1R4WA

Crystal structure of mitochondrial class kappa glutathione transferase
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
221
Chain Sequence
GPAPRVLELFYDVLSPYSWLGFEVLCRYQHLWNIKLKLRPALLAGIMKDSGNQPPAMVPHKGQYILKEIPLLKQLFQVPMSVPKDFFGEHVKKGTVNAMRFLTAVSMEQPEMLEKVSRELWMRIWSRDEDITESQNILSAAEKAGMATAQAQHLLNKISTELVKSKLRETTGAACKYGAFGLPTTVAHVDGKTYMLFGSDRMELLAYLLGEKWMGPVPPTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase, mitochondrial
publication title Parallel Evolutionary Pathways for Glutathione Transferases: Structure and Mechanism of the Mitochondrial Class Kappa Enzyme rGSTK1-1
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 77
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2003-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1r4wA01
1TU8A 1PL1A 2RUEA 1C72A 2DMMA 4AJ8A 2J23A 2GZPA 4IKHA 1GNWA 4WF5A 2FUG2 3WT1A 1T00A 2C0DA 1ZMAA 4F0CA 4Q5QA 2AJQB 5CNWA 4KNDA 4WETA 4CW9A 4O7HA 3L9VA 3HD5A 5IQYA 3BOAA 3KMNA 1M7TA 4OO4A 2RM5A 3N5OA 2NBSA 2IN3A 3VI7A 1V9WA 5G2ZA 2YANA 4MJEA 4JZQA 2N5AA 1VF4A 3BBYA 1XCCA 4XCSA 1DSBA 5J5NA 3IAM2 3GSSA 1Q98A 1ZL9A 5D9TA 3KP9A 3GIXA 4I6XA 4MH3A 4N0ZA 4K1FA 5H5RA 2CA8A 3TKSE 5ECMB 4OCFA 4WEYA 2A4VA 4TOPA 1UN2A 1PKWA 2DBCA 3FRCA 4K7IA 3DYRA 3MNGA 1XXUA 5D96A 4FYUA 1ZZYA 4NXIA 2FCHA 4RI6A 2IFQB 3HYPA 3TJGA 4DSRA 1TRUA 4PQHA 4V1Ap 3SWLA 4EDZA 2BJXA 3APSA 2HZEB 2FGXA 2KP1A 4TXOB 2QC7A 4KE3A 5LCZA 1NHYA 2I81A 2XC2A 2CZ3A 5HFKA 2YZUA 1FO5A 3IRAA 2PMTA 4FYCA 1YEXA 1TDIA 3GNJA 5J9BA 5ECHB 1SU9A 5ABRA 1HNBA 2MYGA 2R6KA 3L9UA 3IV4A 4PGTA 4CDOA 2ALBA 1MEKA 2MMOA 2VO4A 1GTUA 1TP9A 6GSSA 2YWNA 3CBUA 3M8NA 4OMVA 2O85A 1H75A 5JWRB 5DAKB 3ZFLA 4WF4A 4V2LA 4X1UA 1MD3A 4GSTA 1V57A 2HRNA 3UBKA 3ZVJD 2PN8A 2A2SA 2WCIA 5FT3A 1RQMA 3EU3A 4K7NA 3ZVJA 2O7KA 2H66A 3KD0A 4DEJA 4HEA2 3TUEA 2F3MA 1TK5B 2QSIA 4AJ7A 5F07A 5H5SA 2CZ2A 5HFIA 2LQOA 5G5FA 1O8XA 1OKDA 4ZL9A 4AJ6A 2VM1A 3RHBA 1YKAA 4EDYA 1Z7PA 5IOXA 2HSYA 1GTBA 1A0RP 5ECLB 3L9SA 5E59A 2LSTA 6GSUA 2WZ9A 5H5QA 2YWIA 1B9XC 1T1VA 2VL9A 3LFLA 1K0AA 2GGTA 4I2TA 5CAXA 4FIWA 5G1LA 4YQMA 3CTGA 3GH6A 1T4ZA 4MDCA 3PGTA 2X64A 3G7YA 1V58A 1Z5YE 1GUKA 3O6TA 1JZDA 3ZZXA 2C3NA 4ZILA 1XWCA 3EU4A 3D4TA 3MWHA 4KCAA 1ZYEA 1NM3A 5FWGA 3FYGA 4JEDA 2ZNMA 1BAYA 1O6JA 1XOBA 1OAZA 2PVOC 3WYWA 3CXGA 4IBPA 4E8HA 2KOKA 2LNTA 1PL2A 3IAS2 1GWCA 5DCHA 1DUGA 4N11A 2L6DA 4POKA 1PRXA 5ID2A 3J7Yk 1X5EA 2OA7A 3CRTA 3UEMA 3LGCA 5DQYA 3VURA 3BJ5A 2ON7A 3I43A 2QGVA 3OR5A 1F9MA 1ON4A 5FHIA 1OE8A 4V1Ag 2YJHA 1N2AA 5C00A 2AUVA 3M1GA 5DQSA 1MDJA 2HYXA 2WGRA 3J7Yb 4KW6A 4POLA 4DSQA 4J2FA 5JCGA 4YH2A 5AISA 3F9UA 4OFTA 4ZB8A 4POMA 5CRDA 4G2EA 3ZLPA 4GSNA 2XBIA 2H1GA 2R37A 2ON5A 4TR4A 2HZFA 4KX4A 1SENA 3P7XA 2PERA 1JZRA 3SBCA 4MF7A 5ECKB 2IL3A 1IYHA 2AHEA 4TR3A 2CVDA 3KJYA 1XW9A 3QAVA 2B7JA 4OFMA 2FLSA 2YP6A 4HQZA 3P2AA 4JE1A 1YDKA 1TI3A 3W8JA 2E2GA 3KGKA 4RQRA 1OC9B 4NWYA 1X5CA 3GHAA 1SK0A 1PSQA 2VCTA 3GUSA 3DWVA 4OFNA 4MPFA 2VOCA 2GZYA 4NMUA 3RHCA 3ZRDA 4L0UA 3TKRA 3MAKA 1W4VA 3D5JA 5CRGA 4LMWA 2YCDA 3DRNA 4DSSB 5INYA 3CSHA 3NZNA 1FVJA 2DJ1A 3GX8A 1K0OA 4NV5A 1M99A 1B8XA 5EL8A 2H73A 2LKUA 3HVVA 2DSAA 1JZWA 3TJJA 3RAZA 1SKRB 1PX6A 1WPIA 3H79A 2NPBA 2LRNA 1H4OA 4BVXA 4XHMA 3DEXA 3LG6A 2P5RA 2WULA 3VPQA 1SL0B 5DJLA 2VCZA 3PINA 2LNSA 4ECCA 1VF1A 2H1DA 2CX4A 3ZIVA 1GRXA 2B6MA 3C8EA 3GKMA 2HT9A 3FR6A 4WR4A 5IMFA 2H8LA 4HZ4A 4LL1B 2IIYA 4ECIA 1TOFA 5F06A 5F8BA 3EYTA 1K3YA 1F37A 6GSWA 3IDVA 1DBYA 2VAFA 2WJUA 2DJKA 2D2ZA 4HU9A 1SK1A 1SJIA 2X8CA 3TRQA 4EO3A 1GLPA 2VCQA 2I1UA 1A2JA 4EUYA 2XHFA 4I5QA 1XW5A 4JRRA 4TR1A 1EV4A 4Z7XA 5GAND 4WKWA 5DJMA 3GKNA 4KSOA 2C0FA 4F82A 5IIZA 3LJRA 3KIJA 5KN1A 4PUFC 2F8FA 3WGXA 3RDWA 3FZ4A 1X9WB 4TR0A 1R5AA 4TRXA 2LV3A 1AUCA 3I6AA 4XS4A 3F4RA 3WT2A 5L71A 4L8EA 2I3YA 1AIUA 3KTLA 3GN3A 1GH2A 5KN2A 3A2XA 1QK8A 8GSSA 2R3XA 1TK8B 2P0GA 4MZCA 3QD9A 3A2VA 5G5EA 4IJ3A 3BCKA 3CRUA 2GQLA 1B4QA 4IP6A 4K6XA 3PR8A 2A2RA 1TRSA 5E4WA 2LTKA 4BA7A 6GSYA 5HR1A 1THOA 1GTIA 5IMDA 10GSA 3CSIA 5KEJA 3GKXA 3UBLA 1VF2A 1J0FA 2IPAA 3VI5A 1PMTA 4WXTA 2HI7A 5IPGA 3G7IA 1Y25A 4LLRA 19GSA 6GSVA 3GKKA 5JCWA 3ZREA 5IO2A 1XPVA 3HDCA 5J4UA 4N10A 5DVBA 2ZUPA 1QUWA 3P90A 3QDNA 2CVKA 2OBKA 5G1KA 3ZTLA 3FKFA 4BL7A 3HA9A 4FH8A 1F2EA 1XW6A 4KSMA 3IK9A 1EP7A 4TXOA 3IA1A 4GSSA 1N8JA 5ECPB 1IYIA 1U88A 1ERVA 22GSA 5ECRB 1M9BA 2WFCA 4WR5A 3TCOA 4YAPA 4D73A 2C3QA 2IMFA 1SL1B 1T8EB 1GSSA 1EWXA 2I9HA 1EEMA 3KP8A 1V2AA 1CQGA 1K3OA 5EPFA 3P8WA 4JU5A 1A8YA 4ID0A 5HR2A 4KUNA 2N5FA 3CMIA 3APOA 2H74A 3ZITA 2GSRA 4RUVA 5DALB 1G7EA 2V1MA 2H75A 4I8BA 1M2AA 4Q5NA 1XFLA 3JCML 4ZIJA 3HKRA 3GL3A 2X8GA 1FVKA 4POBA 2JACA 5AGYA 5CRWA 1K0CA 1A8LA 4GRFA 4L0WA 1HQOA 1KNGA 4TN8A 4YQVA 3N9JA 3UVHA 1ZYQB 3U5RE 4YQUA 4ECJA 2TIRA 2FWGA 2O8VB 2IMEA 4EXJA 5CREA 3FR3A 3US3A 2BMXA 1UA5A 2YWMA 4HJ2A 2KP2A 1DE1A 1EV9A 3F6DA 4MPGA 1OC8A 2C4JA 3FY7A 3DKSA 2X8HA 2CAIA 3DVWA 1S3CA 3GFKA 3L78A 3LSZA 2H6ZA 3HJOA 4WBJA 4MH2A 2AAWA 2H1BA 3EMXA 1PKZA 7GSSA 3QOUA 1LJRA 1TJDA 4LL4B 1TKDB 3E0UA 2V32A 2K8VA 3ME7A 4PXOA 4MJBA 4GQFA 2I4AA 3DIEA 4ILFA 4HS1A 4V2NA 5IO0A 1MDKA 2VCWA 3M0FA 1VGLA 5B8BA 4GCIA 4IP1A 4ZBBA 1QXHA 1GUMA 5D9VA 2H01A 2DLXA 2CV4A 1A0FA 4PQIA 2H0HA 4ML1A 2PU9C 3ERWA 3TOTA 2G0FA 1WMJA 3UMAA 1U6TA 2B1KA 5J41A 3EWLA 3ZMLA 3GX0A 1DE2A 4O5RA 3GYKA 4KGIA 3D0ZA 3LYKA 3KH9A 5A4WA 5CO3A 4IQ1A 1Z6MA 3GTUA 1XVQA 2PGTA 2PUKC 2DIZA 4BVYA 4JR4A 3Q19A 2ZCTA 1SJ6A 1YJ6A 2C80A 2FWFA 5IPHA 4ZXGA 2GT6A 1SD9A 20GSA 1K0DA 3W8SA 3GSTA 4GQCA 1ZOFA 3KTBA 3TJKA 2OBIA 4XS1A 3HJMA 1BG5A 1KBNA 2C0EA 4IS0A 4G19A 2H72A 5HR3A 1WRYA 3ZYWA 3H93A 5ECSA 3C71A 5G30A 3TKQA 3C1SA 2KHPA 1GSFA 1NSWA 2YNXA 5J9CA 3I9V2 5GAPD 1LU4A 3TOUA 2M80A 3KH7A 2N5BA 4E8EA 1BQ7A 2OACA 2HXKA 4IVFA 2YV9A 3VWWA 1GULA 2OADA 4Q5FA 5G31A 1ERTA 5D93A 4G10A 1PGTA 2L6CA 4F9ZA 4YAVA 1U87A 2TRCP 3TDGA 2DJ2A 1XBSA 3GURA 5JWOB 2H70A 1W89A 3VWXA 4NAXA 1G0TA 1B4PA 1O81A 2C1YA 1URMA 2JSZA 5DBQA 1OC3A 2DC5A 3QAGA 2VCVA 4O92A 5IMZA 3DXBA 2FY6A 1X0RA 4F0BA 4L5OA 4CHSA 2CAQA 1ERWA 3C1RA 3IBHA 1O8WA 2RM6A 1B48A 2GQMA 4HU7A 4I2UA 2JSYA 4ECBA 1AAZA 4IW9A 3Q18A 4EC0A 3IR4A 2LEGA 4F2IA 1GTAA 2OE0A 4MZWA 2H19A 5JWQB 5ID2B 2O87A 1TI1A 16GSA 3TKSA 1GNEA 5DCGA 3UOMA 1MDIA 1NHOA 1Z3EA 1SJZA 2LQQA 2V41A 2IMIA 3GL5A 3FK8A 1KEBA 3C73A 2GLRA 3TJBA 3FZ5A 1Q4JA 4NV2A 4DVCA 3FR9A 2FWEA 6GSTA 3H8QA 5CYYA 3NIVA 3RPPA 3QPMA 3TRXA 3CSJA 3APQA 3TJFA 2KLXA 3HCZA 2CQ9A 2MMZA 4K2DA 5GZZB 5ECQB 1FHEA 4ZL8A 3EE2A 3BCIA 1BEDA 1V40A 1O7UA 4L5LA 1FAAA 1WWJA 3GA4A 2X99A 1JLWA 2L5OA 3ERFA 1PN9A 4XRAA 4ACSA 2H0IA 2E7PA 4HQSA 2YN1A 5AN1A 2VUPA 1WIKA 3KCMA 4MABA 1EOGA 3GH9A 2Z9SA 1HNCA 2EIOA 2RIIA 3WD6A 3CYNA 5COHA 2PWJA 1T7PB 1Z7RA 2VIMA 1S3AA 3U6VA 1TK0B 1G6WA 4IN0A 4MP4A 2AV4A 4K0GA 5CRHA 1USBA 3H4KA 4X43A 4PURA 3KMOA 1EP8A 1E6BA 2VLVA 2MMAA 1A24A 5F0GA 3F63A 4MMMA 2B5XA 3IHQA 3TB2A 5ECOB 4QQ7A 1TU7A 3TKPA 3F0IA 3DVXA 5B6NA 3R2QA 1GSYA 2DJ0A 1YZXA 4KB3A 3KXOA 2JZRA 1FB0A 4KDUA 3KM6A 17GSA 5ENUA 2DMLA 5CP1A 3GMFA 3ERGA 2LS5A 4ZBDA 6GSXA 3AY8A 2C3TA 3A2WA 4PUAA 1OKTA 4JBBA 3QFBC 1SYXA 5IMAA 5GSSA 2P5QA 1J9BA 1OVNA 3EVIA 2K18A 3IK7A 4IELA 1UC7A 1GL8A 1XWAA 4ZB6A 1VRSD 1SKWB 2DIYA 3FW2A 1WJKA 5D8IA 1FG4A 2JZTA 3IC4A 4KDXA 4OD7A 4NHWA 3D6IA 4MLYA 2E0QA 1A2MA 4ZB9A 1WP0A 3VLNA 4N30A 5D9XA 2H71A 5D73A 12GSA 2GQKA 3ED3A 5B8AA 1YF0A 1I9DA 2VLUA 3HHVA 5DALA 1GSQA 2K6VA 4TR1B 1PA3A 2GSTA 3M9JA 4MF6A 2IFQA 3F4TA 1GSDA 2YPMA 5JCUA 1LBKA 3UJ1A 2HZEA 2F8AA 5HQPA 1QMVA 1AC1A 1M0UA 2PPTA 4X0XA 2FNOA 4EF0A 2MBSA 3Q6OA 2DJJA 4XS4B 2FD3A 1SKSB 4MF5A 1JZOA 3D21A 5IMCA 2C8UA 3K8NA 3HXSA 5D9WA 1SL2B 2VM2A 1XWGA 2RLIA 2M46A 2VL2C 1R7HA 4RI7A 3F3QA 4KA0A 3LWAA 3FEUA 5AIVA 1ZCPA 4PNFA 4OO5A 4MJAA 3GV1A 4IQAA 5LNKe 2GSSA 5KN0A 5DAKA 2PVQA 4LMVA 3UL3A 2M72A 3A3TA 2H30A 4XTSA 1AQVA 1AXDA 2K8SA 2L4QA 3VFIA 3FHKA 1ACVA 3V1WA 2YV7A 1BX9A 1EGRA 4ZBAA 3ISOA 2HE3A 2VLTA 3LQ7A 2LRCA 1BYEA 1GSUA 3TRPA 2V6KA 1QGVA 1XOAA 2AYTA 3DD3A 3ZL5A 2GDRA 4EVMA 4HDEA 4JR6A 1K0NA 4ULXA 5A5KA 1G6YA 1FB6A 2CX3A 2HSHA 2R2JA 4D73B 9GSSA 2VL3A 2B5EA 2EC4A 2H76A 4PNGA 3KZQA 1G7OA 4K0NA 2GT5A 3MDKA 5B7CA 11GSA 1TRWA 1KTEA 1O85A 2WRTA 1AW9A 5B6MA 3G7JA 1I5GA 4J56E 2MBTA 1ML6A 2R4VA 2K9FA 1PD21 1YY7A 2LJKA 2L57A 2YOIA 4HJMA 1F3AA 1Z9HA 4ZL7A 3QR6A 2IMDA 5DDLA 5IOWA 2J9HA 5GSTA 2IJYA 1MTCA 4FO5A 2YZHA 4J57E 2OE1A 4GF0A 3ZMKA 1THXA 1PQNA 4AGSA 1YQ1A 4BPYA 1FOVA 1AQWA 1R26A 2F9SA 4HUAA 1Z6NA 1TXXA 3E9JB 1Y6EA 4BWSA 4G9HA 1XZOA 1UVZA 1K0BA 1A23A 1U3AA 1M2DA 4I97A 2NTOA 3EC3A 3LXZA 1AQXA 5ECIB 4MJCA 4EL1A 2NVLA 4N0VA 3QFAC 1V98A 4IHUA 2XPDA 4GLTA 3L0HA 5ELGA 2FWHA 4MA9A 2GSQA 1ZGNA 2PBJA 1M9AA 4IJIA 3M9KA 3WGDA 3IE3A 2DJ3A 3LEFA 2YWOA 3IOSA 4KCEA 5HR0A 1X9SB 2L59A 4HZ2A 2WB9A 2O89A 3NOFA 2XPEA 1TRVA 1RW1A 4EKZA 3VK9A 1FW1A 3QAWA 4V2MA 2H6YA 3O76A 1ST9A 1XWKA 1GUHA 13GSA 3G9BA 1ILOA 1K3LA 2L4CA 3S9FA 3HZ4A 4F03A 3GTUB 4MCUA 3TGZA 1R5PA 1J08A 3LYPA 2FHEA 1OC9A 3L4NA 2TRXA 4PX1A 4K8MA 1EEJA 1YKCA 2WS2A 5J3RA 4RQXA 2B3SA 4LA1A 1XVWA 3CTFA 5LD0A 2G2QA 3D22A 4H86A 3MSZA 2MZCA 2REMA 4DSSA 4BWQA 4K9ZA 4ISDA 1BJXA 4HOJA 1XWBA 5C04A 1HYUA 3FZAA 1VF3A 2OJLA 2RUFA 3WGEA 2OE3A 1T3BA 1JLVA 2FA4A 3PH9A 2C0GA 4OCEA 2VCXA 5A4VA 2B1LA 4KAEA 2IWTA 4O32A 5ECNB 1HNAA 2P31A 3E3EA 2YJ7A 4TVEA 4FYBA 2IMKA 3HVXA 4TKYA 1JFUA 1ERUA 4IGJA 3UVTA 4TW5A 1CQHA 2WDUA 5HFGA 2MMNA 1SK2A 1U3IA 4MK3A 3VPTA 1ABAA 2XBQA 5F05A 2OKAA 4XRDA 3UIWA 3HJPA 4XS6A 4QL7A 5A4UA 1PX7A 1YF1A 3UARA 3LXTA 1SYRA 4GTUA 1F6MC 1SD8A 1XIYA 1GSEA 1WE0A 2CT6A 4KH7A 3F6FA 1OYJA 4ML6A 1QQ2A 1QFNA 2QKEA 1EOHA 2JZSA 5EY6A 4AF2A 3EURA 3GRXA 1S3DA 3HZ8A 4NPBA 3F8UA 2KUCA 4GXZA 1NW2A 4MZBA 1M2BA 1JHBA 18GSA 3QMXA 2LJRA 3HVSA 2E2MA 3LORA 3QCPA 2H1AA 5IM9A 2VD1A 2R5GA 5AIXA 4XIHA 1A2LA 2L5LA 3HY2A 4PQ1A 5KN3A 5ELAA 2H0GA 4WBRD 2EIRA 2LUSA 3VWVA 1T4YA 3D4MA 1F3BA 4QL9A 1EZKA 1K0MA 5EVOA 3A5WA 1TTZA 1YEPA 3W6GA 3RBTA 2FA8A 2F51A 1X9MB 3IPZA 2B5YA 1GLQA 2V2GA 1EGOA 2ES7A 1WOUA 2LJAA 4EE0A 3BD2A 4K7OA 4HI7A 3RPNA 2GVPA 4Q5RA 3H1NA 2HRFA 1O73A 2V6OA 4OWYA 2VL2A 2GS3A 3DGQA 1X5DA 14GSA 2B7KA 2EIQA 2NDOA 3DMLA 4KDYA 3ZFBA 1HD2A 3EMPA 2GZZA 2JL4A 1OE7A 1R4WA 2CVBA 2VD0A 3KEBA 1E2YA 3O3TA 2JADA 2JU5A 3I69A 3TKSC 1RK4A 5IMVA 3VWUA 3C7MA 2AB6A 3EINA 3F4SA 4NHZA 4GWRA 2GTUA 4TXVA 3F3RA 2HFDA 3M3MA 3UAPA 2BTOT 1GP1A 1MD4A 3Q74A 1B9YC 2H6XA 2HNLA 3IXRA 4P3YB 2HLSA 2LRTA 3FZ9A 3ZIJA 3ME8A 1TW9A
chains in the Genus database with same CATH superfamily
1TU8A 1PL1A 2RUEA 1C72A 2DMMA 4AJ8A 2J23A 2GZPA 3EPTA 4IKHA 1GNWA 4WF5A 2FUG2 3WT1A 1T00A 2C0DA 1ZMAA 4F0CA 4Q5QA 2AJQB 5CNWA 4KNDA 4WETA 4CW9A 4O7HA 3L9VA 3HD5A 5IQYA 3BOAA 3FMWA 3KMNA 1M7TA 4OO4A 2RM5A 3N5OA 2NBSA 2IN3A 3VI7A 1V9WA 5G2ZA 2YANA 4MJEA 2QA1A 4JZQA 2N5AA 4Z2TA 1VF4A 3BBYA 1XCCA 4XCSA 1DSBA 5J5NA 3IAM2 3GSSA 1Q98A 1ZL9A 5D9TA 3KP9A 3GIXA 4I6XA 4MH3A 4N0ZA 4K1FA 5H5RA 2CA8A 3TKSE 5ECMB 4G0IA 4OCFA 4WEYA 2HRAA 2A4VA 4TOPA 1UN2A 1PKWA 2DBCA 3FRCA 4K7IA 3DYRA 3MNGA 1XXUA 5D96A 4FYUA 1ZZYA 4NXIA 2FCHA 4RI6A 2IFQB 3HYPA 3TJGA 4DSRA 1TRUA 4PQHA 4V1Ap 3SWLA 4EDZA 2BJXA 3APSA 2HZEB 2FGXA 2KP1A 4TXOB 2QC7A 4KE3A 5LCZA 1NHYA 2I81A 2XC2A 2CZ3A 5HFKA 2YZUA 1FO5A 3IRAA 2PMTA 4FYCA 1YEXA 1TDIA 3GNJA 5J9BA 5ECHB 1SU9A 5ABRA 1HNBA 2MYGA 2R6KA 3L9UA 3IV4A 4PGTA 2HRKA 4CDOA 2ALBA 1MEKA 2MMOA 2VO4A 1GTUA 1TP9A 6GSSA 2YWNA 3CBUA 3M8NA 4OMVA 2O85A 1H75A 5JWRB 5DAKB 3ZFLA 4WF4A 4V2LA 4X1UA 3MYDA 1MD3A 4GSTA 1V57A 2HRNA 3UBKA 3ZVJD 2PN8A 2A2SA 2WCIA 5FT3A 1RQMA 3EU3A 4K7NA 3ZVJA 2O7KA 2H66A 3KD0A 4DEJA 4HEA2 3TUEA 2F3MA 1TK5B 2QSIA 4AJ7A 4FQUA 5F07A 5H5SA 2CZ2A 5HFIA 4YKGA 2LQOA 5G5FA 1O8XA 1OKDA 4ZL9A 4AJ6A 2VM1A 3RHBA 1YKAA 4EDYA 5BMUA 1Z7PA 5IOXA 2HSYA 1GTBA 1A0RP 5ECLB 3L9SA 5E59A 2LSTA 6GSUA 2WZ9A 5H5QA 2YWIA 1B9XC 1T1VA 2VL9A 3LFLA 1K0AA 2GGTA 4I2TA 5CAXA 4FIWA 5G1LA 4YQMA 3CTGA 3GH6A 1T4ZA 1PFOA 4MDCA 3PGTA 2X64A 3G7YA 1V58A 1Z5YE 1GUKA 3O6TA 1JZDA 3ZZXA 2C3NA 4ZILA 1XWCA 3EU4A 3D4TA 3MWHA 4KCAA 1ZYEA 1NM3A 5FWGA 3FYGA 4JEDA 2ZNMA 1BAYA 1O6JA 1XOBA 1OAZA 2PVOC 3WYWA 3CXGA 4IBPA 4E8HA 2KOKA 2LNTA 1PL2A 3IAS2 1GWCA 5DCHA 1DUGA 4N11A 2L6DA 4POKA 1PRXA 5ID2A 3J7Yk 1X5EA 2OA7A 3CRTA 3UEMA 3LGCA 5DQYA 1M3IA 3VURA 3BJ5A 2ON7A 3I43A 2QGVA 3OR5A 1F9MA 1ON4A 5FHIA 1OE8A 4V1Ag 2YJHA 1N2AA 5C00A 2AUVA 3M1GA 5DQSA 1MDJA 2HYXA 2WGRA 3J7Yb 4KW6A 4POLA 4DSQA 4J2FA 5JCGA 4YH2A 5AISA 3F9UA 4OFTA 4ZB8A 4POMA 5CRDA 4G2EA 3ZLPA 4GSNA 2XBIA 2H1GA 2R37A 2ON5A 4TR4A 2HZFA 4KX4A 1SENA 3P7XA 2PERA 1JZRA 4MNNA 3SBCA 4MF7A 5ECKB 2IL3A 1IYHA 2AHEA 4TR3A 2CVDA 3KJYA 1XW9A 3QAVA 2B7JA 4OFMA 2FLSA 2YP6A 4HQZA 3P2AA 4JE1A 1YDKA 1TI3A 3W8JA 2E2GA 3KGKA 4RQRA 1OC9B 4NWYA 1X5CA 3GHAA 1SK0A 1PSQA 2VCTA 3GUSA 3DWVA 4OFNA 4MPFA 2VOCA 2GZYA 4NMUA 3RHCA 3ZRDA 4L0UA 3TKRA 3MAKA 1W4VA 3D5JA 5CRGA 4LMWA 2YCDA 3DRNA 4DSSB 5INYA 3CSHA 3NZNA 1FVJA 2DJ1A 3GX8A 1K0OA 4NV5A 1M99A 1B8XA 5EL8A 2H73A 2LKUA 3HVVA 2DSAA 1JZWA 3TJJA 3RAZA 1SKRB 1PX6A 1WPIA 3H79A 2NPBA 2LRNA 1H4OA 4BVXA 4XHMA 3DEXA 3LG6A 2P5RA 4ICYA 2WULA 3VPQA 1SL0B 5DJLA 2VCZA 3PINA 2LNSA 4ECCA 1VF1A 3R3EA 2H1DA 2CX4A 3ZIVA 1GRXA 2B6MA 3C8EA 3GKMA 4KF9A 2HT9A 3FR6A 4WR4A 5IMFA 2H8LA 4HZ4A 4LL1B 2IIYA 4ECIA 1TOFA 5F06A 5F8BA 3EYTA 1K3YA 1F37A 6GSWA 3IDVA 1DBYA 2VAFA 2WJUA 2DJKA 2D2ZA 4HU9A 1SK1A 1SJIA 2X8CA 3TRQA 4EO3A 1GLPA 2VCQA 2I1UA 1A2JA 4EUYA 2XHFA 4I5QA 1XW5A 4JRRA 4TR1A 1EV4A 4Z7XA 5GAND 4WKWA 5DJMA 3GKNA 4KSOA 2C0FA 4F82A 5IIZA 3LJRA 3KIJA 5KN1A 4PUFC 2F8FA 3WGXA 3RDWA 3FZ4A 1X9WB 4TR0A 1R5AA 4TRXA 2LV3A 1AUCA 3I6AA 4XS4A 3F4RA 3WT2A 5L71A 4L8EA 2I3YA 2X49A 2DKIA 1AIUA 3KTLA 3GN3A 1GH2A 5KN2A 3A2XA 1QK8A 8GSSA 2R3XA 1TK8B 2P0GA 4MZCA 4O5QA 3QD9A 3A2VA 5G5EA 4IJ3A 3BCKA 3CRUA 4HSCX 2GQLA 1B4QA 4IP6A 4K6XA 3PR8A 2A2RA 1TRSA 5E4WA 2LTKA 4BA7A 6GSYA 5HR1A 1THOA 1GTIA 5IMDA 10GSA 3CSIA 5KEJA 3GKXA 3UBLA 1VF2A 1J0FA 2IPAA 3VI5A 1PMTA 4WXTA 2HI7A 5IPGA 3G7IA 1Y25A 4LLRA 19GSA 6GSVA 3GKKA 5JCWA 3ZREA 5IO2A 1XPVA 3HDCA 5J4UA 4N10A 5DVBA 2ZUPA 1QUWA 3P90A 3QDNA 2CVKA 2OBKA 5G1KA 3ZTLA 3FKFA 4BL7A 3HA9A 4FH8A 1F2EA 1XW6A 4KSMA 3IK9A 1EP7A 4TXOA 3IA1A 4GSSA 4CY6A 1N8JA 5ECPB 1IYIA 1U88A 1ERVA 22GSA 5ECRB 1M9BA 2WFCA 4WR5A 3TCOA 4K5SA 4YAPA 4D73A 2C3QA 2IMFA 1SL1B 1T8EB 1GSSA 1EWXA 2I9HA 1EEMA 3KP8A 1V2AA 1CQGA 1K3OA 5EPFA 3P8WA 4JU5A 1A8YA 4ID0A 5HR2A 4KUNA 2N5FA 3CMIA 3APOA 2H74A 3ZITA 2GSRA 4RUVA 5DALB 1G7EA 4G0LA 2V1MA 2H75A 4I8BA 1M2AA 4Q5NA 1XFLA 3JCML 4ZIJA 3HKRA 3GL3A 2X8GA 1FVKA 4POBA 2JACA 5AGYA 5CRWA 1K0CA 1A8LA 4GRFA 4L0WA 1HQOA 1KNGA 4TN8A 1XG8A 4YQVA 3N9JA 3UVHA 1ZYQB 3U5RE 4YQUA 4ECJA 2TIRA 2FWGA 2O8VB 2IMEA 4EXJA 5CREA 3FR3A 3US3A 2BMXA 1UA5A 4X4JA 2YWMA 4HJ2A 2KP2A 1DE1A 1EV9A 3F6DA 4MPGA 1OC8A 2C4JA 3FY7A 3DKSA 2X8HA 2CAIA 3DVWA 1S3CA 3GFKA 3L78A 3LSZA 2H6ZA 3HJOA 4WBJA 4MH2A 2AAWA 2H1BA 3EMXA 1PKZA 7GSSA 3QOUA 1LJRA 1TJDA 4LL4B 1TKDB 3E0UA 2V32A 2K8VA 3ME7A 4PXOA 4MJBA 4GQFA 2I4AA 3DIEA 4ILFA 4HS1A 4V2NA 5IO0A 1MDKA 2VCWA 3M0FA 1VGLA 5B8BA 4GCIA 4IP1A 4ZBBA 1QXHA 1GUMA 5D9VA 2H01A 2DLXA 2CV4A 1A0FA 4PQIA 2H0HA 4ML1A 2PU9C 3ERWA 3TOTA 2G0FA 1WMJA 3UMAA 1U6TA 2B1KA 3CQFA 5J41A 3EWLA 3ZMLA 3GX0A 1DE2A 4O5RA 4K2XA 3GYKA 4KGIA 3D0ZA 3LYKA 3KH9A 5A4WA 5CO3A 4IQ1A 1Z6MA 3GTUA 1XVQA 2PGTA 2PUKC 2DIZA 4BVYA 3A5IA 4JR4A 3Q19A 2ZCTA 1SJ6A 1YJ6A 2C80A 2FWFA 5IPHA 4ZXGA 2GT6A 1SD9A 20GSA 1K0DA 2HSMA 3W8SA 3GSTA 4GQCA 1ZOFA 3KTBA 3TJKA 2OBIA 4XS1A 3HJMA 1BG5A 4EIPA 1KBNA 2C0EA 4IS0A 4G19A 2H72A 5HR3A 1WRYA 3ZYWA 3H93A 5ECSA 3C71A 5G30A 3TKQA 3C1SA 2KHPA 1GSFA 2A4HA 1NSWA 2YNXA 5J9CA 3I9V2 5GAPD 1LU4A 3TOUA 2M80A 3KH7A 2N5BA 4E8EA 1BQ7A 2OACA 2R0GA 2HXKA 4IVFA 2YV9A 3VWWA 1GULA 2OADA 4Q5FA 5G31A 1ERTA 5D93A 4G10A 1PGTA 2L6CA 4F9ZA 4YAVA 1U87A 2TRCP 3TDGA 2DJ2A 1XBSA 3GURA 5JWOB 2H70A 1W89A 3VWXA 2X4AA 4NAXA 1G0TA 1B4PA 1O81A 2C1YA 1URMA 2JSZA 5DBQA 1OC3A 2DC5A 3QAGA 2VCVA 4O92A 5IMZA 3DXBA 2FY6A 1X0RA 4F0BA 4L5OA 4CHSA 2CAQA 1ERWA 3C1RA 3IBHA 1O8WA 2RM6A 1B48A 2GQMA 4HU7A 4I2UA 2JSYA 4ECBA 1AAZA 4IW9A 3Q18A 4EC0A 3IR4A 2LEGA 4F2IA 1GTAA 2OE0A 4MZWA 2H19A 5JWQB 5ID2B 2O87A 1TI1A 16GSA 3TKSA 1GNEA 5DCGA 3UOMA 1MDIA 1NHOA 1Z3EA 1ZYNA 1SJZA 2LQQA 2V41A 2IMIA 3GL5A 3FK8A 1KEBA 3C73A 2GLRA 3TJBA 3FZ5A 1Q4JA 4NV2A 4DVCA 3FR9A 2FWEA 6GSTA 3H8QA 5CYYA 2QA2A 3NIVA 3RPPA 3QPMA 3TRXA 3CSJA 3APQA 3TJFA 2KLXA 3HCZA 2CQ9A 4K5RA 2MMZA 4K2DA 5GZZB 1M3JA 5ECQB 1FHEA 4ZL8A 3EE2A 3BCIA 1BEDA 1V40A 1O7UA 4L5LA 1FAAA 1WWJA 3GA4A 2X99A 1JLWA 2L5OA 3ERFA 1PN9A 4XRAA 4ACSA 2H0IA 2E7PA 4HQSA 2YN1A 5AN1A 2VUPA 1WIKA 3KCMA 4MABA 1EOGA 3GH9A 2Z9SA 1HNCA 2EIOA 2RIIA 3WD6A 3CYNA 5COHA 2PWJA 1T7PB 1Z7RA 2VIMA 1S3AA 3U6VA 1TK0B 1G6WA 4IN0A 4MP4A 3PPUA 2AV4A 4K0GA 5CRHA 1USBA 3H4KA 4X43A 4PURA 3KMOA 1EP8A 1E6BA 2VLVA 2MMAA 1A24A 5F0GA 3F63A 4MMMA 2B5XA 3IHQA 3TB2A 5ECOB 4QQ7A 1TU7A 3TKPA 3F0IA 3DVXA 5B6NA 3R2QA 1GSYA 2DJ0A 1YZXA 4KB3A 3KXOA 2JZRA 1FB0A 4KDUA 3KM6A 17GSA 5ENUA 2DMLA 5CP1A 3GMFA 3ERGA 2LS5A 4ZBDA 6GSXA 3AY8A 2C3TA 3A2WA 4PUAA 4BVXB 1OKTA 4JBBA 3QFBC 1SYXA 5IMAA 5GSSA 2P5QA 1J9BA 1OVNA 3EVIA 2K18A 3IK7A 4IELA 1UC7A 1GL8A 1XWAA 4ZB6A 1VRSD 1SKWB 2DIYA 3FW2A 1WJKA 5D8IA 1FG4A 2JZTA 3IC4A 4KDXA 4OD7A 4NHWA 3D6IA 4MLYA 2E0QA 1A2MA 4ZB9A 1WP0A 3VLNA 4N30A 5D9XA 2H71A 5D73A 12GSA 2GQKA 3ED3A 5B8AA 1YF0A 1I9DA 2VLUA 3HHVA 5DALA 1GSQA 2K6VA 4TR1B 4A5PA 1PA3A 2GSTA 3M9JA 4MF6A 2IFQA 3F4TA 1GSDA 2YPMA 5JCUA 1LBKA 3UJ1A 2HZEA 2F8AA 5HQPA 1QMVA 1AC1A 1M0UA 2PPTA 4X0XA 2FNOA 4EF0A 2MBSA 3Q6OA 5KOXA 2DJJA 4XS4B 2FD3A 1SKSB 4MF5A 1JZOA 3D21A 5IMCA 2C8UA 3K8NA 3HXSA 5D9WA 1SL2B 2VM2A 1XWGA 2RLIA 2M46A 2VL2C 1R7HA 4RI7A 3F3QA 4KA0A 3LWAA 3FEUA 5AIVA 1ZCPA 4PNFA 4OO5A 4MJAA 3GV1A 4IQAA 5LNKe 2GSSA 5KN0A 5DAKA 2PVQA 4LMVA 3UL3A 2M72A 3A3TA 2H30A 4XTSA 1AQVA 1AXDA 1ZYPA 2K8SA 2L4QA 3VFIA 3FHKA 1ACVA 3V1WA 2YV7A 1BX9A 3IHGA 1EGRA 1FOHA 4ZBAA 3ISOA 2HE3A 2VLTA 3LQ7A 2LRCA 1S3RA 1BYEA 1GSUA 3TRPA 2V6KA 1QGVA 1XOAA 2AYTA 4BL7B 3DD3A 3ZL5A 2GDRA 4EVMA 5KOWA 4HDEA 4JR6A 1K0NA 4ULXA 5A5KA 1G6YA 1FB6A 2CX3A 2HSHA 2R2JA 4D73B 9GSSA 2VL3A 2B5EA 2EC4A 2H76A 4PNGA 3KZQA 1G7OA 4K0NA 2GT5A 3MDKA 5B7CA 11GSA 1TRWA 1KTEA 1O85A 4YKFA 2WRTA 1AW9A 5B6MA 3G7JA 1I5GA 4J56E 2MBTA 1ML6A 4G0KA 2R4VA 2K9FA 1PD21 1YY7A 2LJKA 2L57A 3HVNA 2YOIA 4HJMA 1F3AA 1Z9HA 4ZL7A 3QR6A 2IMDA 5DDLA 5IOWA 2J9HA 5GSTA 2IJYA 1MTCA 4FO5A 2YZHA 4J57E 2OE1A 4GF0A 3ZMKA 1THXA 1PQNA 4AGSA 1YQ1A 4BPYA 1FOVA 1AQWA 1R26A 2F9SA 4HUAA 1Z6NA 1TXXA 3E9JB 1Y6EA 4BWSA 4G9HA 1XZOA 1UVZA 1K0BA 1A23A 1U3AA 1M2DA 4I97A 2NTOA 3EC3A 3LXZA 1AQXA 4CY8A 5ECIB 4MJCA 4EL1A 2NVLA 4N0VA 3QFAC 1V98A 4IHUA 2XPDA 4GLTA 3L0HA 5ELGA 2FWHA 4MA9A 2GSQA 1ZGNA 2PBJA 1M9AA 4IJIA 3M9KA 3WGDA 3IE3A 2DJ3A 3LEFA 2YWOA 3IOSA 4KCEA 5HR0A 1X9SB 2L59A 4HZ2A 2WB9A 2O89A 3NOFA 2XPEA 1TRVA 1RW1A 4EKZA 3VK9A 4V2MA 1FW1A 3QAWA 2H6YA 3O76A 1ST9A 1XWKA 1GUHA 13GSA 3G9BA 1ILOA 4Z2RA 1K3LA 2L4CA 3S9FA 3HZ4A 4F03A 3GTUB 4MCUA 3TGZA 1R5PA 1J08A 3LYPA 4BVYB 2FHEA 1OC9A 3L4NA 2TRXA 4PX1A 4K8MA 1EEJA 1YKCA 2WS2A 5J3RA 4RQXA 2B3SA 4O5UA 4LA1A 1XVWA 4BIKA 3CTFA 5LD0A 2G2QA 3D22A 4H86A 3MSZA 2MZCA 2REMA 4DSSA 4BWQA 4K9ZA 4ISDA 1BJXA 4HOJA 1XWBA 2R0PA 5C04A 1HYUA 3FZAA 1VF3A 2OJLA 2RUFA 3WGEA 2OE3A 1T3BA 1JLVA 2FA4A 3PH9A 2C0GA 4OCEA 2VCXA 5A4VA 2B1LA 4KAEA 2IWTA 4O32A 5ECNB 1HNAA 2P31A 3E3EA 2YJ7A 4TVEA 4FYBA 2IMKA 3HVXA 4TKYA 1JFUA 1ERUA 4IGJA 3UVTA 4TW5A 4EIQA 1CQHA 2WDUA 5HFGA 2MMNA 1SK2A 1U3IA 4MK3A 3VPTA 1ABAA 2XBQA 5F05A 2OKAA 4XRDA 3UIWA 3HJPA 4XS6A 4QL7A 5A4UA 1PX7A 1YF1A 3UARA 3LXTA 1SYRA 4GTUA 1F6MC 3MIXA 1SD8A 1XIYA 1GSEA 1WE0A 2CT6A 4KH7A 3F6FA 1OYJA 4ML6A 1QQ2A 1QFNA 2QKEA 1EOHA 2JZSA 5EY6A 4PTSA 4AF2A 3EURA 3GRXA 1S3DA 3HZ8A 4NPBA 3F8UA 2KUCA 4GXZA 1NW2A 4MZBA 1M2BA 2A2PA 1JHBA 18GSA 3QMXA 2LJRA 3HVSA 2E2MA 3LORA 3QCPA 2H1AA 5IM9A 2DKHA 2VD1A 3LW9A 2R5GA 5AIXA 4XIHA 1A2LA 2L5LA 3HY2A 4PQ1A 5KN3A 5ELAA 2H0GA 4WBRD 2EIRA 2LUSA 3VWVA 2R0CA 1T4YA 3D4MA 1F3BA 4QL9A 1EZKA 1K0MA 5EVOA 3A5WA 1TTZA 1YEPA 3W6GA 1PN0A 3RBTA 3IC8A 2FA8A 2F51A 1X9MB 3IPZA 2B5YA 4Z2UA 1GLQA 2V2GA 1EGOA 2ES7A 1WOUA 2LJAA 4EE0A 3BD2A 4K7OA 4HI7A 3RPNA 2GVPA 4Q5RA 5BRTA 3H1NA 2HRFA 1O73A 2V6OA 4OWYA 2VL2A 2GS3A 4USSA 3DGQA 1X5DA 14GSA 2B7KA 2EIQA 2NDOA 3DMLA 4KDYA 3ZFBA 1HD2A 3EMPA 2GZZA 2JL4A 1OE7A 1R4WA 2CVBA 2VD0A 3KEBA 1E2YA 3O3TA 2JADA 2JU5A 3I69A 3TKSC 1RK4A 5IMVA 3VWUA 3C7MA 2AB6A 3EINA 3F4SA 4NHZA 4GWRA 2GTUA 4TXVA 3F3RA 2HFDA 3M3MA 3UAPA 2BTOT 1GP1A 2UZ8A 1MD4A 3Q74A 1B9YC 2H6XA 2HNLA 3IXRA 4P3YB 2HLSA 2LRTA 3FZ9A 3ZIJA 3ME8A 1TW9A
chains in the Genus database with same CATH topology
1TU8A 1PL1A 2RUEA 1C72A 2DMMA 4AJ8A 2J23A 2GZPA 3EPTA 4IKHA 1GNWA 4WF5A 2FUG2 3WT1A 1T00A 2C0DA 1ZMAA 4F0CA 4Q5QA 2AJQB 5CNWA 4KNDA 4WETA 4CW9A 4O7HA 3L9VA 3HD5A 5IQYA 3BOAA 3FMWA 3KMNA 1M7TA 4OO4A 2RM5A 3N5OA 2NBSA 2IN3A 3VI7A 1V9WA 5G2ZA 2YANA 4MJEA 2QA1A 4JZQA 2N5AA 4Z2TA 1VF4A 3BBYA 1XCCA 4XCSA 1DSBA 5J5NA 3IAM2 3GSSA 1Q98A 1ZL9A 5D9TA 3KP9A 3GIXA 4I6XA 4MH3A 4N0ZA 4K1FA 5H5RA 2CA8A 3TKSE 5ECMB 4G0IA 4OCFA 4WEYA 2HRAA 2A4VA 4TOPA 1UN2A 1PKWA 2DBCA 3FRCA 4K7IA 3DYRA 3MNGA 1XXUA 5D96A 4FYUA 1ZZYA 4NXIA 2FCHA 4RI6A 2IFQB 3HYPA 3TJGA 4DSRA 1TRUA 4PQHA 4V1Ap 3SWLA 4EDZA 2BJXA 3APSA 2HZEB 2FGXA 2KP1A 4TXOB 2QC7A 4KE3A 5LCZA 1NHYA 2I81A 2XC2A 2CZ3A 5HFKA 2YZUA 1FO5A 3IRAA 2PMTA 4FYCA 1YEXA 1TDIA 3GNJA 5J9BA 5ECHB 1SU9A 5ABRA 1HNBA 2MYGA 2R6KA 3L9UA 3IV4A 4PGTA 2HRKA 4CDOA 2ALBA 1MEKA 2MMOA 2VO4A 1GTUA 1TP9A 6GSSA 2YWNA 3CBUA 3M8NA 4OMVA 2O85A 1H75A 5JWRB 5DAKB 3ZFLA 4WF4A 4V2LA 4X1UA 3MYDA 1MD3A 4GSTA 1V57A 2HRNA 3UBKA 3ZVJD 2PN8A 2A2SA 2WCIA 5FT3A 1RQMA 3EU3A 4K7NA 3ZVJA 2O7KA 2H66A 3KD0A 4DEJA 4HEA2 3TUEA 2F3MA 1TK5B 2QSIA 4AJ7A 4FQUA 5F07A 5H5SA 2CZ2A 5HFIA 4YKGA 2LQOA 5G5FA 1O8XA 1OKDA 4ZL9A 4AJ6A 2VM1A 3RHBA 1YKAA 4EDYA 5BMUA 1Z7PA 5IOXA 2HSYA 1GTBA 1A0RP 5ECLB 3L9SA 5E59A 2LSTA 6GSUA 2WZ9A 5H5QA 2YWIA 1B9XC 1T1VA 2VL9A 3LFLA 1K0AA 2GGTA 4I2TA 5CAXA 4FIWA 5G1LA 4YQMA 3CTGA 3GH6A 1T4ZA 4MDCA 3PGTA 2X64A 3G7YA 1V58A 1Z5YE 1GUKA 3O6TA 1JZDA 3ZZXA 2C3NA 4ZILA 1XWCA 3EU4A 3D4TA 3MWHA 4KCAA 1ZYEA 1NM3A 5FWGA 3FYGA 4JEDA 2ZNMA 1BAYA 1O6JA 1XOBA 1OAZA 2PVOC 3WYWA 3CXGA 4IBPA 4E8HA 2KOKA 2LNTA 1PL2A 3IAS2 1GWCA 5DCHA 1DUGA 4N11A 2L6DA 4POKA 1PRXA 5ID2A 3J7Yk 1X5EA 2OA7A 3CRTA 3UEMA 3LGCA 5DQYA 3VURA 3BJ5A 2ON7A 3I43A 2QGVA 3OR5A 1F9MA 1ON4A 5FHIA 1OE8A 4V1Ag 2YJHA 1N2AA 5C00A 2AUVA 3M1GA 5DQSA 1MDJA 2HYXA 2WGRA 3J7Yb 4KW6A 4POLA 4DSQA 4J2FA 5JCGA 4YH2A 5AISA 3F9UA 4OFTA 4ZB8A 4POMA 5CRDA 4G2EA 3ZLPA 4GSNA 2XBIA 2H1GA 2R37A 2ON5A 4TR4A 2HZFA 4KX4A 1SENA 3P7XA 2PERA 1JZRA 4MNNA 3SBCA 4MF7A 5ECKB 2IL3A 1IYHA 2AHEA 4TR3A 2CVDA 3KJYA 1XW9A 3QAVA 2B7JA 4OFMA 2FLSA 2YP6A 4HQZA 3P2AA 4JE1A 1YDKA 1TI3A 3W8JA 2E2GA 3KGKA 4RQRA 1OC9B 4NWYA 1X5CA 3GHAA 1SK0A 1PSQA 2VCTA 3GUSA 3DWVA 4OFNA 4MPFA 2VOCA 2GZYA 4NMUA 3RHCA 3ZRDA 4L0UA 3TKRA 3MAKA 1W4VA 3D5JA 5CRGA 4LMWA 2YCDA 3DRNA 4DSSB 5INYA 3CSHA 3NZNA 1FVJA 2DJ1A 3GX8A 1K0OA 4NV5A 1M99A 1B8XA 5EL8A 2H73A 2LKUA 3HVVA 2DSAA 1JZWA 3TJJA 3RAZA 1SKRB 1PX6A 1WPIA 3H79A 2NPBA 2LRNA 1H4OA 4BVXA 4XHMA 3DEXA 3LG6A 2P5RA 4ICYA 2WULA 3VPQA 1SL0B 5DJLA 2VCZA 3PINA 2LNSA 4ECCA 1VF1A 3R3EA 2H1DA 2CX4A 3ZIVA 1GRXA 2B6MA 3C8EA 3GKMA 4KF9A 2HT9A 3FR6A 4WR4A 5IMFA 2H8LA 4HZ4A 4LL1B 2IIYA 4ECIA 1TOFA 5F06A 5F8BA 3EYTA 1K3YA 1F37A 6GSWA 3IDVA 1DBYA 2VAFA 2WJUA 2DJKA 2D2ZA 4HU9A 1SK1A 1SJIA 2X8CA 3TRQA 4EO3A 1GLPA 2VCQA 2I1UA 1A2JA 4EUYA 2XHFA 4I5QA 1XW5A 4JRRA 4TR1A 1EV4A 4Z7XA 5GAND 4WKWA 5DJMA 3GKNA 4KSOA 2C0FA 4F82A 5IIZA 3LJRA 3KIJA 5KN1A 4PUFC 2F8FA 3WGXA 3RDWA 3FZ4A 1X9WB 4TR0A 1R5AA 4TRXA 2LV3A 1AUCA 3I6AA 4XS4A 3F4RA 3WT2A 5L71A 4L8EA 2I3YA 2X49A 2DKIA 1AIUA 3KTLA 3GN3A 1GH2A 5KN2A 3A2XA 1QK8A 8GSSA 2R3XA 1TK8B 2P0GA 4MZCA 4O5QA 3QD9A 3A2VA 5G5EA 4IJ3A 3BCKA 3CRUA 2GQLA 1B4QA 4IP6A 4K6XA 3PR8A 2A2RA 1TRSA 5E4WA 2LTKA 4BA7A 6GSYA 5HR1A 1THOA 1GTIA 5IMDA 10GSA 3CSIA 5KEJA 3GKXA 3UBLA 1VF2A 1J0FA 2IPAA 3VI5A 1PMTA 4WXTA 2HI7A 5IPGA 3G7IA 1Y25A 4LLRA 19GSA 6GSVA 3GKKA 5JCWA 3ZREA 5IO2A 1XPVA 3HDCA 5J4UA 4N10A 5DVBA 2ZUPA 1QUWA 3P90A 3QDNA 2CVKA 2OBKA 5G1KA 3ZTLA 3FKFA 4BL7A 3HA9A 4FH8A 1F2EA 1XW6A 4KSMA 3IK9A 1EP7A 4TXOA 3IA1A 4GSSA 4CY6A 1N8JA 5ECPB 1IYIA 1U88A 1ERVA 22GSA 5ECRB 1M9BA 2WFCA 4WR5A 3TCOA 4K5SA 4YAPA 4D73A 2C3QA 2IMFA 1SL1B 1T8EB 1GSSA 1EWXA 2I9HA 1EEMA 3KP8A 1V2AA 1CQGA 1K3OA 5EPFA 3P8WA 4JU5A 1A8YA 4ID0A 5HR2A 4KUNA 2N5FA 3CMIA 3APOA 2H74A 3ZITA 2GSRA 4RUVA 5DALB 1G7EA 4G0LA 2V1MA 2H75A 4I8BA 1M2AA 4Q5NA 1XFLA 3JCML 4ZIJA 3HKRA 3GL3A 2X8GA 1FVKA 4POBA 2JACA 5AGYA 5CRWA 1K0CA 1A8LA 4GRFA 4L0WA 1HQOA 1KNGA 4TN8A 4YQVA 3N9JA 3UVHA 1ZYQB 3U5RE 4YQUA 4ECJA 2TIRA 2FWGA 2O8VB 2IMEA 4EXJA 5CREA 3FR3A 3US3A 2BMXA 1UA5A 4X4JA 2YWMA 4HJ2A 2KP2A 1DE1A 1EV9A 3F6DA 4MPGA 1OC8A 2C4JA 3FY7A 3DKSA 2X8HA 2CAIA 3DVWA 1S3CA 3GFKA 3L78A 3LSZA 2H6ZA 3HJOA 4WBJA 4MH2A 2AAWA 2H1BA 3EMXA 1PKZA 7GSSA 3QOUA 1LJRA 1TJDA 4LL4B 1TKDB 3E0UA 2V32A 2K8VA 3ME7A 4PXOA 4MJBA 4GQFA 2I4AA 3DIEA 4ILFA 4HS1A 4V2NA 5IO0A 1MDKA 2VCWA 3M0FA 1VGLA 5B8BA 4GCIA 4IP1A 4ZBBA 1QXHA 1GUMA 5D9VA 2H01A 2DLXA 2CV4A 1A0FA 4PQIA 2H0HA 4ML1A 2PU9C 3ERWA 3TOTA 2G0FA 1WMJA 3UMAA 1U6TA 2B1KA 5J41A 3EWLA 3ZMLA 3GX0A 1DE2A 4O5RA 4K2XA 3GYKA 4KGIA 3D0ZA 3LYKA 3KH9A 5A4WA 5CO3A 4IQ1A 1Z6MA 3GTUA 1XVQA 2PGTA 2PUKC 2DIZA 4BVYA 3A5IA 4JR4A 3Q19A 2ZCTA 1SJ6A 1YJ6A 2C80A 2FWFA 5IPHA 4ZXGA 2GT6A 1SD9A 20GSA 1K0DA 2HSMA 3W8SA 3GSTA 4GQCA 1ZOFA 3KTBA 3TJKA 2OBIA 4XS1A 3HJMA 1BG5A 4EIPA 1KBNA 2C0EA 4IS0A 4G19A 2H72A 5HR3A 1WRYA 3ZYWA 3H93A 5ECSA 3C71A 5G30A 3TKQA 3C1SA 2KHPA 1GSFA 2A4HA 1NSWA 2YNXA 5J9CA 3I9V2 5GAPD 1LU4A 3TOUA 2M80A 3KH7A 2N5BA 4E8EA 1BQ7A 2OACA 2R0GA 2HXKA 4IVFA 2YV9A 3VWWA 1GULA 2OADA 4Q5FA 5G31A 1ERTA 5D93A 4G10A 1PGTA 2L6CA 4F9ZA 4YAVA 1U87A 2TRCP 3TDGA 2DJ2A 1XBSA 3GURA 5JWOB 2H70A 1W89A 3VWXA 2X4AA 4NAXA 1G0TA 1B4PA 1O81A 2C1YA 1URMA 2JSZA 5DBQA 1OC3A 2DC5A 3QAGA 2VCVA 4O92A 5IMZA 3DXBA 2FY6A 1X0RA 4F0BA 4L5OA 4CHSA 2CAQA 1ERWA 3C1RA 3IBHA 1O8WA 2RM6A 1B48A 2GQMA 4HU7A 4I2UA 2JSYA 4ECBA 1AAZA 4IW9A 3Q18A 4EC0A 3IR4A 2LEGA 4F2IA 1GTAA 2OE0A 4MZWA 2H19A 5JWQB 5ID2B 2O87A 1TI1A 16GSA 3TKSA 1GNEA 5DCGA 3UOMA 1MDIA 1NHOA 1Z3EA 1ZYNA 1SJZA 2LQQA 2V41A 2IMIA 3GL5A 3FK8A 1KEBA 3C73A 2GLRA 3TJBA 3FZ5A 1Q4JA 4NV2A 4DVCA 3FR9A 2FWEA 6GSTA 3H8QA 5CYYA 2QA2A 3NIVA 3RPPA 3QPMA 3TRXA 3CSJA 3APQA 3TJFA 2KLXA 3HCZA 2CQ9A 4K5RA 2MMZA 4K2DA 5GZZB 5ECQB 1FHEA 4ZL8A 3EE2A 3BCIA 1BEDA 1V40A 1O7UA 4L5LA 1FAAA 1WWJA 3GA4A 2X99A 1JLWA 2L5OA 3ERFA 1PN9A 4XRAA 4ACSA 2H0IA 2E7PA 4HQSA 2YN1A 5AN1A 2VUPA 1WIKA 3KCMA 4MABA 1EOGA 3GH9A 2Z9SA 1HNCA 2EIOA 2RIIA 3WD6A 3CYNA 5COHA 2PWJA 1T7PB 1Z7RA 2VIMA 1S3AA 3U6VA 1TK0B 1G6WA 4IN0A 4MP4A 3PPUA 2AV4A 4K0GA 5CRHA 1USBA 3H4KA 4X43A 4PURA 3KMOA 1EP8A 1E6BA 2VLVA 2MMAA 1A24A 5F0GA 3F63A 4MMMA 2B5XA 3IHQA 3TB2A 5ECOB 4QQ7A 1TU7A 3TKPA 3F0IA 3DVXA 5B6NA 3R2QA 1GSYA 2DJ0A 1YZXA 4KB3A 3KXOA 2JZRA 1FB0A 4KDUA 3KM6A 17GSA 5ENUA 2DMLA 5CP1A 3GMFA 3ERGA 2LS5A 4ZBDA 6GSXA 3AY8A 2C3TA 3A2WA 4PUAA 4BVXB 1OKTA 4JBBA 3QFBC 1SYXA 5IMAA 5GSSA 2P5QA 1J9BA 1OVNA 3EVIA 2K18A 3IK7A 4IELA 1UC7A 1GL8A 1XWAA 4ZB6A 1VRSD 1SKWB 2DIYA 3FW2A 1WJKA 5D8IA 1FG4A 2JZTA 3IC4A 4KDXA 4OD7A 4NHWA 3D6IA 4MLYA 2E0QA 1A2MA 4ZB9A 1WP0A 3VLNA 4N30A 5D9XA 2H71A 5D73A 12GSA 2GQKA 3ED3A 5B8AA 1YF0A 1I9DA 2VLUA 3HHVA 5DALA 1GSQA 2K6VA 4TR1B 4A5PA 1PA3A 2GSTA 3M9JA 4MF6A 2IFQA 3F4TA 1GSDA 2YPMA 5JCUA 1LBKA 3UJ1A 2HZEA 2F8AA 5HQPA 1QMVA 1AC1A 1M0UA 2PPTA 4X0XA 2FNOA 4EF0A 2MBSA 3Q6OA 5KOXA 2DJJA 4XS4B 2FD3A 1SKSB 4MF5A 1JZOA 3D21A 5IMCA 2C8UA 3K8NA 3HXSA 5D9WA 1SL2B 2VM2A 1XWGA 2RLIA 2M46A 2VL2C 1R7HA 4RI7A 3F3QA 4KA0A 3LWAA 3FEUA 5AIVA 1ZCPA 4PNFA 4OO5A 4MJAA 3GV1A 4IQAA 5LNKe 2GSSA 5KN0A 5DAKA 2PVQA 4LMVA 3UL3A 2M72A 3A3TA 2H30A 4XTSA 1AQVA 1AXDA 1ZYPA 2K8SA 2L4QA 3VFIA 3FHKA 1ACVA 3V1WA 2YV7A 1BX9A 3IHGA 1EGRA 1FOHA 4ZBAA 3ISOA 2HE3A 2VLTA 3LQ7A 2LRCA 1BYEA 1GSUA 3TRPA 2V6KA 1QGVA 1XOAA 2AYTA 4BL7B 3DD3A 3ZL5A 2GDRA 4EVMA 5KOWA 4HDEA 4JR6A 1K0NA 4ULXA 5A5KA 1G6YA 1FB6A 2CX3A 2HSHA 2R2JA 4D73B 9GSSA 2VL3A 2B5EA 2EC4A 2H76A 4PNGA 3KZQA 1G7OA 4K0NA 2GT5A 3MDKA 5B7CA 11GSA 1TRWA 1KTEA 1O85A 4YKFA 2WRTA 1AW9A 5B6MA 3G7JA 1I5GA 4J56E 2MBTA 1ML6A 4G0KA 2R4VA 2K9FA 1PD21 1YY7A 2LJKA 2L57A 2YOIA 4HJMA 1F3AA 1Z9HA 4ZL7A 3QR6A 2IMDA 5DDLA 5IOWA 2J9HA 5GSTA 2IJYA 1MTCA 4FO5A 2YZHA 4J57E 2OE1A 4GF0A 3ZMKA 1THXA 1PQNA 4AGSA 1YQ1A 4BPYA 1FOVA 1AQWA 1R26A 2F9SA 4HUAA 1Z6NA 1TXXA 3E9JB 1Y6EA 4BWSA 4G9HA 1XZOA 1UVZA 1K0BA 1A23A 1U3AA 1M2DA 4I97A 2NTOA 3EC3A 3LXZA 1AQXA 4CY8A 5ECIB 4MJCA 4EL1A 2NVLA 4N0VA 3QFAC 1V98A 4IHUA 2XPDA 4GLTA 3L0HA 5ELGA 2FWHA 4MA9A 2GSQA 1ZGNA 2PBJA 1M9AA 4IJIA 3M9KA 3WGDA 3IE3A 2DJ3A 3LEFA 2YWOA 3IOSA 4KCEA 5HR0A 1X9SB 2L59A 4HZ2A 2WB9A 2O89A 3NOFA 2XPEA 1TRVA 1RW1A 4EKZA 3VK9A 4V2MA 1FW1A 3QAWA 2H6YA 3O76A 1ST9A 1XWKA 1GUHA 13GSA 3G9BA 1ILOA 4Z2RA 1K3LA 2L4CA 3S9FA 3HZ4A 4F03A 3GTUB 4MCUA 3TGZA 1R5PA 1J08A 3LYPA 4BVYB 2FHEA 1OC9A 3L4NA 2TRXA 4PX1A 4K8MA 1EEJA 1YKCA 2WS2A 5J3RA 4RQXA 2B3SA 4O5UA 4LA1A 1XVWA 3CTFA 5LD0A 2G2QA 3D22A 4H86A 3MSZA 2MZCA 2REMA 4DSSA 4BWQA 4K9ZA 4ISDA 1BJXA 4HOJA 1XWBA 2R0PA 5C04A 1HYUA 3FZAA 1VF3A 2OJLA 2RUFA 3WGEA 2OE3A 1T3BA 1JLVA 2FA4A 3PH9A 2C0GA 4OCEA 2VCXA 5A4VA 2B1LA 4KAEA 2IWTA 4O32A 5ECNB 1HNAA 2P31A 3E3EA 2YJ7A 4TVEA 4FYBA 2IMKA 3HVXA 4TKYA 1JFUA 1ERUA 4IGJA 3UVTA 4TW5A 4EIQA 1CQHA 2WDUA 5HFGA 2MMNA 1SK2A 1U3IA 4MK3A 3VPTA 1ABAA 2XBQA 5F05A 2OKAA 4XRDA 3UIWA 3HJPA 4XS6A 4QL7A 5A4UA 1PX7A 1YF1A 3UARA 3LXTA 1SYRA 4GTUA 1F6MC 3MIXA 1SD8A 1XIYA 1GSEA 1WE0A 2CT6A 4KH7A 3F6FA 1OYJA 4ML6A 1QQ2A 1QFNA 2QKEA 1EOHA 2JZSA 5EY6A 4PTSA 4AF2A 3EURA 3GRXA 1S3DA 3HZ8A 4NPBA 3F8UA 2KUCA 4GXZA 1NW2A 4MZBA 1M2BA 2A2PA 1JHBA 18GSA 3QMXA 2LJRA 3HVSA 2E2MA 3LORA 3QCPA 2H1AA 5IM9A 2DKHA 2VD1A 3LW9A 2R5GA 5AIXA 4XIHA 1A2LA 2L5LA 3HY2A 4PQ1A 5KN3A 5ELAA 2H0GA 4WBRD 2EIRA 2LUSA 3VWVA 2R0CA 1T4YA 3D4MA 1F3BA 4QL9A 1EZKA 1K0MA 5EVOA 3A5WA 1TTZA 1YEPA 3W6GA 1PN0A 3RBTA 3IC8A 2FA8A 2F51A 1X9MB 3IPZA 2B5YA 4Z2UA 1GLQA 2V2GA 1EGOA 2ES7A 1WOUA 2LJAA 4EE0A 3BD2A 4K7OA 4HI7A 3RPNA 2GVPA 4Q5RA 5BRTA 3H1NA 2HRFA 1O73A 2V6OA 4OWYA 2VL2A 2GS3A 4USSA 3DGQA 1X5DA 14GSA 2B7KA 2EIQA 2NDOA 3DMLA 4KDYA 3ZFBA 1HD2A 3EMPA 2GZZA 2JL4A 1OE7A 1R4WA 2CVBA 2VD0A 3KEBA 1E2YA 3O3TA 2JADA 2JU5A 3I69A 3TKSC 1RK4A 5IMVA 3VWUA 3C7MA 2AB6A 3EINA 3F4SA 4NHZA 4GWRA 2GTUA 4TXVA 3F3RA 2HFDA 3M3MA 3UAPA 2BTOT 1GP1A 2UZ8A 1MD4A 3Q74A 1B9YC 2H6XA 2HNLA 3IXRA 4P3YB 2HLSA 2LRTA 3FZ9A 3ZIJA 3ME8A 1TW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TU8 A;  1PL1 A;  2RUE A;  1C72 A;  2DMM A;  4AJ8 A;  2J23 A;  2GZP A;  4IKH A;  1GNW A;  4WF5 A;  2FUG 2;  3WT1 A;  1T00 A;  2C0D A;  1ZMA A;  4F0C A;  4Q5Q A;  2AJQ B;  5CNW A;  4KND A;  4WET A;  4CW9 A;  4O7H A;  3L9V A;  3HD5 A;  5IQY A;  3BOA A;  3KMN A;  1M7T A;  4OO4 A;  2RM5 A;  3N5O A;  2NBS A;  2IN3 A;  3VI7 A;  1V9W A;  5G2Z A;  2YAN A;  4MJE A;  4JZQ A;  2N5A A;  1VF4 A;  3BBY A;  1XCC A;  4XCS A;  1DSB A;  5J5N A;  3IAM 2;  3GSS A;  1Q98 A;  1ZL9 A;  5D9T A;  3KP9 A;  3GIX A;  4I6X A;  4MH3 A;  4N0Z A;  4K1F A;  5H5R A;  2CA8 A;  3TKS E;  5ECM B;  4OCF A;  4WEY A;  2A4V A;  4TOP A;  1UN2 A;  1PKW A;  2DBC A;  3FRC A;  4K7I A;  3DYR A;  3MNG A;  1XXU A;  5D96 A;  4FYU A;  1ZZY A;  4NXI A;  2FCH A;  4RI6 A;  2IFQ B;  3HYP A;  3TJG A;  4DSR A;  1TRU A;  4PQH A;  4V1A p;  3SWL A;  4EDZ A;  2BJX A;  3APS A;  2HZE B;  2FGX A;  2KP1 A;  4TXO B;  2QC7 A;  4KE3 A;  5LCZ A;  1NHY A;  2I81 A;  2XC2 A;  2CZ3 A;  5HFK A;  2YZU A;  1FO5 A;  3IRA A;  2PMT A;  4FYC A;  1YEX A;  1TDI A;  3GNJ A;  5J9B A;  5ECH B;  1SU9 A;  5ABR A;  1HNB A;  2MYG A;  2R6K A;  3L9U A;  3IV4 A;  4PGT A;  4CDO A;  2ALB A;  1MEK A;  2MMO A;  2VO4 A;  1GTU A;  1TP9 A;  6GSS A;  2YWN A;  3CBU A;  3M8N A;  4OMV A;  2O85 A;  1H75 A;  5JWR B;  5DAK B;  3ZFL A;  4WF4 A;  4V2L A;  4X1U A;  1MD3 A;  4GST A;  1V57 A;  2HRN A;  3UBK A;  3ZVJ D;  2PN8 A;  2A2S A;  2WCI A;  5FT3 A;  1RQM A;  3EU3 A;  4K7N A;  3ZVJ A;  2O7K A;  2H66 A;  3KD0 A;  4DEJ A;  4HEA 2;  3TUE A;  2F3M A;  1TK5 B;  2QSI A;  4AJ7 A;  5F07 A;  5H5S A;  2CZ2 A;  5HFI A;  2LQO A;  5G5F A;  1O8X A;  1OKD A;  4ZL9 A;  4AJ6 A;  2VM1 A;  3RHB A;  1YKA A;  4EDY A;  1Z7P A;  5IOX A;  2HSY A;  1GTB A;  1A0R P;  5ECL B;  3L9S A;  5E59 A;  2LST A;  6GSU A;  2WZ9 A;  5H5Q A;  2YWI A;  1B9X C;  1T1V A;  2VL9 A;  3LFL A;  1K0A A;  2GGT A;  4I2T A;  5CAX A;  4FIW A;  5G1L A;  4YQM A;  3CTG A;  3GH6 A;  1T4Z A;  4MDC A;  3PGT A;  2X64 A;  3G7Y A;  1V58 A;  1Z5Y E;  1GUK A;  3O6T A;  1JZD A;  3ZZX A;  2C3N A;  4ZIL A;  1XWC A;  3EU4 A;  3D4T A;  3MWH A;  4KCA A;  1ZYE A;  1NM3 A;  5FWG A;  3FYG A;  4JED A;  2ZNM A;  1BAY A;  1O6J A;  1XOB A;  1OAZ A;  2PVO C;  3WYW A;  3CXG A;  4IBP A;  4E8H A;  2KOK A;  2LNT A;  1PL2 A;  3IAS 2;  1GWC A;  5DCH A;  1DUG A;  4N11 A;  2L6D A;  4POK A;  1PRX A;  5ID2 A;  3J7Y k;  1X5E A;  2OA7 A;  3CRT A;  3UEM A;  3LGC A;  5DQY A;  3VUR A;  3BJ5 A;  2ON7 A;  3I43 A;  2QGV A;  3OR5 A;  1F9M A;  1ON4 A;  5FHI A;  1OE8 A;  4V1A g;  2YJH A;  1N2A A;  5C00 A;  2AUV A;  3M1G A;  5DQS A;  1MDJ A;  2HYX A;  2WGR A;  3J7Y b;  4KW6 A;  4POL A;  4DSQ A;  4J2F A;  5JCG A;  4YH2 A;  5AIS A;  3F9U A;  4OFT A;  4ZB8 A;  4POM A;  5CRD A;  4G2E A;  3ZLP A;  4GSN A;  2XBI A;  2H1G A;  2R37 A;  2ON5 A;  4TR4 A;  2HZF A;  4KX4 A;  1SEN A;  3P7X A;  2PER A;  1JZR A;  3SBC A;  4MF7 A;  5ECK B;  2IL3 A;  1IYH A;  2AHE A;  4TR3 A;  2CVD A;  3KJY A;  1XW9 A;  3QAV A;  2B7J A;  4OFM A;  2FLS A;  2YP6 A;  4HQZ A;  3P2A A;  4JE1 A;  1YDK A;  1TI3 A;  3W8J A;  2E2G A;  3KGK A;  4RQR A;  1OC9 B;  4NWY A;  1X5C A;  3GHA A;  1SK0 A;  1PSQ A;  2VCT A;  3GUS A;  3DWV A;  4OFN A;  4MPF A;  2VOC A;  2GZY A;  4NMU A;  3RHC A;  3ZRD A;  4L0U A;  3TKR A;  3MAK A;  1W4V A;  3D5J A;  5CRG A;  4LMW A;  2YCD A;  3DRN A;  4DSS B;  5INY A;  3CSH A;  3NZN A;  1FVJ A;  2DJ1 A;  3GX8 A;  1K0O A;  4NV5 A;  1M99 A;  1B8X A;  5EL8 A;  2H73 A;  2LKU A;  3HVV A;  2DSA A;  1JZW A;  3TJJ A;  3RAZ A;  1SKR B;  1PX6 A;  1WPI A;  3H79 A;  2NPB A;  2LRN A;  1H4O A;  4BVX A;  4XHM A;  3DEX A;  3LG6 A;  2P5R A;  2WUL A;  3VPQ A;  1SL0 B;  5DJL A;  2VCZ A;  3PIN A;  2LNS A;  4ECC A;  1VF1 A;  2H1D A;  2CX4 A;  3ZIV A;  1GRX A;  2B6M A;  3C8E A;  3GKM A;  2HT9 A;  3FR6 A;  4WR4 A;  5IMF A;  2H8L A;  4HZ4 A;  4LL1 B;  2IIY A;  4ECI A;  1TOF A;  5F06 A;  5F8B A;  3EYT A;  1K3Y A;  1F37 A;  6GSW A;  3IDV A;  1DBY A;  2VAF A;  2WJU A;  2DJK A;  2D2Z A;  4HU9 A;  1SK1 A;  1SJI A;  2X8C A;  3TRQ A;  4EO3 A;  1GLP A;  2VCQ A;  2I1U A;  1A2J A;  4EUY A;  2XHF A;  4I5Q A;  1XW5 A;  4JRR A;  4TR1 A;  1EV4 A;  4Z7X A;  5GAN D;  4WKW A;  5DJM A;  3GKN A;  4KSO A;  2C0F A;  4F82 A;  5IIZ A;  3LJR A;  3KIJ A;  5KN1 A;  4PUF C;  2F8F A;  3WGX A;  3RDW A;  3FZ4 A;  1X9W B;  4TR0 A;  1R5A A;  4TRX A;  2LV3 A;  1AUC A;  3I6A A;  4XS4 A;  3F4R A;  3WT2 A;  5L71 A;  4L8E A;  2I3Y A;  1AIU A;  3KTL A;  3GN3 A;  1GH2 A;  5KN2 A;  3A2X A;  1QK8 A;  8GSS A;  2R3X A;  1TK8 B;  2P0G A;  4MZC A;  3QD9 A;  3A2V A;  5G5E A;  4IJ3 A;  3BCK A;  3CRU A;  2GQL A;  1B4Q A;  4IP6 A;  4K6X A;  3PR8 A;  2A2R A;  1TRS A;  5E4W A;  2LTK A;  4BA7 A;  6GSY A;  5HR1 A;  1THO A;  1GTI A;  5IMD A;  10GS A;  3CSI A;  5KEJ A;  3GKX A;  3UBL A;  1VF2 A;  1J0F A;  2IPA A;  3VI5 A;  1PMT A;  4WXT A;  2HI7 A;  5IPG A;  3G7I A;  1Y25 A;  4LLR A;  19GS A;  6GSV A;  3GKK A;  5JCW A;  3ZRE A;  5IO2 A;  1XPV A;  3HDC A;  5J4U A;  4N10 A;  5DVB A;  2ZUP A;  1QUW A;  3P90 A;  3QDN A;  2CVK A;  2OBK A;  5G1K A;  3ZTL A;  3FKF A;  4BL7 A;  3HA9 A;  4FH8 A;  1F2E A;  1XW6 A;  4KSM A;  3IK9 A;  1EP7 A;  4TXO A;  3IA1 A;  4GSS A;  1N8J A;  5ECP B;  1IYI A;  1U88 A;  1ERV A;  22GS A;  5ECR B;  1M9B A;  2WFC A;  4WR5 A;  3TCO A;  4YAP A;  4D73 A;  2C3Q A;  2IMF A;  1SL1 B;  1T8E B;  1GSS A;  1EWX A;  2I9H A;  1EEM A;  3KP8 A;  1V2A A;  1CQG A;  1K3O A;  5EPF A;  3P8W A;  4JU5 A;  1A8Y A;  4ID0 A;  5HR2 A;  4KUN A;  2N5F A;  3CMI A;  3APO A;  2H74 A;  3ZIT A;  2GSR A;  4RUV A;  5DAL B;  1G7E A;  2V1M A;  2H75 A;  4I8B A;  1M2A A;  4Q5N A;  1XFL A;  3JCM L;  4ZIJ A;  3HKR A;  3GL3 A;  2X8G A;  1FVK A;  4POB A;  2JAC A;  5AGY A;  5CRW A;  1K0C A;  1A8L A;  4GRF A;  4L0W A;  1HQO A;  1KNG A;  4TN8 A;  4YQV A;  3N9J A;  3UVH A;  1ZYQ B;  3U5R E;  4YQU A;  4ECJ A;  2TIR A;  2FWG A;  2O8V B;  2IME A;  4EXJ A;  5CRE A;  3FR3 A;  3US3 A;  2BMX A;  1UA5 A;  2YWM A;  4HJ2 A;  2KP2 A;  1DE1 A;  1EV9 A;  3F6D A;  4MPG A;  1OC8 A;  2C4J A;  3FY7 A;  3DKS A;  2X8H A;  2CAI A;  3DVW A;  1S3C A;  3GFK A;  3L78 A;  3LSZ A;  2H6Z A;  3HJO A;  4WBJ A;  4MH2 A;  2AAW A;  2H1B A;  3EMX A;  1PKZ A;  7GSS A;  3QOU A;  1LJR A;  1TJD A;  4LL4 B;  1TKD B;  3E0U A;  2V32 A;  2K8V A;  3ME7 A;  4PXO A;  4MJB A;  4GQF A;  2I4A A;  3DIE A;  4ILF A;  4HS1 A;  4V2N A;  5IO0 A;  1MDK A;  2VCW A;  3M0F A;  1VGL A;  5B8B A;  4GCI A;  4IP1 A;  4ZBB A;  1QXH A;  1GUM A;  5D9V A;  2H01 A;  2DLX A;  2CV4 A;  1A0F A;  4PQI A;  2H0H A;  4ML1 A;  2PU9 C;  3ERW A;  3TOT A;  2G0F A;  1WMJ A;  3UMA A;  1U6T A;  2B1K A;  5J41 A;  3EWL A;  3ZML A;  3GX0 A;  1DE2 A;  4O5R A;  3GYK A;  4KGI A;  3D0Z A;  3LYK A;  3KH9 A;  5A4W A;  5CO3 A;  4IQ1 A;  1Z6M A;  3GTU A;  1XVQ A;  2PGT A;  2PUK C;  2DIZ A;  4BVY A;  4JR4 A;  3Q19 A;  2ZCT A;  1SJ6 A;  1YJ6 A;  2C80 A;  2FWF A;  5IPH A;  4ZXG A;  2GT6 A;  1SD9 A;  20GS A;  1K0D A;  3W8S A;  3GST A;  4GQC A;  1ZOF A;  3KTB A;  3TJK A;  2OBI A;  4XS1 A;  3HJM A;  1BG5 A;  1KBN A;  2C0E A;  4IS0 A;  4G19 A;  2H72 A;  5HR3 A;  1WRY A;  3ZYW A;  3H93 A;  5ECS A;  3C71 A;  5G30 A;  3TKQ A;  3C1S A;  2KHP A;  1GSF A;  1NSW A;  2YNX A;  5J9C A;  3I9V 2;  5GAP D;  1LU4 A;  3TOU A;  2M80 A;  3KH7 A;  2N5B A;  4E8E A;  1BQ7 A;  2OAC A;  2HXK A;  4IVF A;  2YV9 A;  3VWW A;  1GUL A;  2OAD A;  4Q5F A;  5G31 A;  1ERT A;  5D93 A;  4G10 A;  1PGT A;  2L6C A;  4F9Z A;  4YAV A;  1U87 A;  2TRC P;  3TDG A;  2DJ2 A;  1XBS A;  3GUR A;  5JWO B;  2H70 A;  1W89 A;  3VWX A;  4NAX A;  1G0T A;  1B4P A;  1O81 A;  2C1Y A;  1URM A;  2JSZ A;  5DBQ A;  1OC3 A;  2DC5 A;  3QAG A;  2VCV A;  4O92 A;  5IMZ A;  3DXB A;  2FY6 A;  1X0R A;  4F0B A;  4L5O A;  4CHS A;  2CAQ A;  1ERW A;  3C1R A;  3IBH A;  1O8W A;  2RM6 A;  1B48 A;  2GQM A;  4HU7 A;  4I2U A;  2JSY A;  4ECB A;  1AAZ A;  4IW9 A;  3Q18 A;  4EC0 A;  3IR4 A;  2LEG A;  4F2I A;  1GTA A;  2OE0 A;  4MZW A;  2H19 A;  5JWQ B;  5ID2 B;  2O87 A;  1TI1 A;  16GS A;  3TKS A;  1GNE A;  5DCG A;  3UOM A;  1MDI A;  1NHO A;  1Z3E A;  1SJZ A;  2LQQ A;  2V41 A;  2IMI A;  3GL5 A;  3FK8 A;  1KEB A;  3C73 A;  2GLR A;  3TJB A;  3FZ5 A;  1Q4J A;  4NV2 A;  4DVC A;  3FR9 A;  2FWE A;  6GST A;  3H8Q A;  5CYY A;  3NIV A;  3RPP A;  3QPM A;  3TRX A;  3CSJ A;  3APQ A;  3TJF A;  2KLX A;  3HCZ A;  2CQ9 A;  2MMZ A;  4K2D A;  5GZZ B;  5ECQ B;  1FHE A;  4ZL8 A;  3EE2 A;  3BCI A;  1BED A;  1V40 A;  1O7U A;  4L5L A;  1FAA A;  1WWJ A;  3GA4 A;  2X99 A;  1JLW A;  2L5O A;  3ERF A;  1PN9 A;  4XRA A;  4ACS A;  2H0I A;  2E7P A;  4HQS A;  2YN1 A;  5AN1 A;  2VUP A;  1WIK A;  3KCM A;  4MAB A;  1EOG A;  3GH9 A;  2Z9S A;  1HNC A;  2EIO A;  2RII A;  3WD6 A;  3CYN A;  5COH A;  2PWJ A;  1T7P B;  1Z7R A;  2VIM A;  1S3A A;  3U6V A;  1TK0 B;  1G6W A;  4IN0 A;  4MP4 A;  2AV4 A;  4K0G A;  5CRH A;  1USB A;  3H4K A;  4X43 A;  4PUR A;  3KMO A;  1EP8 A;  1E6B A;  2VLV A;  2MMA A;  1A24 A;  5F0G A;  3F63 A;  4MMM A;  2B5X A;  3IHQ A;  3TB2 A;  5ECO B;  4QQ7 A;  1TU7 A;  3TKP A;  3F0I A;  3DVX A;  5B6N A;  3R2Q A;  1GSY A;  2DJ0 A;  1YZX A;  4KB3 A;  3KXO A;  2JZR A;  1FB0 A;  4KDU A;  3KM6 A;  17GS A;  5ENU A;  2DML A;  5CP1 A;  3GMF A;  3ERG A;  2LS5 A;  4ZBD A;  6GSX A;  3AY8 A;  2C3T A;  3A2W A;  4PUA A;  1OKT A;  4JBB A;  3QFB C;  1SYX A;  5IMA A;  5GSS A;  2P5Q A;  1J9B A;  1OVN A;  3EVI A;  2K18 A;  3IK7 A;  4IEL A;  1UC7 A;  1GL8 A;  1XWA A;  4ZB6 A;  1VRS D;  1SKW B;  2DIY A;  3FW2 A;  1WJK A;  5D8I A;  1FG4 A;  2JZT A;  3IC4 A;  4KDX A;  4OD7 A;  4NHW A;  3D6I A;  4MLY A;  2E0Q A;  1A2M A;  4ZB9 A;  1WP0 A;  3VLN A;  4N30 A;  5D9X A;  2H71 A;  5D73 A;  12GS A;  2GQK A;  3ED3 A;  5B8A A;  1YF0 A;  1I9D A;  2VLU A;  3HHV A;  5DAL A;  1GSQ A;  2K6V A;  4TR1 B;  1PA3 A;  2GST A;  3M9J A;  4MF6 A;  2IFQ A;  3F4T A;  1GSD A;  2YPM A;  5JCU A;  1LBK A;  3UJ1 A;  2HZE A;  2F8A A;  5HQP A;  1QMV A;  1AC1 A;  1M0U A;  2PPT A;  4X0X A;  2FNO A;  4EF0 A;  2MBS A;  3Q6O A;  2DJJ A;  4XS4 B;  2FD3 A;  1SKS B;  4MF5 A;  1JZO A;  3D21 A;  5IMC A;  2C8U A;  3K8N A;  3HXS A;  5D9W A;  1SL2 B;  2VM2 A;  1XWG A;  2RLI A;  2M46 A;  2VL2 C;  1R7H A;  4RI7 A;  3F3Q A;  4KA0 A;  3LWA A;  3FEU A;  5AIV A;  1ZCP A;  4PNF A;  4OO5 A;  4MJA A;  3GV1 A;  4IQA A;  5LNK e;  2GSS A;  5KN0 A;  5DAK A;  2PVQ A;  4LMV A;  3UL3 A;  2M72 A;  3A3T A;  2H30 A;  4XTS A;  1AQV A;  1AXD A;  2K8S A;  2L4Q A;  3VFI A;  3FHK A;  1ACV A;  3V1W A;  2YV7 A;  1BX9 A;  1EGR A;  4ZBA A;  3ISO A;  2HE3 A;  2VLT A;  3LQ7 A;  2LRC A;  1BYE A;  1GSU A;  3TRP A;  2V6K A;  1QGV A;  1XOA A;  2AYT A;  3DD3 A;  3ZL5 A;  2GDR A;  4EVM A;  4HDE A;  4JR6 A;  1K0N A;  4ULX A;  5A5K A;  1G6Y A;  1FB6 A;  2CX3 A;  2HSH A;  2R2J A;  4D73 B;  9GSS A;  2VL3 A;  2B5E A;  2EC4 A;  2H76 A;  4PNG A;  3KZQ A;  1G7O A;  4K0N A;  2GT5 A;  3MDK A;  5B7C A;  11GS A;  1TRW A;  1KTE A;  1O85 A;  2WRT A;  1AW9 A;  5B6M A;  3G7J A;  1I5G A;  4J56 E;  2MBT A;  1ML6 A;  2R4V A;  2K9F A;  1PD2 1;  1YY7 A;  2LJK A;  2L57 A;  2YOI A;  4HJM A;  1F3A A;  1Z9H A;  4ZL7 A;  3QR6 A;  2IMD A;  5DDL A;  5IOW A;  2J9H A;  5GST A;  2IJY A;  1MTC A;  4FO5 A;  2YZH A;  4J57 E;  2OE1 A;  4GF0 A;  3ZMK A;  1THX A;  1PQN A;  4AGS A;  1YQ1 A;  4BPY A;  1FOV A;  1AQW A;  1R26 A;  2F9S A;  4HUA A;  1Z6N A;  1TXX A;  3E9J B;  1Y6E A;  4BWS A;  4G9H A;  1XZO A;  1UVZ A;  1K0B A;  1A23 A;  1U3A A;  1M2D A;  4I97 A;  2NTO A;  3EC3 A;  3LXZ A;  1AQX A;  5ECI B;  4MJC A;  4EL1 A;  2NVL A;  4N0V A;  3QFA C;  1V98 A;  4IHU A;  2XPD A;  4GLT A;  3L0H A;  5ELG A;  2FWH A;  4MA9 A;  2GSQ A;  1ZGN A;  2PBJ A;  1M9A A;  4IJI A;  3M9K A;  3WGD A;  3IE3 A;  2DJ3 A;  3LEF A;  2YWO A;  3IOS A;  4KCE A;  5HR0 A;  1X9S B;  2L59 A;  4HZ2 A;  2WB9 A;  2O89 A;  3NOF A;  2XPE A;  1TRV A;  1RW1 A;  4EKZ A;  3VK9 A;  1FW1 A;  3QAW A;  4V2M A;  2H6Y A;  3O76 A;  1ST9 A;  1XWK A;  1GUH A;  13GS A;  3G9B A;  1ILO A;  1K3L A;  2L4C A;  3S9F A;  3HZ4 A;  4F03 A;  3GTU B;  4MCU A;  3TGZ A;  1R5P A;  1J08 A;  3LYP A;  2FHE A;  1OC9 A;  3L4N A;  2TRX A;  4PX1 A;  4K8M A;  1EEJ A;  1YKC A;  2WS2 A;  5J3R A;  4RQX A;  2B3S A;  4LA1 A;  1XVW A;  3CTF A;  5LD0 A;  2G2Q A;  3D22 A;  4H86 A;  3MSZ A;  2MZC A;  2REM A;  4DSS A;  4BWQ A;  4K9Z A;  4ISD A;  1BJX A;  4HOJ A;  1XWB A;  5C04 A;  1HYU A;  3FZA A;  1VF3 A;  2OJL A;  2RUF A;  3WGE A;  2OE3 A;  1T3B A;  1JLV A;  2FA4 A;  3PH9 A;  2C0G A;  4OCE A;  2VCX A;  5A4V A;  2B1L A;  4KAE A;  2IWT A;  4O32 A;  5ECN B;  1HNA A;  2P31 A;  3E3E A;  2YJ7 A;  4TVE A;  4FYB A;  2IMK A;  3HVX A;  4TKY A;  1JFU A;  1ERU A;  4IGJ A;  3UVT A;  4TW5 A;  1CQH A;  2WDU A;  5HFG A;  2MMN A;  1SK2 A;  1U3I A;  4MK3 A;  3VPT A;  1ABA A;  2XBQ A;  5F05 A;  2OKA A;  4XRD A;  3UIW A;  3HJP A;  4XS6 A;  4QL7 A;  5A4U A;  1PX7 A;  1YF1 A;  3UAR A;  3LXT A;  1SYR A;  4GTU A;  1F6M C;  1SD8 A;  1XIY A;  1GSE A;  1WE0 A;  2CT6 A;  4KH7 A;  3F6F A;  1OYJ A;  4ML6 A;  1QQ2 A;  1QFN A;  2QKE A;  1EOH A;  2JZS A;  5EY6 A;  4AF2 A;  3EUR A;  3GRX A;  1S3D A;  3HZ8 A;  4NPB A;  3F8U A;  2KUC A;  4GXZ A;  1NW2 A;  4MZB A;  1M2B A;  1JHB A;  18GS A;  3QMX A;  2LJR A;  3HVS A;  2E2M A;  3LOR A;  3QCP A;  2H1A A;  5IM9 A;  2VD1 A;  2R5G A;  5AIX A;  4XIH A;  1A2L A;  2L5L A;  3HY2 A;  4PQ1 A;  5KN3 A;  5ELA A;  2H0G A;  4WBR D;  2EIR A;  2LUS A;  3VWV A;  1T4Y A;  3D4M A;  1F3B A;  4QL9 A;  1EZK A;  1K0M A;  5EVO A;  3A5W A;  1TTZ A;  1YEP A;  3W6G A;  3RBT A;  2FA8 A;  2F51 A;  1X9M B;  3IPZ A;  2B5Y A;  1GLQ A;  2V2G A;  1EGO A;  2ES7 A;  1WOU A;  2LJA A;  4EE0 A;  3BD2 A;  4K7O A;  4HI7 A;  3RPN A;  2GVP A;  4Q5R A;  3H1N A;  2HRF A;  1O73 A;  2V6O A;  4OWY A;  2VL2 A;  2GS3 A;  3DGQ A;  1X5D A;  14GS A;  2B7K A;  2EIQ A;  2NDO A;  3DML A;  4KDY A;  3ZFB A;  1HD2 A;  3EMP A;  2GZZ A;  2JL4 A;  1OE7 A;  1R4W A;  2CVB A;  2VD0 A;  3KEB A;  1E2Y A;  3O3T A;  2JAD A;  2JU5 A;  3I69 A;  3TKS C;  1RK4 A;  5IMV A;  3VWU A;  3C7M A;  2AB6 A;  3EIN A;  3F4S A;  4NHZ A;  4GWR A;  2GTU A;  4TXV A;  3F3R A;  2HFD A;  3M3M A;  3UAP A;  2BTO T;  1GP1 A;  1MD4 A;  3Q74 A;  1B9Y C;  2H6X A;  2HNL A;  3IXR A;  4P3Y B;  2HLS A;  2LRT A;  3FZ9 A;  3ZIJ A;  3ME8 A;  1TW9 A; 
#chains in the Genus database with same CATH topology
 1TU8 A;  1PL1 A;  2RUE A;  1C72 A;  2DMM A;  4AJ8 A;  2J23 A;  2GZP A;  3EPT A;  4IKH A;  1GNW A;  4WF5 A;  2FUG 2;  3WT1 A;  1T00 A;  2C0D A;  1ZMA A;  4F0C A;  4Q5Q A;  2AJQ B;  5CNW A;  4KND A;  4WET A;  4CW9 A;  4O7H A;  3L9V A;  3HD5 A;  5IQY A;  3BOA A;  3FMW A;  3KMN A;  1M7T A;  4OO4 A;  2RM5 A;  3N5O A;  2NBS A;  2IN3 A;  3VI7 A;  1V9W A;  5G2Z A;  2YAN A;  4MJE A;  2QA1 A;  4JZQ A;  2N5A A;  4Z2T A;  1VF4 A;  3BBY A;  1XCC A;  4XCS A;  1DSB A;  5J5N A;  3IAM 2;  3GSS A;  1Q98 A;  1ZL9 A;  5D9T A;  3KP9 A;  3GIX A;  4I6X A;  4MH3 A;  4N0Z A;  4K1F A;  5H5R A;  2CA8 A;  3TKS E;  5ECM B;  4G0I A;  4OCF A;  4WEY A;  2HRA A;  2A4V A;  4TOP A;  1UN2 A;  1PKW A;  2DBC A;  3FRC A;  4K7I A;  3DYR A;  3MNG A;  1XXU A;  5D96 A;  4FYU A;  1ZZY A;  4NXI A;  2FCH A;  4RI6 A;  2IFQ B;  3HYP A;  3TJG A;  4DSR A;  1TRU A;  4PQH A;  4V1A p;  3SWL A;  4EDZ A;  2BJX A;  3APS A;  2HZE B;  2FGX A;  2KP1 A;  4TXO B;  2QC7 A;  4KE3 A;  5LCZ A;  1NHY A;  2I81 A;  2XC2 A;  2CZ3 A;  5HFK A;  2YZU A;  1FO5 A;  3IRA A;  2PMT A;  4FYC A;  1YEX A;  1TDI A;  3GNJ A;  5J9B A;  5ECH B;  1SU9 A;  5ABR A;  1HNB A;  2MYG A;  2R6K A;  3L9U A;  3IV4 A;  4PGT A;  2HRK A;  4CDO A;  2ALB A;  1MEK A;  2MMO A;  2VO4 A;  1GTU A;  1TP9 A;  6GSS A;  2YWN A;  3CBU A;  3M8N A;  4OMV A;  2O85 A;  1H75 A;  5JWR B;  5DAK B;  3ZFL A;  4WF4 A;  4V2L A;  4X1U A;  3MYD A;  1MD3 A;  4GST A;  1V57 A;  2HRN A;  3UBK A;  3ZVJ D;  2PN8 A;  2A2S A;  2WCI A;  5FT3 A;  1RQM A;  3EU3 A;  4K7N A;  3ZVJ A;  2O7K A;  2H66 A;  3KD0 A;  4DEJ A;  4HEA 2;  3TUE A;  2F3M A;  1TK5 B;  2QSI A;  4AJ7 A;  4FQU A;  5F07 A;  5H5S A;  2CZ2 A;  5HFI A;  4YKG A;  2LQO A;  5G5F A;  1O8X A;  1OKD A;  4ZL9 A;  4AJ6 A;  2VM1 A;  3RHB A;  1YKA A;  4EDY A;  5BMU A;  1Z7P A;  5IOX A;  2HSY A;  1GTB A;  1A0R P;  5ECL B;  3L9S A;  5E59 A;  2LST A;  6GSU A;  2WZ9 A;  5H5Q A;  2YWI A;  1B9X C;  1T1V A;  2VL9 A;  3LFL A;  1K0A A;  2GGT A;  4I2T A;  5CAX A;  4FIW A;  5G1L A;  4YQM A;  3CTG A;  3GH6 A;  1T4Z A;  1PFO A;  4MDC A;  3PGT A;  2X64 A;  3G7Y A;  1V58 A;  1Z5Y E;  1GUK A;  3O6T A;  1JZD A;  3ZZX A;  2C3N A;  4ZIL A;  1XWC A;  3EU4 A;  3D4T A;  3MWH A;  4KCA A;  1ZYE A;  1NM3 A;  5FWG A;  3FYG A;  4JED A;  2ZNM A;  1BAY A;  1O6J A;  1XOB A;  1OAZ A;  2PVO C;  3WYW A;  3CXG A;  4IBP A;  4E8H A;  2KOK A;  2LNT A;  1PL2 A;  3IAS 2;  1GWC A;  5DCH A;  1DUG A;  4N11 A;  2L6D A;  4POK A;  1PRX A;  5ID2 A;  3J7Y k;  1X5E A;  2OA7 A;  3CRT A;  3UEM A;  3LGC A;  5DQY A;  1M3I A;  3VUR A;  3BJ5 A;  2ON7 A;  3I43 A;  2QGV A;  3OR5 A;  1F9M A;  1ON4 A;  5FHI A;  1OE8 A;  4V1A g;  2YJH A;  1N2A A;  5C00 A;  2AUV A;  3M1G A;  5DQS A;  1MDJ A;  2HYX A;  2WGR A;  3J7Y b;  4KW6 A;  4POL A;  4DSQ A;  4J2F A;  5JCG A;  4YH2 A;  5AIS A;  3F9U A;  4OFT A;  4ZB8 A;  4POM A;  5CRD A;  4G2E A;  3ZLP A;  4GSN A;  2XBI A;  2H1G A;  2R37 A;  2ON5 A;  4TR4 A;  2HZF A;  4KX4 A;  1SEN A;  3P7X A;  2PER A;  1JZR A;  4MNN A;  3SBC A;  4MF7 A;  5ECK B;  2IL3 A;  1IYH A;  2AHE A;  4TR3 A;  2CVD A;  3KJY A;  1XW9 A;  3QAV A;  2B7J A;  4OFM A;  2FLS A;  2YP6 A;  4HQZ A;  3P2A A;  4JE1 A;  1YDK A;  1TI3 A;  3W8J A;  2E2G A;  3KGK A;  4RQR A;  1OC9 B;  4NWY A;  1X5C A;  3GHA A;  1SK0 A;  1PSQ A;  2VCT A;  3GUS A;  3DWV A;  4OFN A;  4MPF A;  2VOC A;  2GZY A;  4NMU A;  3RHC A;  3ZRD A;  4L0U A;  3TKR A;  3MAK A;  1W4V A;  3D5J A;  5CRG A;  4LMW A;  2YCD A;  3DRN A;  4DSS B;  5INY A;  3CSH A;  3NZN A;  1FVJ A;  2DJ1 A;  3GX8 A;  1K0O A;  4NV5 A;  1M99 A;  1B8X A;  5EL8 A;  2H73 A;  2LKU A;  3HVV A;  2DSA A;  1JZW A;  3TJJ A;  3RAZ A;  1SKR B;  1PX6 A;  1WPI A;  3H79 A;  2NPB A;  2LRN A;  1H4O A;  4BVX A;  4XHM A;  3DEX A;  3LG6 A;  2P5R A;  4ICY A;  2WUL A;  3VPQ A;  1SL0 B;  5DJL A;  2VCZ A;  3PIN A;  2LNS A;  4ECC A;  1VF1 A;  3R3E A;  2H1D A;  2CX4 A;  3ZIV A;  1GRX A;  2B6M A;  3C8E A;  3GKM A;  4KF9 A;  2HT9 A;  3FR6 A;  4WR4 A;  5IMF A;  2H8L A;  4HZ4 A;  4LL1 B;  2IIY A;  4ECI A;  1TOF A;  5F06 A;  5F8B A;  3EYT A;  1K3Y A;  1F37 A;  6GSW A;  3IDV A;  1DBY A;  2VAF A;  2WJU A;  2DJK A;  2D2Z A;  4HU9 A;  1SK1 A;  1SJI A;  2X8C A;  3TRQ A;  4EO3 A;  1GLP A;  2VCQ A;  2I1U A;  1A2J A;  4EUY A;  2XHF A;  4I5Q A;  1XW5 A;  4JRR A;  4TR1 A;  1EV4 A;  4Z7X A;  5GAN D;  4WKW A;  5DJM A;  3GKN A;  4KSO A;  2C0F A;  4F82 A;  5IIZ A;  3LJR A;  3KIJ A;  5KN1 A;  4PUF C;  2F8F A;  3WGX A;  3RDW A;  3FZ4 A;  1X9W B;  4TR0 A;  1R5A A;  4TRX A;  2LV3 A;  1AUC A;  3I6A A;  4XS4 A;  3F4R A;  3WT2 A;  5L71 A;  4L8E A;  2I3Y A;  2X49 A;  2DKI A;  1AIU A;  3KTL A;  3GN3 A;  1GH2 A;  5KN2 A;  3A2X A;  1QK8 A;  8GSS A;  2R3X A;  1TK8 B;  2P0G A;  4MZC A;  4O5Q A;  3QD9 A;  3A2V A;  5G5E A;  4IJ3 A;  3BCK A;  3CRU A;  4HSC X;  2GQL A;  1B4Q A;  4IP6 A;  4K6X A;  3PR8 A;  2A2R A;  1TRS A;  5E4W A;  2LTK A;  4BA7 A;  6GSY A;  5HR1 A;  1THO A;  1GTI A;  5IMD A;  10GS A;  3CSI A;  5KEJ A;  3GKX A;  3UBL A;  1VF2 A;  1J0F A;  2IPA A;  3VI5 A;  1PMT A;  4WXT A;  2HI7 A;  5IPG A;  3G7I A;  1Y25 A;  4LLR A;  19GS A;  6GSV A;  3GKK A;  5JCW A;  3ZRE A;  5IO2 A;  1XPV A;  3HDC A;  5J4U A;  4N10 A;  5DVB A;  2ZUP A;  1QUW A;  3P90 A;  3QDN A;  2CVK A;  2OBK A;  5G1K A;  3ZTL A;  3FKF A;  4BL7 A;  3HA9 A;  4FH8 A;  1F2E A;  1XW6 A;  4KSM A;  3IK9 A;  1EP7 A;  4TXO A;  3IA1 A;  4GSS A;  4CY6 A;  1N8J A;  5ECP B;  1IYI A;  1U88 A;  1ERV A;  22GS A;  5ECR B;  1M9B A;  2WFC A;  4WR5 A;  3TCO A;  4K5S A;  4YAP A;  4D73 A;  2C3Q A;  2IMF A;  1SL1 B;  1T8E B;  1GSS A;  1EWX A;  2I9H A;  1EEM A;  3KP8 A;  1V2A A;  1CQG A;  1K3O A;  5EPF A;  3P8W A;  4JU5 A;  1A8Y A;  4ID0 A;  5HR2 A;  4KUN A;  2N5F A;  3CMI A;  3APO A;  2H74 A;  3ZIT A;  2GSR A;  4RUV A;  5DAL B;  1G7E A;  4G0L A;  2V1M A;  2H75 A;  4I8B A;  1M2A A;  4Q5N A;  1XFL A;  3JCM L;  4ZIJ A;  3HKR A;  3GL3 A;  2X8G A;  1FVK A;  4POB A;  2JAC A;  5AGY A;  5CRW A;  1K0C A;  1A8L A;  4GRF A;  4L0W A;  1HQO A;  1KNG A;  4TN8 A;  1XG8 A;  4YQV A;  3N9J A;  3UVH A;  1ZYQ B;  3U5R E;  4YQU A;  4ECJ A;  2TIR A;  2FWG A;  2O8V B;  2IME A;  4EXJ A;  5CRE A;  3FR3 A;  3US3 A;  2BMX A;  1UA5 A;  4X4J A;  2YWM A;  4HJ2 A;  2KP2 A;  1DE1 A;  1EV9 A;  3F6D A;  4MPG A;  1OC8 A;  2C4J A;  3FY7 A;  3DKS A;  2X8H A;  2CAI A;  3DVW A;  1S3C A;  3GFK A;  3L78 A;  3LSZ A;  2H6Z A;  3HJO A;  4WBJ A;  4MH2 A;  2AAW A;  2H1B A;  3EMX A;  1PKZ A;  7GSS A;  3QOU A;  1LJR A;  1TJD A;  4LL4 B;  1TKD B;  3E0U A;  2V32 A;  2K8V A;  3ME7 A;  4PXO A;  4MJB A;  4GQF A;  2I4A A;  3DIE A;  4ILF A;  4HS1 A;  4V2N A;  5IO0 A;  1MDK A;  2VCW A;  3M0F A;  1VGL A;  5B8B A;  4GCI A;  4IP1 A;  4ZBB A;  1QXH A;  1GUM A;  5D9V A;  2H01 A;  2DLX A;  2CV4 A;  1A0F A;  4PQI A;  2H0H A;  4ML1 A;  2PU9 C;  3ERW A;  3TOT A;  2G0F A;  1WMJ A;  3UMA A;  1U6T A;  2B1K A;  3CQF A;  5J41 A;  3EWL A;  3ZML A;  3GX0 A;  1DE2 A;  4O5R A;  4K2X A;  3GYK A;  4KGI A;  3D0Z A;  3LYK A;  3KH9 A;  5A4W A;  5CO3 A;  4IQ1 A;  1Z6M A;  3GTU A;  1XVQ A;  2PGT A;  2PUK C;  2DIZ A;  4BVY A;  3A5I A;  4JR4 A;  3Q19 A;  2ZCT A;  1SJ6 A;  1YJ6 A;  2C80 A;  2FWF A;  5IPH A;  4ZXG A;  2GT6 A;  1SD9 A;  20GS A;  1K0D A;  2HSM A;  3W8S A;  3GST A;  4GQC A;  1ZOF A;  3KTB A;  3TJK A;  2OBI A;  4XS1 A;  3HJM A;  1BG5 A;  4EIP A;  1KBN A;  2C0E A;  4IS0 A;  4G19 A;  2H72 A;  5HR3 A;  1WRY A;  3ZYW A;  3H93 A;  5ECS A;  3C71 A;  5G30 A;  3TKQ A;  3C1S A;  2KHP A;  1GSF A;  2A4H A;  1NSW A;  2YNX A;  5J9C A;  3I9V 2;  5GAP D;  1LU4 A;  3TOU A;  2M80 A;  3KH7 A;  2N5B A;  4E8E A;  1BQ7 A;  2OAC A;  2R0G A;  2HXK A;  4IVF A;  2YV9 A;  3VWW A;  1GUL A;  2OAD A;  4Q5F A;  5G31 A;  1ERT A;  5D93 A;  4G10 A;  1PGT A;  2L6C A;  4F9Z A;  4YAV A;  1U87 A;  2TRC P;  3TDG A;  2DJ2 A;  1XBS A;  3GUR A;  5JWO B;  2H70 A;  1W89 A;  3VWX A;  2X4A A;  4NAX A;  1G0T A;  1B4P A;  1O81 A;  2C1Y A;  1URM A;  2JSZ A;  5DBQ A;  1OC3 A;  2DC5 A;  3QAG A;  2VCV A;  4O92 A;  5IMZ A;  3DXB A;  2FY6 A;  1X0R A;  4F0B A;  4L5O A;  4CHS A;  2CAQ A;  1ERW A;  3C1R A;  3IBH A;  1O8W A;  2RM6 A;  1B48 A;  2GQM A;  4HU7 A;  4I2U A;  2JSY A;  4ECB A;  1AAZ A;  4IW9 A;  3Q18 A;  4EC0 A;  3IR4 A;  2LEG A;  4F2I A;  1GTA A;  2OE0 A;  4MZW A;  2H19 A;  5JWQ B;  5ID2 B;  2O87 A;  1TI1 A;  16GS A;  3TKS A;  1GNE A;  5DCG A;  3UOM A;  1MDI A;  1NHO A;  1Z3E A;  1ZYN A;  1SJZ A;  2LQQ A;  2V41 A;  2IMI A;  3GL5 A;  3FK8 A;  1KEB A;  3C73 A;  2GLR A;  3TJB A;  3FZ5 A;  1Q4J A;  4NV2 A;  4DVC A;  3FR9 A;  2FWE A;  6GST A;  3H8Q A;  5CYY A;  2QA2 A;  3NIV A;  3RPP A;  3QPM A;  3TRX A;  3CSJ A;  3APQ A;  3TJF A;  2KLX A;  3HCZ A;  2CQ9 A;  4K5R A;  2MMZ A;  4K2D A;  5GZZ B;  1M3J A;  5ECQ B;  1FHE A;  4ZL8 A;  3EE2 A;  3BCI A;  1BED A;  1V40 A;  1O7U A;  4L5L A;  1FAA A;  1WWJ A;  3GA4 A;  2X99 A;  1JLW A;  2L5O A;  3ERF A;  1PN9 A;  4XRA A;  4ACS A;  2H0I A;  2E7P A;  4HQS A;  2YN1 A;  5AN1 A;  2VUP A;  1WIK A;  3KCM A;  4MAB A;  1EOG A;  3GH9 A;  2Z9S A;  1HNC A;  2EIO A;  2RII A;  3WD6 A;  3CYN A;  5COH A;  2PWJ A;  1T7P B;  1Z7R A;  2VIM A;  1S3A A;  3U6V A;  1TK0 B;  1G6W A;  4IN0 A;  4MP4 A;  3PPU A;  2AV4 A;  4K0G A;  5CRH A;  1USB A;  3H4K A;  4X43 A;  4PUR A;  3KMO A;  1EP8 A;  1E6B A;  2VLV A;  2MMA A;  1A24 A;  5F0G A;  3F63 A;  4MMM A;  2B5X A;  3IHQ A;  3TB2 A;  5ECO B;  4QQ7 A;  1TU7 A;  3TKP A;  3F0I A;  3DVX A;  5B6N A;  3R2Q A;  1GSY A;  2DJ0 A;  1YZX A;  4KB3 A;  3KXO A;  2JZR A;  1FB0 A;  4KDU A;  3KM6 A;  17GS A;  5ENU A;  2DML A;  5CP1 A;  3GMF A;  3ERG A;  2LS5 A;  4ZBD A;  6GSX A;  3AY8 A;  2C3T A;  3A2W A;  4PUA A;  4BVX B;  1OKT A;  4JBB A;  3QFB C;  1SYX A;  5IMA A;  5GSS A;  2P5Q A;  1J9B A;  1OVN A;  3EVI A;  2K18 A;  3IK7 A;  4IEL A;  1UC7 A;  1GL8 A;  1XWA A;  4ZB6 A;  1VRS D;  1SKW B;  2DIY A;  3FW2 A;  1WJK A;  5D8I A;  1FG4 A;  2JZT A;  3IC4 A;  4KDX A;  4OD7 A;  4NHW A;  3D6I A;  4MLY A;  2E0Q A;  1A2M A;  4ZB9 A;  1WP0 A;  3VLN A;  4N30 A;  5D9X A;  2H71 A;  5D73 A;  12GS A;  2GQK A;  3ED3 A;  5B8A A;  1YF0 A;  1I9D A;  2VLU A;  3HHV A;  5DAL A;  1GSQ A;  2K6V A;  4TR1 B;  4A5P A;  1PA3 A;  2GST A;  3M9J A;  4MF6 A;  2IFQ A;  3F4T A;  1GSD A;  2YPM A;  5JCU A;  1LBK A;  3UJ1 A;  2HZE A;  2F8A A;  5HQP A;  1QMV A;  1AC1 A;  1M0U A;  2PPT A;  4X0X A;  2FNO A;  4EF0 A;  2MBS A;  3Q6O A;  5KOX A;  2DJJ A;  4XS4 B;  2FD3 A;  1SKS B;  4MF5 A;  1JZO A;  3D21 A;  5IMC A;  2C8U A;  3K8N A;  3HXS A;  5D9W A;  1SL2 B;  2VM2 A;  1XWG A;  2RLI A;  2M46 A;  2VL2 C;  1R7H A;  4RI7 A;  3F3Q A;  4KA0 A;  3LWA A;  3FEU A;  5AIV A;  1ZCP A;  4PNF A;  4OO5 A;  4MJA A;  3GV1 A;  4IQA A;  5LNK e;  2GSS A;  5KN0 A;  5DAK A;  2PVQ A;  4LMV A;  3UL3 A;  2M72 A;  3A3T A;  2H30 A;  4XTS A;  1AQV A;  1AXD A;  1ZYP A;  2K8S A;  2L4Q A;  3VFI A;  3FHK A;  1ACV A;  3V1W A;  2YV7 A;  1BX9 A;  3IHG A;  1EGR A;  1FOH A;  4ZBA A;  3ISO A;  2HE3 A;  2VLT A;  3LQ7 A;  2LRC A;  1S3R A;  1BYE A;  1GSU A;  3TRP A;  2V6K A;  1QGV A;  1XOA A;  2AYT A;  4BL7 B;  3DD3 A;  3ZL5 A;  2GDR A;  4EVM A;  5KOW A;  4HDE A;  4JR6 A;  1K0N A;  4ULX A;  5A5K A;  1G6Y A;  1FB6 A;  2CX3 A;  2HSH A;  2R2J A;  4D73 B;  9GSS A;  2VL3 A;  2B5E A;  2EC4 A;  2H76 A;  4PNG A;  3KZQ A;  1G7O A;  4K0N A;  2GT5 A;  3MDK A;  5B7C A;  11GS A;  1TRW A;  1KTE A;  1O85 A;  4YKF A;  2WRT A;  1AW9 A;  5B6M A;  3G7J A;  1I5G A;  4J56 E;  2MBT A;  1ML6 A;  4G0K A;  2R4V A;  2K9F A;  1PD2 1;  1YY7 A;  2LJK A;  2L57 A;  3HVN A;  2YOI A;  4HJM A;  1F3A A;  1Z9H A;  4ZL7 A;  3QR6 A;  2IMD A;  5DDL A;  5IOW A;  2J9H A;  5GST A;  2IJY A;  1MTC A;  4FO5 A;  2YZH A;  4J57 E;  2OE1 A;  4GF0 A;  3ZMK A;  1THX A;  1PQN A;  4AGS A;  1YQ1 A;  4BPY A;  1FOV A;  1AQW A;  1R26 A;  2F9S A;  4HUA A;  1Z6N A;  1TXX A;  3E9J B;  1Y6E A;  4BWS A;  4G9H A;  1XZO A;  1UVZ A;  1K0B A;  1A23 A;  1U3A A;  1M2D A;  4I97 A;  2NTO A;  3EC3 A;  3LXZ A;  1AQX A;  4CY8 A;  5ECI B;  4MJC A;  4EL1 A;  2NVL A;  4N0V A;  3QFA C;  1V98 A;  4IHU A;  2XPD A;  4GLT A;  3L0H A;  5ELG A;  2FWH A;  4MA9 A;  2GSQ A;  1ZGN A;  2PBJ A;  1M9A A;  4IJI A;  3M9K A;  3WGD A;  3IE3 A;  2DJ3 A;  3LEF A;  2YWO A;  3IOS A;  4KCE A;  5HR0 A;  1X9S B;  2L59 A;  4HZ2 A;  2WB9 A;  2O89 A;  3NOF A;  2XPE A;  1TRV A;  1RW1 A;  4EKZ A;  3VK9 A;  4V2M A;  1FW1 A;  3QAW A;  2H6Y A;  3O76 A;  1ST9 A;  1XWK A;  1GUH A;  13GS A;  3G9B A;  1ILO A;  4Z2R A;  1K3L A;  2L4C A;  3S9F A;  3HZ4 A;  4F03 A;  3GTU B;  4MCU A;  3TGZ A;  1R5P A;  1J08 A;  3LYP A;  4BVY B;  2FHE A;  1OC9 A;  3L4N A;  2TRX A;  4PX1 A;  4K8M A;  1EEJ A;  1YKC A;  2WS2 A;  5J3R A;  4RQX A;  2B3S A;  4O5U A;  4LA1 A;  1XVW A;  4BIK A;  3CTF A;  5LD0 A;  2G2Q A;  3D22 A;  4H86 A;  3MSZ A;  2MZC A;  2REM A;  4DSS A;  4BWQ A;  4K9Z A;  4ISD A;  1BJX A;  4HOJ A;  1XWB A;  2R0P A;  5C04 A;  1HYU A;  3FZA A;  1VF3 A;  2OJL A;  2RUF A;  3WGE A;  2OE3 A;  1T3B A;  1JLV A;  2FA4 A;  3PH9 A;  2C0G A;  4OCE A;  2VCX A;  5A4V A;  2B1L A;  4KAE A;  2IWT A;  4O32 A;  5ECN B;  1HNA A;  2P31 A;  3E3E A;  2YJ7 A;  4TVE A;  4FYB A;  2IMK A;  3HVX A;  4TKY A;  1JFU A;  1ERU A;  4IGJ A;  3UVT A;  4TW5 A;  4EIQ A;  1CQH A;  2WDU A;  5HFG A;  2MMN A;  1SK2 A;  1U3I A;  4MK3 A;  3VPT A;  1ABA A;  2XBQ A;  5F05 A;  2OKA A;  4XRD A;  3UIW A;  3HJP A;  4XS6 A;  4QL7 A;  5A4U A;  1PX7 A;  1YF1 A;  3UAR A;  3LXT A;  1SYR A;  4GTU A;  1F6M C;  3MIX A;  1SD8 A;  1XIY A;  1GSE A;  1WE0 A;  2CT6 A;  4KH7 A;  3F6F A;  1OYJ A;  4ML6 A;  1QQ2 A;  1QFN A;  2QKE A;  1EOH A;  2JZS A;  5EY6 A;  4PTS A;  4AF2 A;  3EUR A;  3GRX A;  1S3D A;  3HZ8 A;  4NPB A;  3F8U A;  2KUC A;  4GXZ A;  1NW2 A;  4MZB A;  1M2B A;  2A2P A;  1JHB A;  18GS A;  3QMX A;  2LJR A;  3HVS A;  2E2M A;  3LOR A;  3QCP A;  2H1A A;  5IM9 A;  2DKH A;  2VD1 A;  3LW9 A;  2R5G A;  5AIX A;  4XIH A;  1A2L A;  2L5L A;  3HY2 A;  4PQ1 A;  5KN3 A;  5ELA A;  2H0G A;  4WBR D;  2EIR A;  2LUS A;  3VWV A;  2R0C A;  1T4Y A;  3D4M A;  1F3B A;  4QL9 A;  1EZK A;  1K0M A;  5EVO A;  3A5W A;  1TTZ A;  1YEP A;  3W6G A;  1PN0 A;  3RBT A;  3IC8 A;  2FA8 A;  2F51 A;  1X9M B;  3IPZ A;  2B5Y A;  4Z2U A;  1GLQ A;  2V2G A;  1EGO A;  2ES7 A;  1WOU A;  2LJA A;  4EE0 A;  3BD2 A;  4K7O A;  4HI7 A;  3RPN A;  2GVP A;  4Q5R A;  5BRT A;  3H1N A;  2HRF A;  1O73 A;  2V6O A;  4OWY A;  2VL2 A;  2GS3 A;  4USS A;  3DGQ A;  1X5D A;  14GS A;  2B7K A;  2EIQ A;  2NDO A;  3DML A;  4KDY A;  3ZFB A;  1HD2 A;  3EMP A;  2GZZ A;  2JL4 A;  1OE7 A;  1R4W A;  2CVB A;  2VD0 A;  3KEB A;  1E2Y A;  3O3T A;  2JAD A;  2JU5 A;  3I69 A;  3TKS C;  1RK4 A;  5IMV A;  3VWU A;  3C7M A;  2AB6 A;  3EIN A;  3F4S A;  4NHZ A;  4GWR A;  2GTU A;  4TXV A;  3F3R A;  2HFD A;  3M3M A;  3UAP A;  2BTO T;  1GP1 A;  2UZ8 A;  1MD4 A;  3Q74 A;  1B9Y C;  2H6X A;  2HNL A;  3IXR A;  4P3Y B;  2HLS A;  2LRT A;  3FZ9 A;  3ZIJ A;  3ME8 A;  1TW9 A; 
#chains in the Genus database with same CATH homology
 1TU8 A;  1PL1 A;  2RUE A;  1C72 A;  2DMM A;  4AJ8 A;  2J23 A;  2GZP A;  3EPT A;  4IKH A;  1GNW A;  4WF5 A;  2FUG 2;  3WT1 A;  1T00 A;  2C0D A;  1ZMA A;  4F0C A;  4Q5Q A;  2AJQ B;  5CNW A;  4KND A;  4WET A;  4CW9 A;  4O7H A;  3L9V A;  3HD5 A;  5IQY A;  3BOA A;  3FMW A;  3KMN A;  1M7T A;  4OO4 A;  2RM5 A;  3N5O A;  2NBS A;  2IN3 A;  3VI7 A;  1V9W A;  5G2Z A;  2YAN A;  4MJE A;  2QA1 A;  4JZQ A;  2N5A A;  4Z2T A;  1VF4 A;  3BBY A;  1XCC A;  4XCS A;  1DSB A;  5J5N A;  3IAM 2;  3GSS A;  1Q98 A;  1ZL9 A;  5D9T A;  3KP9 A;  3GIX A;  4I6X A;  4MH3 A;  4N0Z A;  4K1F A;  5H5R A;  2CA8 A;  3TKS E;  5ECM B;  4G0I A;  4OCF A;  4WEY A;  2HRA A;  2A4V A;  4TOP A;  1UN2 A;  1PKW A;  2DBC A;  3FRC A;  4K7I A;  3DYR A;  3MNG A;  1XXU A;  5D96 A;  4FYU A;  1ZZY A;  4NXI A;  2FCH A;  4RI6 A;  2IFQ B;  3HYP A;  3TJG A;  4DSR A;  1TRU A;  4PQH A;  4V1A p;  3SWL A;  4EDZ A;  2BJX A;  3APS A;  2HZE B;  2FGX A;  2KP1 A;  4TXO B;  2QC7 A;  4KE3 A;  5LCZ A;  1NHY A;  2I81 A;  2XC2 A;  2CZ3 A;  5HFK A;  2YZU A;  1FO5 A;  3IRA A;  2PMT A;  4FYC A;  1YEX A;  1TDI A;  3GNJ A;  5J9B A;  5ECH B;  1SU9 A;  5ABR A;  1HNB A;  2MYG A;  2R6K A;  3L9U A;  3IV4 A;  4PGT A;  2HRK A;  4CDO A;  2ALB A;  1MEK A;  2MMO A;  2VO4 A;  1GTU A;  1TP9 A;  6GSS A;  2YWN A;  3CBU A;  3M8N A;  4OMV A;  2O85 A;  1H75 A;  5JWR B;  5DAK B;  3ZFL A;  4WF4 A;  4V2L A;  4X1U A;  3MYD A;  1MD3 A;  4GST A;  1V57 A;  2HRN A;  3UBK A;  3ZVJ D;  2PN8 A;  2A2S A;  2WCI A;  5FT3 A;  1RQM A;  3EU3 A;  4K7N A;  3ZVJ A;  2O7K A;  2H66 A;  3KD0 A;  4DEJ A;  4HEA 2;  3TUE A;  2F3M A;  1TK5 B;  2QSI A;  4AJ7 A;  4FQU A;  5F07 A;  5H5S A;  2CZ2 A;  5HFI A;  4YKG A;  2LQO A;  5G5F A;  1O8X A;  1OKD A;  4ZL9 A;  4AJ6 A;  2VM1 A;  3RHB A;  1YKA A;  4EDY A;  5BMU A;  1Z7P A;  5IOX A;  2HSY A;  1GTB A;  1A0R P;  5ECL B;  3L9S A;  5E59 A;  2LST A;  6GSU A;  2WZ9 A;  5H5Q A;  2YWI A;  1B9X C;  1T1V A;  2VL9 A;  3LFL A;  1K0A A;  2GGT A;  4I2T A;  5CAX A;  4FIW A;  5G1L A;  4YQM A;  3CTG A;  3GH6 A;  1T4Z A;  4MDC A;  3PGT A;  2X64 A;  3G7Y A;  1V58 A;  1Z5Y E;  1GUK A;  3O6T A;  1JZD A;  3ZZX A;  2C3N A;  4ZIL A;  1XWC A;  3EU4 A;  3D4T A;  3MWH A;  4KCA A;  1ZYE A;  1NM3 A;  5FWG A;  3FYG A;  4JED A;  2ZNM A;  1BAY A;  1O6J A;  1XOB A;  1OAZ A;  2PVO C;  3WYW A;  3CXG A;  4IBP A;  4E8H A;  2KOK A;  2LNT A;  1PL2 A;  3IAS 2;  1GWC A;  5DCH A;  1DUG A;  4N11 A;  2L6D A;  4POK A;  1PRX A;  5ID2 A;  3J7Y k;  1X5E A;  2OA7 A;  3CRT A;  3UEM A;  3LGC A;  5DQY A;  3VUR A;  3BJ5 A;  2ON7 A;  3I43 A;  2QGV A;  3OR5 A;  1F9M A;  1ON4 A;  5FHI A;  1OE8 A;  4V1A g;  2YJH A;  1N2A A;  5C00 A;  2AUV A;  3M1G A;  5DQS A;  1MDJ A;  2HYX A;  2WGR A;  3J7Y b;  4KW6 A;  4POL A;  4DSQ A;  4J2F A;  5JCG A;  4YH2 A;  5AIS A;  3F9U A;  4OFT A;  4ZB8 A;  4POM A;  5CRD A;  4G2E A;  3ZLP A;  4GSN A;  2XBI A;  2H1G A;  2R37 A;  2ON5 A;  4TR4 A;  2HZF A;  4KX4 A;  1SEN A;  3P7X A;  2PER A;  1JZR A;  4MNN A;  3SBC A;  4MF7 A;  5ECK B;  2IL3 A;  1IYH A;  2AHE A;  4TR3 A;  2CVD A;  3KJY A;  1XW9 A;  3QAV A;  2B7J A;  4OFM A;  2FLS A;  2YP6 A;  4HQZ A;  3P2A A;  4JE1 A;  1YDK A;  1TI3 A;  3W8J A;  2E2G A;  3KGK A;  4RQR A;  1OC9 B;  4NWY A;  1X5C A;  3GHA A;  1SK0 A;  1PSQ A;  2VCT A;  3GUS A;  3DWV A;  4OFN A;  4MPF A;  2VOC A;  2GZY A;  4NMU A;  3RHC A;  3ZRD A;  4L0U A;  3TKR A;  3MAK A;  1W4V A;  3D5J A;  5CRG A;  4LMW A;  2YCD A;  3DRN A;  4DSS B;  5INY A;  3CSH A;  3NZN A;  1FVJ A;  2DJ1 A;  3GX8 A;  1K0O A;  4NV5 A;  1M99 A;  1B8X A;  5EL8 A;  2H73 A;  2LKU A;  3HVV A;  2DSA A;  1JZW A;  3TJJ A;  3RAZ A;  1SKR B;  1PX6 A;  1WPI A;  3H79 A;  2NPB A;  2LRN A;  1H4O A;  4BVX A;  4XHM A;  3DEX A;  3LG6 A;  2P5R A;  4ICY A;  2WUL A;  3VPQ A;  1SL0 B;  5DJL A;  2VCZ A;  3PIN A;  2LNS A;  4ECC A;  1VF1 A;  3R3E A;  2H1D A;  2CX4 A;  3ZIV A;  1GRX A;  2B6M A;  3C8E A;  3GKM A;  4KF9 A;  2HT9 A;  3FR6 A;  4WR4 A;  5IMF A;  2H8L A;  4HZ4 A;  4LL1 B;  2IIY A;  4ECI A;  1TOF A;  5F06 A;  5F8B A;  3EYT A;  1K3Y A;  1F37 A;  6GSW A;  3IDV A;  1DBY A;  2VAF A;  2WJU A;  2DJK A;  2D2Z A;  4HU9 A;  1SK1 A;  1SJI A;  2X8C A;  3TRQ A;  4EO3 A;  1GLP A;  2VCQ A;  2I1U A;  1A2J A;  4EUY A;  2XHF A;  4I5Q A;  1XW5 A;  4JRR A;  4TR1 A;  1EV4 A;  4Z7X A;  5GAN D;  4WKW A;  5DJM A;  3GKN A;  4KSO A;  2C0F A;  4F82 A;  5IIZ A;  3LJR A;  3KIJ A;  5KN1 A;  4PUF C;  2F8F A;  3WGX A;  3RDW A;  3FZ4 A;  1X9W B;  4TR0 A;  1R5A A;  4TRX A;  2LV3 A;  1AUC A;  3I6A A;  4XS4 A;  3F4R A;  3WT2 A;  5L71 A;  4L8E A;  2I3Y A;  2X49 A;  2DKI A;  1AIU A;  3KTL A;  3GN3 A;  1GH2 A;  5KN2 A;  3A2X A;  1QK8 A;  8GSS A;  2R3X A;  1TK8 B;  2P0G A;  4MZC A;  4O5Q A;  3QD9 A;  3A2V A;  5G5E A;  4IJ3 A;  3BCK A;  3CRU A;  2GQL A;  1B4Q A;  4IP6 A;  4K6X A;  3PR8 A;  2A2R A;  1TRS A;  5E4W A;  2LTK A;  4BA7 A;  6GSY A;  5HR1 A;  1THO A;  1GTI A;  5IMD A;  10GS A;  3CSI A;  5KEJ A;  3GKX A;  3UBL A;  1VF2 A;  1J0F A;  2IPA A;  3VI5 A;  1PMT A;  4WXT A;  2HI7 A;  5IPG A;  3G7I A;  1Y25 A;  4LLR A;  19GS A;  6GSV A;  3GKK A;  5JCW A;  3ZRE A;  5IO2 A;  1XPV A;  3HDC A;  5J4U A;  4N10 A;  5DVB A;  2ZUP A;  1QUW A;  3P90 A;  3QDN A;  2CVK A;  2OBK A;  5G1K A;  3ZTL A;  3FKF A;  4BL7 A;  3HA9 A;  4FH8 A;  1F2E A;  1XW6 A;  4KSM A;  3IK9 A;  1EP7 A;  4TXO A;  3IA1 A;  4GSS A;  4CY6 A;  1N8J A;  5ECP B;  1IYI A;  1U88 A;  1ERV A;  22GS A;  5ECR B;  1M9B A;  2WFC A;  4WR5 A;  3TCO A;  4K5S A;  4YAP A;  4D73 A;  2C3Q A;  2IMF A;  1SL1 B;  1T8E B;  1GSS A;  1EWX A;  2I9H A;  1EEM A;  3KP8 A;  1V2A A;  1CQG A;  1K3O A;  5EPF A;  3P8W A;  4JU5 A;  1A8Y A;  4ID0 A;  5HR2 A;  4KUN A;  2N5F A;  3CMI A;  3APO A;  2H74 A;  3ZIT A;  2GSR A;  4RUV A;  5DAL B;  1G7E A;  4G0L A;  2V1M A;  2H75 A;  4I8B A;  1M2A A;  4Q5N A;  1XFL A;  3JCM L;  4ZIJ A;  3HKR A;  3GL3 A;  2X8G A;  1FVK A;  4POB A;  2JAC A;  5AGY A;  5CRW A;  1K0C A;  1A8L A;  4GRF A;  4L0W A;  1HQO A;  1KNG A;  4TN8 A;  4YQV A;  3N9J A;  3UVH A;  1ZYQ B;  3U5R E;  4YQU A;  4ECJ A;  2TIR A;  2FWG A;  2O8V B;  2IME A;  4EXJ A;  5CRE A;  3FR3 A;  3US3 A;  2BMX A;  1UA5 A;  4X4J A;  2YWM A;  4HJ2 A;  2KP2 A;  1DE1 A;  1EV9 A;  3F6D A;  4MPG A;  1OC8 A;  2C4J A;  3FY7 A;  3DKS A;  2X8H A;  2CAI A;  3DVW A;  1S3C A;  3GFK A;  3L78 A;  3LSZ A;  2H6Z A;  3HJO A;  4WBJ A;  4MH2 A;  2AAW A;  2H1B A;  3EMX A;  1PKZ A;  7GSS A;  3QOU A;  1LJR A;  1TJD A;  4LL4 B;  1TKD B;  3E0U A;  2V32 A;  2K8V A;  3ME7 A;  4PXO A;  4MJB A;  4GQF A;  2I4A A;  3DIE A;  4ILF A;  4HS1 A;  4V2N A;  5IO0 A;  1MDK A;  2VCW A;  3M0F A;  1VGL A;  5B8B A;  4GCI A;  4IP1 A;  4ZBB A;  1QXH A;  1GUM A;  5D9V A;  2H01 A;  2DLX A;  2CV4 A;  1A0F A;  4PQI A;  2H0H A;  4ML1 A;  2PU9 C;  3ERW A;  3TOT A;  2G0F A;  1WMJ A;  3UMA A;  1U6T A;  2B1K A;  5J41 A;  3EWL A;  3ZML A;  3GX0 A;  1DE2 A;  4O5R A;  4K2X A;  3GYK A;  4KGI A;  3D0Z A;  3LYK A;  3KH9 A;  5A4W A;  5CO3 A;  4IQ1 A;  1Z6M A;  3GTU A;  1XVQ A;  2PGT A;  2PUK C;  2DIZ A;  4BVY A;  3A5I A;  4JR4 A;  3Q19 A;  2ZCT A;  1SJ6 A;  1YJ6 A;  2C80 A;  2FWF A;  5IPH A;  4ZXG A;  2GT6 A;  1SD9 A;  20GS A;  1K0D A;  2HSM A;  3W8S A;  3GST A;  4GQC A;  1ZOF A;  3KTB A;  3TJK A;  2OBI A;  4XS1 A;  3HJM A;  1BG5 A;  4EIP A;  1KBN A;  2C0E A;  4IS0 A;  4G19 A;  2H72 A;  5HR3 A;  1WRY A;  3ZYW A;  3H93 A;  5ECS A;  3C71 A;  5G30 A;  3TKQ A;  3C1S A;  2KHP A;  1GSF A;  2A4H A;  1NSW A;  2YNX A;  5J9C A;  3I9V 2;  5GAP D;  1LU4 A;  3TOU A;  2M80 A;  3KH7 A;  2N5B A;  4E8E A;  1BQ7 A;  2OAC A;  2R0G A;  2HXK A;  4IVF A;  2YV9 A;  3VWW A;  1GUL A;  2OAD A;  4Q5F A;  5G31 A;  1ERT A;  5D93 A;  4G10 A;  1PGT A;  2L6C A;  4F9Z A;  4YAV A;  1U87 A;  2TRC P;  3TDG A;  2DJ2 A;  1XBS A;  3GUR A;  5JWO B;  2H70 A;  1W89 A;  3VWX A;  2X4A A;  4NAX A;  1G0T A;  1B4P A;  1O81 A;  2C1Y A;  1URM A;  2JSZ A;  5DBQ A;  1OC3 A;  2DC5 A;  3QAG A;  2VCV A;  4O92 A;  5IMZ A;  3DXB A;  2FY6 A;  1X0R A;  4F0B A;  4L5O A;  4CHS A;  2CAQ A;  1ERW A;  3C1R A;  3IBH A;  1O8W A;  2RM6 A;  1B48 A;  2GQM A;  4HU7 A;  4I2U A;  2JSY A;  4ECB A;  1AAZ A;  4IW9 A;  3Q18 A;  4EC0 A;  3IR4 A;  2LEG A;  4F2I A;  1GTA A;  2OE0 A;  4MZW A;  2H19 A;  5JWQ B;  5ID2 B;  2O87 A;  1TI1 A;  16GS A;  3TKS A;  1GNE A;  5DCG A;  3UOM A;  1MDI A;  1NHO A;  1Z3E A;  1ZYN A;  1SJZ A;  2LQQ A;  2V41 A;  2IMI A;  3GL5 A;  3FK8 A;  1KEB A;  3C73 A;  2GLR A;  3TJB A;  3FZ5 A;  1Q4J A;  4NV2 A;  4DVC A;  3FR9 A;  2FWE A;  6GST A;  3H8Q A;  5CYY A;  2QA2 A;  3NIV A;  3RPP A;  3QPM A;  3TRX A;  3CSJ A;  3APQ A;  3TJF A;  2KLX A;  3HCZ A;  2CQ9 A;  4K5R A;  2MMZ A;  4K2D A;  5GZZ B;  5ECQ B;  1FHE A;  4ZL8 A;  3EE2 A;  3BCI A;  1BED A;  1V40 A;  1O7U A;  4L5L A;  1FAA A;  1WWJ A;  3GA4 A;  2X99 A;  1JLW A;  2L5O A;  3ERF A;  1PN9 A;  4XRA A;  4ACS A;  2H0I A;  2E7P A;  4HQS A;  2YN1 A;  5AN1 A;  2VUP A;  1WIK A;  3KCM A;  4MAB A;  1EOG A;  3GH9 A;  2Z9S A;  1HNC A;  2EIO A;  2RII A;  3WD6 A;  3CYN A;  5COH A;  2PWJ A;  1T7P B;  1Z7R A;  2VIM A;  1S3A A;  3U6V A;  1TK0 B;  1G6W A;  4IN0 A;  4MP4 A;  3PPU A;  2AV4 A;  4K0G A;  5CRH A;  1USB A;  3H4K A;  4X43 A;  4PUR A;  3KMO A;  1EP8 A;  1E6B A;  2VLV A;  2MMA A;  1A24 A;  5F0G A;  3F63 A;  4MMM A;  2B5X A;  3IHQ A;  3TB2 A;  5ECO B;  4QQ7 A;  1TU7 A;  3TKP A;  3F0I A;  3DVX A;  5B6N A;  3R2Q A;  1GSY A;  2DJ0 A;  1YZX A;  4KB3 A;  3KXO A;  2JZR A;  1FB0 A;  4KDU A;  3KM6 A;  17GS A;  5ENU A;  2DML A;  5CP1 A;  3GMF A;  3ERG A;  2LS5 A;  4ZBD A;  6GSX A;  3AY8 A;  2C3T A;  3A2W A;  4PUA A;  4BVX B;  1OKT A;  4JBB A;  3QFB C;  1SYX A;  5IMA A;  5GSS A;  2P5Q A;  1J9B A;  1OVN A;  3EVI A;  2K18 A;  3IK7 A;  4IEL A;  1UC7 A;  1GL8 A;  1XWA A;  4ZB6 A;  1VRS D;  1SKW B;  2DIY A;  3FW2 A;  1WJK A;  5D8I A;  1FG4 A;  2JZT A;  3IC4 A;  4KDX A;  4OD7 A;  4NHW A;  3D6I A;  4MLY A;  2E0Q A;  1A2M A;  4ZB9 A;  1WP0 A;  3VLN A;  4N30 A;  5D9X A;  2H71 A;  5D73 A;  12GS A;  2GQK A;  3ED3 A;  5B8A A;  1YF0 A;  1I9D A;  2VLU A;  3HHV A;  5DAL A;  1GSQ A;  2K6V A;  4TR1 B;  4A5P A;  1PA3 A;  2GST A;  3M9J A;  4MF6 A;  2IFQ A;  3F4T A;  1GSD A;  2YPM A;  5JCU A;  1LBK A;  3UJ1 A;  2HZE A;  2F8A A;  5HQP A;  1QMV A;  1AC1 A;  1M0U A;  2PPT A;  4X0X A;  2FNO A;  4EF0 A;  2MBS A;  3Q6O A;  5KOX A;  2DJJ A;  4XS4 B;  2FD3 A;  1SKS B;  4MF5 A;  1JZO A;  3D21 A;  5IMC A;  2C8U A;  3K8N A;  3HXS A;  5D9W A;  1SL2 B;  2VM2 A;  1XWG A;  2RLI A;  2M46 A;  2VL2 C;  1R7H A;  4RI7 A;  3F3Q A;  4KA0 A;  3LWA A;  3FEU A;  5AIV A;  1ZCP A;  4PNF A;  4OO5 A;  4MJA A;  3GV1 A;  4IQA A;  5LNK e;  2GSS A;  5KN0 A;  5DAK A;  2PVQ A;  4LMV A;  3UL3 A;  2M72 A;  3A3T A;  2H30 A;  4XTS A;  1AQV A;  1AXD A;  1ZYP A;  2K8S A;  2L4Q A;  3VFI A;  3FHK A;  1ACV A;  3V1W A;  2YV7 A;  1BX9 A;  3IHG A;  1EGR A;  1FOH A;  4ZBA A;  3ISO A;  2HE3 A;  2VLT A;  3LQ7 A;  2LRC A;  1BYE A;  1GSU A;  3TRP A;  2V6K A;  1QGV A;  1XOA A;  2AYT A;  4BL7 B;  3DD3 A;  3ZL5 A;  2GDR A;  4EVM A;  5KOW A;  4HDE A;  4JR6 A;  1K0N A;  4ULX A;  5A5K A;  1G6Y A;  1FB6 A;  2CX3 A;  2HSH A;  2R2J A;  4D73 B;  9GSS A;  2VL3 A;  2B5E A;  2EC4 A;  2H76 A;  4PNG A;  3KZQ A;  1G7O A;  4K0N A;  2GT5 A;  3MDK A;  5B7C A;  11GS A;  1TRW A;  1KTE A;  1O85 A;  4YKF A;  2WRT A;  1AW9 A;  5B6M A;  3G7J A;  1I5G A;  4J56 E;  2MBT A;  1ML6 A;  4G0K A;  2R4V A;  2K9F A;  1PD2 1;  1YY7 A;  2LJK A;  2L57 A;  2YOI A;  4HJM A;  1F3A A;  1Z9H A;  4ZL7 A;  3QR6 A;  2IMD A;  5DDL A;  5IOW A;  2J9H A;  5GST A;  2IJY A;  1MTC A;  4FO5 A;  2YZH A;  4J57 E;  2OE1 A;  4GF0 A;  3ZMK A;  1THX A;  1PQN A;  4AGS A;  1YQ1 A;  4BPY A;  1FOV A;  1AQW A;  1R26 A;  2F9S A;  4HUA A;  1Z6N A;  1TXX A;  3E9J B;  1Y6E A;  4BWS A;  4G9H A;  1XZO A;  1UVZ A;  1K0B A;  1A23 A;  1U3A A;  1M2D A;  4I97 A;  2NTO A;  3EC3 A;  3LXZ A;  1AQX A;  4CY8 A;  5ECI B;  4MJC A;  4EL1 A;  2NVL A;  4N0V A;  3QFA C;  1V98 A;  4IHU A;  2XPD A;  4GLT A;  3L0H A;  5ELG A;  2FWH A;  4MA9 A;  2GSQ A;  1ZGN A;  2PBJ A;  1M9A A;  4IJI A;  3M9K A;  3WGD A;  3IE3 A;  2DJ3 A;  3LEF A;  2YWO A;  3IOS A;  4KCE A;  5HR0 A;  1X9S B;  2L59 A;  4HZ2 A;  2WB9 A;  2O89 A;  3NOF A;  2XPE A;  1TRV A;  1RW1 A;  4EKZ A;  3VK9 A;  4V2M A;  1FW1 A;  3QAW A;  2H6Y A;  3O76 A;  1ST9 A;  1XWK A;  1GUH A;  13GS A;  3G9B A;  1ILO A;  4Z2R A;  1K3L A;  2L4C A;  3S9F A;  3HZ4 A;  4F03 A;  3GTU B;  4MCU A;  3TGZ A;  1R5P A;  1J08 A;  3LYP A;  4BVY B;  2FHE A;  1OC9 A;  3L4N A;  2TRX A;  4PX1 A;  4K8M A;  1EEJ A;  1YKC A;  2WS2 A;  5J3R A;  4RQX A;  2B3S A;  4O5U A;  4LA1 A;  1XVW A;  3CTF A;  5LD0 A;  2G2Q A;  3D22 A;  4H86 A;  3MSZ A;  2MZC A;  2REM A;  4DSS A;  4BWQ A;  4K9Z A;  4ISD A;  1BJX A;  4HOJ A;  1XWB A;  2R0P A;  5C04 A;  1HYU A;  3FZA A;  1VF3 A;  2OJL A;  2RUF A;  3WGE A;  2OE3 A;  1T3B A;  1JLV A;  2FA4 A;  3PH9 A;  2C0G A;  4OCE A;  2VCX A;  5A4V A;  2B1L A;  4KAE A;  2IWT A;  4O32 A;  5ECN B;  1HNA A;  2P31 A;  3E3E A;  2YJ7 A;  4TVE A;  4FYB A;  2IMK A;  3HVX A;  4TKY A;  1JFU A;  1ERU A;  4IGJ A;  3UVT A;  4TW5 A;  4EIQ A;  1CQH A;  2WDU A;  5HFG A;  2MMN A;  1SK2 A;  1U3I A;  4MK3 A;  3VPT A;  1ABA A;  2XBQ A;  5F05 A;  2OKA A;  4XRD A;  3UIW A;  3HJP A;  4XS6 A;  4QL7 A;  5A4U A;  1PX7 A;  1YF1 A;  3UAR A;  3LXT A;  1SYR A;  4GTU A;  1F6M C;  3MIX A;  1SD8 A;  1XIY A;  1GSE A;  1WE0 A;  2CT6 A;  4KH7 A;  3F6F A;  1OYJ A;  4ML6 A;  1QQ2 A;  1QFN A;  2QKE A;  1EOH A;  2JZS A;  5EY6 A;  4PTS A;  4AF2 A;  3EUR A;  3GRX A;  1S3D A;  3HZ8 A;  4NPB A;  3F8U A;  2KUC A;  4GXZ A;  1NW2 A;  4MZB A;  1M2B A;  2A2P A;  1JHB A;  18GS A;  3QMX A;  2LJR A;  3HVS A;  2E2M A;  3LOR A;  3QCP A;  2H1A A;  5IM9 A;  2DKH A;  2VD1 A;  3LW9 A;  2R5G A;  5AIX A;  4XIH A;  1A2L A;  2L5L A;  3HY2 A;  4PQ1 A;  5KN3 A;  5ELA A;  2H0G A;  4WBR D;  2EIR A;  2LUS A;  3VWV A;  2R0C A;  1T4Y A;  3D4M A;  1F3B A;  4QL9 A;  1EZK A;  1K0M A;  5EVO A;  3A5W A;  1TTZ A;  1YEP A;  3W6G A;  1PN0 A;  3RBT A;  3IC8 A;  2FA8 A;  2F51 A;  1X9M B;  3IPZ A;  2B5Y A;  4Z2U A;  1GLQ A;  2V2G A;  1EGO A;  2ES7 A;  1WOU A;  2LJA A;  4EE0 A;  3BD2 A;  4K7O A;  4HI7 A;  3RPN A;  2GVP A;  4Q5R A;  5BRT A;  3H1N A;  2HRF A;  1O73 A;  2V6O A;  4OWY A;  2VL2 A;  2GS3 A;  4USS A;  3DGQ A;  1X5D A;  14GS A;  2B7K A;  2EIQ A;  2NDO A;  3DML A;  4KDY A;  3ZFB A;  1HD2 A;  3EMP A;  2GZZ A;  2JL4 A;  1OE7 A;  1R4W A;  2CVB A;  2VD0 A;  3KEB A;  1E2Y A;  3O3T A;  2JAD A;  2JU5 A;  3I69 A;  3TKS C;  1RK4 A;  5IMV A;  3VWU A;  3C7M A;  2AB6 A;  3EIN A;  3F4S A;  4NHZ A;  4GWR A;  2GTU A;  4TXV A;  3F3R A;  2HFD A;  3M3M A;  3UAP A;  2BTO T;  1GP1 A;  2UZ8 A;  1MD4 A;  3Q74 A;  1B9Y C;  2H6X A;  2HNL A;  3IXR A;  4P3Y B;  2HLS A;  2LRT A;  3FZ9 A;  3ZIJ A;  3ME8 A;  1TW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...