2MMZA

Solution structure of the apo form of human glutaredoxin 5
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
121
structure length
121
Chain Sequence
GSFTMGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Glutaredoxin-related protein 5, mitochondrial
publication title [2Fe-2S] cluster transfer in iron-sulfur protein biogenesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2mmzA01
5H5SA 4EF0A 2CAIA 3QDNA 4IHUA 4NHZA 1K3YA 2V41A 3W6GA 2H0HA 1ZCPA 2VM2A 3H8QA 3VI7A 1BEDA 5B6MA 1EOGA 3QAVA 1OE8A 3EVIA 5ID2A 2P0GA 2G0FA 4EC0A 3LYPA 4CW9A 5IO0A 4TR3A 4MMMA 4K7OA 4TRXA 5JWOB 4XS4B 4MCUA 3APQA 1ZYEA 4LL1B 5D9TA 1OC9A 1OVNA 1F3AA 1XVQA 3GTUB 1R4WA 2CX3A 2H76A 3C1RA 2YNXA 5CRDA 3VI5A 2CZ2A 4MLYA 7GSSA 1GTBA 2K8VA 4IP6A 2BJXA 4HOJA 3GIXA 2JSYA 2A4VA 2AYTA 2E7PA 3ERGA 6GSVA 4X0XA 2YWOA 1NM3A 3TOUA 5ENUA 2X8CA 2VO4A 3FW2A 4OMVA 5B6NA 4CDOA 2LJAA 3RPPA 3L9UA 3ED3A 2X99A 2PPTA 3HCZA 1QQ2A 1PD21 5L71A 4TXOA 3GURA 4WXTA 4MPGA 1W89A 4KNDA 3ERWA 1NHYA 3RBTA 3ZFBA 3KMOA 4JU5A 1R26A 5ECIB 1M99A 1A8LA 3LGCA 1ZYQB 1PRXA 3C7MA 3O6TA 4IKHA 1YEPA 3DXBA 2OACA 2E0QA 5EL8A 5JCWA 1BAYA 2YOIA 1JFUA 4K9ZA 4ZL7A 1SK2A 4AJ8A 3F4RA 3D0ZA 3G7YA 3KEBA 1ERUA 4JRRA 4IJ3A 4WEYA 2YV7A 2WDUA 1N2AA 4KSOA 1ERTA 5ID2B 2B1KA 4MH2A 1IYHA 3UOMA 1K0DA 1EP8A 1EGRA 2LQOA 1GNWA 2FWFA 1Z3EA 3TCOA 4ECIA 5IQYA 4MF5A 4WR4A 1UA5A 1THOA 4ZBBA 3CMIA 1URMA 4YAPA 3DVXA 3Q6OA 3A2WA 1SJIA 2H1GA 4I97A 5DVBA 2MMAA 4IP1A 2WJUA 3LXTA 2AB6A 5AGYA 3FZ5A 3IBHA 1VGLA 4L0UA 1TOFA 4NAXA 1AQXA 2N5BA 5IPHA 1B4PA 1BX9A 3HVVA 1PX6A 3RHBA 1TRUA 3P7XA 5A5KA 1MD3A 1UVZA 4Q5QA 3MDKA 3VURA 3LSZA 3HJMA 5IMCA 3EMXA 4J2FA 4JEDA 4FIWA 2RLIA 2XPDA 3P90A 1DUGA 2KP1A 1K0OA 1SL1B 2R2JA 1RK4A 4PNGA 3E0UA 4XTSA 2YWNA 3VPTA 3TKSE 3Q74A 4TXOB 3CSJA 4ML6A 2YJHA 1WJKA 4OWYA 1SKSB 2WRTA 3KJYA 4L5LA 4P3YB 4HU7A 1GRXA 1WPIA 2IWTA 2NDOA 2Z9SA 1M9BA 4K2DA 1K0NA 4WR5A 1K3LA 4MPFA 1H75A 4IVFA 4Q5FA 3DYRA 3GN3A 1FVKA 4V2LA 5FT3A 5KEJA 4MJBA 3FHKA 2B7KA 4YQUA 5H5QA 1PKWA 4IS0A 3F4TA 3P2AA 4KCEA 2DMLA 3IV4A 4NWYA 3ZIJA 1XWKA 2MYGA 1S3DA 1QFNA 1V9WA 5GAPD 1XIYA 2XC2A 2FY6A 2M80A 1XW6A 1YKCA 4G9HA 3EURA 1YZXA 6GSTA 3LXZA 1OE7A 4GQCA 4HJ2A 2MBSA 1EOHA 2DIYA 4KCAA 4EUYA 4MABA 1BJXA 1T4YA 2H1DA 2HRFA 1N8JA 2CQ9A 3C71A 1A24A 1AQWA 1F2EA 1X5EA 2J23A 3ZMLA 1VF3A 2H1BA 2LRTA 1G6YA 3ZL5A 5D9XA 5EPFA 3U6VA 4XRAA 5G30A 1E2YA 2AUVA 5CRWA 3LORA 4ZB9A 3KZQA 2L5LA 5HR1A 4PNFA 5ECRB 4OFNA 1LJRA 3EMPA 2FLSA 1QGVA 2WB9A 3HJOA 1PX7A 3E9JB 3HY2A 1OKTA 2IJYA 5IPGA 2VAFA 2GVPA 1VF4A 4KGIA 4LL4B 2C3NA 4EVMA 2AJQB 2DMMA 1PL2A 1FOVA 2E2MA 1M9AA 4BVYA 2ZNMA 2B3SA 3Q19A 3O76A 5G5FA 5HQPA 1SK0A 2NPBA 2KP2A 3G7JA 4ECJA 2HSYA 3QAWA 3L0HA 4NV2A 5KN3A 4JR4A 3EYTA 1JZDA 2H0IA 2H19A 2PMTA 3CBUA 4OCEA 3FKFA 1SD8A 4RUVA 2L6CA 3C1SA 5J9CA 4IQAA 2DIZA 1QXHA 2R3XA 1WRYA 2GZPA 1FVJA 2EC4A 16GSA 2KLXA 1FW1A 2C0GA 1UN2A 4F2IA 4LLRA 3IA1A 4XRDA 4GF0A 2LS5A 4ZBAA 5A4VA 3KXOA 4QL7A 5ECOB 4KE3A 1DBYA 1M2BA 3DIEA 5CYYA 1SKWB 3G9BA 1PGTA 1DSBA 4IBPA 1AIUA 4GLTA 3L9SA 1TU7A 1JLWA 4TN8A 2I4AA 3ZITA 3DRNA 4OD7A 5AN1A 1YDKA 2H71A 2R37A 3LQ7A 4HI7A 3UVHA 2NBSA 1XOAA 5ELGA 1TK0B 1A2MA 3KIJA 4IN0A 2B5EA 2IL3A 5ECSA 2GT5A 2C4JA 4K1FA 4GWRA 1LBKA 6GSUA 2GQMA 4J57E 2JZSA 2YP6A 3US3A 4I2TA 5D73A 5JWRB 2IFQA 4EDYA 4E8HA 1T7PB 3VWWA 2XPEA 3LFLA 2HYXA 1ZOFA 2AAWA 3FEUA 4HJMA 2RM6A 3TJBA 1XWGA 5J41A 2ON5A 4JZQA 4L0WA 4DEJA 2GT6A 1PQNA 1C72A 4D73A 3NZNA 1F6MC 3FR6A 3APSA 3ZYWA 4I5QA 4NMUA 4ML1A 2LNTA 1PKZA 1ST9A 3GFKA 2VCTA 2FWEA 5KN0A 2WGRA 1ZL9A 3VWUA 3CTGA 1TRWA 1E6BA 5LNKe 3EWLA 2V6KA 2F3MA 2OADA 2GSSA 2LTKA 3VFIA 1A2LA 2ES7A 1YKAA 2GSTA 1OKDA 3GH6A 5LCZA 2J9HA 2MZCA 2PVOC 4LMWA 2H1AA 1KTEA 3F3RA 5IMVA 2IIYA 4MA9A 3TRXA 1EGOA 3CXGA 1QK8A 1V57A 2CVDA 2E2GA 4RQXA 1XZOA 3IPZA 1A23A 2HNLA 2C80A 3ZREA 3HXSA 2VM1A 5DJMA 2ZCTA 2C0FA 4EKZA 1TK8B 2LJRA 4ULXA 3I9V2 4ID0A 3QR6A 2A2SA 5IIZA 5DALB 2JACA 2M72A 2OE1A 1HYUA 4XCSA 2F8FA 3BBYA 2CVBA 2GQLA 2DSAA 3TJFA 2IFQB 2CT6A 6GSWA 5CRHA 2QSIA 3GH9A 4G19A 1MDJA 5AIVA 2HZEA 2FUG2 3UMAA 2M46A 2HSHA 4POKA 4POMA 4PXOA 4XS1A 2L4QA 4HZ2A 2IMIA 3FR3A 5IM9A 2LRNA 1ABAA 3GRXA 1ON4A 2V32A 3IOSA 3ZLPA 4D73B 4PQHA 1Z6MA 3IK7A 3KTBA 3J7Yk 1NHOA 1A0FA 4DSQA 1ACVA 4XHMA 5JCGA 3JCML 2PVQA 1GWCA 5GZZB 1K0CA 1GLPA 1GUHA 5ECMB 4POLA 3L4NA 4KDYA 2JADA 5KN2A 4ZB8A 3A2VA 4YQMA 2H6YA 1SENA 1GLQA 1GSSA 2EIOA 2VL9A 4PX1A 1RW1A 3CSHA 3OR5A 3GMFA 3ZFLA 1BG5A 2GDRA 2LJKA 3D21A 5IOWA 3UBLA 1OC9B 2DJ3A 2IMFA 5ECNB 1WWJA 3QFBC 3MNGA 3WT2A 3A2XA 2D2ZA 4TXVA 2OBKA 8GSSA 4PQ1A 2HLSA 4KH7A 3M8NA 4MF6A 4GSNA 4DSSA 2WCIA 1GSDA 5DAKA 4F0CA 3HA9A 3QCPA 5B8AA 1F9MA 3GA4A 5FWGA 2DJ1A 1O8XA 1O7UA 4WF5A 3MSZA 2YN1A 3EC3A 4QL9A 4X1UA 4GSTA 2LRCA 4DSRA 1U6TA 1UC7A 2HZEB 2L57A 2YWIA 1MTCA 1TU8A 5D93A 2GGTA 1EV9A 2WZ9A 3FYGA 1PSQA 5J5NA 4E8EA 2RUEA 3VK9A 1M7TA 4MZBA 5CAXA 1Y6EA 4TR1A 3WGDA 2EIRA 3BCKA 2TRXA 2P31A 1Y25A 1EZKA 4F0BA 4ILFA 3HJPA 3W8SA 4N11A 1YY7A 4EDZA 3KCMA 4EL1A 1TTZA 2OA7A 2AV4A 4GSSA 10GSA 2OE3A 2PWJA 4FYUA 1H4OA 4J56E 3HHVA 2FCHA 1ZGNA 5F06A 2K6VA 2A2RA 3HZ8A 3S9FA 2HE3A 2X64A 1T1VA 5DDLA 5ECLB 4RI7A 4ZL9A 2LKUA 1Z6NA 3PINA 3ZMKA 4CHSA 2H6XA 1SK1A 2LEGA 3VPQA 1IYIA 4IW9A 1GP1A 1PN9A 1G6WA 1U87A 1TI1A 2H75A 1HD2A 2VD0A 1M2AA 1PL1A 2H74A 3FZ4A 4DSSB 3ISOA 4OCFA 3WGEA 1OC3A 4HQSA 3ME8A 5DAKB 2LNSA 4KW6A 4WF4A 2WFCA 3KM6A 3F63A 2C0EA 3ZRDA 4MF7A 5CP1A 2JZRA 4KX4A 5B8BA 2VIMA 5COHA 1XW5A 4PURA 2B1LA 1V40A 4I8BA 1J0FA 3CTFA 4MP4A 1CQHA 3H79A 2IMKA 3TKPA 2I1UA 2VL2C 4OFTA 1THXA 2FNOA 4TR1B 1OYJA 1SJZA 1SYRA 4HU9A 1Z7PA 1R5PA 6GSSA 2MBTA 4BA7A 1HNCA 1X9MB 1A8YA 4MJAA 2V1MA 3IC4A 1NW2A 4MH3A 3ERFA 1SL2B 3GL5A 2DBCA 4OO5A 3HZ4A 1AUCA 4YQVA 3CRUA 1ERWA 3UARA 3SWLA 3L9VA 5HR2A 3FR9A 4N0ZA 2VLTA 3WT1A 1GSEA 4QQ7A 4AF2A 3IXRA 3M1GA 1Q98A 3MWHA 5IO2A 2GTUA 2WULA 1PMTA 3IDVA 4OFMA 5HFKA 4Z7XA 1TKDB 4O92A 1JZRA 2H73A 5A4UA 2XBQA 4MJEA 1GSUA 3GKMA 4ACSA 4K6XA 3KD0A 1T4ZA 5J3RA 3RPNA 1W4VA 3TJKA 2VL2A 4L8EA 3IK9A 1YJ6A 4HZ4A 5A4WA 1V58A 5D8IA 5ELAA 4G2EA 1AW9A 4H86A 2MMNA 1K0BA 2X8GA 1U3IA 2L4CA 5C00A 2FA4A 4PGTA 4I6XA 3CRTA 1SYXA 3BOAA 2PU9C 1XW9A 1KEBA 2GLRA 5KN1A 5HR3A 3QAGA 5IMDA 3F0IA 6GSXA 5E59A 1I9DA 3QOUA 4N0VA 3CYNA 1XBSA 1X9WB 1AAZA 2LSTA 2MMZA 2FD3A 4V2MA 1I5GA 3QMXA 1K0AA 3ZVJA 2YPMA 2K9FA 3A5WA 4O7HA 2B5XA 1KBNA 3C8EA 3KTLA 4KAEA 2P5RA 1TRVA 4TW5A 2L5OA 3A3TA 1MDIA 3BD2A 3UIWA 1RQMA 4TOPA 3LWAA 1PA3A 3HVXA 1T8EB 2VL3A 1GULA 1XVWA 3TB2A 1G0TA 2C0DA 2NVLA 1SU9A 2FGXA 1GSQA 2C3TA 3ME7A 5ECPB 3W8JA 2H8LA 3DMLA 2CVKA 4EO3A 3GL3A 2JL4A 2OKAA 1J9BA 3GX0A 1XWCA 1AXDA 4WBJA 2DJ0A 3U5RE 2YJ7A 4WETA 5D9VA 4ZILA 4FO5A 2I81A 2TRCP 2DJ2A 1WP0A 3NOFA 4MZWA 4MDCA 4RQRA 5EY6A 3RDWA 2FA8A 5F07A 3D5JA 2QKEA 3G7IA 2RUFA 2VD1A 2N5AA 2YV9A 5ECHB 2I3YA 2O8VB 5DQYA 5H5RA 5HFGA 1G7OA 1A0RP 4NHWA 4V2NA 4HQZA 4KUNA 5CRGA 1Q4JA 4MZCA 2YCDA 2VLVA 2YZUA 2K8SA 1A2JA 1TRSA 4JBBA 4ECCA 3PR8A 2R6KA 1ZMAA 3TJGA 1Z5YE 1FB6A 1XFLA 3F6DA 1TJDA 2QGVA 4X43A 5DCHA 3IAS2 4XS6A 5DCGA 4N30A 1HNBA 1M2DA 1O85A 1K0MA 1J08A 4Q5RA 1F37A 4AJ7A 2H0GA 3C73A 1BYEA 1VF2A 3IHQA 1FG4A 4ECBA 4IGJA 2EIQA 4L5OA 3FY7A 17GSA 2I9HA 3D4MA 3HD5A 2CV4A 3TKQA 4O5RA 1MD4A 5CO3A 3O3TA 3UAPA 1MEKA 1X5DA 2F51A 3EE2A 3I43A 1TK5B 5D96A 5ECKB 2VUPA 5IMFA 1JZOA 3IAM2 3RAZA 1GSFA 3D22A 4F82A 3F4SA 5CNWA 3GSSA 1GSYA 1O8WA 5J4UA 1FAAA 1ILOA 1USBA 1WIKA 3IE3A 2N5FA 3M9KA 4K7NA 2XHFA 2V2GA 3ZIVA 4JE1A 3FZAA 2HXKA 3EINA 3PGTA 4KA0A 4ZBDA 3KMNA 3KP9A 3F8UA 2IN3A 1TI3A 2IPAA 4FYCA 2AHEA 3I6AA 3DWVA 3DEXA 4PUAA 3R2QA 1GTAA 2CAQA 1GTIA 1WOUA 1XWBA 4ZIJA 2O85A 3TUEA 5IMAA 3QD9A 4BPYA 2F8AA 1DE2A 3APOA 2PBJA 3QPMA 3TRPA 3TDGA 4GQFA 3NIVA 4GCIA 4G10A 5GSTA 3E3EA 5AISA 3LJRA 1F3BA 3GKXA 4IELA 4V1Ag 2F9SA 4BVXA 3KH9A 1ML6A 2L6DA 1S3CA 2O89A 4IJIA 3UL3A 1B9YC 2HZFA 4IQ1A 6GSYA 1X0RA 3WGXA 3ZTLA 3D6IA 3F3QA 1AC1A 2WS2A 2IMDA 2ZUPA 3H1NA 3TGZA 1ERVA 4GTUA 1GL8A 3UJ1A 4TKYA 4LA1A 1V2AA 4KB3A 3I69A 1SL0B 2MMOA 3IRAA 1FB0A 2PUKC 4K8MA 5F0GA 4KDXA 4NXIA 3ZVJD 1Z7RA 3UVTA 4V1Ap 4O32A 4TR4A 2GSQA 2GSRA 2VCXA 2PGTA 2GQKA 3N9JA 1DE1A 3GSTA 5G1LA 2HI7A 2C8UA 1U88A 3M9JA 2H72A 1TXXA 1SJ6A 3FK8A 1YF1A 1EWXA 2VCVA 5DJLA 2GS3A 2PN8A 4GRFA 2C1YA 3F9UA 4NPBA 4FYBA 4HUAA 3IR4A 4HS1A 2NTOA 2PERA 3DVWA 3FRCA 1B4QA 1G7EA 1JZWA 20GSA 3P8WA 4PQIA 2ALBA 1MDKA 4BWQA 3DGQA 4N10A 4TR0A 2RM5A 3ZZXA 1TW9A 5D9WA 4BWSA 4I2UA 4HEA2 3EU3A 4F03A 3SBCA 2QC7A 3KGKA 1BQ7A 4ISDA 1XPVA 5HFIA 4JR6A 1V98A 5HR0A 3UEMA 2FWHA 3K8NA 3N5OA 3TKRA 22GSA 5G5EA 12GSA 1OC8A 3GYKA 1B48A 1WE0A 3L78A 2OE0A 5AIXA 2DJJA 2CX4A 3LG6A 3GKKA 1YEXA 3M3MA 2B6MA 3VWVA 3KP8A 2KUCA 2VCQA 1U3AA 3VWXA 3WYWA 1LU4A 5DBQA 4FH8A 4K0NA 5EVOA 3HVSA 4MK3A 3KH7A 1TP9A 2CZ3A 1GUMA 2IMEA 2KOKA 4EE0A 2H30A 2R4VA 3RHCA 4Q5NA 2X8HA 3HKRA 1JHBA 11GSA 1WMJA 4ZXGA 2O87A 1YQ1A 4LMVA 3LEFA 5IMZA 4K0GA 4KSMA 2FHEA 4AJ6A 3TRQA 13GSA 2K18A 3GX8A 4DVCA 1K3OA 1R5AA 3HDCA 5F8BA 2O7KA 4YH2A 1S3AA 2R5GA 5INYA 3TOTA 2LUSA 5LD0A 4OO4A 2H01A 1EP7A 2JSZA 1O73A 5JCUA 5IOXA 4BL7A 1GTUA 1R7HA 1X9SB 1B8XA 4K7IA 5CREA 3VLNA 5GSSA 4ZB6A 3D4TA 1EEJA 5ABRA 3BJ5A 4HDEA 1XCCA 1ZZYA 5G31A 2VLUA 2DLXA 1CQGA 4GXZA 1HQOA 2YZHA 2LQQA 2DJKA 2G2QA 4WKWA 3GHAA 1EEMA 1GUKA 2OBIA 2CA8A 2C3QA 14GSA 2B5YA 4MJCA 1T3BA 2V6OA 3F6FA 2ON7A 1SD9A 1B9XC 3TKSC 1M0UA 2DC5A 3TJJA 2GZYA 4NV5A 1SKRB 1QMVA 4F9ZA 5G1KA 2TIRA 2B7JA 4XIHA 1GH2A 1O6JA 3GUSA 19GSA 4YAVA 5GAND 1OAZA 1XOBA 2VCWA 2H66A 2RIIA 1FHEA 1T00A 2L59A 3PH9A 3GNJA 5ECQB 3J7Yb 2REMA 4TVEA 1VRSD 5F05A 2JZTA 4ZL8A 2YWMA 4RI6A 5E4WA 1GNEA 4PUFC 2VCZA 4XS4A 9GSSA 5JWQB 1HNAA 1YF0A 1EV4A 3LYKA 2P5QA 5C04A 4POBA 5DQSA 2FWGA 2LV3A 3GTUA 3DD3A 1QUWA 4KDUA 1VF1A 3TKSA 1AQVA 3UBKA 3CSIA 3GV1A 4EXJA 2H6ZA 3V1WA 5J9BA 1XXUA 3Q18A 1FO5A 3H4KA 2BTOT 1TDIA 5G2ZA 3AY8A 3WD6A 5DALA 5B7CA 1XWAA 3FZ9A 3M0FA 2BMXA 2HFDA 1O81A 2GZZA 2HRNA 3BCIA 1NSWA 3EU4A 3DKSA 3H93A 2H70A 2YANA 1Z9HA 2OJLA 1KNGA 2VOCA 2XBIA 3GKNA 1JLVA 4WBRD 1X5CA 3HYPA 4AGSA 2KHPA 3MAKA 2HT9A 2JU5A 18GSA 5FHIA 3QFAC
chains in the Genus database with same CATH superfamily
5H5SA 4EF0A 2CAIA 3QDNA 4IHUA 4NHZA 1K3YA 2V41A 3W6GA 2H0HA 1ZCPA 2VM2A 3H8QA 3VI7A 1BEDA 5B6MA 1EOGA 3QAVA 1OE8A 3EVIA 5ID2A 2P0GA 2G0FA 4EC0A 3LYPA 4CW9A 5IO0A 4TR3A 4MMMA 4K7OA 4TRXA 5JWOB 4XS4B 4MCUA 3APQA 1ZYEA 4LL1B 5D9TA 1OC9A 1OVNA 1F3AA 1XVQA 3GTUB 1R4WA 2CX3A 2H76A 3C1RA 2YNXA 5CRDA 3VI5A 2CZ2A 4MLYA 7GSSA 1GTBA 4O5QA 2K8VA 4IP6A 2BJXA 4HOJA 3GIXA 2JSYA 2A4VA 2AYTA 2E7PA 3ERGA 6GSVA 4X0XA 2YWOA 1NM3A 3TOUA 5ENUA 2X8CA 2VO4A 3FW2A 4OMVA 5B6NA 4CDOA 2LJAA 3RPPA 3L9UA 3ED3A 2X99A 2PPTA 3HCZA 1QQ2A 1PD21 5L71A 4TXOA 3GURA 4WXTA 4MPGA 1W89A 4ICYA 4KNDA 3ERWA 1NHYA 3RBTA 3ZFBA 3KMOA 4JU5A 1R26A 5ECIB 1M99A 1A8LA 3LGCA 1ZYQB 4X4JA 1PRXA 4K5SA 3C7MA 4K5RA 3O6TA 4IKHA 1YEPA 3DXBA 2OACA 2E0QA 5EL8A 5JCWA 1BAYA 2YOIA 1JFUA 4K9ZA 4ZL7A 1SK2A 4AJ8A 3F4RA 3D0ZA 3G7YA 3KEBA 1ERUA 4JRRA 4IJ3A 4WEYA 2YV7A 2WDUA 1N2AA 4KSOA 1ERTA 5ID2B 2B1KA 4MH2A 4BIKA 1IYHA 3UOMA 1K0DA 1EP8A 1EGRA 2LQOA 1GNWA 2FWFA 1ZYNA 1Z3EA 3TCOA 4ECIA 5IQYA 4MF5A 4WR4A 1UA5A 1THOA 4ZBBA 3CMIA 1URMA 4YAPA 3DVXA 3Q6OA 3A2WA 4A5PA 1SJIA 2H1GA 4I97A 5DVBA 2MMAA 4IP1A 2WJUA 3LXTA 2AB6A 5AGYA 3FZ5A 3IBHA 1VGLA 4L0UA 1TOFA 4NAXA 1AQXA 2N5BA 5IPHA 1B4PA 1BX9A 3HVVA 1PX6A 3RHBA 1TRUA 3P7XA 5A5KA 1MD3A 1UVZA 4Q5QA 3MDKA 3VURA 3LSZA 3HJMA 5IMCA 3EMXA 4J2FA 4JEDA 4FIWA 2RLIA 2XPDA 3P90A 1DUGA 2KP1A 2UZ8A 1K0OA 1SL1B 2R2JA 1RK4A 4PNGA 3E0UA 4XTSA 2YWNA 3VPTA 3TKSE 3Q74A 4TXOB 3CSJA 4ML6A 2YJHA 1WJKA 4OWYA 1SKSB 2WRTA 3KJYA 4L5LA 4P3YB 4HU7A 1GRXA 1WPIA 2IWTA 2NDOA 2Z9SA 1M9BA 4K2DA 1K0NA 4WR5A 1K3LA 4MPFA 1H75A 4IVFA 4Q5FA 3DYRA 3GN3A 1FVKA 4V2LA 5FT3A 5KEJA 4MJBA 3FHKA 2B7KA 4YQUA 5H5QA 1PKWA 4IS0A 3F4TA 3P2AA 4KCEA 2DMLA 3IV4A 4NWYA 3ZIJA 1XWKA 2MYGA 1S3DA 1QFNA 1V9WA 5GAPD 1XIYA 2XC2A 2FY6A 2M80A 1XW6A 1YKCA 4G9HA 3EURA 1YZXA 6GSTA 3LXZA 1OE7A 4GQCA 4HJ2A 3IHGA 2MBSA 1EOHA 2DIYA 4KCAA 4EUYA 4MABA 1BJXA 1T4YA 2H1DA 2HRFA 1N8JA 2CQ9A 3C71A 1A24A 1AQWA 1F2EA 1X5EA 4MNNA 2J23A 3ZMLA 1VF3A 2H1BA 2LRTA 1G6YA 3ZL5A 5D9XA 5EPFA 3U6VA 4XRAA 5G30A 1E2YA 2AUVA 5CRWA 3LORA 4ZB9A 3KZQA 2L5LA 5HR1A 4PNFA 5ECRB 4OFNA 1LJRA 3EMPA 2FLSA 1QGVA 2WB9A 3HJOA 2HSMA 1PX7A 3E9JB 3HY2A 1OKTA 2IJYA 5IPGA 2VAFA 2GVPA 1VF4A 4KGIA 4LL4B 2C3NA 4EVMA 2AJQB 2DMMA 1PL2A 1FOVA 2E2MA 1M9AA 4BVYA 2ZNMA 2B3SA 3Q19A 3O76A 1ZYPA 5G5FA 5HQPA 1SK0A 1PFOA 2NPBA 2KP2A 3G7JA 4ECJA 2HSYA 3QAWA 2HRKA 5KOXA 3L0HA 4NV2A 5KN3A 4JR4A 3EYTA 1JZDA 2H0IA 2H19A 2PMTA 3CBUA 4OCEA 3FKFA 1SD8A 4RUVA 2L6CA 3C1SA 5J9CA 4IQAA 2DIZA 1QXHA 2R3XA 1WRYA 2GZPA 5KOWA 1FVJA 2EC4A 16GSA 2KLXA 1FW1A 2C0GA 1UN2A 4F2IA 4LLRA 3IA1A 4XRDA 4GF0A 2LS5A 4ZBAA 5A4VA 3KXOA 4QL7A 5ECOB 4KE3A 1DBYA 1M2BA 3DIEA 5CYYA 1SKWB 3G9BA 1PGTA 1DSBA 4IBPA 1AIUA 4GLTA 3L9SA 1TU7A 1JLWA 4Z2RA 4TN8A 3PPUA 2I4AA 3ZITA 3DRNA 4OD7A 5AN1A 1YDKA 2H71A 2QA2A 2R37A 3LQ7A 4HI7A 3UVHA 2NBSA 1XOAA 5ELGA 1TK0B 1A2MA 3KIJA 4IN0A 2B5EA 2IL3A 5ECSA 2GT5A 2C4JA 4K1FA 4GWRA 1LBKA 6GSUA 2GQMA 4J57E 2JZSA 2YP6A 3US3A 4I2TA 5D73A 4USSA 5JWRB 2IFQA 4EDYA 4E8HA 1T7PB 3VWWA 4BVYB 2XPEA 3LFLA 2HYXA 1ZOFA 2AAWA 3FEUA 4HJMA 2RM6A 3TJBA 1XWGA 5J41A 2ON5A 4JZQA 4L0WA 1FOHA 4DEJA 2GT6A 1PQNA 1C72A 4D73A 3NZNA 1F6MC 3FR6A 3APSA 3ZYWA 4I5QA 4NMUA 4ML1A 2LNTA 1PKZA 1ST9A 3GFKA 2VCTA 2FWEA 5KN0A 2WGRA 1ZL9A 3VWUA 3CTGA 1TRWA 1E6BA 5LNKe 3EWLA 2V6KA 2F3MA 2OADA 2GSSA 2LTKA 3VFIA 1A2LA 2ES7A 1YKAA 2GSTA 1OKDA 3GH6A 5LCZA 2J9HA 2MZCA 2PVOC 4LMWA 2H1AA 1KTEA 3F3RA 5IMVA 2IIYA 4MA9A 3TRXA 1EGOA 3CXGA 1QK8A 1V57A 2CVDA 2E2GA 4EIPA 4RQXA 1XZOA 3IPZA 1A23A 2HNLA 2C80A 3ZREA 3HXSA 2VM1A 5DJMA 2ZCTA 2C0FA 4EKZA 1TK8B 2LJRA 4ULXA 3I9V2 4ID0A 3QR6A 2A2SA 5IIZA 5DALB 2JACA 2M72A 2OE1A 1HYUA 4XCSA 2F8FA 3BBYA 2CVBA 2GQLA 2DSAA 3TJFA 2IFQB 2CT6A 6GSWA 5CRHA 2QSIA 3GH9A 4G19A 1MDJA 5AIVA 2HZEA 2FUG2 3UMAA 2M46A 2HSHA 4POKA 4POMA 4PXOA 4XS1A 2L4QA 4HZ2A 2IMIA 3FR3A 5IM9A 2LRNA 1ABAA 3GRXA 1ON4A 2V32A 3IOSA 3ZLPA 4D73B 4PQHA 1Z6MA 3IK7A 3KTBA 3J7Yk 1NHOA 1A0FA 4DSQA 1ACVA 4XHMA 5JCGA 3JCML 2PVQA 1GWCA 5GZZB 1K0CA 1GLPA 1GUHA 5ECMB 4POLA 3L4NA 4KDYA 2JADA 5KN2A 4ZB8A 3A2VA 4YQMA 2DKHA 2H6YA 1SENA 1GLQA 1GSSA 2EIOA 2VL9A 4PX1A 1RW1A 3CSHA 3OR5A 3GMFA 3ZFLA 1BG5A 2GDRA 2LJKA 3D21A 5IOWA 3UBLA 1OC9B 2DJ3A 2IMFA 5ECNB 1WWJA 3QFBC 3MNGA 3WT2A 3A2XA 2D2ZA 4TXVA 2OBKA 8GSSA 4PQ1A 2HLSA 4KH7A 3M8NA 4MF6A 4GSNA 4DSSA 2WCIA 1GSDA 5DAKA 4F0CA 3HA9A 3QCPA 2A4HA 5B8AA 1F9MA 3GA4A 5FWGA 2DJ1A 1O8XA 1O7UA 4WF5A 3MSZA 2YN1A 3EC3A 4QL9A 4X1UA 4GSTA 2LRCA 4DSRA 1U6TA 1UC7A 2HZEB 2L57A 2YWIA 1MTCA 1TU8A 5D93A 1S3RA 2GGTA 1EV9A 2WZ9A 3FYGA 1PSQA 5J5NA 4E8EA 2RUEA 3VK9A 1M7TA 4MZBA 5CAXA 1Y6EA 4TR1A 3WGDA 2EIRA 3BCKA 2TRXA 2P31A 1Y25A 1EZKA 4F0BA 4ILFA 3HJPA 3W8SA 4N11A 1YY7A 4EDZA 3KCMA 4EL1A 1TTZA 2OA7A 2AV4A 4GSSA 10GSA 2OE3A 2PWJA 4FYUA 1H4OA 4J56E 3HHVA 2FCHA 1ZGNA 5F06A 2K6VA 2A2RA 3HZ8A 3S9FA 2HE3A 2X64A 1T1VA 5DDLA 5ECLB 5BRTA 4RI7A 4ZL9A 2LKUA 1Z6NA 3PINA 3ZMKA 4CHSA 2H6XA 1SK1A 2LEGA 3VPQA 1IYIA 4IW9A 1GP1A 1PN9A 1G6WA 1U87A 1TI1A 2H75A 1HD2A 2VD0A 1M2AA 1PL1A 3FMWA 2H74A 3FZ4A 4DSSB 3ISOA 4OCFA 3WGEA 1OC3A 4HQSA 3ME8A 5DAKB 2LNSA 4KW6A 4CY6A 4WF4A 2WFCA 3KM6A 3F63A 2C0EA 3ZRDA 4MF7A 5CP1A 2JZRA 4KX4A 5B8BA 2VIMA 5COHA 1XW5A 4PURA 3IC8A 2B1LA 1V40A 4I8BA 1J0FA 3CTFA 4MP4A 1CQHA 3H79A 2IMKA 3TKPA 2I1UA 2VL2C 4OFTA 1THXA 2FNOA 4TR1B 1OYJA 1SJZA 1SYRA 4HU9A 1Z7PA 1R5PA 6GSSA 2MBTA 4BA7A 1HNCA 1X9MB 1A8YA 4MJAA 2V1MA 3IC4A 1NW2A 4MH3A 3ERFA 1SL2B 3GL5A 2DBCA 4OO5A 3HZ4A 1AUCA 4YQVA 3CRUA 1ERWA 3UARA 3SWLA 3L9VA 5HR2A 3FR9A 4N0ZA 2VLTA 3WT1A 1GSEA 4QQ7A 4AF2A 3IXRA 3M1GA 1Q98A 3MWHA 5IO2A 2GTUA 2WULA 1PMTA 3IDVA 4OFMA 5HFKA 4Z7XA 1TKDB 4O92A 1JZRA 2H73A 5A4UA 2XBQA 3MYDA 4HSCX 3HVNA 4MJEA 1GSUA 3GKMA 4ACSA 4K6XA 3KD0A 1T4ZA 5J3RA 3RPNA 1W4VA 3TJKA 2VL2A 4L8EA 3IK9A 1YJ6A 4HZ4A 5A4WA 1V58A 5D8IA 5ELAA 4G2EA 1AW9A 2A2PA 4H86A 2MMNA 1K0BA 2X8GA 1U3IA 2L4CA 5C00A 2FA4A 4PGTA 4I6XA 3CRTA 1SYXA 3BOAA 2PU9C 1XW9A 1KEBA 2GLRA 5KN1A 5HR3A 3QAGA 5IMDA 3F0IA 6GSXA 4KF9A 5E59A 1I9DA 3QOUA 4N0VA 3CYNA 1XBSA 1X9WB 1AAZA 2LSTA 2MMZA 2FD3A 4V2MA 1I5GA 4EIQA 3QMXA 1K0AA 3ZVJA 2YPMA 2K9FA 3A5WA 4O7HA 2B5XA 1KBNA 3C8EA 4G0KA 3KTLA 4KAEA 2P5RA 1TRVA 4TW5A 2L5OA 3A3TA 1MDIA 3BD2A 3UIWA 1RQMA 4TOPA 3LWAA 1PA3A 3HVXA 4K2XA 1T8EB 2VL3A 4CY8A 1GULA 1XVWA 3TB2A 1G0TA 2C0DA 2NVLA 1SU9A 2FGXA 1GSQA 2C3TA 3ME7A 5ECPB 3W8JA 2H8LA 3DMLA 2CVKA 4EO3A 3GL3A 2JL4A 3R3EA 2OKAA 1J9BA 3GX0A 1XWCA 4Z2TA 1AXDA 4WBJA 2DJ0A 3U5RE 2YJ7A 4WETA 5D9VA 4ZILA 4FO5A 2I81A 2TRCP 2DJ2A 1WP0A 3NOFA 4MZWA 4MDCA 4RQRA 5EY6A 3RDWA 2FA8A 5F07A 3D5JA 2QKEA 3G7IA 2RUFA 2VD1A 2N5AA 2YV9A 5ECHB 2I3YA 2O8VB 5DQYA 5H5RA 5HFGA 1G7OA 1A0RP 2DKIA 4NHWA 4V2NA 4HQZA 4KUNA 5CRGA 1Q4JA 4YKFA 4MZCA 2YCDA 2VLVA 2YZUA 2K8SA 1A2JA 1TRSA 4JBBA 4ECCA 3PR8A 2R6KA 1ZMAA 3TJGA 1Z5YE 1FB6A 1XFLA 3F6DA 1TJDA 2QGVA 4X43A 5DCHA 3IAS2 4XS6A 5DCGA 4N30A 1HNBA 1M2DA 1O85A 1K0MA 1J08A 4Q5RA 1F37A 4AJ7A 2H0GA 3C73A 1BYEA 1VF2A 3IHQA 1FG4A 4ECBA 4IGJA 2EIQA 4L5OA 3FY7A 17GSA 2I9HA 3D4MA 3HD5A 2CV4A 3TKQA 4O5RA 1MD4A 5CO3A 3O3TA 3UAPA 1MEKA 1X5DA 2F51A 3EE2A 3I43A 1TK5B 5D96A 5ECKB 2VUPA 5IMFA 4YKGA 1JZOA 3IAM2 3RAZA 1GSFA 3D22A 4F82A 3F4SA 5CNWA 3GSSA 1GSYA 1O8WA 5J4UA 1FAAA 1ILOA 1USBA 1WIKA 3IE3A 2N5FA 3M9KA 4K7NA 2XHFA 2V2GA 3ZIVA 4JE1A 3FZAA 1XG8A 2QA1A 2HXKA 3EINA 3PGTA 4KA0A 4ZBDA 3KMNA 3KP9A 3F8UA 2IN3A 1TI3A 2IPAA 4FYCA 2AHEA 3I6AA 3DWVA 3DEXA 4PUAA 3R2QA 1GTAA 2CAQA 1GTIA 1WOUA 1XWBA 4ZIJA 2O85A 3TUEA 5IMAA 3QD9A 4BPYA 2F8AA 1DE2A 3APOA 2PBJA 3QPMA 3TRPA 3TDGA 4GQFA 3NIVA 4GCIA 4G10A 5GSTA 3E3EA 5AISA 3LJRA 4FQUA 1F3BA 3GKXA 3MIXA 4IELA 2X49A 4V1Ag 2F9SA 4BVXA 3KH9A 1ML6A 2L6DA 1S3CA 2O89A 5BMUA 4IJIA 3UL3A 1B9YC 2HZFA 4IQ1A 6GSYA 1X0RA 3WGXA 3ZTLA 3D6IA 4PTSA 3F3QA 1AC1A 2WS2A 2IMDA 2ZUPA 3H1NA 3TGZA 1ERVA 4GTUA 1GL8A 3UJ1A 4TKYA 4LA1A 1V2AA 4KB3A 3I69A 1SL0B 2MMOA 3IRAA 1FB0A 2PUKC 4K8MA 5F0GA 4KDXA 4NXIA 3ZVJD 1Z7RA 3UVTA 4V1Ap 4O32A 4TR4A 2GSQA 2GSRA 2VCXA 2PGTA 2GQKA 3N9JA 1DE1A 3GSTA 5G1LA 2HI7A 2C8UA 1U88A 3M9JA 2H72A 1TXXA 1SJ6A 3FK8A 1YF1A 1EWXA 2VCVA 5DJLA 2GS3A 2PN8A 2R0PA 4GRFA 2C1YA 3F9UA 4NPBA 4FYBA 4HUAA 3IR4A 4HS1A 2NTOA 2PERA 3DVWA 3FRCA 1B4QA 1G7EA 1JZWA 20GSA 3P8WA 4PQIA 2ALBA 1MDKA 4BWQA 3DGQA 4N10A 3EPTA 4TR0A 2RM5A 3ZZXA 1TW9A 5D9WA 4BWSA 4I2UA 4HEA2 3EU3A 1PN0A 4F03A 3SBCA 2QC7A 3KGKA 1BQ7A 4ISDA 1XPVA 1M3IA 5HFIA 4BVXB 4JR6A 1V98A 5HR0A 3UEMA 2FWHA 3K8NA 3N5OA 3TKRA 22GSA 5G5EA 12GSA 1OC8A 3GYKA 1B48A 1WE0A 3L78A 2OE0A 5AIXA 2DJJA 2CX4A 3LG6A 3GKKA 1YEXA 4O5UA 3M3MA 2B6MA 3VWVA 3KP8A 2KUCA 2VCQA 1U3AA 3VWXA 3WYWA 1LU4A 3CQFA 5DBQA 4FH8A 4K0NA 5EVOA 3HVSA 4MK3A 3KH7A 1TP9A 2CZ3A 1GUMA 2IMEA 2KOKA 4EE0A 2H30A 2R4VA 3RHCA 4Q5NA 2X8HA 3HKRA 1JHBA 11GSA 1WMJA 4ZXGA 2O87A 2X4AA 1YQ1A 4LMVA 3LEFA 5IMZA 4K0GA 4KSMA 2FHEA 4AJ6A 2HRAA 3TRQA 13GSA 2K18A 3GX8A 4DVCA 1K3OA 1R5AA 3HDCA 5F8BA 2O7KA 4YH2A 1S3AA 2R5GA 5INYA 3TOTA 2LUSA 5LD0A 4OO4A 2H01A 1EP7A 2JSZA 1O73A 5JCUA 5IOXA 4BL7A 1GTUA 1R7HA 1X9SB 1B8XA 4K7IA 5CREA 3VLNA 5GSSA 4ZB6A 3D4TA 1EEJA 5ABRA 3BJ5A 4HDEA 1XCCA 1ZZYA 5G31A 2VLUA 2DLXA 1CQGA 4GXZA 1HQOA 2YZHA 2LQQA 2DJKA 2G2QA 4WKWA 3A5IA 3GHAA 1EEMA 1GUKA 2OBIA 2CA8A 2C3QA 14GSA 2B5YA 4MJCA 1T3BA 2V6OA 3F6FA 4G0LA 2ON7A 1SD9A 1B9XC 3TKSC 1M0UA 2DC5A 3TJJA 2GZYA 4NV5A 1SKRB 1QMVA 4Z2UA 4F9ZA 5G1KA 3LW9A 2TIRA 2B7JA 4XIHA 1GH2A 1O6JA 3GUSA 19GSA 4YAVA 5GAND 1OAZA 1XOBA 2VCWA 2H66A 2RIIA 1FHEA 1T00A 2L59A 3PH9A 3GNJA 5ECQB 3J7Yb 2REMA 4TVEA 1VRSD 5F05A 2JZTA 4ZL8A 2YWMA 4RI6A 5E4WA 1GNEA 4PUFC 2VCZA 4XS4A 9GSSA 5JWQB 1HNAA 1YF0A 1EV4A 3LYKA 2P5QA 5C04A 4POBA 5DQSA 2FWGA 2LV3A 3GTUA 3DD3A 1QUWA 4KDUA 1VF1A 3TKSA 1AQVA 3UBKA 3CSIA 3GV1A 4EXJA 4BL7B 2H6ZA 3V1WA 5J9BA 1XXUA 3Q18A 1FO5A 3H4KA 2BTOT 1TDIA 5G2ZA 3AY8A 1M3JA 3WD6A 2R0CA 5DALA 5B7CA 1XWAA 3FZ9A 3M0FA 2BMXA 2HFDA 1O81A 2GZZA 2HRNA 3BCIA 1NSWA 3EU4A 2R0GA 3DKSA 3H93A 2H70A 2YANA 1Z9HA 2OJLA 1KNGA 2VOCA 2XBIA 3GKNA 1JLVA 4WBRD 4G0IA 1X5CA 3HYPA 4AGSA 2KHPA 3MAKA 2HT9A 2JU5A 18GSA 5FHIA 3QFAC
chains in the Genus database with same CATH topology
5H5SA 4EF0A 2CAIA 3QDNA 4IHUA 4NHZA 1K3YA 2V41A 3W6GA 2H0HA 1ZCPA 2VM2A 3H8QA 3VI7A 1BEDA 5B6MA 1EOGA 3QAVA 1OE8A 3EVIA 5ID2A 2P0GA 2G0FA 4EC0A 3LYPA 4CW9A 5IO0A 4TR3A 4MMMA 4K7OA 4TRXA 5JWOB 4XS4B 4MCUA 3APQA 1ZYEA 4LL1B 5D9TA 1OC9A 1OVNA 1F3AA 1XVQA 3GTUB 1R4WA 2CX3A 2H76A 3C1RA 2YNXA 5CRDA 3VI5A 2CZ2A 4MLYA 7GSSA 1GTBA 4O5QA 2K8VA 4IP6A 2BJXA 4HOJA 3GIXA 2JSYA 2A4VA 2AYTA 2E7PA 3ERGA 6GSVA 4X0XA 2YWOA 1NM3A 3TOUA 5ENUA 2X8CA 2VO4A 3FW2A 4OMVA 5B6NA 4CDOA 2LJAA 3RPPA 3L9UA 3ED3A 2X99A 2PPTA 3HCZA 1QQ2A 1PD21 5L71A 4TXOA 3GURA 4WXTA 4MPGA 1W89A 4ICYA 4KNDA 3ERWA 1NHYA 3RBTA 3ZFBA 3KMOA 4JU5A 1R26A 5ECIB 1M99A 1A8LA 3LGCA 1ZYQB 4X4JA 1PRXA 4K5SA 3C7MA 4K5RA 3O6TA 4IKHA 1YEPA 3DXBA 2OACA 2E0QA 5EL8A 5JCWA 1BAYA 2YOIA 1JFUA 4K9ZA 4ZL7A 1SK2A 4AJ8A 3F4RA 3D0ZA 3G7YA 3KEBA 1ERUA 4JRRA 4IJ3A 4WEYA 2YV7A 2WDUA 1N2AA 4KSOA 1ERTA 5ID2B 2B1KA 4MH2A 1IYHA 3UOMA 1K0DA 1EP8A 1EGRA 2LQOA 1GNWA 2FWFA 1ZYNA 1Z3EA 3TCOA 4ECIA 5IQYA 4MF5A 4WR4A 1UA5A 1THOA 4ZBBA 3CMIA 1URMA 4YAPA 3DVXA 3Q6OA 3A2WA 4A5PA 1SJIA 2H1GA 4I97A 5DVBA 2MMAA 4IP1A 2WJUA 3LXTA 2AB6A 5AGYA 3FZ5A 3IBHA 1VGLA 4L0UA 1TOFA 4NAXA 1AQXA 2N5BA 5IPHA 1B4PA 1BX9A 3HVVA 1PX6A 3RHBA 1TRUA 3P7XA 5A5KA 1MD3A 1UVZA 4Q5QA 3MDKA 3VURA 3LSZA 3HJMA 5IMCA 3EMXA 4J2FA 4JEDA 4FIWA 2RLIA 2XPDA 3P90A 1DUGA 2KP1A 2UZ8A 1K0OA 1SL1B 2R2JA 1RK4A 4PNGA 3E0UA 4XTSA 2YWNA 3VPTA 3TKSE 3Q74A 4TXOB 3CSJA 4ML6A 2YJHA 1WJKA 4OWYA 1SKSB 2WRTA 3KJYA 4L5LA 4P3YB 4HU7A 1GRXA 1WPIA 2IWTA 2NDOA 2Z9SA 1M9BA 4K2DA 1K0NA 4WR5A 1K3LA 4MPFA 1H75A 4IVFA 4Q5FA 3DYRA 3GN3A 1FVKA 4V2LA 5FT3A 5KEJA 4MJBA 3FHKA 2B7KA 4YQUA 5H5QA 1PKWA 4IS0A 3F4TA 3P2AA 4KCEA 2DMLA 3IV4A 4NWYA 3ZIJA 1XWKA 2MYGA 1S3DA 1QFNA 1V9WA 5GAPD 1XIYA 2XC2A 2FY6A 2M80A 1XW6A 1YKCA 4G9HA 3EURA 1YZXA 6GSTA 3LXZA 1OE7A 4GQCA 4HJ2A 3IHGA 2MBSA 1EOHA 2DIYA 4KCAA 4EUYA 4MABA 1BJXA 1T4YA 2H1DA 2HRFA 1N8JA 2CQ9A 3C71A 1A24A 1AQWA 1F2EA 1X5EA 4MNNA 2J23A 3ZMLA 1VF3A 2H1BA 2LRTA 1G6YA 3ZL5A 5D9XA 5EPFA 3U6VA 4XRAA 5G30A 1E2YA 2AUVA 5CRWA 3LORA 4ZB9A 3KZQA 2L5LA 5HR1A 4PNFA 5ECRB 4OFNA 1LJRA 3EMPA 2FLSA 1QGVA 2WB9A 3HJOA 2HSMA 1PX7A 3E9JB 3HY2A 1OKTA 2IJYA 5IPGA 2VAFA 2GVPA 1VF4A 4KGIA 4LL4B 2C3NA 4EVMA 2AJQB 2DMMA 1PL2A 1FOVA 2E2MA 1M9AA 4BVYA 2ZNMA 2B3SA 3Q19A 3O76A 1ZYPA 5G5FA 5HQPA 1SK0A 2NPBA 2KP2A 3G7JA 4ECJA 2HSYA 3QAWA 2HRKA 5KOXA 3L0HA 4NV2A 5KN3A 4JR4A 3EYTA 1JZDA 2H0IA 2H19A 2PMTA 3CBUA 4OCEA 3FKFA 1SD8A 4RUVA 2L6CA 3C1SA 5J9CA 4IQAA 2DIZA 1QXHA 2R3XA 1WRYA 2GZPA 5KOWA 1FVJA 2EC4A 16GSA 2KLXA 1FW1A 2C0GA 1UN2A 4F2IA 4LLRA 3IA1A 4XRDA 4GF0A 2LS5A 4ZBAA 5A4VA 3KXOA 4QL7A 5ECOB 4KE3A 1DBYA 1M2BA 3DIEA 5CYYA 1SKWB 3G9BA 1PGTA 1DSBA 4IBPA 1AIUA 4GLTA 3L9SA 1TU7A 1JLWA 4Z2RA 4TN8A 3PPUA 2I4AA 3ZITA 3DRNA 4OD7A 5AN1A 1YDKA 2H71A 2QA2A 2R37A 3LQ7A 4HI7A 3UVHA 2NBSA 1XOAA 5ELGA 1TK0B 1A2MA 3KIJA 4IN0A 2B5EA 2IL3A 5ECSA 2GT5A 2C4JA 4K1FA 4GWRA 1LBKA 6GSUA 2GQMA 4J57E 2JZSA 2YP6A 3US3A 4I2TA 5D73A 4USSA 5JWRB 2IFQA 4EDYA 4E8HA 1T7PB 3VWWA 4BVYB 2XPEA 3LFLA 2HYXA 1ZOFA 2AAWA 3FEUA 4HJMA 2RM6A 3TJBA 1XWGA 5J41A 2ON5A 4JZQA 4L0WA 1FOHA 4DEJA 2GT6A 1PQNA 1C72A 4D73A 3NZNA 1F6MC 3FR6A 3APSA 3ZYWA 4I5QA 4NMUA 4ML1A 2LNTA 1PKZA 1ST9A 3GFKA 2VCTA 2FWEA 5KN0A 2WGRA 1ZL9A 3VWUA 3CTGA 1TRWA 1E6BA 5LNKe 3EWLA 2V6KA 2F3MA 2OADA 2GSSA 2LTKA 3VFIA 1A2LA 2ES7A 1YKAA 2GSTA 1OKDA 3GH6A 5LCZA 2J9HA 2MZCA 2PVOC 4LMWA 2H1AA 1KTEA 3F3RA 5IMVA 2IIYA 4MA9A 3TRXA 1EGOA 3CXGA 1QK8A 1V57A 2CVDA 2E2GA 4EIPA 4RQXA 1XZOA 3IPZA 1A23A 2HNLA 2C80A 3ZREA 3HXSA 2VM1A 5DJMA 2ZCTA 2C0FA 4EKZA 1TK8B 2LJRA 4ULXA 3I9V2 4ID0A 3QR6A 2A2SA 5IIZA 5DALB 2JACA 2M72A 2OE1A 1HYUA 4XCSA 2F8FA 3BBYA 2CVBA 2GQLA 2DSAA 3TJFA 2IFQB 2CT6A 6GSWA 5CRHA 2QSIA 3GH9A 4G19A 1MDJA 5AIVA 2HZEA 2FUG2 3UMAA 2M46A 2HSHA 4POKA 4POMA 4PXOA 4XS1A 2L4QA 4HZ2A 2IMIA 3FR3A 5IM9A 2LRNA 1ABAA 3GRXA 1ON4A 2V32A 3IOSA 3ZLPA 4D73B 4PQHA 1Z6MA 3IK7A 3KTBA 3J7Yk 1NHOA 1A0FA 4DSQA 1ACVA 4XHMA 5JCGA 3JCML 2PVQA 1GWCA 5GZZB 1K0CA 1GLPA 1GUHA 5ECMB 4POLA 3L4NA 4KDYA 2JADA 5KN2A 4ZB8A 3A2VA 4YQMA 2DKHA 2H6YA 1SENA 1GLQA 1GSSA 2EIOA 2VL9A 4PX1A 1RW1A 3CSHA 3OR5A 3GMFA 3ZFLA 1BG5A 2GDRA 2LJKA 3D21A 5IOWA 3UBLA 1OC9B 2DJ3A 2IMFA 5ECNB 1WWJA 3QFBC 3MNGA 3WT2A 3A2XA 2D2ZA 4TXVA 2OBKA 8GSSA 4PQ1A 2HLSA 4KH7A 3M8NA 4MF6A 4GSNA 4DSSA 2WCIA 1GSDA 5DAKA 4F0CA 3HA9A 3QCPA 2A4HA 5B8AA 1F9MA 3GA4A 5FWGA 2DJ1A 1O8XA 1O7UA 4WF5A 3MSZA 2YN1A 3EC3A 4QL9A 4X1UA 4GSTA 2LRCA 4DSRA 1U6TA 1UC7A 2HZEB 2L57A 2YWIA 1MTCA 1TU8A 5D93A 2GGTA 1EV9A 2WZ9A 3FYGA 1PSQA 5J5NA 4E8EA 2RUEA 3VK9A 1M7TA 4MZBA 5CAXA 1Y6EA 4TR1A 3WGDA 2EIRA 3BCKA 2TRXA 2P31A 1Y25A 1EZKA 4F0BA 4ILFA 3HJPA 3W8SA 4N11A 1YY7A 4EDZA 3KCMA 4EL1A 1TTZA 2OA7A 2AV4A 4GSSA 10GSA 2OE3A 2PWJA 4FYUA 1H4OA 4J56E 3HHVA 2FCHA 1ZGNA 5F06A 2K6VA 2A2RA 3HZ8A 3S9FA 2HE3A 2X64A 1T1VA 5DDLA 5ECLB 5BRTA 4RI7A 4ZL9A 2LKUA 1Z6NA 3PINA 3ZMKA 4CHSA 2H6XA 1SK1A 2LEGA 3VPQA 1IYIA 4IW9A 1GP1A 1PN9A 1G6WA 1U87A 1TI1A 2H75A 1HD2A 2VD0A 1M2AA 1PL1A 3FMWA 2H74A 3FZ4A 4DSSB 3ISOA 4OCFA 3WGEA 1OC3A 4HQSA 3ME8A 5DAKB 2LNSA 4KW6A 4CY6A 4WF4A 2WFCA 3KM6A 3F63A 2C0EA 3ZRDA 4MF7A 5CP1A 2JZRA 4KX4A 5B8BA 2VIMA 5COHA 1XW5A 4PURA 3IC8A 2B1LA 1V40A 4I8BA 1J0FA 3CTFA 4MP4A 1CQHA 3H79A 2IMKA 3TKPA 2I1UA 2VL2C 4OFTA 1THXA 2FNOA 4TR1B 1OYJA 1SJZA 1SYRA 4HU9A 1Z7PA 1R5PA 6GSSA 2MBTA 4BA7A 1HNCA 1X9MB 1A8YA 4MJAA 2V1MA 3IC4A 1NW2A 4MH3A 3ERFA 1SL2B 3GL5A 2DBCA 4OO5A 3HZ4A 1AUCA 4YQVA 3CRUA 1ERWA 3UARA 3SWLA 3L9VA 5HR2A 3FR9A 4N0ZA 2VLTA 3WT1A 1GSEA 4QQ7A 4AF2A 3IXRA 3M1GA 1Q98A 3MWHA 5IO2A 2GTUA 2WULA 1PMTA 3IDVA 4OFMA 5HFKA 4Z7XA 1TKDB 4O92A 1JZRA 2H73A 5A4UA 2XBQA 3MYDA 4MJEA 1GSUA 3GKMA 4ACSA 4K6XA 3KD0A 1T4ZA 5J3RA 3RPNA 1W4VA 3TJKA 2VL2A 4L8EA 3IK9A 1YJ6A 4HZ4A 5A4WA 1V58A 5D8IA 5ELAA 4G2EA 1AW9A 2A2PA 4H86A 2MMNA 1K0BA 2X8GA 1U3IA 2L4CA 5C00A 2FA4A 4PGTA 4I6XA 3CRTA 1SYXA 3BOAA 2PU9C 1XW9A 1KEBA 2GLRA 5KN1A 5HR3A 3QAGA 5IMDA 3F0IA 6GSXA 4KF9A 5E59A 1I9DA 3QOUA 4N0VA 3CYNA 1XBSA 1X9WB 1AAZA 2LSTA 2MMZA 2FD3A 4V2MA 1I5GA 4EIQA 3QMXA 1K0AA 3ZVJA 2YPMA 2K9FA 3A5WA 4O7HA 2B5XA 1KBNA 3C8EA 4G0KA 3KTLA 4KAEA 2P5RA 1TRVA 4TW5A 2L5OA 3A3TA 1MDIA 3BD2A 3UIWA 1RQMA 4TOPA 3LWAA 1PA3A 3HVXA 4K2XA 1T8EB 2VL3A 4CY8A 1GULA 1XVWA 3TB2A 1G0TA 2C0DA 2NVLA 1SU9A 2FGXA 1GSQA 2C3TA 3ME7A 5ECPB 3W8JA 2H8LA 3DMLA 2CVKA 4EO3A 3GL3A 2JL4A 3R3EA 2OKAA 1J9BA 3GX0A 1XWCA 4Z2TA 1AXDA 4WBJA 2DJ0A 3U5RE 2YJ7A 4WETA 5D9VA 4ZILA 4FO5A 2I81A 2TRCP 2DJ2A 1WP0A 3NOFA 4MZWA 4MDCA 4RQRA 5EY6A 3RDWA 2FA8A 5F07A 3D5JA 2QKEA 3G7IA 2RUFA 2VD1A 2N5AA 2YV9A 5ECHB 2I3YA 2O8VB 5DQYA 5H5RA 5HFGA 1G7OA 1A0RP 2DKIA 4NHWA 4V2NA 4HQZA 4KUNA 5CRGA 1Q4JA 4YKFA 4MZCA 2YCDA 2VLVA 2YZUA 2K8SA 1A2JA 1TRSA 4JBBA 4ECCA 3PR8A 2R6KA 1ZMAA 3TJGA 1Z5YE 1FB6A 1XFLA 3F6DA 1TJDA 2QGVA 4X43A 5DCHA 3IAS2 4XS6A 5DCGA 4N30A 1HNBA 1M2DA 1O85A 1K0MA 1J08A 4Q5RA 1F37A 4AJ7A 2H0GA 3C73A 1BYEA 1VF2A 3IHQA 1FG4A 4ECBA 4IGJA 2EIQA 4L5OA 3FY7A 17GSA 2I9HA 3D4MA 3HD5A 2CV4A 3TKQA 4O5RA 1MD4A 5CO3A 3O3TA 3UAPA 1MEKA 1X5DA 2F51A 3EE2A 3I43A 1TK5B 5D96A 5ECKB 2VUPA 5IMFA 4YKGA 1JZOA 3IAM2 3RAZA 1GSFA 3D22A 4F82A 3F4SA 5CNWA 3GSSA 1GSYA 1O8WA 5J4UA 1FAAA 1ILOA 1USBA 1WIKA 3IE3A 2N5FA 3M9KA 4K7NA 2XHFA 2V2GA 3ZIVA 4JE1A 3FZAA 2QA1A 2HXKA 3EINA 3PGTA 4KA0A 4ZBDA 3KMNA 3KP9A 3F8UA 2IN3A 1TI3A 2IPAA 4FYCA 2AHEA 3I6AA 3DWVA 3DEXA 4PUAA 3R2QA 1GTAA 2CAQA 1GTIA 1WOUA 1XWBA 4ZIJA 2O85A 3TUEA 5IMAA 3QD9A 4BPYA 2F8AA 1DE2A 3APOA 2PBJA 3QPMA 3TRPA 3TDGA 4GQFA 3NIVA 4GCIA 4G10A 5GSTA 3E3EA 5AISA 3LJRA 4FQUA 1F3BA 3GKXA 3MIXA 4IELA 2X49A 4V1Ag 2F9SA 4BVXA 3KH9A 1ML6A 2L6DA 1S3CA 2O89A 5BMUA 4IJIA 3UL3A 1B9YC 2HZFA 4IQ1A 6GSYA 1X0RA 3WGXA 3ZTLA 3D6IA 4PTSA 3F3QA 1AC1A 2WS2A 2IMDA 2ZUPA 3H1NA 3TGZA 1ERVA 4GTUA 1GL8A 3UJ1A 4TKYA 4LA1A 1V2AA 4KB3A 3I69A 1SL0B 2MMOA 3IRAA 1FB0A 2PUKC 4K8MA 5F0GA 4KDXA 4NXIA 3ZVJD 1Z7RA 3UVTA 4V1Ap 4O32A 4TR4A 2GSQA 2GSRA 2VCXA 2PGTA 2GQKA 3N9JA 1DE1A 3GSTA 5G1LA 2HI7A 2C8UA 1U88A 3M9JA 2H72A 1TXXA 1SJ6A 3FK8A 1YF1A 1EWXA 2VCVA 5DJLA 2GS3A 2PN8A 2R0PA 4GRFA 2C1YA 3F9UA 4NPBA 4FYBA 4HUAA 3IR4A 4HS1A 2NTOA 2PERA 3DVWA 3FRCA 1B4QA 1G7EA 1JZWA 20GSA 3P8WA 4PQIA 2ALBA 1MDKA 4BWQA 3DGQA 4N10A 3EPTA 4TR0A 2RM5A 3ZZXA 1TW9A 5D9WA 4BWSA 4I2UA 4HEA2 3EU3A 1PN0A 4F03A 3SBCA 2QC7A 3KGKA 1BQ7A 4ISDA 1XPVA 5HFIA 4BVXB 4JR6A 1V98A 5HR0A 3UEMA 2FWHA 3K8NA 3N5OA 3TKRA 22GSA 5G5EA 12GSA 1OC8A 3GYKA 1B48A 1WE0A 3L78A 2OE0A 5AIXA 2DJJA 2CX4A 3LG6A 3GKKA 1YEXA 4O5UA 3M3MA 2B6MA 3VWVA 3KP8A 2KUCA 2VCQA 1U3AA 3VWXA 3WYWA 1LU4A 5DBQA 4FH8A 4K0NA 5EVOA 3HVSA 4MK3A 3KH7A 1TP9A 2CZ3A 1GUMA 2IMEA 2KOKA 4EE0A 2H30A 2R4VA 3RHCA 4Q5NA 2X8HA 3HKRA 1JHBA 11GSA 1WMJA 4ZXGA 2O87A 2X4AA 1YQ1A 4LMVA 3LEFA 5IMZA 4K0GA 4KSMA 2FHEA 4AJ6A 2HRAA 3TRQA 13GSA 2K18A 3GX8A 4DVCA 1K3OA 1R5AA 3HDCA 5F8BA 2O7KA 4YH2A 1S3AA 2R5GA 5INYA 3TOTA 2LUSA 5LD0A 4OO4A 2H01A 1EP7A 2JSZA 1O73A 5JCUA 5IOXA 4BL7A 1GTUA 1R7HA 1X9SB 1B8XA 4K7IA 5CREA 3VLNA 5GSSA 4ZB6A 3D4TA 1EEJA 5ABRA 3BJ5A 4HDEA 1XCCA 1ZZYA 5G31A 2VLUA 2DLXA 1CQGA 4GXZA 1HQOA 2YZHA 2LQQA 2DJKA 2G2QA 4WKWA 3A5IA 3GHAA 1EEMA 1GUKA 2OBIA 2CA8A 2C3QA 14GSA 2B5YA 4MJCA 1T3BA 2V6OA 3F6FA 4G0LA 2ON7A 1SD9A 1B9XC 3TKSC 1M0UA 2DC5A 3TJJA 2GZYA 4NV5A 1SKRB 1QMVA 4Z2UA 4F9ZA 5G1KA 3LW9A 2TIRA 2B7JA 4XIHA 1GH2A 1O6JA 3GUSA 19GSA 4YAVA 5GAND 1OAZA 1XOBA 2VCWA 2H66A 2RIIA 1FHEA 1T00A 2L59A 3PH9A 3GNJA 5ECQB 3J7Yb 2REMA 4TVEA 1VRSD 5F05A 2JZTA 4ZL8A 2YWMA 4RI6A 5E4WA 1GNEA 4PUFC 2VCZA 4XS4A 9GSSA 5JWQB 1HNAA 1YF0A 1EV4A 3LYKA 2P5QA 5C04A 4POBA 5DQSA 2FWGA 2LV3A 3GTUA 3DD3A 1QUWA 4KDUA 1VF1A 3TKSA 1AQVA 3UBKA 3CSIA 3GV1A 4EXJA 4BL7B 2H6ZA 3V1WA 5J9BA 1XXUA 3Q18A 1FO5A 3H4KA 2BTOT 1TDIA 5G2ZA 3AY8A 3WD6A 2R0CA 5DALA 5B7CA 1XWAA 3FZ9A 3M0FA 2BMXA 2HFDA 1O81A 2GZZA 2HRNA 3BCIA 1NSWA 3EU4A 2R0GA 3DKSA 3H93A 2H70A 2YANA 1Z9HA 2OJLA 1KNGA 2VOCA 2XBIA 3GKNA 1JLVA 4WBRD 4G0IA 1X5CA 3HYPA 4AGSA 2KHPA 3MAKA 2HT9A 2JU5A 18GSA 5FHIA 3QFAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H5S A;  4EF0 A;  2CAI A;  3QDN A;  4IHU A;  4NHZ A;  1K3Y A;  2V41 A;  3W6G A;  2H0H A;  1ZCP A;  2VM2 A;  3H8Q A;  3VI7 A;  1BED A;  5B6M A;  1EOG A;  3QAV A;  1OE8 A;  3EVI A;  5ID2 A;  2P0G A;  2G0F A;  4EC0 A;  3LYP A;  4CW9 A;  5IO0 A;  4TR3 A;  4MMM A;  4K7O A;  4TRX A;  5JWO B;  4XS4 B;  4MCU A;  3APQ A;  1ZYE A;  4LL1 B;  5D9T A;  1OC9 A;  1OVN A;  1F3A A;  1XVQ A;  3GTU B;  1R4W A;  2CX3 A;  2H76 A;  3C1R A;  2YNX A;  5CRD A;  3VI5 A;  2CZ2 A;  4MLY A;  7GSS A;  1GTB A;  2K8V A;  4IP6 A;  2BJX A;  4HOJ A;  3GIX A;  2JSY A;  2A4V A;  2AYT A;  2E7P A;  3ERG A;  6GSV A;  4X0X A;  2YWO A;  1NM3 A;  3TOU A;  5ENU A;  2X8C A;  2VO4 A;  3FW2 A;  4OMV A;  5B6N A;  4CDO A;  2LJA A;  3RPP A;  3L9U A;  3ED3 A;  2X99 A;  2PPT A;  3HCZ A;  1QQ2 A;  1PD2 1;  5L71 A;  4TXO A;  3GUR A;  4WXT A;  4MPG A;  1W89 A;  4KND A;  3ERW A;  1NHY A;  3RBT A;  3ZFB A;  3KMO A;  4JU5 A;  1R26 A;  5ECI B;  1M99 A;  1A8L A;  3LGC A;  1ZYQ B;  1PRX A;  3C7M A;  3O6T A;  4IKH A;  1YEP A;  3DXB A;  2OAC A;  2E0Q A;  5EL8 A;  5JCW A;  1BAY A;  2YOI A;  1JFU A;  4K9Z A;  4ZL7 A;  1SK2 A;  4AJ8 A;  3F4R A;  3D0Z A;  3G7Y A;  3KEB A;  1ERU A;  4JRR A;  4IJ3 A;  4WEY A;  2YV7 A;  2WDU A;  1N2A A;  4KSO A;  1ERT A;  5ID2 B;  2B1K A;  4MH2 A;  1IYH A;  3UOM A;  1K0D A;  1EP8 A;  1EGR A;  2LQO A;  1GNW A;  2FWF A;  1Z3E A;  3TCO A;  4ECI A;  5IQY A;  4MF5 A;  4WR4 A;  1UA5 A;  1THO A;  4ZBB A;  3CMI A;  1URM A;  4YAP A;  3DVX A;  3Q6O A;  3A2W A;  1SJI A;  2H1G A;  4I97 A;  5DVB A;  2MMA A;  4IP1 A;  2WJU A;  3LXT A;  2AB6 A;  5AGY A;  3FZ5 A;  3IBH A;  1VGL A;  4L0U A;  1TOF A;  4NAX A;  1AQX A;  2N5B A;  5IPH A;  1B4P A;  1BX9 A;  3HVV A;  1PX6 A;  3RHB A;  1TRU A;  3P7X A;  5A5K A;  1MD3 A;  1UVZ A;  4Q5Q A;  3MDK A;  3VUR A;  3LSZ A;  3HJM A;  5IMC A;  3EMX A;  4J2F A;  4JED A;  4FIW A;  2RLI A;  2XPD A;  3P90 A;  1DUG A;  2KP1 A;  1K0O A;  1SL1 B;  2R2J A;  1RK4 A;  4PNG A;  3E0U A;  4XTS A;  2YWN A;  3VPT A;  3TKS E;  3Q74 A;  4TXO B;  3CSJ A;  4ML6 A;  2YJH A;  1WJK A;  4OWY A;  1SKS B;  2WRT A;  3KJY A;  4L5L A;  4P3Y B;  4HU7 A;  1GRX A;  1WPI A;  2IWT A;  2NDO A;  2Z9S A;  1M9B A;  4K2D A;  1K0N A;  4WR5 A;  1K3L A;  4MPF A;  1H75 A;  4IVF A;  4Q5F A;  3DYR A;  3GN3 A;  1FVK A;  4V2L A;  5FT3 A;  5KEJ A;  4MJB A;  3FHK A;  2B7K A;  4YQU A;  5H5Q A;  1PKW A;  4IS0 A;  3F4T A;  3P2A A;  4KCE A;  2DML A;  3IV4 A;  4NWY A;  3ZIJ A;  1XWK A;  2MYG A;  1S3D A;  1QFN A;  1V9W A;  5GAP D;  1XIY A;  2XC2 A;  2FY6 A;  2M80 A;  1XW6 A;  1YKC A;  4G9H A;  3EUR A;  1YZX A;  6GST A;  3LXZ A;  1OE7 A;  4GQC A;  4HJ2 A;  2MBS A;  1EOH A;  2DIY A;  4KCA A;  4EUY A;  4MAB A;  1BJX A;  1T4Y A;  2H1D A;  2HRF A;  1N8J A;  2CQ9 A;  3C71 A;  1A24 A;  1AQW A;  1F2E A;  1X5E A;  2J23 A;  3ZML A;  1VF3 A;  2H1B A;  2LRT A;  1G6Y A;  3ZL5 A;  5D9X A;  5EPF A;  3U6V A;  4XRA A;  5G30 A;  1E2Y A;  2AUV A;  5CRW A;  3LOR A;  4ZB9 A;  3KZQ A;  2L5L A;  5HR1 A;  4PNF A;  5ECR B;  4OFN A;  1LJR A;  3EMP A;  2FLS A;  1QGV A;  2WB9 A;  3HJO A;  1PX7 A;  3E9J B;  3HY2 A;  1OKT A;  2IJY A;  5IPG A;  2VAF A;  2GVP A;  1VF4 A;  4KGI A;  4LL4 B;  2C3N A;  4EVM A;  2AJQ B;  2DMM A;  1PL2 A;  1FOV A;  2E2M A;  1M9A A;  4BVY A;  2ZNM A;  2B3S A;  3Q19 A;  3O76 A;  5G5F A;  5HQP A;  1SK0 A;  2NPB A;  2KP2 A;  3G7J A;  4ECJ A;  2HSY A;  3QAW A;  3L0H A;  4NV2 A;  5KN3 A;  4JR4 A;  3EYT A;  1JZD A;  2H0I A;  2H19 A;  2PMT A;  3CBU A;  4OCE A;  3FKF A;  1SD8 A;  4RUV A;  2L6C A;  3C1S A;  5J9C A;  4IQA A;  2DIZ A;  1QXH A;  2R3X A;  1WRY A;  2GZP A;  1FVJ A;  2EC4 A;  16GS A;  2KLX A;  1FW1 A;  2C0G A;  1UN2 A;  4F2I A;  4LLR A;  3IA1 A;  4XRD A;  4GF0 A;  2LS5 A;  4ZBA A;  5A4V A;  3KXO A;  4QL7 A;  5ECO B;  4KE3 A;  1DBY A;  1M2B A;  3DIE A;  5CYY A;  1SKW B;  3G9B A;  1PGT A;  1DSB A;  4IBP A;  1AIU A;  4GLT A;  3L9S A;  1TU7 A;  1JLW A;  4TN8 A;  2I4A A;  3ZIT A;  3DRN A;  4OD7 A;  5AN1 A;  1YDK A;  2H71 A;  2R37 A;  3LQ7 A;  4HI7 A;  3UVH A;  2NBS A;  1XOA A;  5ELG A;  1TK0 B;  1A2M A;  3KIJ A;  4IN0 A;  2B5E A;  2IL3 A;  5ECS A;  2GT5 A;  2C4J A;  4K1F A;  4GWR A;  1LBK A;  6GSU A;  2GQM A;  4J57 E;  2JZS A;  2YP6 A;  3US3 A;  4I2T A;  5D73 A;  5JWR B;  2IFQ A;  4EDY A;  4E8H A;  1T7P B;  3VWW A;  2XPE A;  3LFL A;  2HYX A;  1ZOF A;  2AAW A;  3FEU A;  4HJM A;  2RM6 A;  3TJB A;  1XWG A;  5J41 A;  2ON5 A;  4JZQ A;  4L0W A;  4DEJ A;  2GT6 A;  1PQN A;  1C72 A;  4D73 A;  3NZN A;  1F6M C;  3FR6 A;  3APS A;  3ZYW A;  4I5Q A;  4NMU A;  4ML1 A;  2LNT A;  1PKZ A;  1ST9 A;  3GFK A;  2VCT A;  2FWE A;  5KN0 A;  2WGR A;  1ZL9 A;  3VWU A;  3CTG A;  1TRW A;  1E6B A;  5LNK e;  3EWL A;  2V6K A;  2F3M A;  2OAD A;  2GSS A;  2LTK A;  3VFI A;  1A2L A;  2ES7 A;  1YKA A;  2GST A;  1OKD A;  3GH6 A;  5LCZ A;  2J9H A;  2MZC A;  2PVO C;  4LMW A;  2H1A A;  1KTE A;  3F3R A;  5IMV A;  2IIY A;  4MA9 A;  3TRX A;  1EGO A;  3CXG A;  1QK8 A;  1V57 A;  2CVD A;  2E2G A;  4RQX A;  1XZO A;  3IPZ A;  1A23 A;  2HNL A;  2C80 A;  3ZRE A;  3HXS A;  2VM1 A;  5DJM A;  2ZCT A;  2C0F A;  4EKZ A;  1TK8 B;  2LJR A;  4ULX A;  3I9V 2;  4ID0 A;  3QR6 A;  2A2S A;  5IIZ A;  5DAL B;  2JAC A;  2M72 A;  2OE1 A;  1HYU A;  4XCS A;  2F8F A;  3BBY A;  2CVB A;  2GQL A;  2DSA A;  3TJF A;  2IFQ B;  2CT6 A;  6GSW A;  5CRH A;  2QSI A;  3GH9 A;  4G19 A;  1MDJ A;  5AIV A;  2HZE A;  2FUG 2;  3UMA A;  2M46 A;  2HSH A;  4POK A;  4POM A;  4PXO A;  4XS1 A;  2L4Q A;  4HZ2 A;  2IMI A;  3FR3 A;  5IM9 A;  2LRN A;  1ABA A;  3GRX A;  1ON4 A;  2V32 A;  3IOS A;  3ZLP A;  4D73 B;  4PQH A;  1Z6M A;  3IK7 A;  3KTB A;  3J7Y k;  1NHO A;  1A0F A;  4DSQ A;  1ACV A;  4XHM A;  5JCG A;  3JCM L;  2PVQ A;  1GWC A;  5GZZ B;  1K0C A;  1GLP A;  1GUH A;  5ECM B;  4POL A;  3L4N A;  4KDY A;  2JAD A;  5KN2 A;  4ZB8 A;  3A2V A;  4YQM A;  2H6Y A;  1SEN A;  1GLQ A;  1GSS A;  2EIO A;  2VL9 A;  4PX1 A;  1RW1 A;  3CSH A;  3OR5 A;  3GMF A;  3ZFL A;  1BG5 A;  2GDR A;  2LJK A;  3D21 A;  5IOW A;  3UBL A;  1OC9 B;  2DJ3 A;  2IMF A;  5ECN B;  1WWJ A;  3QFB C;  3MNG A;  3WT2 A;  3A2X A;  2D2Z A;  4TXV A;  2OBK A;  8GSS A;  4PQ1 A;  2HLS A;  4KH7 A;  3M8N A;  4MF6 A;  4GSN A;  4DSS A;  2WCI A;  1GSD A;  5DAK A;  4F0C A;  3HA9 A;  3QCP A;  5B8A A;  1F9M A;  3GA4 A;  5FWG A;  2DJ1 A;  1O8X A;  1O7U A;  4WF5 A;  3MSZ A;  2YN1 A;  3EC3 A;  4QL9 A;  4X1U A;  4GST A;  2LRC A;  4DSR A;  1U6T A;  1UC7 A;  2HZE B;  2L57 A;  2YWI A;  1MTC A;  1TU8 A;  5D93 A;  2GGT A;  1EV9 A;  2WZ9 A;  3FYG A;  1PSQ A;  5J5N A;  4E8E A;  2RUE A;  3VK9 A;  1M7T A;  4MZB A;  5CAX A;  1Y6E A;  4TR1 A;  3WGD A;  2EIR A;  3BCK A;  2TRX A;  2P31 A;  1Y25 A;  1EZK A;  4F0B A;  4ILF A;  3HJP A;  3W8S A;  4N11 A;  1YY7 A;  4EDZ A;  3KCM A;  4EL1 A;  1TTZ A;  2OA7 A;  2AV4 A;  4GSS A;  10GS A;  2OE3 A;  2PWJ A;  4FYU A;  1H4O A;  4J56 E;  3HHV A;  2FCH A;  1ZGN A;  5F06 A;  2K6V A;  2A2R A;  3HZ8 A;  3S9F A;  2HE3 A;  2X64 A;  1T1V A;  5DDL A;  5ECL B;  4RI7 A;  4ZL9 A;  2LKU A;  1Z6N A;  3PIN A;  3ZMK A;  4CHS A;  2H6X A;  1SK1 A;  2LEG A;  3VPQ A;  1IYI A;  4IW9 A;  1GP1 A;  1PN9 A;  1G6W A;  1U87 A;  1TI1 A;  2H75 A;  1HD2 A;  2VD0 A;  1M2A A;  1PL1 A;  2H74 A;  3FZ4 A;  4DSS B;  3ISO A;  4OCF A;  3WGE A;  1OC3 A;  4HQS A;  3ME8 A;  5DAK B;  2LNS A;  4KW6 A;  4WF4 A;  2WFC A;  3KM6 A;  3F63 A;  2C0E A;  3ZRD A;  4MF7 A;  5CP1 A;  2JZR A;  4KX4 A;  5B8B A;  2VIM A;  5COH A;  1XW5 A;  4PUR A;  2B1L A;  1V40 A;  4I8B A;  1J0F A;  3CTF A;  4MP4 A;  1CQH A;  3H79 A;  2IMK A;  3TKP A;  2I1U A;  2VL2 C;  4OFT A;  1THX A;  2FNO A;  4TR1 B;  1OYJ A;  1SJZ A;  1SYR A;  4HU9 A;  1Z7P A;  1R5P A;  6GSS A;  2MBT A;  4BA7 A;  1HNC A;  1X9M B;  1A8Y A;  4MJA A;  2V1M A;  3IC4 A;  1NW2 A;  4MH3 A;  3ERF A;  1SL2 B;  3GL5 A;  2DBC A;  4OO5 A;  3HZ4 A;  1AUC A;  4YQV A;  3CRU A;  1ERW A;  3UAR A;  3SWL A;  3L9V A;  5HR2 A;  3FR9 A;  4N0Z A;  2VLT A;  3WT1 A;  1GSE A;  4QQ7 A;  4AF2 A;  3IXR A;  3M1G A;  1Q98 A;  3MWH A;  5IO2 A;  2GTU A;  2WUL A;  1PMT A;  3IDV A;  4OFM A;  5HFK A;  4Z7X A;  1TKD B;  4O92 A;  1JZR A;  2H73 A;  5A4U A;  2XBQ A;  4MJE A;  1GSU A;  3GKM A;  4ACS A;  4K6X A;  3KD0 A;  1T4Z A;  5J3R A;  3RPN A;  1W4V A;  3TJK A;  2VL2 A;  4L8E A;  3IK9 A;  1YJ6 A;  4HZ4 A;  5A4W A;  1V58 A;  5D8I A;  5ELA A;  4G2E A;  1AW9 A;  4H86 A;  2MMN A;  1K0B A;  2X8G A;  1U3I A;  2L4C A;  5C00 A;  2FA4 A;  4PGT A;  4I6X A;  3CRT A;  1SYX A;  3BOA A;  2PU9 C;  1XW9 A;  1KEB A;  2GLR A;  5KN1 A;  5HR3 A;  3QAG A;  5IMD A;  3F0I A;  6GSX A;  5E59 A;  1I9D A;  3QOU A;  4N0V A;  3CYN A;  1XBS A;  1X9W B;  1AAZ A;  2LST A;  2MMZ A;  2FD3 A;  4V2M A;  1I5G A;  3QMX A;  1K0A A;  3ZVJ A;  2YPM A;  2K9F A;  3A5W A;  4O7H A;  2B5X A;  1KBN A;  3C8E A;  3KTL A;  4KAE A;  2P5R A;  1TRV A;  4TW5 A;  2L5O A;  3A3T A;  1MDI A;  3BD2 A;  3UIW A;  1RQM A;  4TOP A;  3LWA A;  1PA3 A;  3HVX A;  1T8E B;  2VL3 A;  1GUL A;  1XVW A;  3TB2 A;  1G0T A;  2C0D A;  2NVL A;  1SU9 A;  2FGX A;  1GSQ A;  2C3T A;  3ME7 A;  5ECP B;  3W8J A;  2H8L A;  3DML A;  2CVK A;  4EO3 A;  3GL3 A;  2JL4 A;  2OKA A;  1J9B A;  3GX0 A;  1XWC A;  1AXD A;  4WBJ A;  2DJ0 A;  3U5R E;  2YJ7 A;  4WET A;  5D9V A;  4ZIL A;  4FO5 A;  2I81 A;  2TRC P;  2DJ2 A;  1WP0 A;  3NOF A;  4MZW A;  4MDC A;  4RQR A;  5EY6 A;  3RDW A;  2FA8 A;  5F07 A;  3D5J A;  2QKE A;  3G7I A;  2RUF A;  2VD1 A;  2N5A A;  2YV9 A;  5ECH B;  2I3Y A;  2O8V B;  5DQY A;  5H5R A;  5HFG A;  1G7O A;  1A0R P;  4NHW A;  4V2N A;  4HQZ A;  4KUN A;  5CRG A;  1Q4J A;  4MZC A;  2YCD A;  2VLV A;  2YZU A;  2K8S A;  1A2J A;  1TRS A;  4JBB A;  4ECC A;  3PR8 A;  2R6K A;  1ZMA A;  3TJG A;  1Z5Y E;  1FB6 A;  1XFL A;  3F6D A;  1TJD A;  2QGV A;  4X43 A;  5DCH A;  3IAS 2;  4XS6 A;  5DCG A;  4N30 A;  1HNB A;  1M2D A;  1O85 A;  1K0M A;  1J08 A;  4Q5R A;  1F37 A;  4AJ7 A;  2H0G A;  3C73 A;  1BYE A;  1VF2 A;  3IHQ A;  1FG4 A;  4ECB A;  4IGJ A;  2EIQ A;  4L5O A;  3FY7 A;  17GS A;  2I9H A;  3D4M A;  3HD5 A;  2CV4 A;  3TKQ A;  4O5R A;  1MD4 A;  5CO3 A;  3O3T A;  3UAP A;  1MEK A;  1X5D A;  2F51 A;  3EE2 A;  3I43 A;  1TK5 B;  5D96 A;  5ECK B;  2VUP A;  5IMF A;  1JZO A;  3IAM 2;  3RAZ A;  1GSF A;  3D22 A;  4F82 A;  3F4S A;  5CNW A;  3GSS A;  1GSY A;  1O8W A;  5J4U A;  1FAA A;  1ILO A;  1USB A;  1WIK A;  3IE3 A;  2N5F A;  3M9K A;  4K7N A;  2XHF A;  2V2G A;  3ZIV A;  4JE1 A;  3FZA A;  2HXK A;  3EIN A;  3PGT A;  4KA0 A;  4ZBD A;  3KMN A;  3KP9 A;  3F8U A;  2IN3 A;  1TI3 A;  2IPA A;  4FYC A;  2AHE A;  3I6A A;  3DWV A;  3DEX A;  4PUA A;  3R2Q A;  1GTA A;  2CAQ A;  1GTI A;  1WOU A;  1XWB A;  4ZIJ A;  2O85 A;  3TUE A;  5IMA A;  3QD9 A;  4BPY A;  2F8A A;  1DE2 A;  3APO A;  2PBJ A;  3QPM A;  3TRP A;  3TDG A;  4GQF A;  3NIV A;  4GCI A;  4G10 A;  5GST A;  3E3E A;  5AIS A;  3LJR A;  1F3B A;  3GKX A;  4IEL A;  4V1A g;  2F9S A;  4BVX A;  3KH9 A;  1ML6 A;  2L6D A;  1S3C A;  2O89 A;  4IJI A;  3UL3 A;  1B9Y C;  2HZF A;  4IQ1 A;  6GSY A;  1X0R A;  3WGX A;  3ZTL A;  3D6I A;  3F3Q A;  1AC1 A;  2WS2 A;  2IMD A;  2ZUP A;  3H1N A;  3TGZ A;  1ERV A;  4GTU A;  1GL8 A;  3UJ1 A;  4TKY A;  4LA1 A;  1V2A A;  4KB3 A;  3I69 A;  1SL0 B;  2MMO A;  3IRA A;  1FB0 A;  2PUK C;  4K8M A;  5F0G A;  4KDX A;  4NXI A;  3ZVJ D;  1Z7R A;  3UVT A;  4V1A p;  4O32 A;  4TR4 A;  2GSQ A;  2GSR A;  2VCX A;  2PGT A;  2GQK A;  3N9J A;  1DE1 A;  3GST A;  5G1L A;  2HI7 A;  2C8U A;  1U88 A;  3M9J A;  2H72 A;  1TXX A;  1SJ6 A;  3FK8 A;  1YF1 A;  1EWX A;  2VCV A;  5DJL A;  2GS3 A;  2PN8 A;  4GRF A;  2C1Y A;  3F9U A;  4NPB A;  4FYB A;  4HUA A;  3IR4 A;  4HS1 A;  2NTO A;  2PER A;  3DVW A;  3FRC A;  1B4Q A;  1G7E A;  1JZW A;  20GS A;  3P8W A;  4PQI A;  2ALB A;  1MDK A;  4BWQ A;  3DGQ A;  4N10 A;  4TR0 A;  2RM5 A;  3ZZX A;  1TW9 A;  5D9W A;  4BWS A;  4I2U A;  4HEA 2;  3EU3 A;  4F03 A;  3SBC A;  2QC7 A;  3KGK A;  1BQ7 A;  4ISD A;  1XPV A;  5HFI A;  4JR6 A;  1V98 A;  5HR0 A;  3UEM A;  2FWH A;  3K8N A;  3N5O A;  3TKR A;  22GS A;  5G5E A;  12GS A;  1OC8 A;  3GYK A;  1B48 A;  1WE0 A;  3L78 A;  2OE0 A;  5AIX A;  2DJJ A;  2CX4 A;  3LG6 A;  3GKK A;  1YEX A;  3M3M A;  2B6M A;  3VWV A;  3KP8 A;  2KUC A;  2VCQ A;  1U3A A;  3VWX A;  3WYW A;  1LU4 A;  5DBQ A;  4FH8 A;  4K0N A;  5EVO A;  3HVS A;  4MK3 A;  3KH7 A;  1TP9 A;  2CZ3 A;  1GUM A;  2IME A;  2KOK A;  4EE0 A;  2H30 A;  2R4V A;  3RHC A;  4Q5N A;  2X8H A;  3HKR A;  1JHB A;  11GS A;  1WMJ A;  4ZXG A;  2O87 A;  1YQ1 A;  4LMV A;  3LEF A;  5IMZ A;  4K0G A;  4KSM A;  2FHE A;  4AJ6 A;  3TRQ A;  13GS A;  2K18 A;  3GX8 A;  4DVC A;  1K3O A;  1R5A A;  3HDC A;  5F8B A;  2O7K A;  4YH2 A;  1S3A A;  2R5G A;  5INY A;  3TOT A;  2LUS A;  5LD0 A;  4OO4 A;  2H01 A;  1EP7 A;  2JSZ A;  1O73 A;  5JCU A;  5IOX A;  4BL7 A;  1GTU A;  1R7H A;  1X9S B;  1B8X A;  4K7I A;  5CRE A;  3VLN A;  5GSS A;  4ZB6 A;  3D4T A;  1EEJ A;  5ABR A;  3BJ5 A;  4HDE A;  1XCC A;  1ZZY A;  5G31 A;  2VLU A;  2DLX A;  1CQG A;  4GXZ A;  1HQO A;  2YZH A;  2LQQ A;  2DJK A;  2G2Q A;  4WKW A;  3GHA A;  1EEM A;  1GUK A;  2OBI A;  2CA8 A;  2C3Q A;  14GS A;  2B5Y A;  4MJC A;  1T3B A;  2V6O A;  3F6F A;  2ON7 A;  1SD9 A;  1B9X C;  3TKS C;  1M0U A;  2DC5 A;  3TJJ A;  2GZY A;  4NV5 A;  1SKR B;  1QMV A;  4F9Z A;  5G1K A;  2TIR A;  2B7J A;  4XIH A;  1GH2 A;  1O6J A;  3GUS A;  19GS A;  4YAV A;  5GAN D;  1OAZ A;  1XOB A;  2VCW A;  2H66 A;  2RII A;  1FHE A;  1T00 A;  2L59 A;  3PH9 A;  3GNJ A;  5ECQ B;  3J7Y b;  2REM A;  4TVE A;  1VRS D;  5F05 A;  2JZT A;  4ZL8 A;  2YWM A;  4RI6 A;  5E4W A;  1GNE A;  4PUF C;  2VCZ A;  4XS4 A;  9GSS A;  5JWQ B;  1HNA A;  1YF0 A;  1EV4 A;  3LYK A;  2P5Q A;  5C04 A;  4POB A;  5DQS A;  2FWG A;  2LV3 A;  3GTU A;  3DD3 A;  1QUW A;  4KDU A;  1VF1 A;  3TKS A;  1AQV A;  3UBK A;  3CSI A;  3GV1 A;  4EXJ A;  2H6Z A;  3V1W A;  5J9B A;  1XXU A;  3Q18 A;  1FO5 A;  3H4K A;  2BTO T;  1TDI A;  5G2Z A;  3AY8 A;  3WD6 A;  5DAL A;  5B7C A;  1XWA A;  3FZ9 A;  3M0F A;  2BMX A;  2HFD A;  1O81 A;  2GZZ A;  2HRN A;  3BCI A;  1NSW A;  3EU4 A;  3DKS A;  3H93 A;  2H70 A;  2YAN A;  1Z9H A;  2OJL A;  1KNG A;  2VOC A;  2XBI A;  3GKN A;  1JLV A;  4WBR D;  1X5C A;  3HYP A;  4AGS A;  2KHP A;  3MAK A;  2HT9 A;  2JU5 A;  18GS A;  5FHI A;  3QFA C; 
#chains in the Genus database with same CATH topology
 5H5S A;  4EF0 A;  2CAI A;  3QDN A;  4IHU A;  4NHZ A;  1K3Y A;  2V41 A;  3W6G A;  2H0H A;  1ZCP A;  2VM2 A;  3H8Q A;  3VI7 A;  1BED A;  5B6M A;  1EOG A;  3QAV A;  1OE8 A;  3EVI A;  5ID2 A;  2P0G A;  2G0F A;  4EC0 A;  3LYP A;  4CW9 A;  5IO0 A;  4TR3 A;  4MMM A;  4K7O A;  4TRX A;  5JWO B;  4XS4 B;  4MCU A;  3APQ A;  1ZYE A;  4LL1 B;  5D9T A;  1OC9 A;  1OVN A;  1F3A A;  1XVQ A;  3GTU B;  1R4W A;  2CX3 A;  2H76 A;  3C1R A;  2YNX A;  5CRD A;  3VI5 A;  2CZ2 A;  4MLY A;  7GSS A;  1GTB A;  4O5Q A;  2K8V A;  4IP6 A;  2BJX A;  4HOJ A;  3GIX A;  2JSY A;  2A4V A;  2AYT A;  2E7P A;  3ERG A;  6GSV A;  4X0X A;  2YWO A;  1NM3 A;  3TOU A;  5ENU A;  2X8C A;  2VO4 A;  3FW2 A;  4OMV A;  5B6N A;  4CDO A;  2LJA A;  3RPP A;  3L9U A;  3ED3 A;  2X99 A;  2PPT A;  3HCZ A;  1QQ2 A;  1PD2 1;  5L71 A;  4TXO A;  3GUR A;  4WXT A;  4MPG A;  1W89 A;  4ICY A;  4KND A;  3ERW A;  1NHY A;  3RBT A;  3ZFB A;  3KMO A;  4JU5 A;  1R26 A;  5ECI B;  1M99 A;  1A8L A;  3LGC A;  1ZYQ B;  4X4J A;  1PRX A;  4K5S A;  3C7M A;  4K5R A;  3O6T A;  4IKH A;  1YEP A;  3DXB A;  2OAC A;  2E0Q A;  5EL8 A;  5JCW A;  1BAY A;  2YOI A;  1JFU A;  4K9Z A;  4ZL7 A;  1SK2 A;  4AJ8 A;  3F4R A;  3D0Z A;  3G7Y A;  3KEB A;  1ERU A;  4JRR A;  4IJ3 A;  4WEY A;  2YV7 A;  2WDU A;  1N2A A;  4KSO A;  1ERT A;  5ID2 B;  2B1K A;  4MH2 A;  4BIK A;  1IYH A;  3UOM A;  1K0D A;  1EP8 A;  1EGR A;  2LQO A;  1GNW A;  2FWF A;  1ZYN A;  1Z3E A;  3TCO A;  4ECI A;  5IQY A;  4MF5 A;  4WR4 A;  1UA5 A;  1THO A;  4ZBB A;  3CMI A;  1URM A;  4YAP A;  3DVX A;  3Q6O A;  3A2W A;  4A5P A;  1SJI A;  2H1G A;  4I97 A;  5DVB A;  2MMA A;  4IP1 A;  2WJU A;  3LXT A;  2AB6 A;  5AGY A;  3FZ5 A;  3IBH A;  1VGL A;  4L0U A;  1TOF A;  4NAX A;  1AQX A;  2N5B A;  5IPH A;  1B4P A;  1BX9 A;  3HVV A;  1PX6 A;  3RHB A;  1TRU A;  3P7X A;  5A5K A;  1MD3 A;  1UVZ A;  4Q5Q A;  3MDK A;  3VUR A;  3LSZ A;  3HJM A;  5IMC A;  3EMX A;  4J2F A;  4JED A;  4FIW A;  2RLI A;  2XPD A;  3P90 A;  1DUG A;  2KP1 A;  2UZ8 A;  1K0O A;  1SL1 B;  2R2J A;  1RK4 A;  4PNG A;  3E0U A;  4XTS A;  2YWN A;  3VPT A;  3TKS E;  3Q74 A;  4TXO B;  3CSJ A;  4ML6 A;  2YJH A;  1WJK A;  4OWY A;  1SKS B;  2WRT A;  3KJY A;  4L5L A;  4P3Y B;  4HU7 A;  1GRX A;  1WPI A;  2IWT A;  2NDO A;  2Z9S A;  1M9B A;  4K2D A;  1K0N A;  4WR5 A;  1K3L A;  4MPF A;  1H75 A;  4IVF A;  4Q5F A;  3DYR A;  3GN3 A;  1FVK A;  4V2L A;  5FT3 A;  5KEJ A;  4MJB A;  3FHK A;  2B7K A;  4YQU A;  5H5Q A;  1PKW A;  4IS0 A;  3F4T A;  3P2A A;  4KCE A;  2DML A;  3IV4 A;  4NWY A;  3ZIJ A;  1XWK A;  2MYG A;  1S3D A;  1QFN A;  1V9W A;  5GAP D;  1XIY A;  2XC2 A;  2FY6 A;  2M80 A;  1XW6 A;  1YKC A;  4G9H A;  3EUR A;  1YZX A;  6GST A;  3LXZ A;  1OE7 A;  4GQC A;  4HJ2 A;  3IHG A;  2MBS A;  1EOH A;  2DIY A;  4KCA A;  4EUY A;  4MAB A;  1BJX A;  1T4Y A;  2H1D A;  2HRF A;  1N8J A;  2CQ9 A;  3C71 A;  1A24 A;  1AQW A;  1F2E A;  1X5E A;  4MNN A;  2J23 A;  3ZML A;  1VF3 A;  2H1B A;  2LRT A;  1G6Y A;  3ZL5 A;  5D9X A;  5EPF A;  3U6V A;  4XRA A;  5G30 A;  1E2Y A;  2AUV A;  5CRW A;  3LOR A;  4ZB9 A;  3KZQ A;  2L5L A;  5HR1 A;  4PNF A;  5ECR B;  4OFN A;  1LJR A;  3EMP A;  2FLS A;  1QGV A;  2WB9 A;  3HJO A;  2HSM A;  1PX7 A;  3E9J B;  3HY2 A;  1OKT A;  2IJY A;  5IPG A;  2VAF A;  2GVP A;  1VF4 A;  4KGI A;  4LL4 B;  2C3N A;  4EVM A;  2AJQ B;  2DMM A;  1PL2 A;  1FOV A;  2E2M A;  1M9A A;  4BVY A;  2ZNM A;  2B3S A;  3Q19 A;  3O76 A;  1ZYP A;  5G5F A;  5HQP A;  1SK0 A;  1PFO A;  2NPB A;  2KP2 A;  3G7J A;  4ECJ A;  2HSY A;  3QAW A;  2HRK A;  5KOX A;  3L0H A;  4NV2 A;  5KN3 A;  4JR4 A;  3EYT A;  1JZD A;  2H0I A;  2H19 A;  2PMT A;  3CBU A;  4OCE A;  3FKF A;  1SD8 A;  4RUV A;  2L6C A;  3C1S A;  5J9C A;  4IQA A;  2DIZ A;  1QXH A;  2R3X A;  1WRY A;  2GZP A;  5KOW A;  1FVJ A;  2EC4 A;  16GS A;  2KLX A;  1FW1 A;  2C0G A;  1UN2 A;  4F2I A;  4LLR A;  3IA1 A;  4XRD A;  4GF0 A;  2LS5 A;  4ZBA A;  5A4V A;  3KXO A;  4QL7 A;  5ECO B;  4KE3 A;  1DBY A;  1M2B A;  3DIE A;  5CYY A;  1SKW B;  3G9B A;  1PGT A;  1DSB A;  4IBP A;  1AIU A;  4GLT A;  3L9S A;  1TU7 A;  1JLW A;  4Z2R A;  4TN8 A;  3PPU A;  2I4A A;  3ZIT A;  3DRN A;  4OD7 A;  5AN1 A;  1YDK A;  2H71 A;  2QA2 A;  2R37 A;  3LQ7 A;  4HI7 A;  3UVH A;  2NBS A;  1XOA A;  5ELG A;  1TK0 B;  1A2M A;  3KIJ A;  4IN0 A;  2B5E A;  2IL3 A;  5ECS A;  2GT5 A;  2C4J A;  4K1F A;  4GWR A;  1LBK A;  6GSU A;  2GQM A;  4J57 E;  2JZS A;  2YP6 A;  3US3 A;  4I2T A;  5D73 A;  4USS A;  5JWR B;  2IFQ A;  4EDY A;  4E8H A;  1T7P B;  3VWW A;  4BVY B;  2XPE A;  3LFL A;  2HYX A;  1ZOF A;  2AAW A;  3FEU A;  4HJM A;  2RM6 A;  3TJB A;  1XWG A;  5J41 A;  2ON5 A;  4JZQ A;  4L0W A;  1FOH A;  4DEJ A;  2GT6 A;  1PQN A;  1C72 A;  4D73 A;  3NZN A;  1F6M C;  3FR6 A;  3APS A;  3ZYW A;  4I5Q A;  4NMU A;  4ML1 A;  2LNT A;  1PKZ A;  1ST9 A;  3GFK A;  2VCT A;  2FWE A;  5KN0 A;  2WGR A;  1ZL9 A;  3VWU A;  3CTG A;  1TRW A;  1E6B A;  5LNK e;  3EWL A;  2V6K A;  2F3M A;  2OAD A;  2GSS A;  2LTK A;  3VFI A;  1A2L A;  2ES7 A;  1YKA A;  2GST A;  1OKD A;  3GH6 A;  5LCZ A;  2J9H A;  2MZC A;  2PVO C;  4LMW A;  2H1A A;  1KTE A;  3F3R A;  5IMV A;  2IIY A;  4MA9 A;  3TRX A;  1EGO A;  3CXG A;  1QK8 A;  1V57 A;  2CVD A;  2E2G A;  4EIP A;  4RQX A;  1XZO A;  3IPZ A;  1A23 A;  2HNL A;  2C80 A;  3ZRE A;  3HXS A;  2VM1 A;  5DJM A;  2ZCT A;  2C0F A;  4EKZ A;  1TK8 B;  2LJR A;  4ULX A;  3I9V 2;  4ID0 A;  3QR6 A;  2A2S A;  5IIZ A;  5DAL B;  2JAC A;  2M72 A;  2OE1 A;  1HYU A;  4XCS A;  2F8F A;  3BBY A;  2CVB A;  2GQL A;  2DSA A;  3TJF A;  2IFQ B;  2CT6 A;  6GSW A;  5CRH A;  2QSI A;  3GH9 A;  4G19 A;  1MDJ A;  5AIV A;  2HZE A;  2FUG 2;  3UMA A;  2M46 A;  2HSH A;  4POK A;  4POM A;  4PXO A;  4XS1 A;  2L4Q A;  4HZ2 A;  2IMI A;  3FR3 A;  5IM9 A;  2LRN A;  1ABA A;  3GRX A;  1ON4 A;  2V32 A;  3IOS A;  3ZLP A;  4D73 B;  4PQH A;  1Z6M A;  3IK7 A;  3KTB A;  3J7Y k;  1NHO A;  1A0F A;  4DSQ A;  1ACV A;  4XHM A;  5JCG A;  3JCM L;  2PVQ A;  1GWC A;  5GZZ B;  1K0C A;  1GLP A;  1GUH A;  5ECM B;  4POL A;  3L4N A;  4KDY A;  2JAD A;  5KN2 A;  4ZB8 A;  3A2V A;  4YQM A;  2DKH A;  2H6Y A;  1SEN A;  1GLQ A;  1GSS A;  2EIO A;  2VL9 A;  4PX1 A;  1RW1 A;  3CSH A;  3OR5 A;  3GMF A;  3ZFL A;  1BG5 A;  2GDR A;  2LJK A;  3D21 A;  5IOW A;  3UBL A;  1OC9 B;  2DJ3 A;  2IMF A;  5ECN B;  1WWJ A;  3QFB C;  3MNG A;  3WT2 A;  3A2X A;  2D2Z A;  4TXV A;  2OBK A;  8GSS A;  4PQ1 A;  2HLS A;  4KH7 A;  3M8N A;  4MF6 A;  4GSN A;  4DSS A;  2WCI A;  1GSD A;  5DAK A;  4F0C A;  3HA9 A;  3QCP A;  2A4H A;  5B8A A;  1F9M A;  3GA4 A;  5FWG A;  2DJ1 A;  1O8X A;  1O7U A;  4WF5 A;  3MSZ A;  2YN1 A;  3EC3 A;  4QL9 A;  4X1U A;  4GST A;  2LRC A;  4DSR A;  1U6T A;  1UC7 A;  2HZE B;  2L57 A;  2YWI A;  1MTC A;  1TU8 A;  5D93 A;  1S3R A;  2GGT A;  1EV9 A;  2WZ9 A;  3FYG A;  1PSQ A;  5J5N A;  4E8E A;  2RUE A;  3VK9 A;  1M7T A;  4MZB A;  5CAX A;  1Y6E A;  4TR1 A;  3WGD A;  2EIR A;  3BCK A;  2TRX A;  2P31 A;  1Y25 A;  1EZK A;  4F0B A;  4ILF A;  3HJP A;  3W8S A;  4N11 A;  1YY7 A;  4EDZ A;  3KCM A;  4EL1 A;  1TTZ A;  2OA7 A;  2AV4 A;  4GSS A;  10GS A;  2OE3 A;  2PWJ A;  4FYU A;  1H4O A;  4J56 E;  3HHV A;  2FCH A;  1ZGN A;  5F06 A;  2K6V A;  2A2R A;  3HZ8 A;  3S9F A;  2HE3 A;  2X64 A;  1T1V A;  5DDL A;  5ECL B;  5BRT A;  4RI7 A;  4ZL9 A;  2LKU A;  1Z6N A;  3PIN A;  3ZMK A;  4CHS A;  2H6X A;  1SK1 A;  2LEG A;  3VPQ A;  1IYI A;  4IW9 A;  1GP1 A;  1PN9 A;  1G6W A;  1U87 A;  1TI1 A;  2H75 A;  1HD2 A;  2VD0 A;  1M2A A;  1PL1 A;  3FMW A;  2H74 A;  3FZ4 A;  4DSS B;  3ISO A;  4OCF A;  3WGE A;  1OC3 A;  4HQS A;  3ME8 A;  5DAK B;  2LNS A;  4KW6 A;  4CY6 A;  4WF4 A;  2WFC A;  3KM6 A;  3F63 A;  2C0E A;  3ZRD A;  4MF7 A;  5CP1 A;  2JZR A;  4KX4 A;  5B8B A;  2VIM A;  5COH A;  1XW5 A;  4PUR A;  3IC8 A;  2B1L A;  1V40 A;  4I8B A;  1J0F A;  3CTF A;  4MP4 A;  1CQH A;  3H79 A;  2IMK A;  3TKP A;  2I1U A;  2VL2 C;  4OFT A;  1THX A;  2FNO A;  4TR1 B;  1OYJ A;  1SJZ A;  1SYR A;  4HU9 A;  1Z7P A;  1R5P A;  6GSS A;  2MBT A;  4BA7 A;  1HNC A;  1X9M B;  1A8Y A;  4MJA A;  2V1M A;  3IC4 A;  1NW2 A;  4MH3 A;  3ERF A;  1SL2 B;  3GL5 A;  2DBC A;  4OO5 A;  3HZ4 A;  1AUC A;  4YQV A;  3CRU A;  1ERW A;  3UAR A;  3SWL A;  3L9V A;  5HR2 A;  3FR9 A;  4N0Z A;  2VLT A;  3WT1 A;  1GSE A;  4QQ7 A;  4AF2 A;  3IXR A;  3M1G A;  1Q98 A;  3MWH A;  5IO2 A;  2GTU A;  2WUL A;  1PMT A;  3IDV A;  4OFM A;  5HFK A;  4Z7X A;  1TKD B;  4O92 A;  1JZR A;  2H73 A;  5A4U A;  2XBQ A;  3MYD A;  4HSC X;  3HVN A;  4MJE A;  1GSU A;  3GKM A;  4ACS A;  4K6X A;  3KD0 A;  1T4Z A;  5J3R A;  3RPN A;  1W4V A;  3TJK A;  2VL2 A;  4L8E A;  3IK9 A;  1YJ6 A;  4HZ4 A;  5A4W A;  1V58 A;  5D8I A;  5ELA A;  4G2E A;  1AW9 A;  2A2P A;  4H86 A;  2MMN A;  1K0B A;  2X8G A;  1U3I A;  2L4C A;  5C00 A;  2FA4 A;  4PGT A;  4I6X A;  3CRT A;  1SYX A;  3BOA A;  2PU9 C;  1XW9 A;  1KEB A;  2GLR A;  5KN1 A;  5HR3 A;  3QAG A;  5IMD A;  3F0I A;  6GSX A;  4KF9 A;  5E59 A;  1I9D A;  3QOU A;  4N0V A;  3CYN A;  1XBS A;  1X9W B;  1AAZ A;  2LST A;  2MMZ A;  2FD3 A;  4V2M A;  1I5G A;  4EIQ A;  3QMX A;  1K0A A;  3ZVJ A;  2YPM A;  2K9F A;  3A5W A;  4O7H A;  2B5X A;  1KBN A;  3C8E A;  4G0K A;  3KTL A;  4KAE A;  2P5R A;  1TRV A;  4TW5 A;  2L5O A;  3A3T A;  1MDI A;  3BD2 A;  3UIW A;  1RQM A;  4TOP A;  3LWA A;  1PA3 A;  3HVX A;  4K2X A;  1T8E B;  2VL3 A;  4CY8 A;  1GUL A;  1XVW A;  3TB2 A;  1G0T A;  2C0D A;  2NVL A;  1SU9 A;  2FGX A;  1GSQ A;  2C3T A;  3ME7 A;  5ECP B;  3W8J A;  2H8L A;  3DML A;  2CVK A;  4EO3 A;  3GL3 A;  2JL4 A;  3R3E A;  2OKA A;  1J9B A;  3GX0 A;  1XWC A;  4Z2T A;  1AXD A;  4WBJ A;  2DJ0 A;  3U5R E;  2YJ7 A;  4WET A;  5D9V A;  4ZIL A;  4FO5 A;  2I81 A;  2TRC P;  2DJ2 A;  1WP0 A;  3NOF A;  4MZW A;  4MDC A;  4RQR A;  5EY6 A;  3RDW A;  2FA8 A;  5F07 A;  3D5J A;  2QKE A;  3G7I A;  2RUF A;  2VD1 A;  2N5A A;  2YV9 A;  5ECH B;  2I3Y A;  2O8V B;  5DQY A;  5H5R A;  5HFG A;  1G7O A;  1A0R P;  2DKI A;  4NHW A;  4V2N A;  4HQZ A;  4KUN A;  5CRG A;  1Q4J A;  4YKF A;  4MZC A;  2YCD A;  2VLV A;  2YZU A;  2K8S A;  1A2J A;  1TRS A;  4JBB A;  4ECC A;  3PR8 A;  2R6K A;  1ZMA A;  3TJG A;  1Z5Y E;  1FB6 A;  1XFL A;  3F6D A;  1TJD A;  2QGV A;  4X43 A;  5DCH A;  3IAS 2;  4XS6 A;  5DCG A;  4N30 A;  1HNB A;  1M2D A;  1O85 A;  1K0M A;  1J08 A;  4Q5R A;  1F37 A;  4AJ7 A;  2H0G A;  3C73 A;  1BYE A;  1VF2 A;  3IHQ A;  1FG4 A;  4ECB A;  4IGJ A;  2EIQ A;  4L5O A;  3FY7 A;  17GS A;  2I9H A;  3D4M A;  3HD5 A;  2CV4 A;  3TKQ A;  4O5R A;  1MD4 A;  5CO3 A;  3O3T A;  3UAP A;  1MEK A;  1X5D A;  2F51 A;  3EE2 A;  3I43 A;  1TK5 B;  5D96 A;  5ECK B;  2VUP A;  5IMF A;  4YKG A;  1JZO A;  3IAM 2;  3RAZ A;  1GSF A;  3D22 A;  4F82 A;  3F4S A;  5CNW A;  3GSS A;  1GSY A;  1O8W A;  5J4U A;  1FAA A;  1ILO A;  1USB A;  1WIK A;  3IE3 A;  2N5F A;  3M9K A;  4K7N A;  2XHF A;  2V2G A;  3ZIV A;  4JE1 A;  3FZA A;  1XG8 A;  2QA1 A;  2HXK A;  3EIN A;  3PGT A;  4KA0 A;  4ZBD A;  3KMN A;  3KP9 A;  3F8U A;  2IN3 A;  1TI3 A;  2IPA A;  4FYC A;  2AHE A;  3I6A A;  3DWV A;  3DEX A;  4PUA A;  3R2Q A;  1GTA A;  2CAQ A;  1GTI A;  1WOU A;  1XWB A;  4ZIJ A;  2O85 A;  3TUE A;  5IMA A;  3QD9 A;  4BPY A;  2F8A A;  1DE2 A;  3APO A;  2PBJ A;  3QPM A;  3TRP A;  3TDG A;  4GQF A;  3NIV A;  4GCI A;  4G10 A;  5GST A;  3E3E A;  5AIS A;  3LJR A;  4FQU A;  1F3B A;  3GKX A;  3MIX A;  4IEL A;  2X49 A;  4V1A g;  2F9S A;  4BVX A;  3KH9 A;  1ML6 A;  2L6D A;  1S3C A;  2O89 A;  5BMU A;  4IJI A;  3UL3 A;  1B9Y C;  2HZF A;  4IQ1 A;  6GSY A;  1X0R A;  3WGX A;  3ZTL A;  3D6I A;  4PTS A;  3F3Q A;  1AC1 A;  2WS2 A;  2IMD A;  2ZUP A;  3H1N A;  3TGZ A;  1ERV A;  4GTU A;  1GL8 A;  3UJ1 A;  4TKY A;  4LA1 A;  1V2A A;  4KB3 A;  3I69 A;  1SL0 B;  2MMO A;  3IRA A;  1FB0 A;  2PUK C;  4K8M A;  5F0G A;  4KDX A;  4NXI A;  3ZVJ D;  1Z7R A;  3UVT A;  4V1A p;  4O32 A;  4TR4 A;  2GSQ A;  2GSR A;  2VCX A;  2PGT A;  2GQK A;  3N9J A;  1DE1 A;  3GST A;  5G1L A;  2HI7 A;  2C8U A;  1U88 A;  3M9J A;  2H72 A;  1TXX A;  1SJ6 A;  3FK8 A;  1YF1 A;  1EWX A;  2VCV A;  5DJL A;  2GS3 A;  2PN8 A;  2R0P A;  4GRF A;  2C1Y A;  3F9U A;  4NPB A;  4FYB A;  4HUA A;  3IR4 A;  4HS1 A;  2NTO A;  2PER A;  3DVW A;  3FRC A;  1B4Q A;  1G7E A;  1JZW A;  20GS A;  3P8W A;  4PQI A;  2ALB A;  1MDK A;  4BWQ A;  3DGQ A;  4N10 A;  3EPT A;  4TR0 A;  2RM5 A;  3ZZX A;  1TW9 A;  5D9W A;  4BWS A;  4I2U A;  4HEA 2;  3EU3 A;  1PN0 A;  4F03 A;  3SBC A;  2QC7 A;  3KGK A;  1BQ7 A;  4ISD A;  1XPV A;  1M3I A;  5HFI A;  4BVX B;  4JR6 A;  1V98 A;  5HR0 A;  3UEM A;  2FWH A;  3K8N A;  3N5O A;  3TKR A;  22GS A;  5G5E A;  12GS A;  1OC8 A;  3GYK A;  1B48 A;  1WE0 A;  3L78 A;  2OE0 A;  5AIX A;  2DJJ A;  2CX4 A;  3LG6 A;  3GKK A;  1YEX A;  4O5U A;  3M3M A;  2B6M A;  3VWV A;  3KP8 A;  2KUC A;  2VCQ A;  1U3A A;  3VWX A;  3WYW A;  1LU4 A;  3CQF A;  5DBQ A;  4FH8 A;  4K0N A;  5EVO A;  3HVS A;  4MK3 A;  3KH7 A;  1TP9 A;  2CZ3 A;  1GUM A;  2IME A;  2KOK A;  4EE0 A;  2H30 A;  2R4V A;  3RHC A;  4Q5N A;  2X8H A;  3HKR A;  1JHB A;  11GS A;  1WMJ A;  4ZXG A;  2O87 A;  2X4A A;  1YQ1 A;  4LMV A;  3LEF A;  5IMZ A;  4K0G A;  4KSM A;  2FHE A;  4AJ6 A;  2HRA A;  3TRQ A;  13GS A;  2K18 A;  3GX8 A;  4DVC A;  1K3O A;  1R5A A;  3HDC A;  5F8B A;  2O7K A;  4YH2 A;  1S3A A;  2R5G A;  5INY A;  3TOT A;  2LUS A;  5LD0 A;  4OO4 A;  2H01 A;  1EP7 A;  2JSZ A;  1O73 A;  5JCU A;  5IOX A;  4BL7 A;  1GTU A;  1R7H A;  1X9S B;  1B8X A;  4K7I A;  5CRE A;  3VLN A;  5GSS A;  4ZB6 A;  3D4T A;  1EEJ A;  5ABR A;  3BJ5 A;  4HDE A;  1XCC A;  1ZZY A;  5G31 A;  2VLU A;  2DLX A;  1CQG A;  4GXZ A;  1HQO A;  2YZH A;  2LQQ A;  2DJK A;  2G2Q A;  4WKW A;  3A5I A;  3GHA A;  1EEM A;  1GUK A;  2OBI A;  2CA8 A;  2C3Q A;  14GS A;  2B5Y A;  4MJC A;  1T3B A;  2V6O A;  3F6F A;  4G0L A;  2ON7 A;  1SD9 A;  1B9X C;  3TKS C;  1M0U A;  2DC5 A;  3TJJ A;  2GZY A;  4NV5 A;  1SKR B;  1QMV A;  4Z2U A;  4F9Z A;  5G1K A;  3LW9 A;  2TIR A;  2B7J A;  4XIH A;  1GH2 A;  1O6J A;  3GUS A;  19GS A;  4YAV A;  5GAN D;  1OAZ A;  1XOB A;  2VCW A;  2H66 A;  2RII A;  1FHE A;  1T00 A;  2L59 A;  3PH9 A;  3GNJ A;  5ECQ B;  3J7Y b;  2REM A;  4TVE A;  1VRS D;  5F05 A;  2JZT A;  4ZL8 A;  2YWM A;  4RI6 A;  5E4W A;  1GNE A;  4PUF C;  2VCZ A;  4XS4 A;  9GSS A;  5JWQ B;  1HNA A;  1YF0 A;  1EV4 A;  3LYK A;  2P5Q A;  5C04 A;  4POB A;  5DQS A;  2FWG A;  2LV3 A;  3GTU A;  3DD3 A;  1QUW A;  4KDU A;  1VF1 A;  3TKS A;  1AQV A;  3UBK A;  3CSI A;  3GV1 A;  4EXJ A;  4BL7 B;  2H6Z A;  3V1W A;  5J9B A;  1XXU A;  3Q18 A;  1FO5 A;  3H4K A;  2BTO T;  1TDI A;  5G2Z A;  3AY8 A;  1M3J A;  3WD6 A;  2R0C A;  5DAL A;  5B7C A;  1XWA A;  3FZ9 A;  3M0F A;  2BMX A;  2HFD A;  1O81 A;  2GZZ A;  2HRN A;  3BCI A;  1NSW A;  3EU4 A;  2R0G A;  3DKS A;  3H93 A;  2H70 A;  2YAN A;  1Z9H A;  2OJL A;  1KNG A;  2VOC A;  2XBI A;  3GKN A;  1JLV A;  4WBR D;  4G0I A;  1X5C A;  3HYP A;  4AGS A;  2KHP A;  3MAK A;  2HT9 A;  2JU5 A;  18GS A;  5FHI A;  3QFA C; 
#chains in the Genus database with same CATH homology
 5H5S A;  4EF0 A;  2CAI A;  3QDN A;  4IHU A;  4NHZ A;  1K3Y A;  2V41 A;  3W6G A;  2H0H A;  1ZCP A;  2VM2 A;  3H8Q A;  3VI7 A;  1BED A;  5B6M A;  1EOG A;  3QAV A;  1OE8 A;  3EVI A;  5ID2 A;  2P0G A;  2G0F A;  4EC0 A;  3LYP A;  4CW9 A;  5IO0 A;  4TR3 A;  4MMM A;  4K7O A;  4TRX A;  5JWO B;  4XS4 B;  4MCU A;  3APQ A;  1ZYE A;  4LL1 B;  5D9T A;  1OC9 A;  1OVN A;  1F3A A;  1XVQ A;  3GTU B;  1R4W A;  2CX3 A;  2H76 A;  3C1R A;  2YNX A;  5CRD A;  3VI5 A;  2CZ2 A;  4MLY A;  7GSS A;  1GTB A;  4O5Q A;  2K8V A;  4IP6 A;  2BJX A;  4HOJ A;  3GIX A;  2JSY A;  2A4V A;  2AYT A;  2E7P A;  3ERG A;  6GSV A;  4X0X A;  2YWO A;  1NM3 A;  3TOU A;  5ENU A;  2X8C A;  2VO4 A;  3FW2 A;  4OMV A;  5B6N A;  4CDO A;  2LJA A;  3RPP A;  3L9U A;  3ED3 A;  2X99 A;  2PPT A;  3HCZ A;  1QQ2 A;  1PD2 1;  5L71 A;  4TXO A;  3GUR A;  4WXT A;  4MPG A;  1W89 A;  4ICY A;  4KND A;  3ERW A;  1NHY A;  3RBT A;  3ZFB A;  3KMO A;  4JU5 A;  1R26 A;  5ECI B;  1M99 A;  1A8L A;  3LGC A;  1ZYQ B;  4X4J A;  1PRX A;  4K5S A;  3C7M A;  4K5R A;  3O6T A;  4IKH A;  1YEP A;  3DXB A;  2OAC A;  2E0Q A;  5EL8 A;  5JCW A;  1BAY A;  2YOI A;  1JFU A;  4K9Z A;  4ZL7 A;  1SK2 A;  4AJ8 A;  3F4R A;  3D0Z A;  3G7Y A;  3KEB A;  1ERU A;  4JRR A;  4IJ3 A;  4WEY A;  2YV7 A;  2WDU A;  1N2A A;  4KSO A;  1ERT A;  5ID2 B;  2B1K A;  4MH2 A;  1IYH A;  3UOM A;  1K0D A;  1EP8 A;  1EGR A;  2LQO A;  1GNW A;  2FWF A;  1ZYN A;  1Z3E A;  3TCO A;  4ECI A;  5IQY A;  4MF5 A;  4WR4 A;  1UA5 A;  1THO A;  4ZBB A;  3CMI A;  1URM A;  4YAP A;  3DVX A;  3Q6O A;  3A2W A;  4A5P A;  1SJI A;  2H1G A;  4I97 A;  5DVB A;  2MMA A;  4IP1 A;  2WJU A;  3LXT A;  2AB6 A;  5AGY A;  3FZ5 A;  3IBH A;  1VGL A;  4L0U A;  1TOF A;  4NAX A;  1AQX A;  2N5B A;  5IPH A;  1B4P A;  1BX9 A;  3HVV A;  1PX6 A;  3RHB A;  1TRU A;  3P7X A;  5A5K A;  1MD3 A;  1UVZ A;  4Q5Q A;  3MDK A;  3VUR A;  3LSZ A;  3HJM A;  5IMC A;  3EMX A;  4J2F A;  4JED A;  4FIW A;  2RLI A;  2XPD A;  3P90 A;  1DUG A;  2KP1 A;  2UZ8 A;  1K0O A;  1SL1 B;  2R2J A;  1RK4 A;  4PNG A;  3E0U A;  4XTS A;  2YWN A;  3VPT A;  3TKS E;  3Q74 A;  4TXO B;  3CSJ A;  4ML6 A;  2YJH A;  1WJK A;  4OWY A;  1SKS B;  2WRT A;  3KJY A;  4L5L A;  4P3Y B;  4HU7 A;  1GRX A;  1WPI A;  2IWT A;  2NDO A;  2Z9S A;  1M9B A;  4K2D A;  1K0N A;  4WR5 A;  1K3L A;  4MPF A;  1H75 A;  4IVF A;  4Q5F A;  3DYR A;  3GN3 A;  1FVK A;  4V2L A;  5FT3 A;  5KEJ A;  4MJB A;  3FHK A;  2B7K A;  4YQU A;  5H5Q A;  1PKW A;  4IS0 A;  3F4T A;  3P2A A;  4KCE A;  2DML A;  3IV4 A;  4NWY A;  3ZIJ A;  1XWK A;  2MYG A;  1S3D A;  1QFN A;  1V9W A;  5GAP D;  1XIY A;  2XC2 A;  2FY6 A;  2M80 A;  1XW6 A;  1YKC A;  4G9H A;  3EUR A;  1YZX A;  6GST A;  3LXZ A;  1OE7 A;  4GQC A;  4HJ2 A;  3IHG A;  2MBS A;  1EOH A;  2DIY A;  4KCA A;  4EUY A;  4MAB A;  1BJX A;  1T4Y A;  2H1D A;  2HRF A;  1N8J A;  2CQ9 A;  3C71 A;  1A24 A;  1AQW A;  1F2E A;  1X5E A;  4MNN A;  2J23 A;  3ZML A;  1VF3 A;  2H1B A;  2LRT A;  1G6Y A;  3ZL5 A;  5D9X A;  5EPF A;  3U6V A;  4XRA A;  5G30 A;  1E2Y A;  2AUV A;  5CRW A;  3LOR A;  4ZB9 A;  3KZQ A;  2L5L A;  5HR1 A;  4PNF A;  5ECR B;  4OFN A;  1LJR A;  3EMP A;  2FLS A;  1QGV A;  2WB9 A;  3HJO A;  2HSM A;  1PX7 A;  3E9J B;  3HY2 A;  1OKT A;  2IJY A;  5IPG A;  2VAF A;  2GVP A;  1VF4 A;  4KGI A;  4LL4 B;  2C3N A;  4EVM A;  2AJQ B;  2DMM A;  1PL2 A;  1FOV A;  2E2M A;  1M9A A;  4BVY A;  2ZNM A;  2B3S A;  3Q19 A;  3O76 A;  1ZYP A;  5G5F A;  5HQP A;  1SK0 A;  2NPB A;  2KP2 A;  3G7J A;  4ECJ A;  2HSY A;  3QAW A;  2HRK A;  5KOX A;  3L0H A;  4NV2 A;  5KN3 A;  4JR4 A;  3EYT A;  1JZD A;  2H0I A;  2H19 A;  2PMT A;  3CBU A;  4OCE A;  3FKF A;  1SD8 A;  4RUV A;  2L6C A;  3C1S A;  5J9C A;  4IQA A;  2DIZ A;  1QXH A;  2R3X A;  1WRY A;  2GZP A;  5KOW A;  1FVJ A;  2EC4 A;  16GS A;  2KLX A;  1FW1 A;  2C0G A;  1UN2 A;  4F2I A;  4LLR A;  3IA1 A;  4XRD A;  4GF0 A;  2LS5 A;  4ZBA A;  5A4V A;  3KXO A;  4QL7 A;  5ECO B;  4KE3 A;  1DBY A;  1M2B A;  3DIE A;  5CYY A;  1SKW B;  3G9B A;  1PGT A;  1DSB A;  4IBP A;  1AIU A;  4GLT A;  3L9S A;  1TU7 A;  1JLW A;  4Z2R A;  4TN8 A;  3PPU A;  2I4A A;  3ZIT A;  3DRN A;  4OD7 A;  5AN1 A;  1YDK A;  2H71 A;  2QA2 A;  2R37 A;  3LQ7 A;  4HI7 A;  3UVH A;  2NBS A;  1XOA A;  5ELG A;  1TK0 B;  1A2M A;  3KIJ A;  4IN0 A;  2B5E A;  2IL3 A;  5ECS A;  2GT5 A;  2C4J A;  4K1F A;  4GWR A;  1LBK A;  6GSU A;  2GQM A;  4J57 E;  2JZS A;  2YP6 A;  3US3 A;  4I2T A;  5D73 A;  4USS A;  5JWR B;  2IFQ A;  4EDY A;  4E8H A;  1T7P B;  3VWW A;  4BVY B;  2XPE A;  3LFL A;  2HYX A;  1ZOF A;  2AAW A;  3FEU A;  4HJM A;  2RM6 A;  3TJB A;  1XWG A;  5J41 A;  2ON5 A;  4JZQ A;  4L0W A;  1FOH A;  4DEJ A;  2GT6 A;  1PQN A;  1C72 A;  4D73 A;  3NZN A;  1F6M C;  3FR6 A;  3APS A;  3ZYW A;  4I5Q A;  4NMU A;  4ML1 A;  2LNT A;  1PKZ A;  1ST9 A;  3GFK A;  2VCT A;  2FWE A;  5KN0 A;  2WGR A;  1ZL9 A;  3VWU A;  3CTG A;  1TRW A;  1E6B A;  5LNK e;  3EWL A;  2V6K A;  2F3M A;  2OAD A;  2GSS A;  2LTK A;  3VFI A;  1A2L A;  2ES7 A;  1YKA A;  2GST A;  1OKD A;  3GH6 A;  5LCZ A;  2J9H A;  2MZC A;  2PVO C;  4LMW A;  2H1A A;  1KTE A;  3F3R A;  5IMV A;  2IIY A;  4MA9 A;  3TRX A;  1EGO A;  3CXG A;  1QK8 A;  1V57 A;  2CVD A;  2E2G A;  4EIP A;  4RQX A;  1XZO A;  3IPZ A;  1A23 A;  2HNL A;  2C80 A;  3ZRE A;  3HXS A;  2VM1 A;  5DJM A;  2ZCT A;  2C0F A;  4EKZ A;  1TK8 B;  2LJR A;  4ULX A;  3I9V 2;  4ID0 A;  3QR6 A;  2A2S A;  5IIZ A;  5DAL B;  2JAC A;  2M72 A;  2OE1 A;  1HYU A;  4XCS A;  2F8F A;  3BBY A;  2CVB A;  2GQL A;  2DSA A;  3TJF A;  2IFQ B;  2CT6 A;  6GSW A;  5CRH A;  2QSI A;  3GH9 A;  4G19 A;  1MDJ A;  5AIV A;  2HZE A;  2FUG 2;  3UMA A;  2M46 A;  2HSH A;  4POK A;  4POM A;  4PXO A;  4XS1 A;  2L4Q A;  4HZ2 A;  2IMI A;  3FR3 A;  5IM9 A;  2LRN A;  1ABA A;  3GRX A;  1ON4 A;  2V32 A;  3IOS A;  3ZLP A;  4D73 B;  4PQH A;  1Z6M A;  3IK7 A;  3KTB A;  3J7Y k;  1NHO A;  1A0F A;  4DSQ A;  1ACV A;  4XHM A;  5JCG A;  3JCM L;  2PVQ A;  1GWC A;  5GZZ B;  1K0C A;  1GLP A;  1GUH A;  5ECM B;  4POL A;  3L4N A;  4KDY A;  2JAD A;  5KN2 A;  4ZB8 A;  3A2V A;  4YQM A;  2DKH A;  2H6Y A;  1SEN A;  1GLQ A;  1GSS A;  2EIO A;  2VL9 A;  4PX1 A;  1RW1 A;  3CSH A;  3OR5 A;  3GMF A;  3ZFL A;  1BG5 A;  2GDR A;  2LJK A;  3D21 A;  5IOW A;  3UBL A;  1OC9 B;  2DJ3 A;  2IMF A;  5ECN B;  1WWJ A;  3QFB C;  3MNG A;  3WT2 A;  3A2X A;  2D2Z A;  4TXV A;  2OBK A;  8GSS A;  4PQ1 A;  2HLS A;  4KH7 A;  3M8N A;  4MF6 A;  4GSN A;  4DSS A;  2WCI A;  1GSD A;  5DAK A;  4F0C A;  3HA9 A;  3QCP A;  2A4H A;  5B8A A;  1F9M A;  3GA4 A;  5FWG A;  2DJ1 A;  1O8X A;  1O7U A;  4WF5 A;  3MSZ A;  2YN1 A;  3EC3 A;  4QL9 A;  4X1U A;  4GST A;  2LRC A;  4DSR A;  1U6T A;  1UC7 A;  2HZE B;  2L57 A;  2YWI A;  1MTC A;  1TU8 A;  5D93 A;  2GGT A;  1EV9 A;  2WZ9 A;  3FYG A;  1PSQ A;  5J5N A;  4E8E A;  2RUE A;  3VK9 A;  1M7T A;  4MZB A;  5CAX A;  1Y6E A;  4TR1 A;  3WGD A;  2EIR A;  3BCK A;  2TRX A;  2P31 A;  1Y25 A;  1EZK A;  4F0B A;  4ILF A;  3HJP A;  3W8S A;  4N11 A;  1YY7 A;  4EDZ A;  3KCM A;  4EL1 A;  1TTZ A;  2OA7 A;  2AV4 A;  4GSS A;  10GS A;  2OE3 A;  2PWJ A;  4FYU A;  1H4O A;  4J56 E;  3HHV A;  2FCH A;  1ZGN A;  5F06 A;  2K6V A;  2A2R A;  3HZ8 A;  3S9F A;  2HE3 A;  2X64 A;  1T1V A;  5DDL A;  5ECL B;  5BRT A;  4RI7 A;  4ZL9 A;  2LKU A;  1Z6N A;  3PIN A;  3ZMK A;  4CHS A;  2H6X A;  1SK1 A;  2LEG A;  3VPQ A;  1IYI A;  4IW9 A;  1GP1 A;  1PN9 A;  1G6W A;  1U87 A;  1TI1 A;  2H75 A;  1HD2 A;  2VD0 A;  1M2A A;  1PL1 A;  3FMW A;  2H74 A;  3FZ4 A;  4DSS B;  3ISO A;  4OCF A;  3WGE A;  1OC3 A;  4HQS A;  3ME8 A;  5DAK B;  2LNS A;  4KW6 A;  4CY6 A;  4WF4 A;  2WFC A;  3KM6 A;  3F63 A;  2C0E A;  3ZRD A;  4MF7 A;  5CP1 A;  2JZR A;  4KX4 A;  5B8B A;  2VIM A;  5COH A;  1XW5 A;  4PUR A;  3IC8 A;  2B1L A;  1V40 A;  4I8B A;  1J0F A;  3CTF A;  4MP4 A;  1CQH A;  3H79 A;  2IMK A;  3TKP A;  2I1U A;  2VL2 C;  4OFT A;  1THX A;  2FNO A;  4TR1 B;  1OYJ A;  1SJZ A;  1SYR A;  4HU9 A;  1Z7P A;  1R5P A;  6GSS A;  2MBT A;  4BA7 A;  1HNC A;  1X9M B;  1A8Y A;  4MJA A;  2V1M A;  3IC4 A;  1NW2 A;  4MH3 A;  3ERF A;  1SL2 B;  3GL5 A;  2DBC A;  4OO5 A;  3HZ4 A;  1AUC A;  4YQV A;  3CRU A;  1ERW A;  3UAR A;  3SWL A;  3L9V A;  5HR2 A;  3FR9 A;  4N0Z A;  2VLT A;  3WT1 A;  1GSE A;  4QQ7 A;  4AF2 A;  3IXR A;  3M1G A;  1Q98 A;  3MWH A;  5IO2 A;  2GTU A;  2WUL A;  1PMT A;  3IDV A;  4OFM A;  5HFK A;  4Z7X A;  1TKD B;  4O92 A;  1JZR A;  2H73 A;  5A4U A;  2XBQ A;  3MYD A;  4MJE A;  1GSU A;  3GKM A;  4ACS A;  4K6X A;  3KD0 A;  1T4Z A;  5J3R A;  3RPN A;  1W4V A;  3TJK A;  2VL2 A;  4L8E A;  3IK9 A;  1YJ6 A;  4HZ4 A;  5A4W A;  1V58 A;  5D8I A;  5ELA A;  4G2E A;  1AW9 A;  2A2P A;  4H86 A;  2MMN A;  1K0B A;  2X8G A;  1U3I A;  2L4C A;  5C00 A;  2FA4 A;  4PGT A;  4I6X A;  3CRT A;  1SYX A;  3BOA A;  2PU9 C;  1XW9 A;  1KEB A;  2GLR A;  5KN1 A;  5HR3 A;  3QAG A;  5IMD A;  3F0I A;  6GSX A;  4KF9 A;  5E59 A;  1I9D A;  3QOU A;  4N0V A;  3CYN A;  1XBS A;  1X9W B;  1AAZ A;  2LST A;  2MMZ A;  2FD3 A;  4V2M A;  1I5G A;  4EIQ A;  3QMX A;  1K0A A;  3ZVJ A;  2YPM A;  2K9F A;  3A5W A;  4O7H A;  2B5X A;  1KBN A;  3C8E A;  4G0K A;  3KTL A;  4KAE A;  2P5R A;  1TRV A;  4TW5 A;  2L5O A;  3A3T A;  1MDI A;  3BD2 A;  3UIW A;  1RQM A;  4TOP A;  3LWA A;  1PA3 A;  3HVX A;  4K2X A;  1T8E B;  2VL3 A;  4CY8 A;  1GUL A;  1XVW A;  3TB2 A;  1G0T A;  2C0D A;  2NVL A;  1SU9 A;  2FGX A;  1GSQ A;  2C3T A;  3ME7 A;  5ECP B;  3W8J A;  2H8L A;  3DML A;  2CVK A;  4EO3 A;  3GL3 A;  2JL4 A;  3R3E A;  2OKA A;  1J9B A;  3GX0 A;  1XWC A;  4Z2T A;  1AXD A;  4WBJ A;  2DJ0 A;  3U5R E;  2YJ7 A;  4WET A;  5D9V A;  4ZIL A;  4FO5 A;  2I81 A;  2TRC P;  2DJ2 A;  1WP0 A;  3NOF A;  4MZW A;  4MDC A;  4RQR A;  5EY6 A;  3RDW A;  2FA8 A;  5F07 A;  3D5J A;  2QKE A;  3G7I A;  2RUF A;  2VD1 A;  2N5A A;  2YV9 A;  5ECH B;  2I3Y A;  2O8V B;  5DQY A;  5H5R A;  5HFG A;  1G7O A;  1A0R P;  2DKI A;  4NHW A;  4V2N A;  4HQZ A;  4KUN A;  5CRG A;  1Q4J A;  4YKF A;  4MZC A;  2YCD A;  2VLV A;  2YZU A;  2K8S A;  1A2J A;  1TRS A;  4JBB A;  4ECC A;  3PR8 A;  2R6K A;  1ZMA A;  3TJG A;  1Z5Y E;  1FB6 A;  1XFL A;  3F6D A;  1TJD A;  2QGV A;  4X43 A;  5DCH A;  3IAS 2;  4XS6 A;  5DCG A;  4N30 A;  1HNB A;  1M2D A;  1O85 A;  1K0M A;  1J08 A;  4Q5R A;  1F37 A;  4AJ7 A;  2H0G A;  3C73 A;  1BYE A;  1VF2 A;  3IHQ A;  1FG4 A;  4ECB A;  4IGJ A;  2EIQ A;  4L5O A;  3FY7 A;  17GS A;  2I9H A;  3D4M A;  3HD5 A;  2CV4 A;  3TKQ A;  4O5R A;  1MD4 A;  5CO3 A;  3O3T A;  3UAP A;  1MEK A;  1X5D A;  2F51 A;  3EE2 A;  3I43 A;  1TK5 B;  5D96 A;  5ECK B;  2VUP A;  5IMF A;  4YKG A;  1JZO A;  3IAM 2;  3RAZ A;  1GSF A;  3D22 A;  4F82 A;  3F4S A;  5CNW A;  3GSS A;  1GSY A;  1O8W A;  5J4U A;  1FAA A;  1ILO A;  1USB A;  1WIK A;  3IE3 A;  2N5F A;  3M9K A;  4K7N A;  2XHF A;  2V2G A;  3ZIV A;  4JE1 A;  3FZA A;  2QA1 A;  2HXK A;  3EIN A;  3PGT A;  4KA0 A;  4ZBD A;  3KMN A;  3KP9 A;  3F8U A;  2IN3 A;  1TI3 A;  2IPA A;  4FYC A;  2AHE A;  3I6A A;  3DWV A;  3DEX A;  4PUA A;  3R2Q A;  1GTA A;  2CAQ A;  1GTI A;  1WOU A;  1XWB A;  4ZIJ A;  2O85 A;  3TUE A;  5IMA A;  3QD9 A;  4BPY A;  2F8A A;  1DE2 A;  3APO A;  2PBJ A;  3QPM A;  3TRP A;  3TDG A;  4GQF A;  3NIV A;  4GCI A;  4G10 A;  5GST A;  3E3E A;  5AIS A;  3LJR A;  4FQU A;  1F3B A;  3GKX A;  3MIX A;  4IEL A;  2X49 A;  4V1A g;  2F9S A;  4BVX A;  3KH9 A;  1ML6 A;  2L6D A;  1S3C A;  2O89 A;  5BMU A;  4IJI A;  3UL3 A;  1B9Y C;  2HZF A;  4IQ1 A;  6GSY A;  1X0R A;  3WGX A;  3ZTL A;  3D6I A;  4PTS A;  3F3Q A;  1AC1 A;  2WS2 A;  2IMD A;  2ZUP A;  3H1N A;  3TGZ A;  1ERV A;  4GTU A;  1GL8 A;  3UJ1 A;  4TKY A;  4LA1 A;  1V2A A;  4KB3 A;  3I69 A;  1SL0 B;  2MMO A;  3IRA A;  1FB0 A;  2PUK C;  4K8M A;  5F0G A;  4KDX A;  4NXI A;  3ZVJ D;  1Z7R A;  3UVT A;  4V1A p;  4O32 A;  4TR4 A;  2GSQ A;  2GSR A;  2VCX A;  2PGT A;  2GQK A;  3N9J A;  1DE1 A;  3GST A;  5G1L A;  2HI7 A;  2C8U A;  1U88 A;  3M9J A;  2H72 A;  1TXX A;  1SJ6 A;  3FK8 A;  1YF1 A;  1EWX A;  2VCV A;  5DJL A;  2GS3 A;  2PN8 A;  2R0P A;  4GRF A;  2C1Y A;  3F9U A;  4NPB A;  4FYB A;  4HUA A;  3IR4 A;  4HS1 A;  2NTO A;  2PER A;  3DVW A;  3FRC A;  1B4Q A;  1G7E A;  1JZW A;  20GS A;  3P8W A;  4PQI A;  2ALB A;  1MDK A;  4BWQ A;  3DGQ A;  4N10 A;  3EPT A;  4TR0 A;  2RM5 A;  3ZZX A;  1TW9 A;  5D9W A;  4BWS A;  4I2U A;  4HEA 2;  3EU3 A;  1PN0 A;  4F03 A;  3SBC A;  2QC7 A;  3KGK A;  1BQ7 A;  4ISD A;  1XPV A;  5HFI A;  4BVX B;  4JR6 A;  1V98 A;  5HR0 A;  3UEM A;  2FWH A;  3K8N A;  3N5O A;  3TKR A;  22GS A;  5G5E A;  12GS A;  1OC8 A;  3GYK A;  1B48 A;  1WE0 A;  3L78 A;  2OE0 A;  5AIX A;  2DJJ A;  2CX4 A;  3LG6 A;  3GKK A;  1YEX A;  4O5U A;  3M3M A;  2B6M A;  3VWV A;  3KP8 A;  2KUC A;  2VCQ A;  1U3A A;  3VWX A;  3WYW A;  1LU4 A;  5DBQ A;  4FH8 A;  4K0N A;  5EVO A;  3HVS A;  4MK3 A;  3KH7 A;  1TP9 A;  2CZ3 A;  1GUM A;  2IME A;  2KOK A;  4EE0 A;  2H30 A;  2R4V A;  3RHC A;  4Q5N A;  2X8H A;  3HKR A;  1JHB A;  11GS A;  1WMJ A;  4ZXG A;  2O87 A;  2X4A A;  1YQ1 A;  4LMV A;  3LEF A;  5IMZ A;  4K0G A;  4KSM A;  2FHE A;  4AJ6 A;  2HRA A;  3TRQ A;  13GS A;  2K18 A;  3GX8 A;  4DVC A;  1K3O A;  1R5A A;  3HDC A;  5F8B A;  2O7K A;  4YH2 A;  1S3A A;  2R5G A;  5INY A;  3TOT A;  2LUS A;  5LD0 A;  4OO4 A;  2H01 A;  1EP7 A;  2JSZ A;  1O73 A;  5JCU A;  5IOX A;  4BL7 A;  1GTU A;  1R7H A;  1X9S B;  1B8X A;  4K7I A;  5CRE A;  3VLN A;  5GSS A;  4ZB6 A;  3D4T A;  1EEJ A;  5ABR A;  3BJ5 A;  4HDE A;  1XCC A;  1ZZY A;  5G31 A;  2VLU A;  2DLX A;  1CQG A;  4GXZ A;  1HQO A;  2YZH A;  2LQQ A;  2DJK A;  2G2Q A;  4WKW A;  3A5I A;  3GHA A;  1EEM A;  1GUK A;  2OBI A;  2CA8 A;  2C3Q A;  14GS A;  2B5Y A;  4MJC A;  1T3B A;  2V6O A;  3F6F A;  4G0L A;  2ON7 A;  1SD9 A;  1B9X C;  3TKS C;  1M0U A;  2DC5 A;  3TJJ A;  2GZY A;  4NV5 A;  1SKR B;  1QMV A;  4Z2U A;  4F9Z A;  5G1K A;  3LW9 A;  2TIR A;  2B7J A;  4XIH A;  1GH2 A;  1O6J A;  3GUS A;  19GS A;  4YAV A;  5GAN D;  1OAZ A;  1XOB A;  2VCW A;  2H66 A;  2RII A;  1FHE A;  1T00 A;  2L59 A;  3PH9 A;  3GNJ A;  5ECQ B;  3J7Y b;  2REM A;  4TVE A;  1VRS D;  5F05 A;  2JZT A;  4ZL8 A;  2YWM A;  4RI6 A;  5E4W A;  1GNE A;  4PUF C;  2VCZ A;  4XS4 A;  9GSS A;  5JWQ B;  1HNA A;  1YF0 A;  1EV4 A;  3LYK A;  2P5Q A;  5C04 A;  4POB A;  5DQS A;  2FWG A;  2LV3 A;  3GTU A;  3DD3 A;  1QUW A;  4KDU A;  1VF1 A;  3TKS A;  1AQV A;  3UBK A;  3CSI A;  3GV1 A;  4EXJ A;  4BL7 B;  2H6Z A;  3V1W A;  5J9B A;  1XXU A;  3Q18 A;  1FO5 A;  3H4K A;  2BTO T;  1TDI A;  5G2Z A;  3AY8 A;  3WD6 A;  2R0C A;  5DAL A;  5B7C A;  1XWA A;  3FZ9 A;  3M0F A;  2BMX A;  2HFD A;  1O81 A;  2GZZ A;  2HRN A;  3BCI A;  1NSW A;  3EU4 A;  2R0G A;  3DKS A;  3H93 A;  2H70 A;  2YAN A;  1Z9H A;  2OJL A;  1KNG A;  2VOC A;  2XBI A;  3GKN A;  1JLV A;  4WBR D;  4G0I A;  1X5C A;  3HYP A;  4AGS A;  2KHP A;  3MAK A;  2HT9 A;  2JU5 A;  18GS A;  5FHI A;  3QFA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...