3VWVA

Crystal structure of n-terminally truncated peroxiredoxin 4 from m. musculus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
182
structure length
182
Chain Sequence
HHSSGLVPRGSHMPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin-4
publication title Synergistic cooperation of PDI family members in peroxiredoxin 4-driven oxidative protein folding
pubmed doi rcsb
source organism Mus musculus
total genus 54
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vwvA00
4DEJA 2FGXA 4GF0A 2IMFA 5JCGA 5GAND 3TJKA 1GP1A 3DEXA 2E2GA 1GLQA 4POKA 4ZB9A 2XC2A 1O73A 4AJ8A 1PQNA 1GSDA 1TRVA 4YAVA 4PUAA 5KEJA 4PXOA 5HFGA 2HXKA 4N0ZA 4P3YB 1ERVA 5G1LA 5IO2A 5ID2B 5ECNB 3EURA 3FRCA 4WXTA 1LBKA 3E0UA 1EP8A 4TW5A 3J7Yb 1J0FA 4N0VA 5JWOB 4MF5A 1DE2A 2V2GA 3IK7A 2DMMA 4GCIA 5J9CA 5ECRB 4OCFA 3E9JB 4ZBAA 3VI5A 3GKXA 1V2AA 1M7TA 1CQGA 4D73B 3W6GA 1SKWB 2HZEA 2RM5A 1QFNA 4XRAA 1SK1A 1M9BA 2HZFA 4DSQA 2HFDA 2QSIA 3VWUA 2G0FA 1JLVA 3UVTA 2KLXA 1RW1A 1TU7A 3RBTA 1PKWA 3GHAA 4KA0A 2K9FA 1HD2A 1R26A 3GRXA 3I43A 3ISOA 3ERGA 1NM3A 2B6MA 1J9BA 3ZTLA 3IAS2 3EU3A 3KH9A 2LEGA 2X8GA 4WBJA 5IM9A 1AQVA 1OVNA 2C0EA 3BCKA 5ECOB 5AIXA 1DBYA 2H1BA 1O81A 4TKYA 2OKAA 2VLVA 3IV4A 3V1WA 2IMDA 4MZBA 4WF5A 3BCIA 4YQVA 1JFUA 2GGTA 3IOSA 3EWLA 2LQOA 5GSSA 4ZBBA 1YQ1A 3HVXA 5EPFA 2RLIA 5H5SA 4PQ1A 1V9WA 1MD3A 2EIRA 3TDGA 1Y25A 3UBLA 4V1Ap 2AJQB 3N9JA 1XVQA 3HXSA 5AGYA 4HJ2A 3KCMA 3QAGA 1R5AA 1KTEA 5DAKB 2IMIA 1A8LA 4DSSB 2L6CA 4CHSA 1GSSA 4G10A 2TRCP 4L5OA 1XWGA 5DJLA 3TKSC 2WCIA 1PL1A 4MZWA 5ID2A 1XW9A 3KGKA 1XVWA 3WT2A 5DCGA 5J41A 3KIJA 2XPDA 2MMNA 3O6TA 4NPBA 5CRDA 1T8EB 3CSHA 2HT9A 2LS5A 5ELGA 3ZIJA 4TXOB 4KGIA 3MSZA 4ZBDA 19GSA 4D73A 4MDCA 2M46A 2X64A 3TJFA 4HZ4A 1XCCA 3NOFA 3GX8A 1SK0A 4KSOA 1EOHA 3IPZA 2GQKA 1QMVA 4TOPA 2I1UA 1SD9A 4YH2A 2FY6A 2ZCTA 1A2LA 3LXTA 1V98A 4JR4A 2GDRA 1EEJA 1QQ2A 4KB3A 3EMPA 3WGEA 2QC7A 5F07A 1TRSA 3C7MA 2HYXA 2Z9SA 2CZ2A 2PU9C 4EDYA 1GSYA 1ZYQB 4POLA 4L0WA 4GSTA 5CNWA 4FH8A 3D6IA 4K7NA 1PD21 3E3EA 1VF3A 4MPGA 3A5WA 2R6KA 1SKSB 3O3TA 1X9WB 3F4TA 6GSXA 1T1VA 3KZQA 2DLXA 2VLUA 2FCHA 4O5RA 5IMFA 4KE3A 1ERWA 4MPFA 3QAWA 3RHBA 1YEPA 2LKUA 3VPQA 1G0TA 2F8AA 4GRFA 5DAKA 4LL4B 1SYRA 1BX9A 4IS0A 3RAZA 2FWGA 2RUFA 2XHFA 1BEDA 4BPYA 5E4WA 3BD2A 2REMA 2A4VA 4MH2A 3MNGA 2D2ZA 2WZ9A 4POBA 2DMLA 2C3NA 5AN1A 2DJKA 3DVXA 4TXOA 4NXIA 4XIHA 3VLNA 2IJYA 2P0GA 3UMAA 1M2BA 2I3YA 1BAYA 3CRTA 4OFTA 3H1NA 2DSAA 2F8FA 1YKAA 2XPEA 4KX4A 4IHUA 3IAM2 3D4TA 4EC0A 1LJRA 2DJ0A 2YOIA 5DVBA 5F0GA 3HA9A 2RUEA 1TXXA 4NHZA 2LNTA 4EO3A 2C4JA 1OKDA 5HR3A 1JZRA 2MMAA 3G7YA 2O87A 2JADA 3DIEA 4K8MA 5G31A 8GSSA 3UL3A 1WJKA 2VL2C 3C8EA 1SJ6A 14GSA 4I6XA 1A2MA 1PSQA 4Q5RA 4AJ7A 2H75A 2WS2A 1JHBA 5AISA 1A8YA 4IN0A 1AC1A 2PPTA 2K6VA 3IBHA 4LLRA 5COHA 2DC5A 2H1DA 4RI6A 1JZOA 1EWXA 3WGXA 2B5EA 3FK8A 4G9HA 1MDJA 3FR3A 4CDOA 1FOVA 4TXVA 3M9JA 3L0HA 1XFLA 2YPMA 1FO5A 1R4WA 2KUCA 3ZL5A 1YKCA 4ML6A 2N5AA 4IBPA 3D22A 2CA8A 2YP6A 1KEBA 2NTOA 4KDUA 2LJKA 4JBBA 3LFLA 3TRPA 5GAPD 1MD4A 4FYCA 2N5BA 2MZCA 1B8XA 3HJMA 4ILFA 1WRYA 3IRAA 2PWJA 5KN3A 1GH2A 4HQSA 2X99A 4MMMA 4J2FA 5DQSA 1Q4JA 2H0GA 2VD1A 5DJMA 1URMA 1PX6A 2HRNA 4WKWA 2IMEA 3LG6A 3KP8A 2JZRA 4MH3A 2YZHA 3HCZA 4KSMA 3D21A 2H74A 4BWQA 1THOA 1XZOA 3APQA 1K0DA 3WT1A 4XCSA 4GSNA 1B9XC 3CSIA 5IMAA 3M9KA 2C3TA 2YN1A 4IQ1A 1EGOA 3QDNA 3GYKA 3EYTA 2L59A 3DKSA 4N10A 5DCHA 1ZYEA 2I4AA 3F6DA 4ECJA 3F63A 2GZYA 4OD7A 5J3RA 3DYRA 1PX7A 1YEXA 3ME7A 4KDXA 2OE1A 1EV4A 3GKKA 3GKMA 3P8WA 3WD6A 2QKEA 3IDVA 2X8CA 3D5JA 6GSYA 3SWLA 2VM2A 1GNEA 2DBCA 2VCQA 3C1SA 4EVMA 1WE0A 2GT6A 3QD9A 1I9DA 3HVSA 4G19A 3LORA 4WETA 1V57A 4HJMA 2WFCA 2CVKA 2FUG2 1X5DA 1FB0A 9GSSA 2YCDA 1ZGNA 2FWHA 1OE8A 5INYA 1PGTA 3APOA 3F6FA 4XHMA 5J9BA 1U6TA 5GSTA 4L5LA 3NIVA 4RQRA 3QR6A 2WRTA 2K18A 1F9MA 2PUKC 2AHEA 1B48A 5L71A 1A0FA 4X1UA 2R37A 4MF6A 4NHWA 6GSVA 4FO5A 2VCVA 1TJDA 1XWKA 3ZITA 5A4WA 1SKRB 1C72A 2DJ3A 3TOTA 2H70A 3F3RA 4MJCA 3UJ1A 2GVPA 2O7KA 2FWEA 4ZXGA 4WR5A 2FLSA 5CRGA 5J5NA 1OC8A 4TN8A 4MP4A 1Z9HA 5HR1A 3F4SA 3DGQA 2JL4A 2H0HA 1FVKA 1HNBA 2GSTA 1FVJA 5DALB 3TB2A 3IXRA 5CAXA 1VF1A 1B9YC 2M72A 5C00A 2MBTA 2KOKA 5A5KA 3L9SA 4IW9A 2F51A 3G7IA 1DSBA 3ED3A 4GSSA 4EXJA 3VFIA 4F0BA 1X5CA 5C04A 2AV4A 4PX1A 1XIYA 1M9AA 2QGVA 5IPHA 3KD0A 4LL1B 1A23A 2H8LA 1Z5YE 1SL0B 3FEUA 2BMXA 4HEA2 5H5QA 2R5GA 2LV3A 2O85A 4DSRA 2EC4A 4E8EA 3ZREA 6GSUA 4BVXA 2YJHA 3M3MA 3UBKA 1IYIA 1F2EA 3FW2A 5G2ZA 2CQ9A 2M80A 4EDZA 2CZ3A 5G5EA 4K7IA 2J9HA 3IHQA 1S3CA 4RQXA 2CX4A 4KDYA 5G5FA 2IPAA 1SYXA 2KHPA 2DIYA 2EIQA 1WPIA 2G2QA 4EKZA 2CVBA 3FR6A 4MJBA 4QL9A 3FZ5A 2OBIA 5KN1A 3U6VA 2OADA 4ACSA 3FKFA 3ZRDA 3RPPA 3TKSE 2HE3A 3QCPA 5EVOA 2H0IA 2OACA 1YY7A 3HVVA 3UIWA 3O76A 1F3AA 3Q6OA 1R7HA 5IO0A 1K0CA 1TK5B 3MDKA 3UEMA 1GUHA 2IFQB 5CP1A 3TRXA 2CT6A 3CXGA 1XWAA 5HR0A 3H4KA 3VWXA 2V41A 4HQZA 5IMCA 5ECQB 2OE0A 5JCWA 13GSA 2VM1A 3CTGA 4MJEA 5D8IA 3F0IA 3GUSA 1TI1A 2A2SA 3I6AA 4HOJA 2VIMA 2GSRA 4IP1A 2TIRA 3LYPA 2VCWA 3S9FA 2HI7A 3ERFA 2PERA 5IOWA 2NPBA 2C0GA 2ALBA 4F9ZA 3US3A 3FR9A 2B5YA 2KP2A 2CVDA 2H30A 3ZVJD 2JACA 4HU9A 5CREA 1PN9A 4I2UA 1VF4A 5FT3A 1WOUA 2PBJA 2F3MA 3GV1A 4BA7A 3M0FA 1S3DA 2CAQA 2H71A 2NBSA 1Z6MA 1GUMA 3RDWA 2B7JA 2I9HA 3QOUA 3TOUA 5D73A 5F05A 1AQWA 3GNJA 11GSA 1THXA 5F06A 2PGTA 5IIZA 4GWRA 2LRNA 2C0DA 4EF0A 1AUCA 4DSSA 1HNCA 1XBSA 1JLWA 1RK4A 2H19A 3DD3A 3QFAC 2LJAA 1VGLA 1ML6A 4ZIJA 4IKHA 2MBSA 2H01A 2LTKA 3GN3A 3A2XA 1SD8A 4MZCA 4LMVA 1O6JA 4F03A 3KMOA 3KH7A 4ID0A 1TRWA 2C3QA 3A3TA 2YJ7A 2B5XA 3TKRA 2B1KA 1RQMA 5ECKB 1PA3A 4NWYA 1I5GA 10GSA 1M0UA 4IJ3A 1A0RP 4ISDA 4MK3A 4JU5A 5LNKe 2YWIA 4IVFA 1A24A 12GSA 2MYGA 2IFQA 1H4OA 1NSWA 2AAWA 2WGRA 3IC4A 5ECMB 5F8BA 1W89A 1PMTA 1CQHA 5B8AA 1EZKA 1GTIA 2C0FA 1ZZYA 1TW9A 2V1MA 1B4QA 2YWOA 3FZ9A 3G9BA 5J4UA 1WMJA 1W4VA 4FIWA 1O8WA 2E2MA 3IK9A 2YZUA 3N5OA 4ECBA 2NVLA 3CMIA 3FYGA 2JSZA 4MLYA 2LRCA 5B6MA 4ECCA 1VRSD 1BQ7A 2DIZA 1HNAA 4KW6A 1UN2A 5ELAA 3A2WA 5IMDA 1EEMA 1T7PB 3HJOA 4IP6A 1AXDA 2C8UA 5DDLA 1FW1A 1Q98A 1UA5A 3DXBA 2GLRA 4OFNA 3TGZA 3HZ4A 5HFKA 4TR3A 2H1AA 1HYUA 2V6OA 4GQFA 2DJ1A 2VCTA 1O85A 2B7KA 3F4RA 2GQLA 1U88A 5AIVA 3ZMLA 2LJRA 4TVEA 3RHCA 2H6XA 1K3LA 2VLTA 3FZ4A 1O7UA 5ECHB 1XOAA 2IL3A 3P90A 5D9TA 5IQYA 1G7EA 3KJYA 1NHOA 4K7OA 2L5LA 5LD0A 1VF2A 1JZDA 20GSA 2FA4A 3KEBA 2E0QA 1FB6A 2O89A 3EC3A 4OCEA 3GSTA 1N8JA 2AB6A 2PVQA 1GTUA 3QAVA 3HDCA 4Q5FA 1Z3EA 3CSJA 2WB9A 4K0GA 4H86A 2JZTA 2YANA 4MABA 4O92A 2ZUPA 2LUSA 2H1GA 1BYEA 1K0OA 4V2NA 1SL2B 1HQOA 2B1LA 3TJBA 1XXUA 1Y6EA 1AIUA 3ZVJA 2FA8A 2LRTA 3EE2A 3GH6A 3KP9A 3L9VA 4I2TA 1EGRA 5HR2A 5IMVA 1BJXA 3GMFA 2K8VA 3GSSA 2FWFA 3ME8A 1QUWA 2XBQA 6GSSA 4WF4A 4QL7A 4CW9A 1GTAA 4WR4A 5A4UA 3ZLPA 1X9MB 1GLPA 4ECIA 3ZIVA 1G6YA 3TUEA 1DUGA 1M2AA 5D9WA 5DQYA 1ACVA 4HU7A 4ZL9A 1SK2A 3NZNA 1G7OA 2YNXA 4BWSA 2H73A 3EMXA 3DVWA 4V2MA 4BL7A 1TP9A 1PKZA 4IGJA 4X43A 4K2DA 3GL5A 2O8VB 2BTOT 4XS4B 2VOCA 1X0RA 5KN2A 4KUNA 2R3XA 5CRHA 2HNLA 5EL8A 4TRXA 2PN8A 1F37A 1GNWA 2VL9A 3EVIA 4BVYA 1QXHA 3VWWA 3EU4A 1FG4A 1OKTA 2X8HA 16GSA 1USBA 1GUKA 4ZB6A 4PQIA 4N11A 3P7XA 2YV9A 1GTBA 3HKRA 2AUVA 2V32A 1GWCA 3C1RA 3UOMA 1LU4A 1YJ6A 18GSA 2GT5A 4MF7A 1ZCPA 3HYPA 4HS1A 3LXZA 2HSHA 1KNGA 5A4VA 1SU9A 1K3OA 2YWMA 3CTFA 5ECSA 2MMZA 2JSYA 1BG5A 3PH9A 3LYKA 2CX3A 1E2YA 2VAFA 4MA9A 5ENUA 5CYYA 4GXZA 1OYJA 1T00A 3F9UA 1G6WA 5ECPB 1M99A 4LA1A 4IELA 4TR1B 2FNOA 1S3AA 4J57E 3FZAA 1YF0A 4KAEA 1E6BA 5D9VA 3UARA 3TKQA 5E59A 4HI7A 4Q5NA 2HSYA 4RUVA 1EP7A 5B6NA 4GQCA 3Q74A 2L4QA 2CV4A 3VI7A 3FHKA 3GA4A 4PUFC 4JEDA 1FAAA 3GKNA 3Q18A 3GTUB 2I81A 4XS1A 1ON4A 4Z7XA 7GSSA 4PNGA 3H93A 1SJZA 1J08A 3LWAA 1U3IA 4LMWA 4QQ7A 3LEFA 1QGVA 1H75A 1X9SB 4GLTA 2H6YA 2MMOA 1T4ZA 3UVHA 2FD3A 1TU8A 5G30A 2C80A 4MCUA 3TJJA 3DMLA 2P5RA 2ON7A 4O32A 4XS4A 2VCZA 1TDIA 1A2JA 3HHVA 4K6XA 4X0XA 1Z7RA 1TI3A 2OJLA 3TJGA 1ZOFA 4HUAA 1Z7PA 1AW9A 4NV5A 3W8JA 1AAZA 4K9ZA 4I5QA 2DJ2A 1U3AA 3BOAA 4KCEA 2JU5A 4OO5A 1K0BA 2R2JA 3ERWA 2PVOC 1T3BA 5G1KA 3QPMA 3H8QA 4KNDA 1ABAA 2R4VA 3RPNA 4GTUA 1GULA 3DWVA 1ERTA 2AYTA 4MJAA 3U5RE 5JWRB 3GURA 2B3SA 3LSZA 1TRUA 1XOBA 2FHEA 3IE3A 5FWGA 1N2AA 4AJ6A 2IMKA 4ULXA 4HZ2A 4HDEA 3I9V2 2LNSA 4I97A 4V1Ag 3M8NA 3QFBC 1NHYA 1NW2A 5H5RA 3TKPA 1EV9A 4TR1A 3FY7A 1ST9A 3F8UA 1OE7A 2WDUA 2VL3A 3ZZXA 2OBKA 5DALA 5JWQB 3QMXA 3KM6A 3D4MA 1JZWA 1XWBA 3EINA 2ZNMA 4WBRD 5D9XA 3HY2A 3OR5A 1IYHA 1F3BA 2P31A 3G7JA 4ZILA 3PR8A 3LQ7A 3F3QA 3LJRA 1ZMAA 3GTUA 1O8XA 1R5PA 2YV7A 4J56E 3HZ8A 4PGTA 1K0AA 4KH7A 2J23A 4TR4A 2LSTA 4EUYA 2V6KA 2IWTA 2VD0A 1GSUA 2H72A 6GSTA 1X5EA 1KBNA 4PQHA 4ML1A 1YF1A 4O7HA 5DBQA 4PURA 3LGCA 2H6ZA 2GS3A 4JE1A 4IQAA 4G2EA 2WJUA 4XS6A 3GFKA 4PNFA 3VURA 4AF2A 4L8EA 3KTBA 1ZL9A 4E8HA 2VUPA 5HQPA 2RIIA 1MDIA 1MDKA 2L6DA 1B4PA 4I8BA 3WYWA 4YQMA 1TTZA 1PRXA 2H76A 2TRXA 4XRDA 1YZXA 3L78A 1SL1B 3TKSA 4IJIA 1AQXA 3PGTA 3MWHA 3TCOA 1TKDB 3VK9A 5JCUA 22GSA 3M1GA 2XBIA 1MEKA 1UVZA 2GSQA 1ERUA 3CYNA 3DRNA 3APSA 2DJJA 2GZPA 2A2RA 4F2IA 3UAPA 2L4CA 4JR6A 1GSEA 4NV2A 3L4NA 1K0NA 4F0CA 2LQQA 4NMUA 1F6MC 4POMA 2HLSA 1SJIA 1K3YA 3KMNA 1YDKA 3VPTA 1TK0B 2ES7A 4NAXA 5CO3A 4FYBA 1WIKA 4OWYA 4F82A 3WGDA 2L57A 5IOXA 1GRXA 5FHIA 5LCZA 3KXOA 1U87A 3GX0A 1OC9B 1GL8A 4EL1A 3J7Yk 3H79A 3GIXA 5HFIA 3CBUA 2OE3A 3ZFLA 2GSSA 5ECIB 2GZZA 4ZL7A 4WEYA 1OAZA 3PINA 1FHEA 3BBYA 4ZL8A 2VO4A 3IR4A 2GQMA 1OC3A 5D93A 3MAKA 2WULA 2ON5A 3I69A 1GSFA 1V40A 1WP0A 5CRWA 4RI7A 1EOGA 2H66A 2N5FA 3Q19A 4OMVA 3L9UA 1QK8A 5IPGA 4YQUA 3D0ZA 1XW6A 3BJ5A 5B8BA 1GSQA 4L0UA 3JCML 3GH9A 3TRQA 5D96A 6GSWA 2P5QA 4V2LA 5IMZA 2L5OA 4EE0A 2NDOA 4XTSA 3ZMKA 1UC7A 1ILOA 3K8NA 1K0MA 2OA7A 2E7PA 4AGSA 3ZFBA 3P2AA 3C71A 4JZQA 4FYUA 1WWJA 5ABRA 4K0NA 1V58A 3SBCA 5EY6A 3IA1A 2HZEB 4N30A 1XW5A 1XPVA 2K8SA 3HJPA 1DE1A 2JZSA 2HRFA 2YWNA 3ZYWA 2RM6A 4OFMA 2CAIA 5GZZB 2BJXA 2IN3A 3HD5A 2GTUA 2PMTA 1PL2A 3GL3A 4JRRA 2IIYA 3C73A 3KTLA 1SENA 3AY8A 4Q5QA 2VL2A 1M2DA 2F9SA 17GSA 1OC9A 4KCAA 1Z6NA 3VWVA 3A2VA 4YAPA 5B7CA 2C1YA 3W8SA 1XWCA 2EIOA 1MTCA 4ZB8A 1TOFA 3R2QA 4K1FA 3CRUA 4DVCA 1T4YA 5ECLB 1TK8B 5KN0A 2KP1A 2VCXA 4TR0A 4OO4A
chains in the Genus database with same CATH superfamily
4DEJA 2FGXA 4GF0A 2IMFA 5JCGA 5GAND 3TJKA 1GP1A 3DEXA 2E2GA 1GLQA 4POKA 4ZB9A 2XC2A 1O73A 4AJ8A 1PQNA 1GSDA 1TRVA 4YAVA 4PUAA 5KEJA 3LW9A 4PXOA 5HFGA 2HXKA 4N0ZA 4P3YB 1ERVA 5G1LA 5IO2A 5ID2B 5ECNB 3EURA 3FRCA 4WXTA 1LBKA 3E0UA 1EP8A 4TW5A 3J7Yb 1J0FA 4N0VA 5JWOB 4MF5A 1DE2A 2V2GA 3IK7A 2DMMA 4GCIA 5J9CA 5ECRB 4OCFA 3E9JB 4ZBAA 3VI5A 3GKXA 1V2AA 1M7TA 1CQGA 4D73B 3MIXA 3W6GA 1SKWB 2HZEA 2RM5A 1QFNA 4XRAA 1SK1A 1M9BA 2HZFA 1M3IA 4DSQA 2HFDA 2QSIA 3VWUA 2G0FA 1JLVA 3UVTA 2KLXA 1RW1A 1TU7A 3RBTA 1PKWA 3GHAA 4KA0A 2K9FA 1HD2A 1R26A 3GRXA 3I43A 3ISOA 3ERGA 1NM3A 2B6MA 1J9BA 3ZTLA 3IAS2 3EU3A 3KH9A 2LEGA 2X8GA 4WBJA 5IM9A 1AQVA 1OVNA 2C0EA 3BCKA 5ECOB 5AIXA 1DBYA 2H1BA 1O81A 4TKYA 2OKAA 2VLVA 3IV4A 3V1WA 2IMDA 4MZBA 4WF5A 3BCIA 4YQVA 1JFUA 2GGTA 3IOSA 3EWLA 2LQOA 5GSSA 4ZBBA 1YQ1A 3HVXA 5EPFA 2DKIA 2RLIA 1XG8A 5H5SA 4PQ1A 1V9WA 1MD3A 2EIRA 3TDGA 1Y25A 3UBLA 4V1Ap 2AJQB 3N9JA 1XVQA 3HXSA 5AGYA 4HJ2A 2HSMA 3KCMA 3QAGA 1R5AA 1KTEA 5DAKB 2IMIA 1A8LA 4DSSB 2L6CA 4CHSA 1GSSA 4G10A 2TRCP 4L5OA 1XWGA 4HSCX 5DJLA 4O5QA 3TKSC 4X4JA 2WCIA 1PL1A 4MZWA 5ID2A 1XW9A 3KGKA 1XVWA 3WT2A 5DCGA 5J41A 4K5RA 3KIJA 2XPDA 2MMNA 3O6TA 4NPBA 5CRDA 1T8EB 3CSHA 2HT9A 2LS5A 5ELGA 3ZIJA 4TXOB 4KGIA 3MSZA 4ZBDA 19GSA 4YKGA 4D73A 4MDCA 2M46A 2X64A 3TJFA 4HZ4A 1XCCA 3NOFA 3GX8A 1SK0A 4KSOA 1EOHA 3IPZA 2GQKA 1QMVA 4TOPA 2I1UA 1SD9A 4YH2A 2FY6A 4USSA 2ZCTA 1A2LA 3LXTA 1V98A 4JR4A 2GDRA 1EEJA 1QQ2A 3A5IA 4KB3A 3EMPA 3WGEA 2HRKA 2QC7A 5F07A 1TRSA 3C7MA 2HYXA 2Z9SA 2CZ2A 2PU9C 4EDYA 1GSYA 1ZYQB 4POLA 4L0WA 4MNNA 4GSTA 5CNWA 4FH8A 1PFOA 4EIPA 3D6IA 4K7NA 1PD21 3E3EA 1VF3A 4MPGA 3A5WA 2R6KA 1SKSB 3O3TA 1X9WB 3F4TA 6GSXA 1T1VA 3KZQA 2DLXA 2VLUA 2FCHA 4O5RA 5IMFA 4KE3A 1ERWA 4MPFA 3QAWA 3RHBA 1YEPA 2LKUA 3VPQA 1G0TA 2F8AA 4GRFA 5DAKA 4LL4B 3EPTA 1SYRA 1BX9A 4IS0A 3RAZA 2FWGA 2RUFA 2XHFA 1BEDA 4BPYA 5E4WA 3BD2A 2REMA 2A4VA 4MH2A 3MNGA 2D2ZA 2WZ9A 4POBA 2DMLA 1FOHA 2C3NA 5AN1A 2DJKA 3DVXA 4TXOA 4NXIA 4XIHA 3VLNA 2IJYA 2P0GA 3UMAA 1M2BA 2I3YA 4G0LA 1BAYA 3CRTA 4OFTA 3H1NA 2DSAA 2F8FA 1YKAA 2XPEA 4KX4A 4IHUA 3IAM2 3D4TA 4EC0A 4Z2TA 1LJRA 2DJ0A 2YOIA 5DVBA 5F0GA 3HA9A 2RUEA 1TXXA 4NHZA 2LNTA 4EO3A 2C4JA 1OKDA 5HR3A 1JZRA 2MMAA 3G7YA 2O87A 2JADA 3DIEA 4K8MA 5G31A 8GSSA 3UL3A 1WJKA 2VL2C 3C8EA 1SJ6A 14GSA 4I6XA 1A2MA 1PSQA 4Q5RA 2R0CA 4AJ7A 2H75A 2WS2A 1JHBA 5AISA 1A8YA 4IN0A 1AC1A 2PPTA 2K6VA 5KOXA 3IBHA 4LLRA 5COHA 2DC5A 2H1DA 4RI6A 1JZOA 1EWXA 3WGXA 2B5EA 3FK8A 4G9HA 1MDJA 3FR3A 4CDOA 1FOVA 4TXVA 3M9JA 3L0HA 1XFLA 2YPMA 1FO5A 1R4WA 2KUCA 3ZL5A 1YKCA 4ML6A 2N5AA 4IBPA 3D22A 2CA8A 2YP6A 1KEBA 2NTOA 4KDUA 2LJKA 4JBBA 3LFLA 3TRPA 5GAPD 1MD4A 4FYCA 2N5BA 2MZCA 1B8XA 3HJMA 4ILFA 1WRYA 3IRAA 2PWJA 4O5UA 5KN3A 1GH2A 4HQSA 2X99A 4MMMA 4J2FA 3R3EA 5DQSA 1Q4JA 2H0GA 2VD1A 5DJMA 3IC8A 1URMA 1PX6A 2HRNA 4WKWA 2IMEA 3LG6A 3KP8A 4CY6A 2JZRA 4MH3A 2YZHA 3HCZA 4KSMA 3D21A 2H74A 4BWQA 1THOA 1XZOA 3APQA 1K0DA 3WT1A 4XCSA 4GSNA 1B9XC 3CSIA 5IMAA 3M9KA 2C3TA 2YN1A 4IQ1A 1EGOA 3QDNA 3GYKA 3EYTA 2L59A 3DKSA 4N10A 3IHGA 5DCHA 1ZYEA 2I4AA 2QA2A 3F6DA 4ECJA 3F63A 2GZYA 4OD7A 5J3RA 3DYRA 1PX7A 1YEXA 3ME7A 4KDXA 2OE1A 1EV4A 3GKKA 3GKMA 3P8WA 3WD6A 2QKEA 3IDVA 2X8CA 3D5JA 6GSYA 3SWLA 2VM2A 1GNEA 2DBCA 2VCQA 3C1SA 4EVMA 1WE0A 2GT6A 4BVXB 3QD9A 1I9DA 3HVSA 4G19A 3LORA 4WETA 1V57A 4HJMA 2WFCA 2CVKA 5BMUA 4K2XA 2FUG2 1X5DA 1FB0A 9GSSA 2YCDA 1ZGNA 2FWHA 1OE8A 5INYA 1PGTA 3APOA 3F6FA 4XHMA 5J9BA 1U6TA 5GSTA 4L5LA 3NIVA 4RQRA 3QR6A 2WRTA 2K18A 1F9MA 2PUKC 2AHEA 1B48A 5L71A 1A0FA 4X1UA 1M3JA 2R37A 4MF6A 4NHWA 6GSVA 4FO5A 2VCVA 1TJDA 1XWKA 3ZITA 5A4WA 1SKRB 1C72A 3MYDA 2DJ3A 3TOTA 2H70A 3F3RA 4MJCA 3UJ1A 2GVPA 2O7KA 2FWEA 4ZXGA 4WR5A 2FLSA 5CRGA 5J5NA 1OC8A 4TN8A 4MP4A 1Z9HA 5HR1A 3F4SA 3DGQA 2JL4A 2H0HA 1FVKA 2A4HA 1HNBA 4ICYA 3HVNA 2GSTA 1FVJA 5DALB 3TB2A 3IXRA 5CAXA 1VF1A 1B9YC 2M72A 5C00A 2MBTA 2KOKA 5A5KA 3L9SA 4IW9A 2F51A 3G7IA 1DSBA 3ED3A 4GSSA 4EXJA 3VFIA 4F0BA 1X5CA 5C04A 2AV4A 4PX1A 1XIYA 1M9AA 2QGVA 5IPHA 3KD0A 4LL1B 1A23A 2H8LA 1Z5YE 1SL0B 3FEUA 2BMXA 4HEA2 5H5QA 2R5GA 2LV3A 2O85A 4G0KA 4DSRA 2X49A 2EC4A 4E8EA 3ZREA 6GSUA 4BVXA 2YJHA 3M3MA 3UBKA 1IYIA 1F2EA 3FW2A 5G2ZA 2CQ9A 2M80A 4EDZA 1ZYPA 2CZ3A 5G5EA 4K7IA 2J9HA 3IHQA 1S3CA 4RQXA 2CX4A 4KDYA 5G5FA 2IPAA 1SYXA 2KHPA 2DIYA 2EIQA 1WPIA 2G2QA 4EKZA 2CVBA 3FR6A 4MJBA 4QL9A 3FZ5A 2OBIA 5KN1A 3U6VA 2OADA 4ACSA 3FKFA 3ZRDA 3RPPA 3TKSE 2HE3A 3QCPA 5EVOA 4PTSA 4Z2RA 2H0IA 2OACA 1YY7A 3HVVA 3UIWA 3O76A 1F3AA 3Q6OA 1R7HA 5IO0A 1K0CA 1TK5B 3MDKA 4FQUA 3UEMA 4CY8A 1GUHA 2IFQB 5CP1A 3TRXA 2CT6A 3CXGA 1XWAA 5HR0A 3H4KA 3VWXA 2V41A 4HQZA 5IMCA 5ECQB 2OE0A 5JCWA 13GSA 2VM1A 3CTGA 4MJEA 5D8IA 3F0IA 3GUSA 1TI1A 2A2SA 3I6AA 4HOJA 2VIMA 2GSRA 4IP1A 2TIRA 3LYPA 2VCWA 3S9FA 2HI7A 5BRTA 3ERFA 2PERA 5IOWA 2NPBA 2C0GA 2ALBA 4F9ZA 3US3A 3FR9A 2B5YA 2KP2A 2CVDA 2H30A 3ZVJD 2JACA 4HU9A 5CREA 1PN9A 4I2UA 1VF4A 5FT3A 1WOUA 2PBJA 2F3MA 3GV1A 4BA7A 3M0FA 1S3DA 2CAQA 2H71A 2NBSA 1Z6MA 1GUMA 3RDWA 2B7JA 2I9HA 3QOUA 3TOUA 5D73A 5F05A 1AQWA 3GNJA 11GSA 1THXA 5F06A 2PGTA 5IIZA 4GWRA 2LRNA 2C0DA 4EF0A 1AUCA 4DSSA 1HNCA 3FMWA 1XBSA 1JLWA 1RK4A 2H19A 3DD3A 3QFAC 2LJAA 1VGLA 1ML6A 4ZIJA 4IKHA 2MBSA 2H01A 2LTKA 3GN3A 3A2XA 1SD8A 4MZCA 4LMVA 1O6JA 4F03A 3KMOA 3KH7A 4ID0A 1TRWA 2C3QA 2HRAA 3A3TA 2YJ7A 2B5XA 3TKRA 2R0PA 2B1KA 1RQMA 5ECKB 1PA3A 4NWYA 1I5GA 10GSA 1M0UA 4IJ3A 1A0RP 4ISDA 4MK3A 5KOWA 4JU5A 5LNKe 2YWIA 4IVFA 1A24A 12GSA 2MYGA 2IFQA 1H4OA 1NSWA 2AAWA 2WGRA 3IC4A 5ECMB 5F8BA 1W89A 1PMTA 1CQHA 5B8AA 1EZKA 1GTIA 2C0FA 1ZZYA 1TW9A 2V1MA 1B4QA 2YWOA 3FZ9A 3G9BA 5J4UA 1WMJA 1W4VA 4FIWA 1O8WA 2E2MA 3IK9A 2YZUA 3N5OA 4ECBA 2NVLA 3CMIA 3FYGA 2JSZA 4MLYA 2LRCA 5B6MA 4Z2UA 4YKFA 4ECCA 1VRSD 4BL7B 1BQ7A 2DIZA 1HNAA 4KW6A 1UN2A 5ELAA 3A2WA 5IMDA 1EEMA 1T7PB 3HJOA 4IP6A 1AXDA 2C8UA 5DDLA 1FW1A 1Q98A 1UA5A 3DXBA 2GLRA 4OFNA 3TGZA 3HZ4A 5HFKA 4TR3A 2H1AA 1HYUA 2V6OA 4GQFA 2DJ1A 2VCTA 1O85A 2B7KA 4BVYB 3F4RA 2GQLA 1U88A 5AIVA 3ZMLA 2LJRA 4TVEA 3RHCA 2H6XA 1K3LA 2VLTA 3FZ4A 1O7UA 5ECHB 1XOAA 2IL3A 3P90A 5D9TA 5IQYA 1G7EA 3KJYA 3PPUA 1NHOA 4K7OA 2L5LA 5LD0A 1VF2A 1JZDA 20GSA 2FA4A 3KEBA 2E0QA 1FB6A 2O89A 3EC3A 4OCEA 3GSTA 1N8JA 2AB6A 2PVQA 1GTUA 3QAVA 3HDCA 4Q5FA 1Z3EA 3CSJA 2WB9A 4K0GA 4H86A 2JZTA 2YANA 4MABA 4O92A 2ZUPA 2LUSA 2H1GA 1BYEA 1K0OA 4V2NA 1SL2B 1HQOA 2B1LA 3TJBA 1XXUA 1Y6EA 1AIUA 3ZVJA 2FA8A 2LRTA 3EE2A 3GH6A 3KP9A 3L9VA 4I2TA 1EGRA 5HR2A 5IMVA 1BJXA 3GMFA 2K8VA 3GSSA 2FWFA 3ME8A 1QUWA 2XBQA 6GSSA 4WF4A 4QL7A 4CW9A 1GTAA 4WR4A 5A4UA 3ZLPA 1X9MB 1GLPA 4ECIA 3ZIVA 1G6YA 3TUEA 1DUGA 1M2AA 5D9WA 5DQYA 1ACVA 1ZYNA 4HU7A 4ZL9A 1SK2A 3NZNA 1G7OA 2YNXA 4BWSA 2H73A 3EMXA 3DVWA 4V2MA 4BL7A 1TP9A 4A5PA 1PKZA 4IGJA 4X43A 4K2DA 3GL5A 2O8VB 2BTOT 4XS4B 2VOCA 1X0RA 5KN2A 4KUNA 2R3XA 5CRHA 2HNLA 5EL8A 4TRXA 2PN8A 1F37A 2QA1A 1GNWA 2VL9A 3EVIA 4BVYA 1QXHA 3VWWA 3EU4A 1FG4A 1OKTA 2X8HA 16GSA 1USBA 1GUKA 4ZB6A 4PQIA 4N11A 3P7XA 2YV9A 1GTBA 3HKRA 2AUVA 2V32A 1GWCA 3C1RA 3UOMA 1LU4A 1YJ6A 18GSA 2GT5A 4MF7A 1ZCPA 3HYPA 4HS1A 3LXZA 2HSHA 1KNGA 5A4VA 1SU9A 1K3OA 2YWMA 3CTFA 5ECSA 2MMZA 2JSYA 2UZ8A 1BG5A 3PH9A 3LYKA 2CX3A 1E2YA 2VAFA 4MA9A 5ENUA 5CYYA 4GXZA 1OYJA 1T00A 3F9UA 1G6WA 5ECPB 1M99A 4LA1A 4IELA 4TR1B 2FNOA 1S3AA 4J57E 3FZAA 1YF0A 4KAEA 1E6BA 5D9VA 3UARA 3TKQA 5E59A 4HI7A 4Q5NA 2HSYA 4RUVA 1EP7A 5B6NA 4GQCA 3Q74A 2L4QA 2CV4A 3VI7A 3FHKA 3GA4A 4PUFC 4JEDA 1FAAA 3GKNA 3Q18A 3GTUB 2I81A 4XS1A 1ON4A 4Z7XA 7GSSA 4PNGA 3H93A 1SJZA 1J08A 3LWAA 1U3IA 4LMWA 4QQ7A 3LEFA 1QGVA 1H75A 1X9SB 4GLTA 2H6YA 2MMOA 1T4ZA 3UVHA 2FD3A 1TU8A 5G30A 2C80A 4MCUA 3TJJA 3DMLA 2P5RA 2ON7A 4O32A 4XS4A 2VCZA 1TDIA 1A2JA 3HHVA 4K6XA 4X0XA 1Z7RA 1TI3A 2OJLA 3TJGA 1ZOFA 4EIQA 4HUAA 1Z7PA 1AW9A 4NV5A 3W8JA 1AAZA 4K9ZA 4I5QA 2DJ2A 1U3AA 3BOAA 4KCEA 2JU5A 4OO5A 1K0BA 2R2JA 3ERWA 2PVOC 1T3BA 5G1KA 3QPMA 3H8QA 4KNDA 1ABAA 2R4VA 3RPNA 4GTUA 1GULA 3DWVA 1ERTA 2AYTA 4MJAA 3U5RE 5JWRB 3GURA 2B3SA 3LSZA 1TRUA 1XOBA 2FHEA 4K5SA 3IE3A 5FWGA 1N2AA 4AJ6A 2IMKA 4ULXA 4HZ2A 4HDEA 3I9V2 2LNSA 4I97A 4V1Ag 3M8NA 3QFBC 1NHYA 1NW2A 5H5RA 3TKPA 1EV9A 4TR1A 3FY7A 1ST9A 3F8UA 1OE7A 2WDUA 2VL3A 3ZZXA 2OBKA 5DALA 5JWQB 3QMXA 3KM6A 3D4MA 1JZWA 1XWBA 3EINA 2ZNMA 4WBRD 5D9XA 3HY2A 3OR5A 1IYHA 1F3BA 2P31A 3G7JA 4ZILA 3PR8A 3LQ7A 3F3QA 3LJRA 4BIKA 1ZMAA 3GTUA 1O8XA 1R5PA 2YV7A 4J56E 2X4AA 3HZ8A 4PGTA 1K0AA 4KH7A 2J23A 4TR4A 2LSTA 4EUYA 2V6KA 2IWTA 2VD0A 1GSUA 2H72A 6GSTA 1X5EA 1KBNA 4PQHA 4ML1A 1YF1A 4O7HA 5DBQA 4PURA 3LGCA 2H6ZA 2GS3A 4JE1A 4IQAA 4G2EA 2WJUA 4XS6A 3GFKA 4PNFA 3VURA 4AF2A 4L8EA 3KTBA 1ZL9A 4E8HA 2VUPA 2DKHA 5HQPA 2RIIA 1MDIA 1MDKA 2L6DA 1B4PA 4I8BA 3WYWA 4YQMA 1TTZA 1PRXA 2H76A 2TRXA 4XRDA 1YZXA 3L78A 1SL1B 3CQFA 3TKSA 4IJIA 1AQXA 3PGTA 3MWHA 3TCOA 1TKDB 3VK9A 5JCUA 22GSA 3M1GA 2XBIA 1MEKA 1UVZA 2GSQA 1ERUA 3CYNA 3DRNA 3APSA 2DJJA 2GZPA 2A2RA 4F2IA 3UAPA 2L4CA 4JR6A 1GSEA 4NV2A 3L4NA 1K0NA 4F0CA 2LQQA 4NMUA 1F6MC 4POMA 2HLSA 1S3RA 1SJIA 1K3YA 1PN0A 3KMNA 1YDKA 3VPTA 1TK0B 2ES7A 4NAXA 2R0GA 5CO3A 4FYBA 1WIKA 4OWYA 4F82A 3WGDA 2L57A 4G0IA 5IOXA 1GRXA 5FHIA 5LCZA 3KXOA 1U87A 3GX0A 1OC9B 1GL8A 4EL1A 3J7Yk 3H79A 3GIXA 5HFIA 3CBUA 2OE3A 3ZFLA 2GSSA 2A2PA 5ECIB 2GZZA 4ZL7A 4WEYA 1OAZA 3PINA 1FHEA 3BBYA 4ZL8A 2VO4A 3IR4A 2GQMA 1OC3A 5D93A 3MAKA 2WULA 2ON5A 3I69A 1GSFA 1V40A 1WP0A 5CRWA 4RI7A 1EOGA 2H66A 2N5FA 3Q19A 4OMVA 3L9UA 1QK8A 5IPGA 4YQUA 3D0ZA 1XW6A 3BJ5A 5B8BA 1GSQA 4L0UA 3JCML 3GH9A 3TRQA 5D96A 6GSWA 2P5QA 4V2LA 5IMZA 2L5OA 4EE0A 2NDOA 4XTSA 3ZMKA 1UC7A 1ILOA 3K8NA 1K0MA 2OA7A 2E7PA 4AGSA 3ZFBA 3P2AA 3C71A 4JZQA 4FYUA 1WWJA 5ABRA 4KF9A 4K0NA 1V58A 3SBCA 5EY6A 3IA1A 2HZEB 4N30A 1XW5A 1XPVA 2K8SA 3HJPA 1DE1A 2JZSA 2HRFA 2YWNA 3ZYWA 2RM6A 4OFMA 2CAIA 5GZZB 2BJXA 2IN3A 3HD5A 2GTUA 2PMTA 1PL2A 3GL3A 4JRRA 2IIYA 3C73A 3KTLA 1SENA 3AY8A 4Q5QA 2VL2A 1M2DA 2F9SA 17GSA 1OC9A 4KCAA 1Z6NA 3VWVA 3A2VA 4YAPA 5B7CA 2C1YA 3W8SA 1XWCA 2EIOA 1MTCA 4ZB8A 1TOFA 3R2QA 4K1FA 3CRUA 4DVCA 1T4YA 5ECLB 1TK8B 5KN0A 2KP1A 2VCXA 4TR0A 4OO4A
chains in the Genus database with same CATH topology
4DEJA 2FGXA 4GF0A 2IMFA 5JCGA 5GAND 3TJKA 1GP1A 3DEXA 2E2GA 1GLQA 4POKA 4ZB9A 2XC2A 1O73A 4AJ8A 1PQNA 1GSDA 1TRVA 4YAVA 4PUAA 5KEJA 3LW9A 4PXOA 5HFGA 2HXKA 4N0ZA 4P3YB 1ERVA 5G1LA 5IO2A 5ID2B 5ECNB 3EURA 3FRCA 4WXTA 1LBKA 3E0UA 1EP8A 4TW5A 3J7Yb 1J0FA 4N0VA 5JWOB 4MF5A 1DE2A 2V2GA 3IK7A 2DMMA 4GCIA 5J9CA 5ECRB 4OCFA 3E9JB 4ZBAA 3VI5A 3GKXA 1V2AA 1M7TA 1CQGA 4D73B 3MIXA 3W6GA 1SKWB 2HZEA 2RM5A 1QFNA 4XRAA 1SK1A 1M9BA 2HZFA 4DSQA 2HFDA 2QSIA 3VWUA 2G0FA 1JLVA 3UVTA 2KLXA 1RW1A 1TU7A 3RBTA 1PKWA 3GHAA 4KA0A 2K9FA 1HD2A 1R26A 3GRXA 3I43A 3ISOA 3ERGA 1NM3A 2B6MA 1J9BA 3ZTLA 3IAS2 3EU3A 3KH9A 2LEGA 2X8GA 4WBJA 5IM9A 1AQVA 1OVNA 2C0EA 3BCKA 5ECOB 5AIXA 1DBYA 2H1BA 1O81A 4TKYA 2OKAA 2VLVA 3IV4A 3V1WA 2IMDA 4MZBA 4WF5A 3BCIA 4YQVA 1JFUA 2GGTA 3IOSA 3EWLA 2LQOA 5GSSA 4ZBBA 1YQ1A 3HVXA 5EPFA 2DKIA 2RLIA 5H5SA 4PQ1A 1V9WA 1MD3A 2EIRA 3TDGA 1Y25A 3UBLA 4V1Ap 2AJQB 3N9JA 1XVQA 3HXSA 5AGYA 4HJ2A 2HSMA 3KCMA 3QAGA 1R5AA 1KTEA 5DAKB 2IMIA 1A8LA 4DSSB 2L6CA 4CHSA 1GSSA 4G10A 2TRCP 4L5OA 1XWGA 5DJLA 4O5QA 3TKSC 4X4JA 2WCIA 1PL1A 4MZWA 5ID2A 1XW9A 3KGKA 1XVWA 3WT2A 5DCGA 5J41A 4K5RA 3KIJA 2XPDA 2MMNA 3O6TA 4NPBA 5CRDA 1T8EB 3CSHA 2HT9A 2LS5A 5ELGA 3ZIJA 4TXOB 4KGIA 3MSZA 4ZBDA 19GSA 4YKGA 4D73A 4MDCA 2M46A 2X64A 3TJFA 4HZ4A 1XCCA 3NOFA 3GX8A 1SK0A 4KSOA 1EOHA 3IPZA 2GQKA 1QMVA 4TOPA 2I1UA 1SD9A 4YH2A 2FY6A 4USSA 2ZCTA 1A2LA 3LXTA 1V98A 4JR4A 2GDRA 1EEJA 1QQ2A 3A5IA 4KB3A 3EMPA 3WGEA 2HRKA 2QC7A 5F07A 1TRSA 3C7MA 2HYXA 2Z9SA 2CZ2A 2PU9C 4EDYA 1GSYA 1ZYQB 4POLA 4L0WA 4MNNA 4GSTA 5CNWA 4FH8A 4EIPA 3D6IA 4K7NA 1PD21 3E3EA 1VF3A 4MPGA 3A5WA 2R6KA 1SKSB 3O3TA 1X9WB 3F4TA 6GSXA 1T1VA 3KZQA 2DLXA 2VLUA 2FCHA 4O5RA 5IMFA 4KE3A 1ERWA 4MPFA 3QAWA 3RHBA 1YEPA 2LKUA 3VPQA 1G0TA 2F8AA 4GRFA 5DAKA 4LL4B 3EPTA 1SYRA 1BX9A 4IS0A 3RAZA 2FWGA 2RUFA 2XHFA 1BEDA 4BPYA 5E4WA 3BD2A 2REMA 2A4VA 4MH2A 3MNGA 2D2ZA 2WZ9A 4POBA 2DMLA 1FOHA 2C3NA 5AN1A 2DJKA 3DVXA 4TXOA 4NXIA 4XIHA 3VLNA 2IJYA 2P0GA 3UMAA 1M2BA 2I3YA 4G0LA 1BAYA 3CRTA 4OFTA 3H1NA 2DSAA 2F8FA 1YKAA 2XPEA 4KX4A 4IHUA 3IAM2 3D4TA 4EC0A 4Z2TA 1LJRA 2DJ0A 2YOIA 5DVBA 5F0GA 3HA9A 2RUEA 1TXXA 4NHZA 2LNTA 4EO3A 2C4JA 1OKDA 5HR3A 1JZRA 2MMAA 3G7YA 2O87A 2JADA 3DIEA 4K8MA 5G31A 8GSSA 3UL3A 1WJKA 2VL2C 3C8EA 1SJ6A 14GSA 4I6XA 1A2MA 1PSQA 4Q5RA 2R0CA 4AJ7A 2H75A 2WS2A 1JHBA 5AISA 1A8YA 4IN0A 1AC1A 2PPTA 2K6VA 5KOXA 3IBHA 4LLRA 5COHA 2DC5A 2H1DA 4RI6A 1JZOA 1EWXA 3WGXA 2B5EA 3FK8A 4G9HA 1MDJA 3FR3A 4CDOA 1FOVA 4TXVA 3M9JA 3L0HA 1XFLA 2YPMA 1FO5A 1R4WA 2KUCA 3ZL5A 1YKCA 4ML6A 2N5AA 4IBPA 3D22A 2CA8A 2YP6A 1KEBA 2NTOA 4KDUA 2LJKA 4JBBA 3LFLA 3TRPA 5GAPD 1MD4A 4FYCA 2N5BA 2MZCA 1B8XA 3HJMA 4ILFA 1WRYA 3IRAA 2PWJA 4O5UA 5KN3A 1GH2A 4HQSA 2X99A 4MMMA 4J2FA 3R3EA 5DQSA 1Q4JA 2H0GA 2VD1A 5DJMA 3IC8A 1URMA 1PX6A 2HRNA 4WKWA 2IMEA 3LG6A 3KP8A 4CY6A 2JZRA 4MH3A 2YZHA 3HCZA 4KSMA 3D21A 2H74A 4BWQA 1THOA 1XZOA 3APQA 1K0DA 3WT1A 4XCSA 4GSNA 1B9XC 3CSIA 5IMAA 3M9KA 2C3TA 2YN1A 4IQ1A 1EGOA 3QDNA 3GYKA 3EYTA 2L59A 3DKSA 4N10A 3IHGA 5DCHA 1ZYEA 2I4AA 2QA2A 3F6DA 4ECJA 3F63A 2GZYA 4OD7A 5J3RA 3DYRA 1PX7A 1YEXA 3ME7A 4KDXA 2OE1A 1EV4A 3GKKA 3GKMA 3P8WA 3WD6A 2QKEA 3IDVA 2X8CA 3D5JA 6GSYA 3SWLA 2VM2A 1GNEA 2DBCA 2VCQA 3C1SA 4EVMA 1WE0A 2GT6A 4BVXB 3QD9A 1I9DA 3HVSA 4G19A 3LORA 4WETA 1V57A 4HJMA 2WFCA 2CVKA 5BMUA 4K2XA 2FUG2 1X5DA 1FB0A 9GSSA 2YCDA 1ZGNA 2FWHA 1OE8A 5INYA 1PGTA 3APOA 3F6FA 4XHMA 5J9BA 1U6TA 5GSTA 4L5LA 3NIVA 4RQRA 3QR6A 2WRTA 2K18A 1F9MA 2PUKC 2AHEA 1B48A 5L71A 1A0FA 4X1UA 2R37A 4MF6A 4NHWA 6GSVA 4FO5A 2VCVA 1TJDA 1XWKA 3ZITA 5A4WA 1SKRB 1C72A 3MYDA 2DJ3A 3TOTA 2H70A 3F3RA 4MJCA 3UJ1A 2GVPA 2O7KA 2FWEA 4ZXGA 4WR5A 2FLSA 5CRGA 5J5NA 1OC8A 4TN8A 4MP4A 1Z9HA 5HR1A 3F4SA 3DGQA 2JL4A 2H0HA 1FVKA 2A4HA 1HNBA 4ICYA 2GSTA 1FVJA 5DALB 3TB2A 3IXRA 5CAXA 1VF1A 1B9YC 2M72A 5C00A 2MBTA 2KOKA 5A5KA 3L9SA 4IW9A 2F51A 3G7IA 1DSBA 3ED3A 4GSSA 4EXJA 3VFIA 4F0BA 1X5CA 5C04A 2AV4A 4PX1A 1XIYA 1M9AA 2QGVA 5IPHA 3KD0A 4LL1B 1A23A 2H8LA 1Z5YE 1SL0B 3FEUA 2BMXA 4HEA2 5H5QA 2R5GA 2LV3A 2O85A 4G0KA 4DSRA 2X49A 2EC4A 4E8EA 3ZREA 6GSUA 4BVXA 2YJHA 3M3MA 3UBKA 1IYIA 1F2EA 3FW2A 5G2ZA 2CQ9A 2M80A 4EDZA 1ZYPA 2CZ3A 5G5EA 4K7IA 2J9HA 3IHQA 1S3CA 4RQXA 2CX4A 4KDYA 5G5FA 2IPAA 1SYXA 2KHPA 2DIYA 2EIQA 1WPIA 2G2QA 4EKZA 2CVBA 3FR6A 4MJBA 4QL9A 3FZ5A 2OBIA 5KN1A 3U6VA 2OADA 4ACSA 3FKFA 3ZRDA 3RPPA 3TKSE 2HE3A 3QCPA 5EVOA 4PTSA 4Z2RA 2H0IA 2OACA 1YY7A 3HVVA 3UIWA 3O76A 1F3AA 3Q6OA 1R7HA 5IO0A 1K0CA 1TK5B 3MDKA 4FQUA 3UEMA 4CY8A 1GUHA 2IFQB 5CP1A 3TRXA 2CT6A 3CXGA 1XWAA 5HR0A 3H4KA 3VWXA 2V41A 4HQZA 5IMCA 5ECQB 2OE0A 5JCWA 13GSA 2VM1A 3CTGA 4MJEA 5D8IA 3F0IA 3GUSA 1TI1A 2A2SA 3I6AA 4HOJA 2VIMA 2GSRA 4IP1A 2TIRA 3LYPA 2VCWA 3S9FA 2HI7A 5BRTA 3ERFA 2PERA 5IOWA 2NPBA 2C0GA 2ALBA 4F9ZA 3US3A 3FR9A 2B5YA 2KP2A 2CVDA 2H30A 3ZVJD 2JACA 4HU9A 5CREA 1PN9A 4I2UA 1VF4A 5FT3A 1WOUA 2PBJA 2F3MA 3GV1A 4BA7A 3M0FA 1S3DA 2CAQA 2H71A 2NBSA 1Z6MA 1GUMA 3RDWA 2B7JA 2I9HA 3QOUA 3TOUA 5D73A 5F05A 1AQWA 3GNJA 11GSA 1THXA 5F06A 2PGTA 5IIZA 4GWRA 2LRNA 2C0DA 4EF0A 1AUCA 4DSSA 1HNCA 3FMWA 1XBSA 1JLWA 1RK4A 2H19A 3DD3A 3QFAC 2LJAA 1VGLA 1ML6A 4ZIJA 4IKHA 2MBSA 2H01A 2LTKA 3GN3A 3A2XA 1SD8A 4MZCA 4LMVA 1O6JA 4F03A 3KMOA 3KH7A 4ID0A 1TRWA 2C3QA 2HRAA 3A3TA 2YJ7A 2B5XA 3TKRA 2R0PA 2B1KA 1RQMA 5ECKB 1PA3A 4NWYA 1I5GA 10GSA 1M0UA 4IJ3A 1A0RP 4ISDA 4MK3A 5KOWA 4JU5A 5LNKe 2YWIA 4IVFA 1A24A 12GSA 2MYGA 2IFQA 1H4OA 1NSWA 2AAWA 2WGRA 3IC4A 5ECMB 5F8BA 1W89A 1PMTA 1CQHA 5B8AA 1EZKA 1GTIA 2C0FA 1ZZYA 1TW9A 2V1MA 1B4QA 2YWOA 3FZ9A 3G9BA 5J4UA 1WMJA 1W4VA 4FIWA 1O8WA 2E2MA 3IK9A 2YZUA 3N5OA 4ECBA 2NVLA 3CMIA 3FYGA 2JSZA 4MLYA 2LRCA 5B6MA 4Z2UA 4YKFA 4ECCA 1VRSD 4BL7B 1BQ7A 2DIZA 1HNAA 4KW6A 1UN2A 5ELAA 3A2WA 5IMDA 1EEMA 1T7PB 3HJOA 4IP6A 1AXDA 2C8UA 5DDLA 1FW1A 1Q98A 1UA5A 3DXBA 2GLRA 4OFNA 3TGZA 3HZ4A 5HFKA 4TR3A 2H1AA 1HYUA 2V6OA 4GQFA 2DJ1A 2VCTA 1O85A 2B7KA 4BVYB 3F4RA 2GQLA 1U88A 5AIVA 3ZMLA 2LJRA 4TVEA 3RHCA 2H6XA 1K3LA 2VLTA 3FZ4A 1O7UA 5ECHB 1XOAA 2IL3A 3P90A 5D9TA 5IQYA 1G7EA 3KJYA 3PPUA 1NHOA 4K7OA 2L5LA 5LD0A 1VF2A 1JZDA 20GSA 2FA4A 3KEBA 2E0QA 1FB6A 2O89A 3EC3A 4OCEA 3GSTA 1N8JA 2AB6A 2PVQA 1GTUA 3QAVA 3HDCA 4Q5FA 1Z3EA 3CSJA 2WB9A 4K0GA 4H86A 2JZTA 2YANA 4MABA 4O92A 2ZUPA 2LUSA 2H1GA 1BYEA 1K0OA 4V2NA 1SL2B 1HQOA 2B1LA 3TJBA 1XXUA 1Y6EA 1AIUA 3ZVJA 2FA8A 2LRTA 3EE2A 3GH6A 3KP9A 3L9VA 4I2TA 1EGRA 5HR2A 5IMVA 1BJXA 3GMFA 2K8VA 3GSSA 2FWFA 3ME8A 1QUWA 2XBQA 6GSSA 4WF4A 4QL7A 4CW9A 1GTAA 4WR4A 5A4UA 3ZLPA 1X9MB 1GLPA 4ECIA 3ZIVA 1G6YA 3TUEA 1DUGA 1M2AA 5D9WA 5DQYA 1ACVA 1ZYNA 4HU7A 4ZL9A 1SK2A 3NZNA 1G7OA 2YNXA 4BWSA 2H73A 3EMXA 3DVWA 4V2MA 4BL7A 1TP9A 4A5PA 1PKZA 4IGJA 4X43A 4K2DA 3GL5A 2O8VB 2BTOT 4XS4B 2VOCA 1X0RA 5KN2A 4KUNA 2R3XA 5CRHA 2HNLA 5EL8A 4TRXA 2PN8A 1F37A 2QA1A 1GNWA 2VL9A 3EVIA 4BVYA 1QXHA 3VWWA 3EU4A 1FG4A 1OKTA 2X8HA 16GSA 1USBA 1GUKA 4ZB6A 4PQIA 4N11A 3P7XA 2YV9A 1GTBA 3HKRA 2AUVA 2V32A 1GWCA 3C1RA 3UOMA 1LU4A 1YJ6A 18GSA 2GT5A 4MF7A 1ZCPA 3HYPA 4HS1A 3LXZA 2HSHA 1KNGA 5A4VA 1SU9A 1K3OA 2YWMA 3CTFA 5ECSA 2MMZA 2JSYA 2UZ8A 1BG5A 3PH9A 3LYKA 2CX3A 1E2YA 2VAFA 4MA9A 5ENUA 5CYYA 4GXZA 1OYJA 1T00A 3F9UA 1G6WA 5ECPB 1M99A 4LA1A 4IELA 4TR1B 2FNOA 1S3AA 4J57E 3FZAA 1YF0A 4KAEA 1E6BA 5D9VA 3UARA 3TKQA 5E59A 4HI7A 4Q5NA 2HSYA 4RUVA 1EP7A 5B6NA 4GQCA 3Q74A 2L4QA 2CV4A 3VI7A 3FHKA 3GA4A 4PUFC 4JEDA 1FAAA 3GKNA 3Q18A 3GTUB 2I81A 4XS1A 1ON4A 4Z7XA 7GSSA 4PNGA 3H93A 1SJZA 1J08A 3LWAA 1U3IA 4LMWA 4QQ7A 3LEFA 1QGVA 1H75A 1X9SB 4GLTA 2H6YA 2MMOA 1T4ZA 3UVHA 2FD3A 1TU8A 5G30A 2C80A 4MCUA 3TJJA 3DMLA 2P5RA 2ON7A 4O32A 4XS4A 2VCZA 1TDIA 1A2JA 3HHVA 4K6XA 4X0XA 1Z7RA 1TI3A 2OJLA 3TJGA 1ZOFA 4EIQA 4HUAA 1Z7PA 1AW9A 4NV5A 3W8JA 1AAZA 4K9ZA 4I5QA 2DJ2A 1U3AA 3BOAA 4KCEA 2JU5A 4OO5A 1K0BA 2R2JA 3ERWA 2PVOC 1T3BA 5G1KA 3QPMA 3H8QA 4KNDA 1ABAA 2R4VA 3RPNA 4GTUA 1GULA 3DWVA 1ERTA 2AYTA 4MJAA 3U5RE 5JWRB 3GURA 2B3SA 3LSZA 1TRUA 1XOBA 2FHEA 4K5SA 3IE3A 5FWGA 1N2AA 4AJ6A 2IMKA 4ULXA 4HZ2A 4HDEA 3I9V2 2LNSA 4I97A 4V1Ag 3M8NA 3QFBC 1NHYA 1NW2A 5H5RA 3TKPA 1EV9A 4TR1A 3FY7A 1ST9A 3F8UA 1OE7A 2WDUA 2VL3A 3ZZXA 2OBKA 5DALA 5JWQB 3QMXA 3KM6A 3D4MA 1JZWA 1XWBA 3EINA 2ZNMA 4WBRD 5D9XA 3HY2A 3OR5A 1IYHA 1F3BA 2P31A 3G7JA 4ZILA 3PR8A 3LQ7A 3F3QA 3LJRA 1ZMAA 3GTUA 1O8XA 1R5PA 2YV7A 4J56E 2X4AA 3HZ8A 4PGTA 1K0AA 4KH7A 2J23A 4TR4A 2LSTA 4EUYA 2V6KA 2IWTA 2VD0A 1GSUA 2H72A 6GSTA 1X5EA 1KBNA 4PQHA 4ML1A 1YF1A 4O7HA 5DBQA 4PURA 3LGCA 2H6ZA 2GS3A 4JE1A 4IQAA 4G2EA 2WJUA 4XS6A 3GFKA 4PNFA 3VURA 4AF2A 4L8EA 3KTBA 1ZL9A 4E8HA 2VUPA 2DKHA 5HQPA 2RIIA 1MDIA 1MDKA 2L6DA 1B4PA 4I8BA 3WYWA 4YQMA 1TTZA 1PRXA 2H76A 2TRXA 4XRDA 1YZXA 3L78A 1SL1B 3TKSA 4IJIA 1AQXA 3PGTA 3MWHA 3TCOA 1TKDB 3VK9A 5JCUA 22GSA 3M1GA 2XBIA 1MEKA 1UVZA 2GSQA 1ERUA 3CYNA 3DRNA 3APSA 2DJJA 2GZPA 2A2RA 4F2IA 3UAPA 2L4CA 4JR6A 1GSEA 4NV2A 3L4NA 1K0NA 4F0CA 2LQQA 4NMUA 1F6MC 4POMA 2HLSA 1SJIA 1K3YA 1PN0A 3KMNA 1YDKA 3VPTA 1TK0B 2ES7A 4NAXA 2R0GA 5CO3A 4FYBA 1WIKA 4OWYA 4F82A 3WGDA 2L57A 4G0IA 5IOXA 1GRXA 5FHIA 5LCZA 3KXOA 1U87A 3GX0A 1OC9B 1GL8A 4EL1A 3J7Yk 3H79A 3GIXA 5HFIA 3CBUA 2OE3A 3ZFLA 2GSSA 2A2PA 5ECIB 2GZZA 4ZL7A 4WEYA 1OAZA 3PINA 1FHEA 3BBYA 4ZL8A 2VO4A 3IR4A 2GQMA 1OC3A 5D93A 3MAKA 2WULA 2ON5A 3I69A 1GSFA 1V40A 1WP0A 5CRWA 4RI7A 1EOGA 2H66A 2N5FA 3Q19A 4OMVA 3L9UA 1QK8A 5IPGA 4YQUA 3D0ZA 1XW6A 3BJ5A 5B8BA 1GSQA 4L0UA 3JCML 3GH9A 3TRQA 5D96A 6GSWA 2P5QA 4V2LA 5IMZA 2L5OA 4EE0A 2NDOA 4XTSA 3ZMKA 1UC7A 1ILOA 3K8NA 1K0MA 2OA7A 2E7PA 4AGSA 3ZFBA 3P2AA 3C71A 4JZQA 4FYUA 1WWJA 5ABRA 4KF9A 4K0NA 1V58A 3SBCA 5EY6A 3IA1A 2HZEB 4N30A 1XW5A 1XPVA 2K8SA 3HJPA 1DE1A 2JZSA 2HRFA 2YWNA 3ZYWA 2RM6A 4OFMA 2CAIA 5GZZB 2BJXA 2IN3A 3HD5A 2GTUA 2PMTA 1PL2A 3GL3A 4JRRA 2IIYA 3C73A 3KTLA 1SENA 3AY8A 4Q5QA 2VL2A 1M2DA 2F9SA 17GSA 1OC9A 4KCAA 1Z6NA 3VWVA 3A2VA 4YAPA 5B7CA 2C1YA 3W8SA 1XWCA 2EIOA 1MTCA 4ZB8A 1TOFA 3R2QA 4K1FA 3CRUA 4DVCA 1T4YA 5ECLB 1TK8B 5KN0A 2KP1A 2VCXA 4TR0A 4OO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DEJ A;  2FGX A;  4GF0 A;  2IMF A;  5JCG A;  5GAN D;  3TJK A;  1GP1 A;  3DEX A;  2E2G A;  1GLQ A;  4POK A;  4ZB9 A;  2XC2 A;  1O73 A;  4AJ8 A;  1PQN A;  1GSD A;  1TRV A;  4YAV A;  4PUA A;  5KEJ A;  4PXO A;  5HFG A;  2HXK A;  4N0Z A;  4P3Y B;  1ERV A;  5G1L A;  5IO2 A;  5ID2 B;  5ECN B;  3EUR A;  3FRC A;  4WXT A;  1LBK A;  3E0U A;  1EP8 A;  4TW5 A;  3J7Y b;  1J0F A;  4N0V A;  5JWO B;  4MF5 A;  1DE2 A;  2V2G A;  3IK7 A;  2DMM A;  4GCI A;  5J9C A;  5ECR B;  4OCF A;  3E9J B;  4ZBA A;  3VI5 A;  3GKX A;  1V2A A;  1M7T A;  1CQG A;  4D73 B;  3W6G A;  1SKW B;  2HZE A;  2RM5 A;  1QFN A;  4XRA A;  1SK1 A;  1M9B A;  2HZF A;  4DSQ A;  2HFD A;  2QSI A;  3VWU A;  2G0F A;  1JLV A;  3UVT A;  2KLX A;  1RW1 A;  1TU7 A;  3RBT A;  1PKW A;  3GHA A;  4KA0 A;  2K9F A;  1HD2 A;  1R26 A;  3GRX A;  3I43 A;  3ISO A;  3ERG A;  1NM3 A;  2B6M A;  1J9B A;  3ZTL A;  3IAS 2;  3EU3 A;  3KH9 A;  2LEG A;  2X8G A;  4WBJ A;  5IM9 A;  1AQV A;  1OVN A;  2C0E A;  3BCK A;  5ECO B;  5AIX A;  1DBY A;  2H1B A;  1O81 A;  4TKY A;  2OKA A;  2VLV A;  3IV4 A;  3V1W A;  2IMD A;  4MZB A;  4WF5 A;  3BCI A;  4YQV A;  1JFU A;  2GGT A;  3IOS A;  3EWL A;  2LQO A;  5GSS A;  4ZBB A;  1YQ1 A;  3HVX A;  5EPF A;  2RLI A;  5H5S A;  4PQ1 A;  1V9W A;  1MD3 A;  2EIR A;  3TDG A;  1Y25 A;  3UBL A;  4V1A p;  2AJQ B;  3N9J A;  1XVQ A;  3HXS A;  5AGY A;  4HJ2 A;  3KCM A;  3QAG A;  1R5A A;  1KTE A;  5DAK B;  2IMI A;  1A8L A;  4DSS B;  2L6C A;  4CHS A;  1GSS A;  4G10 A;  2TRC P;  4L5O A;  1XWG A;  5DJL A;  3TKS C;  2WCI A;  1PL1 A;  4MZW A;  5ID2 A;  1XW9 A;  3KGK A;  1XVW A;  3WT2 A;  5DCG A;  5J41 A;  3KIJ A;  2XPD A;  2MMN A;  3O6T A;  4NPB A;  5CRD A;  1T8E B;  3CSH A;  2HT9 A;  2LS5 A;  5ELG A;  3ZIJ A;  4TXO B;  4KGI A;  3MSZ A;  4ZBD A;  19GS A;  4D73 A;  4MDC A;  2M46 A;  2X64 A;  3TJF A;  4HZ4 A;  1XCC A;  3NOF A;  3GX8 A;  1SK0 A;  4KSO A;  1EOH A;  3IPZ A;  2GQK A;  1QMV A;  4TOP A;  2I1U A;  1SD9 A;  4YH2 A;  2FY6 A;  2ZCT A;  1A2L A;  3LXT A;  1V98 A;  4JR4 A;  2GDR A;  1EEJ A;  1QQ2 A;  4KB3 A;  3EMP A;  3WGE A;  2QC7 A;  5F07 A;  1TRS A;  3C7M A;  2HYX A;  2Z9S A;  2CZ2 A;  2PU9 C;  4EDY A;  1GSY A;  1ZYQ B;  4POL A;  4L0W A;  4GST A;  5CNW A;  4FH8 A;  3D6I A;  4K7N A;  1PD2 1;  3E3E A;  1VF3 A;  4MPG A;  3A5W A;  2R6K A;  1SKS B;  3O3T A;  1X9W B;  3F4T A;  6GSX A;  1T1V A;  3KZQ A;  2DLX A;  2VLU A;  2FCH A;  4O5R A;  5IMF A;  4KE3 A;  1ERW A;  4MPF A;  3QAW A;  3RHB A;  1YEP A;  2LKU A;  3VPQ A;  1G0T A;  2F8A A;  4GRF A;  5DAK A;  4LL4 B;  1SYR A;  1BX9 A;  4IS0 A;  3RAZ A;  2FWG A;  2RUF A;  2XHF A;  1BED A;  4BPY A;  5E4W A;  3BD2 A;  2REM A;  2A4V A;  4MH2 A;  3MNG A;  2D2Z A;  2WZ9 A;  4POB A;  2DML A;  2C3N A;  5AN1 A;  2DJK A;  3DVX A;  4TXO A;  4NXI A;  4XIH A;  3VLN A;  2IJY A;  2P0G A;  3UMA A;  1M2B A;  2I3Y A;  1BAY A;  3CRT A;  4OFT A;  3H1N A;  2DSA A;  2F8F A;  1YKA A;  2XPE A;  4KX4 A;  4IHU A;  3IAM 2;  3D4T A;  4EC0 A;  1LJR A;  2DJ0 A;  2YOI A;  5DVB A;  5F0G A;  3HA9 A;  2RUE A;  1TXX A;  4NHZ A;  2LNT A;  4EO3 A;  2C4J A;  1OKD A;  5HR3 A;  1JZR A;  2MMA A;  3G7Y A;  2O87 A;  2JAD A;  3DIE A;  4K8M A;  5G31 A;  8GSS A;  3UL3 A;  1WJK A;  2VL2 C;  3C8E A;  1SJ6 A;  14GS A;  4I6X A;  1A2M A;  1PSQ A;  4Q5R A;  4AJ7 A;  2H75 A;  2WS2 A;  1JHB A;  5AIS A;  1A8Y A;  4IN0 A;  1AC1 A;  2PPT A;  2K6V A;  3IBH A;  4LLR A;  5COH A;  2DC5 A;  2H1D A;  4RI6 A;  1JZO A;  1EWX A;  3WGX A;  2B5E A;  3FK8 A;  4G9H A;  1MDJ A;  3FR3 A;  4CDO A;  1FOV A;  4TXV A;  3M9J A;  3L0H A;  1XFL A;  2YPM A;  1FO5 A;  1R4W A;  2KUC A;  3ZL5 A;  1YKC A;  4ML6 A;  2N5A A;  4IBP A;  3D22 A;  2CA8 A;  2YP6 A;  1KEB A;  2NTO A;  4KDU A;  2LJK A;  4JBB A;  3LFL A;  3TRP A;  5GAP D;  1MD4 A;  4FYC A;  2N5B A;  2MZC A;  1B8X A;  3HJM A;  4ILF A;  1WRY A;  3IRA A;  2PWJ A;  5KN3 A;  1GH2 A;  4HQS A;  2X99 A;  4MMM A;  4J2F A;  5DQS A;  1Q4J A;  2H0G A;  2VD1 A;  5DJM A;  1URM A;  1PX6 A;  2HRN A;  4WKW A;  2IME A;  3LG6 A;  3KP8 A;  2JZR A;  4MH3 A;  2YZH A;  3HCZ A;  4KSM A;  3D21 A;  2H74 A;  4BWQ A;  1THO A;  1XZO A;  3APQ A;  1K0D A;  3WT1 A;  4XCS A;  4GSN A;  1B9X C;  3CSI A;  5IMA A;  3M9K A;  2C3T A;  2YN1 A;  4IQ1 A;  1EGO A;  3QDN A;  3GYK A;  3EYT A;  2L59 A;  3DKS A;  4N10 A;  5DCH A;  1ZYE A;  2I4A A;  3F6D A;  4ECJ A;  3F63 A;  2GZY A;  4OD7 A;  5J3R A;  3DYR A;  1PX7 A;  1YEX A;  3ME7 A;  4KDX A;  2OE1 A;  1EV4 A;  3GKK A;  3GKM A;  3P8W A;  3WD6 A;  2QKE A;  3IDV A;  2X8C A;  3D5J A;  6GSY A;  3SWL A;  2VM2 A;  1GNE A;  2DBC A;  2VCQ A;  3C1S A;  4EVM A;  1WE0 A;  2GT6 A;  3QD9 A;  1I9D A;  3HVS A;  4G19 A;  3LOR A;  4WET A;  1V57 A;  4HJM A;  2WFC A;  2CVK A;  2FUG 2;  1X5D A;  1FB0 A;  9GSS A;  2YCD A;  1ZGN A;  2FWH A;  1OE8 A;  5INY A;  1PGT A;  3APO A;  3F6F A;  4XHM A;  5J9B A;  1U6T A;  5GST A;  4L5L A;  3NIV A;  4RQR A;  3QR6 A;  2WRT A;  2K18 A;  1F9M A;  2PUK C;  2AHE A;  1B48 A;  5L71 A;  1A0F A;  4X1U A;  2R37 A;  4MF6 A;  4NHW A;  6GSV A;  4FO5 A;  2VCV A;  1TJD A;  1XWK A;  3ZIT A;  5A4W A;  1SKR B;  1C72 A;  2DJ3 A;  3TOT A;  2H70 A;  3F3R A;  4MJC A;  3UJ1 A;  2GVP A;  2O7K A;  2FWE A;  4ZXG A;  4WR5 A;  2FLS A;  5CRG A;  5J5N A;  1OC8 A;  4TN8 A;  4MP4 A;  1Z9H A;  5HR1 A;  3F4S A;  3DGQ A;  2JL4 A;  2H0H A;  1FVK A;  1HNB A;  2GST A;  1FVJ A;  5DAL B;  3TB2 A;  3IXR A;  5CAX A;  1VF1 A;  1B9Y C;  2M72 A;  5C00 A;  2MBT A;  2KOK A;  5A5K A;  3L9S A;  4IW9 A;  2F51 A;  3G7I A;  1DSB A;  3ED3 A;  4GSS A;  4EXJ A;  3VFI A;  4F0B A;  1X5C A;  5C04 A;  2AV4 A;  4PX1 A;  1XIY A;  1M9A A;  2QGV A;  5IPH A;  3KD0 A;  4LL1 B;  1A23 A;  2H8L A;  1Z5Y E;  1SL0 B;  3FEU A;  2BMX A;  4HEA 2;  5H5Q A;  2R5G A;  2LV3 A;  2O85 A;  4DSR A;  2EC4 A;  4E8E A;  3ZRE A;  6GSU A;  4BVX A;  2YJH A;  3M3M A;  3UBK A;  1IYI A;  1F2E A;  3FW2 A;  5G2Z A;  2CQ9 A;  2M80 A;  4EDZ A;  2CZ3 A;  5G5E A;  4K7I A;  2J9H A;  3IHQ A;  1S3C A;  4RQX A;  2CX4 A;  4KDY A;  5G5F A;  2IPA A;  1SYX A;  2KHP A;  2DIY A;  2EIQ A;  1WPI A;  2G2Q A;  4EKZ A;  2CVB A;  3FR6 A;  4MJB A;  4QL9 A;  3FZ5 A;  2OBI A;  5KN1 A;  3U6V A;  2OAD A;  4ACS A;  3FKF A;  3ZRD A;  3RPP A;  3TKS E;  2HE3 A;  3QCP A;  5EVO A;  2H0I A;  2OAC A;  1YY7 A;  3HVV A;  3UIW A;  3O76 A;  1F3A A;  3Q6O A;  1R7H A;  5IO0 A;  1K0C A;  1TK5 B;  3MDK A;  3UEM A;  1GUH A;  2IFQ B;  5CP1 A;  3TRX A;  2CT6 A;  3CXG A;  1XWA A;  5HR0 A;  3H4K A;  3VWX A;  2V41 A;  4HQZ A;  5IMC A;  5ECQ B;  2OE0 A;  5JCW A;  13GS A;  2VM1 A;  3CTG A;  4MJE A;  5D8I A;  3F0I A;  3GUS A;  1TI1 A;  2A2S A;  3I6A A;  4HOJ A;  2VIM A;  2GSR A;  4IP1 A;  2TIR A;  3LYP A;  2VCW A;  3S9F A;  2HI7 A;  3ERF A;  2PER A;  5IOW A;  2NPB A;  2C0G A;  2ALB A;  4F9Z A;  3US3 A;  3FR9 A;  2B5Y A;  2KP2 A;  2CVD A;  2H30 A;  3ZVJ D;  2JAC A;  4HU9 A;  5CRE A;  1PN9 A;  4I2U A;  1VF4 A;  5FT3 A;  1WOU A;  2PBJ A;  2F3M A;  3GV1 A;  4BA7 A;  3M0F A;  1S3D A;  2CAQ A;  2H71 A;  2NBS A;  1Z6M A;  1GUM A;  3RDW A;  2B7J A;  2I9H A;  3QOU A;  3TOU A;  5D73 A;  5F05 A;  1AQW A;  3GNJ A;  11GS A;  1THX A;  5F06 A;  2PGT A;  5IIZ A;  4GWR A;  2LRN A;  2C0D A;  4EF0 A;  1AUC A;  4DSS A;  1HNC A;  1XBS A;  1JLW A;  1RK4 A;  2H19 A;  3DD3 A;  3QFA C;  2LJA A;  1VGL A;  1ML6 A;  4ZIJ A;  4IKH A;  2MBS A;  2H01 A;  2LTK A;  3GN3 A;  3A2X A;  1SD8 A;  4MZC A;  4LMV A;  1O6J A;  4F03 A;  3KMO A;  3KH7 A;  4ID0 A;  1TRW A;  2C3Q A;  3A3T A;  2YJ7 A;  2B5X A;  3TKR A;  2B1K A;  1RQM A;  5ECK B;  1PA3 A;  4NWY A;  1I5G A;  10GS A;  1M0U A;  4IJ3 A;  1A0R P;  4ISD A;  4MK3 A;  4JU5 A;  5LNK e;  2YWI A;  4IVF A;  1A24 A;  12GS A;  2MYG A;  2IFQ A;  1H4O A;  1NSW A;  2AAW A;  2WGR A;  3IC4 A;  5ECM B;  5F8B A;  1W89 A;  1PMT A;  1CQH A;  5B8A A;  1EZK A;  1GTI A;  2C0F A;  1ZZY A;  1TW9 A;  2V1M A;  1B4Q A;  2YWO A;  3FZ9 A;  3G9B A;  5J4U A;  1WMJ A;  1W4V A;  4FIW A;  1O8W A;  2E2M A;  3IK9 A;  2YZU A;  3N5O A;  4ECB A;  2NVL A;  3CMI A;  3FYG A;  2JSZ A;  4MLY A;  2LRC A;  5B6M A;  4ECC A;  1VRS D;  1BQ7 A;  2DIZ A;  1HNA A;  4KW6 A;  1UN2 A;  5ELA A;  3A2W A;  5IMD A;  1EEM A;  1T7P B;  3HJO A;  4IP6 A;  1AXD A;  2C8U A;  5DDL A;  1FW1 A;  1Q98 A;  1UA5 A;  3DXB A;  2GLR A;  4OFN A;  3TGZ A;  3HZ4 A;  5HFK A;  4TR3 A;  2H1A A;  1HYU A;  2V6O A;  4GQF A;  2DJ1 A;  2VCT A;  1O85 A;  2B7K A;  3F4R A;  2GQL A;  1U88 A;  5AIV A;  3ZML A;  2LJR A;  4TVE A;  3RHC A;  2H6X A;  1K3L A;  2VLT A;  3FZ4 A;  1O7U A;  5ECH B;  1XOA A;  2IL3 A;  3P90 A;  5D9T A;  5IQY A;  1G7E A;  3KJY A;  1NHO A;  4K7O A;  2L5L A;  5LD0 A;  1VF2 A;  1JZD A;  20GS A;  2FA4 A;  3KEB A;  2E0Q A;  1FB6 A;  2O89 A;  3EC3 A;  4OCE A;  3GST A;  1N8J A;  2AB6 A;  2PVQ A;  1GTU A;  3QAV A;  3HDC A;  4Q5F A;  1Z3E A;  3CSJ A;  2WB9 A;  4K0G A;  4H86 A;  2JZT A;  2YAN A;  4MAB A;  4O92 A;  2ZUP A;  2LUS A;  2H1G A;  1BYE A;  1K0O A;  4V2N A;  1SL2 B;  1HQO A;  2B1L A;  3TJB A;  1XXU A;  1Y6E A;  1AIU A;  3ZVJ A;  2FA8 A;  2LRT A;  3EE2 A;  3GH6 A;  3KP9 A;  3L9V A;  4I2T A;  1EGR A;  5HR2 A;  5IMV A;  1BJX A;  3GMF A;  2K8V A;  3GSS A;  2FWF A;  3ME8 A;  1QUW A;  2XBQ A;  6GSS A;  4WF4 A;  4QL7 A;  4CW9 A;  1GTA A;  4WR4 A;  5A4U A;  3ZLP A;  1X9M B;  1GLP A;  4ECI A;  3ZIV A;  1G6Y A;  3TUE A;  1DUG A;  1M2A A;  5D9W A;  5DQY A;  1ACV A;  4HU7 A;  4ZL9 A;  1SK2 A;  3NZN A;  1G7O A;  2YNX A;  4BWS A;  2H73 A;  3EMX A;  3DVW A;  4V2M A;  4BL7 A;  1TP9 A;  1PKZ A;  4IGJ A;  4X43 A;  4K2D A;  3GL5 A;  2O8V B;  2BTO T;  4XS4 B;  2VOC A;  1X0R A;  5KN2 A;  4KUN A;  2R3X A;  5CRH A;  2HNL A;  5EL8 A;  4TRX A;  2PN8 A;  1F37 A;  1GNW A;  2VL9 A;  3EVI A;  4BVY A;  1QXH A;  3VWW A;  3EU4 A;  1FG4 A;  1OKT A;  2X8H A;  16GS A;  1USB A;  1GUK A;  4ZB6 A;  4PQI A;  4N11 A;  3P7X A;  2YV9 A;  1GTB A;  3HKR A;  2AUV A;  2V32 A;  1GWC A;  3C1R A;  3UOM A;  1LU4 A;  1YJ6 A;  18GS A;  2GT5 A;  4MF7 A;  1ZCP A;  3HYP A;  4HS1 A;  3LXZ A;  2HSH A;  1KNG A;  5A4V A;  1SU9 A;  1K3O A;  2YWM A;  3CTF A;  5ECS A;  2MMZ A;  2JSY A;  1BG5 A;  3PH9 A;  3LYK A;  2CX3 A;  1E2Y A;  2VAF A;  4MA9 A;  5ENU A;  5CYY A;  4GXZ A;  1OYJ A;  1T00 A;  3F9U A;  1G6W A;  5ECP B;  1M99 A;  4LA1 A;  4IEL A;  4TR1 B;  2FNO A;  1S3A A;  4J57 E;  3FZA A;  1YF0 A;  4KAE A;  1E6B A;  5D9V A;  3UAR A;  3TKQ A;  5E59 A;  4HI7 A;  4Q5N A;  2HSY A;  4RUV A;  1EP7 A;  5B6N A;  4GQC A;  3Q74 A;  2L4Q A;  2CV4 A;  3VI7 A;  3FHK A;  3GA4 A;  4PUF C;  4JED A;  1FAA A;  3GKN A;  3Q18 A;  3GTU B;  2I81 A;  4XS1 A;  1ON4 A;  4Z7X A;  7GSS A;  4PNG A;  3H93 A;  1SJZ A;  1J08 A;  3LWA A;  1U3I A;  4LMW A;  4QQ7 A;  3LEF A;  1QGV A;  1H75 A;  1X9S B;  4GLT A;  2H6Y A;  2MMO A;  1T4Z A;  3UVH A;  2FD3 A;  1TU8 A;  5G30 A;  2C80 A;  4MCU A;  3TJJ A;  3DML A;  2P5R A;  2ON7 A;  4O32 A;  4XS4 A;  2VCZ A;  1TDI A;  1A2J A;  3HHV A;  4K6X A;  4X0X A;  1Z7R A;  1TI3 A;  2OJL A;  3TJG A;  1ZOF A;  4HUA A;  1Z7P A;  1AW9 A;  4NV5 A;  3W8J A;  1AAZ A;  4K9Z A;  4I5Q A;  2DJ2 A;  1U3A A;  3BOA A;  4KCE A;  2JU5 A;  4OO5 A;  1K0B A;  2R2J A;  3ERW A;  2PVO C;  1T3B A;  5G1K A;  3QPM A;  3H8Q A;  4KND A;  1ABA A;  2R4V A;  3RPN A;  4GTU A;  1GUL A;  3DWV A;  1ERT A;  2AYT A;  4MJA A;  3U5R E;  5JWR B;  3GUR A;  2B3S A;  3LSZ A;  1TRU A;  1XOB A;  2FHE A;  3IE3 A;  5FWG A;  1N2A A;  4AJ6 A;  2IMK A;  4ULX A;  4HZ2 A;  4HDE A;  3I9V 2;  2LNS A;  4I97 A;  4V1A g;  3M8N A;  3QFB C;  1NHY A;  1NW2 A;  5H5R A;  3TKP A;  1EV9 A;  4TR1 A;  3FY7 A;  1ST9 A;  3F8U A;  1OE7 A;  2WDU A;  2VL3 A;  3ZZX A;  2OBK A;  5DAL A;  5JWQ B;  3QMX A;  3KM6 A;  3D4M A;  1JZW A;  1XWB A;  3EIN A;  2ZNM A;  4WBR D;  5D9X A;  3HY2 A;  3OR5 A;  1IYH A;  1F3B A;  2P31 A;  3G7J A;  4ZIL A;  3PR8 A;  3LQ7 A;  3F3Q A;  3LJR A;  1ZMA A;  3GTU A;  1O8X A;  1R5P A;  2YV7 A;  4J56 E;  3HZ8 A;  4PGT A;  1K0A A;  4KH7 A;  2J23 A;  4TR4 A;  2LST A;  4EUY A;  2V6K A;  2IWT A;  2VD0 A;  1GSU A;  2H72 A;  6GST A;  1X5E A;  1KBN A;  4PQH A;  4ML1 A;  1YF1 A;  4O7H A;  5DBQ A;  4PUR A;  3LGC A;  2H6Z A;  2GS3 A;  4JE1 A;  4IQA A;  4G2E A;  2WJU A;  4XS6 A;  3GFK A;  4PNF A;  3VUR A;  4AF2 A;  4L8E A;  3KTB A;  1ZL9 A;  4E8H A;  2VUP A;  5HQP A;  2RII A;  1MDI A;  1MDK A;  2L6D A;  1B4P A;  4I8B A;  3WYW A;  4YQM A;  1TTZ A;  1PRX A;  2H76 A;  2TRX A;  4XRD A;  1YZX A;  3L78 A;  1SL1 B;  3TKS A;  4IJI A;  1AQX A;  3PGT A;  3MWH A;  3TCO A;  1TKD B;  3VK9 A;  5JCU A;  22GS A;  3M1G A;  2XBI A;  1MEK A;  1UVZ A;  2GSQ A;  1ERU A;  3CYN A;  3DRN A;  3APS A;  2DJJ A;  2GZP A;  2A2R A;  4F2I A;  3UAP A;  2L4C A;  4JR6 A;  1GSE A;  4NV2 A;  3L4N A;  1K0N A;  4F0C A;  2LQQ A;  4NMU A;  1F6M C;  4POM A;  2HLS A;  1SJI A;  1K3Y A;  3KMN A;  1YDK A;  3VPT A;  1TK0 B;  2ES7 A;  4NAX A;  5CO3 A;  4FYB A;  1WIK A;  4OWY A;  4F82 A;  3WGD A;  2L57 A;  5IOX A;  1GRX A;  5FHI A;  5LCZ A;  3KXO A;  1U87 A;  3GX0 A;  1OC9 B;  1GL8 A;  4EL1 A;  3J7Y k;  3H79 A;  3GIX A;  5HFI A;  3CBU A;  2OE3 A;  3ZFL A;  2GSS A;  5ECI B;  2GZZ A;  4ZL7 A;  4WEY A;  1OAZ A;  3PIN A;  1FHE A;  3BBY A;  4ZL8 A;  2VO4 A;  3IR4 A;  2GQM A;  1OC3 A;  5D93 A;  3MAK A;  2WUL A;  2ON5 A;  3I69 A;  1GSF A;  1V40 A;  1WP0 A;  5CRW A;  4RI7 A;  1EOG A;  2H66 A;  2N5F A;  3Q19 A;  4OMV A;  3L9U A;  1QK8 A;  5IPG A;  4YQU A;  3D0Z A;  1XW6 A;  3BJ5 A;  5B8B A;  1GSQ A;  4L0U A;  3JCM L;  3GH9 A;  3TRQ A;  5D96 A;  6GSW A;  2P5Q A;  4V2L A;  5IMZ A;  2L5O A;  4EE0 A;  2NDO A;  4XTS A;  3ZMK A;  1UC7 A;  1ILO A;  3K8N A;  1K0M A;  2OA7 A;  2E7P A;  4AGS A;  3ZFB A;  3P2A A;  3C71 A;  4JZQ A;  4FYU A;  1WWJ A;  5ABR A;  4K0N A;  1V58 A;  3SBC A;  5EY6 A;  3IA1 A;  2HZE B;  4N30 A;  1XW5 A;  1XPV A;  2K8S A;  3HJP A;  1DE1 A;  2JZS A;  2HRF A;  2YWN A;  3ZYW A;  2RM6 A;  4OFM A;  2CAI A;  5GZZ B;  2BJX A;  2IN3 A;  3HD5 A;  2GTU A;  2PMT A;  1PL2 A;  3GL3 A;  4JRR A;  2IIY A;  3C73 A;  3KTL A;  1SEN A;  3AY8 A;  4Q5Q A;  2VL2 A;  1M2D A;  2F9S A;  17GS A;  1OC9 A;  4KCA A;  1Z6N A;  3VWV A;  3A2V A;  4YAP A;  5B7C A;  2C1Y A;  3W8S A;  1XWC A;  2EIO A;  1MTC A;  4ZB8 A;  1TOF A;  3R2Q A;  4K1F A;  3CRU A;  4DVC A;  1T4Y A;  5ECL B;  1TK8 B;  5KN0 A;  2KP1 A;  2VCX A;  4TR0 A;  4OO4 A; 
#chains in the Genus database with same CATH topology
 4DEJ A;  2FGX A;  4GF0 A;  2IMF A;  5JCG A;  5GAN D;  3TJK A;  1GP1 A;  3DEX A;  2E2G A;  1GLQ A;  4POK A;  4ZB9 A;  2XC2 A;  1O73 A;  4AJ8 A;  1PQN A;  1GSD A;  1TRV A;  4YAV A;  4PUA A;  5KEJ A;  3LW9 A;  4PXO A;  5HFG A;  2HXK A;  4N0Z A;  4P3Y B;  1ERV A;  5G1L A;  5IO2 A;  5ID2 B;  5ECN B;  3EUR A;  3FRC A;  4WXT A;  1LBK A;  3E0U A;  1EP8 A;  4TW5 A;  3J7Y b;  1J0F A;  4N0V A;  5JWO B;  4MF5 A;  1DE2 A;  2V2G A;  3IK7 A;  2DMM A;  4GCI A;  5J9C A;  5ECR B;  4OCF A;  3E9J B;  4ZBA A;  3VI5 A;  3GKX A;  1V2A A;  1M7T A;  1CQG A;  4D73 B;  3MIX A;  3W6G A;  1SKW B;  2HZE A;  2RM5 A;  1QFN A;  4XRA A;  1SK1 A;  1M9B A;  2HZF A;  1M3I A;  4DSQ A;  2HFD A;  2QSI A;  3VWU A;  2G0F A;  1JLV A;  3UVT A;  2KLX A;  1RW1 A;  1TU7 A;  3RBT A;  1PKW A;  3GHA A;  4KA0 A;  2K9F A;  1HD2 A;  1R26 A;  3GRX A;  3I43 A;  3ISO A;  3ERG A;  1NM3 A;  2B6M A;  1J9B A;  3ZTL A;  3IAS 2;  3EU3 A;  3KH9 A;  2LEG A;  2X8G A;  4WBJ A;  5IM9 A;  1AQV A;  1OVN A;  2C0E A;  3BCK A;  5ECO B;  5AIX A;  1DBY A;  2H1B A;  1O81 A;  4TKY A;  2OKA A;  2VLV A;  3IV4 A;  3V1W A;  2IMD A;  4MZB A;  4WF5 A;  3BCI A;  4YQV A;  1JFU A;  2GGT A;  3IOS A;  3EWL A;  2LQO A;  5GSS A;  4ZBB A;  1YQ1 A;  3HVX A;  5EPF A;  2DKI A;  2RLI A;  1XG8 A;  5H5S A;  4PQ1 A;  1V9W A;  1MD3 A;  2EIR A;  3TDG A;  1Y25 A;  3UBL A;  4V1A p;  2AJQ B;  3N9J A;  1XVQ A;  3HXS A;  5AGY A;  4HJ2 A;  2HSM A;  3KCM A;  3QAG A;  1R5A A;  1KTE A;  5DAK B;  2IMI A;  1A8L A;  4DSS B;  2L6C A;  4CHS A;  1GSS A;  4G10 A;  2TRC P;  4L5O A;  1XWG A;  4HSC X;  5DJL A;  4O5Q A;  3TKS C;  4X4J A;  2WCI A;  1PL1 A;  4MZW A;  5ID2 A;  1XW9 A;  3KGK A;  1XVW A;  3WT2 A;  5DCG A;  5J41 A;  4K5R A;  3KIJ A;  2XPD A;  2MMN A;  3O6T A;  4NPB A;  5CRD A;  1T8E B;  3CSH A;  2HT9 A;  2LS5 A;  5ELG A;  3ZIJ A;  4TXO B;  4KGI A;  3MSZ A;  4ZBD A;  19GS A;  4YKG A;  4D73 A;  4MDC A;  2M46 A;  2X64 A;  3TJF A;  4HZ4 A;  1XCC A;  3NOF A;  3GX8 A;  1SK0 A;  4KSO A;  1EOH A;  3IPZ A;  2GQK A;  1QMV A;  4TOP A;  2I1U A;  1SD9 A;  4YH2 A;  2FY6 A;  4USS A;  2ZCT A;  1A2L A;  3LXT A;  1V98 A;  4JR4 A;  2GDR A;  1EEJ A;  1QQ2 A;  3A5I A;  4KB3 A;  3EMP A;  3WGE A;  2HRK A;  2QC7 A;  5F07 A;  1TRS A;  3C7M A;  2HYX A;  2Z9S A;  2CZ2 A;  2PU9 C;  4EDY A;  1GSY A;  1ZYQ B;  4POL A;  4L0W A;  4MNN A;  4GST A;  5CNW A;  4FH8 A;  1PFO A;  4EIP A;  3D6I A;  4K7N A;  1PD2 1;  3E3E A;  1VF3 A;  4MPG A;  3A5W A;  2R6K A;  1SKS B;  3O3T A;  1X9W B;  3F4T A;  6GSX A;  1T1V A;  3KZQ A;  2DLX A;  2VLU A;  2FCH A;  4O5R A;  5IMF A;  4KE3 A;  1ERW A;  4MPF A;  3QAW A;  3RHB A;  1YEP A;  2LKU A;  3VPQ A;  1G0T A;  2F8A A;  4GRF A;  5DAK A;  4LL4 B;  3EPT A;  1SYR A;  1BX9 A;  4IS0 A;  3RAZ A;  2FWG A;  2RUF A;  2XHF A;  1BED A;  4BPY A;  5E4W A;  3BD2 A;  2REM A;  2A4V A;  4MH2 A;  3MNG A;  2D2Z A;  2WZ9 A;  4POB A;  2DML A;  1FOH A;  2C3N A;  5AN1 A;  2DJK A;  3DVX A;  4TXO A;  4NXI A;  4XIH A;  3VLN A;  2IJY A;  2P0G A;  3UMA A;  1M2B A;  2I3Y A;  4G0L A;  1BAY A;  3CRT A;  4OFT A;  3H1N A;  2DSA A;  2F8F A;  1YKA A;  2XPE A;  4KX4 A;  4IHU A;  3IAM 2;  3D4T A;  4EC0 A;  4Z2T A;  1LJR A;  2DJ0 A;  2YOI A;  5DVB A;  5F0G A;  3HA9 A;  2RUE A;  1TXX A;  4NHZ A;  2LNT A;  4EO3 A;  2C4J A;  1OKD A;  5HR3 A;  1JZR A;  2MMA A;  3G7Y A;  2O87 A;  2JAD A;  3DIE A;  4K8M A;  5G31 A;  8GSS A;  3UL3 A;  1WJK A;  2VL2 C;  3C8E A;  1SJ6 A;  14GS A;  4I6X A;  1A2M A;  1PSQ A;  4Q5R A;  2R0C A;  4AJ7 A;  2H75 A;  2WS2 A;  1JHB A;  5AIS A;  1A8Y A;  4IN0 A;  1AC1 A;  2PPT A;  2K6V A;  5KOX A;  3IBH A;  4LLR A;  5COH A;  2DC5 A;  2H1D A;  4RI6 A;  1JZO A;  1EWX A;  3WGX A;  2B5E A;  3FK8 A;  4G9H A;  1MDJ A;  3FR3 A;  4CDO A;  1FOV A;  4TXV A;  3M9J A;  3L0H A;  1XFL A;  2YPM A;  1FO5 A;  1R4W A;  2KUC A;  3ZL5 A;  1YKC A;  4ML6 A;  2N5A A;  4IBP A;  3D22 A;  2CA8 A;  2YP6 A;  1KEB A;  2NTO A;  4KDU A;  2LJK A;  4JBB A;  3LFL A;  3TRP A;  5GAP D;  1MD4 A;  4FYC A;  2N5B A;  2MZC A;  1B8X A;  3HJM A;  4ILF A;  1WRY A;  3IRA A;  2PWJ A;  4O5U A;  5KN3 A;  1GH2 A;  4HQS A;  2X99 A;  4MMM A;  4J2F A;  3R3E A;  5DQS A;  1Q4J A;  2H0G A;  2VD1 A;  5DJM A;  3IC8 A;  1URM A;  1PX6 A;  2HRN A;  4WKW A;  2IME A;  3LG6 A;  3KP8 A;  4CY6 A;  2JZR A;  4MH3 A;  2YZH A;  3HCZ A;  4KSM A;  3D21 A;  2H74 A;  4BWQ A;  1THO A;  1XZO A;  3APQ A;  1K0D A;  3WT1 A;  4XCS A;  4GSN A;  1B9X C;  3CSI A;  5IMA A;  3M9K A;  2C3T A;  2YN1 A;  4IQ1 A;  1EGO A;  3QDN A;  3GYK A;  3EYT A;  2L59 A;  3DKS A;  4N10 A;  3IHG A;  5DCH A;  1ZYE A;  2I4A A;  2QA2 A;  3F6D A;  4ECJ A;  3F63 A;  2GZY A;  4OD7 A;  5J3R A;  3DYR A;  1PX7 A;  1YEX A;  3ME7 A;  4KDX A;  2OE1 A;  1EV4 A;  3GKK A;  3GKM A;  3P8W A;  3WD6 A;  2QKE A;  3IDV A;  2X8C A;  3D5J A;  6GSY A;  3SWL A;  2VM2 A;  1GNE A;  2DBC A;  2VCQ A;  3C1S A;  4EVM A;  1WE0 A;  2GT6 A;  4BVX B;  3QD9 A;  1I9D A;  3HVS A;  4G19 A;  3LOR A;  4WET A;  1V57 A;  4HJM A;  2WFC A;  2CVK A;  5BMU A;  4K2X A;  2FUG 2;  1X5D A;  1FB0 A;  9GSS A;  2YCD A;  1ZGN A;  2FWH A;  1OE8 A;  5INY A;  1PGT A;  3APO A;  3F6F A;  4XHM A;  5J9B A;  1U6T A;  5GST A;  4L5L A;  3NIV A;  4RQR A;  3QR6 A;  2WRT A;  2K18 A;  1F9M A;  2PUK C;  2AHE A;  1B48 A;  5L71 A;  1A0F A;  4X1U A;  1M3J A;  2R37 A;  4MF6 A;  4NHW A;  6GSV A;  4FO5 A;  2VCV A;  1TJD A;  1XWK A;  3ZIT A;  5A4W A;  1SKR B;  1C72 A;  3MYD A;  2DJ3 A;  3TOT A;  2H70 A;  3F3R A;  4MJC A;  3UJ1 A;  2GVP A;  2O7K A;  2FWE A;  4ZXG A;  4WR5 A;  2FLS A;  5CRG A;  5J5N A;  1OC8 A;  4TN8 A;  4MP4 A;  1Z9H A;  5HR1 A;  3F4S A;  3DGQ A;  2JL4 A;  2H0H A;  1FVK A;  2A4H A;  1HNB A;  4ICY A;  3HVN A;  2GST A;  1FVJ A;  5DAL B;  3TB2 A;  3IXR A;  5CAX A;  1VF1 A;  1B9Y C;  2M72 A;  5C00 A;  2MBT A;  2KOK A;  5A5K A;  3L9S A;  4IW9 A;  2F51 A;  3G7I A;  1DSB A;  3ED3 A;  4GSS A;  4EXJ A;  3VFI A;  4F0B A;  1X5C A;  5C04 A;  2AV4 A;  4PX1 A;  1XIY A;  1M9A A;  2QGV A;  5IPH A;  3KD0 A;  4LL1 B;  1A23 A;  2H8L A;  1Z5Y E;  1SL0 B;  3FEU A;  2BMX A;  4HEA 2;  5H5Q A;  2R5G A;  2LV3 A;  2O85 A;  4G0K A;  4DSR A;  2X49 A;  2EC4 A;  4E8E A;  3ZRE A;  6GSU A;  4BVX A;  2YJH A;  3M3M A;  3UBK A;  1IYI A;  1F2E A;  3FW2 A;  5G2Z A;  2CQ9 A;  2M80 A;  4EDZ A;  1ZYP A;  2CZ3 A;  5G5E A;  4K7I A;  2J9H A;  3IHQ A;  1S3C A;  4RQX A;  2CX4 A;  4KDY A;  5G5F A;  2IPA A;  1SYX A;  2KHP A;  2DIY A;  2EIQ A;  1WPI A;  2G2Q A;  4EKZ A;  2CVB A;  3FR6 A;  4MJB A;  4QL9 A;  3FZ5 A;  2OBI A;  5KN1 A;  3U6V A;  2OAD A;  4ACS A;  3FKF A;  3ZRD A;  3RPP A;  3TKS E;  2HE3 A;  3QCP A;  5EVO A;  4PTS A;  4Z2R A;  2H0I A;  2OAC A;  1YY7 A;  3HVV A;  3UIW A;  3O76 A;  1F3A A;  3Q6O A;  1R7H A;  5IO0 A;  1K0C A;  1TK5 B;  3MDK A;  4FQU A;  3UEM A;  4CY8 A;  1GUH A;  2IFQ B;  5CP1 A;  3TRX A;  2CT6 A;  3CXG A;  1XWA A;  5HR0 A;  3H4K A;  3VWX A;  2V41 A;  4HQZ A;  5IMC A;  5ECQ B;  2OE0 A;  5JCW A;  13GS A;  2VM1 A;  3CTG A;  4MJE A;  5D8I A;  3F0I A;  3GUS A;  1TI1 A;  2A2S A;  3I6A A;  4HOJ A;  2VIM A;  2GSR A;  4IP1 A;  2TIR A;  3LYP A;  2VCW A;  3S9F A;  2HI7 A;  5BRT A;  3ERF A;  2PER A;  5IOW A;  2NPB A;  2C0G A;  2ALB A;  4F9Z A;  3US3 A;  3FR9 A;  2B5Y A;  2KP2 A;  2CVD A;  2H30 A;  3ZVJ D;  2JAC A;  4HU9 A;  5CRE A;  1PN9 A;  4I2U A;  1VF4 A;  5FT3 A;  1WOU A;  2PBJ A;  2F3M A;  3GV1 A;  4BA7 A;  3M0F A;  1S3D A;  2CAQ A;  2H71 A;  2NBS A;  1Z6M A;  1GUM A;  3RDW A;  2B7J A;  2I9H A;  3QOU A;  3TOU A;  5D73 A;  5F05 A;  1AQW A;  3GNJ A;  11GS A;  1THX A;  5F06 A;  2PGT A;  5IIZ A;  4GWR A;  2LRN A;  2C0D A;  4EF0 A;  1AUC A;  4DSS A;  1HNC A;  3FMW A;  1XBS A;  1JLW A;  1RK4 A;  2H19 A;  3DD3 A;  3QFA C;  2LJA A;  1VGL A;  1ML6 A;  4ZIJ A;  4IKH A;  2MBS A;  2H01 A;  2LTK A;  3GN3 A;  3A2X A;  1SD8 A;  4MZC A;  4LMV A;  1O6J A;  4F03 A;  3KMO A;  3KH7 A;  4ID0 A;  1TRW A;  2C3Q A;  2HRA A;  3A3T A;  2YJ7 A;  2B5X A;  3TKR A;  2R0P A;  2B1K A;  1RQM A;  5ECK B;  1PA3 A;  4NWY A;  1I5G A;  10GS A;  1M0U A;  4IJ3 A;  1A0R P;  4ISD A;  4MK3 A;  5KOW A;  4JU5 A;  5LNK e;  2YWI A;  4IVF A;  1A24 A;  12GS A;  2MYG A;  2IFQ A;  1H4O A;  1NSW A;  2AAW A;  2WGR A;  3IC4 A;  5ECM B;  5F8B A;  1W89 A;  1PMT A;  1CQH A;  5B8A A;  1EZK A;  1GTI A;  2C0F A;  1ZZY A;  1TW9 A;  2V1M A;  1B4Q A;  2YWO A;  3FZ9 A;  3G9B A;  5J4U A;  1WMJ A;  1W4V A;  4FIW A;  1O8W A;  2E2M A;  3IK9 A;  2YZU A;  3N5O A;  4ECB A;  2NVL A;  3CMI A;  3FYG A;  2JSZ A;  4MLY A;  2LRC A;  5B6M A;  4Z2U A;  4YKF A;  4ECC A;  1VRS D;  4BL7 B;  1BQ7 A;  2DIZ A;  1HNA A;  4KW6 A;  1UN2 A;  5ELA A;  3A2W A;  5IMD A;  1EEM A;  1T7P B;  3HJO A;  4IP6 A;  1AXD A;  2C8U A;  5DDL A;  1FW1 A;  1Q98 A;  1UA5 A;  3DXB A;  2GLR A;  4OFN A;  3TGZ A;  3HZ4 A;  5HFK A;  4TR3 A;  2H1A A;  1HYU A;  2V6O A;  4GQF A;  2DJ1 A;  2VCT A;  1O85 A;  2B7K A;  4BVY B;  3F4R A;  2GQL A;  1U88 A;  5AIV A;  3ZML A;  2LJR A;  4TVE A;  3RHC A;  2H6X A;  1K3L A;  2VLT A;  3FZ4 A;  1O7U A;  5ECH B;  1XOA A;  2IL3 A;  3P90 A;  5D9T A;  5IQY A;  1G7E A;  3KJY A;  3PPU A;  1NHO A;  4K7O A;  2L5L A;  5LD0 A;  1VF2 A;  1JZD A;  20GS A;  2FA4 A;  3KEB A;  2E0Q A;  1FB6 A;  2O89 A;  3EC3 A;  4OCE A;  3GST A;  1N8J A;  2AB6 A;  2PVQ A;  1GTU A;  3QAV A;  3HDC A;  4Q5F A;  1Z3E A;  3CSJ A;  2WB9 A;  4K0G A;  4H86 A;  2JZT A;  2YAN A;  4MAB A;  4O92 A;  2ZUP A;  2LUS A;  2H1G A;  1BYE A;  1K0O A;  4V2N A;  1SL2 B;  1HQO A;  2B1L A;  3TJB A;  1XXU A;  1Y6E A;  1AIU A;  3ZVJ A;  2FA8 A;  2LRT A;  3EE2 A;  3GH6 A;  3KP9 A;  3L9V A;  4I2T A;  1EGR A;  5HR2 A;  5IMV A;  1BJX A;  3GMF A;  2K8V A;  3GSS A;  2FWF A;  3ME8 A;  1QUW A;  2XBQ A;  6GSS A;  4WF4 A;  4QL7 A;  4CW9 A;  1GTA A;  4WR4 A;  5A4U A;  3ZLP A;  1X9M B;  1GLP A;  4ECI A;  3ZIV A;  1G6Y A;  3TUE A;  1DUG A;  1M2A A;  5D9W A;  5DQY A;  1ACV A;  1ZYN A;  4HU7 A;  4ZL9 A;  1SK2 A;  3NZN A;  1G7O A;  2YNX A;  4BWS A;  2H73 A;  3EMX A;  3DVW A;  4V2M A;  4BL7 A;  1TP9 A;  4A5P A;  1PKZ A;  4IGJ A;  4X43 A;  4K2D A;  3GL5 A;  2O8V B;  2BTO T;  4XS4 B;  2VOC A;  1X0R A;  5KN2 A;  4KUN A;  2R3X A;  5CRH A;  2HNL A;  5EL8 A;  4TRX A;  2PN8 A;  1F37 A;  2QA1 A;  1GNW A;  2VL9 A;  3EVI A;  4BVY A;  1QXH A;  3VWW A;  3EU4 A;  1FG4 A;  1OKT A;  2X8H A;  16GS A;  1USB A;  1GUK A;  4ZB6 A;  4PQI A;  4N11 A;  3P7X A;  2YV9 A;  1GTB A;  3HKR A;  2AUV A;  2V32 A;  1GWC A;  3C1R A;  3UOM A;  1LU4 A;  1YJ6 A;  18GS A;  2GT5 A;  4MF7 A;  1ZCP A;  3HYP A;  4HS1 A;  3LXZ A;  2HSH A;  1KNG A;  5A4V A;  1SU9 A;  1K3O A;  2YWM A;  3CTF A;  5ECS A;  2MMZ A;  2JSY A;  2UZ8 A;  1BG5 A;  3PH9 A;  3LYK A;  2CX3 A;  1E2Y A;  2VAF A;  4MA9 A;  5ENU A;  5CYY A;  4GXZ A;  1OYJ A;  1T00 A;  3F9U A;  1G6W A;  5ECP B;  1M99 A;  4LA1 A;  4IEL A;  4TR1 B;  2FNO A;  1S3A A;  4J57 E;  3FZA A;  1YF0 A;  4KAE A;  1E6B A;  5D9V A;  3UAR A;  3TKQ A;  5E59 A;  4HI7 A;  4Q5N A;  2HSY A;  4RUV A;  1EP7 A;  5B6N A;  4GQC A;  3Q74 A;  2L4Q A;  2CV4 A;  3VI7 A;  3FHK A;  3GA4 A;  4PUF C;  4JED A;  1FAA A;  3GKN A;  3Q18 A;  3GTU B;  2I81 A;  4XS1 A;  1ON4 A;  4Z7X A;  7GSS A;  4PNG A;  3H93 A;  1SJZ A;  1J08 A;  3LWA A;  1U3I A;  4LMW A;  4QQ7 A;  3LEF A;  1QGV A;  1H75 A;  1X9S B;  4GLT A;  2H6Y A;  2MMO A;  1T4Z A;  3UVH A;  2FD3 A;  1TU8 A;  5G30 A;  2C80 A;  4MCU A;  3TJJ A;  3DML A;  2P5R A;  2ON7 A;  4O32 A;  4XS4 A;  2VCZ A;  1TDI A;  1A2J A;  3HHV A;  4K6X A;  4X0X A;  1Z7R A;  1TI3 A;  2OJL A;  3TJG A;  1ZOF A;  4EIQ A;  4HUA A;  1Z7P A;  1AW9 A;  4NV5 A;  3W8J A;  1AAZ A;  4K9Z A;  4I5Q A;  2DJ2 A;  1U3A A;  3BOA A;  4KCE A;  2JU5 A;  4OO5 A;  1K0B A;  2R2J A;  3ERW A;  2PVO C;  1T3B A;  5G1K A;  3QPM A;  3H8Q A;  4KND A;  1ABA A;  2R4V A;  3RPN A;  4GTU A;  1GUL A;  3DWV A;  1ERT A;  2AYT A;  4MJA A;  3U5R E;  5JWR B;  3GUR A;  2B3S A;  3LSZ A;  1TRU A;  1XOB A;  2FHE A;  4K5S A;  3IE3 A;  5FWG A;  1N2A A;  4AJ6 A;  2IMK A;  4ULX A;  4HZ2 A;  4HDE A;  3I9V 2;  2LNS A;  4I97 A;  4V1A g;  3M8N A;  3QFB C;  1NHY A;  1NW2 A;  5H5R A;  3TKP A;  1EV9 A;  4TR1 A;  3FY7 A;  1ST9 A;  3F8U A;  1OE7 A;  2WDU A;  2VL3 A;  3ZZX A;  2OBK A;  5DAL A;  5JWQ B;  3QMX A;  3KM6 A;  3D4M A;  1JZW A;  1XWB A;  3EIN A;  2ZNM A;  4WBR D;  5D9X A;  3HY2 A;  3OR5 A;  1IYH A;  1F3B A;  2P31 A;  3G7J A;  4ZIL A;  3PR8 A;  3LQ7 A;  3F3Q A;  3LJR A;  4BIK A;  1ZMA A;  3GTU A;  1O8X A;  1R5P A;  2YV7 A;  4J56 E;  2X4A A;  3HZ8 A;  4PGT A;  1K0A A;  4KH7 A;  2J23 A;  4TR4 A;  2LST A;  4EUY A;  2V6K A;  2IWT A;  2VD0 A;  1GSU A;  2H72 A;  6GST A;  1X5E A;  1KBN A;  4PQH A;  4ML1 A;  1YF1 A;  4O7H A;  5DBQ A;  4PUR A;  3LGC A;  2H6Z A;  2GS3 A;  4JE1 A;  4IQA A;  4G2E A;  2WJU A;  4XS6 A;  3GFK A;  4PNF A;  3VUR A;  4AF2 A;  4L8E A;  3KTB A;  1ZL9 A;  4E8H A;  2VUP A;  2DKH A;  5HQP A;  2RII A;  1MDI A;  1MDK A;  2L6D A;  1B4P A;  4I8B A;  3WYW A;  4YQM A;  1TTZ A;  1PRX A;  2H76 A;  2TRX A;  4XRD A;  1YZX A;  3L78 A;  1SL1 B;  3CQF A;  3TKS A;  4IJI A;  1AQX A;  3PGT A;  3MWH A;  3TCO A;  1TKD B;  3VK9 A;  5JCU A;  22GS A;  3M1G A;  2XBI A;  1MEK A;  1UVZ A;  2GSQ A;  1ERU A;  3CYN A;  3DRN A;  3APS A;  2DJJ A;  2GZP A;  2A2R A;  4F2I A;  3UAP A;  2L4C A;  4JR6 A;  1GSE A;  4NV2 A;  3L4N A;  1K0N A;  4F0C A;  2LQQ A;  4NMU A;  1F6M C;  4POM A;  2HLS A;  1S3R A;  1SJI A;  1K3Y A;  1PN0 A;  3KMN A;  1YDK A;  3VPT A;  1TK0 B;  2ES7 A;  4NAX A;  2R0G A;  5CO3 A;  4FYB A;  1WIK A;  4OWY A;  4F82 A;  3WGD A;  2L57 A;  4G0I A;  5IOX A;  1GRX A;  5FHI A;  5LCZ A;  3KXO A;  1U87 A;  3GX0 A;  1OC9 B;  1GL8 A;  4EL1 A;  3J7Y k;  3H79 A;  3GIX A;  5HFI A;  3CBU A;  2OE3 A;  3ZFL A;  2GSS A;  2A2P A;  5ECI B;  2GZZ A;  4ZL7 A;  4WEY A;  1OAZ A;  3PIN A;  1FHE A;  3BBY A;  4ZL8 A;  2VO4 A;  3IR4 A;  2GQM A;  1OC3 A;  5D93 A;  3MAK A;  2WUL A;  2ON5 A;  3I69 A;  1GSF A;  1V40 A;  1WP0 A;  5CRW A;  4RI7 A;  1EOG A;  2H66 A;  2N5F A;  3Q19 A;  4OMV A;  3L9U A;  1QK8 A;  5IPG A;  4YQU A;  3D0Z A;  1XW6 A;  3BJ5 A;  5B8B A;  1GSQ A;  4L0U A;  3JCM L;  3GH9 A;  3TRQ A;  5D96 A;  6GSW A;  2P5Q A;  4V2L A;  5IMZ A;  2L5O A;  4EE0 A;  2NDO A;  4XTS A;  3ZMK A;  1UC7 A;  1ILO A;  3K8N A;  1K0M A;  2OA7 A;  2E7P A;  4AGS A;  3ZFB A;  3P2A A;  3C71 A;  4JZQ A;  4FYU A;  1WWJ A;  5ABR A;  4KF9 A;  4K0N A;  1V58 A;  3SBC A;  5EY6 A;  3IA1 A;  2HZE B;  4N30 A;  1XW5 A;  1XPV A;  2K8S A;  3HJP A;  1DE1 A;  2JZS A;  2HRF A;  2YWN A;  3ZYW A;  2RM6 A;  4OFM A;  2CAI A;  5GZZ B;  2BJX A;  2IN3 A;  3HD5 A;  2GTU A;  2PMT A;  1PL2 A;  3GL3 A;  4JRR A;  2IIY A;  3C73 A;  3KTL A;  1SEN A;  3AY8 A;  4Q5Q A;  2VL2 A;  1M2D A;  2F9S A;  17GS A;  1OC9 A;  4KCA A;  1Z6N A;  3VWV A;  3A2V A;  4YAP A;  5B7C A;  2C1Y A;  3W8S A;  1XWC A;  2EIO A;  1MTC A;  4ZB8 A;  1TOF A;  3R2Q A;  4K1F A;  3CRU A;  4DVC A;  1T4Y A;  5ECL B;  1TK8 B;  5KN0 A;  2KP1 A;  2VCX A;  4TR0 A;  4OO4 A; 
#chains in the Genus database with same CATH homology
 4DEJ A;  2FGX A;  4GF0 A;  2IMF A;  5JCG A;  5GAN D;  3TJK A;  1GP1 A;  3DEX A;  2E2G A;  1GLQ A;  4POK A;  4ZB9 A;  2XC2 A;  1O73 A;  4AJ8 A;  1PQN A;  1GSD A;  1TRV A;  4YAV A;  4PUA A;  5KEJ A;  3LW9 A;  4PXO A;  5HFG A;  2HXK A;  4N0Z A;  4P3Y B;  1ERV A;  5G1L A;  5IO2 A;  5ID2 B;  5ECN B;  3EUR A;  3FRC A;  4WXT A;  1LBK A;  3E0U A;  1EP8 A;  4TW5 A;  3J7Y b;  1J0F A;  4N0V A;  5JWO B;  4MF5 A;  1DE2 A;  2V2G A;  3IK7 A;  2DMM A;  4GCI A;  5J9C A;  5ECR B;  4OCF A;  3E9J B;  4ZBA A;  3VI5 A;  3GKX A;  1V2A A;  1M7T A;  1CQG A;  4D73 B;  3MIX A;  3W6G A;  1SKW B;  2HZE A;  2RM5 A;  1QFN A;  4XRA A;  1SK1 A;  1M9B A;  2HZF A;  4DSQ A;  2HFD A;  2QSI A;  3VWU A;  2G0F A;  1JLV A;  3UVT A;  2KLX A;  1RW1 A;  1TU7 A;  3RBT A;  1PKW A;  3GHA A;  4KA0 A;  2K9F A;  1HD2 A;  1R26 A;  3GRX A;  3I43 A;  3ISO A;  3ERG A;  1NM3 A;  2B6M A;  1J9B A;  3ZTL A;  3IAS 2;  3EU3 A;  3KH9 A;  2LEG A;  2X8G A;  4WBJ A;  5IM9 A;  1AQV A;  1OVN A;  2C0E A;  3BCK A;  5ECO B;  5AIX A;  1DBY A;  2H1B A;  1O81 A;  4TKY A;  2OKA A;  2VLV A;  3IV4 A;  3V1W A;  2IMD A;  4MZB A;  4WF5 A;  3BCI A;  4YQV A;  1JFU A;  2GGT A;  3IOS A;  3EWL A;  2LQO A;  5GSS A;  4ZBB A;  1YQ1 A;  3HVX A;  5EPF A;  2DKI A;  2RLI A;  5H5S A;  4PQ1 A;  1V9W A;  1MD3 A;  2EIR A;  3TDG A;  1Y25 A;  3UBL A;  4V1A p;  2AJQ B;  3N9J A;  1XVQ A;  3HXS A;  5AGY A;  4HJ2 A;  2HSM A;  3KCM A;  3QAG A;  1R5A A;  1KTE A;  5DAK B;  2IMI A;  1A8L A;  4DSS B;  2L6C A;  4CHS A;  1GSS A;  4G10 A;  2TRC P;  4L5O A;  1XWG A;  5DJL A;  4O5Q A;  3TKS C;  4X4J A;  2WCI A;  1PL1 A;  4MZW A;  5ID2 A;  1XW9 A;  3KGK A;  1XVW A;  3WT2 A;  5DCG A;  5J41 A;  4K5R A;  3KIJ A;  2XPD A;  2MMN A;  3O6T A;  4NPB A;  5CRD A;  1T8E B;  3CSH A;  2HT9 A;  2LS5 A;  5ELG A;  3ZIJ A;  4TXO B;  4KGI A;  3MSZ A;  4ZBD A;  19GS A;  4YKG A;  4D73 A;  4MDC A;  2M46 A;  2X64 A;  3TJF A;  4HZ4 A;  1XCC A;  3NOF A;  3GX8 A;  1SK0 A;  4KSO A;  1EOH A;  3IPZ A;  2GQK A;  1QMV A;  4TOP A;  2I1U A;  1SD9 A;  4YH2 A;  2FY6 A;  4USS A;  2ZCT A;  1A2L A;  3LXT A;  1V98 A;  4JR4 A;  2GDR A;  1EEJ A;  1QQ2 A;  3A5I A;  4KB3 A;  3EMP A;  3WGE A;  2HRK A;  2QC7 A;  5F07 A;  1TRS A;  3C7M A;  2HYX A;  2Z9S A;  2CZ2 A;  2PU9 C;  4EDY A;  1GSY A;  1ZYQ B;  4POL A;  4L0W A;  4MNN A;  4GST A;  5CNW A;  4FH8 A;  4EIP A;  3D6I A;  4K7N A;  1PD2 1;  3E3E A;  1VF3 A;  4MPG A;  3A5W A;  2R6K A;  1SKS B;  3O3T A;  1X9W B;  3F4T A;  6GSX A;  1T1V A;  3KZQ A;  2DLX A;  2VLU A;  2FCH A;  4O5R A;  5IMF A;  4KE3 A;  1ERW A;  4MPF A;  3QAW A;  3RHB A;  1YEP A;  2LKU A;  3VPQ A;  1G0T A;  2F8A A;  4GRF A;  5DAK A;  4LL4 B;  3EPT A;  1SYR A;  1BX9 A;  4IS0 A;  3RAZ A;  2FWG A;  2RUF A;  2XHF A;  1BED A;  4BPY A;  5E4W A;  3BD2 A;  2REM A;  2A4V A;  4MH2 A;  3MNG A;  2D2Z A;  2WZ9 A;  4POB A;  2DML A;  1FOH A;  2C3N A;  5AN1 A;  2DJK A;  3DVX A;  4TXO A;  4NXI A;  4XIH A;  3VLN A;  2IJY A;  2P0G A;  3UMA A;  1M2B A;  2I3Y A;  4G0L A;  1BAY A;  3CRT A;  4OFT A;  3H1N A;  2DSA A;  2F8F A;  1YKA A;  2XPE A;  4KX4 A;  4IHU A;  3IAM 2;  3D4T A;  4EC0 A;  4Z2T A;  1LJR A;  2DJ0 A;  2YOI A;  5DVB A;  5F0G A;  3HA9 A;  2RUE A;  1TXX A;  4NHZ A;  2LNT A;  4EO3 A;  2C4J A;  1OKD A;  5HR3 A;  1JZR A;  2MMA A;  3G7Y A;  2O87 A;  2JAD A;  3DIE A;  4K8M A;  5G31 A;  8GSS A;  3UL3 A;  1WJK A;  2VL2 C;  3C8E A;  1SJ6 A;  14GS A;  4I6X A;  1A2M A;  1PSQ A;  4Q5R A;  2R0C A;  4AJ7 A;  2H75 A;  2WS2 A;  1JHB A;  5AIS A;  1A8Y A;  4IN0 A;  1AC1 A;  2PPT A;  2K6V A;  5KOX A;  3IBH A;  4LLR A;  5COH A;  2DC5 A;  2H1D A;  4RI6 A;  1JZO A;  1EWX A;  3WGX A;  2B5E A;  3FK8 A;  4G9H A;  1MDJ A;  3FR3 A;  4CDO A;  1FOV A;  4TXV A;  3M9J A;  3L0H A;  1XFL A;  2YPM A;  1FO5 A;  1R4W A;  2KUC A;  3ZL5 A;  1YKC A;  4ML6 A;  2N5A A;  4IBP A;  3D22 A;  2CA8 A;  2YP6 A;  1KEB A;  2NTO A;  4KDU A;  2LJK A;  4JBB A;  3LFL A;  3TRP A;  5GAP D;  1MD4 A;  4FYC A;  2N5B A;  2MZC A;  1B8X A;  3HJM A;  4ILF A;  1WRY A;  3IRA A;  2PWJ A;  4O5U A;  5KN3 A;  1GH2 A;  4HQS A;  2X99 A;  4MMM A;  4J2F A;  3R3E A;  5DQS A;  1Q4J A;  2H0G A;  2VD1 A;  5DJM A;  3IC8 A;  1URM A;  1PX6 A;  2HRN A;  4WKW A;  2IME A;  3LG6 A;  3KP8 A;  4CY6 A;  2JZR A;  4MH3 A;  2YZH A;  3HCZ A;  4KSM A;  3D21 A;  2H74 A;  4BWQ A;  1THO A;  1XZO A;  3APQ A;  1K0D A;  3WT1 A;  4XCS A;  4GSN A;  1B9X C;  3CSI A;  5IMA A;  3M9K A;  2C3T A;  2YN1 A;  4IQ1 A;  1EGO A;  3QDN A;  3GYK A;  3EYT A;  2L59 A;  3DKS A;  4N10 A;  3IHG A;  5DCH A;  1ZYE A;  2I4A A;  2QA2 A;  3F6D A;  4ECJ A;  3F63 A;  2GZY A;  4OD7 A;  5J3R A;  3DYR A;  1PX7 A;  1YEX A;  3ME7 A;  4KDX A;  2OE1 A;  1EV4 A;  3GKK A;  3GKM A;  3P8W A;  3WD6 A;  2QKE A;  3IDV A;  2X8C A;  3D5J A;  6GSY A;  3SWL A;  2VM2 A;  1GNE A;  2DBC A;  2VCQ A;  3C1S A;  4EVM A;  1WE0 A;  2GT6 A;  4BVX B;  3QD9 A;  1I9D A;  3HVS A;  4G19 A;  3LOR A;  4WET A;  1V57 A;  4HJM A;  2WFC A;  2CVK A;  5BMU A;  4K2X A;  2FUG 2;  1X5D A;  1FB0 A;  9GSS A;  2YCD A;  1ZGN A;  2FWH A;  1OE8 A;  5INY A;  1PGT A;  3APO A;  3F6F A;  4XHM A;  5J9B A;  1U6T A;  5GST A;  4L5L A;  3NIV A;  4RQR A;  3QR6 A;  2WRT A;  2K18 A;  1F9M A;  2PUK C;  2AHE A;  1B48 A;  5L71 A;  1A0F A;  4X1U A;  2R37 A;  4MF6 A;  4NHW A;  6GSV A;  4FO5 A;  2VCV A;  1TJD A;  1XWK A;  3ZIT A;  5A4W A;  1SKR B;  1C72 A;  3MYD A;  2DJ3 A;  3TOT A;  2H70 A;  3F3R A;  4MJC A;  3UJ1 A;  2GVP A;  2O7K A;  2FWE A;  4ZXG A;  4WR5 A;  2FLS A;  5CRG A;  5J5N A;  1OC8 A;  4TN8 A;  4MP4 A;  1Z9H A;  5HR1 A;  3F4S A;  3DGQ A;  2JL4 A;  2H0H A;  1FVK A;  2A4H A;  1HNB A;  4ICY A;  2GST A;  1FVJ A;  5DAL B;  3TB2 A;  3IXR A;  5CAX A;  1VF1 A;  1B9Y C;  2M72 A;  5C00 A;  2MBT A;  2KOK A;  5A5K A;  3L9S A;  4IW9 A;  2F51 A;  3G7I A;  1DSB A;  3ED3 A;  4GSS A;  4EXJ A;  3VFI A;  4F0B A;  1X5C A;  5C04 A;  2AV4 A;  4PX1 A;  1XIY A;  1M9A A;  2QGV A;  5IPH A;  3KD0 A;  4LL1 B;  1A23 A;  2H8L A;  1Z5Y E;  1SL0 B;  3FEU A;  2BMX A;  4HEA 2;  5H5Q A;  2R5G A;  2LV3 A;  2O85 A;  4G0K A;  4DSR A;  2X49 A;  2EC4 A;  4E8E A;  3ZRE A;  6GSU A;  4BVX A;  2YJH A;  3M3M A;  3UBK A;  1IYI A;  1F2E A;  3FW2 A;  5G2Z A;  2CQ9 A;  2M80 A;  4EDZ A;  1ZYP A;  2CZ3 A;  5G5E A;  4K7I A;  2J9H A;  3IHQ A;  1S3C A;  4RQX A;  2CX4 A;  4KDY A;  5G5F A;  2IPA A;  1SYX A;  2KHP A;  2DIY A;  2EIQ A;  1WPI A;  2G2Q A;  4EKZ A;  2CVB A;  3FR6 A;  4MJB A;  4QL9 A;  3FZ5 A;  2OBI A;  5KN1 A;  3U6V A;  2OAD A;  4ACS A;  3FKF A;  3ZRD A;  3RPP A;  3TKS E;  2HE3 A;  3QCP A;  5EVO A;  4PTS A;  4Z2R A;  2H0I A;  2OAC A;  1YY7 A;  3HVV A;  3UIW A;  3O76 A;  1F3A A;  3Q6O A;  1R7H A;  5IO0 A;  1K0C A;  1TK5 B;  3MDK A;  4FQU A;  3UEM A;  4CY8 A;  1GUH A;  2IFQ B;  5CP1 A;  3TRX A;  2CT6 A;  3CXG A;  1XWA A;  5HR0 A;  3H4K A;  3VWX A;  2V41 A;  4HQZ A;  5IMC A;  5ECQ B;  2OE0 A;  5JCW A;  13GS A;  2VM1 A;  3CTG A;  4MJE A;  5D8I A;  3F0I A;  3GUS A;  1TI1 A;  2A2S A;  3I6A A;  4HOJ A;  2VIM A;  2GSR A;  4IP1 A;  2TIR A;  3LYP A;  2VCW A;  3S9F A;  2HI7 A;  5BRT A;  3ERF A;  2PER A;  5IOW A;  2NPB A;  2C0G A;  2ALB A;  4F9Z A;  3US3 A;  3FR9 A;  2B5Y A;  2KP2 A;  2CVD A;  2H30 A;  3ZVJ D;  2JAC A;  4HU9 A;  5CRE A;  1PN9 A;  4I2U A;  1VF4 A;  5FT3 A;  1WOU A;  2PBJ A;  2F3M A;  3GV1 A;  4BA7 A;  3M0F A;  1S3D A;  2CAQ A;  2H71 A;  2NBS A;  1Z6M A;  1GUM A;  3RDW A;  2B7J A;  2I9H A;  3QOU A;  3TOU A;  5D73 A;  5F05 A;  1AQW A;  3GNJ A;  11GS A;  1THX A;  5F06 A;  2PGT A;  5IIZ A;  4GWR A;  2LRN A;  2C0D A;  4EF0 A;  1AUC A;  4DSS A;  1HNC A;  3FMW A;  1XBS A;  1JLW A;  1RK4 A;  2H19 A;  3DD3 A;  3QFA C;  2LJA A;  1VGL A;  1ML6 A;  4ZIJ A;  4IKH A;  2MBS A;  2H01 A;  2LTK A;  3GN3 A;  3A2X A;  1SD8 A;  4MZC A;  4LMV A;  1O6J A;  4F03 A;  3KMO A;  3KH7 A;  4ID0 A;  1TRW A;  2C3Q A;  2HRA A;  3A3T A;  2YJ7 A;  2B5X A;  3TKR A;  2R0P A;  2B1K A;  1RQM A;  5ECK B;  1PA3 A;  4NWY A;  1I5G A;  10GS A;  1M0U A;  4IJ3 A;  1A0R P;  4ISD A;  4MK3 A;  5KOW A;  4JU5 A;  5LNK e;  2YWI A;  4IVF A;  1A24 A;  12GS A;  2MYG A;  2IFQ A;  1H4O A;  1NSW A;  2AAW A;  2WGR A;  3IC4 A;  5ECM B;  5F8B A;  1W89 A;  1PMT A;  1CQH A;  5B8A A;  1EZK A;  1GTI A;  2C0F A;  1ZZY A;  1TW9 A;  2V1M A;  1B4Q A;  2YWO A;  3FZ9 A;  3G9B A;  5J4U A;  1WMJ A;  1W4V A;  4FIW A;  1O8W A;  2E2M A;  3IK9 A;  2YZU A;  3N5O A;  4ECB A;  2NVL A;  3CMI A;  3FYG A;  2JSZ A;  4MLY A;  2LRC A;  5B6M A;  4Z2U A;  4YKF A;  4ECC A;  1VRS D;  4BL7 B;  1BQ7 A;  2DIZ A;  1HNA A;  4KW6 A;  1UN2 A;  5ELA A;  3A2W A;  5IMD A;  1EEM A;  1T7P B;  3HJO A;  4IP6 A;  1AXD A;  2C8U A;  5DDL A;  1FW1 A;  1Q98 A;  1UA5 A;  3DXB A;  2GLR A;  4OFN A;  3TGZ A;  3HZ4 A;  5HFK A;  4TR3 A;  2H1A A;  1HYU A;  2V6O A;  4GQF A;  2DJ1 A;  2VCT A;  1O85 A;  2B7K A;  4BVY B;  3F4R A;  2GQL A;  1U88 A;  5AIV A;  3ZML A;  2LJR A;  4TVE A;  3RHC A;  2H6X A;  1K3L A;  2VLT A;  3FZ4 A;  1O7U A;  5ECH B;  1XOA A;  2IL3 A;  3P90 A;  5D9T A;  5IQY A;  1G7E A;  3KJY A;  3PPU A;  1NHO A;  4K7O A;  2L5L A;  5LD0 A;  1VF2 A;  1JZD A;  20GS A;  2FA4 A;  3KEB A;  2E0Q A;  1FB6 A;  2O89 A;  3EC3 A;  4OCE A;  3GST A;  1N8J A;  2AB6 A;  2PVQ A;  1GTU A;  3QAV A;  3HDC A;  4Q5F A;  1Z3E A;  3CSJ A;  2WB9 A;  4K0G A;  4H86 A;  2JZT A;  2YAN A;  4MAB A;  4O92 A;  2ZUP A;  2LUS A;  2H1G A;  1BYE A;  1K0O A;  4V2N A;  1SL2 B;  1HQO A;  2B1L A;  3TJB A;  1XXU A;  1Y6E A;  1AIU A;  3ZVJ A;  2FA8 A;  2LRT A;  3EE2 A;  3GH6 A;  3KP9 A;  3L9V A;  4I2T A;  1EGR A;  5HR2 A;  5IMV A;  1BJX A;  3GMF A;  2K8V A;  3GSS A;  2FWF A;  3ME8 A;  1QUW A;  2XBQ A;  6GSS A;  4WF4 A;  4QL7 A;  4CW9 A;  1GTA A;  4WR4 A;  5A4U A;  3ZLP A;  1X9M B;  1GLP A;  4ECI A;  3ZIV A;  1G6Y A;  3TUE A;  1DUG A;  1M2A A;  5D9W A;  5DQY A;  1ACV A;  1ZYN A;  4HU7 A;  4ZL9 A;  1SK2 A;  3NZN A;  1G7O A;  2YNX A;  4BWS A;  2H73 A;  3EMX A;  3DVW A;  4V2M A;  4BL7 A;  1TP9 A;  4A5P A;  1PKZ A;  4IGJ A;  4X43 A;  4K2D A;  3GL5 A;  2O8V B;  2BTO T;  4XS4 B;  2VOC A;  1X0R A;  5KN2 A;  4KUN A;  2R3X A;  5CRH A;  2HNL A;  5EL8 A;  4TRX A;  2PN8 A;  1F37 A;  2QA1 A;  1GNW A;  2VL9 A;  3EVI A;  4BVY A;  1QXH A;  3VWW A;  3EU4 A;  1FG4 A;  1OKT A;  2X8H A;  16GS A;  1USB A;  1GUK A;  4ZB6 A;  4PQI A;  4N11 A;  3P7X A;  2YV9 A;  1GTB A;  3HKR A;  2AUV A;  2V32 A;  1GWC A;  3C1R A;  3UOM A;  1LU4 A;  1YJ6 A;  18GS A;  2GT5 A;  4MF7 A;  1ZCP A;  3HYP A;  4HS1 A;  3LXZ A;  2HSH A;  1KNG A;  5A4V A;  1SU9 A;  1K3O A;  2YWM A;  3CTF A;  5ECS A;  2MMZ A;  2JSY A;  2UZ8 A;  1BG5 A;  3PH9 A;  3LYK A;  2CX3 A;  1E2Y A;  2VAF A;  4MA9 A;  5ENU A;  5CYY A;  4GXZ A;  1OYJ A;  1T00 A;  3F9U A;  1G6W A;  5ECP B;  1M99 A;  4LA1 A;  4IEL A;  4TR1 B;  2FNO A;  1S3A A;  4J57 E;  3FZA A;  1YF0 A;  4KAE A;  1E6B A;  5D9V A;  3UAR A;  3TKQ A;  5E59 A;  4HI7 A;  4Q5N A;  2HSY A;  4RUV A;  1EP7 A;  5B6N A;  4GQC A;  3Q74 A;  2L4Q A;  2CV4 A;  3VI7 A;  3FHK A;  3GA4 A;  4PUF C;  4JED A;  1FAA A;  3GKN A;  3Q18 A;  3GTU B;  2I81 A;  4XS1 A;  1ON4 A;  4Z7X A;  7GSS A;  4PNG A;  3H93 A;  1SJZ A;  1J08 A;  3LWA A;  1U3I A;  4LMW A;  4QQ7 A;  3LEF A;  1QGV A;  1H75 A;  1X9S B;  4GLT A;  2H6Y A;  2MMO A;  1T4Z A;  3UVH A;  2FD3 A;  1TU8 A;  5G30 A;  2C80 A;  4MCU A;  3TJJ A;  3DML A;  2P5R A;  2ON7 A;  4O32 A;  4XS4 A;  2VCZ A;  1TDI A;  1A2J A;  3HHV A;  4K6X A;  4X0X A;  1Z7R A;  1TI3 A;  2OJL A;  3TJG A;  1ZOF A;  4EIQ A;  4HUA A;  1Z7P A;  1AW9 A;  4NV5 A;  3W8J A;  1AAZ A;  4K9Z A;  4I5Q A;  2DJ2 A;  1U3A A;  3BOA A;  4KCE A;  2JU5 A;  4OO5 A;  1K0B A;  2R2J A;  3ERW A;  2PVO C;  1T3B A;  5G1K A;  3QPM A;  3H8Q A;  4KND A;  1ABA A;  2R4V A;  3RPN A;  4GTU A;  1GUL A;  3DWV A;  1ERT A;  2AYT A;  4MJA A;  3U5R E;  5JWR B;  3GUR A;  2B3S A;  3LSZ A;  1TRU A;  1XOB A;  2FHE A;  4K5S A;  3IE3 A;  5FWG A;  1N2A A;  4AJ6 A;  2IMK A;  4ULX A;  4HZ2 A;  4HDE A;  3I9V 2;  2LNS A;  4I97 A;  4V1A g;  3M8N A;  3QFB C;  1NHY A;  1NW2 A;  5H5R A;  3TKP A;  1EV9 A;  4TR1 A;  3FY7 A;  1ST9 A;  3F8U A;  1OE7 A;  2WDU A;  2VL3 A;  3ZZX A;  2OBK A;  5DAL A;  5JWQ B;  3QMX A;  3KM6 A;  3D4M A;  1JZW A;  1XWB A;  3EIN A;  2ZNM A;  4WBR D;  5D9X A;  3HY2 A;  3OR5 A;  1IYH A;  1F3B A;  2P31 A;  3G7J A;  4ZIL A;  3PR8 A;  3LQ7 A;  3F3Q A;  3LJR A;  1ZMA A;  3GTU A;  1O8X A;  1R5P A;  2YV7 A;  4J56 E;  2X4A A;  3HZ8 A;  4PGT A;  1K0A A;  4KH7 A;  2J23 A;  4TR4 A;  2LST A;  4EUY A;  2V6K A;  2IWT A;  2VD0 A;  1GSU A;  2H72 A;  6GST A;  1X5E A;  1KBN A;  4PQH A;  4ML1 A;  1YF1 A;  4O7H A;  5DBQ A;  4PUR A;  3LGC A;  2H6Z A;  2GS3 A;  4JE1 A;  4IQA A;  4G2E A;  2WJU A;  4XS6 A;  3GFK A;  4PNF A;  3VUR A;  4AF2 A;  4L8E A;  3KTB A;  1ZL9 A;  4E8H A;  2VUP A;  2DKH A;  5HQP A;  2RII A;  1MDI A;  1MDK A;  2L6D A;  1B4P A;  4I8B A;  3WYW A;  4YQM A;  1TTZ A;  1PRX A;  2H76 A;  2TRX A;  4XRD A;  1YZX A;  3L78 A;  1SL1 B;  3TKS A;  4IJI A;  1AQX A;  3PGT A;  3MWH A;  3TCO A;  1TKD B;  3VK9 A;  5JCU A;  22GS A;  3M1G A;  2XBI A;  1MEK A;  1UVZ A;  2GSQ A;  1ERU A;  3CYN A;  3DRN A;  3APS A;  2DJJ A;  2GZP A;  2A2R A;  4F2I A;  3UAP A;  2L4C A;  4JR6 A;  1GSE A;  4NV2 A;  3L4N A;  1K0N A;  4F0C A;  2LQQ A;  4NMU A;  1F6M C;  4POM A;  2HLS A;  1SJI A;  1K3Y A;  1PN0 A;  3KMN A;  1YDK A;  3VPT A;  1TK0 B;  2ES7 A;  4NAX A;  2R0G A;  5CO3 A;  4FYB A;  1WIK A;  4OWY A;  4F82 A;  3WGD A;  2L57 A;  4G0I A;  5IOX A;  1GRX A;  5FHI A;  5LCZ A;  3KXO A;  1U87 A;  3GX0 A;  1OC9 B;  1GL8 A;  4EL1 A;  3J7Y k;  3H79 A;  3GIX A;  5HFI A;  3CBU A;  2OE3 A;  3ZFL A;  2GSS A;  2A2P A;  5ECI B;  2GZZ A;  4ZL7 A;  4WEY A;  1OAZ A;  3PIN A;  1FHE A;  3BBY A;  4ZL8 A;  2VO4 A;  3IR4 A;  2GQM A;  1OC3 A;  5D93 A;  3MAK A;  2WUL A;  2ON5 A;  3I69 A;  1GSF A;  1V40 A;  1WP0 A;  5CRW A;  4RI7 A;  1EOG A;  2H66 A;  2N5F A;  3Q19 A;  4OMV A;  3L9U A;  1QK8 A;  5IPG A;  4YQU A;  3D0Z A;  1XW6 A;  3BJ5 A;  5B8B A;  1GSQ A;  4L0U A;  3JCM L;  3GH9 A;  3TRQ A;  5D96 A;  6GSW A;  2P5Q A;  4V2L A;  5IMZ A;  2L5O A;  4EE0 A;  2NDO A;  4XTS A;  3ZMK A;  1UC7 A;  1ILO A;  3K8N A;  1K0M A;  2OA7 A;  2E7P A;  4AGS A;  3ZFB A;  3P2A A;  3C71 A;  4JZQ A;  4FYU A;  1WWJ A;  5ABR A;  4KF9 A;  4K0N A;  1V58 A;  3SBC A;  5EY6 A;  3IA1 A;  2HZE B;  4N30 A;  1XW5 A;  1XPV A;  2K8S A;  3HJP A;  1DE1 A;  2JZS A;  2HRF A;  2YWN A;  3ZYW A;  2RM6 A;  4OFM A;  2CAI A;  5GZZ B;  2BJX A;  2IN3 A;  3HD5 A;  2GTU A;  2PMT A;  1PL2 A;  3GL3 A;  4JRR A;  2IIY A;  3C73 A;  3KTL A;  1SEN A;  3AY8 A;  4Q5Q A;  2VL2 A;  1M2D A;  2F9S A;  17GS A;  1OC9 A;  4KCA A;  1Z6N A;  3VWV A;  3A2V A;  4YAP A;  5B7C A;  2C1Y A;  3W8S A;  1XWC A;  2EIO A;  1MTC A;  4ZB8 A;  1TOF A;  3R2Q A;  4K1F A;  3CRU A;  4DVC A;  1T4Y A;  5ECL B;  1TK8 B;  5KN0 A;  2KP1 A;  2VCX A;  4TR0 A;  4OO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...