2DJ3A

The solution structure of the third thioredoxin domain of mouse protein disulfide-isomerase a4
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
133
structure length
133
Chain Sequence
GSSGSSGPVKVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKMDATANDITNDQYKVEGFPTIYFAPSGDKKNPIKFEGGNRDLEHLSKFIDEHATKRSRTKEELSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Protein disulfide-isomerase A4
publication title The solution structure of the third thioredoxin domain of mouse Protein disulfide-isomerase A4
rcsb
source organism Mus musculus
total genus 18
structure length 133
sequence length 133
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2dj3A01
1VF2A 3DIEA 1ZGNA 1V58A 4MABA 17GSA 3ZRDA 1O8WA 3D0ZA 1M2DA 3LQ7A 5FHIA 1R4WA 3F0IA 2MMOA 1GNEA 3ME7A 1PGTA 3NOFA 3FKFA 2P31A 1RK4A 5GAND 3GKNA 2H8LA 4ZBDA 5HFIA 1JLWA 7GSSA 3Q74A 3GRXA 3ZIJA 2WRTA 3S9FA 3TJBA 2V41A 5AGYA 5LNKe 4OFTA 3TKSC 3KMNA 2H30A 3FHKA 1MD4A 4KUNA 5IMFA 4HS1A 2KHPA 1PL1A 5D9VA 2LUSA 3TUEA 1A24A 4L0UA 4HU9A 10GSA 3HZ4A 4TXOA 4ACSA 2VIMA 3I43A 2LV3A 4FIWA 4IGJA 4O32A 1BYEA 1JLVA 3VLNA 4LA1A 2G2QA 2VM2A 4IJ3A 4MF7A 4TW5A 4E8EA 1Y25A 3LYPA 2CZ3A 3LORA 4HUAA 2LJRA 5ECPB 3GH9A 3R2QA 2J23A 2AYTA 2GQKA 2I81A 4KDUA 3CRUA 2E2GA 1AQXA 4GSTA 3FZAA 3GTUB 3MNGA 3UBKA 3SBCA 3M9JA 1XXUA 3BCKA 1A2JA 3EVIA 4F9ZA 4KSMA 2GQLA 4OFNA 3C71A 4CW9A 2E2MA 2FGXA 1A8LA 2VCZA 1TI1A 1SK1A 2GTUA 2YWOA 5D73A 3ZFBA 1SL2B 2OE0A 1CQHA 2FNOA 1Q4JA 1J08A 5KEJA 5HR1A 5LD0A 1T3BA 2C80A 4L8EA 2LEGA 1A0FA 3LGCA 2LRTA 4IKHA 1F9MA 3LEFA 3UEMA 2B5XA 3ZVJA 2YANA 3RHBA 1NHYA 3PINA 1A2LA 1SK0A 3L4NA 4XTSA 1YF1A 1AIUA 2C0DA 5EY6A 4EL1A 3LYKA 5B8AA 3M0FA 4V2MA 1Q98A 3PH9A 2MYGA 2ZCTA 1WE0A 2VOCA 3TCOA 1T4YA 5J4UA 3KCMA 3TOUA 3P2AA 3VURA 1UN2A 2FWFA 1BG5A 1EEJA 3W8SA 2X8HA 1XWKA 2R2JA 5ID2B 4ISDA 4ZL9A 2HNLA 4GF0A 2GLRA 2FHEA 2M72A 4MMMA 2IJYA 5J5NA 3RPPA 2CVBA 3GKKA 1KTEA 8GSSA 1R5AA 1M9AA 1S3AA 2CX4A 4WBRD 4J2FA 5H5RA 5HR0A 2C0GA 3VI7A 3KGKA 5CRDA 3GN3A 2R6KA 3IR4A 1GULA 2GSTA 1OE8A 2CV4A 1TXXA 2M46A 3P7XA 1GL8A 3M1GA 4TVEA 1WOUA 3WGXA 4DSRA 4YAVA 5JCGA 2YN1A 4KDYA 5B6NA 3HCZA 4TR1A 1WIKA 3C1RA 3GKXA 2PGTA 22GSA 2WDUA 1GSFA 1SENA 5DQSA 5J9BA 2VLTA 4RI7A 1G6YA 2LRCA 2FA4A 1U3IA 1YY7A 2V1MA 2ON5A 2O7KA 3KTBA 2LJAA 1I9DA 4XS4A 3GURA 5HQPA 5DAKA 1LBKA 2PVOC 4BWQA 2OACA 4WBJA 2DMLA 4RI6A 4GXZA 4GQFA 1XOAA 4PNGA 3IC4A 1K3LA 3L78A 1ERUA 1EGOA 1K0OA 2H19A 1G6WA 5L71A 3FR6A 4JBBA 1O81A 4TN8A 5IO0A 1AXDA 1DE2A 5JWRB 4D73A 2O89A 3KZQA 3FK8A 2H1AA 5IMDA 3A3TA 2E0QA 2NBSA 5DBQA 5G5FA 3VPQA 3CTFA 2EIQA 1AQWA 3QAWA 4GWRA 4Q5NA 3ZVJD 1GNWA 1K3OA 2CAIA 3F6DA 3A2XA 2BMXA 1M99A 3CTGA 3WGDA 1B4PA 2B5YA 2KOKA 1ZOFA 1DSBA 3RPNA 1GTAA 4HI7A 3JCML 4N30A 1XWGA 3D4TA 5IQYA 4K0NA 2C4JA 2VAFA 1YF0A 3H79A 4BL7A 5D8IA 4IELA 3EU4A 2DMMA 4KB3A 4XS1A 2K18A 4GQCA 2GSSA 5FWGA 1HNAA 4XS6A 6GSVA 4XRDA 4H86A 4MJCA 4BVXA 1VF4A 3GYKA 3GHAA 2H01A 1R7HA 4PNFA 3LSZA 5A4WA 3DD3A 2RLIA 4K9ZA 4YQVA 5F8BA 1TW9A 4MLYA 4Z7XA 2IFQB 4JU5A 2LJKA 3IDVA 1SK2A 1QFNA 2A2RA 1F37A 18GSA 2HZFA 3FEUA 4CDOA 5ECNB 1XIYA 2DJ0A 1JZDA 2HRFA 2B3SA 3BD2A 3EURA 1KBNA 3NIVA 1JFUA 1PL2A 4K2DA 3M9KA 3UIWA 1QGVA 4L5OA 4OO4A 4IQ1A 1N8JA 1R26A 2JSYA 3E3EA 2AAWA 4ULXA 2V6KA 5IMAA 2VCTA 4G2EA 1V57A 3QFBC 1WP0A 2OBKA 2OKAA 3I69A 5A5KA 1GP1A 1X5EA 4XIHA 4Q5RA 1SL0B 4EDZA 3LFLA 1PKZA 1K0NA 4KE3A 5KN3A 4WF5A 1PN9A 4EUYA 3F9UA 1OC3A 1ERTA 1A2MA 1V9WA 2M80A 2X99A 2VL9A 4NV2A 3HD5A 1B9YC 1UC7A 3W8JA 4V1Ap 4TOPA 1IYIA 3KTLA 2N5BA 4L5LA 2JADA 2TRXA 1XWAA 1X5CA 3HJPA 2XC2A 3HJMA 3H8QA 2REMA 3VWUA 1TRSA 3BCIA 3GL5A 3QMXA 2MBSA 3GX0A 5CRGA 2YV7A 5D96A 5CNWA 5ECLB 5COHA 3VI5A 3HZ8A 1XW6A 3ED3A 4ZL7A 3HYPA 5ELGA 4EKZA 2KUCA 2DSAA 2VCQA 3FZ5A 2XPDA 4TKYA 3C7MA 1XZOA 1T00A 3F3RA 1FHEA 3FW2A 2PPTA 2WS2A 2V32A 5HR2A 12GSA 3C1SA 2HI7A 2IIYA 5H5SA 4POLA 1UA5A 1EEMA 1M0UA 2HT9A 3CSHA 3KJYA 2F51A 2CQ9A 1LJRA 4TRXA 1ABAA 5IMCA 5D9WA 2L5OA 2CAQA 20GSA 5DQYA 3D6IA 1TI3A 5B8BA 3WYWA 1ZMAA 1O6JA 4ML1A 2JU5A 5IO2A 1B4QA 2HLSA 1UVZA 4WETA 3LG6A 2VL2A 2R5GA 3PR8A 2FWHA 2H70A 2GZYA 2KP2A 2K9FA 3G7IA 3MSZA 4MZWA 3LXZA 1DUGA 3TGZA 1ERWA 5ECIB 2GGTA 2FA8A 5EL8A 4PGTA 1OVNA 3GIXA 1SKSB 3Q19A 3L0HA 4DSSA 1T7PB 1ML6A 2FWGA 2B1LA 2PMTA 5ELAA 1DE1A 3AY8A 2VCVA 2RIIA 4F82A 2OE1A 4YH2A 1J0FA 2NPBA 5JCUA 4F03A 4JE1A 1TOFA 1G7EA 3V1WA 2AUVA 2C3NA 5C00A 3GSTA 3EC3A 1PX7A 1XOBA 2H0HA 2NVLA 1FO5A 3DGQA 4MF6A 1BQ7A 1XVQA 4TR1B 1QUWA 3CMIA 2CVKA 4K7OA 4QL7A 9GSSA 2B7JA 3EWLA 3WT1A 1MD3A 5DDLA 1URMA 2C8UA 4YQUA 3EINA 3UBLA 5B7CA 3EYTA 2F9SA 5EPFA 2DBCA 5ABRA 3WGEA 5KN0A 1XBSA 2MBTA 3DKSA 2RM6A 3HVSA 2L57A 1EWXA 1YJ6A 4FYUA 1EOHA 2H71A 3ZL5A 2JSZA 4TR4A 4XCSA 5C04A 3GA4A 3H1NA 1RQMA 4HJMA 3C73A 3GL3A 3DXBA 3D5JA 4PURA 2VM1A 2GDRA 4L0WA 3CBUA 3HDCA 3ISOA 1A0RP 1B9XC 4NPBA 2QGVA 3J7Yk 4JR4A 1O73A 1T8EB 1FAAA 5HFKA 2XPEA 1Z7RA 2GSRA 1HQOA 1E2YA 4G10A 1AC1A 1H75A 1YZXA 2GS3A 4K7IA 2DLXA 3RAZA 4PQHA 2H1DA 1JZOA 4OO5A 3N5OA 4OCFA 1HD2A 5CRWA 2R4VA 1M2BA 4KCAA 2DJ1A 3APQA 3K8NA 4EVMA 1PQNA 2H6YA 2A4VA 2EIRA 4ZXGA 4IN0A 4IS0A 3BOAA 4JR6A 1GLQA 3KM6A 4ZB6A 2H0IA 1GSEA 3F4SA 1X9SB 2HXKA 4EO3A 1OYJA 3H93A 2ES7A 5CYYA 1BEDA 2H74A 1TDIA 4MJEA 1AQVA 3LXTA 2HRNA 3FZ4A 1ILOA 3ZIVA 1M9BA 4J57E 2WB9A 5KN1A 3TRQA 2H72A 2LNSA 4ZB8A 2MMNA 2H6ZA 4K0GA 4MCUA 4ECIA 1DBYA 3F3QA 1GSUA 1YEPA 6GSUA 3F6FA 2PU9C 2LSTA 3DYRA 4I5QA 4K8MA 3OR5A 5F05A 1GTUA 3L9UA 3VPTA 3IBHA 2FY6A 3KH9A 2B5EA 3QAGA 4PQIA 5GSSA 4HZ4A 1XWBA 2YNXA 3ZMLA 1WPIA 19GSA 3IAM2 2K6VA 4P3YB 4J56E 4PQ1A 4O7HA 1U6TA 4KA0A 1GLPA 1FG4A 3ERFA 2AHEA 1PSQA 3VFIA 1ZYEA 2NDOA 3TKSA 2C0EA 4ILFA 4V2LA 1QK8A 3UVHA 4KX4A 1ZCPA 5B6MA 3D4MA 1HNCA 2DJJA 4XHMA 2MMAA 5LCZA 5ECRB 3HJOA 1NHOA 3L9VA 3IRAA 4LLRA 3IV4A 1JZRA 1OC9A 1PMTA 6GSSA 4MPGA 4KCEA 1E6BA 1I5GA 5ID2A 2L6DA 1ZYQB 5JWOB 2XBQA 5ECHB 3ZREA 4HU7A 4IW9A 3TKSE 1W89A 4TR3A 4G19A 5G31A 4ML6A 2VUPA 3EMXA 1YEXA 1V98A 2EC4A 3E9JB 5JCWA 5J3RA 4POKA 2F3MA 3ZYWA 4QL9A 2YPMA 14GSA 3DVWA 4N0ZA 3TRPA 3F63A 3HY2A 3CXGA 3UAPA 5IOXA 4WR5A 4OCEA 2BJXA 3P90A 4GSSA 2AB6A 3VWVA 3VWWA 1PD21 1U88A 2VCXA 2FUG2 2HZEA 4PXOA 1ACVA 4DVCA 5ENUA 4AJ7A 4BA7A 4HEA2 2DJ3A 1QXHA 1Z7PA 2H73A 2H66A 2X8CA 1GUKA 2IMFA 3TJJA 1Z3EA 2P5RA 4IJIA 4KH7A 1OKTA 2YV9A 1OAZA 1FOVA 3KD0A 4IVFA 4ECJA 5J9CA 4WEYA 4IQAA 2H75A 4AGSA 2WFCA 4NHZA 3ZMKA 4N0VA 4PX1A 2GT5A 5CREA 3U6VA 1M7TA 3N9JA 5AIVA 3US3A 4RUVA 3IA1A 3ERGA 2IMDA 2GQMA 3C8EA 4I8BA 4ECCA 3GV1A 4DSSB 2VLUA 3G7YA 3O76A 4FH8A 4HDEA 3VK9A 3DVXA 4POBA 2I3YA 4TXOB 4LL4B 5FT3A 5IMZA 4WF4A 4EF0A 3CYNA 2OADA 1SJIA 3FZ9A 3HVVA 5D9XA 2QSIA 5G1KA 2YOIA 1XW5A 2K8SA 4EC0A 1MDIA 1XCCA 3ZFLA 2A2SA 3IE3A 1Z6MA 1S3CA 3APOA 4ID0A 1Z5YE 1V2AA 4KGIA 1WWJA 4V1Ag 6GSXA 3G9BA 3E0UA 4NAXA 1WMJA 1TRWA 4HZ2A 2C0FA 1FVJA 3ZITA 5ECOB 3Q6OA 3TB2A 3IXRA 1SD9A 2GZZA 3L9SA 2ALBA 3GUSA 1V40A 3APSA 3TJKA 4WKWA 1VF3A 3LJRA 4RQXA 4K6XA 5ECQB 4X43A 5CRHA 3QOUA 1W4VA 1USBA 2YZHA 3U5RE 3TDGA 5F07A 2PUKC 2YWMA 2XBIA 1PRXA 1GTIA 5HFGA 1VF1A 3IOSA 2ZUPA 4MH2A 5EVOA 3WT2A 2EIOA 4IP6A 1J9BA 3IHQA 1BJXA 2IN3A 5DJMA 1IYHA 1G7OA 1ZZYA 4G9HA 4YQMA 2JACA 2HSHA 1TK8B 2HSYA 2IFQA 2G0FA 1SJ6A 3GSSA 4IP1A 2VD0A 3QCPA 4MPFA 3GFKA 4OD7A 2E7PA 3W6GA 2OBIA 4FYBA 3IAS2 16GSA 2H1GA 3QD9A 1WJKA 1THOA 3ZZXA 4RQRA 3BBYA 3TRXA 4NXIA 4DSQA 1XW9A 2AJQB 2IMEA 2KP1A 3KH7A 5E59A 1SL1B 3HVXA 2WCIA 1TU7A 2C1YA 5D9TA 3UMAA 2ON7A 1A23A 1EOGA 4K7NA 5E4WA 4MJBA 2N5AA 2H76A 1U3AA 5CP1A 1LU4A 1T1VA 5DCHA 1XWCA 2P5QA 2PERA 2DJKA 5A4VA 5DALA 3UOMA 1NM3A 2VL3A 4MZCA 3KXOA 3MWHA 2R37A 3G7JA 2FCHA 4HQSA 4I97A 4HJ2A 1YKCA 2O8VB 2O87A 2YWIA 2V6OA 2K8VA 3FY7A 11GSA 4LL1B 1BAYA 1Z6NA 2PN8A 6GSWA 1MEKA 1GSQA 3FR9A 4QQ7A 5G1LA 1FVKA 2Z9SA 2WZ9A 4XS4B 5DAKB 2H0GA 4TR0A 1X9MB 5ECSA 2ZNMA 2F8FA 5ECKB 1SYRA 5J41A 1YDKA 3BJ5A 1FB0A 1BX9A 2H1BA 5A4UA 2YJHA 4PUAA 3D21A 2HYXA 4I2UA 5AISA 4ZL8A 2X64A 2TRCP 4E8HA 3ZLPA 5GZZB 3GNJA 1X5DA 1NW2A 4D73B 1ST9A 1TP9A 1F6MC 2VCWA 2DJ2A 3KP8A 1MTCA 1KEBA 1OKDA 1ZL9A 3A2VA 3KP9A 3KIJA 1ERVA 3DEXA 5KN2A 2IL3A 2LS5A 3O3TA 5D93A 1AW9A 2HE3A 4MDCA 1TRVA 4PUFC 3M3MA 1HNBA 1SU9A 2VD1A 2RM5A 2C3TA 1EGRA 1K0BA 1OC9B 2PWJA 5AN1A 1OE7A 2PBJA 3J7Yb 3GKMA 1EP8A 2GSQA 3UL3A 3TJGA 3D22A 3P8WA 4X1UA 1JHBA 1XPVA 2FWEA 1TK5B 5IIZA 1X0RA 1VRSD 2C3QA 4JEDA 2CZ2A 2IPAA 2JZTA 2OA7A 2AV4A 2WULA 3EMPA 5IM9A 2DIYA 2MZCA 1GWCA 2D2ZA 4KSOA 1TRUA 1EP7A 4ZIJA 3MAKA 3CSIA 3FYGA 5DCGA 3IPZA 4YAPA 2HZEB 3QPMA 1SYXA 5INYA 3DRNA 4MJAA 3HXSA 2LRNA 2YWNA 1JZWA 1Y6EA 4OFMA 3RDWA 3I6AA 3GTUA 3A5WA 1SD8A 2XHFA 4ZILA 3IK9A 1EV9A 1S3DA 1TU8A 2LTKA 3FRCA 1N2AA 1QMVA 2YJ7A 4NHWA 4ECBA 2FD3A 2MMZA 3EE2A 1U87A 1PA3A 3RHCA 2O85A 3F8UA 2BTOT 1YKAA 2WGRA 4ZBBA 1THXA 3A2WA 1GSSA 1VGLA 4I2TA 5JWQB 3O6TA 2I1UA 4XRAA 3UJ1A 4IBPA 3TJFA 2R3XA 2DIZA 2GZPA 1RW1A 3H4KA 1PX6A 4WXTA 4EDYA 2LQQA 2GT6A 3WD6A 2X8GA 2VL2C 2VLVA 2L6CA 4EE0A 1ON4A 2NTOA 3F4RA 4JRRA 2CA8A 4LMVA 4Q5FA 2QKEA 1YQ1A 2LNTA 4NMUA 1MDKA 1K0CA 1CQGA 2B1KA 4JZQA 3F4TA 4F0BA 4AJ6A 5IPGA 2L4CA 4DEJA 1K0DA 1AUCA 4BPYA 4BVYA 3UVTA 4N11A 2P0GA 2HFDA 1WRYA 4ZBAA 2J9HA 3FR3A 2L4QA 4O92A 5G5EA 2QC7A 2H6XA 3QAVA 4WR4A 4NWYA 3CSJA 2IMKA 1GUHA 1TJDA 3Q18A 4BWSA 5HR3A 1K0MA 3DMLA 1SKWB 3KMOA 5AIXA 1O7UA 4GLTA 3MDKA 1C72A 5F06A 1GTBA 4GSNA 3QDNA 3I9V2 4O5RA 3QFAC 6GSYA 2GVPA 2FLSA 4FYCA 4MK3A 2JZRA 4OWYA 2RUFA 1QQ2A 2JL4A 2RUEA 1SJZA 3GH6A 2JZSA 2YP6A 1GUMA 3NZNA 3RBTA 3VWXA 1T4ZA 2V2GA 2YCDA 4POMA 1NSWA 1MDJA 1Z9HA 4HOJA 1FW1A 5CO3A 4MZBA 1HYUA 4Q5QA 1GSYA 5GAPD 4I6XA 4F0CA 4LMWA 4X0XA 4CHSA 3UARA 3TKPA 4V2NA 2WJUA 3TKRA 1KNGA 2OE3A 3ME8A 4MA9A 4NV5A 4KW6A 1GH2A 2L5LA 3QR6A 3ZTLA 3GX8A 3TOTA 1O8XA 2I9HA 2N5FA 4EXJA 4AF2A 6GSTA 4OMVA 3SWLA 5G30A 1GRXA 2TIRA 4GTUA 2CVDA 2B7KA 1M2AA 2PVQA 4IHUA 5H5QA 1F3AA 1K3YA 2LQOA 4K1FA 2B6MA 1TK0B 2CX3A 2OJLA 2LKUA 4GCIA 5GSTA 4N10A 5DALB 5ECMB 13GSA 1FB6A 1X9WB 2I4AA 3DWVA 1EV4A 2IMIA 3EU3A 3ERWA 3IK7A 5DJLA 2F8AA 5IPHA 1B48A 5G2ZA 1OC8A 2CT6A 3HHVA 4TXVA 5IMVA 4KAEA 4KNDA 1AAZA 2IWTA 4HQZA 1F3BA 3HKRA 1XVWA 3GMFA 2YZUA 1GSDA 3LWAA 1F2EA 3M8NA 1H4OA 1B8XA 4ZB9A 3KEBA 1R5PA 2VO4A 5IOWA 3CRTA 5CAXA 1TKDB 1O85A 2DC5A 1XFLA 2L59A 3TKQA 5DVBA 4MF5A 4MP4A 4GRFA 1A8YA 2KLXA 1G0TA 1PKWA 4FO5A 3PGTA 4MH3A 1K0AA 5F0GA 4F2IA 3HA9A 1EZKA 1SKRB 1TTZA 4KDXA 4AJ8A
chains in the Genus database with same CATH superfamily
1VF2A 1ZYPA 3DIEA 1ZGNA 1V58A 1S3RA 4MABA 17GSA 3ZRDA 1O8WA 3D0ZA 1M2DA 3LQ7A 5FHIA 1R4WA 2UZ8A 3F0IA 2MMOA 1GNEA 1XG8A 3ME7A 1PGTA 3NOFA 3FKFA 2P31A 1RK4A 5GAND 3GKNA 2H8LA 4ZBDA 5HFIA 1JLWA 7GSSA 3Q74A 3GRXA 3ZIJA 2WRTA 3S9FA 3TJBA 2V41A 5AGYA 5LNKe 4OFTA 3TKSC 3KMNA 2H30A 3FHKA 1MD4A 4KUNA 5IMFA 4HS1A 2KHPA 1PL1A 5D9VA 2LUSA 3TUEA 1A24A 4L0UA 4HU9A 10GSA 3HZ4A 4TXOA 4ACSA 2VIMA 3I43A 2LV3A 4FIWA 4IGJA 4O32A 1BYEA 1JLVA 3VLNA 4LA1A 2G2QA 2VM2A 4IJ3A 4MF7A 4TW5A 4E8EA 1Y25A 3LYPA 2CZ3A 3LORA 4ICYA 4HUAA 2LJRA 5ECPB 3GH9A 3R2QA 2J23A 2AYTA 2GQKA 2I81A 4KDUA 3CRUA 2E2GA 1AQXA 4GSTA 2DKIA 3FZAA 3GTUB 3MNGA 3UBKA 3SBCA 3M9JA 1XXUA 3BCKA 1A2JA 1ZYNA 3EVIA 4F9ZA 4KSMA 2GQLA 4OFNA 3C71A 4CW9A 2E2MA 2FGXA 1A8LA 2VCZA 1TI1A 1SK1A 2GTUA 2YWOA 5D73A 3ZFBA 1SL2B 2OE0A 1CQHA 2FNOA 1Q4JA 1J08A 5KEJA 2X49A 5HR1A 5LD0A 1T3BA 2C80A 3CQFA 4L8EA 2LEGA 1A0FA 3LGCA 2LRTA 4IKHA 1F9MA 3LEFA 3UEMA 2B5XA 3ZVJA 2YANA 3RHBA 1NHYA 3PINA 1A2LA 1SK0A 3L4NA 4XTSA 1YF1A 1AIUA 2C0DA 5EY6A 4EL1A 3LYKA 5B8AA 3M0FA 4V2MA 1Q98A 3A5IA 3PH9A 2MYGA 2ZCTA 1WE0A 2VOCA 3TCOA 1T4YA 5J4UA 4K5RA 3KCMA 3TOUA 3P2AA 3VURA 1UN2A 2FWFA 1BG5A 2DKHA 1EEJA 3W8SA 2X8HA 1XWKA 2R2JA 5ID2B 4BVYB 4ISDA 4ZL9A 2HNLA 4GF0A 2GLRA 2FHEA 2M72A 4MMMA 2IJYA 5J5NA 3RPPA 2CVBA 3GKKA 1KTEA 8GSSA 1R5AA 1M9AA 1S3AA 2CX4A 4WBRD 4J2FA 5H5RA 5HR0A 2C0GA 3VI7A 3KGKA 5CRDA 3GN3A 2R6KA 3IR4A 1GULA 2GSTA 1OE8A 2CV4A 1TXXA 2M46A 3P7XA 1GL8A 3M1GA 4TVEA 1WOUA 3WGXA 4DSRA 4YAVA 5JCGA 2YN1A 4KDYA 5B6NA 3HCZA 4TR1A 1WIKA 3C1RA 3GKXA 2PGTA 22GSA 2WDUA 1GSFA 1SENA 5DQSA 5J9BA 2VLTA 4RI7A 1G6YA 2LRCA 2FA4A 1U3IA 1YY7A 3R3EA 2V1MA 2ON5A 2O7KA 3KTBA 2LJAA 1I9DA 4XS4A 3GURA 5HQPA 5DAKA 1LBKA 2PVOC 4BWQA 2OACA 4WBJA 2DMLA 4RI6A 4GXZA 4GQFA 1XOAA 4PNGA 3IC4A 1K3LA 3L78A 1ERUA 1EGOA 1K0OA 2H19A 1G6WA 5L71A 3FR6A 4JBBA 1O81A 4TN8A 5IO0A 1AXDA 4K2XA 1DE2A 5JWRB 4D73A 2O89A 3KZQA 3FK8A 2H1AA 5IMDA 3A3TA 2E0QA 2NBSA 5DBQA 5G5FA 3VPQA 3CTFA 2EIQA 1AQWA 3QAWA 4GWRA 4Q5NA 3ZVJD 1GNWA 1K3OA 2CAIA 2QA1A 3F6DA 3A2XA 2BMXA 1M99A 3CTGA 3WGDA 1B4PA 2B5YA 2KOKA 1ZOFA 1DSBA 3RPNA 1GTAA 4HI7A 2R0GA 3MIXA 4EIPA 3JCML 4N30A 1XWGA 3D4TA 5IQYA 4K0NA 2C4JA 2VAFA 1YF0A 3H79A 4BL7A 5D8IA 4IELA 3EU4A 3HVNA 2DMMA 4KB3A 4XS1A 2K18A 4GQCA 2GSSA 5FWGA 1HNAA 1PN0A 4CY6A 4XS6A 6GSVA 4XRDA 4H86A 4MJCA 4BVXA 1VF4A 3GYKA 3GHAA 2H01A 1R7HA 4PNFA 3LSZA 5A4WA 3DD3A 3IHGA 2RLIA 4K9ZA 4YQVA 5F8BA 1TW9A 4MLYA 4Z7XA 2IFQB 4JU5A 2LJKA 3IDVA 1SK2A 1QFNA 2A2RA 1F37A 18GSA 2HZFA 3FEUA 4CDOA 5ECNB 1XIYA 2DJ0A 1JZDA 2HRFA 2B3SA 3BD2A 3EURA 1KBNA 3NIVA 1JFUA 1PL2A 4K2DA 3M9KA 3UIWA 1QGVA 4L5OA 4OO4A 4IQ1A 1N8JA 1R26A 2JSYA 3E3EA 2AAWA 4ULXA 2V6KA 5IMAA 2VCTA 4G2EA 1V57A 3QFBC 1WP0A 2OBKA 2OKAA 3I69A 4A5PA 5A5KA 1GP1A 1X5EA 4XIHA 4Q5RA 1SL0B 4EDZA 3LFLA 1PKZA 1K0NA 4KE3A 5KN3A 4WF5A 1PN9A 4EUYA 3F9UA 1OC3A 1ERTA 1A2MA 1V9WA 2M80A 2X99A 2VL9A 4NV2A 3HD5A 1B9YC 1UC7A 3W8JA 4V1Ap 4TOPA 1IYIA 3KTLA 2N5BA 4L5LA 2JADA 2TRXA 1XWAA 1X5CA 3HJPA 2XC2A 4USSA 3HJMA 3H8QA 2REMA 3VWUA 1TRSA 3BCIA 3GL5A 3QMXA 2MBSA 3GX0A 5CRGA 2YV7A 5D96A 5CNWA 5ECLB 5COHA 3VI5A 3HZ8A 1XW6A 3ED3A 4ZL7A 3HYPA 5ELGA 4EKZA 2KUCA 2DSAA 2VCQA 3FZ5A 2XPDA 4TKYA 3C7MA 1XZOA 1T00A 3F3RA 1FHEA 3FW2A 2PPTA 2WS2A 2V32A 5HR2A 12GSA 3C1SA 2HI7A 2IIYA 5H5SA 4POLA 1UA5A 1EEMA 1M0UA 2HT9A 3CSHA 3KJYA 2F51A 2CQ9A 1LJRA 4TRXA 1ABAA 5IMCA 4G0IA 5D9WA 4YKFA 2L5OA 2CAQA 20GSA 5DQYA 3D6IA 1TI3A 4K5SA 5B8BA 3WYWA 1ZMAA 1O6JA 4Z2UA 4ML1A 2JU5A 5IO2A 1B4QA 2HLSA 1UVZA 4WETA 3LG6A 2VL2A 2R5GA 3PR8A 2FWHA 3MYDA 2H70A 2GZYA 2KP2A 2K9FA 3G7IA 3MSZA 4MZWA 3LXZA 1DUGA 3TGZA 1ERWA 5ECIB 2GGTA 2FA8A 5EL8A 4PGTA 1OVNA 3GIXA 1SKSB 3Q19A 3L0HA 4DSSA 1T7PB 4MNNA 1ML6A 2FWGA 2B1LA 2PMTA 5ELAA 1DE1A 3AY8A 2VCVA 2RIIA 4F82A 4CY8A 2OE1A 4YH2A 1J0FA 2NPBA 2X4AA 5JCUA 4F03A 4JE1A 2R0CA 1TOFA 1G7EA 3V1WA 2AUVA 2C3NA 5C00A 3GSTA 3EC3A 1PX7A 4PTSA 1XOBA 2H0HA 2NVLA 1FO5A 3DGQA 4MF6A 1BQ7A 1XVQA 4TR1B 1QUWA 3CMIA 2CVKA 4K7OA 3LW9A 4QL7A 4O5QA 9GSSA 2B7JA 3EWLA 3WT1A 1MD3A 5DDLA 1URMA 2C8UA 4YQUA 3EINA 3UBLA 5B7CA 3EYTA 2F9SA 5EPFA 2DBCA 5ABRA 3WGEA 5KN0A 1XBSA 2MBTA 3DKSA 2RM6A 3HVSA 2L57A 1EWXA 1YJ6A 4FYUA 1EOHA 2H71A 3ZL5A 2JSZA 4TR4A 4XCSA 5C04A 3GA4A 3H1NA 1RQMA 4HJMA 3C73A 3GL3A 3DXBA 3D5JA 4PURA 2VM1A 2GDRA 4L0WA 3CBUA 3HDCA 3ISOA 1A0RP 1B9XC 4NPBA 2QGVA 3J7Yk 5BMUA 4JR4A 1O73A 4Z2TA 1T8EB 1FAAA 5HFKA 2XPEA 1Z7RA 2GSRA 1HQOA 1E2YA 4G10A 1AC1A 1H75A 1YZXA 2GS3A 4K7IA 2DLXA 3RAZA 4PQHA 2H1DA 1JZOA 4OO5A 3N5OA 4OCFA 1HD2A 5CRWA 2R4VA 1M2BA 4KCAA 2DJ1A 3APQA 3K8NA 4EVMA 1PQNA 2H6YA 2A4VA 2EIRA 1M3IA 4IN0A 4ZXGA 4IS0A 3BOAA 4JR6A 1GLQA 3KM6A 4ZB6A 2H0IA 1GSEA 3F4SA 1X9SB 2HXKA 4EO3A 1OYJA 3H93A 2ES7A 5CYYA 1BEDA 2H74A 1TDIA 4MJEA 1AQVA 3LXTA 2HRNA 3FZ4A 1ILOA 3ZIVA 1M9BA 4J57E 2WB9A 5KN1A 3TRQA 2H72A 2LNSA 4ZB8A 2MMNA 2H6ZA 4K0GA 4MCUA 4ECIA 1DBYA 3F3QA 1GSUA 1YEPA 6GSUA 3F6FA 2PU9C 2LSTA 3DYRA 4I5QA 4K8MA 3OR5A 5F05A 1GTUA 3L9UA 3VPTA 3IBHA 2FY6A 3KH9A 2B5EA 3QAGA 4PQIA 5GSSA 4O5UA 4HZ4A 1XWBA 2YNXA 3ZMLA 1WPIA 19GSA 3IAM2 2K6VA 4P3YB 4J56E 4PQ1A 2HSMA 4O7HA 1U6TA 4KA0A 1GLPA 1FG4A 3ERFA 2AHEA 1PSQA 3VFIA 1ZYEA 3PPUA 2NDOA 3TKSA 2C0EA 4ILFA 4V2LA 1QK8A 3UVHA 4KX4A 1ZCPA 5B6MA 3D4MA 1HNCA 2DJJA 4XHMA 2MMAA 5LCZA 5ECRB 3HJOA 1NHOA 3L9VA 3EPTA 3IRAA 4LLRA 3IV4A 1JZRA 1OC9A 1PMTA 6GSSA 4MPGA 4KCEA 1E6BA 1I5GA 5ID2A 2L6DA 1ZYQB 5JWOB 2XBQA 5ECHB 3ZREA 4HU7A 4IW9A 3TKSE 1W89A 4TR3A 4G19A 5G31A 4ML6A 2VUPA 3EMXA 1YEXA 1V98A 2EC4A 3E9JB 5JCWA 5J3RA 4POKA 2F3MA 3ZYWA 4QL9A 2YPMA 14GSA 3DVWA 4N0ZA 3TRPA 3F63A 3HY2A 3CXGA 3UAPA 5IOXA 4WR5A 4OCEA 2BJXA 3P90A 4GSSA 2AB6A 3VWVA 3VWWA 1PD21 1U88A 2VCXA 2FUG2 2HZEA 4PXOA 1ACVA 4DVCA 5ENUA 4AJ7A 4BA7A 4HEA2 2DJ3A 1QXHA 1Z7PA 2H73A 2H66A 2X8CA 1GUKA 4X4JA 2IMFA 3TJJA 1Z3EA 2P5RA 4IJIA 4KH7A 1OKTA 2YV9A 1OAZA 1FOVA 3KD0A 4IVFA 4ECJA 5J9CA 4WEYA 4IQAA 2H75A 4AGSA 2WFCA 4NHZA 3ZMKA 4N0VA 4PX1A 2GT5A 5CREA 3U6VA 1M7TA 3N9JA 5AIVA 3US3A 4RUVA 3IA1A 3ERGA 2IMDA 2GQMA 3C8EA 4I8BA 4ECCA 3GV1A 4DSSB 2VLUA 3G7YA 3O76A 4FH8A 4HDEA 3VK9A 3DVXA 4POBA 2I3YA 4TXOB 4LL4B 5FT3A 5IMZA 4WF4A 4EF0A 3CYNA 2OADA 1SJIA 3FZ9A 4BIKA 3HVVA 5D9XA 2QSIA 4EIQA 5G1KA 2YOIA 1XW5A 2K8SA 4EC0A 1MDIA 1XCCA 3ZFLA 2A2SA 3IE3A 1Z6MA 1S3CA 3APOA 4ID0A 1Z5YE 1V2AA 4KGIA 1WWJA 4V1Ag 6GSXA 3G9BA 3E0UA 4NAXA 1WMJA 1TRWA 4HZ2A 2C0FA 1FVJA 3ZITA 5ECOB 3Q6OA 3TB2A 3IXRA 1SD9A 2GZZA 3L9SA 2ALBA 3GUSA 1V40A 3APSA 3TJKA 4WKWA 1VF3A 3FMWA 3LJRA 4RQXA 4G0KA 4K6XA 5ECQB 4X43A 5CRHA 3QOUA 1W4VA 1USBA 2YZHA 3U5RE 3TDGA 5F07A 2PUKC 2YWMA 2XBIA 1PRXA 1GTIA 5HFGA 1VF1A 3IOSA 2ZUPA 4MH2A 5EVOA 3WT2A 2EIOA 4IP6A 1J9BA 3IC8A 3IHQA 1BJXA 2IN3A 5DJMA 1IYHA 1G7OA 1ZZYA 4G9HA 4YQMA 2JACA 2HSHA 1TK8B 2HSYA 2IFQA 2G0FA 1SJ6A 3GSSA 2R0PA 2VD0A 4IP1A 3QCPA 4MPFA 3GFKA 4OD7A 2E7PA 3W6GA 2OBIA 4FYBA 3IAS2 16GSA 2H1GA 3QD9A 1WJKA 1THOA 3ZZXA 4RQRA 3BBYA 3TRXA 4NXIA 4DSQA 1XW9A 2AJQB 2IMEA 2KP1A 3KH7A 5E59A 1SL1B 3HVXA 2WCIA 1TU7A 2C1YA 5D9TA 3UMAA 2ON7A 1A23A 1EOGA 4K7NA 5E4WA 4MJBA 2N5AA 2H76A 1U3AA 5CP1A 1LU4A 1T1VA 5DCHA 1XWCA 2P5QA 2PERA 4KF9A 2DJKA 5A4VA 5DALA 3UOMA 1NM3A 2QA2A 2VL3A 4MZCA 5BRTA 3KXOA 3MWHA 2R37A 3G7JA 2FCHA 4HQSA 4I97A 4HJ2A 1YKCA 2O8VB 2O87A 2YWIA 2V6OA 2K8VA 3FY7A 11GSA 4LL1B 1BAYA 4FQUA 1Z6NA 2A2PA 2PN8A 6GSWA 1MEKA 1GSQA 3FR9A 4QQ7A 5G1LA 1FVKA 2Z9SA 4G0LA 2WZ9A 4XS4B 5DAKB 2H0GA 4TR0A 1X9MB 5ECSA 2ZNMA 2F8FA 5ECKB 1SYRA 5J41A 1YDKA 3BJ5A 1FB0A 1BX9A 2H1BA 5A4UA 2YJHA 5KOXA 4PUAA 3D21A 2HYXA 4I2UA 5AISA 4ZL8A 2X64A 2TRCP 4E8HA 3ZLPA 5GZZB 3GNJA 1X5DA 1NW2A 4D73B 1ST9A 1TP9A 1F6MC 2VCWA 2DJ2A 3KP8A 1MTCA 1KEBA 1OKDA 1ZL9A 3A2VA 3KP9A 3KIJA 1ERVA 3DEXA 5KN2A 2IL3A 2LS5A 3O3TA 5D93A 1AW9A 2HE3A 4MDCA 1TRVA 4PUFC 3M3MA 1HNBA 1SU9A 2VD1A 2RM5A 2C3TA 1EGRA 1K0BA 1OC9B 2PWJA 5AN1A 1OE7A 2PBJA 3J7Yb 3GKMA 1EP8A 2GSQA 3UL3A 3TJGA 3D22A 3P8WA 4X1UA 1JHBA 1XPVA 2FWEA 1TK5B 5IIZA 1X0RA 1VRSD 2C3QA 4JEDA 2CZ2A 2IPAA 2JZTA 4BL7B 2OA7A 2AV4A 2WULA 3EMPA 5IM9A 2DIYA 2MZCA 1GWCA 2D2ZA 4KSOA 1TRUA 1EP7A 4ZIJA 3MAKA 3CSIA 3FYGA 5DCGA 3IPZA 4BVXB 4YAPA 2HZEB 3QPMA 1SYXA 5INYA 5KOWA 2HRAA 3DRNA 4MJAA 3HXSA 2LRNA 2YWNA 1JZWA 1Y6EA 4OFMA 3RDWA 3I6AA 3GTUA 3A5WA 1SD8A 2XHFA 4ZILA 3IK9A 1EV9A 1S3DA 1TU8A 2LTKA 3FRCA 1N2AA 1QMVA 2YJ7A 4NHWA 4ECBA 2FD3A 2MMZA 3EE2A 1U87A 1PA3A 3RHCA 2O85A 3F8UA 2BTOT 1YKAA 2WGRA 4ZBBA 1THXA 3A2WA 1GSSA 1VGLA 4I2TA 5JWQB 3O6TA 4YKGA 2I1UA 4XRAA 3UJ1A 4IBPA 3TJFA 2R3XA 2DIZA 2GZPA 1RW1A 3H4KA 1PX6A 4WXTA 4EDYA 2LQQA 2GT6A 3WD6A 2X8GA 2VL2C 2VLVA 2L6CA 4EE0A 1ON4A 2NTOA 3F4RA 4JRRA 2CA8A 4LMVA 4Q5FA 2QKEA 1YQ1A 2LNTA 4NMUA 1MDKA 1K0CA 1CQGA 2B1KA 4JZQA 3F4TA 4F0BA 4AJ6A 4Z2RA 2A4HA 5IPGA 2L4CA 4DEJA 1K0DA 1AUCA 4BPYA 4BVYA 3UVTA 4N11A 2P0GA 2HFDA 1WRYA 4ZBAA 2J9HA 3FR3A 2L4QA 4O92A 5G5EA 2QC7A 2H6XA 3QAVA 4WR4A 4NWYA 3CSJA 2IMKA 1GUHA 1TJDA 3Q18A 4BWSA 5HR3A 1K0MA 3DMLA 1SKWB 3KMOA 5AIXA 1O7UA 4GLTA 3MDKA 1C72A 5F06A 1GTBA 4GSNA 3QDNA 3I9V2 4O5RA 3QFAC 6GSYA 2GVPA 2FLSA 4FYCA 4MK3A 2JZRA 4OWYA 2RUFA 1QQ2A 2JL4A 2RUEA 1SJZA 3GH6A 2JZSA 2YP6A 1GUMA 3NZNA 3RBTA 3VWXA 1T4ZA 2V2GA 2YCDA 4POMA 1NSWA 1MDJA 1Z9HA 4HOJA 1FW1A 5CO3A 4MZBA 1HYUA 4Q5QA 1GSYA 5GAPD 4I6XA 4F0CA 4LMWA 4X0XA 4CHSA 3UARA 3TKPA 4V2NA 2WJUA 3TKRA 1KNGA 2OE3A 3ME8A 4MA9A 4NV5A 4KW6A 1GH2A 2L5LA 3QR6A 3ZTLA 3GX8A 3TOTA 1O8XA 2I9HA 2N5FA 4EXJA 4AF2A 6GSTA 4OMVA 3SWLA 5G30A 1GRXA 2TIRA 4GTUA 2CVDA 2B7KA 1M2AA 2PVQA 4IHUA 5H5QA 1F3AA 1K3YA 2LQOA 4K1FA 2B6MA 1TK0B 2CX3A 2OJLA 2LKUA 4GCIA 5GSTA 4N10A 2HRKA 5DALB 5ECMB 13GSA 1FB6A 1X9WB 2I4AA 1PFOA 3DWVA 1EV4A 2IMIA 3EU3A 3ERWA 3IK7A 5DJLA 2F8AA 5IPHA 1B48A 5G2ZA 1OC8A 2CT6A 3HHVA 4TXVA 5IMVA 4KAEA 4KNDA 1AAZA 2IWTA 1FOHA 4HQZA 1M3JA 1F3BA 3HKRA 1XVWA 3GMFA 2YZUA 1GSDA 3LWAA 1F2EA 3M8NA 1H4OA 1B8XA 4ZB9A 3KEBA 1R5PA 2VO4A 5IOWA 3CRTA 5CAXA 1TKDB 1O85A 2DC5A 1XFLA 2L59A 3TKQA 5DVBA 4MF5A 4MP4A 4GRFA 1A8YA 2KLXA 1G0TA 1PKWA 4FO5A 4HSCX 3PGTA 4MH3A 1K0AA 5F0GA 4F2IA 3HA9A 1EZKA 1SKRB 1TTZA 4KDXA 4AJ8A
chains in the Genus database with same CATH topology
1VF2A 1ZYPA 3DIEA 1ZGNA 1V58A 4MABA 17GSA 3ZRDA 1O8WA 3D0ZA 1M2DA 3LQ7A 5FHIA 1R4WA 2UZ8A 3F0IA 2MMOA 1GNEA 3ME7A 1PGTA 3NOFA 3FKFA 2P31A 1RK4A 5GAND 3GKNA 2H8LA 4ZBDA 5HFIA 1JLWA 7GSSA 3Q74A 3GRXA 3ZIJA 2WRTA 3S9FA 3TJBA 2V41A 5AGYA 5LNKe 4OFTA 3TKSC 3KMNA 2H30A 3FHKA 1MD4A 4KUNA 5IMFA 4HS1A 2KHPA 1PL1A 5D9VA 2LUSA 3TUEA 1A24A 4L0UA 4HU9A 10GSA 3HZ4A 4TXOA 4ACSA 2VIMA 3I43A 2LV3A 4FIWA 4IGJA 4O32A 1BYEA 1JLVA 3VLNA 4LA1A 2G2QA 2VM2A 4IJ3A 4MF7A 4TW5A 4E8EA 1Y25A 3LYPA 2CZ3A 3LORA 4ICYA 4HUAA 2LJRA 5ECPB 3GH9A 3R2QA 2J23A 2AYTA 2GQKA 2I81A 4KDUA 3CRUA 2E2GA 1AQXA 4GSTA 2DKIA 3FZAA 3GTUB 3MNGA 3UBKA 3SBCA 3M9JA 1XXUA 3BCKA 1A2JA 1ZYNA 3EVIA 4F9ZA 4KSMA 2GQLA 4OFNA 3C71A 4CW9A 2E2MA 2FGXA 1A8LA 2VCZA 1TI1A 1SK1A 2GTUA 2YWOA 5D73A 3ZFBA 1SL2B 2OE0A 1CQHA 2FNOA 1Q4JA 1J08A 5KEJA 2X49A 5HR1A 5LD0A 1T3BA 2C80A 4L8EA 2LEGA 1A0FA 3LGCA 2LRTA 4IKHA 1F9MA 3LEFA 3UEMA 2B5XA 3ZVJA 2YANA 3RHBA 1NHYA 3PINA 1A2LA 1SK0A 3L4NA 4XTSA 1YF1A 1AIUA 2C0DA 5EY6A 4EL1A 3LYKA 5B8AA 3M0FA 4V2MA 1Q98A 3A5IA 3PH9A 2MYGA 2ZCTA 1WE0A 2VOCA 3TCOA 1T4YA 5J4UA 4K5RA 3KCMA 3TOUA 3P2AA 3VURA 1UN2A 2FWFA 1BG5A 2DKHA 1EEJA 3W8SA 2X8HA 1XWKA 2R2JA 5ID2B 4BVYB 4ISDA 4ZL9A 2HNLA 4GF0A 2GLRA 2FHEA 2M72A 4MMMA 2IJYA 5J5NA 3RPPA 2CVBA 3GKKA 1KTEA 8GSSA 1R5AA 1M9AA 1S3AA 2CX4A 4WBRD 4J2FA 5H5RA 5HR0A 2C0GA 3VI7A 3KGKA 5CRDA 3GN3A 2R6KA 3IR4A 1GULA 2GSTA 1OE8A 2CV4A 1TXXA 2M46A 3P7XA 1GL8A 3M1GA 4TVEA 1WOUA 3WGXA 4DSRA 4YAVA 5JCGA 2YN1A 4KDYA 5B6NA 3HCZA 4TR1A 1WIKA 3C1RA 3GKXA 2PGTA 22GSA 2WDUA 1GSFA 1SENA 5DQSA 5J9BA 2VLTA 4RI7A 1G6YA 2LRCA 2FA4A 1U3IA 1YY7A 3R3EA 2V1MA 2ON5A 2O7KA 3KTBA 2LJAA 1I9DA 4XS4A 3GURA 5HQPA 5DAKA 1LBKA 2PVOC 4BWQA 2OACA 4WBJA 2DMLA 4RI6A 4GXZA 4GQFA 1XOAA 4PNGA 3IC4A 1K3LA 3L78A 1ERUA 1EGOA 1K0OA 2H19A 1G6WA 5L71A 3FR6A 4JBBA 1O81A 4TN8A 5IO0A 1AXDA 4K2XA 1DE2A 5JWRB 4D73A 2O89A 3KZQA 3FK8A 2H1AA 5IMDA 3A3TA 2E0QA 2NBSA 5DBQA 5G5FA 3VPQA 3CTFA 2EIQA 1AQWA 3QAWA 4GWRA 4Q5NA 3ZVJD 1GNWA 1K3OA 2CAIA 2QA1A 3F6DA 3A2XA 2BMXA 1M99A 3CTGA 3WGDA 1B4PA 2B5YA 2KOKA 1ZOFA 1DSBA 3RPNA 1GTAA 4HI7A 2R0GA 3MIXA 4EIPA 3JCML 4N30A 1XWGA 3D4TA 5IQYA 4K0NA 2C4JA 2VAFA 1YF0A 3H79A 4BL7A 5D8IA 4IELA 3EU4A 2DMMA 4KB3A 4XS1A 2K18A 4GQCA 2GSSA 5FWGA 1HNAA 1PN0A 4CY6A 4XS6A 6GSVA 4XRDA 4H86A 4MJCA 4BVXA 1VF4A 3GYKA 3GHAA 2H01A 1R7HA 4PNFA 3LSZA 5A4WA 3DD3A 3IHGA 2RLIA 4K9ZA 4YQVA 5F8BA 1TW9A 4MLYA 4Z7XA 2IFQB 4JU5A 2LJKA 3IDVA 1SK2A 1QFNA 2A2RA 1F37A 18GSA 2HZFA 3FEUA 4CDOA 5ECNB 1XIYA 2DJ0A 1JZDA 2HRFA 2B3SA 3BD2A 3EURA 1KBNA 3NIVA 1JFUA 1PL2A 4K2DA 3M9KA 3UIWA 1QGVA 4L5OA 4OO4A 4IQ1A 1N8JA 1R26A 2JSYA 3E3EA 2AAWA 4ULXA 2V6KA 5IMAA 2VCTA 4G2EA 1V57A 3QFBC 1WP0A 2OBKA 2OKAA 3I69A 4A5PA 5A5KA 1GP1A 1X5EA 4XIHA 4Q5RA 1SL0B 4EDZA 3LFLA 1PKZA 1K0NA 4KE3A 5KN3A 4WF5A 1PN9A 4EUYA 3F9UA 1OC3A 1ERTA 1A2MA 1V9WA 2M80A 2X99A 2VL9A 4NV2A 3HD5A 1B9YC 1UC7A 3W8JA 4V1Ap 4TOPA 1IYIA 3KTLA 2N5BA 4L5LA 2JADA 2TRXA 1XWAA 1X5CA 3HJPA 2XC2A 4USSA 3HJMA 3H8QA 2REMA 3VWUA 1TRSA 3BCIA 3GL5A 3QMXA 2MBSA 3GX0A 5CRGA 2YV7A 5D96A 5CNWA 5ECLB 5COHA 3VI5A 3HZ8A 1XW6A 3ED3A 4ZL7A 3HYPA 5ELGA 4EKZA 2KUCA 2DSAA 2VCQA 3FZ5A 2XPDA 4TKYA 3C7MA 1XZOA 1T00A 3F3RA 1FHEA 3FW2A 2PPTA 2WS2A 2V32A 5HR2A 12GSA 3C1SA 2HI7A 2IIYA 5H5SA 4POLA 1UA5A 1EEMA 1M0UA 2HT9A 3CSHA 3KJYA 2F51A 2CQ9A 1LJRA 4TRXA 1ABAA 5IMCA 4G0IA 5D9WA 4YKFA 2L5OA 2CAQA 20GSA 5DQYA 3D6IA 1TI3A 4K5SA 5B8BA 3WYWA 1ZMAA 1O6JA 4Z2UA 4ML1A 2JU5A 5IO2A 1B4QA 2HLSA 1UVZA 4WETA 3LG6A 2VL2A 2R5GA 3PR8A 2FWHA 3MYDA 2H70A 2GZYA 2KP2A 2K9FA 3G7IA 3MSZA 4MZWA 3LXZA 1DUGA 3TGZA 1ERWA 5ECIB 2GGTA 2FA8A 5EL8A 4PGTA 1OVNA 3GIXA 1SKSB 3Q19A 3L0HA 4DSSA 1T7PB 4MNNA 1ML6A 2FWGA 2B1LA 2PMTA 5ELAA 1DE1A 3AY8A 2VCVA 2RIIA 4F82A 4CY8A 2OE1A 4YH2A 1J0FA 2NPBA 2X4AA 5JCUA 4F03A 4JE1A 2R0CA 1TOFA 1G7EA 3V1WA 2AUVA 2C3NA 5C00A 3GSTA 3EC3A 1PX7A 4PTSA 1XOBA 2H0HA 2NVLA 1FO5A 3DGQA 4MF6A 1BQ7A 1XVQA 4TR1B 1QUWA 3CMIA 2CVKA 4K7OA 3LW9A 4QL7A 4O5QA 9GSSA 2B7JA 3EWLA 3WT1A 1MD3A 5DDLA 1URMA 2C8UA 4YQUA 3EINA 3UBLA 5B7CA 3EYTA 2F9SA 5EPFA 2DBCA 5ABRA 3WGEA 5KN0A 1XBSA 2MBTA 3DKSA 2RM6A 3HVSA 2L57A 1EWXA 1YJ6A 4FYUA 1EOHA 2H71A 3ZL5A 2JSZA 4TR4A 4XCSA 5C04A 3GA4A 3H1NA 1RQMA 4HJMA 3C73A 3GL3A 3DXBA 3D5JA 4PURA 2VM1A 2GDRA 4L0WA 3CBUA 3HDCA 3ISOA 1A0RP 1B9XC 4NPBA 2QGVA 3J7Yk 5BMUA 4JR4A 1O73A 4Z2TA 1T8EB 1FAAA 5HFKA 2XPEA 1Z7RA 2GSRA 1HQOA 1E2YA 4G10A 1AC1A 1H75A 1YZXA 2GS3A 4K7IA 2DLXA 3RAZA 4PQHA 2H1DA 1JZOA 4OO5A 3N5OA 4OCFA 1HD2A 5CRWA 2R4VA 1M2BA 4KCAA 2DJ1A 3APQA 3K8NA 4EVMA 1PQNA 2H6YA 2A4VA 2EIRA 4ZXGA 4IN0A 4IS0A 3BOAA 4JR6A 1GLQA 3KM6A 4ZB6A 2H0IA 1GSEA 3F4SA 1X9SB 2HXKA 4EO3A 1OYJA 3H93A 2ES7A 5CYYA 1BEDA 2H74A 1TDIA 4MJEA 1AQVA 3LXTA 2HRNA 3FZ4A 1ILOA 3ZIVA 1M9BA 4J57E 2WB9A 5KN1A 3TRQA 2H72A 2LNSA 4ZB8A 2MMNA 2H6ZA 4K0GA 4MCUA 4ECIA 1DBYA 3F3QA 1GSUA 1YEPA 6GSUA 3F6FA 2PU9C 2LSTA 3DYRA 4I5QA 4K8MA 3OR5A 5F05A 1GTUA 3L9UA 3VPTA 3IBHA 2FY6A 3KH9A 2B5EA 3QAGA 4PQIA 5GSSA 4O5UA 4HZ4A 1XWBA 2YNXA 3ZMLA 1WPIA 19GSA 3IAM2 2K6VA 4P3YB 4J56E 4PQ1A 2HSMA 4O7HA 1U6TA 4KA0A 1GLPA 1FG4A 3ERFA 2AHEA 1PSQA 3VFIA 1ZYEA 3PPUA 2NDOA 3TKSA 2C0EA 4ILFA 4V2LA 1QK8A 3UVHA 4KX4A 1ZCPA 5B6MA 3D4MA 1HNCA 2DJJA 4XHMA 2MMAA 5LCZA 5ECRB 3HJOA 1NHOA 3L9VA 3EPTA 3IRAA 4LLRA 3IV4A 1JZRA 1OC9A 1PMTA 6GSSA 4MPGA 4KCEA 1E6BA 1I5GA 5ID2A 2L6DA 1ZYQB 5JWOB 2XBQA 5ECHB 3ZREA 4HU7A 4IW9A 3TKSE 1W89A 4TR3A 4G19A 5G31A 4ML6A 2VUPA 3EMXA 1YEXA 1V98A 2EC4A 3E9JB 5JCWA 5J3RA 4POKA 2F3MA 3ZYWA 4QL9A 2YPMA 14GSA 3DVWA 4N0ZA 3TRPA 3F63A 3HY2A 3CXGA 3UAPA 5IOXA 4WR5A 4OCEA 2BJXA 3P90A 4GSSA 2AB6A 3VWVA 3VWWA 1PD21 1U88A 2VCXA 2FUG2 2HZEA 4PXOA 1ACVA 4DVCA 5ENUA 4AJ7A 4BA7A 4HEA2 2DJ3A 1QXHA 1Z7PA 2H73A 2H66A 2X8CA 1GUKA 4X4JA 2IMFA 3TJJA 1Z3EA 2P5RA 4IJIA 4KH7A 1OKTA 2YV9A 1OAZA 1FOVA 3KD0A 4IVFA 4ECJA 5J9CA 4WEYA 4IQAA 2H75A 4AGSA 2WFCA 4NHZA 3ZMKA 4N0VA 4PX1A 2GT5A 5CREA 3U6VA 1M7TA 3N9JA 5AIVA 3US3A 4RUVA 3IA1A 3ERGA 2IMDA 2GQMA 3C8EA 4I8BA 4ECCA 3GV1A 4DSSB 2VLUA 3G7YA 3O76A 4FH8A 4HDEA 3VK9A 3DVXA 4POBA 2I3YA 4TXOB 4LL4B 5FT3A 5IMZA 4WF4A 4EF0A 3CYNA 2OADA 1SJIA 3FZ9A 3HVVA 5D9XA 2QSIA 4EIQA 5G1KA 2YOIA 1XW5A 2K8SA 4EC0A 1MDIA 1XCCA 3ZFLA 2A2SA 3IE3A 1Z6MA 1S3CA 3APOA 4ID0A 1Z5YE 1V2AA 4KGIA 1WWJA 4V1Ag 6GSXA 3G9BA 3E0UA 4NAXA 1WMJA 1TRWA 4HZ2A 2C0FA 1FVJA 3ZITA 5ECOB 3Q6OA 3TB2A 3IXRA 1SD9A 2GZZA 3L9SA 2ALBA 3GUSA 1V40A 3APSA 3TJKA 4WKWA 1VF3A 3FMWA 3LJRA 4RQXA 4G0KA 4K6XA 5ECQB 4X43A 5CRHA 3QOUA 1W4VA 1USBA 2YZHA 3U5RE 3TDGA 5F07A 2PUKC 2YWMA 2XBIA 1PRXA 1GTIA 5HFGA 1VF1A 3IOSA 2ZUPA 4MH2A 5EVOA 3WT2A 2EIOA 4IP6A 1J9BA 3IC8A 3IHQA 1BJXA 2IN3A 5DJMA 1IYHA 1G7OA 1ZZYA 4G9HA 4YQMA 2JACA 2HSHA 1TK8B 2HSYA 2IFQA 2G0FA 1SJ6A 3GSSA 2R0PA 2VD0A 4IP1A 3QCPA 4MPFA 3GFKA 4OD7A 2E7PA 3W6GA 2OBIA 4FYBA 3IAS2 16GSA 2H1GA 3QD9A 1WJKA 1THOA 3ZZXA 4RQRA 3BBYA 3TRXA 4NXIA 4DSQA 1XW9A 2AJQB 2IMEA 2KP1A 3KH7A 5E59A 1SL1B 3HVXA 2WCIA 1TU7A 2C1YA 5D9TA 3UMAA 2ON7A 1A23A 1EOGA 4K7NA 5E4WA 4MJBA 2N5AA 2H76A 1U3AA 5CP1A 1LU4A 1T1VA 5DCHA 1XWCA 2P5QA 2PERA 4KF9A 2DJKA 5A4VA 5DALA 3UOMA 1NM3A 2QA2A 2VL3A 4MZCA 5BRTA 3KXOA 3MWHA 2R37A 3G7JA 2FCHA 4HQSA 4I97A 4HJ2A 1YKCA 2O8VB 2O87A 2YWIA 2V6OA 2K8VA 3FY7A 11GSA 4LL1B 1BAYA 4FQUA 1Z6NA 2A2PA 2PN8A 6GSWA 1MEKA 1GSQA 3FR9A 4QQ7A 5G1LA 1FVKA 2Z9SA 4G0LA 2WZ9A 4XS4B 5DAKB 2H0GA 4TR0A 1X9MB 5ECSA 2ZNMA 2F8FA 5ECKB 1SYRA 5J41A 1YDKA 3BJ5A 1FB0A 1BX9A 2H1BA 5A4UA 2YJHA 5KOXA 4PUAA 3D21A 2HYXA 4I2UA 5AISA 4ZL8A 2X64A 2TRCP 4E8HA 3ZLPA 5GZZB 3GNJA 1X5DA 1NW2A 4D73B 1ST9A 1TP9A 1F6MC 2VCWA 2DJ2A 3KP8A 1MTCA 1KEBA 1OKDA 1ZL9A 3A2VA 3KP9A 3KIJA 1ERVA 3DEXA 5KN2A 2IL3A 2LS5A 3O3TA 5D93A 1AW9A 2HE3A 4MDCA 1TRVA 4PUFC 3M3MA 1HNBA 1SU9A 2VD1A 2RM5A 2C3TA 1EGRA 1K0BA 1OC9B 2PWJA 5AN1A 1OE7A 2PBJA 3J7Yb 3GKMA 1EP8A 2GSQA 3UL3A 3TJGA 3D22A 3P8WA 4X1UA 1JHBA 1XPVA 2FWEA 1TK5B 5IIZA 1X0RA 1VRSD 2C3QA 4JEDA 2CZ2A 2IPAA 2JZTA 4BL7B 2OA7A 2AV4A 2WULA 3EMPA 5IM9A 2DIYA 2MZCA 1GWCA 2D2ZA 4KSOA 1TRUA 1EP7A 4ZIJA 3MAKA 3CSIA 3FYGA 5DCGA 3IPZA 4BVXB 4YAPA 2HZEB 3QPMA 1SYXA 5INYA 5KOWA 2HRAA 3DRNA 4MJAA 3HXSA 2LRNA 2YWNA 1JZWA 1Y6EA 4OFMA 3RDWA 3I6AA 3GTUA 3A5WA 1SD8A 2XHFA 4ZILA 3IK9A 1EV9A 1S3DA 1TU8A 2LTKA 3FRCA 1N2AA 1QMVA 2YJ7A 4NHWA 4ECBA 2FD3A 2MMZA 3EE2A 1U87A 1PA3A 3RHCA 2O85A 3F8UA 2BTOT 1YKAA 2WGRA 4ZBBA 1THXA 3A2WA 1GSSA 1VGLA 4I2TA 5JWQB 3O6TA 4YKGA 2I1UA 4XRAA 3UJ1A 4IBPA 3TJFA 2R3XA 2DIZA 2GZPA 1RW1A 3H4KA 1PX6A 4WXTA 4EDYA 2LQQA 2GT6A 3WD6A 2X8GA 2VL2C 2VLVA 2L6CA 4EE0A 1ON4A 2NTOA 3F4RA 4JRRA 2CA8A 4LMVA 4Q5FA 2QKEA 1YQ1A 2LNTA 4NMUA 1MDKA 1K0CA 1CQGA 2B1KA 4JZQA 3F4TA 4F0BA 4AJ6A 4Z2RA 2A4HA 5IPGA 2L4CA 4DEJA 1K0DA 1AUCA 4BPYA 4BVYA 3UVTA 4N11A 2P0GA 2HFDA 1WRYA 4ZBAA 2J9HA 3FR3A 2L4QA 4O92A 5G5EA 2QC7A 2H6XA 3QAVA 4WR4A 4NWYA 3CSJA 2IMKA 1GUHA 1TJDA 3Q18A 4BWSA 5HR3A 1K0MA 3DMLA 1SKWB 3KMOA 5AIXA 1O7UA 4GLTA 3MDKA 1C72A 5F06A 1GTBA 4GSNA 3QDNA 3I9V2 4O5RA 3QFAC 6GSYA 2GVPA 2FLSA 4FYCA 4MK3A 2JZRA 4OWYA 2RUFA 1QQ2A 2JL4A 2RUEA 1SJZA 3GH6A 2JZSA 2YP6A 1GUMA 3NZNA 3RBTA 3VWXA 1T4ZA 2V2GA 2YCDA 4POMA 1NSWA 1MDJA 1Z9HA 4HOJA 1FW1A 5CO3A 4MZBA 1HYUA 4Q5QA 1GSYA 5GAPD 4I6XA 4F0CA 4LMWA 4X0XA 4CHSA 3UARA 3TKPA 4V2NA 2WJUA 3TKRA 1KNGA 2OE3A 3ME8A 4MA9A 4NV5A 4KW6A 1GH2A 2L5LA 3QR6A 3ZTLA 3GX8A 3TOTA 1O8XA 2I9HA 2N5FA 4EXJA 4AF2A 6GSTA 4OMVA 3SWLA 5G30A 1GRXA 2TIRA 4GTUA 2CVDA 2B7KA 1M2AA 2PVQA 4IHUA 5H5QA 1F3AA 1K3YA 2LQOA 4K1FA 2B6MA 1TK0B 2CX3A 2OJLA 2LKUA 4GCIA 5GSTA 4N10A 2HRKA 5DALB 5ECMB 13GSA 1FB6A 1X9WB 2I4AA 3DWVA 1EV4A 2IMIA 3EU3A 3ERWA 3IK7A 5DJLA 2F8AA 5IPHA 1B48A 5G2ZA 1OC8A 2CT6A 3HHVA 4TXVA 5IMVA 4KAEA 4KNDA 1AAZA 2IWTA 1FOHA 4HQZA 1F3BA 3HKRA 1XVWA 3GMFA 2YZUA 1GSDA 3LWAA 1F2EA 3M8NA 1H4OA 1B8XA 4ZB9A 3KEBA 1R5PA 2VO4A 5IOWA 3CRTA 5CAXA 1TKDB 1O85A 2DC5A 1XFLA 2L59A 3TKQA 5DVBA 4MF5A 4MP4A 4GRFA 1A8YA 2KLXA 1G0TA 1PKWA 4FO5A 3PGTA 4MH3A 1K0AA 5F0GA 4F2IA 3HA9A 1EZKA 1SKRB 1TTZA 4KDXA 4AJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF2 A;  3DIE A;  1ZGN A;  1V58 A;  4MAB A;  17GS A;  3ZRD A;  1O8W A;  3D0Z A;  1M2D A;  3LQ7 A;  5FHI A;  1R4W A;  3F0I A;  2MMO A;  1GNE A;  3ME7 A;  1PGT A;  3NOF A;  3FKF A;  2P31 A;  1RK4 A;  5GAN D;  3GKN A;  2H8L A;  4ZBD A;  5HFI A;  1JLW A;  7GSS A;  3Q74 A;  3GRX A;  3ZIJ A;  2WRT A;  3S9F A;  3TJB A;  2V41 A;  5AGY A;  5LNK e;  4OFT A;  3TKS C;  3KMN A;  2H30 A;  3FHK A;  1MD4 A;  4KUN A;  5IMF A;  4HS1 A;  2KHP A;  1PL1 A;  5D9V A;  2LUS A;  3TUE A;  1A24 A;  4L0U A;  4HU9 A;  10GS A;  3HZ4 A;  4TXO A;  4ACS A;  2VIM A;  3I43 A;  2LV3 A;  4FIW A;  4IGJ A;  4O32 A;  1BYE A;  1JLV A;  3VLN A;  4LA1 A;  2G2Q A;  2VM2 A;  4IJ3 A;  4MF7 A;  4TW5 A;  4E8E A;  1Y25 A;  3LYP A;  2CZ3 A;  3LOR A;  4HUA A;  2LJR A;  5ECP B;  3GH9 A;  3R2Q A;  2J23 A;  2AYT A;  2GQK A;  2I81 A;  4KDU A;  3CRU A;  2E2G A;  1AQX A;  4GST A;  3FZA A;  3GTU B;  3MNG A;  3UBK A;  3SBC A;  3M9J A;  1XXU A;  3BCK A;  1A2J A;  3EVI A;  4F9Z A;  4KSM A;  2GQL A;  4OFN A;  3C71 A;  4CW9 A;  2E2M A;  2FGX A;  1A8L A;  2VCZ A;  1TI1 A;  1SK1 A;  2GTU A;  2YWO A;  5D73 A;  3ZFB A;  1SL2 B;  2OE0 A;  1CQH A;  2FNO A;  1Q4J A;  1J08 A;  5KEJ A;  5HR1 A;  5LD0 A;  1T3B A;  2C80 A;  4L8E A;  2LEG A;  1A0F A;  3LGC A;  2LRT A;  4IKH A;  1F9M A;  3LEF A;  3UEM A;  2B5X A;  3ZVJ A;  2YAN A;  3RHB A;  1NHY A;  3PIN A;  1A2L A;  1SK0 A;  3L4N A;  4XTS A;  1YF1 A;  1AIU A;  2C0D A;  5EY6 A;  4EL1 A;  3LYK A;  5B8A A;  3M0F A;  4V2M A;  1Q98 A;  3PH9 A;  2MYG A;  2ZCT A;  1WE0 A;  2VOC A;  3TCO A;  1T4Y A;  5J4U A;  3KCM A;  3TOU A;  3P2A A;  3VUR A;  1UN2 A;  2FWF A;  1BG5 A;  1EEJ A;  3W8S A;  2X8H A;  1XWK A;  2R2J A;  5ID2 B;  4ISD A;  4ZL9 A;  2HNL A;  4GF0 A;  2GLR A;  2FHE A;  2M72 A;  4MMM A;  2IJY A;  5J5N A;  3RPP A;  2CVB A;  3GKK A;  1KTE A;  8GSS A;  1R5A A;  1M9A A;  1S3A A;  2CX4 A;  4WBR D;  4J2F A;  5H5R A;  5HR0 A;  2C0G A;  3VI7 A;  3KGK A;  5CRD A;  3GN3 A;  2R6K A;  3IR4 A;  1GUL A;  2GST A;  1OE8 A;  2CV4 A;  1TXX A;  2M46 A;  3P7X A;  1GL8 A;  3M1G A;  4TVE A;  1WOU A;  3WGX A;  4DSR A;  4YAV A;  5JCG A;  2YN1 A;  4KDY A;  5B6N A;  3HCZ A;  4TR1 A;  1WIK A;  3C1R A;  3GKX A;  2PGT A;  22GS A;  2WDU A;  1GSF A;  1SEN A;  5DQS A;  5J9B A;  2VLT A;  4RI7 A;  1G6Y A;  2LRC A;  2FA4 A;  1U3I A;  1YY7 A;  2V1M A;  2ON5 A;  2O7K A;  3KTB A;  2LJA A;  1I9D A;  4XS4 A;  3GUR A;  5HQP A;  5DAK A;  1LBK A;  2PVO C;  4BWQ A;  2OAC A;  4WBJ A;  2DML A;  4RI6 A;  4GXZ A;  4GQF A;  1XOA A;  4PNG A;  3IC4 A;  1K3L A;  3L78 A;  1ERU A;  1EGO A;  1K0O A;  2H19 A;  1G6W A;  5L71 A;  3FR6 A;  4JBB A;  1O81 A;  4TN8 A;  5IO0 A;  1AXD A;  1DE2 A;  5JWR B;  4D73 A;  2O89 A;  3KZQ A;  3FK8 A;  2H1A A;  5IMD A;  3A3T A;  2E0Q A;  2NBS A;  5DBQ A;  5G5F A;  3VPQ A;  3CTF A;  2EIQ A;  1AQW A;  3QAW A;  4GWR A;  4Q5N A;  3ZVJ D;  1GNW A;  1K3O A;  2CAI A;  3F6D A;  3A2X A;  2BMX A;  1M99 A;  3CTG A;  3WGD A;  1B4P A;  2B5Y A;  2KOK A;  1ZOF A;  1DSB A;  3RPN A;  1GTA A;  4HI7 A;  3JCM L;  4N30 A;  1XWG A;  3D4T A;  5IQY A;  4K0N A;  2C4J A;  2VAF A;  1YF0 A;  3H79 A;  4BL7 A;  5D8I A;  4IEL A;  3EU4 A;  2DMM A;  4KB3 A;  4XS1 A;  2K18 A;  4GQC A;  2GSS A;  5FWG A;  1HNA A;  4XS6 A;  6GSV A;  4XRD A;  4H86 A;  4MJC A;  4BVX A;  1VF4 A;  3GYK A;  3GHA A;  2H01 A;  1R7H A;  4PNF A;  3LSZ A;  5A4W A;  3DD3 A;  2RLI A;  4K9Z A;  4YQV A;  5F8B A;  1TW9 A;  4MLY A;  4Z7X A;  2IFQ B;  4JU5 A;  2LJK A;  3IDV A;  1SK2 A;  1QFN A;  2A2R A;  1F37 A;  18GS A;  2HZF A;  3FEU A;  4CDO A;  5ECN B;  1XIY A;  2DJ0 A;  1JZD A;  2HRF A;  2B3S A;  3BD2 A;  3EUR A;  1KBN A;  3NIV A;  1JFU A;  1PL2 A;  4K2D A;  3M9K A;  3UIW A;  1QGV A;  4L5O A;  4OO4 A;  4IQ1 A;  1N8J A;  1R26 A;  2JSY A;  3E3E A;  2AAW A;  4ULX A;  2V6K A;  5IMA A;  2VCT A;  4G2E A;  1V57 A;  3QFB C;  1WP0 A;  2OBK A;  2OKA A;  3I69 A;  5A5K A;  1GP1 A;  1X5E A;  4XIH A;  4Q5R A;  1SL0 B;  4EDZ A;  3LFL A;  1PKZ A;  1K0N A;  4KE3 A;  5KN3 A;  4WF5 A;  1PN9 A;  4EUY A;  3F9U A;  1OC3 A;  1ERT A;  1A2M A;  1V9W A;  2M80 A;  2X99 A;  2VL9 A;  4NV2 A;  3HD5 A;  1B9Y C;  1UC7 A;  3W8J A;  4V1A p;  4TOP A;  1IYI A;  3KTL A;  2N5B A;  4L5L A;  2JAD A;  2TRX A;  1XWA A;  1X5C A;  3HJP A;  2XC2 A;  3HJM A;  3H8Q A;  2REM A;  3VWU A;  1TRS A;  3BCI A;  3GL5 A;  3QMX A;  2MBS A;  3GX0 A;  5CRG A;  2YV7 A;  5D96 A;  5CNW A;  5ECL B;  5COH A;  3VI5 A;  3HZ8 A;  1XW6 A;  3ED3 A;  4ZL7 A;  3HYP A;  5ELG A;  4EKZ A;  2KUC A;  2DSA A;  2VCQ A;  3FZ5 A;  2XPD A;  4TKY A;  3C7M A;  1XZO A;  1T00 A;  3F3R A;  1FHE A;  3FW2 A;  2PPT A;  2WS2 A;  2V32 A;  5HR2 A;  12GS A;  3C1S A;  2HI7 A;  2IIY A;  5H5S A;  4POL A;  1UA5 A;  1EEM A;  1M0U A;  2HT9 A;  3CSH A;  3KJY A;  2F51 A;  2CQ9 A;  1LJR A;  4TRX A;  1ABA A;  5IMC A;  5D9W A;  2L5O A;  2CAQ A;  20GS A;  5DQY A;  3D6I A;  1TI3 A;  5B8B A;  3WYW A;  1ZMA A;  1O6J A;  4ML1 A;  2JU5 A;  5IO2 A;  1B4Q A;  2HLS A;  1UVZ A;  4WET A;  3LG6 A;  2VL2 A;  2R5G A;  3PR8 A;  2FWH A;  2H70 A;  2GZY A;  2KP2 A;  2K9F A;  3G7I A;  3MSZ A;  4MZW A;  3LXZ A;  1DUG A;  3TGZ A;  1ERW A;  5ECI B;  2GGT A;  2FA8 A;  5EL8 A;  4PGT A;  1OVN A;  3GIX A;  1SKS B;  3Q19 A;  3L0H A;  4DSS A;  1T7P B;  1ML6 A;  2FWG A;  2B1L A;  2PMT A;  5ELA A;  1DE1 A;  3AY8 A;  2VCV A;  2RII A;  4F82 A;  2OE1 A;  4YH2 A;  1J0F A;  2NPB A;  5JCU A;  4F03 A;  4JE1 A;  1TOF A;  1G7E A;  3V1W A;  2AUV A;  2C3N A;  5C00 A;  3GST A;  3EC3 A;  1PX7 A;  1XOB A;  2H0H A;  2NVL A;  1FO5 A;  3DGQ A;  4MF6 A;  1BQ7 A;  1XVQ A;  4TR1 B;  1QUW A;  3CMI A;  2CVK A;  4K7O A;  4QL7 A;  9GSS A;  2B7J A;  3EWL A;  3WT1 A;  1MD3 A;  5DDL A;  1URM A;  2C8U A;  4YQU A;  3EIN A;  3UBL A;  5B7C A;  3EYT A;  2F9S A;  5EPF A;  2DBC A;  5ABR A;  3WGE A;  5KN0 A;  1XBS A;  2MBT A;  3DKS A;  2RM6 A;  3HVS A;  2L57 A;  1EWX A;  1YJ6 A;  4FYU A;  1EOH A;  2H71 A;  3ZL5 A;  2JSZ A;  4TR4 A;  4XCS A;  5C04 A;  3GA4 A;  3H1N A;  1RQM A;  4HJM A;  3C73 A;  3GL3 A;  3DXB A;  3D5J A;  4PUR A;  2VM1 A;  2GDR A;  4L0W A;  3CBU A;  3HDC A;  3ISO A;  1A0R P;  1B9X C;  4NPB A;  2QGV A;  3J7Y k;  4JR4 A;  1O73 A;  1T8E B;  1FAA A;  5HFK A;  2XPE A;  1Z7R A;  2GSR A;  1HQO A;  1E2Y A;  4G10 A;  1AC1 A;  1H75 A;  1YZX A;  2GS3 A;  4K7I A;  2DLX A;  3RAZ A;  4PQH A;  2H1D A;  1JZO A;  4OO5 A;  3N5O A;  4OCF A;  1HD2 A;  5CRW A;  2R4V A;  1M2B A;  4KCA A;  2DJ1 A;  3APQ A;  3K8N A;  4EVM A;  1PQN A;  2H6Y A;  2A4V A;  2EIR A;  4ZXG A;  4IN0 A;  4IS0 A;  3BOA A;  4JR6 A;  1GLQ A;  3KM6 A;  4ZB6 A;  2H0I A;  1GSE A;  3F4S A;  1X9S B;  2HXK A;  4EO3 A;  1OYJ A;  3H93 A;  2ES7 A;  5CYY A;  1BED A;  2H74 A;  1TDI A;  4MJE A;  1AQV A;  3LXT A;  2HRN A;  3FZ4 A;  1ILO A;  3ZIV A;  1M9B A;  4J57 E;  2WB9 A;  5KN1 A;  3TRQ A;  2H72 A;  2LNS A;  4ZB8 A;  2MMN A;  2H6Z A;  4K0G A;  4MCU A;  4ECI A;  1DBY A;  3F3Q A;  1GSU A;  1YEP A;  6GSU A;  3F6F A;  2PU9 C;  2LST A;  3DYR A;  4I5Q A;  4K8M A;  3OR5 A;  5F05 A;  1GTU A;  3L9U A;  3VPT A;  3IBH A;  2FY6 A;  3KH9 A;  2B5E A;  3QAG A;  4PQI A;  5GSS A;  4HZ4 A;  1XWB A;  2YNX A;  3ZML A;  1WPI A;  19GS A;  3IAM 2;  2K6V A;  4P3Y B;  4J56 E;  4PQ1 A;  4O7H A;  1U6T A;  4KA0 A;  1GLP A;  1FG4 A;  3ERF A;  2AHE A;  1PSQ A;  3VFI A;  1ZYE A;  2NDO A;  3TKS A;  2C0E A;  4ILF A;  4V2L A;  1QK8 A;  3UVH A;  4KX4 A;  1ZCP A;  5B6M A;  3D4M A;  1HNC A;  2DJJ A;  4XHM A;  2MMA A;  5LCZ A;  5ECR B;  3HJO A;  1NHO A;  3L9V A;  3IRA A;  4LLR A;  3IV4 A;  1JZR A;  1OC9 A;  1PMT A;  6GSS A;  4MPG A;  4KCE A;  1E6B A;  1I5G A;  5ID2 A;  2L6D A;  1ZYQ B;  5JWO B;  2XBQ A;  5ECH B;  3ZRE A;  4HU7 A;  4IW9 A;  3TKS E;  1W89 A;  4TR3 A;  4G19 A;  5G31 A;  4ML6 A;  2VUP A;  3EMX A;  1YEX A;  1V98 A;  2EC4 A;  3E9J B;  5JCW A;  5J3R A;  4POK A;  2F3M A;  3ZYW A;  4QL9 A;  2YPM A;  14GS A;  3DVW A;  4N0Z A;  3TRP A;  3F63 A;  3HY2 A;  3CXG A;  3UAP A;  5IOX A;  4WR5 A;  4OCE A;  2BJX A;  3P90 A;  4GSS A;  2AB6 A;  3VWV A;  3VWW A;  1PD2 1;  1U88 A;  2VCX A;  2FUG 2;  2HZE A;  4PXO A;  1ACV A;  4DVC A;  5ENU A;  4AJ7 A;  4BA7 A;  4HEA 2;  2DJ3 A;  1QXH A;  1Z7P A;  2H73 A;  2H66 A;  2X8C A;  1GUK A;  2IMF A;  3TJJ A;  1Z3E A;  2P5R A;  4IJI A;  4KH7 A;  1OKT A;  2YV9 A;  1OAZ A;  1FOV A;  3KD0 A;  4IVF A;  4ECJ A;  5J9C A;  4WEY A;  4IQA A;  2H75 A;  4AGS A;  2WFC A;  4NHZ A;  3ZMK A;  4N0V A;  4PX1 A;  2GT5 A;  5CRE A;  3U6V A;  1M7T A;  3N9J A;  5AIV A;  3US3 A;  4RUV A;  3IA1 A;  3ERG A;  2IMD A;  2GQM A;  3C8E A;  4I8B A;  4ECC A;  3GV1 A;  4DSS B;  2VLU A;  3G7Y A;  3O76 A;  4FH8 A;  4HDE A;  3VK9 A;  3DVX A;  4POB A;  2I3Y A;  4TXO B;  4LL4 B;  5FT3 A;  5IMZ A;  4WF4 A;  4EF0 A;  3CYN A;  2OAD A;  1SJI A;  3FZ9 A;  3HVV A;  5D9X A;  2QSI A;  5G1K A;  2YOI A;  1XW5 A;  2K8S A;  4EC0 A;  1MDI A;  1XCC A;  3ZFL A;  2A2S A;  3IE3 A;  1Z6M A;  1S3C A;  3APO A;  4ID0 A;  1Z5Y E;  1V2A A;  4KGI A;  1WWJ A;  4V1A g;  6GSX A;  3G9B A;  3E0U A;  4NAX A;  1WMJ A;  1TRW A;  4HZ2 A;  2C0F A;  1FVJ A;  3ZIT A;  5ECO B;  3Q6O A;  3TB2 A;  3IXR A;  1SD9 A;  2GZZ A;  3L9S A;  2ALB A;  3GUS A;  1V40 A;  3APS A;  3TJK A;  4WKW A;  1VF3 A;  3LJR A;  4RQX A;  4K6X A;  5ECQ B;  4X43 A;  5CRH A;  3QOU A;  1W4V A;  1USB A;  2YZH A;  3U5R E;  3TDG A;  5F07 A;  2PUK C;  2YWM A;  2XBI A;  1PRX A;  1GTI A;  5HFG A;  1VF1 A;  3IOS A;  2ZUP A;  4MH2 A;  5EVO A;  3WT2 A;  2EIO A;  4IP6 A;  1J9B A;  3IHQ A;  1BJX A;  2IN3 A;  5DJM A;  1IYH A;  1G7O A;  1ZZY A;  4G9H A;  4YQM A;  2JAC A;  2HSH A;  1TK8 B;  2HSY A;  2IFQ A;  2G0F A;  1SJ6 A;  3GSS A;  4IP1 A;  2VD0 A;  3QCP A;  4MPF A;  3GFK A;  4OD7 A;  2E7P A;  3W6G A;  2OBI A;  4FYB A;  3IAS 2;  16GS A;  2H1G A;  3QD9 A;  1WJK A;  1THO A;  3ZZX A;  4RQR A;  3BBY A;  3TRX A;  4NXI A;  4DSQ A;  1XW9 A;  2AJQ B;  2IME A;  2KP1 A;  3KH7 A;  5E59 A;  1SL1 B;  3HVX A;  2WCI A;  1TU7 A;  2C1Y A;  5D9T A;  3UMA A;  2ON7 A;  1A23 A;  1EOG A;  4K7N A;  5E4W A;  4MJB A;  2N5A A;  2H76 A;  1U3A A;  5CP1 A;  1LU4 A;  1T1V A;  5DCH A;  1XWC A;  2P5Q A;  2PER A;  2DJK A;  5A4V A;  5DAL A;  3UOM A;  1NM3 A;  2VL3 A;  4MZC A;  3KXO A;  3MWH A;  2R37 A;  3G7J A;  2FCH A;  4HQS A;  4I97 A;  4HJ2 A;  1YKC A;  2O8V B;  2O87 A;  2YWI A;  2V6O A;  2K8V A;  3FY7 A;  11GS A;  4LL1 B;  1BAY A;  1Z6N A;  2PN8 A;  6GSW A;  1MEK A;  1GSQ A;  3FR9 A;  4QQ7 A;  5G1L A;  1FVK A;  2Z9S A;  2WZ9 A;  4XS4 B;  5DAK B;  2H0G A;  4TR0 A;  1X9M B;  5ECS A;  2ZNM A;  2F8F A;  5ECK B;  1SYR A;  5J41 A;  1YDK A;  3BJ5 A;  1FB0 A;  1BX9 A;  2H1B A;  5A4U A;  2YJH A;  4PUA A;  3D21 A;  2HYX A;  4I2U A;  5AIS A;  4ZL8 A;  2X64 A;  2TRC P;  4E8H A;  3ZLP A;  5GZZ B;  3GNJ A;  1X5D A;  1NW2 A;  4D73 B;  1ST9 A;  1TP9 A;  1F6M C;  2VCW A;  2DJ2 A;  3KP8 A;  1MTC A;  1KEB A;  1OKD A;  1ZL9 A;  3A2V A;  3KP9 A;  3KIJ A;  1ERV A;  3DEX A;  5KN2 A;  2IL3 A;  2LS5 A;  3O3T A;  5D93 A;  1AW9 A;  2HE3 A;  4MDC A;  1TRV A;  4PUF C;  3M3M A;  1HNB A;  1SU9 A;  2VD1 A;  2RM5 A;  2C3T A;  1EGR A;  1K0B A;  1OC9 B;  2PWJ A;  5AN1 A;  1OE7 A;  2PBJ A;  3J7Y b;  3GKM A;  1EP8 A;  2GSQ A;  3UL3 A;  3TJG A;  3D22 A;  3P8W A;  4X1U A;  1JHB A;  1XPV A;  2FWE A;  1TK5 B;  5IIZ A;  1X0R A;  1VRS D;  2C3Q A;  4JED A;  2CZ2 A;  2IPA A;  2JZT A;  2OA7 A;  2AV4 A;  2WUL A;  3EMP A;  5IM9 A;  2DIY A;  2MZC A;  1GWC A;  2D2Z A;  4KSO A;  1TRU A;  1EP7 A;  4ZIJ A;  3MAK A;  3CSI A;  3FYG A;  5DCG A;  3IPZ A;  4YAP A;  2HZE B;  3QPM A;  1SYX A;  5INY A;  3DRN A;  4MJA A;  3HXS A;  2LRN A;  2YWN A;  1JZW A;  1Y6E A;  4OFM A;  3RDW A;  3I6A A;  3GTU A;  3A5W A;  1SD8 A;  2XHF A;  4ZIL A;  3IK9 A;  1EV9 A;  1S3D A;  1TU8 A;  2LTK A;  3FRC A;  1N2A A;  1QMV A;  2YJ7 A;  4NHW A;  4ECB A;  2FD3 A;  2MMZ A;  3EE2 A;  1U87 A;  1PA3 A;  3RHC A;  2O85 A;  3F8U A;  2BTO T;  1YKA A;  2WGR A;  4ZBB A;  1THX A;  3A2W A;  1GSS A;  1VGL A;  4I2T A;  5JWQ B;  3O6T A;  2I1U A;  4XRA A;  3UJ1 A;  4IBP A;  3TJF A;  2R3X A;  2DIZ A;  2GZP A;  1RW1 A;  3H4K A;  1PX6 A;  4WXT A;  4EDY A;  2LQQ A;  2GT6 A;  3WD6 A;  2X8G A;  2VL2 C;  2VLV A;  2L6C A;  4EE0 A;  1ON4 A;  2NTO A;  3F4R A;  4JRR A;  2CA8 A;  4LMV A;  4Q5F A;  2QKE A;  1YQ1 A;  2LNT A;  4NMU A;  1MDK A;  1K0C A;  1CQG A;  2B1K A;  4JZQ A;  3F4T A;  4F0B A;  4AJ6 A;  5IPG A;  2L4C A;  4DEJ A;  1K0D A;  1AUC A;  4BPY A;  4BVY A;  3UVT A;  4N11 A;  2P0G A;  2HFD A;  1WRY A;  4ZBA A;  2J9H A;  3FR3 A;  2L4Q A;  4O92 A;  5G5E A;  2QC7 A;  2H6X A;  3QAV A;  4WR4 A;  4NWY A;  3CSJ A;  2IMK A;  1GUH A;  1TJD A;  3Q18 A;  4BWS A;  5HR3 A;  1K0M A;  3DML A;  1SKW B;  3KMO A;  5AIX A;  1O7U A;  4GLT A;  3MDK A;  1C72 A;  5F06 A;  1GTB A;  4GSN A;  3QDN A;  3I9V 2;  4O5R A;  3QFA C;  6GSY A;  2GVP A;  2FLS A;  4FYC A;  4MK3 A;  2JZR A;  4OWY A;  2RUF A;  1QQ2 A;  2JL4 A;  2RUE A;  1SJZ A;  3GH6 A;  2JZS A;  2YP6 A;  1GUM A;  3NZN A;  3RBT A;  3VWX A;  1T4Z A;  2V2G A;  2YCD A;  4POM A;  1NSW A;  1MDJ A;  1Z9H A;  4HOJ A;  1FW1 A;  5CO3 A;  4MZB A;  1HYU A;  4Q5Q A;  1GSY A;  5GAP D;  4I6X A;  4F0C A;  4LMW A;  4X0X A;  4CHS A;  3UAR A;  3TKP A;  4V2N A;  2WJU A;  3TKR A;  1KNG A;  2OE3 A;  3ME8 A;  4MA9 A;  4NV5 A;  4KW6 A;  1GH2 A;  2L5L A;  3QR6 A;  3ZTL A;  3GX8 A;  3TOT A;  1O8X A;  2I9H A;  2N5F A;  4EXJ A;  4AF2 A;  6GST A;  4OMV A;  3SWL A;  5G30 A;  1GRX A;  2TIR A;  4GTU A;  2CVD A;  2B7K A;  1M2A A;  2PVQ A;  4IHU A;  5H5Q A;  1F3A A;  1K3Y A;  2LQO A;  4K1F A;  2B6M A;  1TK0 B;  2CX3 A;  2OJL A;  2LKU A;  4GCI A;  5GST A;  4N10 A;  5DAL B;  5ECM B;  13GS A;  1FB6 A;  1X9W B;  2I4A A;  3DWV A;  1EV4 A;  2IMI A;  3EU3 A;  3ERW A;  3IK7 A;  5DJL A;  2F8A A;  5IPH A;  1B48 A;  5G2Z A;  1OC8 A;  2CT6 A;  3HHV A;  4TXV A;  5IMV A;  4KAE A;  4KND A;  1AAZ A;  2IWT A;  4HQZ A;  1F3B A;  3HKR A;  1XVW A;  3GMF A;  2YZU A;  1GSD A;  3LWA A;  1F2E A;  3M8N A;  1H4O A;  1B8X A;  4ZB9 A;  3KEB A;  1R5P A;  2VO4 A;  5IOW A;  3CRT A;  5CAX A;  1TKD B;  1O85 A;  2DC5 A;  1XFL A;  2L59 A;  3TKQ A;  5DVB A;  4MF5 A;  4MP4 A;  4GRF A;  1A8Y A;  2KLX A;  1G0T A;  1PKW A;  4FO5 A;  3PGT A;  4MH3 A;  1K0A A;  5F0G A;  4F2I A;  3HA9 A;  1EZK A;  1SKR B;  1TTZ A;  4KDX A;  4AJ8 A; 
#chains in the Genus database with same CATH topology
 1VF2 A;  1ZYP A;  3DIE A;  1ZGN A;  1V58 A;  1S3R A;  4MAB A;  17GS A;  3ZRD A;  1O8W A;  3D0Z A;  1M2D A;  3LQ7 A;  5FHI A;  1R4W A;  2UZ8 A;  3F0I A;  2MMO A;  1GNE A;  1XG8 A;  3ME7 A;  1PGT A;  3NOF A;  3FKF A;  2P31 A;  1RK4 A;  5GAN D;  3GKN A;  2H8L A;  4ZBD A;  5HFI A;  1JLW A;  7GSS A;  3Q74 A;  3GRX A;  3ZIJ A;  2WRT A;  3S9F A;  3TJB A;  2V41 A;  5AGY A;  5LNK e;  4OFT A;  3TKS C;  3KMN A;  2H30 A;  3FHK A;  1MD4 A;  4KUN A;  5IMF A;  4HS1 A;  2KHP A;  1PL1 A;  5D9V A;  2LUS A;  3TUE A;  1A24 A;  4L0U A;  4HU9 A;  10GS A;  3HZ4 A;  4TXO A;  4ACS A;  2VIM A;  3I43 A;  2LV3 A;  4FIW A;  4IGJ A;  4O32 A;  1BYE A;  1JLV A;  3VLN A;  4LA1 A;  2G2Q A;  2VM2 A;  4IJ3 A;  4MF7 A;  4TW5 A;  4E8E A;  1Y25 A;  3LYP A;  2CZ3 A;  3LOR A;  4ICY A;  4HUA A;  2LJR A;  5ECP B;  3GH9 A;  3R2Q A;  2J23 A;  2AYT A;  2GQK A;  2I81 A;  4KDU A;  3CRU A;  2E2G A;  1AQX A;  4GST A;  2DKI A;  3FZA A;  3GTU B;  3MNG A;  3UBK A;  3SBC A;  3M9J A;  1XXU A;  3BCK A;  1A2J A;  1ZYN A;  3EVI A;  4F9Z A;  4KSM A;  2GQL A;  4OFN A;  3C71 A;  4CW9 A;  2E2M A;  2FGX A;  1A8L A;  2VCZ A;  1TI1 A;  1SK1 A;  2GTU A;  2YWO A;  5D73 A;  3ZFB A;  1SL2 B;  2OE0 A;  1CQH A;  2FNO A;  1Q4J A;  1J08 A;  5KEJ A;  2X49 A;  5HR1 A;  5LD0 A;  1T3B A;  2C80 A;  3CQF A;  4L8E A;  2LEG A;  1A0F A;  3LGC A;  2LRT A;  4IKH A;  1F9M A;  3LEF A;  3UEM A;  2B5X A;  3ZVJ A;  2YAN A;  3RHB A;  1NHY A;  3PIN A;  1A2L A;  1SK0 A;  3L4N A;  4XTS A;  1YF1 A;  1AIU A;  2C0D A;  5EY6 A;  4EL1 A;  3LYK A;  5B8A A;  3M0F A;  4V2M A;  1Q98 A;  3A5I A;  3PH9 A;  2MYG A;  2ZCT A;  1WE0 A;  2VOC A;  3TCO A;  1T4Y A;  5J4U A;  4K5R A;  3KCM A;  3TOU A;  3P2A A;  3VUR A;  1UN2 A;  2FWF A;  1BG5 A;  2DKH A;  1EEJ A;  3W8S A;  2X8H A;  1XWK A;  2R2J A;  5ID2 B;  4BVY B;  4ISD A;  4ZL9 A;  2HNL A;  4GF0 A;  2GLR A;  2FHE A;  2M72 A;  4MMM A;  2IJY A;  5J5N A;  3RPP A;  2CVB A;  3GKK A;  1KTE A;  8GSS A;  1R5A A;  1M9A A;  1S3A A;  2CX4 A;  4WBR D;  4J2F A;  5H5R A;  5HR0 A;  2C0G A;  3VI7 A;  3KGK A;  5CRD A;  3GN3 A;  2R6K A;  3IR4 A;  1GUL A;  2GST A;  1OE8 A;  2CV4 A;  1TXX A;  2M46 A;  3P7X A;  1GL8 A;  3M1G A;  4TVE A;  1WOU A;  3WGX A;  4DSR A;  4YAV A;  5JCG A;  2YN1 A;  4KDY A;  5B6N A;  3HCZ A;  4TR1 A;  1WIK A;  3C1R A;  3GKX A;  2PGT A;  22GS A;  2WDU A;  1GSF A;  1SEN A;  5DQS A;  5J9B A;  2VLT A;  4RI7 A;  1G6Y A;  2LRC A;  2FA4 A;  1U3I A;  1YY7 A;  3R3E A;  2V1M A;  2ON5 A;  2O7K A;  3KTB A;  2LJA A;  1I9D A;  4XS4 A;  3GUR A;  5HQP A;  5DAK A;  1LBK A;  2PVO C;  4BWQ A;  2OAC A;  4WBJ A;  2DML A;  4RI6 A;  4GXZ A;  4GQF A;  1XOA A;  4PNG A;  3IC4 A;  1K3L A;  3L78 A;  1ERU A;  1EGO A;  1K0O A;  2H19 A;  1G6W A;  5L71 A;  3FR6 A;  4JBB A;  1O81 A;  4TN8 A;  5IO0 A;  1AXD A;  4K2X A;  1DE2 A;  5JWR B;  4D73 A;  2O89 A;  3KZQ A;  3FK8 A;  2H1A A;  5IMD A;  3A3T A;  2E0Q A;  2NBS A;  5DBQ A;  5G5F A;  3VPQ A;  3CTF A;  2EIQ A;  1AQW A;  3QAW A;  4GWR A;  4Q5N A;  3ZVJ D;  1GNW A;  1K3O A;  2CAI A;  2QA1 A;  3F6D A;  3A2X A;  2BMX A;  1M99 A;  3CTG A;  3WGD A;  1B4P A;  2B5Y A;  2KOK A;  1ZOF A;  1DSB A;  3RPN A;  1GTA A;  4HI7 A;  2R0G A;  3MIX A;  4EIP A;  3JCM L;  4N30 A;  1XWG A;  3D4T A;  5IQY A;  4K0N A;  2C4J A;  2VAF A;  1YF0 A;  3H79 A;  4BL7 A;  5D8I A;  4IEL A;  3EU4 A;  3HVN A;  2DMM A;  4KB3 A;  4XS1 A;  2K18 A;  4GQC A;  2GSS A;  5FWG A;  1HNA A;  1PN0 A;  4CY6 A;  4XS6 A;  6GSV A;  4XRD A;  4H86 A;  4MJC A;  4BVX A;  1VF4 A;  3GYK A;  3GHA A;  2H01 A;  1R7H A;  4PNF A;  3LSZ A;  5A4W A;  3DD3 A;  3IHG A;  2RLI A;  4K9Z A;  4YQV A;  5F8B A;  1TW9 A;  4MLY A;  4Z7X A;  2IFQ B;  4JU5 A;  2LJK A;  3IDV A;  1SK2 A;  1QFN A;  2A2R A;  1F37 A;  18GS A;  2HZF A;  3FEU A;  4CDO A;  5ECN B;  1XIY A;  2DJ0 A;  1JZD A;  2HRF A;  2B3S A;  3BD2 A;  3EUR A;  1KBN A;  3NIV A;  1JFU A;  1PL2 A;  4K2D A;  3M9K A;  3UIW A;  1QGV A;  4L5O A;  4OO4 A;  4IQ1 A;  1N8J A;  1R26 A;  2JSY A;  3E3E A;  2AAW A;  4ULX A;  2V6K A;  5IMA A;  2VCT A;  4G2E A;  1V57 A;  3QFB C;  1WP0 A;  2OBK A;  2OKA A;  3I69 A;  4A5P A;  5A5K A;  1GP1 A;  1X5E A;  4XIH A;  4Q5R A;  1SL0 B;  4EDZ A;  3LFL A;  1PKZ A;  1K0N A;  4KE3 A;  5KN3 A;  4WF5 A;  1PN9 A;  4EUY A;  3F9U A;  1OC3 A;  1ERT A;  1A2M A;  1V9W A;  2M80 A;  2X99 A;  2VL9 A;  4NV2 A;  3HD5 A;  1B9Y C;  1UC7 A;  3W8J A;  4V1A p;  4TOP A;  1IYI A;  3KTL A;  2N5B A;  4L5L A;  2JAD A;  2TRX A;  1XWA A;  1X5C A;  3HJP A;  2XC2 A;  4USS A;  3HJM A;  3H8Q A;  2REM A;  3VWU A;  1TRS A;  3BCI A;  3GL5 A;  3QMX A;  2MBS A;  3GX0 A;  5CRG A;  2YV7 A;  5D96 A;  5CNW A;  5ECL B;  5COH A;  3VI5 A;  3HZ8 A;  1XW6 A;  3ED3 A;  4ZL7 A;  3HYP A;  5ELG A;  4EKZ A;  2KUC A;  2DSA A;  2VCQ A;  3FZ5 A;  2XPD A;  4TKY A;  3C7M A;  1XZO A;  1T00 A;  3F3R A;  1FHE A;  3FW2 A;  2PPT A;  2WS2 A;  2V32 A;  5HR2 A;  12GS A;  3C1S A;  2HI7 A;  2IIY A;  5H5S A;  4POL A;  1UA5 A;  1EEM A;  1M0U A;  2HT9 A;  3CSH A;  3KJY A;  2F51 A;  2CQ9 A;  1LJR A;  4TRX A;  1ABA A;  5IMC A;  4G0I A;  5D9W A;  4YKF A;  2L5O A;  2CAQ A;  20GS A;  5DQY A;  3D6I A;  1TI3 A;  4K5S A;  5B8B A;  3WYW A;  1ZMA A;  1O6J A;  4Z2U A;  4ML1 A;  2JU5 A;  5IO2 A;  1B4Q A;  2HLS A;  1UVZ A;  4WET A;  3LG6 A;  2VL2 A;  2R5G A;  3PR8 A;  2FWH A;  3MYD A;  2H70 A;  2GZY A;  2KP2 A;  2K9F A;  3G7I A;  3MSZ A;  4MZW A;  3LXZ A;  1DUG A;  3TGZ A;  1ERW A;  5ECI B;  2GGT A;  2FA8 A;  5EL8 A;  4PGT A;  1OVN A;  3GIX A;  1SKS B;  3Q19 A;  3L0H A;  4DSS A;  1T7P B;  4MNN A;  1ML6 A;  2FWG A;  2B1L A;  2PMT A;  5ELA A;  1DE1 A;  3AY8 A;  2VCV A;  2RII A;  4F82 A;  4CY8 A;  2OE1 A;  4YH2 A;  1J0F A;  2NPB A;  2X4A A;  5JCU A;  4F03 A;  4JE1 A;  2R0C A;  1TOF A;  1G7E A;  3V1W A;  2AUV A;  2C3N A;  5C00 A;  3GST A;  3EC3 A;  1PX7 A;  4PTS A;  1XOB A;  2H0H A;  2NVL A;  1FO5 A;  3DGQ A;  4MF6 A;  1BQ7 A;  1XVQ A;  4TR1 B;  1QUW A;  3CMI A;  2CVK A;  4K7O A;  3LW9 A;  4QL7 A;  4O5Q A;  9GSS A;  2B7J A;  3EWL A;  3WT1 A;  1MD3 A;  5DDL A;  1URM A;  2C8U A;  4YQU A;  3EIN A;  3UBL A;  5B7C A;  3EYT A;  2F9S A;  5EPF A;  2DBC A;  5ABR A;  3WGE A;  5KN0 A;  1XBS A;  2MBT A;  3DKS A;  2RM6 A;  3HVS A;  2L57 A;  1EWX A;  1YJ6 A;  4FYU A;  1EOH A;  2H71 A;  3ZL5 A;  2JSZ A;  4TR4 A;  4XCS A;  5C04 A;  3GA4 A;  3H1N A;  1RQM A;  4HJM A;  3C73 A;  3GL3 A;  3DXB A;  3D5J A;  4PUR A;  2VM1 A;  2GDR A;  4L0W A;  3CBU A;  3HDC A;  3ISO A;  1A0R P;  1B9X C;  4NPB A;  2QGV A;  3J7Y k;  5BMU A;  4JR4 A;  1O73 A;  4Z2T A;  1T8E B;  1FAA A;  5HFK A;  2XPE A;  1Z7R A;  2GSR A;  1HQO A;  1E2Y A;  4G10 A;  1AC1 A;  1H75 A;  1YZX A;  2GS3 A;  4K7I A;  2DLX A;  3RAZ A;  4PQH A;  2H1D A;  1JZO A;  4OO5 A;  3N5O A;  4OCF A;  1HD2 A;  5CRW A;  2R4V A;  1M2B A;  4KCA A;  2DJ1 A;  3APQ A;  3K8N A;  4EVM A;  1PQN A;  2H6Y A;  2A4V A;  2EIR A;  1M3I A;  4IN0 A;  4ZXG A;  4IS0 A;  3BOA A;  4JR6 A;  1GLQ A;  3KM6 A;  4ZB6 A;  2H0I A;  1GSE A;  3F4S A;  1X9S B;  2HXK A;  4EO3 A;  1OYJ A;  3H93 A;  2ES7 A;  5CYY A;  1BED A;  2H74 A;  1TDI A;  4MJE A;  1AQV A;  3LXT A;  2HRN A;  3FZ4 A;  1ILO A;  3ZIV A;  1M9B A;  4J57 E;  2WB9 A;  5KN1 A;  3TRQ A;  2H72 A;  2LNS A;  4ZB8 A;  2MMN A;  2H6Z A;  4K0G A;  4MCU A;  4ECI A;  1DBY A;  3F3Q A;  1GSU A;  1YEP A;  6GSU A;  3F6F A;  2PU9 C;  2LST A;  3DYR A;  4I5Q A;  4K8M A;  3OR5 A;  5F05 A;  1GTU A;  3L9U A;  3VPT A;  3IBH A;  2FY6 A;  3KH9 A;  2B5E A;  3QAG A;  4PQI A;  5GSS A;  4O5U A;  4HZ4 A;  1XWB A;  2YNX A;  3ZML A;  1WPI A;  19GS A;  3IAM 2;  2K6V A;  4P3Y B;  4J56 E;  4PQ1 A;  2HSM A;  4O7H A;  1U6T A;  4KA0 A;  1GLP A;  1FG4 A;  3ERF A;  2AHE A;  1PSQ A;  3VFI A;  1ZYE A;  3PPU A;  2NDO A;  3TKS A;  2C0E A;  4ILF A;  4V2L A;  1QK8 A;  3UVH A;  4KX4 A;  1ZCP A;  5B6M A;  3D4M A;  1HNC A;  2DJJ A;  4XHM A;  2MMA A;  5LCZ A;  5ECR B;  3HJO A;  1NHO A;  3L9V A;  3EPT A;  3IRA A;  4LLR A;  3IV4 A;  1JZR A;  1OC9 A;  1PMT A;  6GSS A;  4MPG A;  4KCE A;  1E6B A;  1I5G A;  5ID2 A;  2L6D A;  1ZYQ B;  5JWO B;  2XBQ A;  5ECH B;  3ZRE A;  4HU7 A;  4IW9 A;  3TKS E;  1W89 A;  4TR3 A;  4G19 A;  5G31 A;  4ML6 A;  2VUP A;  3EMX A;  1YEX A;  1V98 A;  2EC4 A;  3E9J B;  5JCW A;  5J3R A;  4POK A;  2F3M A;  3ZYW A;  4QL9 A;  2YPM A;  14GS A;  3DVW A;  4N0Z A;  3TRP A;  3F63 A;  3HY2 A;  3CXG A;  3UAP A;  5IOX A;  4WR5 A;  4OCE A;  2BJX A;  3P90 A;  4GSS A;  2AB6 A;  3VWV A;  3VWW A;  1PD2 1;  1U88 A;  2VCX A;  2FUG 2;  2HZE A;  4PXO A;  1ACV A;  4DVC A;  5ENU A;  4AJ7 A;  4BA7 A;  4HEA 2;  2DJ3 A;  1QXH A;  1Z7P A;  2H73 A;  2H66 A;  2X8C A;  1GUK A;  4X4J A;  2IMF A;  3TJJ A;  1Z3E A;  2P5R A;  4IJI A;  4KH7 A;  1OKT A;  2YV9 A;  1OAZ A;  1FOV A;  3KD0 A;  4IVF A;  4ECJ A;  5J9C A;  4WEY A;  4IQA A;  2H75 A;  4AGS A;  2WFC A;  4NHZ A;  3ZMK A;  4N0V A;  4PX1 A;  2GT5 A;  5CRE A;  3U6V A;  1M7T A;  3N9J A;  5AIV A;  3US3 A;  4RUV A;  3IA1 A;  3ERG A;  2IMD A;  2GQM A;  3C8E A;  4I8B A;  4ECC A;  3GV1 A;  4DSS B;  2VLU A;  3G7Y A;  3O76 A;  4FH8 A;  4HDE A;  3VK9 A;  3DVX A;  4POB A;  2I3Y A;  4TXO B;  4LL4 B;  5FT3 A;  5IMZ A;  4WF4 A;  4EF0 A;  3CYN A;  2OAD A;  1SJI A;  3FZ9 A;  4BIK A;  3HVV A;  5D9X A;  2QSI A;  4EIQ A;  5G1K A;  2YOI A;  1XW5 A;  2K8S A;  4EC0 A;  1MDI A;  1XCC A;  3ZFL A;  2A2S A;  3IE3 A;  1Z6M A;  1S3C A;  3APO A;  4ID0 A;  1Z5Y E;  1V2A A;  4KGI A;  1WWJ A;  4V1A g;  6GSX A;  3G9B A;  3E0U A;  4NAX A;  1WMJ A;  1TRW A;  4HZ2 A;  2C0F A;  1FVJ A;  3ZIT A;  5ECO B;  3Q6O A;  3TB2 A;  3IXR A;  1SD9 A;  2GZZ A;  3L9S A;  2ALB A;  3GUS A;  1V40 A;  3APS A;  3TJK A;  4WKW A;  1VF3 A;  3FMW A;  3LJR A;  4RQX A;  4G0K A;  4K6X A;  5ECQ B;  4X43 A;  5CRH A;  3QOU A;  1W4V A;  1USB A;  2YZH A;  3U5R E;  3TDG A;  5F07 A;  2PUK C;  2YWM A;  2XBI A;  1PRX A;  1GTI A;  5HFG A;  1VF1 A;  3IOS A;  2ZUP A;  4MH2 A;  5EVO A;  3WT2 A;  2EIO A;  4IP6 A;  1J9B A;  3IC8 A;  3IHQ A;  1BJX A;  2IN3 A;  5DJM A;  1IYH A;  1G7O A;  1ZZY A;  4G9H A;  4YQM A;  2JAC A;  2HSH A;  1TK8 B;  2HSY A;  2IFQ A;  2G0F A;  1SJ6 A;  3GSS A;  2R0P A;  2VD0 A;  4IP1 A;  3QCP A;  4MPF A;  3GFK A;  4OD7 A;  2E7P A;  3W6G A;  2OBI A;  4FYB A;  3IAS 2;  16GS A;  2H1G A;  3QD9 A;  1WJK A;  1THO A;  3ZZX A;  4RQR A;  3BBY A;  3TRX A;  4NXI A;  4DSQ A;  1XW9 A;  2AJQ B;  2IME A;  2KP1 A;  3KH7 A;  5E59 A;  1SL1 B;  3HVX A;  2WCI A;  1TU7 A;  2C1Y A;  5D9T A;  3UMA A;  2ON7 A;  1A23 A;  1EOG A;  4K7N A;  5E4W A;  4MJB A;  2N5A A;  2H76 A;  1U3A A;  5CP1 A;  1LU4 A;  1T1V A;  5DCH A;  1XWC A;  2P5Q A;  2PER A;  4KF9 A;  2DJK A;  5A4V A;  5DAL A;  3UOM A;  1NM3 A;  2QA2 A;  2VL3 A;  4MZC A;  5BRT A;  3KXO A;  3MWH A;  2R37 A;  3G7J A;  2FCH A;  4HQS A;  4I97 A;  4HJ2 A;  1YKC A;  2O8V B;  2O87 A;  2YWI A;  2V6O A;  2K8V A;  3FY7 A;  11GS A;  4LL1 B;  1BAY A;  4FQU A;  1Z6N A;  2A2P A;  2PN8 A;  6GSW A;  1MEK A;  1GSQ A;  3FR9 A;  4QQ7 A;  5G1L A;  1FVK A;  2Z9S A;  4G0L A;  2WZ9 A;  4XS4 B;  5DAK B;  2H0G A;  4TR0 A;  1X9M B;  5ECS A;  2ZNM A;  2F8F A;  5ECK B;  1SYR A;  5J41 A;  1YDK A;  3BJ5 A;  1FB0 A;  1BX9 A;  2H1B A;  5A4U A;  2YJH A;  5KOX A;  4PUA A;  3D21 A;  2HYX A;  4I2U A;  5AIS A;  4ZL8 A;  2X64 A;  2TRC P;  4E8H A;  3ZLP A;  5GZZ B;  3GNJ A;  1X5D A;  1NW2 A;  4D73 B;  1ST9 A;  1TP9 A;  1F6M C;  2VCW A;  2DJ2 A;  3KP8 A;  1MTC A;  1KEB A;  1OKD A;  1ZL9 A;  3A2V A;  3KP9 A;  3KIJ A;  1ERV A;  3DEX A;  5KN2 A;  2IL3 A;  2LS5 A;  3O3T A;  5D93 A;  1AW9 A;  2HE3 A;  4MDC A;  1TRV A;  4PUF C;  3M3M A;  1HNB A;  1SU9 A;  2VD1 A;  2RM5 A;  2C3T A;  1EGR A;  1K0B A;  1OC9 B;  2PWJ A;  5AN1 A;  1OE7 A;  2PBJ A;  3J7Y b;  3GKM A;  1EP8 A;  2GSQ A;  3UL3 A;  3TJG A;  3D22 A;  3P8W A;  4X1U A;  1JHB A;  1XPV A;  2FWE A;  1TK5 B;  5IIZ A;  1X0R A;  1VRS D;  2C3Q A;  4JED A;  2CZ2 A;  2IPA A;  2JZT A;  4BL7 B;  2OA7 A;  2AV4 A;  2WUL A;  3EMP A;  5IM9 A;  2DIY A;  2MZC A;  1GWC A;  2D2Z A;  4KSO A;  1TRU A;  1EP7 A;  4ZIJ A;  3MAK A;  3CSI A;  3FYG A;  5DCG A;  3IPZ A;  4BVX B;  4YAP A;  2HZE B;  3QPM A;  1SYX A;  5INY A;  5KOW A;  2HRA A;  3DRN A;  4MJA A;  3HXS A;  2LRN A;  2YWN A;  1JZW A;  1Y6E A;  4OFM A;  3RDW A;  3I6A A;  3GTU A;  3A5W A;  1SD8 A;  2XHF A;  4ZIL A;  3IK9 A;  1EV9 A;  1S3D A;  1TU8 A;  2LTK A;  3FRC A;  1N2A A;  1QMV A;  2YJ7 A;  4NHW A;  4ECB A;  2FD3 A;  2MMZ A;  3EE2 A;  1U87 A;  1PA3 A;  3RHC A;  2O85 A;  3F8U A;  2BTO T;  1YKA A;  2WGR A;  4ZBB A;  1THX A;  3A2W A;  1GSS A;  1VGL A;  4I2T A;  5JWQ B;  3O6T A;  4YKG A;  2I1U A;  4XRA A;  3UJ1 A;  4IBP A;  3TJF A;  2R3X A;  2DIZ A;  2GZP A;  1RW1 A;  3H4K A;  1PX6 A;  4WXT A;  4EDY A;  2LQQ A;  2GT6 A;  3WD6 A;  2X8G A;  2VL2 C;  2VLV A;  2L6C A;  4EE0 A;  1ON4 A;  2NTO A;  3F4R A;  4JRR A;  2CA8 A;  4LMV A;  4Q5F A;  2QKE A;  1YQ1 A;  2LNT A;  4NMU A;  1MDK A;  1K0C A;  1CQG A;  2B1K A;  4JZQ A;  3F4T A;  4F0B A;  4AJ6 A;  4Z2R A;  2A4H A;  5IPG A;  2L4C A;  4DEJ A;  1K0D A;  1AUC A;  4BPY A;  4BVY A;  3UVT A;  4N11 A;  2P0G A;  2HFD A;  1WRY A;  4ZBA A;  2J9H A;  3FR3 A;  2L4Q A;  4O92 A;  5G5E A;  2QC7 A;  2H6X A;  3QAV A;  4WR4 A;  4NWY A;  3CSJ A;  2IMK A;  1GUH A;  1TJD A;  3Q18 A;  4BWS A;  5HR3 A;  1K0M A;  3DML A;  1SKW B;  3KMO A;  5AIX A;  1O7U A;  4GLT A;  3MDK A;  1C72 A;  5F06 A;  1GTB A;  4GSN A;  3QDN A;  3I9V 2;  4O5R A;  3QFA C;  6GSY A;  2GVP A;  2FLS A;  4FYC A;  4MK3 A;  2JZR A;  4OWY A;  2RUF A;  1QQ2 A;  2JL4 A;  2RUE A;  1SJZ A;  3GH6 A;  2JZS A;  2YP6 A;  1GUM A;  3NZN A;  3RBT A;  3VWX A;  1T4Z A;  2V2G A;  2YCD A;  4POM A;  1NSW A;  1MDJ A;  1Z9H A;  4HOJ A;  1FW1 A;  5CO3 A;  4MZB A;  1HYU A;  4Q5Q A;  1GSY A;  5GAP D;  4I6X A;  4F0C A;  4LMW A;  4X0X A;  4CHS A;  3UAR A;  3TKP A;  4V2N A;  2WJU A;  3TKR A;  1KNG A;  2OE3 A;  3ME8 A;  4MA9 A;  4NV5 A;  4KW6 A;  1GH2 A;  2L5L A;  3QR6 A;  3ZTL A;  3GX8 A;  3TOT A;  1O8X A;  2I9H A;  2N5F A;  4EXJ A;  4AF2 A;  6GST A;  4OMV A;  3SWL A;  5G30 A;  1GRX A;  2TIR A;  4GTU A;  2CVD A;  2B7K A;  1M2A A;  2PVQ A;  4IHU A;  5H5Q A;  1F3A A;  1K3Y A;  2LQO A;  4K1F A;  2B6M A;  1TK0 B;  2CX3 A;  2OJL A;  2LKU A;  4GCI A;  5GST A;  4N10 A;  2HRK A;  5DAL B;  5ECM B;  13GS A;  1FB6 A;  1X9W B;  2I4A A;  1PFO A;  3DWV A;  1EV4 A;  2IMI A;  3EU3 A;  3ERW A;  3IK7 A;  5DJL A;  2F8A A;  5IPH A;  1B48 A;  5G2Z A;  1OC8 A;  2CT6 A;  3HHV A;  4TXV A;  5IMV A;  4KAE A;  4KND A;  1AAZ A;  2IWT A;  1FOH A;  4HQZ A;  1M3J A;  1F3B A;  3HKR A;  1XVW A;  3GMF A;  2YZU A;  1GSD A;  3LWA A;  1F2E A;  3M8N A;  1H4O A;  1B8X A;  4ZB9 A;  3KEB A;  1R5P A;  2VO4 A;  5IOW A;  3CRT A;  5CAX A;  1TKD B;  1O85 A;  2DC5 A;  1XFL A;  2L59 A;  3TKQ A;  5DVB A;  4MF5 A;  4MP4 A;  4GRF A;  1A8Y A;  2KLX A;  1G0T A;  1PKW A;  4FO5 A;  4HSC X;  3PGT A;  4MH3 A;  1K0A A;  5F0G A;  4F2I A;  3HA9 A;  1EZK A;  1SKR B;  1TTZ A;  4KDX A;  4AJ8 A; 
#chains in the Genus database with same CATH homology
 1VF2 A;  1ZYP A;  3DIE A;  1ZGN A;  1V58 A;  4MAB A;  17GS A;  3ZRD A;  1O8W A;  3D0Z A;  1M2D A;  3LQ7 A;  5FHI A;  1R4W A;  2UZ8 A;  3F0I A;  2MMO A;  1GNE A;  3ME7 A;  1PGT A;  3NOF A;  3FKF A;  2P31 A;  1RK4 A;  5GAN D;  3GKN A;  2H8L A;  4ZBD A;  5HFI A;  1JLW A;  7GSS A;  3Q74 A;  3GRX A;  3ZIJ A;  2WRT A;  3S9F A;  3TJB A;  2V41 A;  5AGY A;  5LNK e;  4OFT A;  3TKS C;  3KMN A;  2H30 A;  3FHK A;  1MD4 A;  4KUN A;  5IMF A;  4HS1 A;  2KHP A;  1PL1 A;  5D9V A;  2LUS A;  3TUE A;  1A24 A;  4L0U A;  4HU9 A;  10GS A;  3HZ4 A;  4TXO A;  4ACS A;  2VIM A;  3I43 A;  2LV3 A;  4FIW A;  4IGJ A;  4O32 A;  1BYE A;  1JLV A;  3VLN A;  4LA1 A;  2G2Q A;  2VM2 A;  4IJ3 A;  4MF7 A;  4TW5 A;  4E8E A;  1Y25 A;  3LYP A;  2CZ3 A;  3LOR A;  4ICY A;  4HUA A;  2LJR A;  5ECP B;  3GH9 A;  3R2Q A;  2J23 A;  2AYT A;  2GQK A;  2I81 A;  4KDU A;  3CRU A;  2E2G A;  1AQX A;  4GST A;  2DKI A;  3FZA A;  3GTU B;  3MNG A;  3UBK A;  3SBC A;  3M9J A;  1XXU A;  3BCK A;  1A2J A;  1ZYN A;  3EVI A;  4F9Z A;  4KSM A;  2GQL A;  4OFN A;  3C71 A;  4CW9 A;  2E2M A;  2FGX A;  1A8L A;  2VCZ A;  1TI1 A;  1SK1 A;  2GTU A;  2YWO A;  5D73 A;  3ZFB A;  1SL2 B;  2OE0 A;  1CQH A;  2FNO A;  1Q4J A;  1J08 A;  5KEJ A;  2X49 A;  5HR1 A;  5LD0 A;  1T3B A;  2C80 A;  4L8E A;  2LEG A;  1A0F A;  3LGC A;  2LRT A;  4IKH A;  1F9M A;  3LEF A;  3UEM A;  2B5X A;  3ZVJ A;  2YAN A;  3RHB A;  1NHY A;  3PIN A;  1A2L A;  1SK0 A;  3L4N A;  4XTS A;  1YF1 A;  1AIU A;  2C0D A;  5EY6 A;  4EL1 A;  3LYK A;  5B8A A;  3M0F A;  4V2M A;  1Q98 A;  3A5I A;  3PH9 A;  2MYG A;  2ZCT A;  1WE0 A;  2VOC A;  3TCO A;  1T4Y A;  5J4U A;  4K5R A;  3KCM A;  3TOU A;  3P2A A;  3VUR A;  1UN2 A;  2FWF A;  1BG5 A;  2DKH A;  1EEJ A;  3W8S A;  2X8H A;  1XWK A;  2R2J A;  5ID2 B;  4BVY B;  4ISD A;  4ZL9 A;  2HNL A;  4GF0 A;  2GLR A;  2FHE A;  2M72 A;  4MMM A;  2IJY A;  5J5N A;  3RPP A;  2CVB A;  3GKK A;  1KTE A;  8GSS A;  1R5A A;  1M9A A;  1S3A A;  2CX4 A;  4WBR D;  4J2F A;  5H5R A;  5HR0 A;  2C0G A;  3VI7 A;  3KGK A;  5CRD A;  3GN3 A;  2R6K A;  3IR4 A;  1GUL A;  2GST A;  1OE8 A;  2CV4 A;  1TXX A;  2M46 A;  3P7X A;  1GL8 A;  3M1G A;  4TVE A;  1WOU A;  3WGX A;  4DSR A;  4YAV A;  5JCG A;  2YN1 A;  4KDY A;  5B6N A;  3HCZ A;  4TR1 A;  1WIK A;  3C1R A;  3GKX A;  2PGT A;  22GS A;  2WDU A;  1GSF A;  1SEN A;  5DQS A;  5J9B A;  2VLT A;  4RI7 A;  1G6Y A;  2LRC A;  2FA4 A;  1U3I A;  1YY7 A;  3R3E A;  2V1M A;  2ON5 A;  2O7K A;  3KTB A;  2LJA A;  1I9D A;  4XS4 A;  3GUR A;  5HQP A;  5DAK A;  1LBK A;  2PVO C;  4BWQ A;  2OAC A;  4WBJ A;  2DML A;  4RI6 A;  4GXZ A;  4GQF A;  1XOA A;  4PNG A;  3IC4 A;  1K3L A;  3L78 A;  1ERU A;  1EGO A;  1K0O A;  2H19 A;  1G6W A;  5L71 A;  3FR6 A;  4JBB A;  1O81 A;  4TN8 A;  5IO0 A;  1AXD A;  4K2X A;  1DE2 A;  5JWR B;  4D73 A;  2O89 A;  3KZQ A;  3FK8 A;  2H1A A;  5IMD A;  3A3T A;  2E0Q A;  2NBS A;  5DBQ A;  5G5F A;  3VPQ A;  3CTF A;  2EIQ A;  1AQW A;  3QAW A;  4GWR A;  4Q5N A;  3ZVJ D;  1GNW A;  1K3O A;  2CAI A;  2QA1 A;  3F6D A;  3A2X A;  2BMX A;  1M99 A;  3CTG A;  3WGD A;  1B4P A;  2B5Y A;  2KOK A;  1ZOF A;  1DSB A;  3RPN A;  1GTA A;  4HI7 A;  2R0G A;  3MIX A;  4EIP A;  3JCM L;  4N30 A;  1XWG A;  3D4T A;  5IQY A;  4K0N A;  2C4J A;  2VAF A;  1YF0 A;  3H79 A;  4BL7 A;  5D8I A;  4IEL A;  3EU4 A;  2DMM A;  4KB3 A;  4XS1 A;  2K18 A;  4GQC A;  2GSS A;  5FWG A;  1HNA A;  1PN0 A;  4CY6 A;  4XS6 A;  6GSV A;  4XRD A;  4H86 A;  4MJC A;  4BVX A;  1VF4 A;  3GYK A;  3GHA A;  2H01 A;  1R7H A;  4PNF A;  3LSZ A;  5A4W A;  3DD3 A;  3IHG A;  2RLI A;  4K9Z A;  4YQV A;  5F8B A;  1TW9 A;  4MLY A;  4Z7X A;  2IFQ B;  4JU5 A;  2LJK A;  3IDV A;  1SK2 A;  1QFN A;  2A2R A;  1F37 A;  18GS A;  2HZF A;  3FEU A;  4CDO A;  5ECN B;  1XIY A;  2DJ0 A;  1JZD A;  2HRF A;  2B3S A;  3BD2 A;  3EUR A;  1KBN A;  3NIV A;  1JFU A;  1PL2 A;  4K2D A;  3M9K A;  3UIW A;  1QGV A;  4L5O A;  4OO4 A;  4IQ1 A;  1N8J A;  1R26 A;  2JSY A;  3E3E A;  2AAW A;  4ULX A;  2V6K A;  5IMA A;  2VCT A;  4G2E A;  1V57 A;  3QFB C;  1WP0 A;  2OBK A;  2OKA A;  3I69 A;  4A5P A;  5A5K A;  1GP1 A;  1X5E A;  4XIH A;  4Q5R A;  1SL0 B;  4EDZ A;  3LFL A;  1PKZ A;  1K0N A;  4KE3 A;  5KN3 A;  4WF5 A;  1PN9 A;  4EUY A;  3F9U A;  1OC3 A;  1ERT A;  1A2M A;  1V9W A;  2M80 A;  2X99 A;  2VL9 A;  4NV2 A;  3HD5 A;  1B9Y C;  1UC7 A;  3W8J A;  4V1A p;  4TOP A;  1IYI A;  3KTL A;  2N5B A;  4L5L A;  2JAD A;  2TRX A;  1XWA A;  1X5C A;  3HJP A;  2XC2 A;  4USS A;  3HJM A;  3H8Q A;  2REM A;  3VWU A;  1TRS A;  3BCI A;  3GL5 A;  3QMX A;  2MBS A;  3GX0 A;  5CRG A;  2YV7 A;  5D96 A;  5CNW A;  5ECL B;  5COH A;  3VI5 A;  3HZ8 A;  1XW6 A;  3ED3 A;  4ZL7 A;  3HYP A;  5ELG A;  4EKZ A;  2KUC A;  2DSA A;  2VCQ A;  3FZ5 A;  2XPD A;  4TKY A;  3C7M A;  1XZO A;  1T00 A;  3F3R A;  1FHE A;  3FW2 A;  2PPT A;  2WS2 A;  2V32 A;  5HR2 A;  12GS A;  3C1S A;  2HI7 A;  2IIY A;  5H5S A;  4POL A;  1UA5 A;  1EEM A;  1M0U A;  2HT9 A;  3CSH A;  3KJY A;  2F51 A;  2CQ9 A;  1LJR A;  4TRX A;  1ABA A;  5IMC A;  4G0I A;  5D9W A;  4YKF A;  2L5O A;  2CAQ A;  20GS A;  5DQY A;  3D6I A;  1TI3 A;  4K5S A;  5B8B A;  3WYW A;  1ZMA A;  1O6J A;  4Z2U A;  4ML1 A;  2JU5 A;  5IO2 A;  1B4Q A;  2HLS A;  1UVZ A;  4WET A;  3LG6 A;  2VL2 A;  2R5G A;  3PR8 A;  2FWH A;  3MYD A;  2H70 A;  2GZY A;  2KP2 A;  2K9F A;  3G7I A;  3MSZ A;  4MZW A;  3LXZ A;  1DUG A;  3TGZ A;  1ERW A;  5ECI B;  2GGT A;  2FA8 A;  5EL8 A;  4PGT A;  1OVN A;  3GIX A;  1SKS B;  3Q19 A;  3L0H A;  4DSS A;  1T7P B;  4MNN A;  1ML6 A;  2FWG A;  2B1L A;  2PMT A;  5ELA A;  1DE1 A;  3AY8 A;  2VCV A;  2RII A;  4F82 A;  4CY8 A;  2OE1 A;  4YH2 A;  1J0F A;  2NPB A;  2X4A A;  5JCU A;  4F03 A;  4JE1 A;  2R0C A;  1TOF A;  1G7E A;  3V1W A;  2AUV A;  2C3N A;  5C00 A;  3GST A;  3EC3 A;  1PX7 A;  4PTS A;  1XOB A;  2H0H A;  2NVL A;  1FO5 A;  3DGQ A;  4MF6 A;  1BQ7 A;  1XVQ A;  4TR1 B;  1QUW A;  3CMI A;  2CVK A;  4K7O A;  3LW9 A;  4QL7 A;  4O5Q A;  9GSS A;  2B7J A;  3EWL A;  3WT1 A;  1MD3 A;  5DDL A;  1URM A;  2C8U A;  4YQU A;  3EIN A;  3UBL A;  5B7C A;  3EYT A;  2F9S A;  5EPF A;  2DBC A;  5ABR A;  3WGE A;  5KN0 A;  1XBS A;  2MBT A;  3DKS A;  2RM6 A;  3HVS A;  2L57 A;  1EWX A;  1YJ6 A;  4FYU A;  1EOH A;  2H71 A;  3ZL5 A;  2JSZ A;  4TR4 A;  4XCS A;  5C04 A;  3GA4 A;  3H1N A;  1RQM A;  4HJM A;  3C73 A;  3GL3 A;  3DXB A;  3D5J A;  4PUR A;  2VM1 A;  2GDR A;  4L0W A;  3CBU A;  3HDC A;  3ISO A;  1A0R P;  1B9X C;  4NPB A;  2QGV A;  3J7Y k;  5BMU A;  4JR4 A;  1O73 A;  4Z2T A;  1T8E B;  1FAA A;  5HFK A;  2XPE A;  1Z7R A;  2GSR A;  1HQO A;  1E2Y A;  4G10 A;  1AC1 A;  1H75 A;  1YZX A;  2GS3 A;  4K7I A;  2DLX A;  3RAZ A;  4PQH A;  2H1D A;  1JZO A;  4OO5 A;  3N5O A;  4OCF A;  1HD2 A;  5CRW A;  2R4V A;  1M2B A;  4KCA A;  2DJ1 A;  3APQ A;  3K8N A;  4EVM A;  1PQN A;  2H6Y A;  2A4V A;  2EIR A;  4ZXG A;  4IN0 A;  4IS0 A;  3BOA A;  4JR6 A;  1GLQ A;  3KM6 A;  4ZB6 A;  2H0I A;  1GSE A;  3F4S A;  1X9S B;  2HXK A;  4EO3 A;  1OYJ A;  3H93 A;  2ES7 A;  5CYY A;  1BED A;  2H74 A;  1TDI A;  4MJE A;  1AQV A;  3LXT A;  2HRN A;  3FZ4 A;  1ILO A;  3ZIV A;  1M9B A;  4J57 E;  2WB9 A;  5KN1 A;  3TRQ A;  2H72 A;  2LNS A;  4ZB8 A;  2MMN A;  2H6Z A;  4K0G A;  4MCU A;  4ECI A;  1DBY A;  3F3Q A;  1GSU A;  1YEP A;  6GSU A;  3F6F A;  2PU9 C;  2LST A;  3DYR A;  4I5Q A;  4K8M A;  3OR5 A;  5F05 A;  1GTU A;  3L9U A;  3VPT A;  3IBH A;  2FY6 A;  3KH9 A;  2B5E A;  3QAG A;  4PQI A;  5GSS A;  4O5U A;  4HZ4 A;  1XWB A;  2YNX A;  3ZML A;  1WPI A;  19GS A;  3IAM 2;  2K6V A;  4P3Y B;  4J56 E;  4PQ1 A;  2HSM A;  4O7H A;  1U6T A;  4KA0 A;  1GLP A;  1FG4 A;  3ERF A;  2AHE A;  1PSQ A;  3VFI A;  1ZYE A;  3PPU A;  2NDO A;  3TKS A;  2C0E A;  4ILF A;  4V2L A;  1QK8 A;  3UVH A;  4KX4 A;  1ZCP A;  5B6M A;  3D4M A;  1HNC A;  2DJJ A;  4XHM A;  2MMA A;  5LCZ A;  5ECR B;  3HJO A;  1NHO A;  3L9V A;  3EPT A;  3IRA A;  4LLR A;  3IV4 A;  1JZR A;  1OC9 A;  1PMT A;  6GSS A;  4MPG A;  4KCE A;  1E6B A;  1I5G A;  5ID2 A;  2L6D A;  1ZYQ B;  5JWO B;  2XBQ A;  5ECH B;  3ZRE A;  4HU7 A;  4IW9 A;  3TKS E;  1W89 A;  4TR3 A;  4G19 A;  5G31 A;  4ML6 A;  2VUP A;  3EMX A;  1YEX A;  1V98 A;  2EC4 A;  3E9J B;  5JCW A;  5J3R A;  4POK A;  2F3M A;  3ZYW A;  4QL9 A;  2YPM A;  14GS A;  3DVW A;  4N0Z A;  3TRP A;  3F63 A;  3HY2 A;  3CXG A;  3UAP A;  5IOX A;  4WR5 A;  4OCE A;  2BJX A;  3P90 A;  4GSS A;  2AB6 A;  3VWV A;  3VWW A;  1PD2 1;  1U88 A;  2VCX A;  2FUG 2;  2HZE A;  4PXO A;  1ACV A;  4DVC A;  5ENU A;  4AJ7 A;  4BA7 A;  4HEA 2;  2DJ3 A;  1QXH A;  1Z7P A;  2H73 A;  2H66 A;  2X8C A;  1GUK A;  4X4J A;  2IMF A;  3TJJ A;  1Z3E A;  2P5R A;  4IJI A;  4KH7 A;  1OKT A;  2YV9 A;  1OAZ A;  1FOV A;  3KD0 A;  4IVF A;  4ECJ A;  5J9C A;  4WEY A;  4IQA A;  2H75 A;  4AGS A;  2WFC A;  4NHZ A;  3ZMK A;  4N0V A;  4PX1 A;  2GT5 A;  5CRE A;  3U6V A;  1M7T A;  3N9J A;  5AIV A;  3US3 A;  4RUV A;  3IA1 A;  3ERG A;  2IMD A;  2GQM A;  3C8E A;  4I8B A;  4ECC A;  3GV1 A;  4DSS B;  2VLU A;  3G7Y A;  3O76 A;  4FH8 A;  4HDE A;  3VK9 A;  3DVX A;  4POB A;  2I3Y A;  4TXO B;  4LL4 B;  5FT3 A;  5IMZ A;  4WF4 A;  4EF0 A;  3CYN A;  2OAD A;  1SJI A;  3FZ9 A;  3HVV A;  5D9X A;  2QSI A;  4EIQ A;  5G1K A;  2YOI A;  1XW5 A;  2K8S A;  4EC0 A;  1MDI A;  1XCC A;  3ZFL A;  2A2S A;  3IE3 A;  1Z6M A;  1S3C A;  3APO A;  4ID0 A;  1Z5Y E;  1V2A A;  4KGI A;  1WWJ A;  4V1A g;  6GSX A;  3G9B A;  3E0U A;  4NAX A;  1WMJ A;  1TRW A;  4HZ2 A;  2C0F A;  1FVJ A;  3ZIT A;  5ECO B;  3Q6O A;  3TB2 A;  3IXR A;  1SD9 A;  2GZZ A;  3L9S A;  2ALB A;  3GUS A;  1V40 A;  3APS A;  3TJK A;  4WKW A;  1VF3 A;  3FMW A;  3LJR A;  4RQX A;  4G0K A;  4K6X A;  5ECQ B;  4X43 A;  5CRH A;  3QOU A;  1W4V A;  1USB A;  2YZH A;  3U5R E;  3TDG A;  5F07 A;  2PUK C;  2YWM A;  2XBI A;  1PRX A;  1GTI A;  5HFG A;  1VF1 A;  3IOS A;  2ZUP A;  4MH2 A;  5EVO A;  3WT2 A;  2EIO A;  4IP6 A;  1J9B A;  3IC8 A;  3IHQ A;  1BJX A;  2IN3 A;  5DJM A;  1IYH A;  1G7O A;  1ZZY A;  4G9H A;  4YQM A;  2JAC A;  2HSH A;  1TK8 B;  2HSY A;  2IFQ A;  2G0F A;  1SJ6 A;  3GSS A;  2R0P A;  2VD0 A;  4IP1 A;  3QCP A;  4MPF A;  3GFK A;  4OD7 A;  2E7P A;  3W6G A;  2OBI A;  4FYB A;  3IAS 2;  16GS A;  2H1G A;  3QD9 A;  1WJK A;  1THO A;  3ZZX A;  4RQR A;  3BBY A;  3TRX A;  4NXI A;  4DSQ A;  1XW9 A;  2AJQ B;  2IME A;  2KP1 A;  3KH7 A;  5E59 A;  1SL1 B;  3HVX A;  2WCI A;  1TU7 A;  2C1Y A;  5D9T A;  3UMA A;  2ON7 A;  1A23 A;  1EOG A;  4K7N A;  5E4W A;  4MJB A;  2N5A A;  2H76 A;  1U3A A;  5CP1 A;  1LU4 A;  1T1V A;  5DCH A;  1XWC A;  2P5Q A;  2PER A;  4KF9 A;  2DJK A;  5A4V A;  5DAL A;  3UOM A;  1NM3 A;  2QA2 A;  2VL3 A;  4MZC A;  5BRT A;  3KXO A;  3MWH A;  2R37 A;  3G7J A;  2FCH A;  4HQS A;  4I97 A;  4HJ2 A;  1YKC A;  2O8V B;  2O87 A;  2YWI A;  2V6O A;  2K8V A;  3FY7 A;  11GS A;  4LL1 B;  1BAY A;  4FQU A;  1Z6N A;  2A2P A;  2PN8 A;  6GSW A;  1MEK A;  1GSQ A;  3FR9 A;  4QQ7 A;  5G1L A;  1FVK A;  2Z9S A;  4G0L A;  2WZ9 A;  4XS4 B;  5DAK B;  2H0G A;  4TR0 A;  1X9M B;  5ECS A;  2ZNM A;  2F8F A;  5ECK B;  1SYR A;  5J41 A;  1YDK A;  3BJ5 A;  1FB0 A;  1BX9 A;  2H1B A;  5A4U A;  2YJH A;  5KOX A;  4PUA A;  3D21 A;  2HYX A;  4I2U A;  5AIS A;  4ZL8 A;  2X64 A;  2TRC P;  4E8H A;  3ZLP A;  5GZZ B;  3GNJ A;  1X5D A;  1NW2 A;  4D73 B;  1ST9 A;  1TP9 A;  1F6M C;  2VCW A;  2DJ2 A;  3KP8 A;  1MTC A;  1KEB A;  1OKD A;  1ZL9 A;  3A2V A;  3KP9 A;  3KIJ A;  1ERV A;  3DEX A;  5KN2 A;  2IL3 A;  2LS5 A;  3O3T A;  5D93 A;  1AW9 A;  2HE3 A;  4MDC A;  1TRV A;  4PUF C;  3M3M A;  1HNB A;  1SU9 A;  2VD1 A;  2RM5 A;  2C3T A;  1EGR A;  1K0B A;  1OC9 B;  2PWJ A;  5AN1 A;  1OE7 A;  2PBJ A;  3J7Y b;  3GKM A;  1EP8 A;  2GSQ A;  3UL3 A;  3TJG A;  3D22 A;  3P8W A;  4X1U A;  1JHB A;  1XPV A;  2FWE A;  1TK5 B;  5IIZ A;  1X0R A;  1VRS D;  2C3Q A;  4JED A;  2CZ2 A;  2IPA A;  2JZT A;  4BL7 B;  2OA7 A;  2AV4 A;  2WUL A;  3EMP A;  5IM9 A;  2DIY A;  2MZC A;  1GWC A;  2D2Z A;  4KSO A;  1TRU A;  1EP7 A;  4ZIJ A;  3MAK A;  3CSI A;  3FYG A;  5DCG A;  3IPZ A;  4BVX B;  4YAP A;  2HZE B;  3QPM A;  1SYX A;  5INY A;  5KOW A;  2HRA A;  3DRN A;  4MJA A;  3HXS A;  2LRN A;  2YWN A;  1JZW A;  1Y6E A;  4OFM A;  3RDW A;  3I6A A;  3GTU A;  3A5W A;  1SD8 A;  2XHF A;  4ZIL A;  3IK9 A;  1EV9 A;  1S3D A;  1TU8 A;  2LTK A;  3FRC A;  1N2A A;  1QMV A;  2YJ7 A;  4NHW A;  4ECB A;  2FD3 A;  2MMZ A;  3EE2 A;  1U87 A;  1PA3 A;  3RHC A;  2O85 A;  3F8U A;  2BTO T;  1YKA A;  2WGR A;  4ZBB A;  1THX A;  3A2W A;  1GSS A;  1VGL A;  4I2T A;  5JWQ B;  3O6T A;  4YKG A;  2I1U A;  4XRA A;  3UJ1 A;  4IBP A;  3TJF A;  2R3X A;  2DIZ A;  2GZP A;  1RW1 A;  3H4K A;  1PX6 A;  4WXT A;  4EDY A;  2LQQ A;  2GT6 A;  3WD6 A;  2X8G A;  2VL2 C;  2VLV A;  2L6C A;  4EE0 A;  1ON4 A;  2NTO A;  3F4R A;  4JRR A;  2CA8 A;  4LMV A;  4Q5F A;  2QKE A;  1YQ1 A;  2LNT A;  4NMU A;  1MDK A;  1K0C A;  1CQG A;  2B1K A;  4JZQ A;  3F4T A;  4F0B A;  4AJ6 A;  4Z2R A;  2A4H A;  5IPG A;  2L4C A;  4DEJ A;  1K0D A;  1AUC A;  4BPY A;  4BVY A;  3UVT A;  4N11 A;  2P0G A;  2HFD A;  1WRY A;  4ZBA A;  2J9H A;  3FR3 A;  2L4Q A;  4O92 A;  5G5E A;  2QC7 A;  2H6X A;  3QAV A;  4WR4 A;  4NWY A;  3CSJ A;  2IMK A;  1GUH A;  1TJD A;  3Q18 A;  4BWS A;  5HR3 A;  1K0M A;  3DML A;  1SKW B;  3KMO A;  5AIX A;  1O7U A;  4GLT A;  3MDK A;  1C72 A;  5F06 A;  1GTB A;  4GSN A;  3QDN A;  3I9V 2;  4O5R A;  3QFA C;  6GSY A;  2GVP A;  2FLS A;  4FYC A;  4MK3 A;  2JZR A;  4OWY A;  2RUF A;  1QQ2 A;  2JL4 A;  2RUE A;  1SJZ A;  3GH6 A;  2JZS A;  2YP6 A;  1GUM A;  3NZN A;  3RBT A;  3VWX A;  1T4Z A;  2V2G A;  2YCD A;  4POM A;  1NSW A;  1MDJ A;  1Z9H A;  4HOJ A;  1FW1 A;  5CO3 A;  4MZB A;  1HYU A;  4Q5Q A;  1GSY A;  5GAP D;  4I6X A;  4F0C A;  4LMW A;  4X0X A;  4CHS A;  3UAR A;  3TKP A;  4V2N A;  2WJU A;  3TKR A;  1KNG A;  2OE3 A;  3ME8 A;  4MA9 A;  4NV5 A;  4KW6 A;  1GH2 A;  2L5L A;  3QR6 A;  3ZTL A;  3GX8 A;  3TOT A;  1O8X A;  2I9H A;  2N5F A;  4EXJ A;  4AF2 A;  6GST A;  4OMV A;  3SWL A;  5G30 A;  1GRX A;  2TIR A;  4GTU A;  2CVD A;  2B7K A;  1M2A A;  2PVQ A;  4IHU A;  5H5Q A;  1F3A A;  1K3Y A;  2LQO A;  4K1F A;  2B6M A;  1TK0 B;  2CX3 A;  2OJL A;  2LKU A;  4GCI A;  5GST A;  4N10 A;  2HRK A;  5DAL B;  5ECM B;  13GS A;  1FB6 A;  1X9W B;  2I4A A;  3DWV A;  1EV4 A;  2IMI A;  3EU3 A;  3ERW A;  3IK7 A;  5DJL A;  2F8A A;  5IPH A;  1B48 A;  5G2Z A;  1OC8 A;  2CT6 A;  3HHV A;  4TXV A;  5IMV A;  4KAE A;  4KND A;  1AAZ A;  2IWT A;  1FOH A;  4HQZ A;  1F3B A;  3HKR A;  1XVW A;  3GMF A;  2YZU A;  1GSD A;  3LWA A;  1F2E A;  3M8N A;  1H4O A;  1B8X A;  4ZB9 A;  3KEB A;  1R5P A;  2VO4 A;  5IOW A;  3CRT A;  5CAX A;  1TKD B;  1O85 A;  2DC5 A;  1XFL A;  2L59 A;  3TKQ A;  5DVB A;  4MF5 A;  4MP4 A;  4GRF A;  1A8Y A;  2KLX A;  1G0T A;  1PKW A;  4FO5 A;  3PGT A;  4MH3 A;  1K0A A;  5F0G A;  4F2I A;  3HA9 A;  1EZK A;  1SKR B;  1TTZ A;  4KDX A;  4AJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...