3GA4A

Crystal structure of ost6l (photoreduced form)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
156
structure length
156
Chain Sequence
IDDILQLKDDTGVITVTADNYPLLSRGVPGYFNILYITMRGTNSNGMSCQLCHDFEKTYHAVADVIRSQAPQSLNLFFTVDVNEVPQLVKDLKLQNVPHLVVYPPAESNKQSQFEWKTSPFYQYSLVPENAENTLQFGDFLAKILNISITVPQAFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dolichyl-diphosphooligosaccharide-protein glycosyltransferas
publication title Oxidoreductase activity of oligosaccharyltransferase subunits Ost3p and Ost6p defines site-specific glycosylation efficiency.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 39
structure length 156
sequence length 156
ec nomenclature ec 2.4.1.119: Transferred entry: 2.4.99.18.
pdb deposition date 2009-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ga4A00
1TP9A 5ECOB 1M7TA 5IMFA 2E2GA 3C1RA 1F9MA 3GH6A 3NOFA 4EKZA 4AJ8A 2PU9C 4LA1A 2IN3A 5CO3A 4LMWA 1TRSA 1HNCA 2FWHA 3H1NA 2FA8A 2J9HA 2LTKA 4TXVA 3MNGA 3V1WA 5CNWA 4MF5A 1A0FA 1ZYEA 5J41A 4GTUA 3C73A 1SJZA 3EU3A 2FGXA 3DXBA 2JU5A 4KE3A 4IN0A 2PERA 3U6VA 1XWGA 4J2FA 1YEPA 4E8HA 4MABA 3UJ1A 1TKDB 3A2VA 3FY7A 1O85A 3GKXA 3ZMLA 1X9MB 3QFBC 1G7EA 1PKZA 2H76A 2EIRA 4QL7A 4MJAA 1XCCA 2HYXA 1RW1A 1YJ6A 4I6XA 2WJUA 3LGCA 1PD21 3HJMA 2ZNMA 3ZIVA 3BCIA 2B3SA 4MP4A 3O76A 3RHBA 2RIIA 3Q19A 1FB0A 1PMTA 3LFLA 2V32A 3C1SA 3F8UA 3QDNA 5DALA 1YKCA 1ZCPA 2C3QA 2GQLA 2N5AA 2DLXA 2H1DA 2K8SA 3PR8A 1VF2A 4TW5A 2O89A 2DJJA 3ZTLA 3UBLA 1TDIA 3APOA 3GYKA 1UN2A 1G6WA 2NDOA 1PA3A 2H6ZA 5G1KA 5B8AA 1PSQA 2GSSA 1M9BA 4N30A 3ERFA 1GTIA 4O7HA 1GTUA 2H72A 2NPBA 3F3QA 4TR3A 1K0BA 4GSSA 1ZMAA 4O92A 3QR6A 1Z6NA 1WPIA 3LEFA 1F3BA 3TRPA 1M2BA 4NV2A 3D5JA 1AXDA 2FWGA 1ILOA 2GT5A 3ZZXA 3H8QA 4ECIA 1CQGA 3QOUA 1RQMA 3E9JB 4XIHA 4ML6A 2PGTA 3KIJA 3KMNA 1XOBA 4ZXGA 4PNGA 5DVBA 3EYTA 2H66A 1EV4A 4TR1B 4ZBDA 4OO5A 2H0IA 2GS3A 2H1BA 2REMA 4D73A 3A2XA 1GNWA 2MBTA 3LYKA 1SL2B 5ID2B 1EOHA 3ZVJD 3KMOA 4NMUA 1XZOA 3TOUA 3IPZA 5A4VA 1QUWA 5HR1A 3EMXA 3WT1A 3HVSA 2VUPA 3GTUB 4NAXA 4Z7XA 5G1LA 11GSA 2BTOT 5HQPA 1J0FA 2H75A 2B5XA 2WS2A 1M2DA 1FAAA 3ZVJA 1AAZA 2DC5A 5ELAA 1J9BA 6GSVA 1OKTA 3ZLPA 4E8EA 2PVQA 3EC3A 4POMA 2WFCA 3VWXA 4WBRD 2JSYA 3WD6A 3IDVA 1A0RP 1PRXA 3I69A 1BQ7A 1ERWA 4TN8A 3VPTA 1JLVA 4XS4A 1AUCA 2H73A 1LU4A 2X99A 4PURA 3KXOA 4GQCA 1HNBA 3VWWA 2C0DA 4JEDA 5GZZB 3ZFBA 4I2TA 3EMPA 3IOSA 1HNAA 3HYPA 2IMDA 4J57E 1XWKA 2JL4A 5DCHA 1O7UA 16GSA 1SYRA 4PQIA 1FOVA 1Q4JA 6GSXA 3H4KA 1DE2A 1FHEA 3KZQA 1V98A 2XC2A 1YKAA 2GSTA 3QCPA 2AHEA 4L0WA 1AQWA 1TTZA 4JR6A 1BX9A 5CREA 1A8YA 2TRCP 4ZBBA 3F4SA 2HRFA 5FHIA 3FZ4A 5DALB 2VM2A 4GLTA 4HOJA 4K7IA 2YV9A 2WCIA 5ECQB 1B9YC 2YNXA 3KM6A 1NSWA 1QQ2A 1OYJA 10GSA 1FB6A 1Z9HA 4Q5QA 4FYUA 1BAYA 2LS5A 3CYNA 5GAPD 3FEUA 2H1AA 3P8WA 5HR2A 2FD3A 1XFLA 4MDCA 3UARA 4F9ZA 2OBKA 4IW9A 4PUAA 2TIRA 3VPQA 3TJKA 4KCAA 1TRVA 2QGVA 3QPMA 2O8VB 1U3AA 3DVWA 4K1FA 2I3YA 2V1MA 1N2AA 3P90A 3L9SA 3VURA 2MMAA 2GGTA 3FRCA 3DWVA 1Z3EA 1GSEA 2GZPA 4ISDA 2OE1A 1X5EA 2H6YA 3APQA 3D4MA 1O8XA 2L4CA 3FR3A 1SENA 4ULXA 3QAGA 5KN0A 2H01A 2OADA 4BA7A 1X9WB 2KP2A 1MD4A 1MDIA 5F07A 3UBKA 1CQHA 3C7MA 2VO4A 5INYA 4PQ1A 4RQXA 1SK0A 5JCGA 1UA5A 4D73B 1F6MC 1KNGA 2VL3A 3SWLA 1I5GA 7GSSA 4MJCA 3F63A 1ST9A 1ERVA 2PBJA 2L5OA 2CA8A 3EURA 4CHSA 1EP7A 1WRYA 4MLYA 3LSZA 3FZ9A 3D22A 1C72A 3W6GA 1R4WA 3F3RA 4HDEA 1HQOA 2YZHA 2RUEA 1W4VA 1GSSA 2V6OA 3IAS2 4WF5A 4HEA2 4XCSA 5IMVA 5ELGA 3O6TA 1SKSB 4HQSA 3TKRA 2DJKA 1TRUA 3GHAA 1XWAA 4MJEA 3HCZA 3GX8A 2RM5A 1B4PA 2JZRA 1G6YA 1OVNA 2WULA 3KH9A 1TOFA 3LWAA 2H6XA 3ZIJA 4XS4B 4DSSA 2GZYA 4GSTA 2R4VA 4OFNA 2KLXA 4MK3A 2VCVA 5H5SA 2QC7A 2H0GA 2YCDA 5H5RA 2CX3A 2I4AA 3W8SA 4N0ZA 1PL2A 1VRSD 3DEXA 4JU5A 2DIZA 1EV9A 2YOIA 1M9AA 2HE3A 3M9JA 4LLRA 1PQNA 1QMVA 1TI3A 5KN1A 5A5KA 4ZL7A 1E6BA 2B5YA 1K3LA 2LSTA 3M8NA 3W8JA 5F0GA 1XPVA 5EL8A 3IAM2 5ECMB 2VCZA 1SU9A 3VI7A 5G2ZA 4V2LA 5JCUA 22GSA 3HXSA 3LXZA 1ERTA 5AISA 1VF3A 4KUNA 4F82A 2VM1A 3DMLA 5AIVA 5ECIB 3ERWA 4AF2A 3GKKA 1HYUA 1XWBA 2NTOA 1TRWA 4YAPA 2K6VA 1QK8A 4J56E 3ED3A 2VIMA 2CVDA 1A2MA 1SK1A 4XS6A 5D9TA 2F8FA 3RPNA 2MMOA 3DD3A 2CZ3A 3TKQA 3GMFA 2DIYA 1AW9A 1GH2A 3I9V2 2Z9SA 2AUVA 2PMTA 2A4VA 4F0BA 1GTBA 3WT2A 3HDCA 5C00A 2DSAA 3RBTA 2AYTA 2GSQA 3TRQA 2X64A 4YH2A 3GKNA 1X5DA 1DUGA 2I81A 3GV1A 4G10A 3MDKA 4RQRA 3TGZA 1TK0B 4CW9A 2OACA 3N5OA 3TKPA 3S9FA 2RUFA 3HHVA 4EUYA 2HZFA 3TUEA 2FHEA 1TK8B 1GWCA 4V2MA 2HLSA 1THXA 2ZCTA 3LXTA 5HFIA 5KEJA 2LRNA 2YWMA 1TJDA 2VL9A 4OFMA 3BCKA 5FT3A 3ZFLA 3ZREA 2YP6A 2AJQB 4KDUA 2C0EA 1W89A 1F3AA 1ZZYA 3TKSC 5D73A 4WR5A 3NZNA 5ECPB 3SBCA 1YQ1A 2N5BA 4NWYA 3KJYA 3HVXA 4MMMA 3I6AA 1WOUA 1Z6MA 2R3XA 5EY6A 3L9UA 1VF4A 3GL5A 1M0UA 3CTFA 1XBSA 2FUG2 3GUSA 4WKWA 1Z7RA 5F06A 2LKUA 2YWOA 3H79A 1JZDA 1YF0A 4PXOA 1WE0A 2HSHA 4IQ1A 4K7NA 4TR4A 2F3MA 4OFTA 4ZL9A 1YY7A 1GULA 1M2AA 2HRNA 3EE2A 4MF6A 2HFDA 3TOTA 4XTSA 2XHFA 1SL1B 3D6IA 4WR4A 4LL4B 2VLTA 3QAWA 3IK9A 4DSSB 2AB6A 3IHQA 2MBSA 2CV4A 1KEBA 4EE0A 2AAWA 2H70A 3IC4A 2M72A 4LMVA 1DBYA 1M99A 5E4WA 5EPFA 3MSZA 4IHUA 4XRDA 2X8CA 3RPPA 1HD2A 1V58A 4K6XA 3GIXA 4PGTA 3KCMA 3GL3A 5B6NA 1XWCA 3GSTA 3TKSA 2FY6A 3QAVA 3ISOA 4KDYA 2LJKA 2PWJA 3L0HA 4RI6A 1USBA 3TJFA 2DMLA 3HZ8A 4AJ6A 1O6JA 3FW2A 4GWRA 2YWIA 2C80A 4IVFA 2YWNA 1J08A 3GX0A 4ZB9A 4N10A 2IMKA 2R6KA 1GUKA 5LCZA 2LRTA 3L9VA 4IJ3A 5B8BA 2QKEA 4TKYA 3LG6A 2O87A 3F4RA 5CRWA 4OCEA 1JHBA 3GA4A 3L78A 4L8EA 2C8UA 1A8LA 4O32A 2I1UA 1K0AA 4JE1A 1JLWA 1WJKA 2L59A 2CAIA 4MH3A 3C71A 3LJRA 3PINA 1K0DA 4IBPA 3TJGA 3LORA 2XBIA 2GDRA 1BYEA 4EXJA 3DKSA 2C0FA 1BEDA 4EO3A 1NW2A 2MMZA 3NIVA 2H0HA 4FO5A 3UIWA 5HR0A 2B1LA 2V41A 4PNFA 3F6FA 1AIUA 2OE3A 1OKDA 2YPMA 5HFGA 1OC8A 1NHYA 2VD0A 4NV5A 2YANA 3TCOA 4EF0A 2FNOA 5J9CA 1PX6A 2ALBA 1ZL9A 4L5LA 1B9XC 17GSA 3FYGA 2EIQA 4HJMA 5D9VA 3F6DA 5B6MA 2A2RA 2O85A 3FK8A 4NXIA 1KBNA 2JZTA 1VF1A 4KA0A 5ECHB 2JADA 1T8EB 2MMNA 2LQQA 4ZL8A 2MZCA 3KTLA 3PH9A 4DEJA 2LV3A 5EVOA 3M1GA 1R26A 2HXKA 1YDKA 2ON5A 2C0GA 4KDXA 1SL0B 4ACSA 4V1Ap 1G7OA 3MWHA 5ECNB 2WGRA 4EDZA 3CXGA 1EOGA 4V2NA 3F4TA 3R2QA 3TJBA 4O5RA 1V57A 1VGLA 2BJXA 2H30A 3VI5A 1WMJA 5A4UA 1ML6A 4HU9A 4XS1A 2L57A 2K8VA 5DJMA 2L6DA 4OD7A 3ME8A 2VOCA 2G0FA 3A2WA 5G30A 2ON7A 1T7PB 4HS1A 4ID0A 4K0NA 4I97A 1ZYQB 1DE1A 4YQMA 4I5QA 3ERGA 12GSA 2HZEA 3G7JA 4RUVA 3QMXA 1E2YA 2P5RA 3HJOA 1GLPA 5J4UA 4X1UA 1FW1A 2YN1A 1T4YA 1TU8A 4Q5FA 1GSFA 3HJPA 5IM9A 5E59A 1H4OA 2A2SA 4ILFA 3QD9A 1B8XA 3CSIA 4MPGA 1K3OA 2OBIA 2VCWA 2CQ9A 3QFAC 4N0VA 1O8WA 4TXOA 2VCXA 5JWRB 1KTEA 4ECCA 3ZITA 2IPAA 2OJLA 4GQFA 4WF4A 5JWQB 5KN2A 1ACVA 3CBUA 4L5OA 5GSSA 1EEMA 2IMEA 2P31A 5FWGA 1GLQA 1A2JA 1A23A 1SJIA 1TW9A 2KHPA 3KGKA 2CT6A 4XRAA 1WWJA 2X8HA 4G19A 1MD3A 4BPYA 4N11A 2L6CA 2XPEA 1ABAA 1SD9A 3DYRA 3GNJA 2DJ1A 1T1VA 3ME7A 2GVPA 4TR0A 1EP8A 4MF7A 8GSSA 2OA7A 3FKFA 3IK7A 1I9DA 5AIXA 3AY8A 3BD2A 1GL8A 4AGSA 1XOAA 1AQXA 2ES7A 3G7YA 3H93A 1EEJA 2LJRA 2KOKA 4ECBA 4IP1A 2I9HA 5HFKA 4FYBA 2AV4A 4YAVA 4PQHA 1X5CA 4IELA 3DIEA 3GN3A 3CSHA 2J23A 4F2IA 2B1KA 6GSWA 5J9BA 3JCML 5D9WA 3CTGA 2KP1A 2IMIA 3WGEA 5ECLB 3GURA 2MYGA 1LJRA 1U3IA 2O7KA 5J5NA 3F9UA 4YQVA 1GSDA 5IMZA 2RLIA 5G5EA 2V6KA 4ZB6A 1B48A 2N5FA 3HY2A 4POLA 1S3DA 2L5LA 3OR5A 3MAKA 1X9SB 2YJHA 2CZ2A 3J7Yk 4KCEA 3LQ7A 1X0RA 4IS0A 3G9BA 1K0CA 4FYCA 1JZWA 1G0TA 1NM3A 2E2MA 4G2EA 3WGDA 2KUCA 2YZUA 2IJYA 4KB3A 3GSSA 1Y25A 3I43A 3FZ5A 5A4WA 2E0QA 1NHOA 1XVQA 1K0MA 3FR6A 1TU7A 1XXUA 3J7Yb 4ZILA 3UVHA 3ZRDA 1A2LA 2HZEB 2LJAA 2WZ9A 2JZSA 6GSSA 2HI7A 3HA9A 1FO5A 3CRTA 5IPHA 4ECJA 4GCIA 5CRDA 3BBYA 1JZRA 5GSTA 2F8AA 3GH9A 5LD0A 4GRFA 2VLVA 2R2JA 2H74A 3HZ4A 5C04A 4I8BA 1XIYA 2D2ZA 5D8IA 1GTAA 3KTBA 2G2QA 2VLUA 1GUMA 2H19A 4GF0A 4TXOB 2LQOA 1TXXA 1XW9A 2RM6A 1V2AA 5L71A 3A5WA 4V1Ag 5KN3A 3RHCA 2M46A 2M80A 3FZAA 1T00A 2C3TA 1IYHA 2C3NA 3L4NA 3VWUA 5IOXA 2EIOA 1ON4A 2E7PA 3VK9A 4NHWA 3A3TA 4FIWA 3D0ZA 5CRHA 5D93A 2VCTA 1GP1A 2HNLA 2PUKC 3TDGA 2PPTA 4Q5RA 3GRXA 4MA9A 3WGXA 4L0UA 2QSIA 3ZL5A 4MZBA 2F9SA 2GT6A 4QQ7A 1JZOA 3TRXA 3IRAA 4IP6A 18GSA 5G5FA 5DQYA 2DJ3A 3D4TA 5LNKe 3KD0A 3BJ5A 3GFKA 2R5GA 1XW6A 1SKRB 3M9KA 4KW6A 4K0GA 1TI1A 3EU4A 4X43A 5J3RA 2LNTA 4GXZA 2CVKA 2WB9A 1PGTA 5ECRB 2B6MA 1ERUA 1F37A 1FG4A 2K9FA 4DSQA 2VCQA 5IO0A 3Q18A 3CSJA 3DGQA 3KH7A 1PKWA 2DBCA 5IIZA 1MTCA 4POKA 1SYXA 5CYYA 4ZBAA 1U87A 4KSMA 3UL3A 1TK5B 1A24A 1WIKA 3UOMA 1ZOFA 4EC0A 2CVBA 4HI7A 4F0CA 1EGRA 5JWOB 1PX7A 2C1YA 2DMMA 2GTUA 4JZQA 4BVYA 3UEMA 1XVWA 1MEKA 4ZB8A 1SK2A 5D96A 2VL2C 5IMCA 1SKWB 1GRXA 3VLNA 1PL1A 4TOPA 4DVCA 3E3EA 1S3CA 5ENUA 4K2DA 6GSYA 3IV4A 5ABRA 3KEBA 5DAKA 5F05A 1URMA 5AN1A 4KH7A 4PUFC 2FLSA 3US3A 4HU7A 3UAPA 5DCGA 3VFIA 1GNEA 4WBJA 5IMDA 4JBBA 1RK4A 4TRXA 2B5EA 2HSYA 2LEGA 4KGIA 1B4QA 3RDWA 3IR4A 1BJXA 1U6TA 19GSA 1R5AA 5IMAA 5D9XA 1R5PA 13GSA 2YV7A 1SD8A 2DJ0A 2JSZA 4G9HA 4MH2A 4KNDA 2C4JA 4CDOA 2HT9A 5DDLA 2IFQA 3WYWA 2FWFA 3FR9A 3HKRA 3APSA 9GSSA 1SJ6A 1K0NA 3RAZA 2ZUPA 1YEXA 4EVMA 3F0IA 1F2EA 3UVTA 4OO4A 5IPGA 4Q5NA 2GLRA 5DJLA 4BWSA 2H8LA 1Z7PA 2VD1A 1EZKA 1Z5YE 3VWVA 2EC4A 4H86A 4HJ2A 1OC9A 2NBSA 2XPDA 2P0GA 2TRXA 4IQAA 2VL2A 1BG5A 4MZWA 5HR3A 3HVVA 2IL3A 1GSYA 3ZMKA 2WRTA 3TKSE 3FHKA 2VAFA 2IIYA 3CMIA 2K18A 4K8MA 4ML1A 2GQMA 2V2GA 4K7OA 1N8JA 5GAND 2LNSA 3D21A 1AC1A 4OWYA 2IWTA 1THOA 2LUSA 3PGTA 1K3YA 4GSNA 3LYPA 5ECKB 1QXHA 4BL7A 4BVXA 4MPFA 3U5RE 4OMVA 4HZ4A 1PN9A 4JR4A 4F03A 1OAZA 2P5QA 3EWLA 4KX4A 3M0FA 1MDKA 4MZCA 4NPBA 2OKAA 3KP9A 3EINA 2XBQA 3Q6OA 1UVZA 5DQSA 4FH8A 6GSTA 1YF1A 5F8BA 1Y6EA 4IKHA 2X8GA 1H75A 2PN8A 4X0XA 1GSUA 2CAQA 4DSRA 4MCUA 4MJBA 2DJ2A 5ECSA 1LBKA 4XHMA 3TB2A 3C8EA 2CX4A 1FVKA 1T4ZA 4IGJA 1ZGNA 3DVXA 2GQKA 1V9WA 5CAXA 1JFUA 4NHZA 5JCWA 2B7KA 1QGVA 4WEYA 5CP1A 3IBHA 1OC3A 4YQUA 4HUAA 2H71A 4POBA 2OE0A 3IA1A 3BOAA 4KSOA 3IXRA 2R37A 3DRNA 4EDYA 4IJIA 3HD5A 2JACA 2GSRA 2IMFA 1AQVA 3K8NA 1O73A 5H5QA 1UC7A 2FWEA 4WXTA 2H1GA 3N9JA 14GSA 1R7HA 3G7IA 2PVOC 5AGYA 4AJ7A 3GKMA 1EWXA 2B7JA 2FA4A 4P3YB 5CRGA 1OE8A 4JRRA 4WETA 20GSA 5DAKB 3UMAA 2YJ7A 2WDUA 4BWQA 2NVLA 4I2UA 1O81A 4ZIJA 1K0OA 2F51A 5COHA 1WP0A 2BMXA 3CRUA 3O3TA 3EVIA 1FVJA 1V40A 4QL9A 4TVEA 5IO2A 1DSBA 1OE7A 1GUHA 2L4QA 3P7XA 1U88A 4PX1A 5B7CA 3P2AA 3TJJA 1YZXA 4K9ZA 4RI7A 1EGOA 3Q74A 2IFQB 3E0UA 4TR1A 1GSQA 4EL1A 1XW5A 1T3BA 4KAEA 2LRCA 1Q98A 4LL1B 6GSUA 5ID2A 1MDJA 4HQZA 4OCFA 4HZ2A 5G31A 1IYIA 5IOWA 1S3AA 3M3MA 3ZYWA 1QFNA 5DBQA 3KP8A 1OC9B 2GZZA 2FCHA 5IQYA 3IE3A 3GTUA
chains in the Genus database with same CATH superfamily
4X4JA 1TP9A 5ECOB 1M7TA 5IMFA 2E2GA 2HRKA 3C1RA 1F9MA 3GH6A 3NOFA 4EKZA 4AJ8A 2PU9C 4LA1A 2IN3A 5CO3A 4LMWA 1TRSA 1HNCA 2FWHA 3H1NA 2FA8A 2J9HA 2LTKA 4TXVA 3MNGA 3V1WA 5CNWA 4MF5A 1A0FA 4BL7B 1ZYEA 5J41A 4GTUA 3C73A 4BVXB 1SJZA 3EU3A 2FGXA 3DXBA 2JU5A 4KE3A 4IN0A 2PERA 3U6VA 1XWGA 4J2FA 1YEPA 4E8HA 4MABA 1ZYPA 3UJ1A 1TKDB 3A2VA 3FY7A 1O85A 3GKXA 3ZMLA 1X9MB 3QFBC 1G7EA 1PKZA 2H76A 2EIRA 5BRTA 4QL7A 4MJAA 1XCCA 2HYXA 1RW1A 1YJ6A 4I6XA 2WJUA 3LGCA 1PD21 3HJMA 2ZNMA 3ZIVA 3BCIA 2B3SA 4MP4A 3O76A 3RHBA 2RIIA 3Q19A 1FB0A 1PMTA 3LFLA 2V32A 3C1SA 3F8UA 3QDNA 5DALA 1YKCA 1ZCPA 2C3QA 2GQLA 2N5AA 2DLXA 2H1DA 2K8SA 3PR8A 1VF2A 4TW5A 2O89A 2DJJA 3ZTLA 3UBLA 1TDIA 3APOA 3GYKA 1UN2A 1G6WA 2NDOA 1PA3A 2H6ZA 5G1KA 5B8AA 1PSQA 2GSSA 1M9BA 4N30A 3ERFA 1GTIA 4O7HA 1GTUA 2H72A 2NPBA 3F3QA 4TR3A 1K0BA 4GSSA 1ZMAA 4O92A 3QR6A 1Z6NA 1WPIA 3LEFA 1F3BA 3TRPA 1M2BA 4NV2A 3D5JA 1AXDA 2FWGA 1ILOA 2GT5A 3ZZXA 3H8QA 4ECIA 1CQGA 3QOUA 1RQMA 3E9JB 4XIHA 4ML6A 2PGTA 2A4HA 3KIJA 3KMNA 1XOBA 4ZXGA 4PNGA 5DVBA 3EYTA 2H66A 1EV4A 4TR1B 4ZBDA 4EIPA 4OO5A 2H0IA 2GS3A 2H1BA 2REMA 4D73A 3A2XA 1GNWA 3R3EA 2MBTA 3LYKA 1SL2B 5ID2B 3CQFA 1EOHA 3ZVJD 3KMOA 2DKHA 4NMUA 1XZOA 3TOUA 3IPZA 5A4VA 1QUWA 5HR1A 3EMXA 3WT1A 3HVSA 2VUPA 3GTUB 4NAXA 4Z7XA 5G1LA 11GSA 2BTOT 3IC8A 5HQPA 1J0FA 2H75A 2B5XA 2WS2A 1M2DA 1FAAA 3ZVJA 1AAZA 2DC5A 5ELAA 1J9BA 6GSVA 1OKTA 3ZLPA 4E8EA 2PVQA 3EC3A 4POMA 2WFCA 3VWXA 4WBRD 4A5PA 2JSYA 3LW9A 3WD6A 3IDVA 1A0RP 1PRXA 3I69A 1BQ7A 1ERWA 4TN8A 3VPTA 1JLVA 4XS4A 1AUCA 2H73A 1LU4A 2X99A 4PURA 3KXOA 4GQCA 1HNBA 3VWWA 2C0DA 4JEDA 5GZZB 3ZFBA 4I2TA 3EMPA 3IOSA 1HNAA 3HYPA 2IMDA 4J57E 1PFOA 1XWKA 2JL4A 5DCHA 1O7UA 16GSA 1SYRA 4PQIA 1FOVA 1Q4JA 6GSXA 3H4KA 1DE2A 1FHEA 3KZQA 1V98A 2XC2A 1YKAA 2GSTA 3QCPA 2AHEA 4L0WA 1AQWA 1TTZA 4JR6A 1BX9A 5BMUA 5CREA 1A8YA 2TRCP 2QA2A 4ZBBA 3F4SA 2HRFA 4Z2TA 5FHIA 3FZ4A 5DALB 2VM2A 4GLTA 4HOJA 4K7IA 2YV9A 2WCIA 5ECQB 1B9YC 2YNXA 3KM6A 1NSWA 1QQ2A 1OYJA 10GSA 4HSCX 1FB6A 1Z9HA 4Q5QA 4FYUA 1BAYA 2LS5A 3CYNA 5GAPD 3FEUA 2H1AA 3P8WA 5HR2A 2FD3A 1XFLA 4MDCA 3UARA 4F9ZA 2OBKA 4IW9A 4PUAA 2TIRA 3VPQA 3TJKA 4KCAA 1TRVA 2QGVA 3QPMA 2O8VB 1U3AA 3DVWA 1M3IA 4K1FA 2I3YA 2V1MA 1N2AA 3P90A 3L9SA 3VURA 2MMAA 2GGTA 3FRCA 3DWVA 1Z3EA 1GSEA 2GZPA 4ISDA 2OE1A 1X5EA 2H6YA 3APQA 3D4MA 1O8XA 2L4CA 3FR3A 1SENA 4ULXA 3QAGA 5KN0A 2H01A 2OADA 4BA7A 1X9WB 2KP2A 1MD4A 1MDIA 5F07A 3UBKA 1CQHA 3C7MA 2VO4A 5INYA 4PQ1A 4RQXA 1SK0A 5JCGA 1UA5A 4D73B 1F6MC 1KNGA 2VL3A 3SWLA 1I5GA 7GSSA 4MJCA 3F63A 1ST9A 1ERVA 2PBJA 2L5OA 2CA8A 3EURA 4CHSA 1EP7A 1WRYA 4MLYA 3LSZA 3FZ9A 3D22A 1C72A 3W6GA 1R4WA 3F3RA 4HDEA 1HQOA 2YZHA 2RUEA 1W4VA 1GSSA 2V6OA 3IAS2 4WF5A 4HEA2 4XCSA 5IMVA 5ELGA 3O6TA 1SKSB 4HQSA 3TKRA 2DJKA 1TRUA 4Z2UA 3GHAA 1XWAA 4MJEA 3HCZA 3GX8A 2RM5A 1B4PA 2JZRA 1G6YA 3FMWA 1OVNA 2WULA 3KH9A 1TOFA 3LWAA 2H6XA 3ZIJA 4XS4B 4DSSA 2GZYA 4GSTA 2R4VA 4ICYA 4OFNA 2KLXA 4MK3A 2VCVA 5H5SA 2QC7A 2H0GA 2YCDA 5H5RA 2CX3A 2I4AA 3W8SA 4N0ZA 1PL2A 1VRSD 3DEXA 4JU5A 2DIZA 1EV9A 2YOIA 1M9AA 2HE3A 3M9JA 4LLRA 1PQNA 1QMVA 1TI3A 5KN1A 5A5KA 4ZL7A 1E6BA 2B5YA 1XG8A 1K3LA 2LSTA 3M8NA 3W8JA 5F0GA 1XPVA 5EL8A 3IAM2 5ECMB 2VCZA 1SU9A 3VI7A 5G2ZA 4V2LA 5JCUA 22GSA 3HXSA 3LXZA 1ERTA 5AISA 1VF3A 4KUNA 4F82A 2VM1A 3DMLA 5AIVA 5ECIB 3ERWA 4AF2A 3GKKA 1HYUA 1XWBA 2NTOA 1TRWA 4YAPA 2K6VA 1QK8A 4J56E 3ED3A 4FQUA 2VIMA 2CVDA 1A2MA 1SK1A 4XS6A 5D9TA 2F8FA 3RPNA 2MMOA 3DD3A 2CZ3A 3TKQA 3GMFA 2DIYA 1AW9A 1GH2A 3I9V2 2Z9SA 2AUVA 2PMTA 2A4VA 4F0BA 1GTBA 3WT2A 3HDCA 5C00A 2DSAA 3RBTA 2AYTA 2GSQA 3TRQA 2X64A 4YH2A 3GKNA 1X5DA 1DUGA 2I81A 3GV1A 4G10A 3MDKA 4RQRA 3TGZA 1TK0B 4CW9A 2OACA 3N5OA 3TKPA 3S9FA 2RUFA 3HHVA 4EUYA 2HZFA 3TUEA 4USSA 2FHEA 1TK8B 1GWCA 4V2MA 2HLSA 1THXA 2ZCTA 3LXTA 5HFIA 5KEJA 2LRNA 2YWMA 1TJDA 4G0KA 2VL9A 4OFMA 3BCKA 5FT3A 3ZFLA 3ZREA 2YP6A 2AJQB 4KDUA 2C0EA 1W89A 1F3AA 1ZZYA 4K5SA 3TKSC 5D73A 4WR5A 3NZNA 5ECPB 3SBCA 1YQ1A 2N5BA 4NWYA 3KJYA 3HVXA 4MMMA 3I6AA 1WOUA 1Z6MA 2R3XA 5EY6A 3L9UA 1VF4A 3GL5A 1M0UA 3CTFA 1XBSA 2FUG2 4Z2RA 3GUSA 4WKWA 1Z7RA 5F06A 2LKUA 2YWOA 3H79A 2UZ8A 1JZDA 1YF0A 4PXOA 1WE0A 2HSHA 4IQ1A 4K7NA 4TR4A 2F3MA 4OFTA 4ZL9A 1YY7A 1GULA 1M2AA 2HRNA 3EE2A 4MF6A 2HFDA 3TOTA 4EIQA 4XTSA 2XHFA 1SL1B 3D6IA 4WR4A 4LL4B 2VLTA 3QAWA 3IK9A 4DSSB 2AB6A 3IHQA 2MBSA 2CV4A 1KEBA 4EE0A 2AAWA 2H70A 3IC4A 2M72A 4LMVA 1DBYA 1M99A 5E4WA 5EPFA 3MSZA 4IHUA 4XRDA 2X8CA 3RPPA 1HD2A 1V58A 4K6XA 3GIXA 4PGTA 3KCMA 3GL3A 5B6NA 1XWCA 3GSTA 3TKSA 2FY6A 3QAVA 3ISOA 4KDYA 2LJKA 2PWJA 3L0HA 4RI6A 1USBA 3TJFA 2DMLA 3HZ8A 4AJ6A 1O6JA 3FW2A 4GWRA 2YWIA 2C80A 4IVFA 2YWNA 1J08A 3GX0A 4ZB9A 4N10A 2IMKA 2R6KA 1GUKA 5LCZA 2LRTA 3L9VA 4IJ3A 5B8BA 2QKEA 4TKYA 3LG6A 2O87A 3F4RA 5CRWA 4OCEA 1JHBA 3GA4A 3L78A 4L8EA 2C8UA 1A8LA 4O32A 2I1UA 1K0AA 4JE1A 1JLWA 1WJKA 2L59A 2CAIA 4MH3A 3C71A 3LJRA 3PINA 1K0DA 4IBPA 3TJGA 3LORA 2XBIA 2GDRA 1BYEA 4EXJA 3DKSA 2C0FA 1BEDA 4EO3A 1NW2A 2MMZA 3NIVA 2H0HA 4FO5A 3UIWA 5HR0A 2B1LA 2V41A 4PNFA 3F6FA 1AIUA 2OE3A 4BIKA 1OKDA 2YPMA 5HFGA 1OC8A 2A2PA 1NHYA 2VD0A 4NV5A 2YANA 3TCOA 4EF0A 2FNOA 5J9CA 1PX6A 2ALBA 1ZL9A 4L5LA 4CY8A 4K5RA 1B9XC 17GSA 3FYGA 2EIQA 4HJMA 5D9VA 3F6DA 5B6MA 2A2RA 2O85A 3FK8A 4NXIA 1KBNA 2JZTA 1VF1A 4KA0A 5ECHB 2JADA 3MYDA 1T8EB 2MMNA 2LQQA 4ZL8A 2MZCA 3KTLA 3PH9A 4DEJA 2LV3A 5EVOA 3M1GA 1R26A 2HXKA 1YDKA 2ON5A 2C0GA 4KDXA 1SL0B 4ACSA 4V1Ap 1G7OA 3MWHA 5ECNB 2WGRA 4EDZA 3CXGA 1EOGA 4V2NA 3F4TA 3R2QA 3TJBA 4O5RA 1V57A 1VGLA 2BJXA 2H30A 3VI5A 1WMJA 5A4UA 1ML6A 4HU9A 4XS1A 2L57A 2K8VA 5DJMA 2L6DA 4OD7A 3ME8A 2VOCA 2G0FA 3A2WA 5G30A 2ON7A 1T7PB 4HS1A 4ID0A 4K0NA 2DKIA 4I97A 1ZYQB 1DE1A 4YQMA 4I5QA 3ERGA 12GSA 2HZEA 3G7JA 4RUVA 3QMXA 1E2YA 2P5RA 3HJOA 1GLPA 5J4UA 4X1UA 1FW1A 5KOWA 2YN1A 1T4YA 1TU8A 4Q5FA 1GSFA 3HJPA 5IM9A 5E59A 1H4OA 2A2SA 4ILFA 3QD9A 1B8XA 3CSIA 4MPGA 1K3OA 2OBIA 2VCWA 2CQ9A 3QFAC 4N0VA 1O8WA 4TXOA 2VCXA 5JWRB 1KTEA 4ECCA 1ZYNA 3ZITA 2IPAA 2OJLA 4GQFA 4WF4A 5JWQB 5KN2A 1ACVA 3CBUA 4L5OA 5GSSA 2X4AA 1EEMA 2IMEA 2P31A 5FWGA 1GLQA 1A2JA 1A23A 1SJIA 1TW9A 2KHPA 4CY6A 3KGKA 2CT6A 4XRAA 1WWJA 2X8HA 4G19A 1MD3A 4BPYA 4N11A 1FOHA 2L6CA 2XPEA 1ABAA 1SD9A 3DYRA 3GNJA 2DJ1A 1T1VA 3ME7A 2GVPA 4TR0A 1EP8A 4MF7A 8GSSA 2OA7A 3FKFA 3IK7A 1I9DA 5AIXA 3AY8A 3BD2A 1GL8A 4AGSA 4G0LA 1XOAA 1AQXA 2ES7A 3G7YA 3H93A 4YKGA 1EEJA 3A5IA 2LJRA 1M3JA 2KOKA 4ECBA 4IP1A 2I9HA 5HFKA 4FYBA 2AV4A 3IHGA 4YAVA 4PQHA 1X5CA 4IELA 3DIEA 3GN3A 3CSHA 2J23A 4F2IA 2B1KA 6GSWA 5J9BA 3JCML 5D9WA 3CTGA 2KP1A 2IMIA 3WGEA 5ECLB 3GURA 2MYGA 1LJRA 1U3IA 2O7KA 5J5NA 3F9UA 4YQVA 1GSDA 5IMZA 2RLIA 4KF9A 5G5EA 2V6KA 4ZB6A 1B48A 2N5FA 3HY2A 4POLA 1S3DA 2L5LA 3OR5A 3MAKA 1X9SB 2YJHA 2CZ2A 3J7Yk 4KCEA 3LQ7A 4PTSA 1X0RA 4IS0A 3G9BA 1K0CA 4FYCA 3HVNA 1JZWA 2R0CA 1G0TA 1NM3A 2E2MA 4G2EA 3WGDA 2KUCA 2YZUA 2IJYA 4KB3A 3GSSA 1Y25A 3I43A 3FZ5A 5A4WA 2E0QA 1NHOA 1XVQA 1K0MA 3FR6A 1TU7A 1XXUA 3J7Yb 4ZILA 3UVHA 3ZRDA 1A2LA 2HZEB 2LJAA 2WZ9A 2JZSA 6GSSA 2HI7A 3HA9A 1FO5A 3CRTA 3MIXA 5IPHA 4ECJA 4GCIA 5CRDA 3BBYA 1JZRA 5GSTA 2F8AA 3GH9A 5LD0A 4GRFA 2VLVA 2R2JA 2H74A 3HZ4A 5C04A 4I8BA 1XIYA 2D2ZA 5D8IA 1GTAA 3KTBA 4G0IA 2G2QA 2VLUA 1GUMA 2H19A 4GF0A 5KOXA 4TXOB 2LQOA 1TXXA 1XW9A 2HRAA 2RM6A 1V2AA 5L71A 3A5WA 4V1Ag 5KN3A 3RHCA 2M46A 2M80A 3FZAA 1T00A 2C3TA 1IYHA 2C3NA 3L4NA 3VWUA 5IOXA 2EIOA 1ON4A 2E7PA 3VK9A 4NHWA 3A3TA 4FIWA 3D0ZA 5CRHA 5D93A 2VCTA 1GP1A 2HNLA 2PUKC 3TDGA 2PPTA 4Q5RA 3GRXA 4MA9A 3WGXA 4L0UA 2QSIA 3ZL5A 4MZBA 2F9SA 2GT6A 4QQ7A 1JZOA 4YKFA 3TRXA 3IRAA 4IP6A 18GSA 5G5FA 5DQYA 2DJ3A 3D4TA 5LNKe 3KD0A 3BJ5A 3GFKA 2R5GA 1XW6A 1SKRB 3M9KA 4KW6A 4K0GA 1TI1A 3EU4A 4X43A 5J3RA 2LNTA 4GXZA 2CVKA 2WB9A 1PGTA 5ECRB 2B6MA 1ERUA 1F37A 1FG4A 2K9FA 4DSQA 2VCQA 3PPUA 1PN0A 5IO0A 3Q18A 3CSJA 3DGQA 3KH7A 1PKWA 2DBCA 5IIZA 1MTCA 4POKA 1SYXA 5CYYA 4ZBAA 1U87A 2R0PA 4KSMA 3UL3A 1TK5B 1A24A 1WIKA 3UOMA 1ZOFA 4EC0A 2CVBA 4HI7A 4F0CA 1EGRA 5JWOB 1PX7A 2C1YA 2DMMA 2GTUA 4JZQA 4BVYA 3UEMA 1XVWA 1MEKA 4ZB8A 1SK2A 5D96A 2VL2C 5IMCA 1SKWB 1GRXA 3VLNA 1PL1A 4TOPA 4DVCA 3E3EA 1S3CA 5ENUA 4K2DA 6GSYA 3IV4A 5ABRA 3KEBA 5DAKA 5F05A 1URMA 5AN1A 4KH7A 4PUFC 2FLSA 3US3A 4HU7A 3UAPA 5DCGA 3VFIA 1GNEA 4WBJA 5IMDA 4JBBA 1RK4A 4TRXA 2B5EA 2HSYA 2LEGA 4KGIA 1B4QA 3RDWA 3IR4A 1BJXA 1U6TA 3EPTA 19GSA 1R5AA 2QA1A 5IMAA 5D9XA 1R5PA 13GSA 2YV7A 1SD8A 2DJ0A 2JSZA 4G9HA 4MH2A 4KNDA 2C4JA 4CDOA 2HT9A 5DDLA 2IFQA 3WYWA 2FWFA 3FR9A 3HKRA 3APSA 9GSSA 1SJ6A 1K0NA 3RAZA 2ZUPA 1YEXA 4EVMA 3F0IA 1F2EA 3UVTA 4OO4A 5IPGA 4Q5NA 2GLRA 5DJLA 4BWSA 2H8LA 1Z7PA 2VD1A 1EZKA 1Z5YE 3VWVA 2EC4A 4H86A 4HJ2A 1OC9A 2NBSA 2XPDA 2X49A 2P0GA 2TRXA 4IQAA 2VL2A 1BG5A 4MZWA 5HR3A 3HVVA 2IL3A 1GSYA 3ZMKA 2WRTA 3TKSE 3FHKA 2VAFA 2IIYA 3CMIA 2K18A 4K8MA 4ML1A 2GQMA 2V2GA 4K7OA 1N8JA 5GAND 2LNSA 3D21A 1AC1A 4OWYA 2IWTA 1THOA 2HSMA 2LUSA 3PGTA 1K3YA 4GSNA 2R0GA 3LYPA 5ECKB 1QXHA 4BL7A 4BVXA 4MPFA 3U5RE 4OMVA 4HZ4A 1PN9A 4JR4A 4F03A 1OAZA 2P5QA 3EWLA 4KX4A 3M0FA 1MDKA 4MZCA 4NPBA 2OKAA 3KP9A 3EINA 2XBQA 3Q6OA 1UVZA 5DQSA 4FH8A 6GSTA 1YF1A 5F8BA 1Y6EA 4IKHA 4K2XA 2X8GA 1H75A 2PN8A 4X0XA 1GSUA 2CAQA 4DSRA 4MCUA 4MJBA 2DJ2A 5ECSA 1LBKA 4XHMA 3TB2A 3C8EA 1S3RA 4MNNA 2CX4A 1FVKA 1T4ZA 4IGJA 1ZGNA 3DVXA 2GQKA 1V9WA 5CAXA 1JFUA 4NHZA 5JCWA 2B7KA 1QGVA 4WEYA 5CP1A 3IBHA 1OC3A 4YQUA 4HUAA 2H71A 4POBA 2OE0A 3IA1A 3BOAA 4KSOA 3IXRA 2R37A 3DRNA 4EDYA 4IJIA 3HD5A 2JACA 2GSRA 2IMFA 4BVYB 1AQVA 3K8NA 1O73A 5H5QA 1UC7A 2FWEA 4WXTA 2H1GA 3N9JA 14GSA 1R7HA 3G7IA 2PVOC 5AGYA 4AJ7A 3GKMA 1EWXA 2B7JA 2FA4A 4P3YB 5CRGA 1OE8A 4JRRA 4WETA 20GSA 5DAKB 3UMAA 2YJ7A 2WDUA 4BWQA 2NVLA 4I2UA 1O81A 4ZIJA 1K0OA 2F51A 5COHA 1WP0A 2BMXA 3CRUA 3O3TA 3EVIA 1FVJA 1V40A 4QL9A 4TVEA 5IO2A 1DSBA 1OE7A 1GUHA 2L4QA 3P7XA 1U88A 4PX1A 4O5UA 5B7CA 3P2AA 3TJJA 1YZXA 4K9ZA 4RI7A 1EGOA 3Q74A 2IFQB 3E0UA 4TR1A 1GSQA 4EL1A 1XW5A 1T3BA 4KAEA 2LRCA 1Q98A 4LL1B 6GSUA 5ID2A 1MDJA 4HQZA 4OCFA 4HZ2A 5G31A 1IYIA 5IOWA 1S3AA 3M3MA 3ZYWA 1QFNA 5DBQA 3KP8A 1OC9B 2GZZA 2FCHA 5IQYA 4O5QA 3IE3A 3GTUA
chains in the Genus database with same CATH topology
4X4JA 1TP9A 5ECOB 1M7TA 5IMFA 2E2GA 2HRKA 3C1RA 1F9MA 3GH6A 3NOFA 4EKZA 4AJ8A 2PU9C 4LA1A 2IN3A 5CO3A 4LMWA 1TRSA 1HNCA 2FWHA 3H1NA 2FA8A 2J9HA 2LTKA 4TXVA 3MNGA 3V1WA 5CNWA 4MF5A 1A0FA 4BL7B 1ZYEA 5J41A 4GTUA 3C73A 4BVXB 1SJZA 3EU3A 2FGXA 3DXBA 2JU5A 4KE3A 4IN0A 2PERA 3U6VA 1XWGA 4J2FA 1YEPA 4E8HA 4MABA 1ZYPA 3UJ1A 1TKDB 3A2VA 3FY7A 1O85A 3GKXA 3ZMLA 1X9MB 3QFBC 1G7EA 1PKZA 2H76A 2EIRA 5BRTA 4QL7A 4MJAA 1XCCA 2HYXA 1RW1A 1YJ6A 4I6XA 2WJUA 3LGCA 1PD21 3HJMA 2ZNMA 3ZIVA 3BCIA 2B3SA 4MP4A 3O76A 3RHBA 2RIIA 3Q19A 1FB0A 1PMTA 3LFLA 2V32A 3C1SA 3F8UA 3QDNA 5DALA 1YKCA 1ZCPA 2C3QA 2GQLA 2N5AA 2DLXA 2H1DA 2K8SA 3PR8A 1VF2A 4TW5A 2O89A 2DJJA 3ZTLA 3UBLA 1TDIA 3APOA 3GYKA 1UN2A 1G6WA 2NDOA 1PA3A 2H6ZA 5G1KA 5B8AA 1PSQA 2GSSA 1M9BA 4N30A 3ERFA 1GTIA 4O7HA 1GTUA 2H72A 2NPBA 3F3QA 4TR3A 1K0BA 4GSSA 1ZMAA 4O92A 3QR6A 1Z6NA 1WPIA 3LEFA 1F3BA 3TRPA 1M2BA 4NV2A 3D5JA 1AXDA 2FWGA 1ILOA 2GT5A 3ZZXA 3H8QA 4ECIA 1CQGA 3QOUA 1RQMA 3E9JB 4XIHA 4ML6A 2PGTA 2A4HA 3KIJA 3KMNA 1XOBA 4ZXGA 4PNGA 5DVBA 3EYTA 2H66A 1EV4A 4TR1B 4ZBDA 4EIPA 4OO5A 2H0IA 2GS3A 2H1BA 2REMA 4D73A 3A2XA 1GNWA 3R3EA 2MBTA 3LYKA 1SL2B 5ID2B 1EOHA 3ZVJD 3KMOA 2DKHA 4NMUA 1XZOA 3TOUA 3IPZA 5A4VA 1QUWA 5HR1A 3EMXA 3WT1A 3HVSA 2VUPA 3GTUB 4NAXA 4Z7XA 5G1LA 11GSA 2BTOT 3IC8A 5HQPA 1J0FA 2H75A 2B5XA 2WS2A 1M2DA 1FAAA 3ZVJA 1AAZA 2DC5A 5ELAA 1J9BA 6GSVA 1OKTA 3ZLPA 4E8EA 2PVQA 3EC3A 4POMA 2WFCA 3VWXA 4WBRD 4A5PA 2JSYA 3LW9A 3WD6A 3IDVA 1A0RP 1PRXA 3I69A 1BQ7A 1ERWA 4TN8A 3VPTA 1JLVA 4XS4A 1AUCA 2H73A 1LU4A 2X99A 4PURA 3KXOA 4GQCA 1HNBA 3VWWA 2C0DA 4JEDA 5GZZB 3ZFBA 4I2TA 3EMPA 3IOSA 1HNAA 3HYPA 2IMDA 4J57E 1XWKA 2JL4A 5DCHA 1O7UA 16GSA 1SYRA 4PQIA 1FOVA 1Q4JA 6GSXA 3H4KA 1DE2A 1FHEA 3KZQA 1V98A 2XC2A 1YKAA 2GSTA 3QCPA 2AHEA 4L0WA 1AQWA 1TTZA 4JR6A 1BX9A 5BMUA 5CREA 1A8YA 2TRCP 2QA2A 4ZBBA 3F4SA 2HRFA 4Z2TA 5FHIA 3FZ4A 5DALB 2VM2A 4GLTA 4HOJA 4K7IA 2YV9A 2WCIA 5ECQB 1B9YC 2YNXA 3KM6A 1NSWA 1QQ2A 1OYJA 10GSA 1FB6A 1Z9HA 4Q5QA 4FYUA 1BAYA 2LS5A 3CYNA 5GAPD 3FEUA 2H1AA 3P8WA 5HR2A 2FD3A 1XFLA 4MDCA 3UARA 4F9ZA 2OBKA 4IW9A 4PUAA 2TIRA 3VPQA 3TJKA 4KCAA 1TRVA 2QGVA 3QPMA 2O8VB 1U3AA 3DVWA 4K1FA 2I3YA 2V1MA 1N2AA 3P90A 3L9SA 3VURA 2MMAA 2GGTA 3FRCA 3DWVA 1Z3EA 1GSEA 2GZPA 4ISDA 2OE1A 1X5EA 2H6YA 3APQA 3D4MA 1O8XA 2L4CA 3FR3A 1SENA 4ULXA 3QAGA 5KN0A 2H01A 2OADA 4BA7A 1X9WB 2KP2A 1MD4A 1MDIA 5F07A 3UBKA 1CQHA 3C7MA 2VO4A 5INYA 4PQ1A 4RQXA 1SK0A 5JCGA 1UA5A 4D73B 1F6MC 1KNGA 2VL3A 3SWLA 1I5GA 7GSSA 4MJCA 3F63A 1ST9A 1ERVA 2PBJA 2L5OA 2CA8A 3EURA 4CHSA 1EP7A 1WRYA 4MLYA 3LSZA 3FZ9A 3D22A 1C72A 3W6GA 1R4WA 3F3RA 4HDEA 1HQOA 2YZHA 2RUEA 1W4VA 1GSSA 2V6OA 3IAS2 4WF5A 4HEA2 4XCSA 5IMVA 5ELGA 3O6TA 1SKSB 4HQSA 3TKRA 2DJKA 1TRUA 4Z2UA 3GHAA 1XWAA 4MJEA 3HCZA 3GX8A 2RM5A 1B4PA 2JZRA 1G6YA 3FMWA 1OVNA 2WULA 3KH9A 1TOFA 3LWAA 2H6XA 3ZIJA 4XS4B 4DSSA 2GZYA 4GSTA 2R4VA 4ICYA 4OFNA 2KLXA 4MK3A 2VCVA 5H5SA 2QC7A 2H0GA 2YCDA 5H5RA 2CX3A 2I4AA 3W8SA 4N0ZA 1PL2A 1VRSD 3DEXA 4JU5A 2DIZA 1EV9A 2YOIA 1M9AA 2HE3A 3M9JA 4LLRA 1PQNA 1QMVA 1TI3A 5KN1A 5A5KA 4ZL7A 1E6BA 2B5YA 1K3LA 2LSTA 3M8NA 3W8JA 5F0GA 1XPVA 5EL8A 3IAM2 5ECMB 2VCZA 1SU9A 3VI7A 5G2ZA 4V2LA 5JCUA 22GSA 3HXSA 3LXZA 1ERTA 5AISA 1VF3A 4KUNA 4F82A 2VM1A 3DMLA 5AIVA 5ECIB 3ERWA 4AF2A 3GKKA 1HYUA 1XWBA 2NTOA 1TRWA 4YAPA 2K6VA 1QK8A 4J56E 3ED3A 4FQUA 2VIMA 2CVDA 1A2MA 1SK1A 4XS6A 5D9TA 2F8FA 3RPNA 2MMOA 3DD3A 2CZ3A 3TKQA 3GMFA 2DIYA 1AW9A 1GH2A 3I9V2 2Z9SA 2AUVA 2PMTA 2A4VA 4F0BA 1GTBA 3WT2A 3HDCA 5C00A 2DSAA 3RBTA 2AYTA 2GSQA 3TRQA 2X64A 4YH2A 3GKNA 1X5DA 1DUGA 2I81A 3GV1A 4G10A 3MDKA 4RQRA 3TGZA 1TK0B 4CW9A 2OACA 3N5OA 3TKPA 3S9FA 2RUFA 3HHVA 4EUYA 2HZFA 3TUEA 4USSA 2FHEA 1TK8B 1GWCA 4V2MA 2HLSA 1THXA 2ZCTA 3LXTA 5HFIA 5KEJA 2LRNA 2YWMA 1TJDA 4G0KA 2VL9A 4OFMA 3BCKA 5FT3A 3ZFLA 3ZREA 2YP6A 2AJQB 4KDUA 2C0EA 1W89A 1F3AA 1ZZYA 4K5SA 3TKSC 5D73A 4WR5A 3NZNA 5ECPB 3SBCA 1YQ1A 2N5BA 4NWYA 3KJYA 3HVXA 4MMMA 3I6AA 1WOUA 1Z6MA 2R3XA 5EY6A 3L9UA 1VF4A 3GL5A 1M0UA 3CTFA 1XBSA 2FUG2 4Z2RA 3GUSA 4WKWA 1Z7RA 5F06A 2LKUA 2YWOA 3H79A 2UZ8A 1JZDA 1YF0A 4PXOA 1WE0A 2HSHA 4IQ1A 4K7NA 4TR4A 2F3MA 4OFTA 4ZL9A 1YY7A 1GULA 1M2AA 2HRNA 3EE2A 4MF6A 2HFDA 3TOTA 4EIQA 4XTSA 2XHFA 1SL1B 3D6IA 4WR4A 4LL4B 2VLTA 3QAWA 3IK9A 4DSSB 2AB6A 3IHQA 2MBSA 2CV4A 1KEBA 4EE0A 2AAWA 2H70A 3IC4A 2M72A 4LMVA 1DBYA 1M99A 5E4WA 5EPFA 3MSZA 4IHUA 4XRDA 2X8CA 3RPPA 1HD2A 1V58A 4K6XA 3GIXA 4PGTA 3KCMA 3GL3A 5B6NA 1XWCA 3GSTA 3TKSA 2FY6A 3QAVA 3ISOA 4KDYA 2LJKA 2PWJA 3L0HA 4RI6A 1USBA 3TJFA 2DMLA 3HZ8A 4AJ6A 1O6JA 3FW2A 4GWRA 2YWIA 2C80A 4IVFA 2YWNA 1J08A 3GX0A 4ZB9A 4N10A 2IMKA 2R6KA 1GUKA 5LCZA 2LRTA 3L9VA 4IJ3A 5B8BA 2QKEA 4TKYA 3LG6A 2O87A 3F4RA 5CRWA 4OCEA 1JHBA 3GA4A 3L78A 4L8EA 2C8UA 1A8LA 4O32A 2I1UA 1K0AA 4JE1A 1JLWA 1WJKA 2L59A 2CAIA 4MH3A 3C71A 3LJRA 3PINA 1K0DA 4IBPA 3TJGA 3LORA 2XBIA 2GDRA 1BYEA 4EXJA 3DKSA 2C0FA 1BEDA 4EO3A 1NW2A 2MMZA 3NIVA 2H0HA 4FO5A 3UIWA 5HR0A 2B1LA 2V41A 4PNFA 3F6FA 1AIUA 2OE3A 1OKDA 2YPMA 5HFGA 1OC8A 2A2PA 1NHYA 2VD0A 4NV5A 2YANA 3TCOA 4EF0A 2FNOA 5J9CA 1PX6A 2ALBA 1ZL9A 4L5LA 4CY8A 4K5RA 1B9XC 17GSA 3FYGA 2EIQA 4HJMA 5D9VA 3F6DA 5B6MA 2A2RA 2O85A 3FK8A 4NXIA 1KBNA 2JZTA 1VF1A 4KA0A 5ECHB 2JADA 3MYDA 1T8EB 2MMNA 2LQQA 4ZL8A 2MZCA 3KTLA 3PH9A 4DEJA 2LV3A 5EVOA 3M1GA 1R26A 2HXKA 1YDKA 2ON5A 2C0GA 4KDXA 1SL0B 4ACSA 4V1Ap 1G7OA 3MWHA 5ECNB 2WGRA 4EDZA 3CXGA 1EOGA 4V2NA 3F4TA 3R2QA 3TJBA 4O5RA 1V57A 1VGLA 2BJXA 2H30A 3VI5A 1WMJA 5A4UA 1ML6A 4HU9A 4XS1A 2L57A 2K8VA 5DJMA 2L6DA 4OD7A 3ME8A 2VOCA 2G0FA 3A2WA 5G30A 2ON7A 1T7PB 4HS1A 4ID0A 4K0NA 2DKIA 4I97A 1ZYQB 1DE1A 4YQMA 4I5QA 3ERGA 12GSA 2HZEA 3G7JA 4RUVA 3QMXA 1E2YA 2P5RA 3HJOA 1GLPA 5J4UA 4X1UA 1FW1A 5KOWA 2YN1A 1T4YA 1TU8A 4Q5FA 1GSFA 3HJPA 5IM9A 5E59A 1H4OA 2A2SA 4ILFA 3QD9A 1B8XA 3CSIA 4MPGA 1K3OA 2OBIA 2VCWA 2CQ9A 3QFAC 4N0VA 1O8WA 4TXOA 2VCXA 5JWRB 1KTEA 4ECCA 1ZYNA 3ZITA 2IPAA 2OJLA 4GQFA 4WF4A 5JWQB 5KN2A 1ACVA 3CBUA 4L5OA 5GSSA 2X4AA 1EEMA 2IMEA 2P31A 5FWGA 1GLQA 1A2JA 1A23A 1SJIA 1TW9A 2KHPA 4CY6A 3KGKA 2CT6A 4XRAA 1WWJA 2X8HA 4G19A 1MD3A 4BPYA 4N11A 1FOHA 2L6CA 2XPEA 1ABAA 1SD9A 3DYRA 3GNJA 2DJ1A 1T1VA 3ME7A 2GVPA 4TR0A 1EP8A 4MF7A 8GSSA 2OA7A 3FKFA 3IK7A 1I9DA 5AIXA 3AY8A 3BD2A 1GL8A 4AGSA 4G0LA 1XOAA 1AQXA 2ES7A 3G7YA 3H93A 4YKGA 1EEJA 3A5IA 2LJRA 2KOKA 4ECBA 4IP1A 2I9HA 5HFKA 4FYBA 2AV4A 3IHGA 4YAVA 4PQHA 1X5CA 4IELA 3DIEA 3GN3A 3CSHA 2J23A 4F2IA 2B1KA 6GSWA 5J9BA 3JCML 5D9WA 3CTGA 2KP1A 2IMIA 3WGEA 5ECLB 3GURA 2MYGA 1LJRA 1U3IA 2O7KA 5J5NA 3F9UA 4YQVA 1GSDA 5IMZA 2RLIA 4KF9A 5G5EA 2V6KA 4ZB6A 1B48A 2N5FA 3HY2A 4POLA 1S3DA 2L5LA 3OR5A 3MAKA 1X9SB 2YJHA 2CZ2A 3J7Yk 4KCEA 3LQ7A 4PTSA 1X0RA 4IS0A 3G9BA 1K0CA 4FYCA 1JZWA 2R0CA 1G0TA 1NM3A 2E2MA 4G2EA 3WGDA 2KUCA 2YZUA 2IJYA 4KB3A 3GSSA 1Y25A 3I43A 3FZ5A 5A4WA 2E0QA 1NHOA 1XVQA 1K0MA 3FR6A 1TU7A 1XXUA 3J7Yb 4ZILA 3UVHA 3ZRDA 1A2LA 2HZEB 2LJAA 2WZ9A 2JZSA 6GSSA 2HI7A 3HA9A 1FO5A 3CRTA 3MIXA 5IPHA 4ECJA 4GCIA 5CRDA 3BBYA 1JZRA 5GSTA 2F8AA 3GH9A 5LD0A 4GRFA 2VLVA 2R2JA 2H74A 3HZ4A 5C04A 4I8BA 1XIYA 2D2ZA 5D8IA 1GTAA 3KTBA 4G0IA 2G2QA 2VLUA 1GUMA 2H19A 4GF0A 5KOXA 4TXOB 2LQOA 1TXXA 1XW9A 2HRAA 2RM6A 1V2AA 5L71A 3A5WA 4V1Ag 5KN3A 3RHCA 2M46A 2M80A 3FZAA 1T00A 2C3TA 1IYHA 2C3NA 3L4NA 3VWUA 5IOXA 2EIOA 1ON4A 2E7PA 3VK9A 4NHWA 3A3TA 4FIWA 3D0ZA 5CRHA 5D93A 2VCTA 1GP1A 2HNLA 2PUKC 3TDGA 2PPTA 4Q5RA 3GRXA 4MA9A 3WGXA 4L0UA 2QSIA 3ZL5A 4MZBA 2F9SA 2GT6A 4QQ7A 1JZOA 4YKFA 3TRXA 3IRAA 4IP6A 18GSA 5G5FA 5DQYA 2DJ3A 3D4TA 5LNKe 3KD0A 3BJ5A 3GFKA 2R5GA 1XW6A 1SKRB 3M9KA 4KW6A 4K0GA 1TI1A 3EU4A 4X43A 5J3RA 2LNTA 4GXZA 2CVKA 2WB9A 1PGTA 5ECRB 2B6MA 1ERUA 1F37A 1FG4A 2K9FA 4DSQA 2VCQA 3PPUA 1PN0A 5IO0A 3Q18A 3CSJA 3DGQA 3KH7A 1PKWA 2DBCA 5IIZA 1MTCA 4POKA 1SYXA 5CYYA 4ZBAA 1U87A 2R0PA 4KSMA 3UL3A 1TK5B 1A24A 1WIKA 3UOMA 1ZOFA 4EC0A 2CVBA 4HI7A 4F0CA 1EGRA 5JWOB 1PX7A 2C1YA 2DMMA 2GTUA 4JZQA 4BVYA 3UEMA 1XVWA 1MEKA 4ZB8A 1SK2A 5D96A 2VL2C 5IMCA 1SKWB 1GRXA 3VLNA 1PL1A 4TOPA 4DVCA 3E3EA 1S3CA 5ENUA 4K2DA 6GSYA 3IV4A 5ABRA 3KEBA 5DAKA 5F05A 1URMA 5AN1A 4KH7A 4PUFC 2FLSA 3US3A 4HU7A 3UAPA 5DCGA 3VFIA 1GNEA 4WBJA 5IMDA 4JBBA 1RK4A 4TRXA 2B5EA 2HSYA 2LEGA 4KGIA 1B4QA 3RDWA 3IR4A 1BJXA 1U6TA 3EPTA 19GSA 1R5AA 2QA1A 5IMAA 5D9XA 1R5PA 13GSA 2YV7A 1SD8A 2DJ0A 2JSZA 4G9HA 4MH2A 4KNDA 2C4JA 4CDOA 2HT9A 5DDLA 2IFQA 3WYWA 2FWFA 3FR9A 3HKRA 3APSA 9GSSA 1SJ6A 1K0NA 3RAZA 2ZUPA 1YEXA 4EVMA 3F0IA 1F2EA 3UVTA 4OO4A 5IPGA 4Q5NA 2GLRA 5DJLA 4BWSA 2H8LA 1Z7PA 2VD1A 1EZKA 1Z5YE 3VWVA 2EC4A 4H86A 4HJ2A 1OC9A 2NBSA 2XPDA 2X49A 2P0GA 2TRXA 4IQAA 2VL2A 1BG5A 4MZWA 5HR3A 3HVVA 2IL3A 1GSYA 3ZMKA 2WRTA 3TKSE 3FHKA 2VAFA 2IIYA 3CMIA 2K18A 4K8MA 4ML1A 2GQMA 2V2GA 4K7OA 1N8JA 5GAND 2LNSA 3D21A 1AC1A 4OWYA 2IWTA 1THOA 2HSMA 2LUSA 3PGTA 1K3YA 4GSNA 2R0GA 3LYPA 5ECKB 1QXHA 4BL7A 4BVXA 4MPFA 3U5RE 4OMVA 4HZ4A 1PN9A 4JR4A 4F03A 1OAZA 2P5QA 3EWLA 4KX4A 3M0FA 1MDKA 4MZCA 4NPBA 2OKAA 3KP9A 3EINA 2XBQA 3Q6OA 1UVZA 5DQSA 4FH8A 6GSTA 1YF1A 5F8BA 1Y6EA 4IKHA 4K2XA 2X8GA 1H75A 2PN8A 4X0XA 1GSUA 2CAQA 4DSRA 4MCUA 4MJBA 2DJ2A 5ECSA 1LBKA 4XHMA 3TB2A 3C8EA 4MNNA 2CX4A 1FVKA 1T4ZA 4IGJA 1ZGNA 3DVXA 2GQKA 1V9WA 5CAXA 1JFUA 4NHZA 5JCWA 2B7KA 1QGVA 4WEYA 5CP1A 3IBHA 1OC3A 4YQUA 4HUAA 2H71A 4POBA 2OE0A 3IA1A 3BOAA 4KSOA 3IXRA 2R37A 3DRNA 4EDYA 4IJIA 3HD5A 2JACA 2GSRA 2IMFA 4BVYB 1AQVA 3K8NA 1O73A 5H5QA 1UC7A 2FWEA 4WXTA 2H1GA 3N9JA 14GSA 1R7HA 3G7IA 2PVOC 5AGYA 4AJ7A 3GKMA 1EWXA 2B7JA 2FA4A 4P3YB 5CRGA 1OE8A 4JRRA 4WETA 20GSA 5DAKB 3UMAA 2YJ7A 2WDUA 4BWQA 2NVLA 4I2UA 1O81A 4ZIJA 1K0OA 2F51A 5COHA 1WP0A 2BMXA 3CRUA 3O3TA 3EVIA 1FVJA 1V40A 4QL9A 4TVEA 5IO2A 1DSBA 1OE7A 1GUHA 2L4QA 3P7XA 1U88A 4PX1A 4O5UA 5B7CA 3P2AA 3TJJA 1YZXA 4K9ZA 4RI7A 1EGOA 3Q74A 2IFQB 3E0UA 4TR1A 1GSQA 4EL1A 1XW5A 1T3BA 4KAEA 2LRCA 1Q98A 4LL1B 6GSUA 5ID2A 1MDJA 4HQZA 4OCFA 4HZ2A 5G31A 1IYIA 5IOWA 1S3AA 3M3MA 3ZYWA 1QFNA 5DBQA 3KP8A 1OC9B 2GZZA 2FCHA 5IQYA 4O5QA 3IE3A 3GTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TP9 A;  5ECO B;  1M7T A;  5IMF A;  2E2G A;  3C1R A;  1F9M A;  3GH6 A;  3NOF A;  4EKZ A;  4AJ8 A;  2PU9 C;  4LA1 A;  2IN3 A;  5CO3 A;  4LMW A;  1TRS A;  1HNC A;  2FWH A;  3H1N A;  2FA8 A;  2J9H A;  2LTK A;  4TXV A;  3MNG A;  3V1W A;  5CNW A;  4MF5 A;  1A0F A;  1ZYE A;  5J41 A;  4GTU A;  3C73 A;  1SJZ A;  3EU3 A;  2FGX A;  3DXB A;  2JU5 A;  4KE3 A;  4IN0 A;  2PER A;  3U6V A;  1XWG A;  4J2F A;  1YEP A;  4E8H A;  4MAB A;  3UJ1 A;  1TKD B;  3A2V A;  3FY7 A;  1O85 A;  3GKX A;  3ZML A;  1X9M B;  3QFB C;  1G7E A;  1PKZ A;  2H76 A;  2EIR A;  4QL7 A;  4MJA A;  1XCC A;  2HYX A;  1RW1 A;  1YJ6 A;  4I6X A;  2WJU A;  3LGC A;  1PD2 1;  3HJM A;  2ZNM A;  3ZIV A;  3BCI A;  2B3S A;  4MP4 A;  3O76 A;  3RHB A;  2RII A;  3Q19 A;  1FB0 A;  1PMT A;  3LFL A;  2V32 A;  3C1S A;  3F8U A;  3QDN A;  5DAL A;  1YKC A;  1ZCP A;  2C3Q A;  2GQL A;  2N5A A;  2DLX A;  2H1D A;  2K8S A;  3PR8 A;  1VF2 A;  4TW5 A;  2O89 A;  2DJJ A;  3ZTL A;  3UBL A;  1TDI A;  3APO A;  3GYK A;  1UN2 A;  1G6W A;  2NDO A;  1PA3 A;  2H6Z A;  5G1K A;  5B8A A;  1PSQ A;  2GSS A;  1M9B A;  4N30 A;  3ERF A;  1GTI A;  4O7H A;  1GTU A;  2H72 A;  2NPB A;  3F3Q A;  4TR3 A;  1K0B A;  4GSS A;  1ZMA A;  4O92 A;  3QR6 A;  1Z6N A;  1WPI A;  3LEF A;  1F3B A;  3TRP A;  1M2B A;  4NV2 A;  3D5J A;  1AXD A;  2FWG A;  1ILO A;  2GT5 A;  3ZZX A;  3H8Q A;  4ECI A;  1CQG A;  3QOU A;  1RQM A;  3E9J B;  4XIH A;  4ML6 A;  2PGT A;  3KIJ A;  3KMN A;  1XOB A;  4ZXG A;  4PNG A;  5DVB A;  3EYT A;  2H66 A;  1EV4 A;  4TR1 B;  4ZBD A;  4OO5 A;  2H0I A;  2GS3 A;  2H1B A;  2REM A;  4D73 A;  3A2X A;  1GNW A;  2MBT A;  3LYK A;  1SL2 B;  5ID2 B;  1EOH A;  3ZVJ D;  3KMO A;  4NMU A;  1XZO A;  3TOU A;  3IPZ A;  5A4V A;  1QUW A;  5HR1 A;  3EMX A;  3WT1 A;  3HVS A;  2VUP A;  3GTU B;  4NAX A;  4Z7X A;  5G1L A;  11GS A;  2BTO T;  5HQP A;  1J0F A;  2H75 A;  2B5X A;  2WS2 A;  1M2D A;  1FAA A;  3ZVJ A;  1AAZ A;  2DC5 A;  5ELA A;  1J9B A;  6GSV A;  1OKT A;  3ZLP A;  4E8E A;  2PVQ A;  3EC3 A;  4POM A;  2WFC A;  3VWX A;  4WBR D;  2JSY A;  3WD6 A;  3IDV A;  1A0R P;  1PRX A;  3I69 A;  1BQ7 A;  1ERW A;  4TN8 A;  3VPT A;  1JLV A;  4XS4 A;  1AUC A;  2H73 A;  1LU4 A;  2X99 A;  4PUR A;  3KXO A;  4GQC A;  1HNB A;  3VWW A;  2C0D A;  4JED A;  5GZZ B;  3ZFB A;  4I2T A;  3EMP A;  3IOS A;  1HNA A;  3HYP A;  2IMD A;  4J57 E;  1XWK A;  2JL4 A;  5DCH A;  1O7U A;  16GS A;  1SYR A;  4PQI A;  1FOV A;  1Q4J A;  6GSX A;  3H4K A;  1DE2 A;  1FHE A;  3KZQ A;  1V98 A;  2XC2 A;  1YKA A;  2GST A;  3QCP A;  2AHE A;  4L0W A;  1AQW A;  1TTZ A;  4JR6 A;  1BX9 A;  5CRE A;  1A8Y A;  2TRC P;  4ZBB A;  3F4S A;  2HRF A;  5FHI A;  3FZ4 A;  5DAL B;  2VM2 A;  4GLT A;  4HOJ A;  4K7I A;  2YV9 A;  2WCI A;  5ECQ B;  1B9Y C;  2YNX A;  3KM6 A;  1NSW A;  1QQ2 A;  1OYJ A;  10GS A;  1FB6 A;  1Z9H A;  4Q5Q A;  4FYU A;  1BAY A;  2LS5 A;  3CYN A;  5GAP D;  3FEU A;  2H1A A;  3P8W A;  5HR2 A;  2FD3 A;  1XFL A;  4MDC A;  3UAR A;  4F9Z A;  2OBK A;  4IW9 A;  4PUA A;  2TIR A;  3VPQ A;  3TJK A;  4KCA A;  1TRV A;  2QGV A;  3QPM A;  2O8V B;  1U3A A;  3DVW A;  4K1F A;  2I3Y A;  2V1M A;  1N2A A;  3P90 A;  3L9S A;  3VUR A;  2MMA A;  2GGT A;  3FRC A;  3DWV A;  1Z3E A;  1GSE A;  2GZP A;  4ISD A;  2OE1 A;  1X5E A;  2H6Y A;  3APQ A;  3D4M A;  1O8X A;  2L4C A;  3FR3 A;  1SEN A;  4ULX A;  3QAG A;  5KN0 A;  2H01 A;  2OAD A;  4BA7 A;  1X9W B;  2KP2 A;  1MD4 A;  1MDI A;  5F07 A;  3UBK A;  1CQH A;  3C7M A;  2VO4 A;  5INY A;  4PQ1 A;  4RQX A;  1SK0 A;  5JCG A;  1UA5 A;  4D73 B;  1F6M C;  1KNG A;  2VL3 A;  3SWL A;  1I5G A;  7GSS A;  4MJC A;  3F63 A;  1ST9 A;  1ERV A;  2PBJ A;  2L5O A;  2CA8 A;  3EUR A;  4CHS A;  1EP7 A;  1WRY A;  4MLY A;  3LSZ A;  3FZ9 A;  3D22 A;  1C72 A;  3W6G A;  1R4W A;  3F3R A;  4HDE A;  1HQO A;  2YZH A;  2RUE A;  1W4V A;  1GSS A;  2V6O A;  3IAS 2;  4WF5 A;  4HEA 2;  4XCS A;  5IMV A;  5ELG A;  3O6T A;  1SKS B;  4HQS A;  3TKR A;  2DJK A;  1TRU A;  3GHA A;  1XWA A;  4MJE A;  3HCZ A;  3GX8 A;  2RM5 A;  1B4P A;  2JZR A;  1G6Y A;  1OVN A;  2WUL A;  3KH9 A;  1TOF A;  3LWA A;  2H6X A;  3ZIJ A;  4XS4 B;  4DSS A;  2GZY A;  4GST A;  2R4V A;  4OFN A;  2KLX A;  4MK3 A;  2VCV A;  5H5S A;  2QC7 A;  2H0G A;  2YCD A;  5H5R A;  2CX3 A;  2I4A A;  3W8S A;  4N0Z A;  1PL2 A;  1VRS D;  3DEX A;  4JU5 A;  2DIZ A;  1EV9 A;  2YOI A;  1M9A A;  2HE3 A;  3M9J A;  4LLR A;  1PQN A;  1QMV A;  1TI3 A;  5KN1 A;  5A5K A;  4ZL7 A;  1E6B A;  2B5Y A;  1K3L A;  2LST A;  3M8N A;  3W8J A;  5F0G A;  1XPV A;  5EL8 A;  3IAM 2;  5ECM B;  2VCZ A;  1SU9 A;  3VI7 A;  5G2Z A;  4V2L A;  5JCU A;  22GS A;  3HXS A;  3LXZ A;  1ERT A;  5AIS A;  1VF3 A;  4KUN A;  4F82 A;  2VM1 A;  3DML A;  5AIV A;  5ECI B;  3ERW A;  4AF2 A;  3GKK A;  1HYU A;  1XWB A;  2NTO A;  1TRW A;  4YAP A;  2K6V A;  1QK8 A;  4J56 E;  3ED3 A;  2VIM A;  2CVD A;  1A2M A;  1SK1 A;  4XS6 A;  5D9T A;  2F8F A;  3RPN A;  2MMO A;  3DD3 A;  2CZ3 A;  3TKQ A;  3GMF A;  2DIY A;  1AW9 A;  1GH2 A;  3I9V 2;  2Z9S A;  2AUV A;  2PMT A;  2A4V A;  4F0B A;  1GTB A;  3WT2 A;  3HDC A;  5C00 A;  2DSA A;  3RBT A;  2AYT A;  2GSQ A;  3TRQ A;  2X64 A;  4YH2 A;  3GKN A;  1X5D A;  1DUG A;  2I81 A;  3GV1 A;  4G10 A;  3MDK A;  4RQR A;  3TGZ A;  1TK0 B;  4CW9 A;  2OAC A;  3N5O A;  3TKP A;  3S9F A;  2RUF A;  3HHV A;  4EUY A;  2HZF A;  3TUE A;  2FHE A;  1TK8 B;  1GWC A;  4V2M A;  2HLS A;  1THX A;  2ZCT A;  3LXT A;  5HFI A;  5KEJ A;  2LRN A;  2YWM A;  1TJD A;  2VL9 A;  4OFM A;  3BCK A;  5FT3 A;  3ZFL A;  3ZRE A;  2YP6 A;  2AJQ B;  4KDU A;  2C0E A;  1W89 A;  1F3A A;  1ZZY A;  3TKS C;  5D73 A;  4WR5 A;  3NZN A;  5ECP B;  3SBC A;  1YQ1 A;  2N5B A;  4NWY A;  3KJY A;  3HVX A;  4MMM A;  3I6A A;  1WOU A;  1Z6M A;  2R3X A;  5EY6 A;  3L9U A;  1VF4 A;  3GL5 A;  1M0U A;  3CTF A;  1XBS A;  2FUG 2;  3GUS A;  4WKW A;  1Z7R A;  5F06 A;  2LKU A;  2YWO A;  3H79 A;  1JZD A;  1YF0 A;  4PXO A;  1WE0 A;  2HSH A;  4IQ1 A;  4K7N A;  4TR4 A;  2F3M A;  4OFT A;  4ZL9 A;  1YY7 A;  1GUL A;  1M2A A;  2HRN A;  3EE2 A;  4MF6 A;  2HFD A;  3TOT A;  4XTS A;  2XHF A;  1SL1 B;  3D6I A;  4WR4 A;  4LL4 B;  2VLT A;  3QAW A;  3IK9 A;  4DSS B;  2AB6 A;  3IHQ A;  2MBS A;  2CV4 A;  1KEB A;  4EE0 A;  2AAW A;  2H70 A;  3IC4 A;  2M72 A;  4LMV A;  1DBY A;  1M99 A;  5E4W A;  5EPF A;  3MSZ A;  4IHU A;  4XRD A;  2X8C A;  3RPP A;  1HD2 A;  1V58 A;  4K6X A;  3GIX A;  4PGT A;  3KCM A;  3GL3 A;  5B6N A;  1XWC A;  3GST A;  3TKS A;  2FY6 A;  3QAV A;  3ISO A;  4KDY A;  2LJK A;  2PWJ A;  3L0H A;  4RI6 A;  1USB A;  3TJF A;  2DML A;  3HZ8 A;  4AJ6 A;  1O6J A;  3FW2 A;  4GWR A;  2YWI A;  2C80 A;  4IVF A;  2YWN A;  1J08 A;  3GX0 A;  4ZB9 A;  4N10 A;  2IMK A;  2R6K A;  1GUK A;  5LCZ A;  2LRT A;  3L9V A;  4IJ3 A;  5B8B A;  2QKE A;  4TKY A;  3LG6 A;  2O87 A;  3F4R A;  5CRW A;  4OCE A;  1JHB A;  3GA4 A;  3L78 A;  4L8E A;  2C8U A;  1A8L A;  4O32 A;  2I1U A;  1K0A A;  4JE1 A;  1JLW A;  1WJK A;  2L59 A;  2CAI A;  4MH3 A;  3C71 A;  3LJR A;  3PIN A;  1K0D A;  4IBP A;  3TJG A;  3LOR A;  2XBI A;  2GDR A;  1BYE A;  4EXJ A;  3DKS A;  2C0F A;  1BED A;  4EO3 A;  1NW2 A;  2MMZ A;  3NIV A;  2H0H A;  4FO5 A;  3UIW A;  5HR0 A;  2B1L A;  2V41 A;  4PNF A;  3F6F A;  1AIU A;  2OE3 A;  1OKD A;  2YPM A;  5HFG A;  1OC8 A;  1NHY A;  2VD0 A;  4NV5 A;  2YAN A;  3TCO A;  4EF0 A;  2FNO A;  5J9C A;  1PX6 A;  2ALB A;  1ZL9 A;  4L5L A;  1B9X C;  17GS A;  3FYG A;  2EIQ A;  4HJM A;  5D9V A;  3F6D A;  5B6M A;  2A2R A;  2O85 A;  3FK8 A;  4NXI A;  1KBN A;  2JZT A;  1VF1 A;  4KA0 A;  5ECH B;  2JAD A;  1T8E B;  2MMN A;  2LQQ A;  4ZL8 A;  2MZC A;  3KTL A;  3PH9 A;  4DEJ A;  2LV3 A;  5EVO A;  3M1G A;  1R26 A;  2HXK A;  1YDK A;  2ON5 A;  2C0G A;  4KDX A;  1SL0 B;  4ACS A;  4V1A p;  1G7O A;  3MWH A;  5ECN B;  2WGR A;  4EDZ A;  3CXG A;  1EOG A;  4V2N A;  3F4T A;  3R2Q A;  3TJB A;  4O5R A;  1V57 A;  1VGL A;  2BJX A;  2H30 A;  3VI5 A;  1WMJ A;  5A4U A;  1ML6 A;  4HU9 A;  4XS1 A;  2L57 A;  2K8V A;  5DJM A;  2L6D A;  4OD7 A;  3ME8 A;  2VOC A;  2G0F A;  3A2W A;  5G30 A;  2ON7 A;  1T7P B;  4HS1 A;  4ID0 A;  4K0N A;  4I97 A;  1ZYQ B;  1DE1 A;  4YQM A;  4I5Q A;  3ERG A;  12GS A;  2HZE A;  3G7J A;  4RUV A;  3QMX A;  1E2Y A;  2P5R A;  3HJO A;  1GLP A;  5J4U A;  4X1U A;  1FW1 A;  2YN1 A;  1T4Y A;  1TU8 A;  4Q5F A;  1GSF A;  3HJP A;  5IM9 A;  5E59 A;  1H4O A;  2A2S A;  4ILF A;  3QD9 A;  1B8X A;  3CSI A;  4MPG A;  1K3O A;  2OBI A;  2VCW A;  2CQ9 A;  3QFA C;  4N0V A;  1O8W A;  4TXO A;  2VCX A;  5JWR B;  1KTE A;  4ECC A;  3ZIT A;  2IPA A;  2OJL A;  4GQF A;  4WF4 A;  5JWQ B;  5KN2 A;  1ACV A;  3CBU A;  4L5O A;  5GSS A;  1EEM A;  2IME A;  2P31 A;  5FWG A;  1GLQ A;  1A2J A;  1A23 A;  1SJI A;  1TW9 A;  2KHP A;  3KGK A;  2CT6 A;  4XRA A;  1WWJ A;  2X8H A;  4G19 A;  1MD3 A;  4BPY A;  4N11 A;  2L6C A;  2XPE A;  1ABA A;  1SD9 A;  3DYR A;  3GNJ A;  2DJ1 A;  1T1V A;  3ME7 A;  2GVP A;  4TR0 A;  1EP8 A;  4MF7 A;  8GSS A;  2OA7 A;  3FKF A;  3IK7 A;  1I9D A;  5AIX A;  3AY8 A;  3BD2 A;  1GL8 A;  4AGS A;  1XOA A;  1AQX A;  2ES7 A;  3G7Y A;  3H93 A;  1EEJ A;  2LJR A;  2KOK A;  4ECB A;  4IP1 A;  2I9H A;  5HFK A;  4FYB A;  2AV4 A;  4YAV A;  4PQH A;  1X5C A;  4IEL A;  3DIE A;  3GN3 A;  3CSH A;  2J23 A;  4F2I A;  2B1K A;  6GSW A;  5J9B A;  3JCM L;  5D9W A;  3CTG A;  2KP1 A;  2IMI A;  3WGE A;  5ECL B;  3GUR A;  2MYG A;  1LJR A;  1U3I A;  2O7K A;  5J5N A;  3F9U A;  4YQV A;  1GSD A;  5IMZ A;  2RLI A;  5G5E A;  2V6K A;  4ZB6 A;  1B48 A;  2N5F A;  3HY2 A;  4POL A;  1S3D A;  2L5L A;  3OR5 A;  3MAK A;  1X9S B;  2YJH A;  2CZ2 A;  3J7Y k;  4KCE A;  3LQ7 A;  1X0R A;  4IS0 A;  3G9B A;  1K0C A;  4FYC A;  1JZW A;  1G0T A;  1NM3 A;  2E2M A;  4G2E A;  3WGD A;  2KUC A;  2YZU A;  2IJY A;  4KB3 A;  3GSS A;  1Y25 A;  3I43 A;  3FZ5 A;  5A4W A;  2E0Q A;  1NHO A;  1XVQ A;  1K0M A;  3FR6 A;  1TU7 A;  1XXU A;  3J7Y b;  4ZIL A;  3UVH A;  3ZRD A;  1A2L A;  2HZE B;  2LJA A;  2WZ9 A;  2JZS A;  6GSS A;  2HI7 A;  3HA9 A;  1FO5 A;  3CRT A;  5IPH A;  4ECJ A;  4GCI A;  5CRD A;  3BBY A;  1JZR A;  5GST A;  2F8A A;  3GH9 A;  5LD0 A;  4GRF A;  2VLV A;  2R2J A;  2H74 A;  3HZ4 A;  5C04 A;  4I8B A;  1XIY A;  2D2Z A;  5D8I A;  1GTA A;  3KTB A;  2G2Q A;  2VLU A;  1GUM A;  2H19 A;  4GF0 A;  4TXO B;  2LQO A;  1TXX A;  1XW9 A;  2RM6 A;  1V2A A;  5L71 A;  3A5W A;  4V1A g;  5KN3 A;  3RHC A;  2M46 A;  2M80 A;  3FZA A;  1T00 A;  2C3T A;  1IYH A;  2C3N A;  3L4N A;  3VWU A;  5IOX A;  2EIO A;  1ON4 A;  2E7P A;  3VK9 A;  4NHW A;  3A3T A;  4FIW A;  3D0Z A;  5CRH A;  5D93 A;  2VCT A;  1GP1 A;  2HNL A;  2PUK C;  3TDG A;  2PPT A;  4Q5R A;  3GRX A;  4MA9 A;  3WGX A;  4L0U A;  2QSI A;  3ZL5 A;  4MZB A;  2F9S A;  2GT6 A;  4QQ7 A;  1JZO A;  3TRX A;  3IRA A;  4IP6 A;  18GS A;  5G5F A;  5DQY A;  2DJ3 A;  3D4T A;  5LNK e;  3KD0 A;  3BJ5 A;  3GFK A;  2R5G A;  1XW6 A;  1SKR B;  3M9K A;  4KW6 A;  4K0G A;  1TI1 A;  3EU4 A;  4X43 A;  5J3R A;  2LNT A;  4GXZ A;  2CVK A;  2WB9 A;  1PGT A;  5ECR B;  2B6M A;  1ERU A;  1F37 A;  1FG4 A;  2K9F A;  4DSQ A;  2VCQ A;  5IO0 A;  3Q18 A;  3CSJ A;  3DGQ A;  3KH7 A;  1PKW A;  2DBC A;  5IIZ A;  1MTC A;  4POK A;  1SYX A;  5CYY A;  4ZBA A;  1U87 A;  4KSM A;  3UL3 A;  1TK5 B;  1A24 A;  1WIK A;  3UOM A;  1ZOF A;  4EC0 A;  2CVB A;  4HI7 A;  4F0C A;  1EGR A;  5JWO B;  1PX7 A;  2C1Y A;  2DMM A;  2GTU A;  4JZQ A;  4BVY A;  3UEM A;  1XVW A;  1MEK A;  4ZB8 A;  1SK2 A;  5D96 A;  2VL2 C;  5IMC A;  1SKW B;  1GRX A;  3VLN A;  1PL1 A;  4TOP A;  4DVC A;  3E3E A;  1S3C A;  5ENU A;  4K2D A;  6GSY A;  3IV4 A;  5ABR A;  3KEB A;  5DAK A;  5F05 A;  1URM A;  5AN1 A;  4KH7 A;  4PUF C;  2FLS A;  3US3 A;  4HU7 A;  3UAP A;  5DCG A;  3VFI A;  1GNE A;  4WBJ A;  5IMD A;  4JBB A;  1RK4 A;  4TRX A;  2B5E A;  2HSY A;  2LEG A;  4KGI A;  1B4Q A;  3RDW A;  3IR4 A;  1BJX A;  1U6T A;  19GS A;  1R5A A;  5IMA A;  5D9X A;  1R5P A;  13GS A;  2YV7 A;  1SD8 A;  2DJ0 A;  2JSZ A;  4G9H A;  4MH2 A;  4KND A;  2C4J A;  4CDO A;  2HT9 A;  5DDL A;  2IFQ A;  3WYW A;  2FWF A;  3FR9 A;  3HKR A;  3APS A;  9GSS A;  1SJ6 A;  1K0N A;  3RAZ A;  2ZUP A;  1YEX A;  4EVM A;  3F0I A;  1F2E A;  3UVT A;  4OO4 A;  5IPG A;  4Q5N A;  2GLR A;  5DJL A;  4BWS A;  2H8L A;  1Z7P A;  2VD1 A;  1EZK A;  1Z5Y E;  3VWV A;  2EC4 A;  4H86 A;  4HJ2 A;  1OC9 A;  2NBS A;  2XPD A;  2P0G A;  2TRX A;  4IQA A;  2VL2 A;  1BG5 A;  4MZW A;  5HR3 A;  3HVV A;  2IL3 A;  1GSY A;  3ZMK A;  2WRT A;  3TKS E;  3FHK A;  2VAF A;  2IIY A;  3CMI A;  2K18 A;  4K8M A;  4ML1 A;  2GQM A;  2V2G A;  4K7O A;  1N8J A;  5GAN D;  2LNS A;  3D21 A;  1AC1 A;  4OWY A;  2IWT A;  1THO A;  2LUS A;  3PGT A;  1K3Y A;  4GSN A;  3LYP A;  5ECK B;  1QXH A;  4BL7 A;  4BVX A;  4MPF A;  3U5R E;  4OMV A;  4HZ4 A;  1PN9 A;  4JR4 A;  4F03 A;  1OAZ A;  2P5Q A;  3EWL A;  4KX4 A;  3M0F A;  1MDK A;  4MZC A;  4NPB A;  2OKA A;  3KP9 A;  3EIN A;  2XBQ A;  3Q6O A;  1UVZ A;  5DQS A;  4FH8 A;  6GST A;  1YF1 A;  5F8B A;  1Y6E A;  4IKH A;  2X8G A;  1H75 A;  2PN8 A;  4X0X A;  1GSU A;  2CAQ A;  4DSR A;  4MCU A;  4MJB A;  2DJ2 A;  5ECS A;  1LBK A;  4XHM A;  3TB2 A;  3C8E A;  2CX4 A;  1FVK A;  1T4Z A;  4IGJ A;  1ZGN A;  3DVX A;  2GQK A;  1V9W A;  5CAX A;  1JFU A;  4NHZ A;  5JCW A;  2B7K A;  1QGV A;  4WEY A;  5CP1 A;  3IBH A;  1OC3 A;  4YQU A;  4HUA A;  2H71 A;  4POB A;  2OE0 A;  3IA1 A;  3BOA A;  4KSO A;  3IXR A;  2R37 A;  3DRN A;  4EDY A;  4IJI A;  3HD5 A;  2JAC A;  2GSR A;  2IMF A;  1AQV A;  3K8N A;  1O73 A;  5H5Q A;  1UC7 A;  2FWE A;  4WXT A;  2H1G A;  3N9J A;  14GS A;  1R7H A;  3G7I A;  2PVO C;  5AGY A;  4AJ7 A;  3GKM A;  1EWX A;  2B7J A;  2FA4 A;  4P3Y B;  5CRG A;  1OE8 A;  4JRR A;  4WET A;  20GS A;  5DAK B;  3UMA A;  2YJ7 A;  2WDU A;  4BWQ A;  2NVL A;  4I2U A;  1O81 A;  4ZIJ A;  1K0O A;  2F51 A;  5COH A;  1WP0 A;  2BMX A;  3CRU A;  3O3T A;  3EVI A;  1FVJ A;  1V40 A;  4QL9 A;  4TVE A;  5IO2 A;  1DSB A;  1OE7 A;  1GUH A;  2L4Q A;  3P7X A;  1U88 A;  4PX1 A;  5B7C A;  3P2A A;  3TJJ A;  1YZX A;  4K9Z A;  4RI7 A;  1EGO A;  3Q74 A;  2IFQ B;  3E0U A;  4TR1 A;  1GSQ A;  4EL1 A;  1XW5 A;  1T3B A;  4KAE A;  2LRC A;  1Q98 A;  4LL1 B;  6GSU A;  5ID2 A;  1MDJ A;  4HQZ A;  4OCF A;  4HZ2 A;  5G31 A;  1IYI A;  5IOW A;  1S3A A;  3M3M A;  3ZYW A;  1QFN A;  5DBQ A;  3KP8 A;  1OC9 B;  2GZZ A;  2FCH A;  5IQY A;  3IE3 A;  3GTU A; 
#chains in the Genus database with same CATH topology
 4X4J A;  1TP9 A;  5ECO B;  1M7T A;  5IMF A;  2E2G A;  2HRK A;  3C1R A;  1F9M A;  3GH6 A;  3NOF A;  4EKZ A;  4AJ8 A;  2PU9 C;  4LA1 A;  2IN3 A;  5CO3 A;  4LMW A;  1TRS A;  1HNC A;  2FWH A;  3H1N A;  2FA8 A;  2J9H A;  2LTK A;  4TXV A;  3MNG A;  3V1W A;  5CNW A;  4MF5 A;  1A0F A;  4BL7 B;  1ZYE A;  5J41 A;  4GTU A;  3C73 A;  4BVX B;  1SJZ A;  3EU3 A;  2FGX A;  3DXB A;  2JU5 A;  4KE3 A;  4IN0 A;  2PER A;  3U6V A;  1XWG A;  4J2F A;  1YEP A;  4E8H A;  4MAB A;  1ZYP A;  3UJ1 A;  1TKD B;  3A2V A;  3FY7 A;  1O85 A;  3GKX A;  3ZML A;  1X9M B;  3QFB C;  1G7E A;  1PKZ A;  2H76 A;  2EIR A;  5BRT A;  4QL7 A;  4MJA A;  1XCC A;  2HYX A;  1RW1 A;  1YJ6 A;  4I6X A;  2WJU A;  3LGC A;  1PD2 1;  3HJM A;  2ZNM A;  3ZIV A;  3BCI A;  2B3S A;  4MP4 A;  3O76 A;  3RHB A;  2RII A;  3Q19 A;  1FB0 A;  1PMT A;  3LFL A;  2V32 A;  3C1S A;  3F8U A;  3QDN A;  5DAL A;  1YKC A;  1ZCP A;  2C3Q A;  2GQL A;  2N5A A;  2DLX A;  2H1D A;  2K8S A;  3PR8 A;  1VF2 A;  4TW5 A;  2O89 A;  2DJJ A;  3ZTL A;  3UBL A;  1TDI A;  3APO A;  3GYK A;  1UN2 A;  1G6W A;  2NDO A;  1PA3 A;  2H6Z A;  5G1K A;  5B8A A;  1PSQ A;  2GSS A;  1M9B A;  4N30 A;  3ERF A;  1GTI A;  4O7H A;  1GTU A;  2H72 A;  2NPB A;  3F3Q A;  4TR3 A;  1K0B A;  4GSS A;  1ZMA A;  4O92 A;  3QR6 A;  1Z6N A;  1WPI A;  3LEF A;  1F3B A;  3TRP A;  1M2B A;  4NV2 A;  3D5J A;  1AXD A;  2FWG A;  1ILO A;  2GT5 A;  3ZZX A;  3H8Q A;  4ECI A;  1CQG A;  3QOU A;  1RQM A;  3E9J B;  4XIH A;  4ML6 A;  2PGT A;  2A4H A;  3KIJ A;  3KMN A;  1XOB A;  4ZXG A;  4PNG A;  5DVB A;  3EYT A;  2H66 A;  1EV4 A;  4TR1 B;  4ZBD A;  4EIP A;  4OO5 A;  2H0I A;  2GS3 A;  2H1B A;  2REM A;  4D73 A;  3A2X A;  1GNW A;  3R3E A;  2MBT A;  3LYK A;  1SL2 B;  5ID2 B;  3CQF A;  1EOH A;  3ZVJ D;  3KMO A;  2DKH A;  4NMU A;  1XZO A;  3TOU A;  3IPZ A;  5A4V A;  1QUW A;  5HR1 A;  3EMX A;  3WT1 A;  3HVS A;  2VUP A;  3GTU B;  4NAX A;  4Z7X A;  5G1L A;  11GS A;  2BTO T;  3IC8 A;  5HQP A;  1J0F A;  2H75 A;  2B5X A;  2WS2 A;  1M2D A;  1FAA A;  3ZVJ A;  1AAZ A;  2DC5 A;  5ELA A;  1J9B A;  6GSV A;  1OKT A;  3ZLP A;  4E8E A;  2PVQ A;  3EC3 A;  4POM A;  2WFC A;  3VWX A;  4WBR D;  4A5P A;  2JSY A;  3LW9 A;  3WD6 A;  3IDV A;  1A0R P;  1PRX A;  3I69 A;  1BQ7 A;  1ERW A;  4TN8 A;  3VPT A;  1JLV A;  4XS4 A;  1AUC A;  2H73 A;  1LU4 A;  2X99 A;  4PUR A;  3KXO A;  4GQC A;  1HNB A;  3VWW A;  2C0D A;  4JED A;  5GZZ B;  3ZFB A;  4I2T A;  3EMP A;  3IOS A;  1HNA A;  3HYP A;  2IMD A;  4J57 E;  1PFO A;  1XWK A;  2JL4 A;  5DCH A;  1O7U A;  16GS A;  1SYR A;  4PQI A;  1FOV A;  1Q4J A;  6GSX A;  3H4K A;  1DE2 A;  1FHE A;  3KZQ A;  1V98 A;  2XC2 A;  1YKA A;  2GST A;  3QCP A;  2AHE A;  4L0W A;  1AQW A;  1TTZ A;  4JR6 A;  1BX9 A;  5BMU A;  5CRE A;  1A8Y A;  2TRC P;  2QA2 A;  4ZBB A;  3F4S A;  2HRF A;  4Z2T A;  5FHI A;  3FZ4 A;  5DAL B;  2VM2 A;  4GLT A;  4HOJ A;  4K7I A;  2YV9 A;  2WCI A;  5ECQ B;  1B9Y C;  2YNX A;  3KM6 A;  1NSW A;  1QQ2 A;  1OYJ A;  10GS A;  4HSC X;  1FB6 A;  1Z9H A;  4Q5Q A;  4FYU A;  1BAY A;  2LS5 A;  3CYN A;  5GAP D;  3FEU A;  2H1A A;  3P8W A;  5HR2 A;  2FD3 A;  1XFL A;  4MDC A;  3UAR A;  4F9Z A;  2OBK A;  4IW9 A;  4PUA A;  2TIR A;  3VPQ A;  3TJK A;  4KCA A;  1TRV A;  2QGV A;  3QPM A;  2O8V B;  1U3A A;  3DVW A;  1M3I A;  4K1F A;  2I3Y A;  2V1M A;  1N2A A;  3P90 A;  3L9S A;  3VUR A;  2MMA A;  2GGT A;  3FRC A;  3DWV A;  1Z3E A;  1GSE A;  2GZP A;  4ISD A;  2OE1 A;  1X5E A;  2H6Y A;  3APQ A;  3D4M A;  1O8X A;  2L4C A;  3FR3 A;  1SEN A;  4ULX A;  3QAG A;  5KN0 A;  2H01 A;  2OAD A;  4BA7 A;  1X9W B;  2KP2 A;  1MD4 A;  1MDI A;  5F07 A;  3UBK A;  1CQH A;  3C7M A;  2VO4 A;  5INY A;  4PQ1 A;  4RQX A;  1SK0 A;  5JCG A;  1UA5 A;  4D73 B;  1F6M C;  1KNG A;  2VL3 A;  3SWL A;  1I5G A;  7GSS A;  4MJC A;  3F63 A;  1ST9 A;  1ERV A;  2PBJ A;  2L5O A;  2CA8 A;  3EUR A;  4CHS A;  1EP7 A;  1WRY A;  4MLY A;  3LSZ A;  3FZ9 A;  3D22 A;  1C72 A;  3W6G A;  1R4W A;  3F3R A;  4HDE A;  1HQO A;  2YZH A;  2RUE A;  1W4V A;  1GSS A;  2V6O A;  3IAS 2;  4WF5 A;  4HEA 2;  4XCS A;  5IMV A;  5ELG A;  3O6T A;  1SKS B;  4HQS A;  3TKR A;  2DJK A;  1TRU A;  4Z2U A;  3GHA A;  1XWA A;  4MJE A;  3HCZ A;  3GX8 A;  2RM5 A;  1B4P A;  2JZR A;  1G6Y A;  3FMW A;  1OVN A;  2WUL A;  3KH9 A;  1TOF A;  3LWA A;  2H6X A;  3ZIJ A;  4XS4 B;  4DSS A;  2GZY A;  4GST A;  2R4V A;  4ICY A;  4OFN A;  2KLX A;  4MK3 A;  2VCV A;  5H5S A;  2QC7 A;  2H0G A;  2YCD A;  5H5R A;  2CX3 A;  2I4A A;  3W8S A;  4N0Z A;  1PL2 A;  1VRS D;  3DEX A;  4JU5 A;  2DIZ A;  1EV9 A;  2YOI A;  1M9A A;  2HE3 A;  3M9J A;  4LLR A;  1PQN A;  1QMV A;  1TI3 A;  5KN1 A;  5A5K A;  4ZL7 A;  1E6B A;  2B5Y A;  1XG8 A;  1K3L A;  2LST A;  3M8N A;  3W8J A;  5F0G A;  1XPV A;  5EL8 A;  3IAM 2;  5ECM B;  2VCZ A;  1SU9 A;  3VI7 A;  5G2Z A;  4V2L A;  5JCU A;  22GS A;  3HXS A;  3LXZ A;  1ERT A;  5AIS A;  1VF3 A;  4KUN A;  4F82 A;  2VM1 A;  3DML A;  5AIV A;  5ECI B;  3ERW A;  4AF2 A;  3GKK A;  1HYU A;  1XWB A;  2NTO A;  1TRW A;  4YAP A;  2K6V A;  1QK8 A;  4J56 E;  3ED3 A;  4FQU A;  2VIM A;  2CVD A;  1A2M A;  1SK1 A;  4XS6 A;  5D9T A;  2F8F A;  3RPN A;  2MMO A;  3DD3 A;  2CZ3 A;  3TKQ A;  3GMF A;  2DIY A;  1AW9 A;  1GH2 A;  3I9V 2;  2Z9S A;  2AUV A;  2PMT A;  2A4V A;  4F0B A;  1GTB A;  3WT2 A;  3HDC A;  5C00 A;  2DSA A;  3RBT A;  2AYT A;  2GSQ A;  3TRQ A;  2X64 A;  4YH2 A;  3GKN A;  1X5D A;  1DUG A;  2I81 A;  3GV1 A;  4G10 A;  3MDK A;  4RQR A;  3TGZ A;  1TK0 B;  4CW9 A;  2OAC A;  3N5O A;  3TKP A;  3S9F A;  2RUF A;  3HHV A;  4EUY A;  2HZF A;  3TUE A;  4USS A;  2FHE A;  1TK8 B;  1GWC A;  4V2M A;  2HLS A;  1THX A;  2ZCT A;  3LXT A;  5HFI A;  5KEJ A;  2LRN A;  2YWM A;  1TJD A;  4G0K A;  2VL9 A;  4OFM A;  3BCK A;  5FT3 A;  3ZFL A;  3ZRE A;  2YP6 A;  2AJQ B;  4KDU A;  2C0E A;  1W89 A;  1F3A A;  1ZZY A;  4K5S A;  3TKS C;  5D73 A;  4WR5 A;  3NZN A;  5ECP B;  3SBC A;  1YQ1 A;  2N5B A;  4NWY A;  3KJY A;  3HVX A;  4MMM A;  3I6A A;  1WOU A;  1Z6M A;  2R3X A;  5EY6 A;  3L9U A;  1VF4 A;  3GL5 A;  1M0U A;  3CTF A;  1XBS A;  2FUG 2;  4Z2R A;  3GUS A;  4WKW A;  1Z7R A;  5F06 A;  2LKU A;  2YWO A;  3H79 A;  2UZ8 A;  1JZD A;  1YF0 A;  4PXO A;  1WE0 A;  2HSH A;  4IQ1 A;  4K7N A;  4TR4 A;  2F3M A;  4OFT A;  4ZL9 A;  1YY7 A;  1GUL A;  1M2A A;  2HRN A;  3EE2 A;  4MF6 A;  2HFD A;  3TOT A;  4EIQ A;  4XTS A;  2XHF A;  1SL1 B;  3D6I A;  4WR4 A;  4LL4 B;  2VLT A;  3QAW A;  3IK9 A;  4DSS B;  2AB6 A;  3IHQ A;  2MBS A;  2CV4 A;  1KEB A;  4EE0 A;  2AAW A;  2H70 A;  3IC4 A;  2M72 A;  4LMV A;  1DBY A;  1M99 A;  5E4W A;  5EPF A;  3MSZ A;  4IHU A;  4XRD A;  2X8C A;  3RPP A;  1HD2 A;  1V58 A;  4K6X A;  3GIX A;  4PGT A;  3KCM A;  3GL3 A;  5B6N A;  1XWC A;  3GST A;  3TKS A;  2FY6 A;  3QAV A;  3ISO A;  4KDY A;  2LJK A;  2PWJ A;  3L0H A;  4RI6 A;  1USB A;  3TJF A;  2DML A;  3HZ8 A;  4AJ6 A;  1O6J A;  3FW2 A;  4GWR A;  2YWI A;  2C80 A;  4IVF A;  2YWN A;  1J08 A;  3GX0 A;  4ZB9 A;  4N10 A;  2IMK A;  2R6K A;  1GUK A;  5LCZ A;  2LRT A;  3L9V A;  4IJ3 A;  5B8B A;  2QKE A;  4TKY A;  3LG6 A;  2O87 A;  3F4R A;  5CRW A;  4OCE A;  1JHB A;  3GA4 A;  3L78 A;  4L8E A;  2C8U A;  1A8L A;  4O32 A;  2I1U A;  1K0A A;  4JE1 A;  1JLW A;  1WJK A;  2L59 A;  2CAI A;  4MH3 A;  3C71 A;  3LJR A;  3PIN A;  1K0D A;  4IBP A;  3TJG A;  3LOR A;  2XBI A;  2GDR A;  1BYE A;  4EXJ A;  3DKS A;  2C0F A;  1BED A;  4EO3 A;  1NW2 A;  2MMZ A;  3NIV A;  2H0H A;  4FO5 A;  3UIW A;  5HR0 A;  2B1L A;  2V41 A;  4PNF A;  3F6F A;  1AIU A;  2OE3 A;  4BIK A;  1OKD A;  2YPM A;  5HFG A;  1OC8 A;  2A2P A;  1NHY A;  2VD0 A;  4NV5 A;  2YAN A;  3TCO A;  4EF0 A;  2FNO A;  5J9C A;  1PX6 A;  2ALB A;  1ZL9 A;  4L5L A;  4CY8 A;  4K5R A;  1B9X C;  17GS A;  3FYG A;  2EIQ A;  4HJM A;  5D9V A;  3F6D A;  5B6M A;  2A2R A;  2O85 A;  3FK8 A;  4NXI A;  1KBN A;  2JZT A;  1VF1 A;  4KA0 A;  5ECH B;  2JAD A;  3MYD A;  1T8E B;  2MMN A;  2LQQ A;  4ZL8 A;  2MZC A;  3KTL A;  3PH9 A;  4DEJ A;  2LV3 A;  5EVO A;  3M1G A;  1R26 A;  2HXK A;  1YDK A;  2ON5 A;  2C0G A;  4KDX A;  1SL0 B;  4ACS A;  4V1A p;  1G7O A;  3MWH A;  5ECN B;  2WGR A;  4EDZ A;  3CXG A;  1EOG A;  4V2N A;  3F4T A;  3R2Q A;  3TJB A;  4O5R A;  1V57 A;  1VGL A;  2BJX A;  2H30 A;  3VI5 A;  1WMJ A;  5A4U A;  1ML6 A;  4HU9 A;  4XS1 A;  2L57 A;  2K8V A;  5DJM A;  2L6D A;  4OD7 A;  3ME8 A;  2VOC A;  2G0F A;  3A2W A;  5G30 A;  2ON7 A;  1T7P B;  4HS1 A;  4ID0 A;  4K0N A;  2DKI A;  4I97 A;  1ZYQ B;  1DE1 A;  4YQM A;  4I5Q A;  3ERG A;  12GS A;  2HZE A;  3G7J A;  4RUV A;  3QMX A;  1E2Y A;  2P5R A;  3HJO A;  1GLP A;  5J4U A;  4X1U A;  1FW1 A;  5KOW A;  2YN1 A;  1T4Y A;  1TU8 A;  4Q5F A;  1GSF A;  3HJP A;  5IM9 A;  5E59 A;  1H4O A;  2A2S A;  4ILF A;  3QD9 A;  1B8X A;  3CSI A;  4MPG A;  1K3O A;  2OBI A;  2VCW A;  2CQ9 A;  3QFA C;  4N0V A;  1O8W A;  4TXO A;  2VCX A;  5JWR B;  1KTE A;  4ECC A;  1ZYN A;  3ZIT A;  2IPA A;  2OJL A;  4GQF A;  4WF4 A;  5JWQ B;  5KN2 A;  1ACV A;  3CBU A;  4L5O A;  5GSS A;  2X4A A;  1EEM A;  2IME A;  2P31 A;  5FWG A;  1GLQ A;  1A2J A;  1A23 A;  1SJI A;  1TW9 A;  2KHP A;  4CY6 A;  3KGK A;  2CT6 A;  4XRA A;  1WWJ A;  2X8H A;  4G19 A;  1MD3 A;  4BPY A;  4N11 A;  1FOH A;  2L6C A;  2XPE A;  1ABA A;  1SD9 A;  3DYR A;  3GNJ A;  2DJ1 A;  1T1V A;  3ME7 A;  2GVP A;  4TR0 A;  1EP8 A;  4MF7 A;  8GSS A;  2OA7 A;  3FKF A;  3IK7 A;  1I9D A;  5AIX A;  3AY8 A;  3BD2 A;  1GL8 A;  4AGS A;  4G0L A;  1XOA A;  1AQX A;  2ES7 A;  3G7Y A;  3H93 A;  4YKG A;  1EEJ A;  3A5I A;  2LJR A;  1M3J A;  2KOK A;  4ECB A;  4IP1 A;  2I9H A;  5HFK A;  4FYB A;  2AV4 A;  3IHG A;  4YAV A;  4PQH A;  1X5C A;  4IEL A;  3DIE A;  3GN3 A;  3CSH A;  2J23 A;  4F2I A;  2B1K A;  6GSW A;  5J9B A;  3JCM L;  5D9W A;  3CTG A;  2KP1 A;  2IMI A;  3WGE A;  5ECL B;  3GUR A;  2MYG A;  1LJR A;  1U3I A;  2O7K A;  5J5N A;  3F9U A;  4YQV A;  1GSD A;  5IMZ A;  2RLI A;  4KF9 A;  5G5E A;  2V6K A;  4ZB6 A;  1B48 A;  2N5F A;  3HY2 A;  4POL A;  1S3D A;  2L5L A;  3OR5 A;  3MAK A;  1X9S B;  2YJH A;  2CZ2 A;  3J7Y k;  4KCE A;  3LQ7 A;  4PTS A;  1X0R A;  4IS0 A;  3G9B A;  1K0C A;  4FYC A;  3HVN A;  1JZW A;  2R0C A;  1G0T A;  1NM3 A;  2E2M A;  4G2E A;  3WGD A;  2KUC A;  2YZU A;  2IJY A;  4KB3 A;  3GSS A;  1Y25 A;  3I43 A;  3FZ5 A;  5A4W A;  2E0Q A;  1NHO A;  1XVQ A;  1K0M A;  3FR6 A;  1TU7 A;  1XXU A;  3J7Y b;  4ZIL A;  3UVH A;  3ZRD A;  1A2L A;  2HZE B;  2LJA A;  2WZ9 A;  2JZS A;  6GSS A;  2HI7 A;  3HA9 A;  1FO5 A;  3CRT A;  3MIX A;  5IPH A;  4ECJ A;  4GCI A;  5CRD A;  3BBY A;  1JZR A;  5GST A;  2F8A A;  3GH9 A;  5LD0 A;  4GRF A;  2VLV A;  2R2J A;  2H74 A;  3HZ4 A;  5C04 A;  4I8B A;  1XIY A;  2D2Z A;  5D8I A;  1GTA A;  3KTB A;  4G0I A;  2G2Q A;  2VLU A;  1GUM A;  2H19 A;  4GF0 A;  5KOX A;  4TXO B;  2LQO A;  1TXX A;  1XW9 A;  2HRA A;  2RM6 A;  1V2A A;  5L71 A;  3A5W A;  4V1A g;  5KN3 A;  3RHC A;  2M46 A;  2M80 A;  3FZA A;  1T00 A;  2C3T A;  1IYH A;  2C3N A;  3L4N A;  3VWU A;  5IOX A;  2EIO A;  1ON4 A;  2E7P A;  3VK9 A;  4NHW A;  3A3T A;  4FIW A;  3D0Z A;  5CRH A;  5D93 A;  2VCT A;  1GP1 A;  2HNL A;  2PUK C;  3TDG A;  2PPT A;  4Q5R A;  3GRX A;  4MA9 A;  3WGX A;  4L0U A;  2QSI A;  3ZL5 A;  4MZB A;  2F9S A;  2GT6 A;  4QQ7 A;  1JZO A;  4YKF A;  3TRX A;  3IRA A;  4IP6 A;  18GS A;  5G5F A;  5DQY A;  2DJ3 A;  3D4T A;  5LNK e;  3KD0 A;  3BJ5 A;  3GFK A;  2R5G A;  1XW6 A;  1SKR B;  3M9K A;  4KW6 A;  4K0G A;  1TI1 A;  3EU4 A;  4X43 A;  5J3R A;  2LNT A;  4GXZ A;  2CVK A;  2WB9 A;  1PGT A;  5ECR B;  2B6M A;  1ERU A;  1F37 A;  1FG4 A;  2K9F A;  4DSQ A;  2VCQ A;  3PPU A;  1PN0 A;  5IO0 A;  3Q18 A;  3CSJ A;  3DGQ A;  3KH7 A;  1PKW A;  2DBC A;  5IIZ A;  1MTC A;  4POK A;  1SYX A;  5CYY A;  4ZBA A;  1U87 A;  2R0P A;  4KSM A;  3UL3 A;  1TK5 B;  1A24 A;  1WIK A;  3UOM A;  1ZOF A;  4EC0 A;  2CVB A;  4HI7 A;  4F0C A;  1EGR A;  5JWO B;  1PX7 A;  2C1Y A;  2DMM A;  2GTU A;  4JZQ A;  4BVY A;  3UEM A;  1XVW A;  1MEK A;  4ZB8 A;  1SK2 A;  5D96 A;  2VL2 C;  5IMC A;  1SKW B;  1GRX A;  3VLN A;  1PL1 A;  4TOP A;  4DVC A;  3E3E A;  1S3C A;  5ENU A;  4K2D A;  6GSY A;  3IV4 A;  5ABR A;  3KEB A;  5DAK A;  5F05 A;  1URM A;  5AN1 A;  4KH7 A;  4PUF C;  2FLS A;  3US3 A;  4HU7 A;  3UAP A;  5DCG A;  3VFI A;  1GNE A;  4WBJ A;  5IMD A;  4JBB A;  1RK4 A;  4TRX A;  2B5E A;  2HSY A;  2LEG A;  4KGI A;  1B4Q A;  3RDW A;  3IR4 A;  1BJX A;  1U6T A;  3EPT A;  19GS A;  1R5A A;  2QA1 A;  5IMA A;  5D9X A;  1R5P A;  13GS A;  2YV7 A;  1SD8 A;  2DJ0 A;  2JSZ A;  4G9H A;  4MH2 A;  4KND A;  2C4J A;  4CDO A;  2HT9 A;  5DDL A;  2IFQ A;  3WYW A;  2FWF A;  3FR9 A;  3HKR A;  3APS A;  9GSS A;  1SJ6 A;  1K0N A;  3RAZ A;  2ZUP A;  1YEX A;  4EVM A;  3F0I A;  1F2E A;  3UVT A;  4OO4 A;  5IPG A;  4Q5N A;  2GLR A;  5DJL A;  4BWS A;  2H8L A;  1Z7P A;  2VD1 A;  1EZK A;  1Z5Y E;  3VWV A;  2EC4 A;  4H86 A;  4HJ2 A;  1OC9 A;  2NBS A;  2XPD A;  2X49 A;  2P0G A;  2TRX A;  4IQA A;  2VL2 A;  1BG5 A;  4MZW A;  5HR3 A;  3HVV A;  2IL3 A;  1GSY A;  3ZMK A;  2WRT A;  3TKS E;  3FHK A;  2VAF A;  2IIY A;  3CMI A;  2K18 A;  4K8M A;  4ML1 A;  2GQM A;  2V2G A;  4K7O A;  1N8J A;  5GAN D;  2LNS A;  3D21 A;  1AC1 A;  4OWY A;  2IWT A;  1THO A;  2HSM A;  2LUS A;  3PGT A;  1K3Y A;  4GSN A;  2R0G A;  3LYP A;  5ECK B;  1QXH A;  4BL7 A;  4BVX A;  4MPF A;  3U5R E;  4OMV A;  4HZ4 A;  1PN9 A;  4JR4 A;  4F03 A;  1OAZ A;  2P5Q A;  3EWL A;  4KX4 A;  3M0F A;  1MDK A;  4MZC A;  4NPB A;  2OKA A;  3KP9 A;  3EIN A;  2XBQ A;  3Q6O A;  1UVZ A;  5DQS A;  4FH8 A;  6GST A;  1YF1 A;  5F8B A;  1Y6E A;  4IKH A;  4K2X A;  2X8G A;  1H75 A;  2PN8 A;  4X0X A;  1GSU A;  2CAQ A;  4DSR A;  4MCU A;  4MJB A;  2DJ2 A;  5ECS A;  1LBK A;  4XHM A;  3TB2 A;  3C8E A;  1S3R A;  4MNN A;  2CX4 A;  1FVK A;  1T4Z A;  4IGJ A;  1ZGN A;  3DVX A;  2GQK A;  1V9W A;  5CAX A;  1JFU A;  4NHZ A;  5JCW A;  2B7K A;  1QGV A;  4WEY A;  5CP1 A;  3IBH A;  1OC3 A;  4YQU A;  4HUA A;  2H71 A;  4POB A;  2OE0 A;  3IA1 A;  3BOA A;  4KSO A;  3IXR A;  2R37 A;  3DRN A;  4EDY A;  4IJI A;  3HD5 A;  2JAC A;  2GSR A;  2IMF A;  4BVY B;  1AQV A;  3K8N A;  1O73 A;  5H5Q A;  1UC7 A;  2FWE A;  4WXT A;  2H1G A;  3N9J A;  14GS A;  1R7H A;  3G7I A;  2PVO C;  5AGY A;  4AJ7 A;  3GKM A;  1EWX A;  2B7J A;  2FA4 A;  4P3Y B;  5CRG A;  1OE8 A;  4JRR A;  4WET A;  20GS A;  5DAK B;  3UMA A;  2YJ7 A;  2WDU A;  4BWQ A;  2NVL A;  4I2U A;  1O81 A;  4ZIJ A;  1K0O A;  2F51 A;  5COH A;  1WP0 A;  2BMX A;  3CRU A;  3O3T A;  3EVI A;  1FVJ A;  1V40 A;  4QL9 A;  4TVE A;  5IO2 A;  1DSB A;  1OE7 A;  1GUH A;  2L4Q A;  3P7X A;  1U88 A;  4PX1 A;  4O5U A;  5B7C A;  3P2A A;  3TJJ A;  1YZX A;  4K9Z A;  4RI7 A;  1EGO A;  3Q74 A;  2IFQ B;  3E0U A;  4TR1 A;  1GSQ A;  4EL1 A;  1XW5 A;  1T3B A;  4KAE A;  2LRC A;  1Q98 A;  4LL1 B;  6GSU A;  5ID2 A;  1MDJ A;  4HQZ A;  4OCF A;  4HZ2 A;  5G31 A;  1IYI A;  5IOW A;  1S3A A;  3M3M A;  3ZYW A;  1QFN A;  5DBQ A;  3KP8 A;  1OC9 B;  2GZZ A;  2FCH A;  5IQY A;  4O5Q A;  3IE3 A;  3GTU A; 
#chains in the Genus database with same CATH homology
 4X4J A;  1TP9 A;  5ECO B;  1M7T A;  5IMF A;  2E2G A;  2HRK A;  3C1R A;  1F9M A;  3GH6 A;  3NOF A;  4EKZ A;  4AJ8 A;  2PU9 C;  4LA1 A;  2IN3 A;  5CO3 A;  4LMW A;  1TRS A;  1HNC A;  2FWH A;  3H1N A;  2FA8 A;  2J9H A;  2LTK A;  4TXV A;  3MNG A;  3V1W A;  5CNW A;  4MF5 A;  1A0F A;  4BL7 B;  1ZYE A;  5J41 A;  4GTU A;  3C73 A;  4BVX B;  1SJZ A;  3EU3 A;  2FGX A;  3DXB A;  2JU5 A;  4KE3 A;  4IN0 A;  2PER A;  3U6V A;  1XWG A;  4J2F A;  1YEP A;  4E8H A;  4MAB A;  1ZYP A;  3UJ1 A;  1TKD B;  3A2V A;  3FY7 A;  1O85 A;  3GKX A;  3ZML A;  1X9M B;  3QFB C;  1G7E A;  1PKZ A;  2H76 A;  2EIR A;  5BRT A;  4QL7 A;  4MJA A;  1XCC A;  2HYX A;  1RW1 A;  1YJ6 A;  4I6X A;  2WJU A;  3LGC A;  1PD2 1;  3HJM A;  2ZNM A;  3ZIV A;  3BCI A;  2B3S A;  4MP4 A;  3O76 A;  3RHB A;  2RII A;  3Q19 A;  1FB0 A;  1PMT A;  3LFL A;  2V32 A;  3C1S A;  3F8U A;  3QDN A;  5DAL A;  1YKC A;  1ZCP A;  2C3Q A;  2GQL A;  2N5A A;  2DLX A;  2H1D A;  2K8S A;  3PR8 A;  1VF2 A;  4TW5 A;  2O89 A;  2DJJ A;  3ZTL A;  3UBL A;  1TDI A;  3APO A;  3GYK A;  1UN2 A;  1G6W A;  2NDO A;  1PA3 A;  2H6Z A;  5G1K A;  5B8A A;  1PSQ A;  2GSS A;  1M9B A;  4N30 A;  3ERF A;  1GTI A;  4O7H A;  1GTU A;  2H72 A;  2NPB A;  3F3Q A;  4TR3 A;  1K0B A;  4GSS A;  1ZMA A;  4O92 A;  3QR6 A;  1Z6N A;  1WPI A;  3LEF A;  1F3B A;  3TRP A;  1M2B A;  4NV2 A;  3D5J A;  1AXD A;  2FWG A;  1ILO A;  2GT5 A;  3ZZX A;  3H8Q A;  4ECI A;  1CQG A;  3QOU A;  1RQM A;  3E9J B;  4XIH A;  4ML6 A;  2PGT A;  2A4H A;  3KIJ A;  3KMN A;  1XOB A;  4ZXG A;  4PNG A;  5DVB A;  3EYT A;  2H66 A;  1EV4 A;  4TR1 B;  4ZBD A;  4EIP A;  4OO5 A;  2H0I A;  2GS3 A;  2H1B A;  2REM A;  4D73 A;  3A2X A;  1GNW A;  3R3E A;  2MBT A;  3LYK A;  1SL2 B;  5ID2 B;  1EOH A;  3ZVJ D;  3KMO A;  2DKH A;  4NMU A;  1XZO A;  3TOU A;  3IPZ A;  5A4V A;  1QUW A;  5HR1 A;  3EMX A;  3WT1 A;  3HVS A;  2VUP A;  3GTU B;  4NAX A;  4Z7X A;  5G1L A;  11GS A;  2BTO T;  3IC8 A;  5HQP A;  1J0F A;  2H75 A;  2B5X A;  2WS2 A;  1M2D A;  1FAA A;  3ZVJ A;  1AAZ A;  2DC5 A;  5ELA A;  1J9B A;  6GSV A;  1OKT A;  3ZLP A;  4E8E A;  2PVQ A;  3EC3 A;  4POM A;  2WFC A;  3VWX A;  4WBR D;  4A5P A;  2JSY A;  3LW9 A;  3WD6 A;  3IDV A;  1A0R P;  1PRX A;  3I69 A;  1BQ7 A;  1ERW A;  4TN8 A;  3VPT A;  1JLV A;  4XS4 A;  1AUC A;  2H73 A;  1LU4 A;  2X99 A;  4PUR A;  3KXO A;  4GQC A;  1HNB A;  3VWW A;  2C0D A;  4JED A;  5GZZ B;  3ZFB A;  4I2T A;  3EMP A;  3IOS A;  1HNA A;  3HYP A;  2IMD A;  4J57 E;  1XWK A;  2JL4 A;  5DCH A;  1O7U A;  16GS A;  1SYR A;  4PQI A;  1FOV A;  1Q4J A;  6GSX A;  3H4K A;  1DE2 A;  1FHE A;  3KZQ A;  1V98 A;  2XC2 A;  1YKA A;  2GST A;  3QCP A;  2AHE A;  4L0W A;  1AQW A;  1TTZ A;  4JR6 A;  1BX9 A;  5BMU A;  5CRE A;  1A8Y A;  2TRC P;  2QA2 A;  4ZBB A;  3F4S A;  2HRF A;  4Z2T A;  5FHI A;  3FZ4 A;  5DAL B;  2VM2 A;  4GLT A;  4HOJ A;  4K7I A;  2YV9 A;  2WCI A;  5ECQ B;  1B9Y C;  2YNX A;  3KM6 A;  1NSW A;  1QQ2 A;  1OYJ A;  10GS A;  1FB6 A;  1Z9H A;  4Q5Q A;  4FYU A;  1BAY A;  2LS5 A;  3CYN A;  5GAP D;  3FEU A;  2H1A A;  3P8W A;  5HR2 A;  2FD3 A;  1XFL A;  4MDC A;  3UAR A;  4F9Z A;  2OBK A;  4IW9 A;  4PUA A;  2TIR A;  3VPQ A;  3TJK A;  4KCA A;  1TRV A;  2QGV A;  3QPM A;  2O8V B;  1U3A A;  3DVW A;  4K1F A;  2I3Y A;  2V1M A;  1N2A A;  3P90 A;  3L9S A;  3VUR A;  2MMA A;  2GGT A;  3FRC A;  3DWV A;  1Z3E A;  1GSE A;  2GZP A;  4ISD A;  2OE1 A;  1X5E A;  2H6Y A;  3APQ A;  3D4M A;  1O8X A;  2L4C A;  3FR3 A;  1SEN A;  4ULX A;  3QAG A;  5KN0 A;  2H01 A;  2OAD A;  4BA7 A;  1X9W B;  2KP2 A;  1MD4 A;  1MDI A;  5F07 A;  3UBK A;  1CQH A;  3C7M A;  2VO4 A;  5INY A;  4PQ1 A;  4RQX A;  1SK0 A;  5JCG A;  1UA5 A;  4D73 B;  1F6M C;  1KNG A;  2VL3 A;  3SWL A;  1I5G A;  7GSS A;  4MJC A;  3F63 A;  1ST9 A;  1ERV A;  2PBJ A;  2L5O A;  2CA8 A;  3EUR A;  4CHS A;  1EP7 A;  1WRY A;  4MLY A;  3LSZ A;  3FZ9 A;  3D22 A;  1C72 A;  3W6G A;  1R4W A;  3F3R A;  4HDE A;  1HQO A;  2YZH A;  2RUE A;  1W4V A;  1GSS A;  2V6O A;  3IAS 2;  4WF5 A;  4HEA 2;  4XCS A;  5IMV A;  5ELG A;  3O6T A;  1SKS B;  4HQS A;  3TKR A;  2DJK A;  1TRU A;  4Z2U A;  3GHA A;  1XWA A;  4MJE A;  3HCZ A;  3GX8 A;  2RM5 A;  1B4P A;  2JZR A;  1G6Y A;  3FMW A;  1OVN A;  2WUL A;  3KH9 A;  1TOF A;  3LWA A;  2H6X A;  3ZIJ A;  4XS4 B;  4DSS A;  2GZY A;  4GST A;  2R4V A;  4ICY A;  4OFN A;  2KLX A;  4MK3 A;  2VCV A;  5H5S A;  2QC7 A;  2H0G A;  2YCD A;  5H5R A;  2CX3 A;  2I4A A;  3W8S A;  4N0Z A;  1PL2 A;  1VRS D;  3DEX A;  4JU5 A;  2DIZ A;  1EV9 A;  2YOI A;  1M9A A;  2HE3 A;  3M9J A;  4LLR A;  1PQN A;  1QMV A;  1TI3 A;  5KN1 A;  5A5K A;  4ZL7 A;  1E6B A;  2B5Y A;  1K3L A;  2LST A;  3M8N A;  3W8J A;  5F0G A;  1XPV A;  5EL8 A;  3IAM 2;  5ECM B;  2VCZ A;  1SU9 A;  3VI7 A;  5G2Z A;  4V2L A;  5JCU A;  22GS A;  3HXS A;  3LXZ A;  1ERT A;  5AIS A;  1VF3 A;  4KUN A;  4F82 A;  2VM1 A;  3DML A;  5AIV A;  5ECI B;  3ERW A;  4AF2 A;  3GKK A;  1HYU A;  1XWB A;  2NTO A;  1TRW A;  4YAP A;  2K6V A;  1QK8 A;  4J56 E;  3ED3 A;  4FQU A;  2VIM A;  2CVD A;  1A2M A;  1SK1 A;  4XS6 A;  5D9T A;  2F8F A;  3RPN A;  2MMO A;  3DD3 A;  2CZ3 A;  3TKQ A;  3GMF A;  2DIY A;  1AW9 A;  1GH2 A;  3I9V 2;  2Z9S A;  2AUV A;  2PMT A;  2A4V A;  4F0B A;  1GTB A;  3WT2 A;  3HDC A;  5C00 A;  2DSA A;  3RBT A;  2AYT A;  2GSQ A;  3TRQ A;  2X64 A;  4YH2 A;  3GKN A;  1X5D A;  1DUG A;  2I81 A;  3GV1 A;  4G10 A;  3MDK A;  4RQR A;  3TGZ A;  1TK0 B;  4CW9 A;  2OAC A;  3N5O A;  3TKP A;  3S9F A;  2RUF A;  3HHV A;  4EUY A;  2HZF A;  3TUE A;  4USS A;  2FHE A;  1TK8 B;  1GWC A;  4V2M A;  2HLS A;  1THX A;  2ZCT A;  3LXT A;  5HFI A;  5KEJ A;  2LRN A;  2YWM A;  1TJD A;  4G0K A;  2VL9 A;  4OFM A;  3BCK A;  5FT3 A;  3ZFL A;  3ZRE A;  2YP6 A;  2AJQ B;  4KDU A;  2C0E A;  1W89 A;  1F3A A;  1ZZY A;  4K5S A;  3TKS C;  5D73 A;  4WR5 A;  3NZN A;  5ECP B;  3SBC A;  1YQ1 A;  2N5B A;  4NWY A;  3KJY A;  3HVX A;  4MMM A;  3I6A A;  1WOU A;  1Z6M A;  2R3X A;  5EY6 A;  3L9U A;  1VF4 A;  3GL5 A;  1M0U A;  3CTF A;  1XBS A;  2FUG 2;  4Z2R A;  3GUS A;  4WKW A;  1Z7R A;  5F06 A;  2LKU A;  2YWO A;  3H79 A;  2UZ8 A;  1JZD A;  1YF0 A;  4PXO A;  1WE0 A;  2HSH A;  4IQ1 A;  4K7N A;  4TR4 A;  2F3M A;  4OFT A;  4ZL9 A;  1YY7 A;  1GUL A;  1M2A A;  2HRN A;  3EE2 A;  4MF6 A;  2HFD A;  3TOT A;  4EIQ A;  4XTS A;  2XHF A;  1SL1 B;  3D6I A;  4WR4 A;  4LL4 B;  2VLT A;  3QAW A;  3IK9 A;  4DSS B;  2AB6 A;  3IHQ A;  2MBS A;  2CV4 A;  1KEB A;  4EE0 A;  2AAW A;  2H70 A;  3IC4 A;  2M72 A;  4LMV A;  1DBY A;  1M99 A;  5E4W A;  5EPF A;  3MSZ A;  4IHU A;  4XRD A;  2X8C A;  3RPP A;  1HD2 A;  1V58 A;  4K6X A;  3GIX A;  4PGT A;  3KCM A;  3GL3 A;  5B6N A;  1XWC A;  3GST A;  3TKS A;  2FY6 A;  3QAV A;  3ISO A;  4KDY A;  2LJK A;  2PWJ A;  3L0H A;  4RI6 A;  1USB A;  3TJF A;  2DML A;  3HZ8 A;  4AJ6 A;  1O6J A;  3FW2 A;  4GWR A;  2YWI A;  2C80 A;  4IVF A;  2YWN A;  1J08 A;  3GX0 A;  4ZB9 A;  4N10 A;  2IMK A;  2R6K A;  1GUK A;  5LCZ A;  2LRT A;  3L9V A;  4IJ3 A;  5B8B A;  2QKE A;  4TKY A;  3LG6 A;  2O87 A;  3F4R A;  5CRW A;  4OCE A;  1JHB A;  3GA4 A;  3L78 A;  4L8E A;  2C8U A;  1A8L A;  4O32 A;  2I1U A;  1K0A A;  4JE1 A;  1JLW A;  1WJK A;  2L59 A;  2CAI A;  4MH3 A;  3C71 A;  3LJR A;  3PIN A;  1K0D A;  4IBP A;  3TJG A;  3LOR A;  2XBI A;  2GDR A;  1BYE A;  4EXJ A;  3DKS A;  2C0F A;  1BED A;  4EO3 A;  1NW2 A;  2MMZ A;  3NIV A;  2H0H A;  4FO5 A;  3UIW A;  5HR0 A;  2B1L A;  2V41 A;  4PNF A;  3F6F A;  1AIU A;  2OE3 A;  1OKD A;  2YPM A;  5HFG A;  1OC8 A;  2A2P A;  1NHY A;  2VD0 A;  4NV5 A;  2YAN A;  3TCO A;  4EF0 A;  2FNO A;  5J9C A;  1PX6 A;  2ALB A;  1ZL9 A;  4L5L A;  4CY8 A;  4K5R A;  1B9X C;  17GS A;  3FYG A;  2EIQ A;  4HJM A;  5D9V A;  3F6D A;  5B6M A;  2A2R A;  2O85 A;  3FK8 A;  4NXI A;  1KBN A;  2JZT A;  1VF1 A;  4KA0 A;  5ECH B;  2JAD A;  3MYD A;  1T8E B;  2MMN A;  2LQQ A;  4ZL8 A;  2MZC A;  3KTL A;  3PH9 A;  4DEJ A;  2LV3 A;  5EVO A;  3M1G A;  1R26 A;  2HXK A;  1YDK A;  2ON5 A;  2C0G A;  4KDX A;  1SL0 B;  4ACS A;  4V1A p;  1G7O A;  3MWH A;  5ECN B;  2WGR A;  4EDZ A;  3CXG A;  1EOG A;  4V2N A;  3F4T A;  3R2Q A;  3TJB A;  4O5R A;  1V57 A;  1VGL A;  2BJX A;  2H30 A;  3VI5 A;  1WMJ A;  5A4U A;  1ML6 A;  4HU9 A;  4XS1 A;  2L57 A;  2K8V A;  5DJM A;  2L6D A;  4OD7 A;  3ME8 A;  2VOC A;  2G0F A;  3A2W A;  5G30 A;  2ON7 A;  1T7P B;  4HS1 A;  4ID0 A;  4K0N A;  2DKI A;  4I97 A;  1ZYQ B;  1DE1 A;  4YQM A;  4I5Q A;  3ERG A;  12GS A;  2HZE A;  3G7J A;  4RUV A;  3QMX A;  1E2Y A;  2P5R A;  3HJO A;  1GLP A;  5J4U A;  4X1U A;  1FW1 A;  5KOW A;  2YN1 A;  1T4Y A;  1TU8 A;  4Q5F A;  1GSF A;  3HJP A;  5IM9 A;  5E59 A;  1H4O A;  2A2S A;  4ILF A;  3QD9 A;  1B8X A;  3CSI A;  4MPG A;  1K3O A;  2OBI A;  2VCW A;  2CQ9 A;  3QFA C;  4N0V A;  1O8W A;  4TXO A;  2VCX A;  5JWR B;  1KTE A;  4ECC A;  1ZYN A;  3ZIT A;  2IPA A;  2OJL A;  4GQF A;  4WF4 A;  5JWQ B;  5KN2 A;  1ACV A;  3CBU A;  4L5O A;  5GSS A;  2X4A A;  1EEM A;  2IME A;  2P31 A;  5FWG A;  1GLQ A;  1A2J A;  1A23 A;  1SJI A;  1TW9 A;  2KHP A;  4CY6 A;  3KGK A;  2CT6 A;  4XRA A;  1WWJ A;  2X8H A;  4G19 A;  1MD3 A;  4BPY A;  4N11 A;  1FOH A;  2L6C A;  2XPE A;  1ABA A;  1SD9 A;  3DYR A;  3GNJ A;  2DJ1 A;  1T1V A;  3ME7 A;  2GVP A;  4TR0 A;  1EP8 A;  4MF7 A;  8GSS A;  2OA7 A;  3FKF A;  3IK7 A;  1I9D A;  5AIX A;  3AY8 A;  3BD2 A;  1GL8 A;  4AGS A;  4G0L A;  1XOA A;  1AQX A;  2ES7 A;  3G7Y A;  3H93 A;  4YKG A;  1EEJ A;  3A5I A;  2LJR A;  2KOK A;  4ECB A;  4IP1 A;  2I9H A;  5HFK A;  4FYB A;  2AV4 A;  3IHG A;  4YAV A;  4PQH A;  1X5C A;  4IEL A;  3DIE A;  3GN3 A;  3CSH A;  2J23 A;  4F2I A;  2B1K A;  6GSW A;  5J9B A;  3JCM L;  5D9W A;  3CTG A;  2KP1 A;  2IMI A;  3WGE A;  5ECL B;  3GUR A;  2MYG A;  1LJR A;  1U3I A;  2O7K A;  5J5N A;  3F9U A;  4YQV A;  1GSD A;  5IMZ A;  2RLI A;  4KF9 A;  5G5E A;  2V6K A;  4ZB6 A;  1B48 A;  2N5F A;  3HY2 A;  4POL A;  1S3D A;  2L5L A;  3OR5 A;  3MAK A;  1X9S B;  2YJH A;  2CZ2 A;  3J7Y k;  4KCE A;  3LQ7 A;  4PTS A;  1X0R A;  4IS0 A;  3G9B A;  1K0C A;  4FYC A;  1JZW A;  2R0C A;  1G0T A;  1NM3 A;  2E2M A;  4G2E A;  3WGD A;  2KUC A;  2YZU A;  2IJY A;  4KB3 A;  3GSS A;  1Y25 A;  3I43 A;  3FZ5 A;  5A4W A;  2E0Q A;  1NHO A;  1XVQ A;  1K0M A;  3FR6 A;  1TU7 A;  1XXU A;  3J7Y b;  4ZIL A;  3UVH A;  3ZRD A;  1A2L A;  2HZE B;  2LJA A;  2WZ9 A;  2JZS A;  6GSS A;  2HI7 A;  3HA9 A;  1FO5 A;  3CRT A;  3MIX A;  5IPH A;  4ECJ A;  4GCI A;  5CRD A;  3BBY A;  1JZR A;  5GST A;  2F8A A;  3GH9 A;  5LD0 A;  4GRF A;  2VLV A;  2R2J A;  2H74 A;  3HZ4 A;  5C04 A;  4I8B A;  1XIY A;  2D2Z A;  5D8I A;  1GTA A;  3KTB A;  4G0I A;  2G2Q A;  2VLU A;  1GUM A;  2H19 A;  4GF0 A;  5KOX A;  4TXO B;  2LQO A;  1TXX A;  1XW9 A;  2HRA A;  2RM6 A;  1V2A A;  5L71 A;  3A5W A;  4V1A g;  5KN3 A;  3RHC A;  2M46 A;  2M80 A;  3FZA A;  1T00 A;  2C3T A;  1IYH A;  2C3N A;  3L4N A;  3VWU A;  5IOX A;  2EIO A;  1ON4 A;  2E7P A;  3VK9 A;  4NHW A;  3A3T A;  4FIW A;  3D0Z A;  5CRH A;  5D93 A;  2VCT A;  1GP1 A;  2HNL A;  2PUK C;  3TDG A;  2PPT A;  4Q5R A;  3GRX A;  4MA9 A;  3WGX A;  4L0U A;  2QSI A;  3ZL5 A;  4MZB A;  2F9S A;  2GT6 A;  4QQ7 A;  1JZO A;  4YKF A;  3TRX A;  3IRA A;  4IP6 A;  18GS A;  5G5F A;  5DQY A;  2DJ3 A;  3D4T A;  5LNK e;  3KD0 A;  3BJ5 A;  3GFK A;  2R5G A;  1XW6 A;  1SKR B;  3M9K A;  4KW6 A;  4K0G A;  1TI1 A;  3EU4 A;  4X43 A;  5J3R A;  2LNT A;  4GXZ A;  2CVK A;  2WB9 A;  1PGT A;  5ECR B;  2B6M A;  1ERU A;  1F37 A;  1FG4 A;  2K9F A;  4DSQ A;  2VCQ A;  3PPU A;  1PN0 A;  5IO0 A;  3Q18 A;  3CSJ A;  3DGQ A;  3KH7 A;  1PKW A;  2DBC A;  5IIZ A;  1MTC A;  4POK A;  1SYX A;  5CYY A;  4ZBA A;  1U87 A;  2R0P A;  4KSM A;  3UL3 A;  1TK5 B;  1A24 A;  1WIK A;  3UOM A;  1ZOF A;  4EC0 A;  2CVB A;  4HI7 A;  4F0C A;  1EGR A;  5JWO B;  1PX7 A;  2C1Y A;  2DMM A;  2GTU A;  4JZQ A;  4BVY A;  3UEM A;  1XVW A;  1MEK A;  4ZB8 A;  1SK2 A;  5D96 A;  2VL2 C;  5IMC A;  1SKW B;  1GRX A;  3VLN A;  1PL1 A;  4TOP A;  4DVC A;  3E3E A;  1S3C A;  5ENU A;  4K2D A;  6GSY A;  3IV4 A;  5ABR A;  3KEB A;  5DAK A;  5F05 A;  1URM A;  5AN1 A;  4KH7 A;  4PUF C;  2FLS A;  3US3 A;  4HU7 A;  3UAP A;  5DCG A;  3VFI A;  1GNE A;  4WBJ A;  5IMD A;  4JBB A;  1RK4 A;  4TRX A;  2B5E A;  2HSY A;  2LEG A;  4KGI A;  1B4Q A;  3RDW A;  3IR4 A;  1BJX A;  1U6T A;  3EPT A;  19GS A;  1R5A A;  2QA1 A;  5IMA A;  5D9X A;  1R5P A;  13GS A;  2YV7 A;  1SD8 A;  2DJ0 A;  2JSZ A;  4G9H A;  4MH2 A;  4KND A;  2C4J A;  4CDO A;  2HT9 A;  5DDL A;  2IFQ A;  3WYW A;  2FWF A;  3FR9 A;  3HKR A;  3APS A;  9GSS A;  1SJ6 A;  1K0N A;  3RAZ A;  2ZUP A;  1YEX A;  4EVM A;  3F0I A;  1F2E A;  3UVT A;  4OO4 A;  5IPG A;  4Q5N A;  2GLR A;  5DJL A;  4BWS A;  2H8L A;  1Z7P A;  2VD1 A;  1EZK A;  1Z5Y E;  3VWV A;  2EC4 A;  4H86 A;  4HJ2 A;  1OC9 A;  2NBS A;  2XPD A;  2X49 A;  2P0G A;  2TRX A;  4IQA A;  2VL2 A;  1BG5 A;  4MZW A;  5HR3 A;  3HVV A;  2IL3 A;  1GSY A;  3ZMK A;  2WRT A;  3TKS E;  3FHK A;  2VAF A;  2IIY A;  3CMI A;  2K18 A;  4K8M A;  4ML1 A;  2GQM A;  2V2G A;  4K7O A;  1N8J A;  5GAN D;  2LNS A;  3D21 A;  1AC1 A;  4OWY A;  2IWT A;  1THO A;  2HSM A;  2LUS A;  3PGT A;  1K3Y A;  4GSN A;  2R0G A;  3LYP A;  5ECK B;  1QXH A;  4BL7 A;  4BVX A;  4MPF A;  3U5R E;  4OMV A;  4HZ4 A;  1PN9 A;  4JR4 A;  4F03 A;  1OAZ A;  2P5Q A;  3EWL A;  4KX4 A;  3M0F A;  1MDK A;  4MZC A;  4NPB A;  2OKA A;  3KP9 A;  3EIN A;  2XBQ A;  3Q6O A;  1UVZ A;  5DQS A;  4FH8 A;  6GST A;  1YF1 A;  5F8B A;  1Y6E A;  4IKH A;  4K2X A;  2X8G A;  1H75 A;  2PN8 A;  4X0X A;  1GSU A;  2CAQ A;  4DSR A;  4MCU A;  4MJB A;  2DJ2 A;  5ECS A;  1LBK A;  4XHM A;  3TB2 A;  3C8E A;  4MNN A;  2CX4 A;  1FVK A;  1T4Z A;  4IGJ A;  1ZGN A;  3DVX A;  2GQK A;  1V9W A;  5CAX A;  1JFU A;  4NHZ A;  5JCW A;  2B7K A;  1QGV A;  4WEY A;  5CP1 A;  3IBH A;  1OC3 A;  4YQU A;  4HUA A;  2H71 A;  4POB A;  2OE0 A;  3IA1 A;  3BOA A;  4KSO A;  3IXR A;  2R37 A;  3DRN A;  4EDY A;  4IJI A;  3HD5 A;  2JAC A;  2GSR A;  2IMF A;  4BVY B;  1AQV A;  3K8N A;  1O73 A;  5H5Q A;  1UC7 A;  2FWE A;  4WXT A;  2H1G A;  3N9J A;  14GS A;  1R7H A;  3G7I A;  2PVO C;  5AGY A;  4AJ7 A;  3GKM A;  1EWX A;  2B7J A;  2FA4 A;  4P3Y B;  5CRG A;  1OE8 A;  4JRR A;  4WET A;  20GS A;  5DAK B;  3UMA A;  2YJ7 A;  2WDU A;  4BWQ A;  2NVL A;  4I2U A;  1O81 A;  4ZIJ A;  1K0O A;  2F51 A;  5COH A;  1WP0 A;  2BMX A;  3CRU A;  3O3T A;  3EVI A;  1FVJ A;  1V40 A;  4QL9 A;  4TVE A;  5IO2 A;  1DSB A;  1OE7 A;  1GUH A;  2L4Q A;  3P7X A;  1U88 A;  4PX1 A;  4O5U A;  5B7C A;  3P2A A;  3TJJ A;  1YZX A;  4K9Z A;  4RI7 A;  1EGO A;  3Q74 A;  2IFQ B;  3E0U A;  4TR1 A;  1GSQ A;  4EL1 A;  1XW5 A;  1T3B A;  4KAE A;  2LRC A;  1Q98 A;  4LL1 B;  6GSU A;  5ID2 A;  1MDJ A;  4HQZ A;  4OCF A;  4HZ2 A;  5G31 A;  1IYI A;  5IOW A;  1S3A A;  3M3M A;  3ZYW A;  1QFN A;  5DBQ A;  3KP8 A;  1OC9 B;  2GZZ A;  2FCH A;  5IQY A;  4O5Q A;  3IE3 A;  3GTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...