1SKWB

Binary 3' complex of t7 dna polymerase with a dna primer/template containing a disordered cis-syn thymine dimer on the template
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*C*GP*GP*CP*CP*AP*GP*TP*GP*C
publication title Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase/electron transport/dna
total genus 30
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1skwB00
4RI7A 4YQUA 3ERWA 1LBKA 1XOBA 3FR6A 2WZ9A 1ABAA 4KCEA 4KDXA 4ECBA 2RLIA 4DSRA 2C3QA 2LS5A 4RQXA 5IMFA 2MBSA 5ECRB 1S3AA 4DSSB 4WF4A 3D6IA 1T7PB 4HQZA 2NTOA 4KA0A 3RBTA 3HA9A 2AV4A 5E59A 1CQGA 3O3TA 3LEFA 2H0HA 1WJKA 4FH8A 1B48A 1ACVA 2KOKA 1ZGNA 2B7KA 3IV4A 2LJKA 5F06A 4N10A 3KCMA 1SK1A 1TTZA 3C71A 4I8BA 4HEA2 5CAXA 5B8AA 3W8SA 2IMIA 1H75A 3A5WA 2J9HA 5CRGA 4ZBAA 1SK2A 3CTFA 4I5QA 5KEJA 4FYCA 2EIOA 5G1KA 3RPNA 2CV4A 1M99A 1JZWA 1I9DA 4EDZA 3F4TA 4IP1A 1J0FA 5G5FA 3ZITA 5GAND 4ECCA 2VIMA 3GV1A 1WOUA 3FHKA 4JEDA 2BMXA 1K3YA 5ENUA 1JZDA 3E3EA 3R2QA 1EGOA 1WMJA 3GKMA 4ML1A 3VI7A 1K0MA 3VK9A 5KN0A 6GSVA 4KSOA 4MF6A 1YKAA 4PUFC 5DJLA 1K0OA 4BVYA 20GSA 3A3TA 1NW2A 3QMXA 5GSTA 2PVQA 2AUVA 3HVVA 2GZZA 2CVBA 3MNGA 5F05A 1YJ6A 2CAIA 5IMAA 1QXHA 1FW1A 2XBQA 3WGXA 5DVBA 3DXBA 2GLRA 3D22A 4MJBA 4KB3A 1TK8B 3HVSA 1S3DA 2FA4A 4KDUA 13GSA 1XXUA 3RPPA 4LA1A 2XHFA 3TDGA 1EEMA 1YQ1A 5EL8A 2B3SA 1K3LA 3GKKA 5AIVA 3P8WA 3LYKA 1KEBA 1MDIA 1Z7RA 1ZZYA 2VLTA 2LNSA 2PERA 2K8VA 4G10A 3ZREA 5DQSA 4MF5A 4QQ7A 3FY7A 2V41A 1YF1A 3HKRA 1PRXA 4IHUA 2AHEA 4ECJA 6GSTA 3QDNA 4HU7A 3L78A 3C8EA 1BYEA 5HR0A 2JU5A 3O76A 4TVEA 5DCGA 4RI6A 3GH6A 3GN3A 1LU4A 3UL3A 1TRVA 4XRDA 1MDJA 1VF1A 3G9BA 3LYPA 2FY6A 2GDRA 5KN2A 2V2GA 5KN1A 4V2MA 3ZZXA 2CX4A 2O85A 1T1VA 2VAFA 1HQOA 3H93A 1GH2A 3GFKA 4IELA 1AQVA 2C1YA 2EIRA 2GT5A 3BBYA 3PR8A 4DEJA 12GSA 5CRDA 2GSRA 2V6KA 2G2QA 2H72A 1SL1B 4EC0A 4BL7A 2QSIA 5GZZB 3ZLPA 1GULA 3KJYA 3RAZA 1VGLA 3PH9A 3GHAA 1GTBA 4FIWA 1G0TA 5GSSA 1GSUA 2C3TA 1ZL9A 4MJAA 4MPFA 1NSWA 4IVFA 2F8FA 2GGTA 1GUHA 1QFNA 2VCVA 2PN8A 3HHVA 2J23A 2PMTA 2F51A 4KAEA 4L5OA 2OBIA 2V6OA 3U6VA 3DEXA 1XFLA 1BEDA 3VWUA 4HS1A 1A8YA 1TRUA 3D21A 4NHWA 5HFKA 3HDCA 3VWWA 5DALA 3US3A 4ULXA 4ZBDA 2JZRA 5DAKB 3EINA 5ABRA 3FZAA 1FOVA 4Q5RA 3ERFA 5J41A 2H8LA 6GSUA 2JZTA 3H79A 1XVQA 2CVKA 3GKNA 2JADA 5J4UA 5FWGA 2LQOA 3KH7A 17GSA 3KD0A 2FNOA 3F3RA 2I4AA 5AIXA 3QAVA 1X9SB 4E8HA 5DALB 2WRTA 4IKHA 4HU9A 4EDYA 4Z7XA 3FW2A 3LWAA 2DJ3A 3IDVA 5HFIA 5KN3A 1XWCA 1RK4A 1Z7PA 2C0GA 3ED3A 2O7KA 3F4RA 5J9CA 1SJIA 3RHBA 5B6MA 2B1LA 3BD2A 3TUEA 2KHPA 3FEUA 2B6MA 2MMOA 4LMWA 2KP1A 5ECOB 4ML6A 2HRFA 4O5RA 3HYPA 5CO3A 2O8VB 1SYRA 2GTUA 1EOGA 1SD9A 1TRSA 3QAGA 2X8GA 4IJIA 3Q74A 3VFIA 3IAS2 3QFAC 1WRYA 3P7XA 2ES7A 5D93A 3HCZA 2IN3A 2CT6A 3LFLA 3TKSE 1XOAA 2YV7A 1OC9A 3WT1A 1TKDB 3ZIVA 2RUFA 2H01A 3E0UA 3TOTA 3Q19A 1JLWA 4HUAA 1R5PA 2IFQA 4CW9A 3M0FA 1SK0A 2MZCA 1PL2A 5LCZA 3FR9A 5B8BA 1XWAA 3I69A 1C72A 2YWMA 3CBUA 1V9WA 4HJ2A 4RUVA 3FZ9A 4LL4B 5IOXA 1A2MA 4G9HA 3DKSA 1OC9B 1PN9A 2DJKA 4L5LA 1K0CA 4EF0A 1H4OA 2WB9A 3IK9A 2IFQB 4TR4A 1A24A 1K0NA 1SKWB 2LQQA 2YCDA 4OD7A 2NVLA 2AJQB 3BJ5A 4XS6A 1SU9A 2IIYA 3LJRA 5G2ZA 3FRCA 1DE2A 2MMAA 3A2WA 1AC1A 1G6WA 1O85A 2IMFA 5IMVA 4IGJA 5HFGA 2H1AA 5HR3A 1CQHA 3TGZA 2OBKA 2H73A 1JZRA 3DVXA 4HI7A 5JWOB 2XBIA 4TW5A 1V98A 8GSSA 1Z5YE 1WWJA 1X5DA 3CYNA 3IK7A 3Q18A 2YPMA 2JSZA 1O8XA 2RIIA 1X0RA 2A2SA 1Z9HA 1G6YA 2GQLA 4X43A 4BPYA 1TI3A 5IM9A 4MA9A 3ZVJA 2YOIA 4POKA 2QGVA 1THXA 2LNTA 2BTOT 2HE3A 4O92A 2YZUA 2HFDA 5G31A 1GSEA 4ISDA 3IC4A 4ZL7A 2H75A 3C73A 1A0FA 4NPBA 4OO4A 1U87A 3NZNA 2H71A 4KSMA 3GX8A 2YWOA 4PQHA 4JBBA 4HZ2A 3GSTA 4QL9A 1B4PA 4AJ6A 3QR6A 3ZFBA 4N0VA 4GSSA 5EY6A 4MDCA 1OYJA 3HVXA 3UBKA 2F3MA 5CREA 2VM2A 3H1NA 5JCGA 1XVWA 4YAVA 1M2AA 4IW9A 4XTSA 2TRCP 4ZL8A 1SKRB 2TRXA 5F07A 1VRSD 4TXVA 1RW1A 1ZYQB 2YJ7A 4Q5NA 4ZBBA 1JHBA 5D73A 3UOMA 1FO5A 3QCPA 2K6VA 4K7NA 2N5FA 2FHEA 4MZBA 2HLSA 1FB6A 3GA4A 2E2GA 3QOUA 4N11A 5D9VA 2WCIA 4GQFA 4JR6A 3WGDA 3CRUA 3KTBA 3E9JB 1O81A 4ZB9A 2B7JA 2HYXA 4NXIA 2LRCA 5EPFA 1QGVA 4KDYA 2JSYA 2X99A 4I6XA 4O7HA 5L71A 1PX7A 3EYTA 5ECMB 3FZ5A 3KH9A 3EU3A 1MTCA 5DCHA 1VF2A 1LJRA 5D96A 4I97A 3OR5A 1VF4A 1K3OA 1X5EA 1A2LA 1OC3A 1PKWA 4V2LA 1TK0B 1ON4A 3ZMLA 4NV5A 2YWNA 1J9BA 1Y25A 3ME7A 4IS0A 3I43A 2I9HA 1M2BA 2LSTA 4TR0A 1G7OA 1M0UA 4KE3A 2M46A 2TIRA 3F9UA 4MPGA 3CTGA 1HD2A 1M9AA 3ZMKA 1XWBA 1AW9A 2X64A 3N5OA 3A2XA 2I81A 4JZQA 3GIXA 2PGTA 4J2FA 4OFTA 5DDLA 3C1RA 3ME8A 2H6ZA 4YQMA 1GNWA 2OACA 2FWFA 2C0FA 1RQMA 2ZUPA 2NBSA 3ZL5A 1ZMAA 3VURA 1G7EA 4BA7A 1TP9A 2R5GA 5AISA 3C1SA 5ECHB 2F9SA 3TJGA 2QC7A 4DSQA 4POBA 4BWSA 4OWYA 3UVHA 4TN8A 3F6DA 2LRNA 3FKFA 2H6XA 1B9YC 2LKUA 1TW9A 4ILFA 1SKSB 3TOUA 1YDKA 2DSAA 1UA5A 3ZVJD 3DD3A 2H0IA 4GQCA 6GSWA 1A23A 2VO4A 3D0ZA 4HOJA 5EVOA 5ECNB 2GT6A 2V1MA 2QKEA 2YWIA 1BJXA 2H1BA 2JACA 1EWXA 4IJ3A 4GSNA 3UVTA 5H5RA 1OKDA 4PGTA 7GSSA 1GL8A 3F0IA 2LJAA 2GSSA 4TRXA 4H86A 5D9XA 4WBJA 1F3AA 5AGYA 1AXDA 2G0FA 4YAPA 2YZHA 2VCXA 4QL7A 2DLXA 2IMKA 3KEBA 5A4UA 1I5GA 1NHOA 1S3CA 2R6KA 5DJMA 3M9JA 4F0CA 3G7JA 4ECIA 4TKYA 2H1GA 3F3QA 5F0GA 3UBLA 1HYUA 4K1FA 1T00A 4AJ8A 5G5EA 3DGQA 1SL2B 5DQYA 1NHYA 4F82A 2LJRA 2VCTA 5HQPA 5JCUA 3EWLA 2K8SA 1OE8A 4RQRA 4K6XA 1YEPA 2ZNMA 5CNWA 5COHA 5G30A 5ID2A 3MSZA 2VLUA 2VCWA 4L0UA 2C3NA 1A2JA 5H5SA 1U6TA 2C0EA 3APSA 3HJPA 1F6MC 2LEGA 4PQIA 2HRNA 1EEJA 3M8NA 3EU4A 2KLXA 4IQ1A 4WF5A 1PQNA 2L6CA 3LQ7A 4JU5A 2NDOA 1TRWA 4NAXA 1ST9A 3IRAA 2X8HA 2C80A 4WETA 5G1LA 3D4TA 4D73A 3TRQA 3GTUA 4OCFA 2R2JA 3CSIA 3NIVA 2XC2A 2A2RA 3GMFA 1SJZA 3IPZA 1GSDA 5CP1A 2HT9A 1TU7A 5FT3A 2R4VA 2HI7A 3TJFA 1VF3A 1MEKA 2E0QA 2K9FA 1K0AA 3JCML 3DWVA 2V32A 5IMDA 2PU9C 4FYBA 4FYUA 3F8UA 3K8NA 1YZXA 6GSYA 5HR2A 11GSA 3L9VA 1TU8A 1U3IA 2O87A 3WD6A 2F8AA 2GQMA 3TJKA 1N2AA 3GTUB 3KP8A 3J7Yk 1HNCA 3TJJA 5B7CA 3LORA 4PURA 2E2MA 2H30A 2VL9A 4GLTA 1O7UA 10GSA 5INYA 4F2IA 3MAKA 4MCUA 2YANA 3Q6OA 1T3BA 3M9KA 4PQ1A 5CYYA 4PUAA 1UVZA 3IHQA 4NMUA 3IXRA 2KP2A 1R4WA 2GS3A 2EC4A 1B9XC 3UJ1A 2B5XA 4EL1A 4TR3A 2PWJA 1JFUA 1MD4A 4MZWA 3DIEA 2REMA 3TCOA 1FB0A 3VPTA 4PNGA 1SL0B 2H74A 2L5OA 3MDKA 2LRTA 4OMVA 2ALBA 2VD1A 1GSFA 1XCCA 3TKSC 1OAZA 4HZ4A 3KTLA 3EE2A 1XW5A 4AGSA 2N5BA 2AB6A 5J3RA 5A4VA 3IOSA 4NHZA 2L4CA 5F8BA 4AF2A 3UIWA 3M3MA 1AQWA 4GRFA 1Z6NA 1TDIA 4EVMA 2DJ2A 1OVNA 3TRPA 4MZCA 1T4ZA 4GCIA 3C7MA 4POMA 2FA8A 2WFCA 5C00A 2LV3A 1DBYA 3KZQA 4MK3A 3VLNA 2VCZA 1W89A 2XPEA 2VCQA 2P5QA 2MMZA 5D9TA 2DMLA 2M72A 3ISOA 4GXZA 1A8LA 2H1DA 5ECSA 1V2AA 1O8WA 3GL3A 1DE1A 1M2DA 2IPAA 3GL5A 2IWTA 4ZL9A 3CRTA 2CA8A 4KCAA 1NM3A 2GZPA 3S9FA 3LSZA 4OCEA 1XPVA 3F4SA 1YF0A 2CQ9A 1OC8A 2DBCA 4J57E 2YJHA 2DMMA 2VD0A 1T8EB 5B6NA 1XW6A 1XIYA 4GWRA 4V1Ap 3BCIA 2YP6A 4OO5A 1ZCPA 3GUSA 1R26A 1GLQA 2WJUA 4LLRA 1Q4JA 3GNJA 2H76A 3L9SA 4F0BA 2H6YA 4K7IA 4GF0A 4DSSA 3VPQA 2MMNA 2H19A 4GTUA 1SYXA 2E7PA 2WS2A 1GSYA 3IA1A 2I1UA 1J08A 2MBTA 2IMDA 2H0GA 4KW6A 2VL2C 5FHIA 4JE1A 4MJEA 3ZFLA 5LD0A 3MWHA 3KGKA 1WE0A 3RDWA 4CDOA 4I2TA 3GH9A 1F9MA 2HSHA 4ZB8A 5IIZA 2D2ZA 2Z9SA 1F37A 3O6TA 3FYGA 3LG6A 1QK8A 3CXGA 4F03A 5CRWA 3EC3A 3I6AA 3L0HA 1TK5B 3TKRA 1O6JA 3ZTLA 1A0RP 1SD8A 4ZILA 1BAYA 2O89A 1ZOFA 5IPGA 4ZB6A 4WR5A 1ERUA 1U3AA 5DBQA 3UAPA 1ILOA 2L5LA 5ECLB 4FO5A 1W4VA 3TKPA 1EV4A 3G7IA 2FGXA 4XHMA 5IQYA 3UEMA 2PBJA 2FWEA 2LTKA 5IOWA 2B1KA 3WT2A 2CZ2A 3CSHA 5ECQB 4XS4A 4HJMA 1PSQA 3DRNA 2ZCTA 4MABA 4K9ZA 4N30A 1EZKA 2HXKA 1MDKA 4G2EA 4X1UA 1FVKA 4XCSA 2GZYA 2L4QA 1R7HA 3TRXA 4ACSA 3HY2A 2N5AA 1V57A 3D5JA 4WBRD 3IAM2 2RM6A 1FAAA 1ERVA 1XW9A 5JWRB 1PL1A 4XS4B 3LGCA 3L4NA 9GSSA 1AQXA 4BVXA 1U88A 2PUKC 2JL4A 2WDUA 3LXZA 5E4WA 3U5RE 2OE1A 4NWYA 1GUKA 1USBA 14GSA 1M9BA 2C0DA 3TKSA 1AUCA 1XWGA 1KBNA 1FG4A 1PMTA 2A4VA 1AIUA 16GSA 3UMAA 1R5AA 2FWGA 2CZ3A 1GSSA 1FHEA 4MF7A 4G19A 1F3BA 4HDEA 1WPIA 3HZ4A 3D4MA 2MYGA 2P31A 1GTUA 1FVJA 2DIZA 3UARA 4WEYA 4LMVA 3J7Yb 2FUG2 4KUNA 5LNKe 4KNDA 1K0BA 4V1Ag 1YEXA 2ON7A 1DUGA 1TOFA 3P2AA 4X0XA 3LXTA 4EO3A 2HSYA 1ZYEA 1XBSA 5ELAA 1BX9A 1Z6MA 2LUSA 1DSBA 1V58A 4WR4A 2AAWA 2OA7A 4EE0A 5A4WA 2B5EA 2OADA 4WKWA 3V1WA 4MLYA 1IYHA 1TXXA 2OE3A 2VM1A 5J9BA 3GYKA 3KMNA 2R37A 2GSQA 2DC5A 1BQ7A 2R3XA 2B5YA 1K0DA 3GRXA 4MJCA 4XRAA 4DVCA 1B8XA 4NV2A 1M7TA 4YQVA 3KM6A 4PXOA 3F63A 4WXTA 4V2NA 3CSJA 1MD3A 3DVWA 5AN1A 5A5KA 4MH3A 22GSA 3EMXA 4ZXGA 3N9JA 1X9MB 1IYIA 5ECIB 3EMPA 5J5NA 1GWCA 2DJ1A 3PINA 4BWQA 2DJJA 2C8UA 5ECKB 1B4QA 4TR1A 4K0GA 1V40A 5D8IA 1OE7A 3VI5A 2XPDA 2VL2A 2OJLA 4XIHA 2HZFA 4K2DA 1ERTA 3HJOA 5GAPD 2IMEA 4PX1A 5DAKA 4IN0A 4EKZA 4I2UA 1WIKA 1O73A 3FK8A 3CMIA 3NOFA 1EOHA 1UN2A 3KP9A 2FWHA 3EVIA 3P90A 4TR1B 3A2VA 3TKQA 3HXSA 4HQSA 2NPBA 4JRRA 5ID2B 4K0NA 1UC7A 2RUEA 1GRXA 5IO0A 1GTAA 4L0WA 4IQAA 4J56E 4Q5QA 3DYRA 3I9V2 4P3YB 3ZRDA 2VL3A 3TJBA 1JLVA 2WGRA 3KXOA 3DMLA 4K8MA 1GLPA 3APQA 1PGTA 2FCHA 19GSA 6GSSA 1F2EA 3QD9A 1X9WB 4D73B 1EV9A 3WYWA 3GKXA 2X8CA 1GUMA 2EIQA 18GSA 6GSXA 4GSTA 3KMOA 4ZIJA 1WP0A 4ID0A 5ELGA 5IMCA 1Z3EA 2GQKA 4EXJA 1PD21 2HZEA 1JZOA 4MMMA 2KUCA 2OKAA 4KH7A 2C4JA 1Y6EA 1SJ6A 3EURA 2CVDA 1ML6A 3ERGA 5CRHA 3AY8A 3W8JA 5IPHA 1T4YA 4K7OA 3M1GA 2HZEB 1ERWA 3APOA 3FR3A 1GTIA 5C04A 2P0GA 4MP4A 4CHSA 3W6GA 3HJMA 5H5QA 1GSQA 2ON5A 3VWXA 3HZ8A 1XWKA 3BOAA 3QFBC 3G7YA 1QUWA 2YNXA 2M80A 1YY7A 3ZYWA 2OE0A 4AJ7A 2AYTA 4KGIA 1PX6A 4O32A 3QAWA 5JCWA 2GVPA 4YH2A 2P5RA 3IR4A 5ECPB 2VOCA 4MH2A 3PGTA 1YKCA 4JR4A 4IBPA 3VWVA 3IBHA 4OFNA 5IMZA 3GURA 1EP8A 3RHCA 4IP6A 1PA3A 2DJ0A 2VUPA 1EP7A 2JZSA 2PVOC 1OKTA 2IL3A 2HNLA 4TXOA 1URMA 2VLVA 2RM5A 1THOA 2CX3A 3GSSA 2FLSA 3HD5A 2H66A 4F9ZA 2L59A 4EUYA 4POLA 2L6DA 4E8EA 3H8QA 1E2YA 2FD3A 1BG5A 3WGEA 3F6FA 3KIJA 5IO2A 4PNFA 4TXOB 2YV9A 1KTEA 4TOPA 3ZIJA 1HNAA 4XS1A 1QMVA 1GNEA 3FZ4A 2L57A 5JWQB 1TJDA 2CAQA 2IJYA 4N0ZA 2H70A 1HNBA 1GP1A 3GX0A 1AAZA 3SWLA 1XZOA 1TI1A 4L8EA 1QQ2A 3H4KA 3L9UA 4LL1B 2K18A 5HR1A 1EGRA 2PPTA 1PKZA 2BJXA 2DIYA 3QPMA 3IE3A 4KX4A 2YN1A 3TB2A 1Q98A 2I3YA 4Q5FA 3BCKA 1KNGA 1X5CA 2WULA 1E6BA 4OFMA 1SENA 3SBCA 2GSTA 5D9WA 1N8JA
chains in the Genus database with same CATH superfamily
4RI7A 4YQUA 2HRAA 3ERWA 1LBKA 1XOBA 3FR6A 2WZ9A 1ABAA 4KCEA 4KDXA 2QA2A 4ECBA 2RLIA 4DSRA 2C3QA 2LS5A 4RQXA 1PFOA 5IMFA 2MBSA 5ECRB 1S3AA 4DSSB 4WF4A 3D6IA 1T7PB 4HQZA 2NTOA 4KA0A 3RBTA 4A5PA 3HA9A 2AV4A 5E59A 1CQGA 3O3TA 3LEFA 2H0HA 1WJKA 4FH8A 1B48A 1ACVA 2KOKA 1ZGNA 2B7KA 3IV4A 2LJKA 5F06A 4MNNA 4N10A 3KCMA 1SK1A 1TTZA 2X4AA 3C71A 4I8BA 4HEA2 4BIKA 5CAXA 5B8AA 3W8SA 2IMIA 1H75A 3A5WA 2J9HA 5CRGA 4ZBAA 1SK2A 3CTFA 4I5QA 5KEJA 4FYCA 2EIOA 5G1KA 3RPNA 4CY6A 2CV4A 1M99A 1JZWA 1I9DA 4EDZA 3F4TA 4IP1A 1S3RA 1J0FA 5G5FA 3ZITA 5GAND 4K2XA 4ECCA 2VIMA 3GV1A 1WOUA 3FHKA 4JEDA 2BMXA 1K3YA 5ENUA 1JZDA 3E3EA 3R2QA 1EGOA 2DKIA 4Z2RA 1WMJA 3GKMA 4ML1A 2R0GA 3VI7A 1K0MA 3VK9A 5KN0A 6GSVA 4KSOA 4MF6A 1YKAA 4PUFC 5DJLA 1K0OA 4BVYA 20GSA 3A3TA 1NW2A 3QMXA 5GSTA 2PVQA 2AUVA 3HVVA 2GZZA 2CVBA 3MNGA 4HSCX 3PPUA 2QA1A 5F05A 1YJ6A 3FMWA 2CAIA 5IMAA 2HRKA 1QXHA 1FW1A 2XBQA 3WGXA 5DVBA 3DXBA 2GLRA 3D22A 4MJBA 4KB3A 1TK8B 3HVSA 4BVYB 1S3DA 2FA4A 4KDUA 13GSA 1XXUA 3RPPA 4LA1A 2XHFA 3TDGA 1EEMA 4FQUA 1YQ1A 5EL8A 2B3SA 1K3LA 3GKKA 5AIVA 3P8WA 3LYKA 1KEBA 1MDIA 1Z7RA 1ZZYA 2VLTA 2LNSA 2PERA 2K8VA 4G10A 3ZREA 5KOXA 5DQSA 4MF5A 4QQ7A 3FY7A 2V41A 4G0LA 1YF1A 3HKRA 1PRXA 4IHUA 2AHEA 4ECJA 1FOHA 6GSTA 2UZ8A 3QDNA 4HU7A 3L78A 3C8EA 1BYEA 5HR0A 2JU5A 3O76A 4TVEA 5DCGA 4RI6A 3GH6A 3GN3A 1LU4A 3UL3A 1TRVA 4XRDA 1MDJA 1VF1A 3G9BA 3LYPA 2FY6A 2GDRA 5KN2A 2V2GA 5KN1A 4V2MA 3ZZXA 2CX4A 2O85A 1T1VA 2VAFA 1HQOA 3H93A 1GH2A 3GFKA 4IELA 1AQVA 2C1YA 2EIRA 2GT5A 3BBYA 3PR8A 4DEJA 12GSA 5CRDA 2GSRA 2V6KA 2G2QA 2H72A 1SL1B 4EC0A 4BL7A 2QSIA 5GZZB 3ZLPA 1GULA 3KJYA 3RAZA 1VGLA 3PH9A 3GHAA 1GTBA 4FIWA 1G0TA 5GSSA 1GSUA 2C3TA 1ZL9A 4MJAA 4MPFA 1NSWA 4IVFA 2F8FA 2GGTA 1GUHA 1QFNA 3A5IA 2VCVA 2PN8A 3HHVA 2J23A 4BL7B 2PMTA 2F51A 4KAEA 4L5OA 2OBIA 2V6OA 3U6VA 3DEXA 1XFLA 1BEDA 3VWUA 4HS1A 1A8YA 1TRUA 3D21A 4NHWA 5HFKA 3HDCA 3VWWA 4K5RA 5DALA 3US3A 4ULXA 4ZBDA 2JZRA 5DAKB 3EINA 5ABRA 3FZAA 1FOVA 4Q5RA 3ERFA 5J41A 2H8LA 6GSUA 3HVNA 2JZTA 3H79A 1XVQA 2CVKA 3GKNA 2JADA 5J4UA 5FWGA 2LQOA 3KH7A 17GSA 3KD0A 2FNOA 3F3RA 2I4AA 5AIXA 3QAVA 1X9SB 4E8HA 5DALB 2WRTA 4IKHA 4HU9A 4EDYA 4Z7XA 3FW2A 3LWAA 2DJ3A 3IDVA 5HFIA 5KN3A 1XWCA 1RK4A 1Z7PA 4EIPA 2C0GA 3ED3A 2O7KA 3F4RA 5J9CA 1SJIA 3RHBA 5B6MA 2B1LA 3BD2A 3TUEA 2KHPA 3FEUA 2B6MA 2MMOA 4ICYA 4LMWA 2KP1A 5ECOB 4ML6A 2HRFA 4O5RA 3HYPA 5CO3A 2O8VB 1SYRA 2GTUA 1EOGA 1SD9A 1TRSA 3QAGA 2X8GA 4IJIA 3Q74A 3VFIA 3IAS2 3QFAC 1WRYA 3P7XA 2ES7A 5D93A 3HCZA 2IN3A 2CT6A 3LFLA 3TKSE 1XOAA 2YV7A 1OC9A 3WT1A 1TKDB 3ZIVA 2RUFA 2H01A 3E0UA 3TOTA 3Q19A 1JLWA 4HUAA 1R5PA 2IFQA 4CW9A 3M0FA 1SK0A 2MZCA 1PL2A 5LCZA 3FR9A 5B8BA 1XWAA 3I69A 1C72A 2YWMA 3CBUA 1V9WA 4HJ2A 4RUVA 3FZ9A 4LL4B 5IOXA 1A2MA 4G9HA 3DKSA 1OC9B 1PN9A 2DJKA 4L5LA 1K0CA 4EF0A 1H4OA 2WB9A 3IK9A 2IFQB 4TR4A 1A24A 1K0NA 1SKWB 2LQQA 2YCDA 4OD7A 2NVLA 2AJQB 3BJ5A 4XS6A 1SU9A 2IIYA 3LJRA 5G2ZA 3FRCA 1DE2A 2MMAA 3A2WA 1AC1A 1G6WA 1O85A 2IMFA 5IMVA 4IGJA 5HFGA 2H1AA 5HR3A 1CQHA 2A2PA 3TGZA 2OBKA 2H73A 1JZRA 3DVXA 4HI7A 5JWOB 2XBIA 4G0KA 4TW5A 1V98A 8GSSA 1Z5YE 1WWJA 1X5DA 3MYDA 3CYNA 3IK7A 3Q18A 2YPMA 2JSZA 1O8XA 2RIIA 1X0RA 2A2SA 1Z9HA 1G6YA 2GQLA 4X43A 2A4HA 4BPYA 1TI3A 5IM9A 4MA9A 3ZVJA 2YOIA 4POKA 2QGVA 1THXA 2LNTA 2BTOT 2HE3A 4O92A 2YZUA 2HFDA 5G31A 1GSEA 4ISDA 3IC4A 4ZL7A 2H75A 3C73A 1A0FA 4NPBA 4OO4A 1U87A 3NZNA 2H71A 4KSMA 5BMUA 3GX8A 2YWOA 4PQHA 4JBBA 4HZ2A 3GSTA 4QL9A 1ZYNA 1B4PA 4AJ6A 3QR6A 3ZFBA 4N0VA 4GSSA 5EY6A 4MDCA 1OYJA 3HVXA 3UBKA 2F3MA 5CREA 2VM2A 3H1NA 5JCGA 1XVWA 4YAVA 1M2AA 4IW9A 4XTSA 2TRCP 4ZL8A 1SKRB 4YKGA 2TRXA 5F07A 1VRSD 4TXVA 1RW1A 1ZYQB 2YJ7A 4Q5NA 4ZBBA 1JHBA 5D73A 3UOMA 1FO5A 3QCPA 2K6VA 4K7NA 2N5FA 2FHEA 4MZBA 2HLSA 1FB6A 3GA4A 2E2GA 3QOUA 4N11A 5D9VA 2WCIA 4GQFA 4JR6A 3WGDA 3CRUA 3KTBA 3E9JB 1O81A 4ZB9A 2B7JA 2HYXA 4NXIA 2LRCA 5EPFA 1QGVA 4KDYA 2JSYA 2X99A 4I6XA 4O7HA 5L71A 1PX7A 3EYTA 5ECMB 3FZ5A 3KH9A 3EU3A 1MTCA 5DCHA 1VF2A 1LJRA 4I97A 5D96A 3OR5A 1VF4A 1K3OA 1X5EA 1A2LA 1OC3A 1PKWA 4V2LA 1TK0B 1ON4A 3ZMLA 4NV5A 2YWNA 1J9BA 1Y25A 3ME7A 4IS0A 3I43A 2I9HA 1M2BA 2LSTA 4TR0A 1G7OA 1M0UA 4KE3A 2M46A 2TIRA 3F9UA 4MPGA 3CTGA 1HD2A 1M9AA 4O5QA 3ZMKA 1XWBA 1AW9A 2X64A 3EPTA 3N5OA 3A2XA 2I81A 4JZQA 3GIXA 2PGTA 2DKHA 4J2FA 4OFTA 5DDLA 3C1RA 3ME8A 2H6ZA 1GNWA 2OACA 4YQMA 2FWFA 2C0FA 1RQMA 2ZUPA 2NBSA 4PTSA 3ZL5A 1ZMAA 3VURA 1G7EA 4BA7A 1TP9A 2R5GA 5AISA 3C1SA 5ECHB 2F9SA 3TJGA 2QC7A 4DSQA 4POBA 4BWSA 4OWYA 3UVHA 4TN8A 3F6DA 2LRNA 3FKFA 2H6XA 1B9YC 2LKUA 1TW9A 4ILFA 1SKSB 3TOUA 1YDKA 2DSAA 1UA5A 3ZVJD 3DD3A 4USSA 2H0IA 4GQCA 6GSWA 1A23A 2VO4A 3D0ZA 4HOJA 5EVOA 2R0PA 5ECNB 2GT6A 2V1MA 2QKEA 2YWIA 1BJXA 2H1BA 2JACA 1EWXA 4IJ3A 4GSNA 3UVTA 5H5RA 1OKDA 4PGTA 7GSSA 1GL8A 4Z2TA 3F0IA 2LJAA 2GSSA 4TRXA 4H86A 5D9XA 4WBJA 3IC8A 1F3AA 5AGYA 1AXDA 2G0FA 4YAPA 2YZHA 2VCXA 4QL7A 2DLXA 2IMKA 3KEBA 5A4UA 1I5GA 1NHOA 1S3CA 2R6KA 5DJMA 3M9JA 4F0CA 3G7JA 4ECIA 4TKYA 2H1GA 3F3QA 5F0GA 3UBLA 1HYUA 4K1FA 1T00A 4AJ8A 5G5EA 3DGQA 1SL2B 5DQYA 1NHYA 4F82A 2LJRA 2VCTA 5HQPA 5JCUA 3EWLA 2K8SA 1OE8A 4RQRA 4K6XA 1YEPA 2ZNMA 5CNWA 5COHA 5G30A 5ID2A 3MSZA 2VLUA 2VCWA 4L0UA 2C3NA 1A2JA 5H5SA 1U6TA 2C0EA 4O5UA 3APSA 3HJPA 1F6MC 2LEGA 4PQIA 2HRNA 1EEJA 3M8NA 3EU4A 2KLXA 4G0IA 4IQ1A 4WF5A 1PQNA 2L6CA 3LQ7A 4JU5A 2NDOA 1TRWA 4NAXA 1ST9A 3IRAA 2X8HA 2C80A 4WETA 5G1LA 3D4TA 4D73A 3TRQA 3GTUA 4OCFA 2R2JA 3CSIA 3NIVA 2XC2A 2A2RA 3GMFA 1SJZA 3IPZA 1GSDA 5CP1A 2HT9A 1TU7A 5FT3A 2R4VA 2HI7A 3TJFA 1VF3A 1MEKA 2E0QA 2K9FA 1K0AA 3JCML 3DWVA 2V32A 5IMDA 2PU9C 4FYBA 4FYUA 3F8UA 3K8NA 1YZXA 6GSYA 5HR2A 11GSA 3L9VA 1TU8A 1U3IA 2O87A 3WD6A 2F8AA 2GQMA 3TJKA 1N2AA 3GTUB 3KP8A 3J7Yk 1HNCA 3TJJA 5B7CA 3LORA 4X4JA 4PURA 2E2MA 2H30A 2VL9A 4GLTA 1O7UA 10GSA 5INYA 4F2IA 3MAKA 4MCUA 2YANA 3Q6OA 1T3BA 3M9KA 4PQ1A 5CYYA 4PUAA 1UVZA 3IHQA 4NMUA 3IXRA 2KP2A 1R4WA 2GS3A 2EC4A 1B9XC 3UJ1A 2B5XA 4EL1A 4TR3A 2PWJA 1JFUA 1MD4A 4MZWA 3DIEA 2REMA 3TCOA 1FB0A 3VPTA 4PNGA 1SL0B 2H74A 2L5OA 3MDKA 2LRTA 4OMVA 2ALBA 2VD1A 1GSFA 1XCCA 3TKSC 1OAZA 4HZ4A 3KTLA 3EE2A 1XW5A 4AGSA 2N5BA 2AB6A 5J3RA 5A4VA 3IOSA 4NHZA 2L4CA 5F8BA 4AF2A 3UIWA 3M3MA 1AQWA 4GRFA 1Z6NA 1TDIA 4EVMA 2DJ2A 1OVNA 3TRPA 4MZCA 1T4ZA 4GCIA 3C7MA 4POMA 2FA8A 2WFCA 5C00A 2LV3A 1DBYA 3KZQA 4MK3A 3VLNA 2VCZA 1W89A 2XPEA 2VCQA 2P5QA 2MMZA 5D9TA 2DMLA 2M72A 3ISOA 5KOWA 4GXZA 1A8LA 2H1DA 5ECSA 1V2AA 1O8WA 3GL3A 1DE1A 1M2DA 2IPAA 3GL5A 2IWTA 4ZL9A 3CRTA 2CA8A 4KCAA 1NM3A 2GZPA 3S9FA 3LSZA 4OCEA 1XPVA 3F4SA 1YF0A 2CQ9A 1OC8A 2DBCA 4J57E 2YJHA 2DMMA 2VD0A 1T8EB 5B6NA 1XW6A 1XIYA 4GWRA 4V1Ap 3BCIA 2YP6A 4OO5A 1ZCPA 2R0CA 3GUSA 2X49A 1R26A 1GLQA 2WJUA 4LLRA 1Q4JA 3GNJA 2H76A 3L9SA 3CQFA 2H6YA 4F0BA 4K7IA 4GF0A 5BRTA 4DSSA 3VPQA 2MMNA 2H19A 4GTUA 1SYXA 2E7PA 2WS2A 1GSYA 3IA1A 2I1UA 1J08A 2MBTA 2IMDA 2H0GA 4KW6A 2VL2C 5FHIA 4JE1A 4MJEA 3ZFLA 5LD0A 3MWHA 3KGKA 1WE0A 3RDWA 4CDOA 4I2TA 3GH9A 1F9MA 2HSHA 4ZB8A 5IIZA 4KF9A 2D2ZA 2Z9SA 1F37A 3O6TA 3FYGA 3LG6A 1QK8A 3CXGA 4F03A 5CRWA 3EC3A 3I6AA 3L0HA 1TK5B 3TKRA 1O6JA 3ZTLA 1A0RP 1SD8A 4ZILA 1BAYA 2O89A 1ZOFA 5IPGA 4ZB6A 4WR5A 1ERUA 1U3AA 5DBQA 3UAPA 1ILOA 2L5LA 5ECLB 4FO5A 1W4VA 3TKPA 1EV4A 3G7IA 2FGXA 4XHMA 5IQYA 3UEMA 2PBJA 2FWEA 2LTKA 5IOWA 2B1KA 3WT2A 2CZ2A 3CSHA 5ECQB 4XS4A 4HJMA 1PSQA 3DRNA 2ZCTA 4MABA 4K9ZA 4N30A 1EZKA 2HXKA 1MDKA 4G2EA 4X1UA 1FVKA 4XCSA 2GZYA 2L4QA 1R7HA 3TRXA 4ACSA 3HY2A 2N5AA 1V57A 3D5JA 4WBRD 3IAM2 2RM6A 1FAAA 1ERVA 1XW9A 5JWRB 1PL1A 4XS4B 3LGCA 3L4NA 9GSSA 1AQXA 4BVXA 1U88A 2PUKC 2JL4A 2WDUA 3LXZA 5E4WA 3U5RE 2OE1A 4NWYA 1GUKA 1USBA 14GSA 1M9BA 2C0DA 3TKSA 1AUCA 1XWGA 1KBNA 1FG4A 1PMTA 2A4VA 1AIUA 16GSA 3UMAA 4BVXB 1R5AA 2FWGA 2CZ3A 1GSSA 1FHEA 4MF7A 4G19A 1F3BA 4HDEA 1WPIA 3HZ4A 3D4MA 2MYGA 2P31A 1GTUA 1FVJA 2DIZA 3UARA 4WEYA 4LMVA 3J7Yb 2FUG2 4KUNA 5LNKe 4KNDA 1K0BA 4V1Ag 1YEXA 2ON7A 1DUGA 1TOFA 4CY8A 3P2AA 4X0XA 3LXTA 4EO3A 2HSYA 1ZYEA 1XBSA 5ELAA 1BX9A 1Z6MA 2LUSA 1DSBA 1V58A 4WR4A 2AAWA 2OA7A 4EE0A 5A4WA 2B5EA 2OADA 3R3EA 4WKWA 3V1WA 4MLYA 1IYHA 1TXXA 2OE3A 2VM1A 5J9BA 3GYKA 3KMNA 2R37A 2GSQA 2DC5A 1BQ7A 2R3XA 2B5YA 1K0DA 4EIQA 3GRXA 4MJCA 4XRAA 4DVCA 1B8XA 4NV2A 1M7TA 4YQVA 3IHGA 3KM6A 4PXOA 3F63A 4WXTA 4V2NA 3CSJA 1MD3A 3DVWA 5AN1A 5A5KA 4MH3A 22GSA 3EMXA 4ZXGA 3N9JA 1X9MB 1IYIA 5ECIB 3EMPA 5J5NA 1GWCA 2DJ1A 3PINA 4BWQA 2DJJA 2C8UA 5ECKB 1B4QA 4TR1A 4K0GA 1V40A 5D8IA 1OE7A 3VI5A 2XPDA 2VL2A 2OJLA 4XIHA 2HZFA 4K2DA 1ERTA 3HJOA 1XG8A 5GAPD 2IMEA 4PX1A 5DAKA 4IN0A 4EKZA 4I2UA 1WIKA 1O73A 3FK8A 3CMIA 3NOFA 1EOHA 1UN2A 3KP9A 3LW9A 2FWHA 3EVIA 3P90A 4TR1B 3A2VA 3TKQA 3HXSA 4HQSA 2NPBA 4JRRA 5ID2B 4K0NA 1UC7A 4Z2UA 2RUEA 1GRXA 1ZYPA 5IO0A 1GTAA 4L0WA 4IQAA 4J56E 4Q5QA 3DYRA 3I9V2 4P3YB 3ZRDA 2VL3A 3TJBA 1JLVA 2WGRA 3KXOA 3DMLA 4K8MA 1GLPA 3APQA 1PGTA 2FCHA 19GSA 6GSSA 1F2EA 3QD9A 1X9WB 4D73B 1EV9A 3WYWA 3GKXA 2X8CA 1GUMA 2EIQA 18GSA 6GSXA 4GSTA 3KMOA 4ZIJA 1WP0A 4ID0A 5ELGA 5IMCA 1Z3EA 2GQKA 4EXJA 1PD21 2HZEA 1JZOA 4MMMA 2KUCA 2OKAA 4KH7A 2C4JA 1Y6EA 1SJ6A 3EURA 2CVDA 1ML6A 3ERGA 5CRHA 3AY8A 3W8JA 5IPHA 1T4YA 4K7OA 3M1GA 2HZEB 1ERWA 3APOA 3FR3A 1GTIA 5C04A 2P0GA 4MP4A 4CHSA 2HSMA 3W6GA 3HJMA 5H5QA 1GSQA 2ON5A 3VWXA 3HZ8A 1XWKA 3BOAA 3QFBC 4YKFA 3G7YA 1QUWA 2YNXA 2M80A 1YY7A 3ZYWA 2OE0A 4AJ7A 2AYTA 4KGIA 1PX6A 4O32A 3QAWA 5JCWA 2GVPA 4YH2A 2P5RA 3IR4A 5ECPB 2VOCA 4MH2A 3PGTA 1YKCA 4JR4A 4IBPA 3VWVA 3IBHA 4OFNA 5IMZA 3GURA 1EP8A 3RHCA 4IP6A 1PA3A 2DJ0A 2VUPA 1EP7A 2JZSA 2PVOC 1OKTA 4K5SA 2IL3A 2HNLA 4TXOA 1URMA 2VLVA 2RM5A 1THOA 2CX3A 3GSSA 1PN0A 2FLSA 3HD5A 2H66A 4F9ZA 2L59A 4EUYA 4POLA 2L6DA 4E8EA 3H8QA 1M3IA 1M3JA 1E2YA 2FD3A 1BG5A 3WGEA 3F6FA 3KIJA 5IO2A 4PNFA 4TXOB 2YV9A 1KTEA 4TOPA 3ZIJA 1HNAA 4XS1A 1QMVA 1GNEA 3FZ4A 2L57A 5JWQB 1TJDA 2CAQA 2IJYA 4N0ZA 2H70A 1HNBA 1GP1A 3GX0A 1AAZA 3SWLA 1XZOA 1TI1A 4L8EA 1QQ2A 3H4KA 3MIXA 3L9UA 4LL1B 2K18A 5HR1A 1EGRA 2PPTA 1PKZA 2BJXA 2DIYA 3QPMA 3IE3A 4KX4A 2YN1A 3TB2A 1Q98A 2I3YA 4Q5FA 3BCKA 1KNGA 1X5CA 2WULA 1E6BA 4OFMA 1SENA 3SBCA 2GSTA 5D9WA 1N8JA
chains in the Genus database with same CATH topology
4RI7A 4YQUA 2HRAA 3ERWA 1LBKA 1XOBA 3FR6A 2WZ9A 1ABAA 4KCEA 4KDXA 2QA2A 4ECBA 2RLIA 4DSRA 2C3QA 2LS5A 4RQXA 5IMFA 2MBSA 5ECRB 1S3AA 4DSSB 4WF4A 3D6IA 1T7PB 4HQZA 2NTOA 4KA0A 3RBTA 4A5PA 3HA9A 2AV4A 5E59A 1CQGA 3O3TA 3LEFA 2H0HA 1WJKA 4FH8A 1B48A 1ACVA 2KOKA 1ZGNA 2B7KA 3IV4A 2LJKA 5F06A 4MNNA 4N10A 3KCMA 1SK1A 1TTZA 2X4AA 3C71A 4I8BA 4HEA2 5CAXA 5B8AA 3W8SA 2IMIA 1H75A 3A5WA 2J9HA 5CRGA 4ZBAA 1SK2A 3CTFA 4I5QA 5KEJA 4FYCA 2EIOA 5G1KA 3RPNA 4CY6A 2CV4A 1M99A 1JZWA 1I9DA 4EDZA 3F4TA 4IP1A 1J0FA 5G5FA 3ZITA 5GAND 4K2XA 4ECCA 2VIMA 3GV1A 1WOUA 3FHKA 4JEDA 2BMXA 1K3YA 5ENUA 1JZDA 3E3EA 3R2QA 1EGOA 2DKIA 4Z2RA 1WMJA 3GKMA 4ML1A 2R0GA 3VI7A 1K0MA 3VK9A 5KN0A 6GSVA 4KSOA 4MF6A 1YKAA 4PUFC 5DJLA 1K0OA 4BVYA 20GSA 3A3TA 1NW2A 3QMXA 5GSTA 2PVQA 2AUVA 3HVVA 2GZZA 2CVBA 3MNGA 3PPUA 2QA1A 5F05A 1YJ6A 3FMWA 2CAIA 5IMAA 2HRKA 1QXHA 1FW1A 2XBQA 3WGXA 5DVBA 3DXBA 2GLRA 3D22A 4MJBA 4KB3A 1TK8B 3HVSA 4BVYB 1S3DA 2FA4A 4KDUA 13GSA 1XXUA 3RPPA 4LA1A 2XHFA 3TDGA 1EEMA 4FQUA 1YQ1A 5EL8A 2B3SA 1K3LA 3GKKA 5AIVA 3P8WA 3LYKA 1KEBA 1MDIA 1Z7RA 1ZZYA 2VLTA 2LNSA 2PERA 2K8VA 4G10A 3ZREA 5KOXA 5DQSA 4MF5A 4QQ7A 3FY7A 2V41A 4G0LA 1YF1A 3HKRA 1PRXA 4IHUA 2AHEA 4ECJA 1FOHA 6GSTA 2UZ8A 3QDNA 4HU7A 3L78A 3C8EA 1BYEA 5HR0A 2JU5A 3O76A 4TVEA 5DCGA 4RI6A 3GH6A 3GN3A 1LU4A 3UL3A 1TRVA 4XRDA 1MDJA 1VF1A 3G9BA 3LYPA 2FY6A 2GDRA 5KN2A 2V2GA 5KN1A 4V2MA 3ZZXA 2CX4A 2O85A 1T1VA 2VAFA 1HQOA 3H93A 1GH2A 3GFKA 4IELA 1AQVA 2C1YA 2EIRA 2GT5A 3BBYA 3PR8A 4DEJA 12GSA 5CRDA 2GSRA 2V6KA 2G2QA 2H72A 1SL1B 4EC0A 4BL7A 2QSIA 5GZZB 3ZLPA 1GULA 3KJYA 3RAZA 1VGLA 3PH9A 3GHAA 1GTBA 4FIWA 1G0TA 5GSSA 1GSUA 2C3TA 1ZL9A 4MJAA 4MPFA 1NSWA 4IVFA 2F8FA 2GGTA 1GUHA 1QFNA 3A5IA 2VCVA 2PN8A 3HHVA 2J23A 4BL7B 2PMTA 2F51A 4KAEA 4L5OA 2OBIA 2V6OA 3U6VA 3DEXA 1XFLA 1BEDA 3VWUA 4HS1A 1A8YA 1TRUA 3D21A 4NHWA 5HFKA 3HDCA 3VWWA 4K5RA 5DALA 3US3A 4ULXA 4ZBDA 2JZRA 5DAKB 3EINA 5ABRA 3FZAA 1FOVA 4Q5RA 3ERFA 5J41A 2H8LA 6GSUA 2JZTA 3H79A 1XVQA 2CVKA 3GKNA 2JADA 5J4UA 5FWGA 2LQOA 3KH7A 17GSA 3KD0A 2FNOA 3F3RA 2I4AA 5AIXA 3QAVA 1X9SB 4E8HA 5DALB 2WRTA 4IKHA 4HU9A 4EDYA 4Z7XA 3FW2A 3LWAA 2DJ3A 3IDVA 5HFIA 5KN3A 1XWCA 1RK4A 1Z7PA 4EIPA 2C0GA 3ED3A 2O7KA 3F4RA 5J9CA 1SJIA 3RHBA 5B6MA 2B1LA 3BD2A 3TUEA 2KHPA 3FEUA 2B6MA 2MMOA 4ICYA 4LMWA 2KP1A 5ECOB 4ML6A 2HRFA 4O5RA 3HYPA 5CO3A 2O8VB 1SYRA 2GTUA 1EOGA 1SD9A 1TRSA 3QAGA 2X8GA 4IJIA 3Q74A 3VFIA 3IAS2 3QFAC 1WRYA 3P7XA 2ES7A 5D93A 3HCZA 2IN3A 2CT6A 3LFLA 3TKSE 1XOAA 2YV7A 1OC9A 3WT1A 1TKDB 3ZIVA 2RUFA 2H01A 3E0UA 3TOTA 3Q19A 1JLWA 4HUAA 1R5PA 2IFQA 4CW9A 3M0FA 1SK0A 2MZCA 1PL2A 5LCZA 3FR9A 5B8BA 1XWAA 3I69A 1C72A 2YWMA 3CBUA 1V9WA 4HJ2A 4RUVA 3FZ9A 4LL4B 5IOXA 1A2MA 4G9HA 3DKSA 1OC9B 1PN9A 2DJKA 4L5LA 1K0CA 4EF0A 1H4OA 2WB9A 3IK9A 2IFQB 4TR4A 1A24A 1K0NA 1SKWB 2LQQA 2YCDA 4OD7A 2NVLA 2AJQB 3BJ5A 4XS6A 1SU9A 2IIYA 3LJRA 5G2ZA 3FRCA 1DE2A 2MMAA 3A2WA 1AC1A 1G6WA 1O85A 2IMFA 5IMVA 4IGJA 5HFGA 2H1AA 5HR3A 1CQHA 2A2PA 3TGZA 2OBKA 2H73A 1JZRA 3DVXA 4HI7A 5JWOB 2XBIA 4G0KA 4TW5A 1V98A 8GSSA 1Z5YE 1WWJA 1X5DA 3MYDA 3CYNA 3IK7A 3Q18A 2YPMA 2JSZA 1O8XA 2RIIA 1X0RA 2A2SA 1Z9HA 1G6YA 2GQLA 4X43A 2A4HA 4BPYA 1TI3A 5IM9A 4MA9A 3ZVJA 2YOIA 4POKA 2QGVA 1THXA 2LNTA 2BTOT 2HE3A 4O92A 2YZUA 2HFDA 5G31A 1GSEA 4ISDA 3IC4A 4ZL7A 2H75A 3C73A 1A0FA 4NPBA 4OO4A 1U87A 3NZNA 2H71A 4KSMA 5BMUA 3GX8A 2YWOA 4PQHA 4JBBA 4HZ2A 3GSTA 4QL9A 1ZYNA 1B4PA 4AJ6A 3QR6A 3ZFBA 4N0VA 4GSSA 5EY6A 4MDCA 1OYJA 3HVXA 3UBKA 2F3MA 5CREA 2VM2A 3H1NA 5JCGA 1XVWA 4YAVA 1M2AA 4IW9A 4XTSA 2TRCP 4ZL8A 1SKRB 4YKGA 2TRXA 5F07A 1VRSD 4TXVA 1RW1A 1ZYQB 2YJ7A 4Q5NA 4ZBBA 1JHBA 5D73A 3UOMA 1FO5A 3QCPA 2K6VA 4K7NA 2N5FA 2FHEA 4MZBA 2HLSA 1FB6A 3GA4A 2E2GA 3QOUA 4N11A 5D9VA 2WCIA 4GQFA 4JR6A 3WGDA 3CRUA 3KTBA 3E9JB 1O81A 4ZB9A 2B7JA 2HYXA 4NXIA 2LRCA 5EPFA 1QGVA 4KDYA 2JSYA 2X99A 4I6XA 4O7HA 5L71A 1PX7A 3EYTA 5ECMB 3FZ5A 3KH9A 3EU3A 1MTCA 5DCHA 1VF2A 1LJRA 5D96A 4I97A 3OR5A 1VF4A 1K3OA 1X5EA 1A2LA 1OC3A 1PKWA 4V2LA 1TK0B 1ON4A 3ZMLA 4NV5A 2YWNA 1J9BA 1Y25A 3ME7A 4IS0A 3I43A 2I9HA 1M2BA 2LSTA 4TR0A 1G7OA 1M0UA 4KE3A 2M46A 2TIRA 3F9UA 4MPGA 3CTGA 1HD2A 1M9AA 4O5QA 3ZMKA 1XWBA 1AW9A 2X64A 3EPTA 3N5OA 3A2XA 2I81A 4JZQA 3GIXA 2PGTA 2DKHA 4J2FA 4OFTA 5DDLA 3C1RA 3ME8A 2H6ZA 4YQMA 1GNWA 2OACA 2FWFA 2C0FA 1RQMA 2ZUPA 2NBSA 4PTSA 3ZL5A 1ZMAA 3VURA 1G7EA 4BA7A 1TP9A 2R5GA 5AISA 3C1SA 5ECHB 2F9SA 3TJGA 2QC7A 4DSQA 4POBA 4BWSA 4OWYA 3UVHA 4TN8A 3F6DA 2LRNA 3FKFA 2H6XA 1B9YC 2LKUA 1TW9A 4ILFA 1SKSB 3TOUA 1YDKA 2DSAA 1UA5A 3ZVJD 3DD3A 4USSA 2H0IA 4GQCA 6GSWA 1A23A 2VO4A 3D0ZA 4HOJA 5EVOA 2R0PA 5ECNB 2GT6A 2V1MA 2QKEA 2YWIA 1BJXA 2H1BA 2JACA 1EWXA 4IJ3A 4GSNA 3UVTA 5H5RA 1OKDA 4PGTA 7GSSA 1GL8A 4Z2TA 3F0IA 2LJAA 2GSSA 4TRXA 4H86A 5D9XA 4WBJA 3IC8A 1F3AA 5AGYA 1AXDA 2G0FA 4YAPA 2YZHA 2VCXA 4QL7A 2DLXA 2IMKA 3KEBA 5A4UA 1I5GA 1NHOA 1S3CA 2R6KA 5DJMA 3M9JA 4F0CA 3G7JA 4ECIA 4TKYA 2H1GA 3F3QA 5F0GA 3UBLA 1HYUA 4K1FA 1T00A 4AJ8A 5G5EA 3DGQA 1SL2B 5DQYA 1NHYA 4F82A 2LJRA 2VCTA 5HQPA 5JCUA 3EWLA 2K8SA 1OE8A 4RQRA 4K6XA 1YEPA 2ZNMA 5CNWA 5COHA 5G30A 5ID2A 3MSZA 2VLUA 2VCWA 4L0UA 2C3NA 1A2JA 5H5SA 1U6TA 2C0EA 4O5UA 3APSA 3HJPA 1F6MC 2LEGA 4PQIA 2HRNA 1EEJA 3M8NA 3EU4A 2KLXA 4G0IA 4IQ1A 4WF5A 1PQNA 2L6CA 3LQ7A 4JU5A 2NDOA 1TRWA 4NAXA 1ST9A 3IRAA 2X8HA 2C80A 4WETA 5G1LA 3D4TA 4D73A 3TRQA 3GTUA 4OCFA 2R2JA 3CSIA 3NIVA 2XC2A 2A2RA 3GMFA 1SJZA 3IPZA 1GSDA 5CP1A 2HT9A 1TU7A 5FT3A 2R4VA 2HI7A 3TJFA 1VF3A 1MEKA 2E0QA 2K9FA 1K0AA 3JCML 3DWVA 2V32A 5IMDA 2PU9C 4FYBA 4FYUA 3F8UA 3K8NA 1YZXA 6GSYA 5HR2A 11GSA 3L9VA 1TU8A 1U3IA 2O87A 3WD6A 2F8AA 2GQMA 3TJKA 1N2AA 3GTUB 3KP8A 3J7Yk 1HNCA 3TJJA 5B7CA 3LORA 4X4JA 4PURA 2E2MA 2H30A 2VL9A 4GLTA 1O7UA 10GSA 5INYA 4F2IA 3MAKA 4MCUA 2YANA 3Q6OA 1T3BA 3M9KA 4PQ1A 5CYYA 4PUAA 1UVZA 3IHQA 4NMUA 3IXRA 2KP2A 1R4WA 2GS3A 2EC4A 1B9XC 3UJ1A 2B5XA 4EL1A 4TR3A 2PWJA 1JFUA 1MD4A 4MZWA 3DIEA 2REMA 3TCOA 1FB0A 3VPTA 4PNGA 1SL0B 2H74A 2L5OA 3MDKA 2LRTA 4OMVA 2ALBA 2VD1A 1GSFA 1XCCA 3TKSC 1OAZA 4HZ4A 3KTLA 3EE2A 1XW5A 4AGSA 2N5BA 2AB6A 5J3RA 5A4VA 3IOSA 4NHZA 2L4CA 5F8BA 4AF2A 3UIWA 3M3MA 1AQWA 4GRFA 1Z6NA 1TDIA 4EVMA 2DJ2A 1OVNA 3TRPA 4MZCA 1T4ZA 4GCIA 3C7MA 4POMA 2FA8A 2WFCA 5C00A 2LV3A 1DBYA 3KZQA 4MK3A 3VLNA 2VCZA 1W89A 2XPEA 2VCQA 2P5QA 2MMZA 5D9TA 2DMLA 2M72A 3ISOA 5KOWA 4GXZA 1A8LA 2H1DA 5ECSA 1V2AA 1O8WA 3GL3A 1DE1A 1M2DA 2IPAA 3GL5A 2IWTA 4ZL9A 3CRTA 2CA8A 4KCAA 1NM3A 2GZPA 3S9FA 3LSZA 4OCEA 1XPVA 3F4SA 1YF0A 2CQ9A 1OC8A 2DBCA 4J57E 2YJHA 2DMMA 2VD0A 1T8EB 5B6NA 1XW6A 1XIYA 4GWRA 4V1Ap 3BCIA 2YP6A 4OO5A 1ZCPA 2R0CA 3GUSA 2X49A 1R26A 1GLQA 2WJUA 4LLRA 1Q4JA 3GNJA 2H76A 3L9SA 4F0BA 2H6YA 4K7IA 4GF0A 5BRTA 4DSSA 3VPQA 2MMNA 2H19A 4GTUA 1SYXA 2E7PA 2WS2A 1GSYA 3IA1A 2I1UA 1J08A 2MBTA 2IMDA 2H0GA 4KW6A 2VL2C 5FHIA 4JE1A 4MJEA 3ZFLA 5LD0A 3MWHA 3KGKA 1WE0A 3RDWA 4CDOA 4I2TA 3GH9A 1F9MA 2HSHA 4ZB8A 5IIZA 4KF9A 2D2ZA 2Z9SA 1F37A 3O6TA 3FYGA 3LG6A 1QK8A 3CXGA 4F03A 5CRWA 3EC3A 3I6AA 3L0HA 1TK5B 3TKRA 1O6JA 3ZTLA 1A0RP 1SD8A 4ZILA 1BAYA 2O89A 1ZOFA 5IPGA 4ZB6A 4WR5A 1ERUA 1U3AA 5DBQA 3UAPA 1ILOA 2L5LA 5ECLB 4FO5A 1W4VA 3TKPA 1EV4A 3G7IA 2FGXA 4XHMA 5IQYA 3UEMA 2PBJA 2FWEA 2LTKA 5IOWA 2B1KA 3WT2A 2CZ2A 3CSHA 5ECQB 4XS4A 4HJMA 1PSQA 3DRNA 2ZCTA 4MABA 4K9ZA 4N30A 1EZKA 2HXKA 1MDKA 4G2EA 4X1UA 1FVKA 4XCSA 2GZYA 2L4QA 1R7HA 3TRXA 4ACSA 3HY2A 2N5AA 1V57A 3D5JA 4WBRD 3IAM2 2RM6A 1FAAA 1ERVA 1XW9A 5JWRB 1PL1A 4XS4B 3LGCA 3L4NA 9GSSA 1AQXA 4BVXA 1U88A 2PUKC 2JL4A 2WDUA 3LXZA 5E4WA 3U5RE 2OE1A 4NWYA 1GUKA 1USBA 14GSA 1M9BA 2C0DA 3TKSA 1AUCA 1XWGA 1KBNA 1FG4A 1PMTA 2A4VA 1AIUA 16GSA 3UMAA 4BVXB 1R5AA 2FWGA 2CZ3A 1GSSA 1FHEA 4MF7A 4G19A 1F3BA 4HDEA 1WPIA 3HZ4A 3D4MA 2MYGA 2P31A 1GTUA 1FVJA 2DIZA 3UARA 4WEYA 4LMVA 3J7Yb 2FUG2 4KUNA 5LNKe 4KNDA 1K0BA 4V1Ag 1YEXA 2ON7A 1DUGA 1TOFA 4CY8A 3P2AA 4X0XA 3LXTA 4EO3A 2HSYA 1ZYEA 1XBSA 5ELAA 1BX9A 1Z6MA 2LUSA 1DSBA 1V58A 4WR4A 2AAWA 2OA7A 4EE0A 5A4WA 2B5EA 2OADA 3R3EA 4WKWA 3V1WA 4MLYA 1IYHA 1TXXA 2OE3A 2VM1A 5J9BA 3GYKA 3KMNA 2R37A 2GSQA 2DC5A 1BQ7A 2R3XA 2B5YA 1K0DA 4EIQA 3GRXA 4MJCA 4XRAA 4DVCA 1B8XA 4NV2A 1M7TA 4YQVA 3IHGA 3KM6A 4PXOA 3F63A 4WXTA 4V2NA 3CSJA 1MD3A 3DVWA 5AN1A 5A5KA 4MH3A 22GSA 3EMXA 4ZXGA 3N9JA 1X9MB 1IYIA 5ECIB 3EMPA 5J5NA 1GWCA 2DJ1A 3PINA 4BWQA 2DJJA 2C8UA 5ECKB 1B4QA 4TR1A 4K0GA 1V40A 5D8IA 1OE7A 3VI5A 2XPDA 2VL2A 2OJLA 4XIHA 2HZFA 4K2DA 1ERTA 3HJOA 5GAPD 2IMEA 4PX1A 5DAKA 4IN0A 4EKZA 4I2UA 1WIKA 1O73A 3FK8A 3CMIA 3NOFA 1EOHA 1UN2A 3KP9A 3LW9A 2FWHA 3EVIA 3P90A 4TR1B 3A2VA 3TKQA 3HXSA 4HQSA 2NPBA 4JRRA 5ID2B 4K0NA 1UC7A 4Z2UA 2RUEA 1GRXA 1ZYPA 5IO0A 1GTAA 4L0WA 4IQAA 4J56E 4Q5QA 3DYRA 3I9V2 4P3YB 3ZRDA 2VL3A 3TJBA 1JLVA 2WGRA 3KXOA 3DMLA 4K8MA 1GLPA 3APQA 1PGTA 2FCHA 19GSA 6GSSA 1F2EA 3QD9A 1X9WB 4D73B 1EV9A 3WYWA 3GKXA 2X8CA 1GUMA 2EIQA 18GSA 6GSXA 4GSTA 3KMOA 4ZIJA 1WP0A 4ID0A 5ELGA 5IMCA 1Z3EA 2GQKA 4EXJA 1PD21 2HZEA 1JZOA 4MMMA 2KUCA 2OKAA 4KH7A 2C4JA 1Y6EA 1SJ6A 3EURA 2CVDA 1ML6A 3ERGA 5CRHA 3AY8A 3W8JA 5IPHA 1T4YA 4K7OA 3M1GA 2HZEB 1ERWA 3APOA 3FR3A 1GTIA 5C04A 2P0GA 4MP4A 4CHSA 2HSMA 3W6GA 3HJMA 5H5QA 1GSQA 2ON5A 3VWXA 3HZ8A 1XWKA 3BOAA 3QFBC 4YKFA 3G7YA 1QUWA 2YNXA 2M80A 1YY7A 3ZYWA 2OE0A 4AJ7A 2AYTA 4KGIA 1PX6A 4O32A 3QAWA 5JCWA 2GVPA 4YH2A 2P5RA 3IR4A 5ECPB 2VOCA 4MH2A 3PGTA 1YKCA 4JR4A 4IBPA 3VWVA 3IBHA 4OFNA 5IMZA 3GURA 1EP8A 3RHCA 4IP6A 1PA3A 2DJ0A 2VUPA 1EP7A 2JZSA 2PVOC 1OKTA 4K5SA 2IL3A 2HNLA 4TXOA 1URMA 2VLVA 2RM5A 1THOA 2CX3A 3GSSA 1PN0A 2FLSA 3HD5A 2H66A 4F9ZA 2L59A 4EUYA 4POLA 2L6DA 4E8EA 3H8QA 1E2YA 2FD3A 1BG5A 3WGEA 3F6FA 3KIJA 5IO2A 4PNFA 4TXOB 2YV9A 1KTEA 4TOPA 3ZIJA 1HNAA 4XS1A 1QMVA 1GNEA 3FZ4A 2L57A 5JWQB 1TJDA 2CAQA 2IJYA 4N0ZA 2H70A 1HNBA 1GP1A 3GX0A 1AAZA 3SWLA 1XZOA 1TI1A 4L8EA 1QQ2A 3H4KA 3MIXA 3L9UA 4LL1B 2K18A 5HR1A 1EGRA 2PPTA 1PKZA 2BJXA 2DIYA 3QPMA 3IE3A 4KX4A 2YN1A 3TB2A 1Q98A 2I3YA 4Q5FA 3BCKA 1KNGA 1X5CA 2WULA 1E6BA 4OFMA 1SENA 3SBCA 2GSTA 5D9WA 1N8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RI7 A;  4YQU A;  3ERW A;  1LBK A;  1XOB A;  3FR6 A;  2WZ9 A;  1ABA A;  4KCE A;  4KDX A;  4ECB A;  2RLI A;  4DSR A;  2C3Q A;  2LS5 A;  4RQX A;  5IMF A;  2MBS A;  5ECR B;  1S3A A;  4DSS B;  4WF4 A;  3D6I A;  1T7P B;  4HQZ A;  2NTO A;  4KA0 A;  3RBT A;  3HA9 A;  2AV4 A;  5E59 A;  1CQG A;  3O3T A;  3LEF A;  2H0H A;  1WJK A;  4FH8 A;  1B48 A;  1ACV A;  2KOK A;  1ZGN A;  2B7K A;  3IV4 A;  2LJK A;  5F06 A;  4N10 A;  3KCM A;  1SK1 A;  1TTZ A;  3C71 A;  4I8B A;  4HEA 2;  5CAX A;  5B8A A;  3W8S A;  2IMI A;  1H75 A;  3A5W A;  2J9H A;  5CRG A;  4ZBA A;  1SK2 A;  3CTF A;  4I5Q A;  5KEJ A;  4FYC A;  2EIO A;  5G1K A;  3RPN A;  2CV4 A;  1M99 A;  1JZW A;  1I9D A;  4EDZ A;  3F4T A;  4IP1 A;  1J0F A;  5G5F A;  3ZIT A;  5GAN D;  4ECC A;  2VIM A;  3GV1 A;  1WOU A;  3FHK A;  4JED A;  2BMX A;  1K3Y A;  5ENU A;  1JZD A;  3E3E A;  3R2Q A;  1EGO A;  1WMJ A;  3GKM A;  4ML1 A;  3VI7 A;  1K0M A;  3VK9 A;  5KN0 A;  6GSV A;  4KSO A;  4MF6 A;  1YKA A;  4PUF C;  5DJL A;  1K0O A;  4BVY A;  20GS A;  3A3T A;  1NW2 A;  3QMX A;  5GST A;  2PVQ A;  2AUV A;  3HVV A;  2GZZ A;  2CVB A;  3MNG A;  5F05 A;  1YJ6 A;  2CAI A;  5IMA A;  1QXH A;  1FW1 A;  2XBQ A;  3WGX A;  5DVB A;  3DXB A;  2GLR A;  3D22 A;  4MJB A;  4KB3 A;  1TK8 B;  3HVS A;  1S3D A;  2FA4 A;  4KDU A;  13GS A;  1XXU A;  3RPP A;  4LA1 A;  2XHF A;  3TDG A;  1EEM A;  1YQ1 A;  5EL8 A;  2B3S A;  1K3L A;  3GKK A;  5AIV A;  3P8W A;  3LYK A;  1KEB A;  1MDI A;  1Z7R A;  1ZZY A;  2VLT A;  2LNS A;  2PER A;  2K8V A;  4G10 A;  3ZRE A;  5DQS A;  4MF5 A;  4QQ7 A;  3FY7 A;  2V41 A;  1YF1 A;  3HKR A;  1PRX A;  4IHU A;  2AHE A;  4ECJ A;  6GST A;  3QDN A;  4HU7 A;  3L78 A;  3C8E A;  1BYE A;  5HR0 A;  2JU5 A;  3O76 A;  4TVE A;  5DCG A;  4RI6 A;  3GH6 A;  3GN3 A;  1LU4 A;  3UL3 A;  1TRV A;  4XRD A;  1MDJ A;  1VF1 A;  3G9B A;  3LYP A;  2FY6 A;  2GDR A;  5KN2 A;  2V2G A;  5KN1 A;  4V2M A;  3ZZX A;  2CX4 A;  2O85 A;  1T1V A;  2VAF A;  1HQO A;  3H93 A;  1GH2 A;  3GFK A;  4IEL A;  1AQV A;  2C1Y A;  2EIR A;  2GT5 A;  3BBY A;  3PR8 A;  4DEJ A;  12GS A;  5CRD A;  2GSR A;  2V6K A;  2G2Q A;  2H72 A;  1SL1 B;  4EC0 A;  4BL7 A;  2QSI A;  5GZZ B;  3ZLP A;  1GUL A;  3KJY A;  3RAZ A;  1VGL A;  3PH9 A;  3GHA A;  1GTB A;  4FIW A;  1G0T A;  5GSS A;  1GSU A;  2C3T A;  1ZL9 A;  4MJA A;  4MPF A;  1NSW A;  4IVF A;  2F8F A;  2GGT A;  1GUH A;  1QFN A;  2VCV A;  2PN8 A;  3HHV A;  2J23 A;  2PMT A;  2F51 A;  4KAE A;  4L5O A;  2OBI A;  2V6O A;  3U6V A;  3DEX A;  1XFL A;  1BED A;  3VWU A;  4HS1 A;  1A8Y A;  1TRU A;  3D21 A;  4NHW A;  5HFK A;  3HDC A;  3VWW A;  5DAL A;  3US3 A;  4ULX A;  4ZBD A;  2JZR A;  5DAK B;  3EIN A;  5ABR A;  3FZA A;  1FOV A;  4Q5R A;  3ERF A;  5J41 A;  2H8L A;  6GSU A;  2JZT A;  3H79 A;  1XVQ A;  2CVK A;  3GKN A;  2JAD A;  5J4U A;  5FWG A;  2LQO A;  3KH7 A;  17GS A;  3KD0 A;  2FNO A;  3F3R A;  2I4A A;  5AIX A;  3QAV A;  1X9S B;  4E8H A;  5DAL B;  2WRT A;  4IKH A;  4HU9 A;  4EDY A;  4Z7X A;  3FW2 A;  3LWA A;  2DJ3 A;  3IDV A;  5HFI A;  5KN3 A;  1XWC A;  1RK4 A;  1Z7P A;  2C0G A;  3ED3 A;  2O7K A;  3F4R A;  5J9C A;  1SJI A;  3RHB A;  5B6M A;  2B1L A;  3BD2 A;  3TUE A;  2KHP A;  3FEU A;  2B6M A;  2MMO A;  4LMW A;  2KP1 A;  5ECO B;  4ML6 A;  2HRF A;  4O5R A;  3HYP A;  5CO3 A;  2O8V B;  1SYR A;  2GTU A;  1EOG A;  1SD9 A;  1TRS A;  3QAG A;  2X8G A;  4IJI A;  3Q74 A;  3VFI A;  3IAS 2;  3QFA C;  1WRY A;  3P7X A;  2ES7 A;  5D93 A;  3HCZ A;  2IN3 A;  2CT6 A;  3LFL A;  3TKS E;  1XOA A;  2YV7 A;  1OC9 A;  3WT1 A;  1TKD B;  3ZIV A;  2RUF A;  2H01 A;  3E0U A;  3TOT A;  3Q19 A;  1JLW A;  4HUA A;  1R5P A;  2IFQ A;  4CW9 A;  3M0F A;  1SK0 A;  2MZC A;  1PL2 A;  5LCZ A;  3FR9 A;  5B8B A;  1XWA A;  3I69 A;  1C72 A;  2YWM A;  3CBU A;  1V9W A;  4HJ2 A;  4RUV A;  3FZ9 A;  4LL4 B;  5IOX A;  1A2M A;  4G9H A;  3DKS A;  1OC9 B;  1PN9 A;  2DJK A;  4L5L A;  1K0C A;  4EF0 A;  1H4O A;  2WB9 A;  3IK9 A;  2IFQ B;  4TR4 A;  1A24 A;  1K0N A;  1SKW B;  2LQQ A;  2YCD A;  4OD7 A;  2NVL A;  2AJQ B;  3BJ5 A;  4XS6 A;  1SU9 A;  2IIY A;  3LJR A;  5G2Z A;  3FRC A;  1DE2 A;  2MMA A;  3A2W A;  1AC1 A;  1G6W A;  1O85 A;  2IMF A;  5IMV A;  4IGJ A;  5HFG A;  2H1A A;  5HR3 A;  1CQH A;  3TGZ A;  2OBK A;  2H73 A;  1JZR A;  3DVX A;  4HI7 A;  5JWO B;  2XBI A;  4TW5 A;  1V98 A;  8GSS A;  1Z5Y E;  1WWJ A;  1X5D A;  3CYN A;  3IK7 A;  3Q18 A;  2YPM A;  2JSZ A;  1O8X A;  2RII A;  1X0R A;  2A2S A;  1Z9H A;  1G6Y A;  2GQL A;  4X43 A;  4BPY A;  1TI3 A;  5IM9 A;  4MA9 A;  3ZVJ A;  2YOI A;  4POK A;  2QGV A;  1THX A;  2LNT A;  2BTO T;  2HE3 A;  4O92 A;  2YZU A;  2HFD A;  5G31 A;  1GSE A;  4ISD A;  3IC4 A;  4ZL7 A;  2H75 A;  3C73 A;  1A0F A;  4NPB A;  4OO4 A;  1U87 A;  3NZN A;  2H71 A;  4KSM A;  3GX8 A;  2YWO A;  4PQH A;  4JBB A;  4HZ2 A;  3GST A;  4QL9 A;  1B4P A;  4AJ6 A;  3QR6 A;  3ZFB A;  4N0V A;  4GSS A;  5EY6 A;  4MDC A;  1OYJ A;  3HVX A;  3UBK A;  2F3M A;  5CRE A;  2VM2 A;  3H1N A;  5JCG A;  1XVW A;  4YAV A;  1M2A A;  4IW9 A;  4XTS A;  2TRC P;  4ZL8 A;  1SKR B;  2TRX A;  5F07 A;  1VRS D;  4TXV A;  1RW1 A;  1ZYQ B;  2YJ7 A;  4Q5N A;  4ZBB A;  1JHB A;  5D73 A;  3UOM A;  1FO5 A;  3QCP A;  2K6V A;  4K7N A;  2N5F A;  2FHE A;  4MZB A;  2HLS A;  1FB6 A;  3GA4 A;  2E2G A;  3QOU A;  4N11 A;  5D9V A;  2WCI A;  4GQF A;  4JR6 A;  3WGD A;  3CRU A;  3KTB A;  3E9J B;  1O81 A;  4ZB9 A;  2B7J A;  2HYX A;  4NXI A;  2LRC A;  5EPF A;  1QGV A;  4KDY A;  2JSY A;  2X99 A;  4I6X A;  4O7H A;  5L71 A;  1PX7 A;  3EYT A;  5ECM B;  3FZ5 A;  3KH9 A;  3EU3 A;  1MTC A;  5DCH A;  1VF2 A;  1LJR A;  5D96 A;  4I97 A;  3OR5 A;  1VF4 A;  1K3O A;  1X5E A;  1A2L A;  1OC3 A;  1PKW A;  4V2L A;  1TK0 B;  1ON4 A;  3ZML A;  4NV5 A;  2YWN A;  1J9B A;  1Y25 A;  3ME7 A;  4IS0 A;  3I43 A;  2I9H A;  1M2B A;  2LST A;  4TR0 A;  1G7O A;  1M0U A;  4KE3 A;  2M46 A;  2TIR A;  3F9U A;  4MPG A;  3CTG A;  1HD2 A;  1M9A A;  3ZMK A;  1XWB A;  1AW9 A;  2X64 A;  3N5O A;  3A2X A;  2I81 A;  4JZQ A;  3GIX A;  2PGT A;  4J2F A;  4OFT A;  5DDL A;  3C1R A;  3ME8 A;  2H6Z A;  4YQM A;  1GNW A;  2OAC A;  2FWF A;  2C0F A;  1RQM A;  2ZUP A;  2NBS A;  3ZL5 A;  1ZMA A;  3VUR A;  1G7E A;  4BA7 A;  1TP9 A;  2R5G A;  5AIS A;  3C1S A;  5ECH B;  2F9S A;  3TJG A;  2QC7 A;  4DSQ A;  4POB A;  4BWS A;  4OWY A;  3UVH A;  4TN8 A;  3F6D A;  2LRN A;  3FKF A;  2H6X A;  1B9Y C;  2LKU A;  1TW9 A;  4ILF A;  1SKS B;  3TOU A;  1YDK A;  2DSA A;  1UA5 A;  3ZVJ D;  3DD3 A;  2H0I A;  4GQC A;  6GSW A;  1A23 A;  2VO4 A;  3D0Z A;  4HOJ A;  5EVO A;  5ECN B;  2GT6 A;  2V1M A;  2QKE A;  2YWI A;  1BJX A;  2H1B A;  2JAC A;  1EWX A;  4IJ3 A;  4GSN A;  3UVT A;  5H5R A;  1OKD A;  4PGT A;  7GSS A;  1GL8 A;  3F0I A;  2LJA A;  2GSS A;  4TRX A;  4H86 A;  5D9X A;  4WBJ A;  1F3A A;  5AGY A;  1AXD A;  2G0F A;  4YAP A;  2YZH A;  2VCX A;  4QL7 A;  2DLX A;  2IMK A;  3KEB A;  5A4U A;  1I5G A;  1NHO A;  1S3C A;  2R6K A;  5DJM A;  3M9J A;  4F0C A;  3G7J A;  4ECI A;  4TKY A;  2H1G A;  3F3Q A;  5F0G A;  3UBL A;  1HYU A;  4K1F A;  1T00 A;  4AJ8 A;  5G5E A;  3DGQ A;  1SL2 B;  5DQY A;  1NHY A;  4F82 A;  2LJR A;  2VCT A;  5HQP A;  5JCU A;  3EWL A;  2K8S A;  1OE8 A;  4RQR A;  4K6X A;  1YEP A;  2ZNM A;  5CNW A;  5COH A;  5G30 A;  5ID2 A;  3MSZ A;  2VLU A;  2VCW A;  4L0U A;  2C3N A;  1A2J A;  5H5S A;  1U6T A;  2C0E A;  3APS A;  3HJP A;  1F6M C;  2LEG A;  4PQI A;  2HRN A;  1EEJ A;  3M8N A;  3EU4 A;  2KLX A;  4IQ1 A;  4WF5 A;  1PQN A;  2L6C A;  3LQ7 A;  4JU5 A;  2NDO A;  1TRW A;  4NAX A;  1ST9 A;  3IRA A;  2X8H A;  2C80 A;  4WET A;  5G1L A;  3D4T A;  4D73 A;  3TRQ A;  3GTU A;  4OCF A;  2R2J A;  3CSI A;  3NIV A;  2XC2 A;  2A2R A;  3GMF A;  1SJZ A;  3IPZ A;  1GSD A;  5CP1 A;  2HT9 A;  1TU7 A;  5FT3 A;  2R4V A;  2HI7 A;  3TJF A;  1VF3 A;  1MEK A;  2E0Q A;  2K9F A;  1K0A A;  3JCM L;  3DWV A;  2V32 A;  5IMD A;  2PU9 C;  4FYB A;  4FYU A;  3F8U A;  3K8N A;  1YZX A;  6GSY A;  5HR2 A;  11GS A;  3L9V A;  1TU8 A;  1U3I A;  2O87 A;  3WD6 A;  2F8A A;  2GQM A;  3TJK A;  1N2A A;  3GTU B;  3KP8 A;  3J7Y k;  1HNC A;  3TJJ A;  5B7C A;  3LOR A;  4PUR A;  2E2M A;  2H30 A;  2VL9 A;  4GLT A;  1O7U A;  10GS A;  5INY A;  4F2I A;  3MAK A;  4MCU A;  2YAN A;  3Q6O A;  1T3B A;  3M9K A;  4PQ1 A;  5CYY A;  4PUA A;  1UVZ A;  3IHQ A;  4NMU A;  3IXR A;  2KP2 A;  1R4W A;  2GS3 A;  2EC4 A;  1B9X C;  3UJ1 A;  2B5X A;  4EL1 A;  4TR3 A;  2PWJ A;  1JFU A;  1MD4 A;  4MZW A;  3DIE A;  2REM A;  3TCO A;  1FB0 A;  3VPT A;  4PNG A;  1SL0 B;  2H74 A;  2L5O A;  3MDK A;  2LRT A;  4OMV A;  2ALB A;  2VD1 A;  1GSF A;  1XCC A;  3TKS C;  1OAZ A;  4HZ4 A;  3KTL A;  3EE2 A;  1XW5 A;  4AGS A;  2N5B A;  2AB6 A;  5J3R A;  5A4V A;  3IOS A;  4NHZ A;  2L4C A;  5F8B A;  4AF2 A;  3UIW A;  3M3M A;  1AQW A;  4GRF A;  1Z6N A;  1TDI A;  4EVM A;  2DJ2 A;  1OVN A;  3TRP A;  4MZC A;  1T4Z A;  4GCI A;  3C7M A;  4POM A;  2FA8 A;  2WFC A;  5C00 A;  2LV3 A;  1DBY A;  3KZQ A;  4MK3 A;  3VLN A;  2VCZ A;  1W89 A;  2XPE A;  2VCQ A;  2P5Q A;  2MMZ A;  5D9T A;  2DML A;  2M72 A;  3ISO A;  4GXZ A;  1A8L A;  2H1D A;  5ECS A;  1V2A A;  1O8W A;  3GL3 A;  1DE1 A;  1M2D A;  2IPA A;  3GL5 A;  2IWT A;  4ZL9 A;  3CRT A;  2CA8 A;  4KCA A;  1NM3 A;  2GZP A;  3S9F A;  3LSZ A;  4OCE A;  1XPV A;  3F4S A;  1YF0 A;  2CQ9 A;  1OC8 A;  2DBC A;  4J57 E;  2YJH A;  2DMM A;  2VD0 A;  1T8E B;  5B6N A;  1XW6 A;  1XIY A;  4GWR A;  4V1A p;  3BCI A;  2YP6 A;  4OO5 A;  1ZCP A;  3GUS A;  1R26 A;  1GLQ A;  2WJU A;  4LLR A;  1Q4J A;  3GNJ A;  2H76 A;  3L9S A;  4F0B A;  2H6Y A;  4K7I A;  4GF0 A;  4DSS A;  3VPQ A;  2MMN A;  2H19 A;  4GTU A;  1SYX A;  2E7P A;  2WS2 A;  1GSY A;  3IA1 A;  2I1U A;  1J08 A;  2MBT A;  2IMD A;  2H0G A;  4KW6 A;  2VL2 C;  5FHI A;  4JE1 A;  4MJE A;  3ZFL A;  5LD0 A;  3MWH A;  3KGK A;  1WE0 A;  3RDW A;  4CDO A;  4I2T A;  3GH9 A;  1F9M A;  2HSH A;  4ZB8 A;  5IIZ A;  2D2Z A;  2Z9S A;  1F37 A;  3O6T A;  3FYG A;  3LG6 A;  1QK8 A;  3CXG A;  4F03 A;  5CRW A;  3EC3 A;  3I6A A;  3L0H A;  1TK5 B;  3TKR A;  1O6J A;  3ZTL A;  1A0R P;  1SD8 A;  4ZIL A;  1BAY A;  2O89 A;  1ZOF A;  5IPG A;  4ZB6 A;  4WR5 A;  1ERU A;  1U3A A;  5DBQ A;  3UAP A;  1ILO A;  2L5L A;  5ECL B;  4FO5 A;  1W4V A;  3TKP A;  1EV4 A;  3G7I A;  2FGX A;  4XHM A;  5IQY A;  3UEM A;  2PBJ A;  2FWE A;  2LTK A;  5IOW A;  2B1K A;  3WT2 A;  2CZ2 A;  3CSH A;  5ECQ B;  4XS4 A;  4HJM A;  1PSQ A;  3DRN A;  2ZCT A;  4MAB A;  4K9Z A;  4N30 A;  1EZK A;  2HXK A;  1MDK A;  4G2E A;  4X1U A;  1FVK A;  4XCS A;  2GZY A;  2L4Q A;  1R7H A;  3TRX A;  4ACS A;  3HY2 A;  2N5A A;  1V57 A;  3D5J A;  4WBR D;  3IAM 2;  2RM6 A;  1FAA A;  1ERV A;  1XW9 A;  5JWR B;  1PL1 A;  4XS4 B;  3LGC A;  3L4N A;  9GSS A;  1AQX A;  4BVX A;  1U88 A;  2PUK C;  2JL4 A;  2WDU A;  3LXZ A;  5E4W A;  3U5R E;  2OE1 A;  4NWY A;  1GUK A;  1USB A;  14GS A;  1M9B A;  2C0D A;  3TKS A;  1AUC A;  1XWG A;  1KBN A;  1FG4 A;  1PMT A;  2A4V A;  1AIU A;  16GS A;  3UMA A;  1R5A A;  2FWG A;  2CZ3 A;  1GSS A;  1FHE A;  4MF7 A;  4G19 A;  1F3B A;  4HDE A;  1WPI A;  3HZ4 A;  3D4M A;  2MYG A;  2P31 A;  1GTU A;  1FVJ A;  2DIZ A;  3UAR A;  4WEY A;  4LMV A;  3J7Y b;  2FUG 2;  4KUN A;  5LNK e;  4KND A;  1K0B A;  4V1A g;  1YEX A;  2ON7 A;  1DUG A;  1TOF A;  3P2A A;  4X0X A;  3LXT A;  4EO3 A;  2HSY A;  1ZYE A;  1XBS A;  5ELA A;  1BX9 A;  1Z6M A;  2LUS A;  1DSB A;  1V58 A;  4WR4 A;  2AAW A;  2OA7 A;  4EE0 A;  5A4W A;  2B5E A;  2OAD A;  4WKW A;  3V1W A;  4MLY A;  1IYH A;  1TXX A;  2OE3 A;  2VM1 A;  5J9B A;  3GYK A;  3KMN A;  2R37 A;  2GSQ A;  2DC5 A;  1BQ7 A;  2R3X A;  2B5Y A;  1K0D A;  3GRX A;  4MJC A;  4XRA A;  4DVC A;  1B8X A;  4NV2 A;  1M7T A;  4YQV A;  3KM6 A;  4PXO A;  3F63 A;  4WXT A;  4V2N A;  3CSJ A;  1MD3 A;  3DVW A;  5AN1 A;  5A5K A;  4MH3 A;  22GS A;  3EMX A;  4ZXG A;  3N9J A;  1X9M B;  1IYI A;  5ECI B;  3EMP A;  5J5N A;  1GWC A;  2DJ1 A;  3PIN A;  4BWQ A;  2DJJ A;  2C8U A;  5ECK B;  1B4Q A;  4TR1 A;  4K0G A;  1V40 A;  5D8I A;  1OE7 A;  3VI5 A;  2XPD A;  2VL2 A;  2OJL A;  4XIH A;  2HZF A;  4K2D A;  1ERT A;  3HJO A;  5GAP D;  2IME A;  4PX1 A;  5DAK A;  4IN0 A;  4EKZ A;  4I2U A;  1WIK A;  1O73 A;  3FK8 A;  3CMI A;  3NOF A;  1EOH A;  1UN2 A;  3KP9 A;  2FWH A;  3EVI A;  3P90 A;  4TR1 B;  3A2V A;  3TKQ A;  3HXS A;  4HQS A;  2NPB A;  4JRR A;  5ID2 B;  4K0N A;  1UC7 A;  2RUE A;  1GRX A;  5IO0 A;  1GTA A;  4L0W A;  4IQA A;  4J56 E;  4Q5Q A;  3DYR A;  3I9V 2;  4P3Y B;  3ZRD A;  2VL3 A;  3TJB A;  1JLV A;  2WGR A;  3KXO A;  3DML A;  4K8M A;  1GLP A;  3APQ A;  1PGT A;  2FCH A;  19GS A;  6GSS A;  1F2E A;  3QD9 A;  1X9W B;  4D73 B;  1EV9 A;  3WYW A;  3GKX A;  2X8C A;  1GUM A;  2EIQ A;  18GS A;  6GSX A;  4GST A;  3KMO A;  4ZIJ A;  1WP0 A;  4ID0 A;  5ELG A;  5IMC A;  1Z3E A;  2GQK A;  4EXJ A;  1PD2 1;  2HZE A;  1JZO A;  4MMM A;  2KUC A;  2OKA A;  4KH7 A;  2C4J A;  1Y6E A;  1SJ6 A;  3EUR A;  2CVD A;  1ML6 A;  3ERG A;  5CRH A;  3AY8 A;  3W8J A;  5IPH A;  1T4Y A;  4K7O A;  3M1G A;  2HZE B;  1ERW A;  3APO A;  3FR3 A;  1GTI A;  5C04 A;  2P0G A;  4MP4 A;  4CHS A;  3W6G A;  3HJM A;  5H5Q A;  1GSQ A;  2ON5 A;  3VWX A;  3HZ8 A;  1XWK A;  3BOA A;  3QFB C;  3G7Y A;  1QUW A;  2YNX A;  2M80 A;  1YY7 A;  3ZYW A;  2OE0 A;  4AJ7 A;  2AYT A;  4KGI A;  1PX6 A;  4O32 A;  3QAW A;  5JCW A;  2GVP A;  4YH2 A;  2P5R A;  3IR4 A;  5ECP B;  2VOC A;  4MH2 A;  3PGT A;  1YKC A;  4JR4 A;  4IBP A;  3VWV A;  3IBH A;  4OFN A;  5IMZ A;  3GUR A;  1EP8 A;  3RHC A;  4IP6 A;  1PA3 A;  2DJ0 A;  2VUP A;  1EP7 A;  2JZS A;  2PVO C;  1OKT A;  2IL3 A;  2HNL A;  4TXO A;  1URM A;  2VLV A;  2RM5 A;  1THO A;  2CX3 A;  3GSS A;  2FLS A;  3HD5 A;  2H66 A;  4F9Z A;  2L59 A;  4EUY A;  4POL A;  2L6D A;  4E8E A;  3H8Q A;  1E2Y A;  2FD3 A;  1BG5 A;  3WGE A;  3F6F A;  3KIJ A;  5IO2 A;  4PNF A;  4TXO B;  2YV9 A;  1KTE A;  4TOP A;  3ZIJ A;  1HNA A;  4XS1 A;  1QMV A;  1GNE A;  3FZ4 A;  2L57 A;  5JWQ B;  1TJD A;  2CAQ A;  2IJY A;  4N0Z A;  2H70 A;  1HNB A;  1GP1 A;  3GX0 A;  1AAZ A;  3SWL A;  1XZO A;  1TI1 A;  4L8E A;  1QQ2 A;  3H4K A;  3L9U A;  4LL1 B;  2K18 A;  5HR1 A;  1EGR A;  2PPT A;  1PKZ A;  2BJX A;  2DIY A;  3QPM A;  3IE3 A;  4KX4 A;  2YN1 A;  3TB2 A;  1Q98 A;  2I3Y A;  4Q5F A;  3BCK A;  1KNG A;  1X5C A;  2WUL A;  1E6B A;  4OFM A;  1SEN A;  3SBC A;  2GST A;  5D9W A;  1N8J A; 
#chains in the Genus database with same CATH topology
 4RI7 A;  4YQU A;  2HRA A;  3ERW A;  1LBK A;  1XOB A;  3FR6 A;  2WZ9 A;  1ABA A;  4KCE A;  4KDX A;  2QA2 A;  4ECB A;  2RLI A;  4DSR A;  2C3Q A;  2LS5 A;  4RQX A;  1PFO A;  5IMF A;  2MBS A;  5ECR B;  1S3A A;  4DSS B;  4WF4 A;  3D6I A;  1T7P B;  4HQZ A;  2NTO A;  4KA0 A;  3RBT A;  4A5P A;  3HA9 A;  2AV4 A;  5E59 A;  1CQG A;  3O3T A;  3LEF A;  2H0H A;  1WJK A;  4FH8 A;  1B48 A;  1ACV A;  2KOK A;  1ZGN A;  2B7K A;  3IV4 A;  2LJK A;  5F06 A;  4MNN A;  4N10 A;  3KCM A;  1SK1 A;  1TTZ A;  2X4A A;  3C71 A;  4I8B A;  4HEA 2;  4BIK A;  5CAX A;  5B8A A;  3W8S A;  2IMI A;  1H75 A;  3A5W A;  2J9H A;  5CRG A;  4ZBA A;  1SK2 A;  3CTF A;  4I5Q A;  5KEJ A;  4FYC A;  2EIO A;  5G1K A;  3RPN A;  4CY6 A;  2CV4 A;  1M99 A;  1JZW A;  1I9D A;  4EDZ A;  3F4T A;  4IP1 A;  1S3R A;  1J0F A;  5G5F A;  3ZIT A;  5GAN D;  4K2X A;  4ECC A;  2VIM A;  3GV1 A;  1WOU A;  3FHK A;  4JED A;  2BMX A;  1K3Y A;  5ENU A;  1JZD A;  3E3E A;  3R2Q A;  1EGO A;  2DKI A;  4Z2R A;  1WMJ A;  3GKM A;  4ML1 A;  2R0G A;  3VI7 A;  1K0M A;  3VK9 A;  5KN0 A;  6GSV A;  4KSO A;  4MF6 A;  1YKA A;  4PUF C;  5DJL A;  1K0O A;  4BVY A;  20GS A;  3A3T A;  1NW2 A;  3QMX A;  5GST A;  2PVQ A;  2AUV A;  3HVV A;  2GZZ A;  2CVB A;  3MNG A;  4HSC X;  3PPU A;  2QA1 A;  5F05 A;  1YJ6 A;  3FMW A;  2CAI A;  5IMA A;  2HRK A;  1QXH A;  1FW1 A;  2XBQ A;  3WGX A;  5DVB A;  3DXB A;  2GLR A;  3D22 A;  4MJB A;  4KB3 A;  1TK8 B;  3HVS A;  4BVY B;  1S3D A;  2FA4 A;  4KDU A;  13GS A;  1XXU A;  3RPP A;  4LA1 A;  2XHF A;  3TDG A;  1EEM A;  4FQU A;  1YQ1 A;  5EL8 A;  2B3S A;  1K3L A;  3GKK A;  5AIV A;  3P8W A;  3LYK A;  1KEB A;  1MDI A;  1Z7R A;  1ZZY A;  2VLT A;  2LNS A;  2PER A;  2K8V A;  4G10 A;  3ZRE A;  5KOX A;  5DQS A;  4MF5 A;  4QQ7 A;  3FY7 A;  2V41 A;  4G0L A;  1YF1 A;  3HKR A;  1PRX A;  4IHU A;  2AHE A;  4ECJ A;  1FOH A;  6GST A;  2UZ8 A;  3QDN A;  4HU7 A;  3L78 A;  3C8E A;  1BYE A;  5HR0 A;  2JU5 A;  3O76 A;  4TVE A;  5DCG A;  4RI6 A;  3GH6 A;  3GN3 A;  1LU4 A;  3UL3 A;  1TRV A;  4XRD A;  1MDJ A;  1VF1 A;  3G9B A;  3LYP A;  2FY6 A;  2GDR A;  5KN2 A;  2V2G A;  5KN1 A;  4V2M A;  3ZZX A;  2CX4 A;  2O85 A;  1T1V A;  2VAF A;  1HQO A;  3H93 A;  1GH2 A;  3GFK A;  4IEL A;  1AQV A;  2C1Y A;  2EIR A;  2GT5 A;  3BBY A;  3PR8 A;  4DEJ A;  12GS A;  5CRD A;  2GSR A;  2V6K A;  2G2Q A;  2H72 A;  1SL1 B;  4EC0 A;  4BL7 A;  2QSI A;  5GZZ B;  3ZLP A;  1GUL A;  3KJY A;  3RAZ A;  1VGL A;  3PH9 A;  3GHA A;  1GTB A;  4FIW A;  1G0T A;  5GSS A;  1GSU A;  2C3T A;  1ZL9 A;  4MJA A;  4MPF A;  1NSW A;  4IVF A;  2F8F A;  2GGT A;  1GUH A;  1QFN A;  3A5I A;  2VCV A;  2PN8 A;  3HHV A;  2J23 A;  4BL7 B;  2PMT A;  2F51 A;  4KAE A;  4L5O A;  2OBI A;  2V6O A;  3U6V A;  3DEX A;  1XFL A;  1BED A;  3VWU A;  4HS1 A;  1A8Y A;  1TRU A;  3D21 A;  4NHW A;  5HFK A;  3HDC A;  3VWW A;  4K5R A;  5DAL A;  3US3 A;  4ULX A;  4ZBD A;  2JZR A;  5DAK B;  3EIN A;  5ABR A;  3FZA A;  1FOV A;  4Q5R A;  3ERF A;  5J41 A;  2H8L A;  6GSU A;  3HVN A;  2JZT A;  3H79 A;  1XVQ A;  2CVK A;  3GKN A;  2JAD A;  5J4U A;  5FWG A;  2LQO A;  3KH7 A;  17GS A;  3KD0 A;  2FNO A;  3F3R A;  2I4A A;  5AIX A;  3QAV A;  1X9S B;  4E8H A;  5DAL B;  2WRT A;  4IKH A;  4HU9 A;  4EDY A;  4Z7X A;  3FW2 A;  3LWA A;  2DJ3 A;  3IDV A;  5HFI A;  5KN3 A;  1XWC A;  1RK4 A;  1Z7P A;  4EIP A;  2C0G A;  3ED3 A;  2O7K A;  3F4R A;  5J9C A;  1SJI A;  3RHB A;  5B6M A;  2B1L A;  3BD2 A;  3TUE A;  2KHP A;  3FEU A;  2B6M A;  2MMO A;  4ICY A;  4LMW A;  2KP1 A;  5ECO B;  4ML6 A;  2HRF A;  4O5R A;  3HYP A;  5CO3 A;  2O8V B;  1SYR A;  2GTU A;  1EOG A;  1SD9 A;  1TRS A;  3QAG A;  2X8G A;  4IJI A;  3Q74 A;  3VFI A;  3IAS 2;  3QFA C;  1WRY A;  3P7X A;  2ES7 A;  5D93 A;  3HCZ A;  2IN3 A;  2CT6 A;  3LFL A;  3TKS E;  1XOA A;  2YV7 A;  1OC9 A;  3WT1 A;  1TKD B;  3ZIV A;  2RUF A;  2H01 A;  3E0U A;  3TOT A;  3Q19 A;  1JLW A;  4HUA A;  1R5P A;  2IFQ A;  4CW9 A;  3M0F A;  1SK0 A;  2MZC A;  1PL2 A;  5LCZ A;  3FR9 A;  5B8B A;  1XWA A;  3I69 A;  1C72 A;  2YWM A;  3CBU A;  1V9W A;  4HJ2 A;  4RUV A;  3FZ9 A;  4LL4 B;  5IOX A;  1A2M A;  4G9H A;  3DKS A;  1OC9 B;  1PN9 A;  2DJK A;  4L5L A;  1K0C A;  4EF0 A;  1H4O A;  2WB9 A;  3IK9 A;  2IFQ B;  4TR4 A;  1A24 A;  1K0N A;  1SKW B;  2LQQ A;  2YCD A;  4OD7 A;  2NVL A;  2AJQ B;  3BJ5 A;  4XS6 A;  1SU9 A;  2IIY A;  3LJR A;  5G2Z A;  3FRC A;  1DE2 A;  2MMA A;  3A2W A;  1AC1 A;  1G6W A;  1O85 A;  2IMF A;  5IMV A;  4IGJ A;  5HFG A;  2H1A A;  5HR3 A;  1CQH A;  2A2P A;  3TGZ A;  2OBK A;  2H73 A;  1JZR A;  3DVX A;  4HI7 A;  5JWO B;  2XBI A;  4G0K A;  4TW5 A;  1V98 A;  8GSS A;  1Z5Y E;  1WWJ A;  1X5D A;  3MYD A;  3CYN A;  3IK7 A;  3Q18 A;  2YPM A;  2JSZ A;  1O8X A;  2RII A;  1X0R A;  2A2S A;  1Z9H A;  1G6Y A;  2GQL A;  4X43 A;  2A4H A;  4BPY A;  1TI3 A;  5IM9 A;  4MA9 A;  3ZVJ A;  2YOI A;  4POK A;  2QGV A;  1THX A;  2LNT A;  2BTO T;  2HE3 A;  4O92 A;  2YZU A;  2HFD A;  5G31 A;  1GSE A;  4ISD A;  3IC4 A;  4ZL7 A;  2H75 A;  3C73 A;  1A0F A;  4NPB A;  4OO4 A;  1U87 A;  3NZN A;  2H71 A;  4KSM A;  5BMU A;  3GX8 A;  2YWO A;  4PQH A;  4JBB A;  4HZ2 A;  3GST A;  4QL9 A;  1ZYN A;  1B4P A;  4AJ6 A;  3QR6 A;  3ZFB A;  4N0V A;  4GSS A;  5EY6 A;  4MDC A;  1OYJ A;  3HVX A;  3UBK A;  2F3M A;  5CRE A;  2VM2 A;  3H1N A;  5JCG A;  1XVW A;  4YAV A;  1M2A A;  4IW9 A;  4XTS A;  2TRC P;  4ZL8 A;  1SKR B;  4YKG A;  2TRX A;  5F07 A;  1VRS D;  4TXV A;  1RW1 A;  1ZYQ B;  2YJ7 A;  4Q5N A;  4ZBB A;  1JHB A;  5D73 A;  3UOM A;  1FO5 A;  3QCP A;  2K6V A;  4K7N A;  2N5F A;  2FHE A;  4MZB A;  2HLS A;  1FB6 A;  3GA4 A;  2E2G A;  3QOU A;  4N11 A;  5D9V A;  2WCI A;  4GQF A;  4JR6 A;  3WGD A;  3CRU A;  3KTB A;  3E9J B;  1O81 A;  4ZB9 A;  2B7J A;  2HYX A;  4NXI A;  2LRC A;  5EPF A;  1QGV A;  4KDY A;  2JSY A;  2X99 A;  4I6X A;  4O7H A;  5L71 A;  1PX7 A;  3EYT A;  5ECM B;  3FZ5 A;  3KH9 A;  3EU3 A;  1MTC A;  5DCH A;  1VF2 A;  1LJR A;  4I97 A;  5D96 A;  3OR5 A;  1VF4 A;  1K3O A;  1X5E A;  1A2L A;  1OC3 A;  1PKW A;  4V2L A;  1TK0 B;  1ON4 A;  3ZML A;  4NV5 A;  2YWN A;  1J9B A;  1Y25 A;  3ME7 A;  4IS0 A;  3I43 A;  2I9H A;  1M2B A;  2LST A;  4TR0 A;  1G7O A;  1M0U A;  4KE3 A;  2M46 A;  2TIR A;  3F9U A;  4MPG A;  3CTG A;  1HD2 A;  1M9A A;  4O5Q A;  3ZMK A;  1XWB A;  1AW9 A;  2X64 A;  3EPT A;  3N5O A;  3A2X A;  2I81 A;  4JZQ A;  3GIX A;  2PGT A;  2DKH A;  4J2F A;  4OFT A;  5DDL A;  3C1R A;  3ME8 A;  2H6Z A;  1GNW A;  2OAC A;  4YQM A;  2FWF A;  2C0F A;  1RQM A;  2ZUP A;  2NBS A;  4PTS A;  3ZL5 A;  1ZMA A;  3VUR A;  1G7E A;  4BA7 A;  1TP9 A;  2R5G A;  5AIS A;  3C1S A;  5ECH B;  2F9S A;  3TJG A;  2QC7 A;  4DSQ A;  4POB A;  4BWS A;  4OWY A;  3UVH A;  4TN8 A;  3F6D A;  2LRN A;  3FKF A;  2H6X A;  1B9Y C;  2LKU A;  1TW9 A;  4ILF A;  1SKS B;  3TOU A;  1YDK A;  2DSA A;  1UA5 A;  3ZVJ D;  3DD3 A;  4USS A;  2H0I A;  4GQC A;  6GSW A;  1A23 A;  2VO4 A;  3D0Z A;  4HOJ A;  5EVO A;  2R0P A;  5ECN B;  2GT6 A;  2V1M A;  2QKE A;  2YWI A;  1BJX A;  2H1B A;  2JAC A;  1EWX A;  4IJ3 A;  4GSN A;  3UVT A;  5H5R A;  1OKD A;  4PGT A;  7GSS A;  1GL8 A;  4Z2T A;  3F0I A;  2LJA A;  2GSS A;  4TRX A;  4H86 A;  5D9X A;  4WBJ A;  3IC8 A;  1F3A A;  5AGY A;  1AXD A;  2G0F A;  4YAP A;  2YZH A;  2VCX A;  4QL7 A;  2DLX A;  2IMK A;  3KEB A;  5A4U A;  1I5G A;  1NHO A;  1S3C A;  2R6K A;  5DJM A;  3M9J A;  4F0C A;  3G7J A;  4ECI A;  4TKY A;  2H1G A;  3F3Q A;  5F0G A;  3UBL A;  1HYU A;  4K1F A;  1T00 A;  4AJ8 A;  5G5E A;  3DGQ A;  1SL2 B;  5DQY A;  1NHY A;  4F82 A;  2LJR A;  2VCT A;  5HQP A;  5JCU A;  3EWL A;  2K8S A;  1OE8 A;  4RQR A;  4K6X A;  1YEP A;  2ZNM A;  5CNW A;  5COH A;  5G30 A;  5ID2 A;  3MSZ A;  2VLU A;  2VCW A;  4L0U A;  2C3N A;  1A2J A;  5H5S A;  1U6T A;  2C0E A;  4O5U A;  3APS A;  3HJP A;  1F6M C;  2LEG A;  4PQI A;  2HRN A;  1EEJ A;  3M8N A;  3EU4 A;  2KLX A;  4G0I A;  4IQ1 A;  4WF5 A;  1PQN A;  2L6C A;  3LQ7 A;  4JU5 A;  2NDO A;  1TRW A;  4NAX A;  1ST9 A;  3IRA A;  2X8H A;  2C80 A;  4WET A;  5G1L A;  3D4T A;  4D73 A;  3TRQ A;  3GTU A;  4OCF A;  2R2J A;  3CSI A;  3NIV A;  2XC2 A;  2A2R A;  3GMF A;  1SJZ A;  3IPZ A;  1GSD A;  5CP1 A;  2HT9 A;  1TU7 A;  5FT3 A;  2R4V A;  2HI7 A;  3TJF A;  1VF3 A;  1MEK A;  2E0Q A;  2K9F A;  1K0A A;  3JCM L;  3DWV A;  2V32 A;  5IMD A;  2PU9 C;  4FYB A;  4FYU A;  3F8U A;  3K8N A;  1YZX A;  6GSY A;  5HR2 A;  11GS A;  3L9V A;  1TU8 A;  1U3I A;  2O87 A;  3WD6 A;  2F8A A;  2GQM A;  3TJK A;  1N2A A;  3GTU B;  3KP8 A;  3J7Y k;  1HNC A;  3TJJ A;  5B7C A;  3LOR A;  4X4J A;  4PUR A;  2E2M A;  2H30 A;  2VL9 A;  4GLT A;  1O7U A;  10GS A;  5INY A;  4F2I A;  3MAK A;  4MCU A;  2YAN A;  3Q6O A;  1T3B A;  3M9K A;  4PQ1 A;  5CYY A;  4PUA A;  1UVZ A;  3IHQ A;  4NMU A;  3IXR A;  2KP2 A;  1R4W A;  2GS3 A;  2EC4 A;  1B9X C;  3UJ1 A;  2B5X A;  4EL1 A;  4TR3 A;  2PWJ A;  1JFU A;  1MD4 A;  4MZW A;  3DIE A;  2REM A;  3TCO A;  1FB0 A;  3VPT A;  4PNG A;  1SL0 B;  2H74 A;  2L5O A;  3MDK A;  2LRT A;  4OMV A;  2ALB A;  2VD1 A;  1GSF A;  1XCC A;  3TKS C;  1OAZ A;  4HZ4 A;  3KTL A;  3EE2 A;  1XW5 A;  4AGS A;  2N5B A;  2AB6 A;  5J3R A;  5A4V A;  3IOS A;  4NHZ A;  2L4C A;  5F8B A;  4AF2 A;  3UIW A;  3M3M A;  1AQW A;  4GRF A;  1Z6N A;  1TDI A;  4EVM A;  2DJ2 A;  1OVN A;  3TRP A;  4MZC A;  1T4Z A;  4GCI A;  3C7M A;  4POM A;  2FA8 A;  2WFC A;  5C00 A;  2LV3 A;  1DBY A;  3KZQ A;  4MK3 A;  3VLN A;  2VCZ A;  1W89 A;  2XPE A;  2VCQ A;  2P5Q A;  2MMZ A;  5D9T A;  2DML A;  2M72 A;  3ISO A;  5KOW A;  4GXZ A;  1A8L A;  2H1D A;  5ECS A;  1V2A A;  1O8W A;  3GL3 A;  1DE1 A;  1M2D A;  2IPA A;  3GL5 A;  2IWT A;  4ZL9 A;  3CRT A;  2CA8 A;  4KCA A;  1NM3 A;  2GZP A;  3S9F A;  3LSZ A;  4OCE A;  1XPV A;  3F4S A;  1YF0 A;  2CQ9 A;  1OC8 A;  2DBC A;  4J57 E;  2YJH A;  2DMM A;  2VD0 A;  1T8E B;  5B6N A;  1XW6 A;  1XIY A;  4GWR A;  4V1A p;  3BCI A;  2YP6 A;  4OO5 A;  1ZCP A;  2R0C A;  3GUS A;  2X49 A;  1R26 A;  1GLQ A;  2WJU A;  4LLR A;  1Q4J A;  3GNJ A;  2H76 A;  3L9S A;  3CQF A;  2H6Y A;  4F0B A;  4K7I A;  4GF0 A;  5BRT A;  4DSS A;  3VPQ A;  2MMN A;  2H19 A;  4GTU A;  1SYX A;  2E7P A;  2WS2 A;  1GSY A;  3IA1 A;  2I1U A;  1J08 A;  2MBT A;  2IMD A;  2H0G A;  4KW6 A;  2VL2 C;  5FHI A;  4JE1 A;  4MJE A;  3ZFL A;  5LD0 A;  3MWH A;  3KGK A;  1WE0 A;  3RDW A;  4CDO A;  4I2T A;  3GH9 A;  1F9M A;  2HSH A;  4ZB8 A;  5IIZ A;  4KF9 A;  2D2Z A;  2Z9S A;  1F37 A;  3O6T A;  3FYG A;  3LG6 A;  1QK8 A;  3CXG A;  4F03 A;  5CRW A;  3EC3 A;  3I6A A;  3L0H A;  1TK5 B;  3TKR A;  1O6J A;  3ZTL A;  1A0R P;  1SD8 A;  4ZIL A;  1BAY A;  2O89 A;  1ZOF A;  5IPG A;  4ZB6 A;  4WR5 A;  1ERU A;  1U3A A;  5DBQ A;  3UAP A;  1ILO A;  2L5L A;  5ECL B;  4FO5 A;  1W4V A;  3TKP A;  1EV4 A;  3G7I A;  2FGX A;  4XHM A;  5IQY A;  3UEM A;  2PBJ A;  2FWE A;  2LTK A;  5IOW A;  2B1K A;  3WT2 A;  2CZ2 A;  3CSH A;  5ECQ B;  4XS4 A;  4HJM A;  1PSQ A;  3DRN A;  2ZCT A;  4MAB A;  4K9Z A;  4N30 A;  1EZK A;  2HXK A;  1MDK A;  4G2E A;  4X1U A;  1FVK A;  4XCS A;  2GZY A;  2L4Q A;  1R7H A;  3TRX A;  4ACS A;  3HY2 A;  2N5A A;  1V57 A;  3D5J A;  4WBR D;  3IAM 2;  2RM6 A;  1FAA A;  1ERV A;  1XW9 A;  5JWR B;  1PL1 A;  4XS4 B;  3LGC A;  3L4N A;  9GSS A;  1AQX A;  4BVX A;  1U88 A;  2PUK C;  2JL4 A;  2WDU A;  3LXZ A;  5E4W A;  3U5R E;  2OE1 A;  4NWY A;  1GUK A;  1USB A;  14GS A;  1M9B A;  2C0D A;  3TKS A;  1AUC A;  1XWG A;  1KBN A;  1FG4 A;  1PMT A;  2A4V A;  1AIU A;  16GS A;  3UMA A;  4BVX B;  1R5A A;  2FWG A;  2CZ3 A;  1GSS A;  1FHE A;  4MF7 A;  4G19 A;  1F3B A;  4HDE A;  1WPI A;  3HZ4 A;  3D4M A;  2MYG A;  2P31 A;  1GTU A;  1FVJ A;  2DIZ A;  3UAR A;  4WEY A;  4LMV A;  3J7Y b;  2FUG 2;  4KUN A;  5LNK e;  4KND A;  1K0B A;  4V1A g;  1YEX A;  2ON7 A;  1DUG A;  1TOF A;  4CY8 A;  3P2A A;  4X0X A;  3LXT A;  4EO3 A;  2HSY A;  1ZYE A;  1XBS A;  5ELA A;  1BX9 A;  1Z6M A;  2LUS A;  1DSB A;  1V58 A;  4WR4 A;  2AAW A;  2OA7 A;  4EE0 A;  5A4W A;  2B5E A;  2OAD A;  3R3E A;  4WKW A;  3V1W A;  4MLY A;  1IYH A;  1TXX A;  2OE3 A;  2VM1 A;  5J9B A;  3GYK A;  3KMN A;  2R37 A;  2GSQ A;  2DC5 A;  1BQ7 A;  2R3X A;  2B5Y A;  1K0D A;  4EIQ A;  3GRX A;  4MJC A;  4XRA A;  4DVC A;  1B8X A;  4NV2 A;  1M7T A;  4YQV A;  3IHG A;  3KM6 A;  4PXO A;  3F63 A;  4WXT A;  4V2N A;  3CSJ A;  1MD3 A;  3DVW A;  5AN1 A;  5A5K A;  4MH3 A;  22GS A;  3EMX A;  4ZXG A;  3N9J A;  1X9M B;  1IYI A;  5ECI B;  3EMP A;  5J5N A;  1GWC A;  2DJ1 A;  3PIN A;  4BWQ A;  2DJJ A;  2C8U A;  5ECK B;  1B4Q A;  4TR1 A;  4K0G A;  1V40 A;  5D8I A;  1OE7 A;  3VI5 A;  2XPD A;  2VL2 A;  2OJL A;  4XIH A;  2HZF A;  4K2D A;  1ERT A;  3HJO A;  1XG8 A;  5GAP D;  2IME A;  4PX1 A;  5DAK A;  4IN0 A;  4EKZ A;  4I2U A;  1WIK A;  1O73 A;  3FK8 A;  3CMI A;  3NOF A;  1EOH A;  1UN2 A;  3KP9 A;  3LW9 A;  2FWH A;  3EVI A;  3P90 A;  4TR1 B;  3A2V A;  3TKQ A;  3HXS A;  4HQS A;  2NPB A;  4JRR A;  5ID2 B;  4K0N A;  1UC7 A;  4Z2U A;  2RUE A;  1GRX A;  1ZYP A;  5IO0 A;  1GTA A;  4L0W A;  4IQA A;  4J56 E;  4Q5Q A;  3DYR A;  3I9V 2;  4P3Y B;  3ZRD A;  2VL3 A;  3TJB A;  1JLV A;  2WGR A;  3KXO A;  3DML A;  4K8M A;  1GLP A;  3APQ A;  1PGT A;  2FCH A;  19GS A;  6GSS A;  1F2E A;  3QD9 A;  1X9W B;  4D73 B;  1EV9 A;  3WYW A;  3GKX A;  2X8C A;  1GUM A;  2EIQ A;  18GS A;  6GSX A;  4GST A;  3KMO A;  4ZIJ A;  1WP0 A;  4ID0 A;  5ELG A;  5IMC A;  1Z3E A;  2GQK A;  4EXJ A;  1PD2 1;  2HZE A;  1JZO A;  4MMM A;  2KUC A;  2OKA A;  4KH7 A;  2C4J A;  1Y6E A;  1SJ6 A;  3EUR A;  2CVD A;  1ML6 A;  3ERG A;  5CRH A;  3AY8 A;  3W8J A;  5IPH A;  1T4Y A;  4K7O A;  3M1G A;  2HZE B;  1ERW A;  3APO A;  3FR3 A;  1GTI A;  5C04 A;  2P0G A;  4MP4 A;  4CHS A;  2HSM A;  3W6G A;  3HJM A;  5H5Q A;  1GSQ A;  2ON5 A;  3VWX A;  3HZ8 A;  1XWK A;  3BOA A;  3QFB C;  4YKF A;  3G7Y A;  1QUW A;  2YNX A;  2M80 A;  1YY7 A;  3ZYW A;  2OE0 A;  4AJ7 A;  2AYT A;  4KGI A;  1PX6 A;  4O32 A;  3QAW A;  5JCW A;  2GVP A;  4YH2 A;  2P5R A;  3IR4 A;  5ECP B;  2VOC A;  4MH2 A;  3PGT A;  1YKC A;  4JR4 A;  4IBP A;  3VWV A;  3IBH A;  4OFN A;  5IMZ A;  3GUR A;  1EP8 A;  3RHC A;  4IP6 A;  1PA3 A;  2DJ0 A;  2VUP A;  1EP7 A;  2JZS A;  2PVO C;  1OKT A;  4K5S A;  2IL3 A;  2HNL A;  4TXO A;  1URM A;  2VLV A;  2RM5 A;  1THO A;  2CX3 A;  3GSS A;  1PN0 A;  2FLS A;  3HD5 A;  2H66 A;  4F9Z A;  2L59 A;  4EUY A;  4POL A;  2L6D A;  4E8E A;  3H8Q A;  1M3I A;  1M3J A;  1E2Y A;  2FD3 A;  1BG5 A;  3WGE A;  3F6F A;  3KIJ A;  5IO2 A;  4PNF A;  4TXO B;  2YV9 A;  1KTE A;  4TOP A;  3ZIJ A;  1HNA A;  4XS1 A;  1QMV A;  1GNE A;  3FZ4 A;  2L57 A;  5JWQ B;  1TJD A;  2CAQ A;  2IJY A;  4N0Z A;  2H70 A;  1HNB A;  1GP1 A;  3GX0 A;  1AAZ A;  3SWL A;  1XZO A;  1TI1 A;  4L8E A;  1QQ2 A;  3H4K A;  3MIX A;  3L9U A;  4LL1 B;  2K18 A;  5HR1 A;  1EGR A;  2PPT A;  1PKZ A;  2BJX A;  2DIY A;  3QPM A;  3IE3 A;  4KX4 A;  2YN1 A;  3TB2 A;  1Q98 A;  2I3Y A;  4Q5F A;  3BCK A;  1KNG A;  1X5C A;  2WUL A;  1E6B A;  4OFM A;  1SEN A;  3SBC A;  2GST A;  5D9W A;  1N8J A; 
#chains in the Genus database with same CATH homology
 4RI7 A;  4YQU A;  2HRA A;  3ERW A;  1LBK A;  1XOB A;  3FR6 A;  2WZ9 A;  1ABA A;  4KCE A;  4KDX A;  2QA2 A;  4ECB A;  2RLI A;  4DSR A;  2C3Q A;  2LS5 A;  4RQX A;  5IMF A;  2MBS A;  5ECR B;  1S3A A;  4DSS B;  4WF4 A;  3D6I A;  1T7P B;  4HQZ A;  2NTO A;  4KA0 A;  3RBT A;  4A5P A;  3HA9 A;  2AV4 A;  5E59 A;  1CQG A;  3O3T A;  3LEF A;  2H0H A;  1WJK A;  4FH8 A;  1B48 A;  1ACV A;  2KOK A;  1ZGN A;  2B7K A;  3IV4 A;  2LJK A;  5F06 A;  4MNN A;  4N10 A;  3KCM A;  1SK1 A;  1TTZ A;  2X4A A;  3C71 A;  4I8B A;  4HEA 2;  5CAX A;  5B8A A;  3W8S A;  2IMI A;  1H75 A;  3A5W A;  2J9H A;  5CRG A;  4ZBA A;  1SK2 A;  3CTF A;  4I5Q A;  5KEJ A;  4FYC A;  2EIO A;  5G1K A;  3RPN A;  4CY6 A;  2CV4 A;  1M99 A;  1JZW A;  1I9D A;  4EDZ A;  3F4T A;  4IP1 A;  1J0F A;  5G5F A;  3ZIT A;  5GAN D;  4K2X A;  4ECC A;  2VIM A;  3GV1 A;  1WOU A;  3FHK A;  4JED A;  2BMX A;  1K3Y A;  5ENU A;  1JZD A;  3E3E A;  3R2Q A;  1EGO A;  2DKI A;  4Z2R A;  1WMJ A;  3GKM A;  4ML1 A;  2R0G A;  3VI7 A;  1K0M A;  3VK9 A;  5KN0 A;  6GSV A;  4KSO A;  4MF6 A;  1YKA A;  4PUF C;  5DJL A;  1K0O A;  4BVY A;  20GS A;  3A3T A;  1NW2 A;  3QMX A;  5GST A;  2PVQ A;  2AUV A;  3HVV A;  2GZZ A;  2CVB A;  3MNG A;  3PPU A;  2QA1 A;  5F05 A;  1YJ6 A;  3FMW A;  2CAI A;  5IMA A;  2HRK A;  1QXH A;  1FW1 A;  2XBQ A;  3WGX A;  5DVB A;  3DXB A;  2GLR A;  3D22 A;  4MJB A;  4KB3 A;  1TK8 B;  3HVS A;  4BVY B;  1S3D A;  2FA4 A;  4KDU A;  13GS A;  1XXU A;  3RPP A;  4LA1 A;  2XHF A;  3TDG A;  1EEM A;  4FQU A;  1YQ1 A;  5EL8 A;  2B3S A;  1K3L A;  3GKK A;  5AIV A;  3P8W A;  3LYK A;  1KEB A;  1MDI A;  1Z7R A;  1ZZY A;  2VLT A;  2LNS A;  2PER A;  2K8V A;  4G10 A;  3ZRE A;  5KOX A;  5DQS A;  4MF5 A;  4QQ7 A;  3FY7 A;  2V41 A;  4G0L A;  1YF1 A;  3HKR A;  1PRX A;  4IHU A;  2AHE A;  4ECJ A;  1FOH A;  6GST A;  2UZ8 A;  3QDN A;  4HU7 A;  3L78 A;  3C8E A;  1BYE A;  5HR0 A;  2JU5 A;  3O76 A;  4TVE A;  5DCG A;  4RI6 A;  3GH6 A;  3GN3 A;  1LU4 A;  3UL3 A;  1TRV A;  4XRD A;  1MDJ A;  1VF1 A;  3G9B A;  3LYP A;  2FY6 A;  2GDR A;  5KN2 A;  2V2G A;  5KN1 A;  4V2M A;  3ZZX A;  2CX4 A;  2O85 A;  1T1V A;  2VAF A;  1HQO A;  3H93 A;  1GH2 A;  3GFK A;  4IEL A;  1AQV A;  2C1Y A;  2EIR A;  2GT5 A;  3BBY A;  3PR8 A;  4DEJ A;  12GS A;  5CRD A;  2GSR A;  2V6K A;  2G2Q A;  2H72 A;  1SL1 B;  4EC0 A;  4BL7 A;  2QSI A;  5GZZ B;  3ZLP A;  1GUL A;  3KJY A;  3RAZ A;  1VGL A;  3PH9 A;  3GHA A;  1GTB A;  4FIW A;  1G0T A;  5GSS A;  1GSU A;  2C3T A;  1ZL9 A;  4MJA A;  4MPF A;  1NSW A;  4IVF A;  2F8F A;  2GGT A;  1GUH A;  1QFN A;  3A5I A;  2VCV A;  2PN8 A;  3HHV A;  2J23 A;  4BL7 B;  2PMT A;  2F51 A;  4KAE A;  4L5O A;  2OBI A;  2V6O A;  3U6V A;  3DEX A;  1XFL A;  1BED A;  3VWU A;  4HS1 A;  1A8Y A;  1TRU A;  3D21 A;  4NHW A;  5HFK A;  3HDC A;  3VWW A;  4K5R A;  5DAL A;  3US3 A;  4ULX A;  4ZBD A;  2JZR A;  5DAK B;  3EIN A;  5ABR A;  3FZA A;  1FOV A;  4Q5R A;  3ERF A;  5J41 A;  2H8L A;  6GSU A;  2JZT A;  3H79 A;  1XVQ A;  2CVK A;  3GKN A;  2JAD A;  5J4U A;  5FWG A;  2LQO A;  3KH7 A;  17GS A;  3KD0 A;  2FNO A;  3F3R A;  2I4A A;  5AIX A;  3QAV A;  1X9S B;  4E8H A;  5DAL B;  2WRT A;  4IKH A;  4HU9 A;  4EDY A;  4Z7X A;  3FW2 A;  3LWA A;  2DJ3 A;  3IDV A;  5HFI A;  5KN3 A;  1XWC A;  1RK4 A;  1Z7P A;  4EIP A;  2C0G A;  3ED3 A;  2O7K A;  3F4R A;  5J9C A;  1SJI A;  3RHB A;  5B6M A;  2B1L A;  3BD2 A;  3TUE A;  2KHP A;  3FEU A;  2B6M A;  2MMO A;  4ICY A;  4LMW A;  2KP1 A;  5ECO B;  4ML6 A;  2HRF A;  4O5R A;  3HYP A;  5CO3 A;  2O8V B;  1SYR A;  2GTU A;  1EOG A;  1SD9 A;  1TRS A;  3QAG A;  2X8G A;  4IJI A;  3Q74 A;  3VFI A;  3IAS 2;  3QFA C;  1WRY A;  3P7X A;  2ES7 A;  5D93 A;  3HCZ A;  2IN3 A;  2CT6 A;  3LFL A;  3TKS E;  1XOA A;  2YV7 A;  1OC9 A;  3WT1 A;  1TKD B;  3ZIV A;  2RUF A;  2H01 A;  3E0U A;  3TOT A;  3Q19 A;  1JLW A;  4HUA A;  1R5P A;  2IFQ A;  4CW9 A;  3M0F A;  1SK0 A;  2MZC A;  1PL2 A;  5LCZ A;  3FR9 A;  5B8B A;  1XWA A;  3I69 A;  1C72 A;  2YWM A;  3CBU A;  1V9W A;  4HJ2 A;  4RUV A;  3FZ9 A;  4LL4 B;  5IOX A;  1A2M A;  4G9H A;  3DKS A;  1OC9 B;  1PN9 A;  2DJK A;  4L5L A;  1K0C A;  4EF0 A;  1H4O A;  2WB9 A;  3IK9 A;  2IFQ B;  4TR4 A;  1A24 A;  1K0N A;  1SKW B;  2LQQ A;  2YCD A;  4OD7 A;  2NVL A;  2AJQ B;  3BJ5 A;  4XS6 A;  1SU9 A;  2IIY A;  3LJR A;  5G2Z A;  3FRC A;  1DE2 A;  2MMA A;  3A2W A;  1AC1 A;  1G6W A;  1O85 A;  2IMF A;  5IMV A;  4IGJ A;  5HFG A;  2H1A A;  5HR3 A;  1CQH A;  2A2P A;  3TGZ A;  2OBK A;  2H73 A;  1JZR A;  3DVX A;  4HI7 A;  5JWO B;  2XBI A;  4G0K A;  4TW5 A;  1V98 A;  8GSS A;  1Z5Y E;  1WWJ A;  1X5D A;  3MYD A;  3CYN A;  3IK7 A;  3Q18 A;  2YPM A;  2JSZ A;  1O8X A;  2RII A;  1X0R A;  2A2S A;  1Z9H A;  1G6Y A;  2GQL A;  4X43 A;  2A4H A;  4BPY A;  1TI3 A;  5IM9 A;  4MA9 A;  3ZVJ A;  2YOI A;  4POK A;  2QGV A;  1THX A;  2LNT A;  2BTO T;  2HE3 A;  4O92 A;  2YZU A;  2HFD A;  5G31 A;  1GSE A;  4ISD A;  3IC4 A;  4ZL7 A;  2H75 A;  3C73 A;  1A0F A;  4NPB A;  4OO4 A;  1U87 A;  3NZN A;  2H71 A;  4KSM A;  5BMU A;  3GX8 A;  2YWO A;  4PQH A;  4JBB A;  4HZ2 A;  3GST A;  4QL9 A;  1ZYN A;  1B4P A;  4AJ6 A;  3QR6 A;  3ZFB A;  4N0V A;  4GSS A;  5EY6 A;  4MDC A;  1OYJ A;  3HVX A;  3UBK A;  2F3M A;  5CRE A;  2VM2 A;  3H1N A;  5JCG A;  1XVW A;  4YAV A;  1M2A A;  4IW9 A;  4XTS A;  2TRC P;  4ZL8 A;  1SKR B;  4YKG A;  2TRX A;  5F07 A;  1VRS D;  4TXV A;  1RW1 A;  1ZYQ B;  2YJ7 A;  4Q5N A;  4ZBB A;  1JHB A;  5D73 A;  3UOM A;  1FO5 A;  3QCP A;  2K6V A;  4K7N A;  2N5F A;  2FHE A;  4MZB A;  2HLS A;  1FB6 A;  3GA4 A;  2E2G A;  3QOU A;  4N11 A;  5D9V A;  2WCI A;  4GQF A;  4JR6 A;  3WGD A;  3CRU A;  3KTB A;  3E9J B;  1O81 A;  4ZB9 A;  2B7J A;  2HYX A;  4NXI A;  2LRC A;  5EPF A;  1QGV A;  4KDY A;  2JSY A;  2X99 A;  4I6X A;  4O7H A;  5L71 A;  1PX7 A;  3EYT A;  5ECM B;  3FZ5 A;  3KH9 A;  3EU3 A;  1MTC A;  5DCH A;  1VF2 A;  1LJR A;  5D96 A;  4I97 A;  3OR5 A;  1VF4 A;  1K3O A;  1X5E A;  1A2L A;  1OC3 A;  1PKW A;  4V2L A;  1TK0 B;  1ON4 A;  3ZML A;  4NV5 A;  2YWN A;  1J9B A;  1Y25 A;  3ME7 A;  4IS0 A;  3I43 A;  2I9H A;  1M2B A;  2LST A;  4TR0 A;  1G7O A;  1M0U A;  4KE3 A;  2M46 A;  2TIR A;  3F9U A;  4MPG A;  3CTG A;  1HD2 A;  1M9A A;  4O5Q A;  3ZMK A;  1XWB A;  1AW9 A;  2X64 A;  3EPT A;  3N5O A;  3A2X A;  2I81 A;  4JZQ A;  3GIX A;  2PGT A;  2DKH A;  4J2F A;  4OFT A;  5DDL A;  3C1R A;  3ME8 A;  2H6Z A;  4YQM A;  1GNW A;  2OAC A;  2FWF A;  2C0F A;  1RQM A;  2ZUP A;  2NBS A;  4PTS A;  3ZL5 A;  1ZMA A;  3VUR A;  1G7E A;  4BA7 A;  1TP9 A;  2R5G A;  5AIS A;  3C1S A;  5ECH B;  2F9S A;  3TJG A;  2QC7 A;  4DSQ A;  4POB A;  4BWS A;  4OWY A;  3UVH A;  4TN8 A;  3F6D A;  2LRN A;  3FKF A;  2H6X A;  1B9Y C;  2LKU A;  1TW9 A;  4ILF A;  1SKS B;  3TOU A;  1YDK A;  2DSA A;  1UA5 A;  3ZVJ D;  3DD3 A;  4USS A;  2H0I A;  4GQC A;  6GSW A;  1A23 A;  2VO4 A;  3D0Z A;  4HOJ A;  5EVO A;  2R0P A;  5ECN B;  2GT6 A;  2V1M A;  2QKE A;  2YWI A;  1BJX A;  2H1B A;  2JAC A;  1EWX A;  4IJ3 A;  4GSN A;  3UVT A;  5H5R A;  1OKD A;  4PGT A;  7GSS A;  1GL8 A;  4Z2T A;  3F0I A;  2LJA A;  2GSS A;  4TRX A;  4H86 A;  5D9X A;  4WBJ A;  3IC8 A;  1F3A A;  5AGY A;  1AXD A;  2G0F A;  4YAP A;  2YZH A;  2VCX A;  4QL7 A;  2DLX A;  2IMK A;  3KEB A;  5A4U A;  1I5G A;  1NHO A;  1S3C A;  2R6K A;  5DJM A;  3M9J A;  4F0C A;  3G7J A;  4ECI A;  4TKY A;  2H1G A;  3F3Q A;  5F0G A;  3UBL A;  1HYU A;  4K1F A;  1T00 A;  4AJ8 A;  5G5E A;  3DGQ A;  1SL2 B;  5DQY A;  1NHY A;  4F82 A;  2LJR A;  2VCT A;  5HQP A;  5JCU A;  3EWL A;  2K8S A;  1OE8 A;  4RQR A;  4K6X A;  1YEP A;  2ZNM A;  5CNW A;  5COH A;  5G30 A;  5ID2 A;  3MSZ A;  2VLU A;  2VCW A;  4L0U A;  2C3N A;  1A2J A;  5H5S A;  1U6T A;  2C0E A;  4O5U A;  3APS A;  3HJP A;  1F6M C;  2LEG A;  4PQI A;  2HRN A;  1EEJ A;  3M8N A;  3EU4 A;  2KLX A;  4G0I A;  4IQ1 A;  4WF5 A;  1PQN A;  2L6C A;  3LQ7 A;  4JU5 A;  2NDO A;  1TRW A;  4NAX A;  1ST9 A;  3IRA A;  2X8H A;  2C80 A;  4WET A;  5G1L A;  3D4T A;  4D73 A;  3TRQ A;  3GTU A;  4OCF A;  2R2J A;  3CSI A;  3NIV A;  2XC2 A;  2A2R A;  3GMF A;  1SJZ A;  3IPZ A;  1GSD A;  5CP1 A;  2HT9 A;  1TU7 A;  5FT3 A;  2R4V A;  2HI7 A;  3TJF A;  1VF3 A;  1MEK A;  2E0Q A;  2K9F A;  1K0A A;  3JCM L;  3DWV A;  2V32 A;  5IMD A;  2PU9 C;  4FYB A;  4FYU A;  3F8U A;  3K8N A;  1YZX A;  6GSY A;  5HR2 A;  11GS A;  3L9V A;  1TU8 A;  1U3I A;  2O87 A;  3WD6 A;  2F8A A;  2GQM A;  3TJK A;  1N2A A;  3GTU B;  3KP8 A;  3J7Y k;  1HNC A;  3TJJ A;  5B7C A;  3LOR A;  4X4J A;  4PUR A;  2E2M A;  2H30 A;  2VL9 A;  4GLT A;  1O7U A;  10GS A;  5INY A;  4F2I A;  3MAK A;  4MCU A;  2YAN A;  3Q6O A;  1T3B A;  3M9K A;  4PQ1 A;  5CYY A;  4PUA A;  1UVZ A;  3IHQ A;  4NMU A;  3IXR A;  2KP2 A;  1R4W A;  2GS3 A;  2EC4 A;  1B9X C;  3UJ1 A;  2B5X A;  4EL1 A;  4TR3 A;  2PWJ A;  1JFU A;  1MD4 A;  4MZW A;  3DIE A;  2REM A;  3TCO A;  1FB0 A;  3VPT A;  4PNG A;  1SL0 B;  2H74 A;  2L5O A;  3MDK A;  2LRT A;  4OMV A;  2ALB A;  2VD1 A;  1GSF A;  1XCC A;  3TKS C;  1OAZ A;  4HZ4 A;  3KTL A;  3EE2 A;  1XW5 A;  4AGS A;  2N5B A;  2AB6 A;  5J3R A;  5A4V A;  3IOS A;  4NHZ A;  2L4C A;  5F8B A;  4AF2 A;  3UIW A;  3M3M A;  1AQW A;  4GRF A;  1Z6N A;  1TDI A;  4EVM A;  2DJ2 A;  1OVN A;  3TRP A;  4MZC A;  1T4Z A;  4GCI A;  3C7M A;  4POM A;  2FA8 A;  2WFC A;  5C00 A;  2LV3 A;  1DBY A;  3KZQ A;  4MK3 A;  3VLN A;  2VCZ A;  1W89 A;  2XPE A;  2VCQ A;  2P5Q A;  2MMZ A;  5D9T A;  2DML A;  2M72 A;  3ISO A;  5KOW A;  4GXZ A;  1A8L A;  2H1D A;  5ECS A;  1V2A A;  1O8W A;  3GL3 A;  1DE1 A;  1M2D A;  2IPA A;  3GL5 A;  2IWT A;  4ZL9 A;  3CRT A;  2CA8 A;  4KCA A;  1NM3 A;  2GZP A;  3S9F A;  3LSZ A;  4OCE A;  1XPV A;  3F4S A;  1YF0 A;  2CQ9 A;  1OC8 A;  2DBC A;  4J57 E;  2YJH A;  2DMM A;  2VD0 A;  1T8E B;  5B6N A;  1XW6 A;  1XIY A;  4GWR A;  4V1A p;  3BCI A;  2YP6 A;  4OO5 A;  1ZCP A;  2R0C A;  3GUS A;  2X49 A;  1R26 A;  1GLQ A;  2WJU A;  4LLR A;  1Q4J A;  3GNJ A;  2H76 A;  3L9S A;  4F0B A;  2H6Y A;  4K7I A;  4GF0 A;  5BRT A;  4DSS A;  3VPQ A;  2MMN A;  2H19 A;  4GTU A;  1SYX A;  2E7P A;  2WS2 A;  1GSY A;  3IA1 A;  2I1U A;  1J08 A;  2MBT A;  2IMD A;  2H0G A;  4KW6 A;  2VL2 C;  5FHI A;  4JE1 A;  4MJE A;  3ZFL A;  5LD0 A;  3MWH A;  3KGK A;  1WE0 A;  3RDW A;  4CDO A;  4I2T A;  3GH9 A;  1F9M A;  2HSH A;  4ZB8 A;  5IIZ A;  4KF9 A;  2D2Z A;  2Z9S A;  1F37 A;  3O6T A;  3FYG A;  3LG6 A;  1QK8 A;  3CXG A;  4F03 A;  5CRW A;  3EC3 A;  3I6A A;  3L0H A;  1TK5 B;  3TKR A;  1O6J A;  3ZTL A;  1A0R P;  1SD8 A;  4ZIL A;  1BAY A;  2O89 A;  1ZOF A;  5IPG A;  4ZB6 A;  4WR5 A;  1ERU A;  1U3A A;  5DBQ A;  3UAP A;  1ILO A;  2L5L A;  5ECL B;  4FO5 A;  1W4V A;  3TKP A;  1EV4 A;  3G7I A;  2FGX A;  4XHM A;  5IQY A;  3UEM A;  2PBJ A;  2FWE A;  2LTK A;  5IOW A;  2B1K A;  3WT2 A;  2CZ2 A;  3CSH A;  5ECQ B;  4XS4 A;  4HJM A;  1PSQ A;  3DRN A;  2ZCT A;  4MAB A;  4K9Z A;  4N30 A;  1EZK A;  2HXK A;  1MDK A;  4G2E A;  4X1U A;  1FVK A;  4XCS A;  2GZY A;  2L4Q A;  1R7H A;  3TRX A;  4ACS A;  3HY2 A;  2N5A A;  1V57 A;  3D5J A;  4WBR D;  3IAM 2;  2RM6 A;  1FAA A;  1ERV A;  1XW9 A;  5JWR B;  1PL1 A;  4XS4 B;  3LGC A;  3L4N A;  9GSS A;  1AQX A;  4BVX A;  1U88 A;  2PUK C;  2JL4 A;  2WDU A;  3LXZ A;  5E4W A;  3U5R E;  2OE1 A;  4NWY A;  1GUK A;  1USB A;  14GS A;  1M9B A;  2C0D A;  3TKS A;  1AUC A;  1XWG A;  1KBN A;  1FG4 A;  1PMT A;  2A4V A;  1AIU A;  16GS A;  3UMA A;  4BVX B;  1R5A A;  2FWG A;  2CZ3 A;  1GSS A;  1FHE A;  4MF7 A;  4G19 A;  1F3B A;  4HDE A;  1WPI A;  3HZ4 A;  3D4M A;  2MYG A;  2P31 A;  1GTU A;  1FVJ A;  2DIZ A;  3UAR A;  4WEY A;  4LMV A;  3J7Y b;  2FUG 2;  4KUN A;  5LNK e;  4KND A;  1K0B A;  4V1A g;  1YEX A;  2ON7 A;  1DUG A;  1TOF A;  4CY8 A;  3P2A A;  4X0X A;  3LXT A;  4EO3 A;  2HSY A;  1ZYE A;  1XBS A;  5ELA A;  1BX9 A;  1Z6M A;  2LUS A;  1DSB A;  1V58 A;  4WR4 A;  2AAW A;  2OA7 A;  4EE0 A;  5A4W A;  2B5E A;  2OAD A;  3R3E A;  4WKW A;  3V1W A;  4MLY A;  1IYH A;  1TXX A;  2OE3 A;  2VM1 A;  5J9B A;  3GYK A;  3KMN A;  2R37 A;  2GSQ A;  2DC5 A;  1BQ7 A;  2R3X A;  2B5Y A;  1K0D A;  4EIQ A;  3GRX A;  4MJC A;  4XRA A;  4DVC A;  1B8X A;  4NV2 A;  1M7T A;  4YQV A;  3IHG A;  3KM6 A;  4PXO A;  3F63 A;  4WXT A;  4V2N A;  3CSJ A;  1MD3 A;  3DVW A;  5AN1 A;  5A5K A;  4MH3 A;  22GS A;  3EMX A;  4ZXG A;  3N9J A;  1X9M B;  1IYI A;  5ECI B;  3EMP A;  5J5N A;  1GWC A;  2DJ1 A;  3PIN A;  4BWQ A;  2DJJ A;  2C8U A;  5ECK B;  1B4Q A;  4TR1 A;  4K0G A;  1V40 A;  5D8I A;  1OE7 A;  3VI5 A;  2XPD A;  2VL2 A;  2OJL A;  4XIH A;  2HZF A;  4K2D A;  1ERT A;  3HJO A;  5GAP D;  2IME A;  4PX1 A;  5DAK A;  4IN0 A;  4EKZ A;  4I2U A;  1WIK A;  1O73 A;  3FK8 A;  3CMI A;  3NOF A;  1EOH A;  1UN2 A;  3KP9 A;  3LW9 A;  2FWH A;  3EVI A;  3P90 A;  4TR1 B;  3A2V A;  3TKQ A;  3HXS A;  4HQS A;  2NPB A;  4JRR A;  5ID2 B;  4K0N A;  1UC7 A;  4Z2U A;  2RUE A;  1GRX A;  1ZYP A;  5IO0 A;  1GTA A;  4L0W A;  4IQA A;  4J56 E;  4Q5Q A;  3DYR A;  3I9V 2;  4P3Y B;  3ZRD A;  2VL3 A;  3TJB A;  1JLV A;  2WGR A;  3KXO A;  3DML A;  4K8M A;  1GLP A;  3APQ A;  1PGT A;  2FCH A;  19GS A;  6GSS A;  1F2E A;  3QD9 A;  1X9W B;  4D73 B;  1EV9 A;  3WYW A;  3GKX A;  2X8C A;  1GUM A;  2EIQ A;  18GS A;  6GSX A;  4GST A;  3KMO A;  4ZIJ A;  1WP0 A;  4ID0 A;  5ELG A;  5IMC A;  1Z3E A;  2GQK A;  4EXJ A;  1PD2 1;  2HZE A;  1JZO A;  4MMM A;  2KUC A;  2OKA A;  4KH7 A;  2C4J A;  1Y6E A;  1SJ6 A;  3EUR A;  2CVD A;  1ML6 A;  3ERG A;  5CRH A;  3AY8 A;  3W8J A;  5IPH A;  1T4Y A;  4K7O A;  3M1G A;  2HZE B;  1ERW A;  3APO A;  3FR3 A;  1GTI A;  5C04 A;  2P0G A;  4MP4 A;  4CHS A;  2HSM A;  3W6G A;  3HJM A;  5H5Q A;  1GSQ A;  2ON5 A;  3VWX A;  3HZ8 A;  1XWK A;  3BOA A;  3QFB C;  4YKF A;  3G7Y A;  1QUW A;  2YNX A;  2M80 A;  1YY7 A;  3ZYW A;  2OE0 A;  4AJ7 A;  2AYT A;  4KGI A;  1PX6 A;  4O32 A;  3QAW A;  5JCW A;  2GVP A;  4YH2 A;  2P5R A;  3IR4 A;  5ECP B;  2VOC A;  4MH2 A;  3PGT A;  1YKC A;  4JR4 A;  4IBP A;  3VWV A;  3IBH A;  4OFN A;  5IMZ A;  3GUR A;  1EP8 A;  3RHC A;  4IP6 A;  1PA3 A;  2DJ0 A;  2VUP A;  1EP7 A;  2JZS A;  2PVO C;  1OKT A;  4K5S A;  2IL3 A;  2HNL A;  4TXO A;  1URM A;  2VLV A;  2RM5 A;  1THO A;  2CX3 A;  3GSS A;  1PN0 A;  2FLS A;  3HD5 A;  2H66 A;  4F9Z A;  2L59 A;  4EUY A;  4POL A;  2L6D A;  4E8E A;  3H8Q A;  1E2Y A;  2FD3 A;  1BG5 A;  3WGE A;  3F6F A;  3KIJ A;  5IO2 A;  4PNF A;  4TXO B;  2YV9 A;  1KTE A;  4TOP A;  3ZIJ A;  1HNA A;  4XS1 A;  1QMV A;  1GNE A;  3FZ4 A;  2L57 A;  5JWQ B;  1TJD A;  2CAQ A;  2IJY A;  4N0Z A;  2H70 A;  1HNB A;  1GP1 A;  3GX0 A;  1AAZ A;  3SWL A;  1XZO A;  1TI1 A;  4L8E A;  1QQ2 A;  3H4K A;  3MIX A;  3L9U A;  4LL1 B;  2K18 A;  5HR1 A;  1EGR A;  2PPT A;  1PKZ A;  2BJX A;  2DIY A;  3QPM A;  3IE3 A;  4KX4 A;  2YN1 A;  3TB2 A;  1Q98 A;  2I3Y A;  4Q5F A;  3BCK A;  1KNG A;  1X5C A;  2WUL A;  1E6B A;  4OFM A;  1SEN A;  3SBC A;  2GST A;  5D9W A;  1N8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...