1R4WA

Crystal structure of mitochondrial class kappa glutathione transferase
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
221
Chain Sequence
b'GPAPRVLELFYDVLSPYSWLGFEVLCRYQHLWNIKLKLRPALLAGIMKDSGNQPPAMVPHKGQYILKEIPLLKQLFQVPMSVPKDFFGEHVKKGTVNAMRFLTAVSMEQPEMLEKVSRELWMRIWSRDEDITESQNILSAAEKAGMATAQAQHLLNKISTELVKSKLRETTGAACKYGAFGLPTTVAHVDGKTYMLFGSDRMELLAYLLGEKWMGPVPPTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase, mitochondrial
publication title Parallel Evolutionary Pathways for Glutathione Transferases: Structure and Mechanism of the Mitochondrial Class Kappa Enzyme rGSTK1-1
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 77
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2003-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1r4wA01
4HU7A 2H30A 3VWWA 5G31A 1ERVA 4AJ6A 4F82A 2LJKA 1SJIA 4V2LA 3HVXA 3EVIA 4KE3A 3VI5A 1Y25A 2WRTA 2YJHA 1RW1A 3S9FA 3HCZA 2FHEA 2PVOC 4IP1A 1BX9A 5J41A 5AISA 1YQ1A 2P31A 2DSAA 2OBIA 2L4CA 2PERA 4KDUA 2GSTA 2HE3A 2V41A 3D0ZA 1TRVA 2VIMA 3GL3A 2JZSA 3A2XA 3F3RA 1WE0A 4TR1B 19GSA 2A4VA 5ECQB 4WKWA 1USBA 3C8EA 5CP1A 1SENA 3LG6A 1QK8A 2K18A 4ZBAA 5ECRB 4MCUA 1BQ7A 5FWGA 3CSJA 3RPPA 4RI7A 4K7NA 2B3SA 3WGDA 1PA3A 3C1RA 4WR4A 3TJBA 4ZBDA 2H1AA 5HR2A 1TI3A 5F07A 3KD0A 3KMNA 2CVDA 2IFQA 3E0UA 1A2JA 3ZLPA 2QKEA 1AC1A 3IV4A 3L9UA 1GSUA 2HXKA 2WCIA 3UMAA 4TXVA 3VK9A 5DALB 4KW6A 4IHUA 6GSWA 5KN0A 3UIWA 1A0RP 1Z6NA 3UBKA 3M8NA 2GS3A 4XIHA 3IR4A 3BBYA 5C00A 3TKQA 2JSZA 2WJUA 4HUAA 2IL3A 3TKSE 3CBUA 1TU7A 4J56E 3GX8A 2B5YA 1OE8A 1SK2A 3F4SA 2VCWA 1EEMA 3DRNA 1LU4A 2ZNMA 3NIVA 4PUAA 4DVCA 3IOSA 2J23A 1F3AA 5IOWA 1K3YA 2LJAA 1O8XA 2N5BA 3QPMA 1TTZA 3QOUA 2FGXA 4YAPA 4ZL7A 4JR4A 3DIEA 3TRQA 2K6VA 1B9XC 3US3A 1SL1B 4Z7XA 1ZGNA 4KUNA 2JU5A 1OC9B 4XS4B 3J7Yb 2MMAA 4LMVA 2KP2A 2VLUA 3O76A 3GYKA 3EU3A 1QXHA 1AQXA 1CQHA 3I43A 2F9SA 4L0UA 1XPVA 1SL2B 2IMEA 2LEGA 5LNKe 1YKAA 1X5DA 2A2SA 2B5EA 2C0DA 2LSTA 5G30A 3K8NA 3CRUA 4ULXA 4ZL9A 3M1GA 2L6CA 4EDYA 5DAKA 2H01A 4KGIA 2B6MA 2GSSA 2IMIA 5LD0A 2VUPA 5G5EA 1S3AA 5EY6A 4NHZA 2VM2A 3L78A 4I2TA 4ZB6A 3TOUA 1M2DA 2LNTA 4I97A 1TRSA 3WGXA 1K3LA 1OE7A 2YZHA 4V1Ap 3EINA 3MNGA 3ZL5A 2DJ3A 1SD9A 1G7OA 7GSSA 3W6GA 1DE2A 1ML6A 2K9FA 4KCEA 3DYRA 5GSTA 1G7EA 5A4WA 4IQAA 1QGVA 1MEKA 3LFLA 5D96A 1JLWA 2HFDA 3FEUA 2VD1A 5G5FA 2XPDA 2X8CA 3M3MA 5G2ZA 1NM3A 2CX3A 3TRPA 5EPFA 2M72A 1WPIA 1EWXA 1YDKA 3DEXA 4YQVA 2IWTA 3D22A 3P90A 1XXUA 1SD8A 3C7MA 1EOHA 2PGTA 1QQ2A 1MTCA 3NZNA 4RI6A 5GAND 4IQ1A 4MLYA 2OBKA 2H8LA 2LS5A 4MMMA 1OC3A 1XFLA 5GAPD 2CQ9A 1EV4A 8GSSA 5ECLB 2LUSA 4BPYA 1N8JA 3ERFA 3DMLA 2VL3A 4O7HA 4KSOA 4IKHA 5ECPB 1PX7A 2OKAA 1XW9A 1UC7A 3GL5A 4MH3A 2EIOA 2FY6A 1B8XA 3QMXA 2HZEB 1GWCA 1ABAA 4EF0A 1GNWA 2LJRA 3DKSA 2PPTA 1JZWA 3WYWA 1K0DA 1O85A 6GSTA 3IBHA 1Z9HA 1SYRA 3TJFA 5CRHA 4G2EA 2GTUA 1TKDB 4TW5A 2ES7A 4ML1A 2YANA 1TRWA 1WWJA 3UL3A 5FT3A 4DSSA 2QSIA 4BWQA 4WETA 2CZ2A 2AB6A 4KX4A 1EP8A 3RHCA 4OCFA 1TXXA 1GNEA 3TKSA 3GIXA 2KP1A 1IYHA 5CRWA 1GP1A 3H93A 3GSTA 2LQOA 4POBA 2D2ZA 3F6DA 3HJOA 1FO5A 2O7KA 5DDLA 1O7UA 1UVZA 4KCAA 3J7Yk 1C72A 5D9WA 3GH9A 4MH2A 4KDXA 22GSA 3LJRA 2H74A 2CX4A 1ERWA 1J08A 3L9VA 4YAVA 1SL0B 1XZOA 1Q98A 2Z9SA 5CYYA 1EGRA 1V2AA 3MWHA 3GTUB 2JZTA 2AAWA 3GFKA 1GRXA 1LBKA 3LYPA 5IMVA 3FYGA 1TI1A 1GTUA 3HJPA 2FWHA 2IJYA 3TOTA 3HVVA 1EOGA 3EU4A 2XBIA 3TKPA 2H73A 2OACA 1R7HA 6GSUA 3KXOA 4CDOA 4XS6A 3TJGA 2DJ0A 2HT9A 4K0NA 3CRTA 1GLQA 2TIRA 2GQMA 1O8WA 4MZBA 1GSDA 1F3BA 2X8HA 2OE1A 3RPNA 4E8EA 2CZ3A 3A5WA 4MPGA 1H4OA 2DC5A 4PXOA 2H66A 5ECSA 1Z7RA 1K0AA 1TU8A 4IJIA 2AYTA 5JCGA 1B48A 1MDJA 3CSHA 1E2YA 2YZUA 4MF6A 1OKDA 4X1UA 2YWNA 1MD4A 2WFCA 3GKMA 1GSQA 5A4UA 2IMFA 1U3AA 3HZ4A 4XHMA 5ENUA 3VWXA 5D9VA 5CRDA 4OMVA 2WB9A 1NHYA 2IFQB 3EMPA 4IBPA 5J3RA 3TB2A 4XS1A 3C73A 4XRAA 1K0OA 4POMA 4EL1A 1OYJA 1QFNA 3F3QA 1YEPA 4JU5A 2OADA 1XW5A 1GH2A 1X9SB 2NPBA 3LYKA 4ZILA 1GULA 3IE3A 1AAZA 3DVXA 2DJ2A 2VL2A 5AIVA 1H75A 4GTUA 4Q5QA 2IIYA 1M99A 4D73A 3LQ7A 2B1LA 2GZZA 1FOVA 3FR6A 5DVBA 5GSSA 4POKA 4TXOA 3V1WA 4KAEA 2FNOA 2L6DA 5HR1A 1YF1A 4JRRA 4FH8A 3RDWA 1GUHA 2MZCA 3QFBC 1OKTA 1ON4A 3G7JA 4POLA 5JCWA 3Q74A 5CO3A 4K1FA 3QR6A 4TOPA 5CREA 3ZFLA 2E0QA 3MDKA 1TP9A 4TKYA 1S3DA 4TVEA 3P2AA 3JCML 5F05A 2M46A 2PMTA 1WJKA 1WMJA 2VLTA 4ACSA 6GSVA 3UJ1A 2VD0A 2HSHA 2REMA 4JZQA 1NW2A 4J57E 2EIRA 3FY7A 4BL7A 5JWRB 5KN1A 3HY2A 4EKZA 2DIYA 4K8MA 3N5OA 3M9JA 1KBNA 3Q18A 4KA0A 3EC3A 3APSA 4O5RA 3RHBA 3ZTLA 1X9MB 4ISDA 2N5AA 4GQCA 4GF0A 3IC4A 4EE0A 5JWOB 3ERGA 5H5SA 1X5EA 3FZ4A 4GWRA 3EYTA 2DMLA 3H8QA 3ZVJD 4JEDA 1T4ZA 1S3CA 2ON5A 2C0FA 3MAKA 3TGZA 4HOJA 2R37A 2WS2A 4MZWA 3UARA 2VL2C 3TDGA 1TK8B 1XWAA 2K8VA 3VWVA 5JWQB 4YQUA 5KEJA 3R2QA 2H76A 3D6IA 2JZRA 3EE2A 1JZRA 5IMCA 1SKRB 6GSSA 2L59A 1A24A 2C80A 1VF2A 2G2QA 3QAGA 4XTSA 1A2LA 4NPBA 1FW1A 2R2JA 1T7PB 2FA4A 2I4AA 2DJJA 20GSA 3FKFA 4WF4A 4HI7A 4LL1B 12GSA 1TOFA 4I6XA 1ZCPA 3UBLA 4NXIA 2F8FA 4BVXA 2E2MA 2JADA 1WOUA 2RUEA 1UA5A 2X8GA 3KM6A 5H5QA 3LXTA 2C3NA 2XHFA 2YV7A 2VCVA 1YZXA 1FG4A 4TR1A 5DBQA 2VO4A 4PQ1A 4IN0A 1XWCA 5ELGA 4I5QA 1HNCA 2RM5A 4GRFA 4BA7A 5B6MA 1O6JA 2CAIA 1EP7A 4MP4A 3D4TA 5J4UA 4N10A 4PGTA 1T8EB 3HXSA 2C0GA 5DJMA 1Q4JA 4K9ZA 2H1BA 2I1UA 1F2EA 2V6KA 4CW9A 18GSA 1ERUA 1GTBA 3KTLA 3WT1A 3KIJA 3FRCA 4KB3A 3GV1A 1YEXA 1PL1A 4LMWA 1GSYA 6GSXA 3KH9A 3HJMA 2FWEA 2NTOA 5B8BA 4I8BA 2O89A 1XVQA 5EVOA 2H0GA 3PGTA 1HNBA 4JR6A 2V6OA 3C1SA 3VPTA 1V57A 4G19A 4HZ4A 2LQQA 2VOCA 2MMOA 2OE0A 2EIQA 2L5OA 3BCIA 4MF7A 2B7KA 4JBBA 3TJJA 2VM1A 2F8AA 2PBJA 5J5NA 1B4PA 1O73A 1PL2A 3ZIVA 3ISOA 1PN9A 1RQMA 3ZIJA 1DUGA 5HQPA 1M2BA 1R4WA 4KSMA 5ECNB 2ALBA 1K0BA 4Q5FA 1T4YA 1F6MC 3TUEA 2F3MA 3PH9A 4DSRA 1JZOA 2YP6A 2HRFA 2R4VA 2BTOT 1NSWA 2YWIA 4GSNA 1OC9A 3IAS2 4XS4A 2V1MA 1PX6A 2IN3A 4OWYA 2ZUPA 4EC0A 3KJYA 1RK4A 4L5LA 1M9BA 2GQLA 2R3XA 1PGTA 5B8AA 1SJ6A 1BYEA 4HJMA 2L5LA 1EV9A 3C71A 3KCMA 3EMXA 3W8JA 1JFUA 4N30A 5D73A 5IIZA 1CQGA 2LRNA 3KTBA 3UVHA 2H6YA 3F63A 1GTIA 1VRSD 2NDOA 1X0RA 5J9CA 2GVPA 3VWUA 1X9WB 4P3YB 2FD3A 6GSYA 1URMA 2E7PA 2VAFA 1FB6A 2X64A 1SU9A 3LEFA 5J9BA 3ZITA 4MJAA 1ZYEA 4ECBA 2BJXA 4MK3A 5G1KA 3F9UA 3TJKA 3UAPA 3BOAA 1FVJA 2C3QA 2KUCA 1N2AA 4OCEA 2I3YA 4ECCA 3FZAA 4XCSA 5ECHB 4HQSA 1XBSA 3U5RE 17GSA 5H5RA 4PUFC 4BWSA 2FLSA 2OE3A 1SK0A 5ID2A 3Q6OA 2HSYA 3KP9A 1K0MA 3U6VA 2O85A 1ZZYA 4PQHA 2LRTA 1F37A 4TR3A 4D73B 1V9WA 4H86A 1E6BA 3SWLA 4EDZA 1FAAA 5D93A 1W89A 3GSSA 4ZXGA 2C3TA 3APOA 4TR0A 1WIKA 4O92A 1XOBA 1J0FA 1MD3A 1GSFA 16GSA 2PWJA 3HVSA 3L0HA 4X43A 4ILFA 2F51A 2LRCA 3HD5A 2V32A 1V98A 1UN2A 5ECKB 3W8SA 3CYNA 2XBQA 2HLSA 2YCDA 1AIUA 5HR0A 4AGSA 4X0XA 3I9V2 3KGKA 4EO3A 2AUVA 4L5OA 1T00A 2XPEA 2FWFA 3E9JB 2GQKA 3N9JA 4PNGA 2AV4A 4OD7A 2CV4A 3GH6A 4HS1A 2HZEA 2KOKA 2H6ZA 2R5GA 4IW9A 3I69A 4HQZA 4DEJA 2LTKA 2B7JA 1YKCA 2LKUA 4J2FA 1YY7A 2LNSA 1XIYA 2RIIA 5ELAA 1QUWA 2GGTA 4KH7A 3IHQA 4FYBA 1B9YC 3IDVA 1J9BA 4K0GA 2H71A 1DBYA 5EL8A 5D9XA 5A5KA 4RUVA 5IMDA 1FB0A 1NHOA 3IA1A 5G1LA 2RM6A 3VPQA 4LL4B 1Z7PA 1U87A 2P5RA 2I9HA 1SKWB 1ZL9A 2B1KA 2GT5A 2CAQA 2A2RA 1QMVA 1GUMA 2B5XA 1GTAA 1U3IA 2O87A 4GQFA 2AJQB 2MYGA 2WGRA 4OFTA 2TRCP 2GDRA 3H79A 3D21A 4HZ2A 3O3TA 5F8BA 4GCIA 1SK1A 2IPAA 1G6WA 1PD21 3FR3A 3GKKA 4HEA2 4G10A 4F0CA 3P8WA 4V2NA 2O8VB 3GHAA 3P7XA 4EVMA 2H72A 2H6XA 3ERWA 2L57A 1VF3A 4NAXA 1TW9A 5CAXA 3O6TA 4MJEA 3GTUA 2KLXA 5HFGA 2IMKA 2GSQA 2IMDA 1A8LA 4ZL8A 4E8HA 5ABRA 4ECIA 4YQMA 5D8IA 1GL8A 1OVNA 5L71A 2CVKA 2HZFA 5IO0A 1XOAA 1XCCA 3CTFA 2H1GA 3QAWA 3GUSA 2H75A 4PQIA 1U88A 1ZOFA 2K8SA 3GURA 1I5GA 4OFNA 2ZCTA 4FO5A 5DQYA 5E59A 5IPGA 3EURA 4FYUA 3ZMKA 1TK5B 1XWKA 2E2GA 1FVKA 1SKSB 3NOFA 4TR4A 4YH2A 4K6XA 3UOMA 2GSRA 3VLNA 2MMNA 1SJZA 2DJKA 2RUFA 5DAKB 2HRNA 5INYA 3F8UA 1LJRA 3F4TA 1YJ6A 1AUCA 4HDEA 2WDUA 2NVLA 3KEBA 1THOA 4NV2A 13GSA 3IK7A 1WP0A 1EZKA 4F0BA 3ED3A 4L0WA 1HD2A 1BEDA 4IS0A 5IMZA 2QGVA 3QD9A 1PQNA 1HQOA 3H1NA 2GZYA 3DXBA 3TRXA 1ACVA 2H1DA 4I2UA 1GLPA 5CRGA 4ZB8A 5GZZB 4WBRD 1TRUA 2H70A 3DD3A 5HFIA 3SBCA 4ECJA 2CT6A 2WZ9A 4NWYA 4QL9A 1Z6MA 2NBSA 2G0FA 1R5AA 1AW9A 2KHPA 4MJCA 3GN3A 5A4VA 1JHBA 1XWBA 4OO5A 2EC4A 1THXA 2M80A 2JSYA 5FHIA 1HNAA 11GSA 3VURA 4OO4A 5F0GA 3IAM2 1EEJA 1W4VA 2P0GA 3G7YA 4F9ZA 1ILOA 5HR3A 2YJ7A 2MBSA 2PU9C 4N0VA 2YWOA 4WR5A 2YWMA 5IMAA 3I6AA 4KNDA 1EGOA 1A0FA 1K0CA 1HYUA 1GSEA 3DGQA 5HFKA 5AN1A 1VGLA 2C4JA 4NMUA 5DQSA 3D4MA 3F0IA 3QAVA 2V2GA 3WD6A 1JLVA 4MA9A 3GA4A 5KN2A 3H4KA 3APQA 2C0EA 3DVWA 3FR9A 2DLXA 1BG5A 3KZQA 4V2MA 2HYXA 2FA8A 2H0HA 1ZYQB 4N11A 2FWGA 1I9DA 4QQ7A 1KTEA 4ML6A 4GSTA 3IRAA 4L8EA 4BVYA 5ECMB 14GSA 3LGCA 3QCPA 3LWAA 1MDIA 4ID0A 5CNWA 4FYCA 2C8UA 5DCHA 4DSSB 1Z3EA 2QC7A 5DALA 1K0NA 2VCXA 3OR5A 3Q19A 2XC2A 1PKWA 1PKZA 2VL9A 2VCZA 5IMFA 1B4QA 3GNJA 4OFMA 5ECIB 2CA8A 4NHWA 3GKXA 4HU9A 1YF0A 3GMFA 3KH7A 2PUKC 2PVQA 5ECOB 3CTGA 2WULA 5ID2B 2VLVA 4TRXA 3FK8A 4AF2A 2YNXA 3ME7A 5B7CA 4N0ZA 2GT6A 4PNFA 4Q5NA 1GSSA 4MZCA 1Z5YE 4MF5A 2GZPA 1R26A 3DWVA 1GUKA 4V1Ag 2X99A 2GLRA 1TK0B 3FZ9A 1A23A 3LSZA 4AJ7A 4QL7A 3VFIA 3HHVA 4JE1A 5D9TA 2JL4A 4F2IA 3F6FA 1A8YA 1MDKA 3M9KA 1F9MA 3FZ5A 4EXJA 2YV9A 1FHEA 2LV3A 3ZZXA 1Y6EA 2P5QA 1AQVA 4FIWA 4Q5RA 5B6NA 1V58A 4TN8A 3KP8A 1TJDA 3EWLA 3HKRA 2R6KA 2N5FA 5JCUA 1VF4A 1K3OA 3GKNA 2YN1A 2FUG2 2YPMA 4AJ8A 3F4RA 2C1YA 3A3TA 1ST9A 3IPZA 4IVFA 2H0IA 1U6TA 1SYXA 3D5JA 4MDCA 3L4NA 4IJ3A 3TCOA 5DJLA 1M9AA 4HJ2A 1TDIA 1OC8A 2YOIA 5IPHA 4IGJA 4GLTA 3A2WA 4DSQA 4WBJA 4CHSA 3MSZA 1XW6A 1AQWA 3UEMA 3FHKA 3ZFBA 2VCQA 1KNGA 5AGYA 3BJ5A 3E3EA 3TKRA 5IO2A 1O81A 4TXOB 1JZDA 5E4WA 4F03A 4MPFA 1PSQA 2OA7A 4IP6A 3BD2A 1G0TA 1VF1A 2CVBA 3G7IA 1OAZA 4WEYA 1AXDA 3A2VA 4XRDA 3IXRA 3IK9A 3QFAC 1IYIA 4PX1A 3RAZA 3CSIA 5IOXA 3HA9A 2VCTA 4O32A 3ZYWA 4ZBBA 3CXGA 1G6YA 3LXZA 3ME8A 2RLIA 5IM9A 4LA1A 4K7IA 5COHA 1XVWA 4WXTA 4GSSA 4K7OA 5F06A 3VI7A 1WRYA 2H19A 2MBTA 1M2AA 5LCZA 1M0UA 1DE1A 3HYPA 10GSA 2ON7A 3ZREA 3PINA 4ZIJA 2MMZA 3ZMLA 5KN3A 1X5CA 1BJXA 2TRXA 4GXZA 3HDCA 2HNLA 2FCHA 3AY8A 1BAYA 4MJBA 1ZMAA 4MABA 5IQYA 3QDNA 3PR8A 1PMTA 4G9HA 3GX0A 3RBTA 1R5PA 2JACA 4ZB9A 3UVTA 4PURA 3G9BA 3WT2A 2DBCA 4LLRA 3HZ8A 4RQXA 9GSSA 2DJ1A 2HI7A 3M0FA 5DCGA 2PN8A 2AHEA 4KDYA 2J9HA 3ZVJA 1XWGA 1ERTA 2DIZA 5AIXA 4WF5A 3GRXA 3CMIA 1V40A 3KMOA 4NV5A 1DSBA 2I81A 2OJLA 1T1VA 3ZRDA 3TKSC 3BCKA 1PRXA 1M7TA 2L4QA 2DMMA 2BMXA 4IELA 1KEBA 1T3BA 3WGEA 3L9SA 1A2MA 3LORA 3FW2A 5C04A 4RQRA 4EUYA 4K2DA
chains in the Genus database with same CATH superfamily
4HU7A 2H30A 4O5QA 3VWWA 5G31A 1ERVA 4AJ6A 4F82A 4Z2RA 2LJKA 1SJIA 4V2LA 3HVXA 3EVIA 4KE3A 3VI5A 1Y25A 2WRTA 2YJHA 1RW1A 3S9FA 3HCZA 2FHEA 2PVOC 4BVXB 4IP1A 1BX9A 5J41A 5AISA 1YQ1A 2P31A 2DSAA 2OBIA 2L4CA 2PERA 4KDUA 2GSTA 2HE3A 2V41A 3D0ZA 1TRVA 2VIMA 3GL3A 2JZSA 1FOHA 3A2XA 4G0IA 3F3RA 1WE0A 4TR1B 19GSA 2A4VA 5ECQB 4WKWA 1USBA 3C8EA 5CP1A 1SENA 3LG6A 1QK8A 2K18A 4ZBAA 5ECRB 4MCUA 1BQ7A 5FWGA 3CSJA 3RPPA 4RI7A 4K7NA 2HSMA 2B3SA 3WGDA 1PA3A 3C1RA 4WR4A 3TJBA 4ZBDA 2H1AA 5HR2A 1TI3A 5F07A 3KD0A 4G0LA 3KMNA 2CVDA 4BVYB 2IFQA 3E0UA 1A2JA 3ZLPA 2QKEA 1AC1A 3IV4A 3L9UA 4EIPA 1GSUA 2HXKA 2WCIA 3UMAA 4TXVA 3VK9A 5DALB 4KW6A 4IHUA 6GSWA 5KN0A 3UIWA 1A0RP 1Z6NA 3UBKA 3M8NA 2GS3A 4XIHA 3IR4A 3BBYA 5C00A 3TKQA 2JSZA 2WJUA 4HUAA 2IL3A 3TKSE 3CBUA 3A5IA 1TU7A 4J56E 3GX8A 2B5YA 1OE8A 1SK2A 3F4SA 2VCWA 1EEMA 3DRNA 1LU4A 2ZNMA 3NIVA 4PUAA 4DVCA 3IOSA 2J23A 1F3AA 5IOWA 1K3YA 2LJAA 1O8XA 2N5BA 3QPMA 1TTZA 3QOUA 2FGXA 4YAPA 4ZL7A 4JR4A 3DIEA 3TRQA 2K6VA 1B9XC 3US3A 1SL1B 4Z7XA 1ZGNA 4KUNA 2JU5A 1OC9B 4XS4B 3J7Yb 2MMAA 4LMVA 2KP2A 2VLUA 3O76A 3GYKA 3EU3A 1QXHA 1AQXA 1CQHA 3I43A 2F9SA 4L0UA 1XPVA 1SL2B 2IMEA 2LEGA 5LNKe 1YKAA 1X5DA 2A2SA 2B5EA 2C0DA 2LSTA 5G30A 3K8NA 3CRUA 4ULXA 4ZL9A 3M1GA 2L6CA 4EDYA 5DAKA 2H01A 4KGIA 2B6MA 2GSSA 2IMIA 5LD0A 5BRTA 2VUPA 5G5EA 1S3AA 5EY6A 4NHZA 1PFOA 2VM2A 3L78A 4I2TA 4ZB6A 3TOUA 1M2DA 2LNTA 4I97A 1TRSA 3WGXA 1K3LA 1OE7A 2YZHA 4V1Ap 3EINA 3MNGA 3ZL5A 2DJ3A 1SD9A 1G7OA 7GSSA 3W6GA 1DE2A 1ML6A 2K9FA 4KCEA 3DYRA 5GSTA 1G7EA 5A4WA 4IQAA 1QGVA 1MEKA 3LFLA 5D96A 1JLWA 2HFDA 3FEUA 2VD1A 5G5FA 2XPDA 2X8CA 3M3MA 5G2ZA 1NM3A 2CX3A 3TRPA 5EPFA 2M72A 1WPIA 1EWXA 1YDKA 3DEXA 4YQVA 2IWTA 3D22A 3P90A 1XXUA 1SD8A 3C7MA 1EOHA 2PGTA 1QQ2A 1MTCA 3NZNA 4RI6A 2HRKA 5GAND 4IQ1A 4MLYA 2OBKA 2H8LA 2LS5A 4MMMA 1OC3A 1XFLA 5GAPD 2CQ9A 1EV4A 8GSSA 5ECLB 2LUSA 4BPYA 1N8JA 3ERFA 4O5UA 3DMLA 2VL3A 4O7HA 4KSOA 4IKHA 5ECPB 1PX7A 2OKAA 1XW9A 1UC7A 3GL5A 4MH3A 2EIOA 2FY6A 1B8XA 3QMXA 2HZEB 1GWCA 1ABAA 4EF0A 1GNWA 2LJRA 3DKSA 2PPTA 1JZWA 3WYWA 1K0DA 4X4JA 1O85A 6GSTA 3IBHA 1Z9HA 1SYRA 3TJFA 5CRHA 4G2EA 2GTUA 1TKDB 4TW5A 2ES7A 4ML1A 2YANA 1TRWA 1WWJA 3UL3A 5FT3A 4DSSA 2QSIA 4BWQA 4WETA 2CZ2A 2AB6A 4KX4A 1EP8A 3RHCA 4OCFA 1TXXA 1GNEA 3TKSA 3GIXA 2KP1A 1IYHA 5CRWA 3IHGA 1GP1A 3H93A 3GSTA 2LQOA 2UZ8A 4POBA 2D2ZA 3F6DA 3HJOA 1FO5A 2O7KA 5DDLA 1O7UA 1UVZA 2DKHA 4KCAA 3J7Yk 1C72A 5D9WA 3GH9A 4MH2A 4KDXA 22GSA 3LJRA 2H74A 2CX4A 1ERWA 1J08A 3L9VA 4YAVA 1SL0B 1XZOA 1Q98A 2Z9SA 5CYYA 1EGRA 1V2AA 3MWHA 3GTUB 2JZTA 2AAWA 3GFKA 1GRXA 1LBKA 3LYPA 5IMVA 3FYGA 1TI1A 1GTUA 3HJPA 2FWHA 2IJYA 4K2XA 3TOTA 3HVVA 1EOGA 1M3IA 3EU4A 2XBIA 3TKPA 2H73A 2OACA 1R7HA 6GSUA 3KXOA 4CDOA 4XS6A 3TJGA 4FQUA 2DJ0A 2HT9A 4K0NA 2A2PA 3CRTA 1GLQA 2TIRA 2GQMA 1O8WA 4MZBA 1GSDA 1F3BA 2X8HA 2OE1A 3RPNA 4E8EA 2CZ3A 3A5WA 4MPGA 1H4OA 2DC5A 4PXOA 2H66A 5ECSA 1Z7RA 1K0AA 1TU8A 4IJIA 2AYTA 5JCGA 1B48A 1MDJA 3CSHA 1E2YA 2YZUA 4MF6A 1OKDA 4X1UA 2YWNA 1MD4A 2WFCA 3GKMA 1GSQA 5A4UA 2IMFA 1U3AA 3HZ4A 4XHMA 5ENUA 3VWXA 5D9VA 5CRDA 4OMVA 2WB9A 1NHYA 2IFQB 3EMPA 4IBPA 5J3RA 3TB2A 3CQFA 4XS1A 3C73A 4XRAA 1K0OA 4POMA 4EL1A 1OYJA 1QFNA 3F3QA 1YEPA 4JU5A 4K5RA 2OADA 1XW5A 1GH2A 1X9SB 2NPBA 3LYKA 4ZILA 2A4HA 1GULA 3IE3A 1AAZA 3DVXA 2DJ2A 2VL2A 5AIVA 1H75A 4GTUA 4Q5QA 2IIYA 1M99A 4D73A 3LQ7A 2B1LA 2GZZA 1FOVA 3FR6A 5DVBA 5GSSA 4POKA 4TXOA 3V1WA 4KAEA 2FNOA 2L6DA 2X4AA 5HR1A 1YF1A 4JRRA 4FH8A 3RDWA 1GUHA 2MZCA 3QFBC 1OKTA 1ON4A 3G7JA 4POLA 5JCWA 3Q74A 5CO3A 4K1FA 3QR6A 4TOPA 5CREA 3ZFLA 2E0QA 3MDKA 1TP9A 4TKYA 1S3DA 4TVEA 3P2AA 4USSA 3JCML 5F05A 2M46A 2PMTA 1WJKA 1WMJA 2VLTA 4ACSA 6GSVA 3UJ1A 2VD0A 2HSHA 2REMA 4JZQA 1NW2A 2X49A 4J57E 2EIRA 3FY7A 4BL7A 5JWRB 5KN1A 3HY2A 4EKZA 2DIYA 4K8MA 3IC8A 3N5OA 3M9JA 1KBNA 3FMWA 3Q18A 4KA0A 3EC3A 3APSA 4O5RA 3RHBA 3ZTLA 1X9MB 4ISDA 2N5AA 4GQCA 4GF0A 3EPTA 3IC4A 4EE0A 4G0KA 5JWOB 3ERGA 5H5SA 1X5EA 1ZYPA 3FZ4A 4GWRA 3EYTA 2DMLA 3H8QA 3ZVJD 4JEDA 1T4ZA 1S3CA 2ON5A 2C0FA 3MAKA 3TGZA 4HOJA 2R37A 2WS2A 4MZWA 3UARA 2VL2C 3TDGA 1TK8B 1XWAA 2K8VA 3VWVA 5JWQB 4YQUA 5KEJA 3R2QA 2H76A 3D6IA 2JZRA 3EE2A 1JZRA 5IMCA 1SKRB 6GSSA 2L59A 1A24A 2C80A 1VF2A 2G2QA 3QAGA 4XTSA 1A2LA 4NPBA 1FW1A 2R2JA 1T7PB 2FA4A 2I4AA 2DJJA 20GSA 3FKFA 4WF4A 4HI7A 4LL1B 12GSA 1TOFA 4I6XA 1ZCPA 3UBLA 4NXIA 2F8FA 4BVXA 2E2MA 2JADA 1WOUA 2RUEA 1UA5A 2X8GA 3KM6A 5H5QA 3LXTA 2C3NA 2XHFA 2YV7A 2VCVA 1YZXA 1FG4A 4TR1A 5DBQA 2VO4A 4PQ1A 4IN0A 1XWCA 5ELGA 1PN0A 4I5QA 1HNCA 2RM5A 4GRFA 4BA7A 5B6MA 1O6JA 2CAIA 1EP7A 4MP4A 2R0CA 3D4TA 5J4UA 4N10A 4PGTA 1T8EB 3HXSA 2C0GA 5DJMA 1XG8A 1Q4JA 4K9ZA 2H1BA 2I1UA 1F2EA 2V6KA 4CW9A 18GSA 1ERUA 1GTBA 3KTLA 3WT1A 3KIJA 3FRCA 4KB3A 3GV1A 1YEXA 2QA2A 1PL1A 4LMWA 1GSYA 6GSXA 3KH9A 3HJMA 2FWEA 2NTOA 5B8BA 4I8BA 2O89A 1XVQA 5EVOA 2H0GA 3PGTA 1HNBA 4JR6A 2V6OA 3C1SA 3VPTA 1V57A 4G19A 4HZ4A 2LQQA 2VOCA 2MMOA 2OE0A 2EIQA 2L5OA 3BCIA 4MF7A 4BIKA 4ICYA 2B7KA 4JBBA 3TJJA 2VM1A 2F8AA 2PBJA 5J5NA 1B4PA 1O73A 1PL2A 3ZIVA 3ISOA 1PN9A 1RQMA 3ZIJA 1DUGA 5HQPA 1M2BA 1R4WA 4KSMA 5ECNB 2ALBA 1K0BA 4Q5FA 1T4YA 1F6MC 3TUEA 2F3MA 3PH9A 4DSRA 1JZOA 2YP6A 2HRFA 2R4VA 2BTOT 1NSWA 2YWIA 4GSNA 1OC9A 3IAS2 4XS4A 2V1MA 1PX6A 2IN3A 4OWYA 2ZUPA 4EC0A 3KJYA 1RK4A 4L5LA 1M9BA 2GQLA 2R3XA 1PGTA 4YKGA 5B8AA 1SJ6A 1BYEA 4HJMA 2L5LA 1EV9A 3C71A 3KCMA 3EMXA 3W8JA 1JFUA 4N30A 5D73A 5IIZA 1CQGA 2LRNA 3KTBA 3UVHA 2H6YA 3F63A 1GTIA 1VRSD 2NDOA 1X0RA 5J9CA 2GVPA 3VWUA 5KOXA 1X9WB 4P3YB 2FD3A 6GSYA 4EIQA 1URMA 2E7PA 2VAFA 1FB6A 2X64A 1SU9A 3LEFA 5J9BA 3ZITA 4MJAA 1ZYEA 4ECBA 2BJXA 4MK3A 5G1KA 3F9UA 3TJKA 3UAPA 3BOAA 1FVJA 2C3QA 2KUCA 1N2AA 4OCEA 2I3YA 4ECCA 3FZAA 4XCSA 5ECHB 4HQSA 1XBSA 3U5RE 17GSA 5H5RA 3MIXA 4PUFC 4BWSA 2FLSA 2OE3A 1SK0A 5ID2A 3Q6OA 2HSYA 3PPUA 3KP9A 1K0MA 3U6VA 2O85A 1ZZYA 4PQHA 2LRTA 1F37A 4TR3A 4D73B 1V9WA 4H86A 1E6BA 3SWLA 4EDZA 2R0PA 1FAAA 5D93A 1W89A 3GSSA 4ZXGA 2C3TA 3APOA 4TR0A 1WIKA 4O92A 1XOBA 1J0FA 1MD3A 1GSFA 16GSA 2PWJA 3HVSA 3L0HA 4X43A 4ILFA 2F51A 2LRCA 5KOWA 3HD5A 2V32A 1V98A 1UN2A 5ECKB 3W8SA 3CYNA 2XBQA 2HLSA 2YCDA 1AIUA 5HR0A 4AGSA 4X0XA 3I9V2 3KGKA 4EO3A 2AUVA 4L5OA 1T00A 2XPEA 2FWFA 3E9JB 2GQKA 3N9JA 4PNGA 2AV4A 4OD7A 2CV4A 3GH6A 4HS1A 2HZEA 4BL7B 2KOKA 2H6ZA 2R5GA 4IW9A 3I69A 4HQZA 4DEJA 2LTKA 2B7JA 1YKCA 2LKUA 4J2FA 1YY7A 2LNSA 1XIYA 2RIIA 5ELAA 1QUWA 2GGTA 4KH7A 3IHQA 4FYBA 1B9YC 3IDVA 1J9BA 4K0GA 2H71A 1DBYA 5EL8A 5D9XA 5A5KA 4RUVA 5IMDA 1FB0A 1NHOA 3IA1A 5G1LA 2RM6A 3VPQA 4LL4B 1Z7PA 1U87A 2P5RA 2I9HA 1SKWB 1ZL9A 2B1KA 2GT5A 2CAQA 2A2RA 1QMVA 1GUMA 2B5XA 1GTAA 1U3IA 2O87A 4Z2TA 4GQFA 2AJQB 2MYGA 2WGRA 4OFTA 2TRCP 2GDRA 3H79A 3D21A 4HZ2A 3O3TA 5F8BA 4GCIA 1SK1A 2IPAA 1G6WA 4K5SA 1PD21 3FR3A 3GKKA 4HEA2 4G10A 4F0CA 3P8WA 4V2NA 2O8VB 3GHAA 3P7XA 4EVMA 2H72A 2H6XA 3ERWA 2L57A 1VF3A 4NAXA 1TW9A 5CAXA 3O6TA 4MJEA 3GTUA 2KLXA 5HFGA 2IMKA 2GSQA 2IMDA 1A8LA 4ZL8A 4E8HA 4MNNA 5ABRA 4ECIA 3R3EA 4YQMA 5D8IA 1GL8A 1OVNA 5L71A 2CVKA 2HZFA 5IO0A 1XOAA 1XCCA 3CTFA 2H1GA 3QAWA 3GUSA 2H75A 4PQIA 1U88A 1ZOFA 2K8SA 3GURA 1I5GA 4KF9A 2ZCTA 4OFNA 4FO5A 5DQYA 5E59A 5IPGA 3EURA 4FYUA 3ZMKA 1TK5B 1XWKA 2E2GA 1FVKA 5BMUA 1SKSB 3NOFA 4TR4A 4YH2A 4K6XA 3UOMA 2GSRA 3VLNA 2MMNA 1SJZA 2DJKA 2RUFA 5DAKB 2HRNA 5INYA 3F8UA 1LJRA 3F4TA 1YJ6A 1AUCA 4HDEA 2WDUA 2NVLA 3KEBA 1THOA 4NV2A 13GSA 3IK7A 1WP0A 1EZKA 4F0BA 3ED3A 4L0WA 1HD2A 1BEDA 4IS0A 5IMZA 2QGVA 3QD9A 1PQNA 1HQOA 3H1NA 2GZYA 3DXBA 3TRXA 1ACVA 2H1DA 4I2UA 1GLPA 5CRGA 4ZB8A 5GZZB 4WBRD 1TRUA 2H70A 3DD3A 5HFIA 3HVNA 3SBCA 4ECJA 2CT6A 2WZ9A 4NWYA 4QL9A 1Z6MA 2NBSA 2G0FA 1R5AA 1AW9A 2KHPA 4MJCA 3GN3A 5A4VA 1JHBA 1XWBA 4OO5A 2EC4A 1THXA 2M80A 2JSYA 5FHIA 3MYDA 1HNAA 11GSA 3VURA 4OO4A 5F0GA 3IAM2 1EEJA 1W4VA 2P0GA 3G7YA 4F9ZA 1ILOA 5HR3A 2YJ7A 2MBSA 2PU9C 4N0VA 2YWOA 4WR5A 2YWMA 5IMAA 3I6AA 4KNDA 1EGOA 1A0FA 1K0CA 1HYUA 1GSEA 3DGQA 5HFKA 5AN1A 1VGLA 2C4JA 4NMUA 5DQSA 3D4MA 3F0IA 3QAVA 2V2GA 3WD6A 1JLVA 4MA9A 3GA4A 2DKIA 5KN2A 3H4KA 3APQA 2C0EA 3DVWA 3FR9A 2R0GA 2DLXA 1BG5A 3KZQA 4V2MA 2HYXA 2FA8A 2H0HA 1ZYQB 4N11A 2FWGA 1I9DA 4QQ7A 1KTEA 4YKFA 4ML6A 4GSTA 3IRAA 4L8EA 4BVYA 5ECMB 14GSA 3LGCA 3QCPA 3LWAA 1MDIA 4ID0A 5CNWA 4FYCA 2QA1A 2C8UA 5DCHA 4DSSB 1Z3EA 2QC7A 5DALA 1K0NA 2VCXA 3OR5A 3Q19A 2XC2A 1PKWA 1PKZA 2VL9A 2VCZA 5IMFA 4HSCX 1B4QA 3GNJA 4OFMA 5ECIB 2CA8A 4NHWA 3GKXA 3LW9A 4HU9A 1YF0A 3GMFA 3KH7A 2PUKC 2PVQA 5ECOB 3CTGA 2WULA 5ID2B 2VLVA 4TRXA 3FK8A 4AF2A 2YNXA 3ME7A 5B7CA 4N0ZA 2GT6A 4PNFA 4Q5NA 1GSSA 4MZCA 1Z5YE 4MF5A 2GZPA 1R26A 3DWVA 1GUKA 4V1Ag 2X99A 2GLRA 1TK0B 3FZ9A 1A23A 3LSZA 4AJ7A 4QL7A 3VFIA 3HHVA 4JE1A 5D9TA 2JL4A 4F2IA 3F6FA 1A8YA 1MDKA 3M9KA 1F9MA 3FZ5A 4EXJA 2YV9A 1FHEA 2LV3A 3ZZXA 1Y6EA 2P5QA 1AQVA 4FIWA 4Q5RA 5B6NA 1V58A 4TN8A 3KP8A 1TJDA 3EWLA 3HKRA 2R6KA 2N5FA 5JCUA 1VF4A 1K3OA 3GKNA 2YN1A 2FUG2 1ZYNA 2YPMA 4AJ8A 3F4RA 2C1YA 3A3TA 1ST9A 3IPZA 4IVFA 2H0IA 1U6TA 1SYXA 3D5JA 4MDCA 3L4NA 4IJ3A 3TCOA 5DJLA 1M9AA 4HJ2A 1TDIA 1OC8A 2YOIA 5IPHA 4IGJA 4GLTA 3A2WA 4DSQA 4WBJA 4CHSA 3MSZA 1XW6A 1AQWA 3UEMA 3FHKA 3ZFBA 2VCQA 1KNGA 5AGYA 4CY6A 3BJ5A 3E3EA 3TKRA 5IO2A 1O81A 4TXOB 1JZDA 5E4WA 4PTSA 4F03A 4MPFA 1PSQA 2OA7A 4IP6A 3BD2A 1G0TA 1VF1A 2CVBA 3G7IA 1OAZA 4WEYA 1AXDA 3A2VA 4XRDA 3IXRA 3IK9A 3QFAC 1IYIA 4PX1A 3RAZA 3CSIA 5IOXA 3HA9A 4CY8A 2VCTA 4O32A 3ZYWA 4ZBBA 3CXGA 1G6YA 3LXZA 3ME8A 2RLIA 1M3JA 5IM9A 4LA1A 4K7IA 4A5PA 5COHA 1XVWA 4WXTA 4GSSA 4K7OA 5F06A 3VI7A 1WRYA 2H19A 2MBTA 1M2AA 5LCZA 1M0UA 2HRAA 1DE1A 3HYPA 10GSA 2ON7A 3ZREA 3PINA 4ZIJA 2MMZA 3ZMLA 5KN3A 1X5CA 1BJXA 2TRXA 4GXZA 3HDCA 2HNLA 2FCHA 3AY8A 1BAYA 4MJBA 1ZMAA 4MABA 5IQYA 3QDNA 3PR8A 1PMTA 4G9HA 3GX0A 3RBTA 1R5PA 2JACA 4ZB9A 3UVTA 4PURA 3G9BA 4Z2UA 3WT2A 2DBCA 4LLRA 3HZ8A 4RQXA 9GSSA 2DJ1A 2HI7A 3M0FA 5DCGA 2PN8A 2AHEA 4KDYA 2J9HA 3ZVJA 1XWGA 1ERTA 2DIZA 1S3RA 5AIXA 4WF5A 3GRXA 3CMIA 1V40A 3KMOA 4NV5A 1DSBA 2I81A 2OJLA 1T1VA 3ZRDA 3TKSC 3BCKA 1PRXA 1M7TA 2L4QA 2DMMA 2BMXA 4IELA 1KEBA 1T3BA 3WGEA 3L9SA 1A2MA 3LORA 3FW2A 5C04A 4RQRA 4EUYA 4K2DA
chains in the Genus database with same CATH topology
4HU7A 2H30A 4O5QA 3VWWA 5G31A 1ERVA 4AJ6A 4F82A 4Z2RA 2LJKA 1SJIA 4V2LA 3HVXA 3EVIA 4KE3A 3VI5A 1Y25A 2WRTA 2YJHA 1RW1A 3S9FA 3HCZA 2FHEA 2PVOC 4BVXB 4IP1A 1BX9A 5J41A 5AISA 1YQ1A 2P31A 2DSAA 2OBIA 2L4CA 2PERA 4KDUA 2GSTA 2HE3A 2V41A 3D0ZA 1TRVA 2VIMA 3GL3A 2JZSA 1FOHA 3A2XA 4G0IA 3F3RA 1WE0A 4TR1B 19GSA 2A4VA 5ECQB 4WKWA 1USBA 3C8EA 5CP1A 1SENA 3LG6A 1QK8A 2K18A 4ZBAA 5ECRB 4MCUA 1BQ7A 5FWGA 3CSJA 3RPPA 4RI7A 4K7NA 2HSMA 2B3SA 3WGDA 1PA3A 3C1RA 4WR4A 3TJBA 4ZBDA 2H1AA 5HR2A 1TI3A 5F07A 3KD0A 4G0LA 3KMNA 2CVDA 4BVYB 2IFQA 3E0UA 1A2JA 3ZLPA 2QKEA 1AC1A 3IV4A 3L9UA 4EIPA 1GSUA 2HXKA 2WCIA 3UMAA 4TXVA 3VK9A 5DALB 4KW6A 4IHUA 6GSWA 5KN0A 3UIWA 1A0RP 1Z6NA 3UBKA 3M8NA 2GS3A 4XIHA 3IR4A 3BBYA 5C00A 3TKQA 2JSZA 2WJUA 4HUAA 2IL3A 3TKSE 3CBUA 3A5IA 1TU7A 4J56E 3GX8A 2B5YA 1OE8A 1SK2A 3F4SA 2VCWA 1EEMA 3DRNA 1LU4A 2ZNMA 3NIVA 4PUAA 4DVCA 3IOSA 2J23A 1F3AA 5IOWA 1K3YA 2LJAA 1O8XA 2N5BA 3QPMA 1TTZA 3QOUA 2FGXA 4YAPA 4ZL7A 4JR4A 3DIEA 3TRQA 2K6VA 1B9XC 3US3A 1SL1B 4Z7XA 1ZGNA 4KUNA 2JU5A 1OC9B 4XS4B 3J7Yb 2MMAA 4LMVA 2KP2A 2VLUA 3O76A 3GYKA 3EU3A 1QXHA 1AQXA 1CQHA 3I43A 2F9SA 4L0UA 1XPVA 1SL2B 2IMEA 2LEGA 5LNKe 1YKAA 1X5DA 2A2SA 2B5EA 2C0DA 2LSTA 5G30A 3K8NA 3CRUA 4ULXA 4ZL9A 3M1GA 2L6CA 4EDYA 5DAKA 2H01A 4KGIA 2B6MA 2GSSA 2IMIA 5LD0A 5BRTA 2VUPA 5G5EA 1S3AA 5EY6A 4NHZA 2VM2A 3L78A 4I2TA 4ZB6A 3TOUA 1M2DA 2LNTA 4I97A 1TRSA 3WGXA 1K3LA 1OE7A 2YZHA 4V1Ap 3EINA 3MNGA 3ZL5A 2DJ3A 1SD9A 1G7OA 7GSSA 3W6GA 1DE2A 1ML6A 2K9FA 4KCEA 3DYRA 5GSTA 1G7EA 5A4WA 4IQAA 1QGVA 1MEKA 3LFLA 5D96A 1JLWA 2HFDA 3FEUA 2VD1A 5G5FA 2XPDA 2X8CA 3M3MA 5G2ZA 1NM3A 2CX3A 3TRPA 5EPFA 2M72A 1WPIA 1EWXA 1YDKA 3DEXA 4YQVA 2IWTA 3D22A 3P90A 1XXUA 1SD8A 3C7MA 1EOHA 2PGTA 1QQ2A 1MTCA 3NZNA 4RI6A 2HRKA 5GAND 4IQ1A 4MLYA 2OBKA 2H8LA 2LS5A 4MMMA 1OC3A 1XFLA 5GAPD 2CQ9A 1EV4A 8GSSA 5ECLB 2LUSA 4BPYA 1N8JA 3ERFA 4O5UA 3DMLA 2VL3A 4O7HA 4KSOA 4IKHA 5ECPB 1PX7A 2OKAA 1XW9A 1UC7A 3GL5A 4MH3A 2EIOA 2FY6A 1B8XA 3QMXA 2HZEB 1GWCA 1ABAA 4EF0A 1GNWA 2LJRA 3DKSA 2PPTA 1JZWA 3WYWA 1K0DA 4X4JA 1O85A 6GSTA 3IBHA 1Z9HA 1SYRA 3TJFA 5CRHA 4G2EA 2GTUA 1TKDB 4TW5A 2ES7A 4ML1A 2YANA 1TRWA 1WWJA 3UL3A 5FT3A 4DSSA 2QSIA 4BWQA 4WETA 2CZ2A 2AB6A 4KX4A 1EP8A 3RHCA 4OCFA 1TXXA 1GNEA 3TKSA 3GIXA 2KP1A 1IYHA 5CRWA 3IHGA 1GP1A 3H93A 3GSTA 2LQOA 2UZ8A 4POBA 2D2ZA 3F6DA 3HJOA 1FO5A 2O7KA 5DDLA 1O7UA 1UVZA 2DKHA 4KCAA 3J7Yk 1C72A 5D9WA 3GH9A 4MH2A 4KDXA 22GSA 3LJRA 2H74A 2CX4A 1ERWA 1J08A 3L9VA 4YAVA 1SL0B 1XZOA 1Q98A 2Z9SA 5CYYA 1EGRA 1V2AA 3MWHA 3GTUB 2JZTA 2AAWA 3GFKA 1GRXA 1LBKA 3LYPA 5IMVA 3FYGA 1TI1A 1GTUA 3HJPA 2FWHA 2IJYA 4K2XA 3TOTA 3HVVA 1EOGA 3EU4A 2XBIA 3TKPA 2H73A 2OACA 1R7HA 6GSUA 3KXOA 4CDOA 4XS6A 3TJGA 4FQUA 2DJ0A 2HT9A 4K0NA 2A2PA 3CRTA 1GLQA 2TIRA 2GQMA 1O8WA 4MZBA 1GSDA 1F3BA 2X8HA 2OE1A 3RPNA 4E8EA 2CZ3A 3A5WA 4MPGA 1H4OA 2DC5A 4PXOA 2H66A 5ECSA 1Z7RA 1K0AA 1TU8A 4IJIA 2AYTA 5JCGA 1B48A 1MDJA 3CSHA 1E2YA 2YZUA 4MF6A 1OKDA 4X1UA 2YWNA 1MD4A 2WFCA 3GKMA 1GSQA 5A4UA 2IMFA 1U3AA 3HZ4A 4XHMA 5ENUA 3VWXA 5D9VA 5CRDA 4OMVA 2WB9A 1NHYA 2IFQB 3EMPA 4IBPA 5J3RA 3TB2A 4XS1A 3C73A 4XRAA 1K0OA 4POMA 4EL1A 1OYJA 1QFNA 3F3QA 1YEPA 4JU5A 4K5RA 2OADA 1XW5A 1GH2A 1X9SB 2NPBA 3LYKA 4ZILA 2A4HA 1GULA 3IE3A 1AAZA 3DVXA 2DJ2A 2VL2A 5AIVA 1H75A 4GTUA 4Q5QA 2IIYA 1M99A 4D73A 3LQ7A 2B1LA 2GZZA 1FOVA 3FR6A 5DVBA 5GSSA 4POKA 4TXOA 3V1WA 4KAEA 2FNOA 2L6DA 2X4AA 5HR1A 1YF1A 4JRRA 4FH8A 3RDWA 1GUHA 2MZCA 3QFBC 1OKTA 1ON4A 3G7JA 4POLA 5JCWA 3Q74A 5CO3A 4K1FA 3QR6A 4TOPA 5CREA 3ZFLA 2E0QA 3MDKA 1TP9A 4TKYA 1S3DA 4TVEA 3P2AA 4USSA 3JCML 5F05A 2M46A 2PMTA 1WJKA 1WMJA 2VLTA 4ACSA 6GSVA 3UJ1A 2VD0A 2HSHA 2REMA 4JZQA 1NW2A 2X49A 4J57E 2EIRA 3FY7A 4BL7A 5JWRB 5KN1A 3HY2A 4EKZA 2DIYA 4K8MA 3IC8A 3N5OA 3M9JA 1KBNA 3FMWA 3Q18A 4KA0A 3EC3A 3APSA 4O5RA 3RHBA 3ZTLA 1X9MB 4ISDA 2N5AA 4GQCA 4GF0A 3EPTA 3IC4A 4EE0A 4G0KA 5JWOB 3ERGA 5H5SA 1X5EA 1ZYPA 3FZ4A 4GWRA 3EYTA 2DMLA 3H8QA 3ZVJD 4JEDA 1T4ZA 1S3CA 2ON5A 2C0FA 3MAKA 3TGZA 4HOJA 2R37A 2WS2A 4MZWA 3UARA 2VL2C 3TDGA 1TK8B 1XWAA 2K8VA 3VWVA 5JWQB 4YQUA 5KEJA 3R2QA 2H76A 3D6IA 2JZRA 3EE2A 1JZRA 5IMCA 1SKRB 6GSSA 2L59A 1A24A 2C80A 1VF2A 2G2QA 3QAGA 4XTSA 1A2LA 4NPBA 1FW1A 2R2JA 1T7PB 2FA4A 2I4AA 2DJJA 20GSA 3FKFA 4WF4A 4HI7A 4LL1B 12GSA 1TOFA 4I6XA 1ZCPA 3UBLA 4NXIA 2F8FA 4BVXA 2E2MA 2JADA 1WOUA 2RUEA 1UA5A 2X8GA 3KM6A 5H5QA 3LXTA 2C3NA 2XHFA 2YV7A 2VCVA 1YZXA 1FG4A 4TR1A 5DBQA 2VO4A 4PQ1A 4IN0A 1XWCA 5ELGA 1PN0A 4I5QA 1HNCA 2RM5A 4GRFA 4BA7A 5B6MA 1O6JA 2CAIA 1EP7A 4MP4A 2R0CA 3D4TA 5J4UA 4N10A 4PGTA 1T8EB 3HXSA 2C0GA 5DJMA 1Q4JA 4K9ZA 2H1BA 2I1UA 1F2EA 2V6KA 4CW9A 18GSA 1ERUA 1GTBA 3KTLA 3WT1A 3KIJA 3FRCA 4KB3A 3GV1A 1YEXA 2QA2A 1PL1A 4LMWA 1GSYA 6GSXA 3KH9A 3HJMA 2FWEA 2NTOA 5B8BA 4I8BA 2O89A 1XVQA 5EVOA 2H0GA 3PGTA 1HNBA 4JR6A 2V6OA 3C1SA 3VPTA 1V57A 4G19A 4HZ4A 2LQQA 2VOCA 2MMOA 2OE0A 2EIQA 2L5OA 3BCIA 4MF7A 4ICYA 2B7KA 4JBBA 3TJJA 2VM1A 2F8AA 2PBJA 5J5NA 1B4PA 1O73A 1PL2A 3ZIVA 3ISOA 1PN9A 1RQMA 3ZIJA 1DUGA 5HQPA 1M2BA 1R4WA 4KSMA 5ECNB 2ALBA 1K0BA 4Q5FA 1T4YA 1F6MC 3TUEA 2F3MA 3PH9A 4DSRA 1JZOA 2YP6A 2HRFA 2R4VA 2BTOT 1NSWA 2YWIA 4GSNA 1OC9A 3IAS2 4XS4A 2V1MA 1PX6A 2IN3A 4OWYA 2ZUPA 4EC0A 3KJYA 1RK4A 4L5LA 1M9BA 2GQLA 2R3XA 1PGTA 4YKGA 5B8AA 1SJ6A 1BYEA 4HJMA 2L5LA 1EV9A 3C71A 3KCMA 3EMXA 3W8JA 1JFUA 4N30A 5D73A 5IIZA 1CQGA 2LRNA 3KTBA 3UVHA 2H6YA 3F63A 1GTIA 1VRSD 2NDOA 1X0RA 5J9CA 2GVPA 3VWUA 5KOXA 1X9WB 4P3YB 2FD3A 6GSYA 4EIQA 1URMA 2E7PA 2VAFA 1FB6A 2X64A 1SU9A 3LEFA 5J9BA 3ZITA 4MJAA 1ZYEA 4ECBA 2BJXA 4MK3A 5G1KA 3F9UA 3TJKA 3UAPA 3BOAA 1FVJA 2C3QA 2KUCA 1N2AA 4OCEA 2I3YA 4ECCA 3FZAA 4XCSA 5ECHB 4HQSA 1XBSA 3U5RE 17GSA 5H5RA 3MIXA 4PUFC 4BWSA 2FLSA 2OE3A 1SK0A 5ID2A 3Q6OA 2HSYA 3PPUA 3KP9A 1K0MA 3U6VA 2O85A 1ZZYA 4PQHA 2LRTA 1F37A 4TR3A 4D73B 1V9WA 4H86A 1E6BA 3SWLA 4EDZA 2R0PA 1FAAA 5D93A 1W89A 3GSSA 4ZXGA 2C3TA 3APOA 4TR0A 1WIKA 4O92A 1XOBA 1J0FA 1MD3A 1GSFA 16GSA 2PWJA 3HVSA 3L0HA 4X43A 4ILFA 2F51A 2LRCA 5KOWA 3HD5A 2V32A 1V98A 1UN2A 5ECKB 3W8SA 3CYNA 2XBQA 2HLSA 2YCDA 1AIUA 5HR0A 4AGSA 4X0XA 3I9V2 3KGKA 4EO3A 2AUVA 4L5OA 1T00A 2XPEA 2FWFA 3E9JB 2GQKA 3N9JA 4PNGA 2AV4A 4OD7A 2CV4A 3GH6A 4HS1A 2HZEA 4BL7B 2KOKA 2H6ZA 2R5GA 4IW9A 3I69A 4HQZA 4DEJA 2LTKA 2B7JA 1YKCA 2LKUA 4J2FA 1YY7A 2LNSA 1XIYA 2RIIA 5ELAA 1QUWA 2GGTA 4KH7A 3IHQA 4FYBA 1B9YC 3IDVA 1J9BA 4K0GA 2H71A 1DBYA 5EL8A 5D9XA 5A5KA 4RUVA 5IMDA 1FB0A 1NHOA 3IA1A 5G1LA 2RM6A 3VPQA 4LL4B 1Z7PA 1U87A 2P5RA 2I9HA 1SKWB 1ZL9A 2B1KA 2GT5A 2CAQA 2A2RA 1QMVA 1GUMA 2B5XA 1GTAA 1U3IA 2O87A 4Z2TA 4GQFA 2AJQB 2MYGA 2WGRA 4OFTA 2TRCP 2GDRA 3H79A 3D21A 4HZ2A 3O3TA 5F8BA 4GCIA 1SK1A 2IPAA 1G6WA 4K5SA 1PD21 3FR3A 3GKKA 4HEA2 4G10A 4F0CA 3P8WA 4V2NA 2O8VB 3GHAA 3P7XA 4EVMA 2H72A 2H6XA 3ERWA 2L57A 1VF3A 4NAXA 1TW9A 5CAXA 3O6TA 4MJEA 3GTUA 2KLXA 5HFGA 2IMKA 2GSQA 2IMDA 1A8LA 4ZL8A 4E8HA 4MNNA 5ABRA 4ECIA 3R3EA 4YQMA 5D8IA 1GL8A 1OVNA 5L71A 2CVKA 2HZFA 5IO0A 1XOAA 1XCCA 3CTFA 2H1GA 3QAWA 3GUSA 2H75A 4PQIA 1U88A 1ZOFA 2K8SA 3GURA 1I5GA 4KF9A 2ZCTA 4OFNA 4FO5A 5DQYA 5E59A 5IPGA 3EURA 4FYUA 3ZMKA 1TK5B 1XWKA 2E2GA 1FVKA 5BMUA 1SKSB 3NOFA 4TR4A 4YH2A 4K6XA 3UOMA 2GSRA 3VLNA 2MMNA 1SJZA 2DJKA 2RUFA 5DAKB 2HRNA 5INYA 3F8UA 1LJRA 3F4TA 1YJ6A 1AUCA 4HDEA 2WDUA 2NVLA 3KEBA 1THOA 4NV2A 13GSA 3IK7A 1WP0A 1EZKA 4F0BA 3ED3A 4L0WA 1HD2A 1BEDA 4IS0A 5IMZA 2QGVA 3QD9A 1PQNA 1HQOA 3H1NA 2GZYA 3DXBA 3TRXA 1ACVA 2H1DA 4I2UA 1GLPA 5CRGA 4ZB8A 5GZZB 4WBRD 1TRUA 2H70A 3DD3A 5HFIA 3SBCA 4ECJA 2CT6A 2WZ9A 4NWYA 4QL9A 1Z6MA 2NBSA 2G0FA 1R5AA 1AW9A 2KHPA 4MJCA 3GN3A 5A4VA 1JHBA 1XWBA 4OO5A 2EC4A 1THXA 2M80A 2JSYA 5FHIA 3MYDA 1HNAA 11GSA 3VURA 4OO4A 5F0GA 3IAM2 1EEJA 1W4VA 2P0GA 3G7YA 4F9ZA 1ILOA 5HR3A 2YJ7A 2MBSA 2PU9C 4N0VA 2YWOA 4WR5A 2YWMA 5IMAA 3I6AA 4KNDA 1EGOA 1A0FA 1K0CA 1HYUA 1GSEA 3DGQA 5HFKA 5AN1A 1VGLA 2C4JA 4NMUA 5DQSA 3D4MA 3F0IA 3QAVA 2V2GA 3WD6A 1JLVA 4MA9A 3GA4A 2DKIA 5KN2A 3H4KA 3APQA 2C0EA 3DVWA 3FR9A 2R0GA 2DLXA 1BG5A 3KZQA 4V2MA 2HYXA 2FA8A 2H0HA 1ZYQB 4N11A 2FWGA 1I9DA 4QQ7A 1KTEA 4YKFA 4ML6A 4GSTA 3IRAA 4L8EA 4BVYA 5ECMB 14GSA 3LGCA 3QCPA 3LWAA 1MDIA 4ID0A 5CNWA 4FYCA 2QA1A 2C8UA 5DCHA 4DSSB 1Z3EA 2QC7A 5DALA 1K0NA 2VCXA 3OR5A 3Q19A 2XC2A 1PKWA 1PKZA 2VL9A 2VCZA 5IMFA 1B4QA 3GNJA 4OFMA 5ECIB 2CA8A 4NHWA 3GKXA 3LW9A 4HU9A 1YF0A 3GMFA 3KH7A 2PUKC 2PVQA 5ECOB 3CTGA 2WULA 5ID2B 2VLVA 4TRXA 3FK8A 4AF2A 2YNXA 3ME7A 5B7CA 4N0ZA 2GT6A 4PNFA 4Q5NA 1GSSA 4MZCA 1Z5YE 4MF5A 2GZPA 1R26A 3DWVA 1GUKA 4V1Ag 2X99A 2GLRA 1TK0B 3FZ9A 1A23A 3LSZA 4AJ7A 4QL7A 3VFIA 3HHVA 4JE1A 5D9TA 2JL4A 4F2IA 3F6FA 1A8YA 1MDKA 3M9KA 1F9MA 3FZ5A 4EXJA 2YV9A 1FHEA 2LV3A 3ZZXA 1Y6EA 2P5QA 1AQVA 4FIWA 4Q5RA 5B6NA 1V58A 4TN8A 3KP8A 1TJDA 3EWLA 3HKRA 2R6KA 2N5FA 5JCUA 1VF4A 1K3OA 3GKNA 2YN1A 2FUG2 1ZYNA 2YPMA 4AJ8A 3F4RA 2C1YA 3A3TA 1ST9A 3IPZA 4IVFA 2H0IA 1U6TA 1SYXA 3D5JA 4MDCA 3L4NA 4IJ3A 3TCOA 5DJLA 1M9AA 4HJ2A 1TDIA 1OC8A 2YOIA 5IPHA 4IGJA 4GLTA 3A2WA 4DSQA 4WBJA 4CHSA 3MSZA 1XW6A 1AQWA 3UEMA 3FHKA 3ZFBA 2VCQA 1KNGA 5AGYA 4CY6A 3BJ5A 3E3EA 3TKRA 5IO2A 1O81A 4TXOB 1JZDA 5E4WA 4PTSA 4F03A 4MPFA 1PSQA 2OA7A 4IP6A 3BD2A 1G0TA 1VF1A 2CVBA 3G7IA 1OAZA 4WEYA 1AXDA 3A2VA 4XRDA 3IXRA 3IK9A 3QFAC 1IYIA 4PX1A 3RAZA 3CSIA 5IOXA 3HA9A 4CY8A 2VCTA 4O32A 3ZYWA 4ZBBA 3CXGA 1G6YA 3LXZA 3ME8A 2RLIA 5IM9A 4LA1A 4K7IA 4A5PA 5COHA 1XVWA 4WXTA 4GSSA 4K7OA 5F06A 3VI7A 1WRYA 2H19A 2MBTA 1M2AA 5LCZA 1M0UA 2HRAA 1DE1A 3HYPA 10GSA 2ON7A 3ZREA 3PINA 4ZIJA 2MMZA 3ZMLA 5KN3A 1X5CA 1BJXA 2TRXA 4GXZA 3HDCA 2HNLA 2FCHA 3AY8A 1BAYA 4MJBA 1ZMAA 4MABA 5IQYA 3QDNA 3PR8A 1PMTA 4G9HA 3GX0A 3RBTA 1R5PA 2JACA 4ZB9A 3UVTA 4PURA 3G9BA 4Z2UA 3WT2A 2DBCA 4LLRA 3HZ8A 4RQXA 9GSSA 2DJ1A 2HI7A 3M0FA 5DCGA 2PN8A 2AHEA 4KDYA 2J9HA 3ZVJA 1XWGA 1ERTA 2DIZA 5AIXA 4WF5A 3GRXA 3CMIA 1V40A 3KMOA 4NV5A 1DSBA 2I81A 2OJLA 1T1VA 3ZRDA 3TKSC 3BCKA 1PRXA 1M7TA 2L4QA 2DMMA 2BMXA 4IELA 1KEBA 1T3BA 3WGEA 3L9SA 1A2MA 3LORA 3FW2A 5C04A 4RQRA 4EUYA 4K2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HU7 A;  2H30 A;  3VWW A;  5G31 A;  1ERV A;  4AJ6 A;  4F82 A;  2LJK A;  1SJI A;  4V2L A;  3HVX A;  3EVI A;  4KE3 A;  3VI5 A;  1Y25 A;  2WRT A;  2YJH A;  1RW1 A;  3S9F A;  3HCZ A;  2FHE A;  2PVO C;  4IP1 A;  1BX9 A;  5J41 A;  5AIS A;  1YQ1 A;  2P31 A;  2DSA A;  2OBI A;  2L4C A;  2PER A;  4KDU A;  2GST A;  2HE3 A;  2V41 A;  3D0Z A;  1TRV A;  2VIM A;  3GL3 A;  2JZS A;  3A2X A;  3F3R A;  1WE0 A;  4TR1 B;  19GS A;  2A4V A;  5ECQ B;  4WKW A;  1USB A;  3C8E A;  5CP1 A;  1SEN A;  3LG6 A;  1QK8 A;  2K18 A;  4ZBA A;  5ECR B;  4MCU A;  1BQ7 A;  5FWG A;  3CSJ A;  3RPP A;  4RI7 A;  4K7N A;  2B3S A;  3WGD A;  1PA3 A;  3C1R A;  4WR4 A;  3TJB A;  4ZBD A;  2H1A A;  5HR2 A;  1TI3 A;  5F07 A;  3KD0 A;  3KMN A;  2CVD A;  2IFQ A;  3E0U A;  1A2J A;  3ZLP A;  2QKE A;  1AC1 A;  3IV4 A;  3L9U A;  1GSU A;  2HXK A;  2WCI A;  3UMA A;  4TXV A;  3VK9 A;  5DAL B;  4KW6 A;  4IHU A;  6GSW A;  5KN0 A;  3UIW A;  1A0R P;  1Z6N A;  3UBK A;  3M8N A;  2GS3 A;  4XIH A;  3IR4 A;  3BBY A;  5C00 A;  3TKQ A;  2JSZ A;  2WJU A;  4HUA A;  2IL3 A;  3TKS E;  3CBU A;  1TU7 A;  4J56 E;  3GX8 A;  2B5Y A;  1OE8 A;  1SK2 A;  3F4S A;  2VCW A;  1EEM A;  3DRN A;  1LU4 A;  2ZNM A;  3NIV A;  4PUA A;  4DVC A;  3IOS A;  2J23 A;  1F3A A;  5IOW A;  1K3Y A;  2LJA A;  1O8X A;  2N5B A;  3QPM A;  1TTZ A;  3QOU A;  2FGX A;  4YAP A;  4ZL7 A;  4JR4 A;  3DIE A;  3TRQ A;  2K6V A;  1B9X C;  3US3 A;  1SL1 B;  4Z7X A;  1ZGN A;  4KUN A;  2JU5 A;  1OC9 B;  4XS4 B;  3J7Y b;  2MMA A;  4LMV A;  2KP2 A;  2VLU A;  3O76 A;  3GYK A;  3EU3 A;  1QXH A;  1AQX A;  1CQH A;  3I43 A;  2F9S A;  4L0U A;  1XPV A;  1SL2 B;  2IME A;  2LEG A;  5LNK e;  1YKA A;  1X5D A;  2A2S A;  2B5E A;  2C0D A;  2LST A;  5G30 A;  3K8N A;  3CRU A;  4ULX A;  4ZL9 A;  3M1G A;  2L6C A;  4EDY A;  5DAK A;  2H01 A;  4KGI A;  2B6M A;  2GSS A;  2IMI A;  5LD0 A;  2VUP A;  5G5E A;  1S3A A;  5EY6 A;  4NHZ A;  2VM2 A;  3L78 A;  4I2T A;  4ZB6 A;  3TOU A;  1M2D A;  2LNT A;  4I97 A;  1TRS A;  3WGX A;  1K3L A;  1OE7 A;  2YZH A;  4V1A p;  3EIN A;  3MNG A;  3ZL5 A;  2DJ3 A;  1SD9 A;  1G7O A;  7GSS A;  3W6G A;  1DE2 A;  1ML6 A;  2K9F A;  4KCE A;  3DYR A;  5GST A;  1G7E A;  5A4W A;  4IQA A;  1QGV A;  1MEK A;  3LFL A;  5D96 A;  1JLW A;  2HFD A;  3FEU A;  2VD1 A;  5G5F A;  2XPD A;  2X8C A;  3M3M A;  5G2Z A;  1NM3 A;  2CX3 A;  3TRP A;  5EPF A;  2M72 A;  1WPI A;  1EWX A;  1YDK A;  3DEX A;  4YQV A;  2IWT A;  3D22 A;  3P90 A;  1XXU A;  1SD8 A;  3C7M A;  1EOH A;  2PGT A;  1QQ2 A;  1MTC A;  3NZN A;  4RI6 A;  5GAN D;  4IQ1 A;  4MLY A;  2OBK A;  2H8L A;  2LS5 A;  4MMM A;  1OC3 A;  1XFL A;  5GAP D;  2CQ9 A;  1EV4 A;  8GSS A;  5ECL B;  2LUS A;  4BPY A;  1N8J A;  3ERF A;  3DML A;  2VL3 A;  4O7H A;  4KSO A;  4IKH A;  5ECP B;  1PX7 A;  2OKA A;  1XW9 A;  1UC7 A;  3GL5 A;  4MH3 A;  2EIO A;  2FY6 A;  1B8X A;  3QMX A;  2HZE B;  1GWC A;  1ABA A;  4EF0 A;  1GNW A;  2LJR A;  3DKS A;  2PPT A;  1JZW A;  3WYW A;  1K0D A;  1O85 A;  6GST A;  3IBH A;  1Z9H A;  1SYR A;  3TJF A;  5CRH A;  4G2E A;  2GTU A;  1TKD B;  4TW5 A;  2ES7 A;  4ML1 A;  2YAN A;  1TRW A;  1WWJ A;  3UL3 A;  5FT3 A;  4DSS A;  2QSI A;  4BWQ A;  4WET A;  2CZ2 A;  2AB6 A;  4KX4 A;  1EP8 A;  3RHC A;  4OCF A;  1TXX A;  1GNE A;  3TKS A;  3GIX A;  2KP1 A;  1IYH A;  5CRW A;  1GP1 A;  3H93 A;  3GST A;  2LQO A;  4POB A;  2D2Z A;  3F6D A;  3HJO A;  1FO5 A;  2O7K A;  5DDL A;  1O7U A;  1UVZ A;  4KCA A;  3J7Y k;  1C72 A;  5D9W A;  3GH9 A;  4MH2 A;  4KDX A;  22GS A;  3LJR A;  2H74 A;  2CX4 A;  1ERW A;  1J08 A;  3L9V A;  4YAV A;  1SL0 B;  1XZO A;  1Q98 A;  2Z9S A;  5CYY A;  1EGR A;  1V2A A;  3MWH A;  3GTU B;  2JZT A;  2AAW A;  3GFK A;  1GRX A;  1LBK A;  3LYP A;  5IMV A;  3FYG A;  1TI1 A;  1GTU A;  3HJP A;  2FWH A;  2IJY A;  3TOT A;  3HVV A;  1EOG A;  3EU4 A;  2XBI A;  3TKP A;  2H73 A;  2OAC A;  1R7H A;  6GSU A;  3KXO A;  4CDO A;  4XS6 A;  3TJG A;  2DJ0 A;  2HT9 A;  4K0N A;  3CRT A;  1GLQ A;  2TIR A;  2GQM A;  1O8W A;  4MZB A;  1GSD A;  1F3B A;  2X8H A;  2OE1 A;  3RPN A;  4E8E A;  2CZ3 A;  3A5W A;  4MPG A;  1H4O A;  2DC5 A;  4PXO A;  2H66 A;  5ECS A;  1Z7R A;  1K0A A;  1TU8 A;  4IJI A;  2AYT A;  5JCG A;  1B48 A;  1MDJ A;  3CSH A;  1E2Y A;  2YZU A;  4MF6 A;  1OKD A;  4X1U A;  2YWN A;  1MD4 A;  2WFC A;  3GKM A;  1GSQ A;  5A4U A;  2IMF A;  1U3A A;  3HZ4 A;  4XHM A;  5ENU A;  3VWX A;  5D9V A;  5CRD A;  4OMV A;  2WB9 A;  1NHY A;  2IFQ B;  3EMP A;  4IBP A;  5J3R A;  3TB2 A;  4XS1 A;  3C73 A;  4XRA A;  1K0O A;  4POM A;  4EL1 A;  1OYJ A;  1QFN A;  3F3Q A;  1YEP A;  4JU5 A;  2OAD A;  1XW5 A;  1GH2 A;  1X9S B;  2NPB A;  3LYK A;  4ZIL A;  1GUL A;  3IE3 A;  1AAZ A;  3DVX A;  2DJ2 A;  2VL2 A;  5AIV A;  1H75 A;  4GTU A;  4Q5Q A;  2IIY A;  1M99 A;  4D73 A;  3LQ7 A;  2B1L A;  2GZZ A;  1FOV A;  3FR6 A;  5DVB A;  5GSS A;  4POK A;  4TXO A;  3V1W A;  4KAE A;  2FNO A;  2L6D A;  5HR1 A;  1YF1 A;  4JRR A;  4FH8 A;  3RDW A;  1GUH A;  2MZC A;  3QFB C;  1OKT A;  1ON4 A;  3G7J A;  4POL A;  5JCW A;  3Q74 A;  5CO3 A;  4K1F A;  3QR6 A;  4TOP A;  5CRE A;  3ZFL A;  2E0Q A;  3MDK A;  1TP9 A;  4TKY A;  1S3D A;  4TVE A;  3P2A A;  3JCM L;  5F05 A;  2M46 A;  2PMT A;  1WJK A;  1WMJ A;  2VLT A;  4ACS A;  6GSV A;  3UJ1 A;  2VD0 A;  2HSH A;  2REM A;  4JZQ A;  1NW2 A;  4J57 E;  2EIR A;  3FY7 A;  4BL7 A;  5JWR B;  5KN1 A;  3HY2 A;  4EKZ A;  2DIY A;  4K8M A;  3N5O A;  3M9J A;  1KBN A;  3Q18 A;  4KA0 A;  3EC3 A;  3APS A;  4O5R A;  3RHB A;  3ZTL A;  1X9M B;  4ISD A;  2N5A A;  4GQC A;  4GF0 A;  3IC4 A;  4EE0 A;  5JWO B;  3ERG A;  5H5S A;  1X5E A;  3FZ4 A;  4GWR A;  3EYT A;  2DML A;  3H8Q A;  3ZVJ D;  4JED A;  1T4Z A;  1S3C A;  2ON5 A;  2C0F A;  3MAK A;  3TGZ A;  4HOJ A;  2R37 A;  2WS2 A;  4MZW A;  3UAR A;  2VL2 C;  3TDG A;  1TK8 B;  1XWA A;  2K8V A;  3VWV A;  5JWQ B;  4YQU A;  5KEJ A;  3R2Q A;  2H76 A;  3D6I A;  2JZR A;  3EE2 A;  1JZR A;  5IMC A;  1SKR B;  6GSS A;  2L59 A;  1A24 A;  2C80 A;  1VF2 A;  2G2Q A;  3QAG A;  4XTS A;  1A2L A;  4NPB A;  1FW1 A;  2R2J A;  1T7P B;  2FA4 A;  2I4A A;  2DJJ A;  20GS A;  3FKF A;  4WF4 A;  4HI7 A;  4LL1 B;  12GS A;  1TOF A;  4I6X A;  1ZCP A;  3UBL A;  4NXI A;  2F8F A;  4BVX A;  2E2M A;  2JAD A;  1WOU A;  2RUE A;  1UA5 A;  2X8G A;  3KM6 A;  5H5Q A;  3LXT A;  2C3N A;  2XHF A;  2YV7 A;  2VCV A;  1YZX A;  1FG4 A;  4TR1 A;  5DBQ A;  2VO4 A;  4PQ1 A;  4IN0 A;  1XWC A;  5ELG A;  4I5Q A;  1HNC A;  2RM5 A;  4GRF A;  4BA7 A;  5B6M A;  1O6J A;  2CAI A;  1EP7 A;  4MP4 A;  3D4T A;  5J4U A;  4N10 A;  4PGT A;  1T8E B;  3HXS A;  2C0G A;  5DJM A;  1Q4J A;  4K9Z A;  2H1B A;  2I1U A;  1F2E A;  2V6K A;  4CW9 A;  18GS A;  1ERU A;  1GTB A;  3KTL A;  3WT1 A;  3KIJ A;  3FRC A;  4KB3 A;  3GV1 A;  1YEX A;  1PL1 A;  4LMW A;  1GSY A;  6GSX A;  3KH9 A;  3HJM A;  2FWE A;  2NTO A;  5B8B A;  4I8B A;  2O89 A;  1XVQ A;  5EVO A;  2H0G A;  3PGT A;  1HNB A;  4JR6 A;  2V6O A;  3C1S A;  3VPT A;  1V57 A;  4G19 A;  4HZ4 A;  2LQQ A;  2VOC A;  2MMO A;  2OE0 A;  2EIQ A;  2L5O A;  3BCI A;  4MF7 A;  2B7K A;  4JBB A;  3TJJ A;  2VM1 A;  2F8A A;  2PBJ A;  5J5N A;  1B4P A;  1O73 A;  1PL2 A;  3ZIV A;  3ISO A;  1PN9 A;  1RQM A;  3ZIJ A;  1DUG A;  5HQP A;  1M2B A;  1R4W A;  4KSM A;  5ECN B;  2ALB A;  1K0B A;  4Q5F A;  1T4Y A;  1F6M C;  3TUE A;  2F3M A;  3PH9 A;  4DSR A;  1JZO A;  2YP6 A;  2HRF A;  2R4V A;  2BTO T;  1NSW A;  2YWI A;  4GSN A;  1OC9 A;  3IAS 2;  4XS4 A;  2V1M A;  1PX6 A;  2IN3 A;  4OWY A;  2ZUP A;  4EC0 A;  3KJY A;  1RK4 A;  4L5L A;  1M9B A;  2GQL A;  2R3X A;  1PGT A;  5B8A A;  1SJ6 A;  1BYE A;  4HJM A;  2L5L A;  1EV9 A;  3C71 A;  3KCM A;  3EMX A;  3W8J A;  1JFU A;  4N30 A;  5D73 A;  5IIZ A;  1CQG A;  2LRN A;  3KTB A;  3UVH A;  2H6Y A;  3F63 A;  1GTI A;  1VRS D;  2NDO A;  1X0R A;  5J9C A;  2GVP A;  3VWU A;  1X9W B;  4P3Y B;  2FD3 A;  6GSY A;  1URM A;  2E7P A;  2VAF A;  1FB6 A;  2X64 A;  1SU9 A;  3LEF A;  5J9B A;  3ZIT A;  4MJA A;  1ZYE A;  4ECB A;  2BJX A;  4MK3 A;  5G1K A;  3F9U A;  3TJK A;  3UAP A;  3BOA A;  1FVJ A;  2C3Q A;  2KUC A;  1N2A A;  4OCE A;  2I3Y A;  4ECC A;  3FZA A;  4XCS A;  5ECH B;  4HQS A;  1XBS A;  3U5R E;  17GS A;  5H5R A;  4PUF C;  4BWS A;  2FLS A;  2OE3 A;  1SK0 A;  5ID2 A;  3Q6O A;  2HSY A;  3KP9 A;  1K0M A;  3U6V A;  2O85 A;  1ZZY A;  4PQH A;  2LRT A;  1F37 A;  4TR3 A;  4D73 B;  1V9W A;  4H86 A;  1E6B A;  3SWL A;  4EDZ A;  1FAA A;  5D93 A;  1W89 A;  3GSS A;  4ZXG A;  2C3T A;  3APO A;  4TR0 A;  1WIK A;  4O92 A;  1XOB A;  1J0F A;  1MD3 A;  1GSF A;  16GS A;  2PWJ A;  3HVS A;  3L0H A;  4X43 A;  4ILF A;  2F51 A;  2LRC A;  3HD5 A;  2V32 A;  1V98 A;  1UN2 A;  5ECK B;  3W8S A;  3CYN A;  2XBQ A;  2HLS A;  2YCD A;  1AIU A;  5HR0 A;  4AGS A;  4X0X A;  3I9V 2;  3KGK A;  4EO3 A;  2AUV A;  4L5O A;  1T00 A;  2XPE A;  2FWF A;  3E9J B;  2GQK A;  3N9J A;  4PNG A;  2AV4 A;  4OD7 A;  2CV4 A;  3GH6 A;  4HS1 A;  2HZE A;  2KOK A;  2H6Z A;  2R5G A;  4IW9 A;  3I69 A;  4HQZ A;  4DEJ A;  2LTK A;  2B7J A;  1YKC A;  2LKU A;  4J2F A;  1YY7 A;  2LNS A;  1XIY A;  2RII A;  5ELA A;  1QUW A;  2GGT A;  4KH7 A;  3IHQ A;  4FYB A;  1B9Y C;  3IDV A;  1J9B A;  4K0G A;  2H71 A;  1DBY A;  5EL8 A;  5D9X A;  5A5K A;  4RUV A;  5IMD A;  1FB0 A;  1NHO A;  3IA1 A;  5G1L A;  2RM6 A;  3VPQ A;  4LL4 B;  1Z7P A;  1U87 A;  2P5R A;  2I9H A;  1SKW B;  1ZL9 A;  2B1K A;  2GT5 A;  2CAQ A;  2A2R A;  1QMV A;  1GUM A;  2B5X A;  1GTA A;  1U3I A;  2O87 A;  4GQF A;  2AJQ B;  2MYG A;  2WGR A;  4OFT A;  2TRC P;  2GDR A;  3H79 A;  3D21 A;  4HZ2 A;  3O3T A;  5F8B A;  4GCI A;  1SK1 A;  2IPA A;  1G6W A;  1PD2 1;  3FR3 A;  3GKK A;  4HEA 2;  4G10 A;  4F0C A;  3P8W A;  4V2N A;  2O8V B;  3GHA A;  3P7X A;  4EVM A;  2H72 A;  2H6X A;  3ERW A;  2L57 A;  1VF3 A;  4NAX A;  1TW9 A;  5CAX A;  3O6T A;  4MJE A;  3GTU A;  2KLX A;  5HFG A;  2IMK A;  2GSQ A;  2IMD A;  1A8L A;  4ZL8 A;  4E8H A;  5ABR A;  4ECI A;  4YQM A;  5D8I A;  1GL8 A;  1OVN A;  5L71 A;  2CVK A;  2HZF A;  5IO0 A;  1XOA A;  1XCC A;  3CTF A;  2H1G A;  3QAW A;  3GUS A;  2H75 A;  4PQI A;  1U88 A;  1ZOF A;  2K8S A;  3GUR A;  1I5G A;  4OFN A;  2ZCT A;  4FO5 A;  5DQY A;  5E59 A;  5IPG A;  3EUR A;  4FYU A;  3ZMK A;  1TK5 B;  1XWK A;  2E2G A;  1FVK A;  1SKS B;  3NOF A;  4TR4 A;  4YH2 A;  4K6X A;  3UOM A;  2GSR A;  3VLN A;  2MMN A;  1SJZ A;  2DJK A;  2RUF A;  5DAK B;  2HRN A;  5INY A;  3F8U A;  1LJR A;  3F4T A;  1YJ6 A;  1AUC A;  4HDE A;  2WDU A;  2NVL A;  3KEB A;  1THO A;  4NV2 A;  13GS A;  3IK7 A;  1WP0 A;  1EZK A;  4F0B A;  3ED3 A;  4L0W A;  1HD2 A;  1BED A;  4IS0 A;  5IMZ A;  2QGV A;  3QD9 A;  1PQN A;  1HQO A;  3H1N A;  2GZY A;  3DXB A;  3TRX A;  1ACV A;  2H1D A;  4I2U A;  1GLP A;  5CRG A;  4ZB8 A;  5GZZ B;  4WBR D;  1TRU A;  2H70 A;  3DD3 A;  5HFI A;  3SBC A;  4ECJ A;  2CT6 A;  2WZ9 A;  4NWY A;  4QL9 A;  1Z6M A;  2NBS A;  2G0F A;  1R5A A;  1AW9 A;  2KHP A;  4MJC A;  3GN3 A;  5A4V A;  1JHB A;  1XWB A;  4OO5 A;  2EC4 A;  1THX A;  2M80 A;  2JSY A;  5FHI A;  1HNA A;  11GS A;  3VUR A;  4OO4 A;  5F0G A;  3IAM 2;  1EEJ A;  1W4V A;  2P0G A;  3G7Y A;  4F9Z A;  1ILO A;  5HR3 A;  2YJ7 A;  2MBS A;  2PU9 C;  4N0V A;  2YWO A;  4WR5 A;  2YWM A;  5IMA A;  3I6A A;  4KND A;  1EGO A;  1A0F A;  1K0C A;  1HYU A;  1GSE A;  3DGQ A;  5HFK A;  5AN1 A;  1VGL A;  2C4J A;  4NMU A;  5DQS A;  3D4M A;  3F0I A;  3QAV A;  2V2G A;  3WD6 A;  1JLV A;  4MA9 A;  3GA4 A;  5KN2 A;  3H4K A;  3APQ A;  2C0E A;  3DVW A;  3FR9 A;  2DLX A;  1BG5 A;  3KZQ A;  4V2M A;  2HYX A;  2FA8 A;  2H0H A;  1ZYQ B;  4N11 A;  2FWG A;  1I9D A;  4QQ7 A;  1KTE A;  4ML6 A;  4GST A;  3IRA A;  4L8E A;  4BVY A;  5ECM B;  14GS A;  3LGC A;  3QCP A;  3LWA A;  1MDI A;  4ID0 A;  5CNW A;  4FYC A;  2C8U A;  5DCH A;  4DSS B;  1Z3E A;  2QC7 A;  5DAL A;  1K0N A;  2VCX A;  3OR5 A;  3Q19 A;  2XC2 A;  1PKW A;  1PKZ A;  2VL9 A;  2VCZ A;  5IMF A;  1B4Q A;  3GNJ A;  4OFM A;  5ECI B;  2CA8 A;  4NHW A;  3GKX A;  4HU9 A;  1YF0 A;  3GMF A;  3KH7 A;  2PUK C;  2PVQ A;  5ECO B;  3CTG A;  2WUL A;  5ID2 B;  2VLV A;  4TRX A;  3FK8 A;  4AF2 A;  2YNX A;  3ME7 A;  5B7C A;  4N0Z A;  2GT6 A;  4PNF A;  4Q5N A;  1GSS A;  4MZC A;  1Z5Y E;  4MF5 A;  2GZP A;  1R26 A;  3DWV A;  1GUK A;  4V1A g;  2X99 A;  2GLR A;  1TK0 B;  3FZ9 A;  1A23 A;  3LSZ A;  4AJ7 A;  4QL7 A;  3VFI A;  3HHV A;  4JE1 A;  5D9T A;  2JL4 A;  4F2I A;  3F6F A;  1A8Y A;  1MDK A;  3M9K A;  1F9M A;  3FZ5 A;  4EXJ A;  2YV9 A;  1FHE A;  2LV3 A;  3ZZX A;  1Y6E A;  2P5Q A;  1AQV A;  4FIW A;  4Q5R A;  5B6N A;  1V58 A;  4TN8 A;  3KP8 A;  1TJD A;  3EWL A;  3HKR A;  2R6K A;  2N5F A;  5JCU A;  1VF4 A;  1K3O A;  3GKN A;  2YN1 A;  2FUG 2;  2YPM A;  4AJ8 A;  3F4R A;  2C1Y A;  3A3T A;  1ST9 A;  3IPZ A;  4IVF A;  2H0I A;  1U6T A;  1SYX A;  3D5J A;  4MDC A;  3L4N A;  4IJ3 A;  3TCO A;  5DJL A;  1M9A A;  4HJ2 A;  1TDI A;  1OC8 A;  2YOI A;  5IPH A;  4IGJ A;  4GLT A;  3A2W A;  4DSQ A;  4WBJ A;  4CHS A;  3MSZ A;  1XW6 A;  1AQW A;  3UEM A;  3FHK A;  3ZFB A;  2VCQ A;  1KNG A;  5AGY A;  3BJ5 A;  3E3E A;  3TKR A;  5IO2 A;  1O81 A;  4TXO B;  1JZD A;  5E4W A;  4F03 A;  4MPF A;  1PSQ A;  2OA7 A;  4IP6 A;  3BD2 A;  1G0T A;  1VF1 A;  2CVB A;  3G7I A;  1OAZ A;  4WEY A;  1AXD A;  3A2V A;  4XRD A;  3IXR A;  3IK9 A;  3QFA C;  1IYI A;  4PX1 A;  3RAZ A;  3CSI A;  5IOX A;  3HA9 A;  2VCT A;  4O32 A;  3ZYW A;  4ZBB A;  3CXG A;  1G6Y A;  3LXZ A;  3ME8 A;  2RLI A;  5IM9 A;  4LA1 A;  4K7I A;  5COH A;  1XVW A;  4WXT A;  4GSS A;  4K7O A;  5F06 A;  3VI7 A;  1WRY A;  2H19 A;  2MBT A;  1M2A A;  5LCZ A;  1M0U A;  1DE1 A;  3HYP A;  10GS A;  2ON7 A;  3ZRE A;  3PIN A;  4ZIJ A;  2MMZ A;  3ZML A;  5KN3 A;  1X5C A;  1BJX A;  2TRX A;  4GXZ A;  3HDC A;  2HNL A;  2FCH A;  3AY8 A;  1BAY A;  4MJB A;  1ZMA A;  4MAB A;  5IQY A;  3QDN A;  3PR8 A;  1PMT A;  4G9H A;  3GX0 A;  3RBT A;  1R5P A;  2JAC A;  4ZB9 A;  3UVT A;  4PUR A;  3G9B A;  3WT2 A;  2DBC A;  4LLR A;  3HZ8 A;  4RQX A;  9GSS A;  2DJ1 A;  2HI7 A;  3M0F A;  5DCG A;  2PN8 A;  2AHE A;  4KDY A;  2J9H A;  3ZVJ A;  1XWG A;  1ERT A;  2DIZ A;  5AIX A;  4WF5 A;  3GRX A;  3CMI A;  1V40 A;  3KMO A;  4NV5 A;  1DSB A;  2I81 A;  2OJL A;  1T1V A;  3ZRD A;  3TKS C;  3BCK A;  1PRX A;  1M7T A;  2L4Q A;  2DMM A;  2BMX A;  4IEL A;  1KEB A;  1T3B A;  3WGE A;  3L9S A;  1A2M A;  3LOR A;  3FW2 A;  5C04 A;  4RQR A;  4EUY A;  4K2D A; 
#chains in the Genus database with same CATH topology
 4HU7 A;  2H30 A;  4O5Q A;  3VWW A;  5G31 A;  1ERV A;  4AJ6 A;  4F82 A;  4Z2R A;  2LJK A;  1SJI A;  4V2L A;  3HVX A;  3EVI A;  4KE3 A;  3VI5 A;  1Y25 A;  2WRT A;  2YJH A;  1RW1 A;  3S9F A;  3HCZ A;  2FHE A;  2PVO C;  4BVX B;  4IP1 A;  1BX9 A;  5J41 A;  5AIS A;  1YQ1 A;  2P31 A;  2DSA A;  2OBI A;  2L4C A;  2PER A;  4KDU A;  2GST A;  2HE3 A;  2V41 A;  3D0Z A;  1TRV A;  2VIM A;  3GL3 A;  2JZS A;  1FOH A;  3A2X A;  4G0I A;  3F3R A;  1WE0 A;  4TR1 B;  19GS A;  2A4V A;  5ECQ B;  4WKW A;  1USB A;  3C8E A;  5CP1 A;  1SEN A;  3LG6 A;  1QK8 A;  2K18 A;  4ZBA A;  5ECR B;  4MCU A;  1BQ7 A;  5FWG A;  3CSJ A;  3RPP A;  4RI7 A;  4K7N A;  2HSM A;  2B3S A;  3WGD A;  1PA3 A;  3C1R A;  4WR4 A;  3TJB A;  4ZBD A;  2H1A A;  5HR2 A;  1TI3 A;  5F07 A;  3KD0 A;  4G0L A;  3KMN A;  2CVD A;  4BVY B;  2IFQ A;  3E0U A;  1A2J A;  3ZLP A;  2QKE A;  1AC1 A;  3IV4 A;  3L9U A;  4EIP A;  1GSU A;  2HXK A;  2WCI A;  3UMA A;  4TXV A;  3VK9 A;  5DAL B;  4KW6 A;  4IHU A;  6GSW A;  5KN0 A;  3UIW A;  1A0R P;  1Z6N A;  3UBK A;  3M8N A;  2GS3 A;  4XIH A;  3IR4 A;  3BBY A;  5C00 A;  3TKQ A;  2JSZ A;  2WJU A;  4HUA A;  2IL3 A;  3TKS E;  3CBU A;  3A5I A;  1TU7 A;  4J56 E;  3GX8 A;  2B5Y A;  1OE8 A;  1SK2 A;  3F4S A;  2VCW A;  1EEM A;  3DRN A;  1LU4 A;  2ZNM A;  3NIV A;  4PUA A;  4DVC A;  3IOS A;  2J23 A;  1F3A A;  5IOW A;  1K3Y A;  2LJA A;  1O8X A;  2N5B A;  3QPM A;  1TTZ A;  3QOU A;  2FGX A;  4YAP A;  4ZL7 A;  4JR4 A;  3DIE A;  3TRQ A;  2K6V A;  1B9X C;  3US3 A;  1SL1 B;  4Z7X A;  1ZGN A;  4KUN A;  2JU5 A;  1OC9 B;  4XS4 B;  3J7Y b;  2MMA A;  4LMV A;  2KP2 A;  2VLU A;  3O76 A;  3GYK A;  3EU3 A;  1QXH A;  1AQX A;  1CQH A;  3I43 A;  2F9S A;  4L0U A;  1XPV A;  1SL2 B;  2IME A;  2LEG A;  5LNK e;  1YKA A;  1X5D A;  2A2S A;  2B5E A;  2C0D A;  2LST A;  5G30 A;  3K8N A;  3CRU A;  4ULX A;  4ZL9 A;  3M1G A;  2L6C A;  4EDY A;  5DAK A;  2H01 A;  4KGI A;  2B6M A;  2GSS A;  2IMI A;  5LD0 A;  5BRT A;  2VUP A;  5G5E A;  1S3A A;  5EY6 A;  4NHZ A;  1PFO A;  2VM2 A;  3L78 A;  4I2T A;  4ZB6 A;  3TOU A;  1M2D A;  2LNT A;  4I97 A;  1TRS A;  3WGX A;  1K3L A;  1OE7 A;  2YZH A;  4V1A p;  3EIN A;  3MNG A;  3ZL5 A;  2DJ3 A;  1SD9 A;  1G7O A;  7GSS A;  3W6G A;  1DE2 A;  1ML6 A;  2K9F A;  4KCE A;  3DYR A;  5GST A;  1G7E A;  5A4W A;  4IQA A;  1QGV A;  1MEK A;  3LFL A;  5D96 A;  1JLW A;  2HFD A;  3FEU A;  2VD1 A;  5G5F A;  2XPD A;  2X8C A;  3M3M A;  5G2Z A;  1NM3 A;  2CX3 A;  3TRP A;  5EPF A;  2M72 A;  1WPI A;  1EWX A;  1YDK A;  3DEX A;  4YQV A;  2IWT A;  3D22 A;  3P90 A;  1XXU A;  1SD8 A;  3C7M A;  1EOH A;  2PGT A;  1QQ2 A;  1MTC A;  3NZN A;  4RI6 A;  2HRK A;  5GAN D;  4IQ1 A;  4MLY A;  2OBK A;  2H8L A;  2LS5 A;  4MMM A;  1OC3 A;  1XFL A;  5GAP D;  2CQ9 A;  1EV4 A;  8GSS A;  5ECL B;  2LUS A;  4BPY A;  1N8J A;  3ERF A;  4O5U A;  3DML A;  2VL3 A;  4O7H A;  4KSO A;  4IKH A;  5ECP B;  1PX7 A;  2OKA A;  1XW9 A;  1UC7 A;  3GL5 A;  4MH3 A;  2EIO A;  2FY6 A;  1B8X A;  3QMX A;  2HZE B;  1GWC A;  1ABA A;  4EF0 A;  1GNW A;  2LJR A;  3DKS A;  2PPT A;  1JZW A;  3WYW A;  1K0D A;  4X4J A;  1O85 A;  6GST A;  3IBH A;  1Z9H A;  1SYR A;  3TJF A;  5CRH A;  4G2E A;  2GTU A;  1TKD B;  4TW5 A;  2ES7 A;  4ML1 A;  2YAN A;  1TRW A;  1WWJ A;  3UL3 A;  5FT3 A;  4DSS A;  2QSI A;  4BWQ A;  4WET A;  2CZ2 A;  2AB6 A;  4KX4 A;  1EP8 A;  3RHC A;  4OCF A;  1TXX A;  1GNE A;  3TKS A;  3GIX A;  2KP1 A;  1IYH A;  5CRW A;  3IHG A;  1GP1 A;  3H93 A;  3GST A;  2LQO A;  2UZ8 A;  4POB A;  2D2Z A;  3F6D A;  3HJO A;  1FO5 A;  2O7K A;  5DDL A;  1O7U A;  1UVZ A;  2DKH A;  4KCA A;  3J7Y k;  1C72 A;  5D9W A;  3GH9 A;  4MH2 A;  4KDX A;  22GS A;  3LJR A;  2H74 A;  2CX4 A;  1ERW A;  1J08 A;  3L9V A;  4YAV A;  1SL0 B;  1XZO A;  1Q98 A;  2Z9S A;  5CYY A;  1EGR A;  1V2A A;  3MWH A;  3GTU B;  2JZT A;  2AAW A;  3GFK A;  1GRX A;  1LBK A;  3LYP A;  5IMV A;  3FYG A;  1TI1 A;  1GTU A;  3HJP A;  2FWH A;  2IJY A;  4K2X A;  3TOT A;  3HVV A;  1EOG A;  1M3I A;  3EU4 A;  2XBI A;  3TKP A;  2H73 A;  2OAC A;  1R7H A;  6GSU A;  3KXO A;  4CDO A;  4XS6 A;  3TJG A;  4FQU A;  2DJ0 A;  2HT9 A;  4K0N A;  2A2P A;  3CRT A;  1GLQ A;  2TIR A;  2GQM A;  1O8W A;  4MZB A;  1GSD A;  1F3B A;  2X8H A;  2OE1 A;  3RPN A;  4E8E A;  2CZ3 A;  3A5W A;  4MPG A;  1H4O A;  2DC5 A;  4PXO A;  2H66 A;  5ECS A;  1Z7R A;  1K0A A;  1TU8 A;  4IJI A;  2AYT A;  5JCG A;  1B48 A;  1MDJ A;  3CSH A;  1E2Y A;  2YZU A;  4MF6 A;  1OKD A;  4X1U A;  2YWN A;  1MD4 A;  2WFC A;  3GKM A;  1GSQ A;  5A4U A;  2IMF A;  1U3A A;  3HZ4 A;  4XHM A;  5ENU A;  3VWX A;  5D9V A;  5CRD A;  4OMV A;  2WB9 A;  1NHY A;  2IFQ B;  3EMP A;  4IBP A;  5J3R A;  3TB2 A;  3CQF A;  4XS1 A;  3C73 A;  4XRA A;  1K0O A;  4POM A;  4EL1 A;  1OYJ A;  1QFN A;  3F3Q A;  1YEP A;  4JU5 A;  4K5R A;  2OAD A;  1XW5 A;  1GH2 A;  1X9S B;  2NPB A;  3LYK A;  4ZIL A;  2A4H A;  1GUL A;  3IE3 A;  1AAZ A;  3DVX A;  2DJ2 A;  2VL2 A;  5AIV A;  1H75 A;  4GTU A;  4Q5Q A;  2IIY A;  1M99 A;  4D73 A;  3LQ7 A;  2B1L A;  2GZZ A;  1FOV A;  3FR6 A;  5DVB A;  5GSS A;  4POK A;  4TXO A;  3V1W A;  4KAE A;  2FNO A;  2L6D A;  2X4A A;  5HR1 A;  1YF1 A;  4JRR A;  4FH8 A;  3RDW A;  1GUH A;  2MZC A;  3QFB C;  1OKT A;  1ON4 A;  3G7J A;  4POL A;  5JCW A;  3Q74 A;  5CO3 A;  4K1F A;  3QR6 A;  4TOP A;  5CRE A;  3ZFL A;  2E0Q A;  3MDK A;  1TP9 A;  4TKY A;  1S3D A;  4TVE A;  3P2A A;  4USS A;  3JCM L;  5F05 A;  2M46 A;  2PMT A;  1WJK A;  1WMJ A;  2VLT A;  4ACS A;  6GSV A;  3UJ1 A;  2VD0 A;  2HSH A;  2REM A;  4JZQ A;  1NW2 A;  2X49 A;  4J57 E;  2EIR A;  3FY7 A;  4BL7 A;  5JWR B;  5KN1 A;  3HY2 A;  4EKZ A;  2DIY A;  4K8M A;  3IC8 A;  3N5O A;  3M9J A;  1KBN A;  3FMW A;  3Q18 A;  4KA0 A;  3EC3 A;  3APS A;  4O5R A;  3RHB A;  3ZTL A;  1X9M B;  4ISD A;  2N5A A;  4GQC A;  4GF0 A;  3EPT A;  3IC4 A;  4EE0 A;  4G0K A;  5JWO B;  3ERG A;  5H5S A;  1X5E A;  1ZYP A;  3FZ4 A;  4GWR A;  3EYT A;  2DML A;  3H8Q A;  3ZVJ D;  4JED A;  1T4Z A;  1S3C A;  2ON5 A;  2C0F A;  3MAK A;  3TGZ A;  4HOJ A;  2R37 A;  2WS2 A;  4MZW A;  3UAR A;  2VL2 C;  3TDG A;  1TK8 B;  1XWA A;  2K8V A;  3VWV A;  5JWQ B;  4YQU A;  5KEJ A;  3R2Q A;  2H76 A;  3D6I A;  2JZR A;  3EE2 A;  1JZR A;  5IMC A;  1SKR B;  6GSS A;  2L59 A;  1A24 A;  2C80 A;  1VF2 A;  2G2Q A;  3QAG A;  4XTS A;  1A2L A;  4NPB A;  1FW1 A;  2R2J A;  1T7P B;  2FA4 A;  2I4A A;  2DJJ A;  20GS A;  3FKF A;  4WF4 A;  4HI7 A;  4LL1 B;  12GS A;  1TOF A;  4I6X A;  1ZCP A;  3UBL A;  4NXI A;  2F8F A;  4BVX A;  2E2M A;  2JAD A;  1WOU A;  2RUE A;  1UA5 A;  2X8G A;  3KM6 A;  5H5Q A;  3LXT A;  2C3N A;  2XHF A;  2YV7 A;  2VCV A;  1YZX A;  1FG4 A;  4TR1 A;  5DBQ A;  2VO4 A;  4PQ1 A;  4IN0 A;  1XWC A;  5ELG A;  1PN0 A;  4I5Q A;  1HNC A;  2RM5 A;  4GRF A;  4BA7 A;  5B6M A;  1O6J A;  2CAI A;  1EP7 A;  4MP4 A;  2R0C A;  3D4T A;  5J4U A;  4N10 A;  4PGT A;  1T8E B;  3HXS A;  2C0G A;  5DJM A;  1XG8 A;  1Q4J A;  4K9Z A;  2H1B A;  2I1U A;  1F2E A;  2V6K A;  4CW9 A;  18GS A;  1ERU A;  1GTB A;  3KTL A;  3WT1 A;  3KIJ A;  3FRC A;  4KB3 A;  3GV1 A;  1YEX A;  2QA2 A;  1PL1 A;  4LMW A;  1GSY A;  6GSX A;  3KH9 A;  3HJM A;  2FWE A;  2NTO A;  5B8B A;  4I8B A;  2O89 A;  1XVQ A;  5EVO A;  2H0G A;  3PGT A;  1HNB A;  4JR6 A;  2V6O A;  3C1S A;  3VPT A;  1V57 A;  4G19 A;  4HZ4 A;  2LQQ A;  2VOC A;  2MMO A;  2OE0 A;  2EIQ A;  2L5O A;  3BCI A;  4MF7 A;  4BIK A;  4ICY A;  2B7K A;  4JBB A;  3TJJ A;  2VM1 A;  2F8A A;  2PBJ A;  5J5N A;  1B4P A;  1O73 A;  1PL2 A;  3ZIV A;  3ISO A;  1PN9 A;  1RQM A;  3ZIJ A;  1DUG A;  5HQP A;  1M2B A;  1R4W A;  4KSM A;  5ECN B;  2ALB A;  1K0B A;  4Q5F A;  1T4Y A;  1F6M C;  3TUE A;  2F3M A;  3PH9 A;  4DSR A;  1JZO A;  2YP6 A;  2HRF A;  2R4V A;  2BTO T;  1NSW A;  2YWI A;  4GSN A;  1OC9 A;  3IAS 2;  4XS4 A;  2V1M A;  1PX6 A;  2IN3 A;  4OWY A;  2ZUP A;  4EC0 A;  3KJY A;  1RK4 A;  4L5L A;  1M9B A;  2GQL A;  2R3X A;  1PGT A;  4YKG A;  5B8A A;  1SJ6 A;  1BYE A;  4HJM A;  2L5L A;  1EV9 A;  3C71 A;  3KCM A;  3EMX A;  3W8J A;  1JFU A;  4N30 A;  5D73 A;  5IIZ A;  1CQG A;  2LRN A;  3KTB A;  3UVH A;  2H6Y A;  3F63 A;  1GTI A;  1VRS D;  2NDO A;  1X0R A;  5J9C A;  2GVP A;  3VWU A;  5KOX A;  1X9W B;  4P3Y B;  2FD3 A;  6GSY A;  4EIQ A;  1URM A;  2E7P A;  2VAF A;  1FB6 A;  2X64 A;  1SU9 A;  3LEF A;  5J9B A;  3ZIT A;  4MJA A;  1ZYE A;  4ECB A;  2BJX A;  4MK3 A;  5G1K A;  3F9U A;  3TJK A;  3UAP A;  3BOA A;  1FVJ A;  2C3Q A;  2KUC A;  1N2A A;  4OCE A;  2I3Y A;  4ECC A;  3FZA A;  4XCS A;  5ECH B;  4HQS A;  1XBS A;  3U5R E;  17GS A;  5H5R A;  3MIX A;  4PUF C;  4BWS A;  2FLS A;  2OE3 A;  1SK0 A;  5ID2 A;  3Q6O A;  2HSY A;  3PPU A;  3KP9 A;  1K0M A;  3U6V A;  2O85 A;  1ZZY A;  4PQH A;  2LRT A;  1F37 A;  4TR3 A;  4D73 B;  1V9W A;  4H86 A;  1E6B A;  3SWL A;  4EDZ A;  2R0P A;  1FAA A;  5D93 A;  1W89 A;  3GSS A;  4ZXG A;  2C3T A;  3APO A;  4TR0 A;  1WIK A;  4O92 A;  1XOB A;  1J0F A;  1MD3 A;  1GSF A;  16GS A;  2PWJ A;  3HVS A;  3L0H A;  4X43 A;  4ILF A;  2F51 A;  2LRC A;  5KOW A;  3HD5 A;  2V32 A;  1V98 A;  1UN2 A;  5ECK B;  3W8S A;  3CYN A;  2XBQ A;  2HLS A;  2YCD A;  1AIU A;  5HR0 A;  4AGS A;  4X0X A;  3I9V 2;  3KGK A;  4EO3 A;  2AUV A;  4L5O A;  1T00 A;  2XPE A;  2FWF A;  3E9J B;  2GQK A;  3N9J A;  4PNG A;  2AV4 A;  4OD7 A;  2CV4 A;  3GH6 A;  4HS1 A;  2HZE A;  4BL7 B;  2KOK A;  2H6Z A;  2R5G A;  4IW9 A;  3I69 A;  4HQZ A;  4DEJ A;  2LTK A;  2B7J A;  1YKC A;  2LKU A;  4J2F A;  1YY7 A;  2LNS A;  1XIY A;  2RII A;  5ELA A;  1QUW A;  2GGT A;  4KH7 A;  3IHQ A;  4FYB A;  1B9Y C;  3IDV A;  1J9B A;  4K0G A;  2H71 A;  1DBY A;  5EL8 A;  5D9X A;  5A5K A;  4RUV A;  5IMD A;  1FB0 A;  1NHO A;  3IA1 A;  5G1L A;  2RM6 A;  3VPQ A;  4LL4 B;  1Z7P A;  1U87 A;  2P5R A;  2I9H A;  1SKW B;  1ZL9 A;  2B1K A;  2GT5 A;  2CAQ A;  2A2R A;  1QMV A;  1GUM A;  2B5X A;  1GTA A;  1U3I A;  2O87 A;  4Z2T A;  4GQF A;  2AJQ B;  2MYG A;  2WGR A;  4OFT A;  2TRC P;  2GDR A;  3H79 A;  3D21 A;  4HZ2 A;  3O3T A;  5F8B A;  4GCI A;  1SK1 A;  2IPA A;  1G6W A;  4K5S A;  1PD2 1;  3FR3 A;  3GKK A;  4HEA 2;  4G10 A;  4F0C A;  3P8W A;  4V2N A;  2O8V B;  3GHA A;  3P7X A;  4EVM A;  2H72 A;  2H6X A;  3ERW A;  2L57 A;  1VF3 A;  4NAX A;  1TW9 A;  5CAX A;  3O6T A;  4MJE A;  3GTU A;  2KLX A;  5HFG A;  2IMK A;  2GSQ A;  2IMD A;  1A8L A;  4ZL8 A;  4E8H A;  4MNN A;  5ABR A;  4ECI A;  3R3E A;  4YQM A;  5D8I A;  1GL8 A;  1OVN A;  5L71 A;  2CVK A;  2HZF A;  5IO0 A;  1XOA A;  1XCC A;  3CTF A;  2H1G A;  3QAW A;  3GUS A;  2H75 A;  4PQI A;  1U88 A;  1ZOF A;  2K8S A;  3GUR A;  1I5G A;  4KF9 A;  2ZCT A;  4OFN A;  4FO5 A;  5DQY A;  5E59 A;  5IPG A;  3EUR A;  4FYU A;  3ZMK A;  1TK5 B;  1XWK A;  2E2G A;  1FVK A;  5BMU A;  1SKS B;  3NOF A;  4TR4 A;  4YH2 A;  4K6X A;  3UOM A;  2GSR A;  3VLN A;  2MMN A;  1SJZ A;  2DJK A;  2RUF A;  5DAK B;  2HRN A;  5INY A;  3F8U A;  1LJR A;  3F4T A;  1YJ6 A;  1AUC A;  4HDE A;  2WDU A;  2NVL A;  3KEB A;  1THO A;  4NV2 A;  13GS A;  3IK7 A;  1WP0 A;  1EZK A;  4F0B A;  3ED3 A;  4L0W A;  1HD2 A;  1BED A;  4IS0 A;  5IMZ A;  2QGV A;  3QD9 A;  1PQN A;  1HQO A;  3H1N A;  2GZY A;  3DXB A;  3TRX A;  1ACV A;  2H1D A;  4I2U A;  1GLP A;  5CRG A;  4ZB8 A;  5GZZ B;  4WBR D;  1TRU A;  2H70 A;  3DD3 A;  5HFI A;  3HVN A;  3SBC A;  4ECJ A;  2CT6 A;  2WZ9 A;  4NWY A;  4QL9 A;  1Z6M A;  2NBS A;  2G0F A;  1R5A A;  1AW9 A;  2KHP A;  4MJC A;  3GN3 A;  5A4V A;  1JHB A;  1XWB A;  4OO5 A;  2EC4 A;  1THX A;  2M80 A;  2JSY A;  5FHI A;  3MYD A;  1HNA A;  11GS A;  3VUR A;  4OO4 A;  5F0G A;  3IAM 2;  1EEJ A;  1W4V A;  2P0G A;  3G7Y A;  4F9Z A;  1ILO A;  5HR3 A;  2YJ7 A;  2MBS A;  2PU9 C;  4N0V A;  2YWO A;  4WR5 A;  2YWM A;  5IMA A;  3I6A A;  4KND A;  1EGO A;  1A0F A;  1K0C A;  1HYU A;  1GSE A;  3DGQ A;  5HFK A;  5AN1 A;  1VGL A;  2C4J A;  4NMU A;  5DQS A;  3D4M A;  3F0I A;  3QAV A;  2V2G A;  3WD6 A;  1JLV A;  4MA9 A;  3GA4 A;  2DKI A;  5KN2 A;  3H4K A;  3APQ A;  2C0E A;  3DVW A;  3FR9 A;  2R0G A;  2DLX A;  1BG5 A;  3KZQ A;  4V2M A;  2HYX A;  2FA8 A;  2H0H A;  1ZYQ B;  4N11 A;  2FWG A;  1I9D A;  4QQ7 A;  1KTE A;  4YKF A;  4ML6 A;  4GST A;  3IRA A;  4L8E A;  4BVY A;  5ECM B;  14GS A;  3LGC A;  3QCP A;  3LWA A;  1MDI A;  4ID0 A;  5CNW A;  4FYC A;  2QA1 A;  2C8U A;  5DCH A;  4DSS B;  1Z3E A;  2QC7 A;  5DAL A;  1K0N A;  2VCX A;  3OR5 A;  3Q19 A;  2XC2 A;  1PKW A;  1PKZ A;  2VL9 A;  2VCZ A;  5IMF A;  4HSC X;  1B4Q A;  3GNJ A;  4OFM A;  5ECI B;  2CA8 A;  4NHW A;  3GKX A;  3LW9 A;  4HU9 A;  1YF0 A;  3GMF A;  3KH7 A;  2PUK C;  2PVQ A;  5ECO B;  3CTG A;  2WUL A;  5ID2 B;  2VLV A;  4TRX A;  3FK8 A;  4AF2 A;  2YNX A;  3ME7 A;  5B7C A;  4N0Z A;  2GT6 A;  4PNF A;  4Q5N A;  1GSS A;  4MZC A;  1Z5Y E;  4MF5 A;  2GZP A;  1R26 A;  3DWV A;  1GUK A;  4V1A g;  2X99 A;  2GLR A;  1TK0 B;  3FZ9 A;  1A23 A;  3LSZ A;  4AJ7 A;  4QL7 A;  3VFI A;  3HHV A;  4JE1 A;  5D9T A;  2JL4 A;  4F2I A;  3F6F A;  1A8Y A;  1MDK A;  3M9K A;  1F9M A;  3FZ5 A;  4EXJ A;  2YV9 A;  1FHE A;  2LV3 A;  3ZZX A;  1Y6E A;  2P5Q A;  1AQV A;  4FIW A;  4Q5R A;  5B6N A;  1V58 A;  4TN8 A;  3KP8 A;  1TJD A;  3EWL A;  3HKR A;  2R6K A;  2N5F A;  5JCU A;  1VF4 A;  1K3O A;  3GKN A;  2YN1 A;  2FUG 2;  1ZYN A;  2YPM A;  4AJ8 A;  3F4R A;  2C1Y A;  3A3T A;  1ST9 A;  3IPZ A;  4IVF A;  2H0I A;  1U6T A;  1SYX A;  3D5J A;  4MDC A;  3L4N A;  4IJ3 A;  3TCO A;  5DJL A;  1M9A A;  4HJ2 A;  1TDI A;  1OC8 A;  2YOI A;  5IPH A;  4IGJ A;  4GLT A;  3A2W A;  4DSQ A;  4WBJ A;  4CHS A;  3MSZ A;  1XW6 A;  1AQW A;  3UEM A;  3FHK A;  3ZFB A;  2VCQ A;  1KNG A;  5AGY A;  4CY6 A;  3BJ5 A;  3E3E A;  3TKR A;  5IO2 A;  1O81 A;  4TXO B;  1JZD A;  5E4W A;  4PTS A;  4F03 A;  4MPF A;  1PSQ A;  2OA7 A;  4IP6 A;  3BD2 A;  1G0T A;  1VF1 A;  2CVB A;  3G7I A;  1OAZ A;  4WEY A;  1AXD A;  3A2V A;  4XRD A;  3IXR A;  3IK9 A;  3QFA C;  1IYI A;  4PX1 A;  3RAZ A;  3CSI A;  5IOX A;  3HA9 A;  4CY8 A;  2VCT A;  4O32 A;  3ZYW A;  4ZBB A;  3CXG A;  1G6Y A;  3LXZ A;  3ME8 A;  2RLI A;  1M3J A;  5IM9 A;  4LA1 A;  4K7I A;  4A5P A;  5COH A;  1XVW A;  4WXT A;  4GSS A;  4K7O A;  5F06 A;  3VI7 A;  1WRY A;  2H19 A;  2MBT A;  1M2A A;  5LCZ A;  1M0U A;  2HRA A;  1DE1 A;  3HYP A;  10GS A;  2ON7 A;  3ZRE A;  3PIN A;  4ZIJ A;  2MMZ A;  3ZML A;  5KN3 A;  1X5C A;  1BJX A;  2TRX A;  4GXZ A;  3HDC A;  2HNL A;  2FCH A;  3AY8 A;  1BAY A;  4MJB A;  1ZMA A;  4MAB A;  5IQY A;  3QDN A;  3PR8 A;  1PMT A;  4G9H A;  3GX0 A;  3RBT A;  1R5P A;  2JAC A;  4ZB9 A;  3UVT A;  4PUR A;  3G9B A;  4Z2U A;  3WT2 A;  2DBC A;  4LLR A;  3HZ8 A;  4RQX A;  9GSS A;  2DJ1 A;  2HI7 A;  3M0F A;  5DCG A;  2PN8 A;  2AHE A;  4KDY A;  2J9H A;  3ZVJ A;  1XWG A;  1ERT A;  2DIZ A;  1S3R A;  5AIX A;  4WF5 A;  3GRX A;  3CMI A;  1V40 A;  3KMO A;  4NV5 A;  1DSB A;  2I81 A;  2OJL A;  1T1V A;  3ZRD A;  3TKS C;  3BCK A;  1PRX A;  1M7T A;  2L4Q A;  2DMM A;  2BMX A;  4IEL A;  1KEB A;  1T3B A;  3WGE A;  3L9S A;  1A2M A;  3LOR A;  3FW2 A;  5C04 A;  4RQR A;  4EUY A;  4K2D A; 
#chains in the Genus database with same CATH homology
 4HU7 A;  2H30 A;  4O5Q A;  3VWW A;  5G31 A;  1ERV A;  4AJ6 A;  4F82 A;  4Z2R A;  2LJK A;  1SJI A;  4V2L A;  3HVX A;  3EVI A;  4KE3 A;  3VI5 A;  1Y25 A;  2WRT A;  2YJH A;  1RW1 A;  3S9F A;  3HCZ A;  2FHE A;  2PVO C;  4BVX B;  4IP1 A;  1BX9 A;  5J41 A;  5AIS A;  1YQ1 A;  2P31 A;  2DSA A;  2OBI A;  2L4C A;  2PER A;  4KDU A;  2GST A;  2HE3 A;  2V41 A;  3D0Z A;  1TRV A;  2VIM A;  3GL3 A;  2JZS A;  1FOH A;  3A2X A;  4G0I A;  3F3R A;  1WE0 A;  4TR1 B;  19GS A;  2A4V A;  5ECQ B;  4WKW A;  1USB A;  3C8E A;  5CP1 A;  1SEN A;  3LG6 A;  1QK8 A;  2K18 A;  4ZBA A;  5ECR B;  4MCU A;  1BQ7 A;  5FWG A;  3CSJ A;  3RPP A;  4RI7 A;  4K7N A;  2HSM A;  2B3S A;  3WGD A;  1PA3 A;  3C1R A;  4WR4 A;  3TJB A;  4ZBD A;  2H1A A;  5HR2 A;  1TI3 A;  5F07 A;  3KD0 A;  4G0L A;  3KMN A;  2CVD A;  4BVY B;  2IFQ A;  3E0U A;  1A2J A;  3ZLP A;  2QKE A;  1AC1 A;  3IV4 A;  3L9U A;  4EIP A;  1GSU A;  2HXK A;  2WCI A;  3UMA A;  4TXV A;  3VK9 A;  5DAL B;  4KW6 A;  4IHU A;  6GSW A;  5KN0 A;  3UIW A;  1A0R P;  1Z6N A;  3UBK A;  3M8N A;  2GS3 A;  4XIH A;  3IR4 A;  3BBY A;  5C00 A;  3TKQ A;  2JSZ A;  2WJU A;  4HUA A;  2IL3 A;  3TKS E;  3CBU A;  3A5I A;  1TU7 A;  4J56 E;  3GX8 A;  2B5Y A;  1OE8 A;  1SK2 A;  3F4S A;  2VCW A;  1EEM A;  3DRN A;  1LU4 A;  2ZNM A;  3NIV A;  4PUA A;  4DVC A;  3IOS A;  2J23 A;  1F3A A;  5IOW A;  1K3Y A;  2LJA A;  1O8X A;  2N5B A;  3QPM A;  1TTZ A;  3QOU A;  2FGX A;  4YAP A;  4ZL7 A;  4JR4 A;  3DIE A;  3TRQ A;  2K6V A;  1B9X C;  3US3 A;  1SL1 B;  4Z7X A;  1ZGN A;  4KUN A;  2JU5 A;  1OC9 B;  4XS4 B;  3J7Y b;  2MMA A;  4LMV A;  2KP2 A;  2VLU A;  3O76 A;  3GYK A;  3EU3 A;  1QXH A;  1AQX A;  1CQH A;  3I43 A;  2F9S A;  4L0U A;  1XPV A;  1SL2 B;  2IME A;  2LEG A;  5LNK e;  1YKA A;  1X5D A;  2A2S A;  2B5E A;  2C0D A;  2LST A;  5G30 A;  3K8N A;  3CRU A;  4ULX A;  4ZL9 A;  3M1G A;  2L6C A;  4EDY A;  5DAK A;  2H01 A;  4KGI A;  2B6M A;  2GSS A;  2IMI A;  5LD0 A;  5BRT A;  2VUP A;  5G5E A;  1S3A A;  5EY6 A;  4NHZ A;  2VM2 A;  3L78 A;  4I2T A;  4ZB6 A;  3TOU A;  1M2D A;  2LNT A;  4I97 A;  1TRS A;  3WGX A;  1K3L A;  1OE7 A;  2YZH A;  4V1A p;  3EIN A;  3MNG A;  3ZL5 A;  2DJ3 A;  1SD9 A;  1G7O A;  7GSS A;  3W6G A;  1DE2 A;  1ML6 A;  2K9F A;  4KCE A;  3DYR A;  5GST A;  1G7E A;  5A4W A;  4IQA A;  1QGV A;  1MEK A;  3LFL A;  5D96 A;  1JLW A;  2HFD A;  3FEU A;  2VD1 A;  5G5F A;  2XPD A;  2X8C A;  3M3M A;  5G2Z A;  1NM3 A;  2CX3 A;  3TRP A;  5EPF A;  2M72 A;  1WPI A;  1EWX A;  1YDK A;  3DEX A;  4YQV A;  2IWT A;  3D22 A;  3P90 A;  1XXU A;  1SD8 A;  3C7M A;  1EOH A;  2PGT A;  1QQ2 A;  1MTC A;  3NZN A;  4RI6 A;  2HRK A;  5GAN D;  4IQ1 A;  4MLY A;  2OBK A;  2H8L A;  2LS5 A;  4MMM A;  1OC3 A;  1XFL A;  5GAP D;  2CQ9 A;  1EV4 A;  8GSS A;  5ECL B;  2LUS A;  4BPY A;  1N8J A;  3ERF A;  4O5U A;  3DML A;  2VL3 A;  4O7H A;  4KSO A;  4IKH A;  5ECP B;  1PX7 A;  2OKA A;  1XW9 A;  1UC7 A;  3GL5 A;  4MH3 A;  2EIO A;  2FY6 A;  1B8X A;  3QMX A;  2HZE B;  1GWC A;  1ABA A;  4EF0 A;  1GNW A;  2LJR A;  3DKS A;  2PPT A;  1JZW A;  3WYW A;  1K0D A;  4X4J A;  1O85 A;  6GST A;  3IBH A;  1Z9H A;  1SYR A;  3TJF A;  5CRH A;  4G2E A;  2GTU A;  1TKD B;  4TW5 A;  2ES7 A;  4ML1 A;  2YAN A;  1TRW A;  1WWJ A;  3UL3 A;  5FT3 A;  4DSS A;  2QSI A;  4BWQ A;  4WET A;  2CZ2 A;  2AB6 A;  4KX4 A;  1EP8 A;  3RHC A;  4OCF A;  1TXX A;  1GNE A;  3TKS A;  3GIX A;  2KP1 A;  1IYH A;  5CRW A;  3IHG A;  1GP1 A;  3H93 A;  3GST A;  2LQO A;  2UZ8 A;  4POB A;  2D2Z A;  3F6D A;  3HJO A;  1FO5 A;  2O7K A;  5DDL A;  1O7U A;  1UVZ A;  2DKH A;  4KCA A;  3J7Y k;  1C72 A;  5D9W A;  3GH9 A;  4MH2 A;  4KDX A;  22GS A;  3LJR A;  2H74 A;  2CX4 A;  1ERW A;  1J08 A;  3L9V A;  4YAV A;  1SL0 B;  1XZO A;  1Q98 A;  2Z9S A;  5CYY A;  1EGR A;  1V2A A;  3MWH A;  3GTU B;  2JZT A;  2AAW A;  3GFK A;  1GRX A;  1LBK A;  3LYP A;  5IMV A;  3FYG A;  1TI1 A;  1GTU A;  3HJP A;  2FWH A;  2IJY A;  4K2X A;  3TOT A;  3HVV A;  1EOG A;  3EU4 A;  2XBI A;  3TKP A;  2H73 A;  2OAC A;  1R7H A;  6GSU A;  3KXO A;  4CDO A;  4XS6 A;  3TJG A;  4FQU A;  2DJ0 A;  2HT9 A;  4K0N A;  2A2P A;  3CRT A;  1GLQ A;  2TIR A;  2GQM A;  1O8W A;  4MZB A;  1GSD A;  1F3B A;  2X8H A;  2OE1 A;  3RPN A;  4E8E A;  2CZ3 A;  3A5W A;  4MPG A;  1H4O A;  2DC5 A;  4PXO A;  2H66 A;  5ECS A;  1Z7R A;  1K0A A;  1TU8 A;  4IJI A;  2AYT A;  5JCG A;  1B48 A;  1MDJ A;  3CSH A;  1E2Y A;  2YZU A;  4MF6 A;  1OKD A;  4X1U A;  2YWN A;  1MD4 A;  2WFC A;  3GKM A;  1GSQ A;  5A4U A;  2IMF A;  1U3A A;  3HZ4 A;  4XHM A;  5ENU A;  3VWX A;  5D9V A;  5CRD A;  4OMV A;  2WB9 A;  1NHY A;  2IFQ B;  3EMP A;  4IBP A;  5J3R A;  3TB2 A;  4XS1 A;  3C73 A;  4XRA A;  1K0O A;  4POM A;  4EL1 A;  1OYJ A;  1QFN A;  3F3Q A;  1YEP A;  4JU5 A;  4K5R A;  2OAD A;  1XW5 A;  1GH2 A;  1X9S B;  2NPB A;  3LYK A;  4ZIL A;  2A4H A;  1GUL A;  3IE3 A;  1AAZ A;  3DVX A;  2DJ2 A;  2VL2 A;  5AIV A;  1H75 A;  4GTU A;  4Q5Q A;  2IIY A;  1M99 A;  4D73 A;  3LQ7 A;  2B1L A;  2GZZ A;  1FOV A;  3FR6 A;  5DVB A;  5GSS A;  4POK A;  4TXO A;  3V1W A;  4KAE A;  2FNO A;  2L6D A;  2X4A A;  5HR1 A;  1YF1 A;  4JRR A;  4FH8 A;  3RDW A;  1GUH A;  2MZC A;  3QFB C;  1OKT A;  1ON4 A;  3G7J A;  4POL A;  5JCW A;  3Q74 A;  5CO3 A;  4K1F A;  3QR6 A;  4TOP A;  5CRE A;  3ZFL A;  2E0Q A;  3MDK A;  1TP9 A;  4TKY A;  1S3D A;  4TVE A;  3P2A A;  4USS A;  3JCM L;  5F05 A;  2M46 A;  2PMT A;  1WJK A;  1WMJ A;  2VLT A;  4ACS A;  6GSV A;  3UJ1 A;  2VD0 A;  2HSH A;  2REM A;  4JZQ A;  1NW2 A;  2X49 A;  4J57 E;  2EIR A;  3FY7 A;  4BL7 A;  5JWR B;  5KN1 A;  3HY2 A;  4EKZ A;  2DIY A;  4K8M A;  3IC8 A;  3N5O A;  3M9J A;  1KBN A;  3FMW A;  3Q18 A;  4KA0 A;  3EC3 A;  3APS A;  4O5R A;  3RHB A;  3ZTL A;  1X9M B;  4ISD A;  2N5A A;  4GQC A;  4GF0 A;  3EPT A;  3IC4 A;  4EE0 A;  4G0K A;  5JWO B;  3ERG A;  5H5S A;  1X5E A;  1ZYP A;  3FZ4 A;  4GWR A;  3EYT A;  2DML A;  3H8Q A;  3ZVJ D;  4JED A;  1T4Z A;  1S3C A;  2ON5 A;  2C0F A;  3MAK A;  3TGZ A;  4HOJ A;  2R37 A;  2WS2 A;  4MZW A;  3UAR A;  2VL2 C;  3TDG A;  1TK8 B;  1XWA A;  2K8V A;  3VWV A;  5JWQ B;  4YQU A;  5KEJ A;  3R2Q A;  2H76 A;  3D6I A;  2JZR A;  3EE2 A;  1JZR A;  5IMC A;  1SKR B;  6GSS A;  2L59 A;  1A24 A;  2C80 A;  1VF2 A;  2G2Q A;  3QAG A;  4XTS A;  1A2L A;  4NPB A;  1FW1 A;  2R2J A;  1T7P B;  2FA4 A;  2I4A A;  2DJJ A;  20GS A;  3FKF A;  4WF4 A;  4HI7 A;  4LL1 B;  12GS A;  1TOF A;  4I6X A;  1ZCP A;  3UBL A;  4NXI A;  2F8F A;  4BVX A;  2E2M A;  2JAD A;  1WOU A;  2RUE A;  1UA5 A;  2X8G A;  3KM6 A;  5H5Q A;  3LXT A;  2C3N A;  2XHF A;  2YV7 A;  2VCV A;  1YZX A;  1FG4 A;  4TR1 A;  5DBQ A;  2VO4 A;  4PQ1 A;  4IN0 A;  1XWC A;  5ELG A;  1PN0 A;  4I5Q A;  1HNC A;  2RM5 A;  4GRF A;  4BA7 A;  5B6M A;  1O6J A;  2CAI A;  1EP7 A;  4MP4 A;  2R0C A;  3D4T A;  5J4U A;  4N10 A;  4PGT A;  1T8E B;  3HXS A;  2C0G A;  5DJM A;  1Q4J A;  4K9Z A;  2H1B A;  2I1U A;  1F2E A;  2V6K A;  4CW9 A;  18GS A;  1ERU A;  1GTB A;  3KTL A;  3WT1 A;  3KIJ A;  3FRC A;  4KB3 A;  3GV1 A;  1YEX A;  2QA2 A;  1PL1 A;  4LMW A;  1GSY A;  6GSX A;  3KH9 A;  3HJM A;  2FWE A;  2NTO A;  5B8B A;  4I8B A;  2O89 A;  1XVQ A;  5EVO A;  2H0G A;  3PGT A;  1HNB A;  4JR6 A;  2V6O A;  3C1S A;  3VPT A;  1V57 A;  4G19 A;  4HZ4 A;  2LQQ A;  2VOC A;  2MMO A;  2OE0 A;  2EIQ A;  2L5O A;  3BCI A;  4MF7 A;  4ICY A;  2B7K A;  4JBB A;  3TJJ A;  2VM1 A;  2F8A A;  2PBJ A;  5J5N A;  1B4P A;  1O73 A;  1PL2 A;  3ZIV A;  3ISO A;  1PN9 A;  1RQM A;  3ZIJ A;  1DUG A;  5HQP A;  1M2B A;  1R4W A;  4KSM A;  5ECN B;  2ALB A;  1K0B A;  4Q5F A;  1T4Y A;  1F6M C;  3TUE A;  2F3M A;  3PH9 A;  4DSR A;  1JZO A;  2YP6 A;  2HRF A;  2R4V A;  2BTO T;  1NSW A;  2YWI A;  4GSN A;  1OC9 A;  3IAS 2;  4XS4 A;  2V1M A;  1PX6 A;  2IN3 A;  4OWY A;  2ZUP A;  4EC0 A;  3KJY A;  1RK4 A;  4L5L A;  1M9B A;  2GQL A;  2R3X A;  1PGT A;  4YKG A;  5B8A A;  1SJ6 A;  1BYE A;  4HJM A;  2L5L A;  1EV9 A;  3C71 A;  3KCM A;  3EMX A;  3W8J A;  1JFU A;  4N30 A;  5D73 A;  5IIZ A;  1CQG A;  2LRN A;  3KTB A;  3UVH A;  2H6Y A;  3F63 A;  1GTI A;  1VRS D;  2NDO A;  1X0R A;  5J9C A;  2GVP A;  3VWU A;  5KOX A;  1X9W B;  4P3Y B;  2FD3 A;  6GSY A;  4EIQ A;  1URM A;  2E7P A;  2VAF A;  1FB6 A;  2X64 A;  1SU9 A;  3LEF A;  5J9B A;  3ZIT A;  4MJA A;  1ZYE A;  4ECB A;  2BJX A;  4MK3 A;  5G1K A;  3F9U A;  3TJK A;  3UAP A;  3BOA A;  1FVJ A;  2C3Q A;  2KUC A;  1N2A A;  4OCE A;  2I3Y A;  4ECC A;  3FZA A;  4XCS A;  5ECH B;  4HQS A;  1XBS A;  3U5R E;  17GS A;  5H5R A;  3MIX A;  4PUF C;  4BWS A;  2FLS A;  2OE3 A;  1SK0 A;  5ID2 A;  3Q6O A;  2HSY A;  3PPU A;  3KP9 A;  1K0M A;  3U6V A;  2O85 A;  1ZZY A;  4PQH A;  2LRT A;  1F37 A;  4TR3 A;  4D73 B;  1V9W A;  4H86 A;  1E6B A;  3SWL A;  4EDZ A;  2R0P A;  1FAA A;  5D93 A;  1W89 A;  3GSS A;  4ZXG A;  2C3T A;  3APO A;  4TR0 A;  1WIK A;  4O92 A;  1XOB A;  1J0F A;  1MD3 A;  1GSF A;  16GS A;  2PWJ A;  3HVS A;  3L0H A;  4X43 A;  4ILF A;  2F51 A;  2LRC A;  5KOW A;  3HD5 A;  2V32 A;  1V98 A;  1UN2 A;  5ECK B;  3W8S A;  3CYN A;  2XBQ A;  2HLS A;  2YCD A;  1AIU A;  5HR0 A;  4AGS A;  4X0X A;  3I9V 2;  3KGK A;  4EO3 A;  2AUV A;  4L5O A;  1T00 A;  2XPE A;  2FWF A;  3E9J B;  2GQK A;  3N9J A;  4PNG A;  2AV4 A;  4OD7 A;  2CV4 A;  3GH6 A;  4HS1 A;  2HZE A;  4BL7 B;  2KOK A;  2H6Z A;  2R5G A;  4IW9 A;  3I69 A;  4HQZ A;  4DEJ A;  2LTK A;  2B7J A;  1YKC A;  2LKU A;  4J2F A;  1YY7 A;  2LNS A;  1XIY A;  2RII A;  5ELA A;  1QUW A;  2GGT A;  4KH7 A;  3IHQ A;  4FYB A;  1B9Y C;  3IDV A;  1J9B A;  4K0G A;  2H71 A;  1DBY A;  5EL8 A;  5D9X A;  5A5K A;  4RUV A;  5IMD A;  1FB0 A;  1NHO A;  3IA1 A;  5G1L A;  2RM6 A;  3VPQ A;  4LL4 B;  1Z7P A;  1U87 A;  2P5R A;  2I9H A;  1SKW B;  1ZL9 A;  2B1K A;  2GT5 A;  2CAQ A;  2A2R A;  1QMV A;  1GUM A;  2B5X A;  1GTA A;  1U3I A;  2O87 A;  4Z2T A;  4GQF A;  2AJQ B;  2MYG A;  2WGR A;  4OFT A;  2TRC P;  2GDR A;  3H79 A;  3D21 A;  4HZ2 A;  3O3T A;  5F8B A;  4GCI A;  1SK1 A;  2IPA A;  1G6W A;  4K5S A;  1PD2 1;  3FR3 A;  3GKK A;  4HEA 2;  4G10 A;  4F0C A;  3P8W A;  4V2N A;  2O8V B;  3GHA A;  3P7X A;  4EVM A;  2H72 A;  2H6X A;  3ERW A;  2L57 A;  1VF3 A;  4NAX A;  1TW9 A;  5CAX A;  3O6T A;  4MJE A;  3GTU A;  2KLX A;  5HFG A;  2IMK A;  2GSQ A;  2IMD A;  1A8L A;  4ZL8 A;  4E8H A;  4MNN A;  5ABR A;  4ECI A;  3R3E A;  4YQM A;  5D8I A;  1GL8 A;  1OVN A;  5L71 A;  2CVK A;  2HZF A;  5IO0 A;  1XOA A;  1XCC A;  3CTF A;  2H1G A;  3QAW A;  3GUS A;  2H75 A;  4PQI A;  1U88 A;  1ZOF A;  2K8S A;  3GUR A;  1I5G A;  4KF9 A;  2ZCT A;  4OFN A;  4FO5 A;  5DQY A;  5E59 A;  5IPG A;  3EUR A;  4FYU A;  3ZMK A;  1TK5 B;  1XWK A;  2E2G A;  1FVK A;  5BMU A;  1SKS B;  3NOF A;  4TR4 A;  4YH2 A;  4K6X A;  3UOM A;  2GSR A;  3VLN A;  2MMN A;  1SJZ A;  2DJK A;  2RUF A;  5DAK B;  2HRN A;  5INY A;  3F8U A;  1LJR A;  3F4T A;  1YJ6 A;  1AUC A;  4HDE A;  2WDU A;  2NVL A;  3KEB A;  1THO A;  4NV2 A;  13GS A;  3IK7 A;  1WP0 A;  1EZK A;  4F0B A;  3ED3 A;  4L0W A;  1HD2 A;  1BED A;  4IS0 A;  5IMZ A;  2QGV A;  3QD9 A;  1PQN A;  1HQO A;  3H1N A;  2GZY A;  3DXB A;  3TRX A;  1ACV A;  2H1D A;  4I2U A;  1GLP A;  5CRG A;  4ZB8 A;  5GZZ B;  4WBR D;  1TRU A;  2H70 A;  3DD3 A;  5HFI A;  3SBC A;  4ECJ A;  2CT6 A;  2WZ9 A;  4NWY A;  4QL9 A;  1Z6M A;  2NBS A;  2G0F A;  1R5A A;  1AW9 A;  2KHP A;  4MJC A;  3GN3 A;  5A4V A;  1JHB A;  1XWB A;  4OO5 A;  2EC4 A;  1THX A;  2M80 A;  2JSY A;  5FHI A;  3MYD A;  1HNA A;  11GS A;  3VUR A;  4OO4 A;  5F0G A;  3IAM 2;  1EEJ A;  1W4V A;  2P0G A;  3G7Y A;  4F9Z A;  1ILO A;  5HR3 A;  2YJ7 A;  2MBS A;  2PU9 C;  4N0V A;  2YWO A;  4WR5 A;  2YWM A;  5IMA A;  3I6A A;  4KND A;  1EGO A;  1A0F A;  1K0C A;  1HYU A;  1GSE A;  3DGQ A;  5HFK A;  5AN1 A;  1VGL A;  2C4J A;  4NMU A;  5DQS A;  3D4M A;  3F0I A;  3QAV A;  2V2G A;  3WD6 A;  1JLV A;  4MA9 A;  3GA4 A;  2DKI A;  5KN2 A;  3H4K A;  3APQ A;  2C0E A;  3DVW A;  3FR9 A;  2R0G A;  2DLX A;  1BG5 A;  3KZQ A;  4V2M A;  2HYX A;  2FA8 A;  2H0H A;  1ZYQ B;  4N11 A;  2FWG A;  1I9D A;  4QQ7 A;  1KTE A;  4YKF A;  4ML6 A;  4GST A;  3IRA A;  4L8E A;  4BVY A;  5ECM B;  14GS A;  3LGC A;  3QCP A;  3LWA A;  1MDI A;  4ID0 A;  5CNW A;  4FYC A;  2QA1 A;  2C8U A;  5DCH A;  4DSS B;  1Z3E A;  2QC7 A;  5DAL A;  1K0N A;  2VCX A;  3OR5 A;  3Q19 A;  2XC2 A;  1PKW A;  1PKZ A;  2VL9 A;  2VCZ A;  5IMF A;  1B4Q A;  3GNJ A;  4OFM A;  5ECI B;  2CA8 A;  4NHW A;  3GKX A;  3LW9 A;  4HU9 A;  1YF0 A;  3GMF A;  3KH7 A;  2PUK C;  2PVQ A;  5ECO B;  3CTG A;  2WUL A;  5ID2 B;  2VLV A;  4TRX A;  3FK8 A;  4AF2 A;  2YNX A;  3ME7 A;  5B7C A;  4N0Z A;  2GT6 A;  4PNF A;  4Q5N A;  1GSS A;  4MZC A;  1Z5Y E;  4MF5 A;  2GZP A;  1R26 A;  3DWV A;  1GUK A;  4V1A g;  2X99 A;  2GLR A;  1TK0 B;  3FZ9 A;  1A23 A;  3LSZ A;  4AJ7 A;  4QL7 A;  3VFI A;  3HHV A;  4JE1 A;  5D9T A;  2JL4 A;  4F2I A;  3F6F A;  1A8Y A;  1MDK A;  3M9K A;  1F9M A;  3FZ5 A;  4EXJ A;  2YV9 A;  1FHE A;  2LV3 A;  3ZZX A;  1Y6E A;  2P5Q A;  1AQV A;  4FIW A;  4Q5R A;  5B6N A;  1V58 A;  4TN8 A;  3KP8 A;  1TJD A;  3EWL A;  3HKR A;  2R6K A;  2N5F A;  5JCU A;  1VF4 A;  1K3O A;  3GKN A;  2YN1 A;  2FUG 2;  1ZYN A;  2YPM A;  4AJ8 A;  3F4R A;  2C1Y A;  3A3T A;  1ST9 A;  3IPZ A;  4IVF A;  2H0I A;  1U6T A;  1SYX A;  3D5J A;  4MDC A;  3L4N A;  4IJ3 A;  3TCO A;  5DJL A;  1M9A A;  4HJ2 A;  1TDI A;  1OC8 A;  2YOI A;  5IPH A;  4IGJ A;  4GLT A;  3A2W A;  4DSQ A;  4WBJ A;  4CHS A;  3MSZ A;  1XW6 A;  1AQW A;  3UEM A;  3FHK A;  3ZFB A;  2VCQ A;  1KNG A;  5AGY A;  4CY6 A;  3BJ5 A;  3E3E A;  3TKR A;  5IO2 A;  1O81 A;  4TXO B;  1JZD A;  5E4W A;  4PTS A;  4F03 A;  4MPF A;  1PSQ A;  2OA7 A;  4IP6 A;  3BD2 A;  1G0T A;  1VF1 A;  2CVB A;  3G7I A;  1OAZ A;  4WEY A;  1AXD A;  3A2V A;  4XRD A;  3IXR A;  3IK9 A;  3QFA C;  1IYI A;  4PX1 A;  3RAZ A;  3CSI A;  5IOX A;  3HA9 A;  4CY8 A;  2VCT A;  4O32 A;  3ZYW A;  4ZBB A;  3CXG A;  1G6Y A;  3LXZ A;  3ME8 A;  2RLI A;  5IM9 A;  4LA1 A;  4K7I A;  4A5P A;  5COH A;  1XVW A;  4WXT A;  4GSS A;  4K7O A;  5F06 A;  3VI7 A;  1WRY A;  2H19 A;  2MBT A;  1M2A A;  5LCZ A;  1M0U A;  2HRA A;  1DE1 A;  3HYP A;  10GS A;  2ON7 A;  3ZRE A;  3PIN A;  4ZIJ A;  2MMZ A;  3ZML A;  5KN3 A;  1X5C A;  1BJX A;  2TRX A;  4GXZ A;  3HDC A;  2HNL A;  2FCH A;  3AY8 A;  1BAY A;  4MJB A;  1ZMA A;  4MAB A;  5IQY A;  3QDN A;  3PR8 A;  1PMT A;  4G9H A;  3GX0 A;  3RBT A;  1R5P A;  2JAC A;  4ZB9 A;  3UVT A;  4PUR A;  3G9B A;  4Z2U A;  3WT2 A;  2DBC A;  4LLR A;  3HZ8 A;  4RQX A;  9GSS A;  2DJ1 A;  2HI7 A;  3M0F A;  5DCG A;  2PN8 A;  2AHE A;  4KDY A;  2J9H A;  3ZVJ A;  1XWG A;  1ERT A;  2DIZ A;  5AIX A;  4WF5 A;  3GRX A;  3CMI A;  1V40 A;  3KMO A;  4NV5 A;  1DSB A;  2I81 A;  2OJL A;  1T1V A;  3ZRD A;  3TKS C;  3BCK A;  1PRX A;  1M7T A;  2L4Q A;  2DMM A;  2BMX A;  4IEL A;  1KEB A;  1T3B A;  3WGE A;  3L9S A;  1A2M A;  3LOR A;  3FW2 A;  5C04 A;  4RQR A;  4EUY A;  4K2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...