4K7OA

Human peroxiredoxin 5 with a fragment
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
162
structure length
162
Chain Sequence
SAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin-5, mitochondrial
publication title Comparing Binding Modes of Analogous Fragments Using NMR in Fragment-Based Drug Design: Application to PRDX5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 51
structure length 162
sequence length 162
chains with identical sequence B, C
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4k7oA00
1YDKA 1T3BA 4WETA 2O8VB 2LQOA 3ISOA 4EDYA 3Q6OA 4EF0A 3S9FA 1G6WA 4MJEA 1X9MB 1T00A 3K8NA 1GLPA 4K2DA 3BCKA 2R6KA 5A4WA 4ZXGA 3KMOA 1XIYA 2NTOA 4Q5QA 2MBTA 4F0BA 1SJ6A 3ERGA 4BVYA 2ON7A 3GURA 4BWSA 5EVOA 2LKUA 3VI5A 2R2JA 3WD6A 2XHFA 4RI6A 5CNWA 5FHIA 1WIKA 5A5KA 2DBCA 1N8JA 2CVKA 3RPNA 2FHEA 1LBKA 5AISA 3FHKA 3RHCA 1BEDA 4HQZA 2DLXA 3MSZA 1TXXA 1MD4A 2H6YA 2HZFA 4HQSA 4LLRA 3FW2A 5DDLA 1LJRA 4FIWA 4FYCA 2OE1A 3CBUA 3ZFBA 5HR2A 2PU9C 4GWRA 1B4PA 5LCZA 2FUG2 2I4AA 4ZBBA 5CREA 4MJBA 3O6TA 1V40A 2R5GA 1OC3A 1E6BA 2C80A 1FB0A 4ML1A 1KNGA 2JACA 4XRDA 5G30A 5HQPA 2H30A 2K18A 3US3A 2H75A 1X5DA 3EWLA 2VLUA 3C73A 1ZZYA 3HYPA 1K3YA 2FA4A 3UBKA 3VWXA 1WE0A 3P2AA 3DRNA 2IWTA 5E4WA 4Q5NA 1QUWA 2P5RA 6GSUA 1YEXA 2GT5A 3I69A 2R3XA 4HOJA 2PERA 1XFLA 4PXOA 5AGYA 3IPZA 5H5SA 4IQ1A 3VPTA 2FLSA 2J23A 5IOWA 2C1YA 3NIVA 6GSYA 1TRWA 1JZDA 4QL7A 1SKSB 4ECBA 2LSTA 1FAAA 2JZRA 1PSQA 1QFNA 3EYTA 2HFDA 3GTUA 2CZ2A 4MMMA 4AJ8A 3UMAA 3V1WA 1YZXA 2CX3A 4DSSA 1FG4A 2PGTA 2LV3A 3F4TA 3TKRA 1OKDA 2NVLA 4LA1A 2C3QA 3FK8A 3R2QA 4FO5A 2H6XA 2M72A 1Z5YE 4IVFA 1G7EA 4LL1B 6GSXA 2F3MA 2WCIA 1JZWA 1JFUA 5CAXA 2VL9A 3GL3A 3TUEA 1THXA 4ULXA 3IXRA 5LD0A 2E2GA 1FO5A 4GCIA 9GSSA 4TR4A 2FA8A 2CQ9A 1KEBA 3BOAA 2OA7A 1S3DA 5G2ZA 5HR0A 4MZWA 4CW9A 2HYXA 1ZOFA 1SYRA 1MTCA 5A4UA 1XW6A 1XWAA 3LG6A 4OFMA 5GZZB 3TGZA 3ME7A 5D8IA 3TKPA 1K3OA 1E2YA 2XPEA 3EU3A 1F37A 1ZYQB 2KUCA 2H70A 5GSTA 4EVMA 1YJ6A 3MNGA 4F2IA 4E8HA 3APQA 5J9BA 3GHAA 4O32A 1B9YC 4MP4A 2D2ZA 3EURA 1LU4A 2NDOA 3DYRA 3IDVA 2B3SA 2LEGA 5F0GA 2JZSA 2OBIA 3GL5A 4TR0A 1TW9A 1GSDA 1K0CA 2JL4A 19GSA 3KTLA 4ECIA 4Q5FA 2A4VA 3ZVJA 1SJZA 1YF1A 3PH9A 2TRCP 1G7OA 1M2BA 3MDKA 4IQAA 2ES7A 2VUPA 4KH7A 1EP8A 2K9FA 2RUFA 1HNAA 1A0FA 2FD3A 2VLTA 3HY2A 4G9HA 1Z7PA 4O5RA 4MK3A 5IPGA 3WT1A 1O6JA 1T8EB 3ZIJA 3F9UA 1A23A 3KZQA 2DJ3A 3F3QA 5CYYA 4TOPA 2XBQA 2AUVA 2HRFA 4RUVA 5HFIA 2RIIA 2YV7A 2ZUPA 1SD8A 1YKAA 5G5EA 1RQMA 1EV9A 2VM2A 3GIXA 2O85A 3ZMKA 2HLSA 3E9JB 3P7XA 4POBA 3QPMA 5IMZA 3GN3A 3L4NA 3L9VA 3NZNA 5JWRB 1ERUA 4ECJA 2LRCA 1K3LA 4HDEA 3D22A 3KMNA 4WR4A 3ZVJD 4KGIA 3M8NA 2FY6A 4IN0A 1YKCA 2F9SA 1AQVA 3UL3A 1MDJA 5DJLA 1QK8A 4MJCA 20GSA 3D5JA 1UC7A 1YF0A 2F51A 3Q18A 2HZEA 2VL2A 2RUEA 3SBCA 2C0FA 2LNSA 5ECSA 5IO0A 3JCML 1SK2A 4L0UA 4WXTA 2CAIA 4MH2A 3APOA 4KSMA 1ZMAA 1M7TA 4JR6A 3HZ8A 3KEBA 1EEJA 1XWKA 2HRNA 4XRAA 4IJIA 3G7JA 2FGXA 2MMAA 4K9ZA 3M3MA 4IJ3A 4K8MA 1VF3A 5D9WA 3F4SA 2X8HA 2IJYA 4J56E 2KOKA 5DCHA 1W4VA 2CT6A 10GSA 1AQXA 3SWLA 1I5GA 1I9DA 5J5NA 3GFKA 3QDNA 4TKYA 2G2QA 2L6CA 2C3NA 1THOA 4NXIA 3FZ9A 1M99A 3KH9A 3C1SA 4AGSA 3KM6A 4PNGA 3RBTA 2L4QA 4WEYA 4XCSA 3IR4A 3ED3A 3HVSA 1BAYA 4GLTA 1T4ZA 2OBKA 4TR1A 1A8LA 4X1UA 3DGQA 3GRXA 4G2EA 4KUNA 5FWGA 4IKHA 3GKNA 2N5BA 2J9HA 2AAWA 2ALBA 3HZ4A 2MMZA 3UOMA 2B5YA 2OADA 3TRPA 1M9AA 2LJRA 4FYUA 4IHUA 3A3TA 3TJJA 4ZL7A 3A2WA 1GUHA 3PINA 1URMA 2GGTA 2B1LA 2LNTA 4MH3A 3ZZXA 1WRYA 2YN1A 3IK9A 2OE0A 1GUMA 1GL8A 4IW9A 2Z9SA 3IK7A 2QGVA 4KSOA 3C8EA 3UVTA 2H19A 1JZRA 1HD2A 4X43A 1M9BA 2LUSA 2LJAA 5DCGA 1NM3A 3TKSE 1V57A 5JWQB 4PUFC 2VD1A 4PURA 4NV2A 1V58A 1TOFA 1GRXA 3LJRA 5KN1A 5B8BA 2GZYA 4NWYA 2RM6A 3O76A 4GSNA 1VF1A 2WULA 1F9MA 3KTBA 1XOAA 1BX9A 2OKAA 5G1LA 5D9XA 4MZCA 3C1RA 1K0NA 4XHMA 1TRVA 3HXSA 3KCMA 3IOSA 3FZAA 3GTUB 4HEA2 1PKZA 2H1GA 5AN1A 1A8YA 1WPIA 1O73A 2FWFA 3TB2A 4CDOA 3C71A 3I9V2 4DSSB 3LGCA 3HCZA 2K6VA 5J4UA 3HJOA 3HJPA 3PGTA 2VCZA 3TKQA 4K7IA 4PNFA 1O85A 4I2UA 2YOIA 3DMLA 3FY7A 4POMA 4EE0A 1FB6A 2HSHA 3GKXA 3CSHA 2WDUA 2G0FA 4X0XA 5G1KA 2E0QA 2O89A 1ST9A 1EEMA 4QL9A 2YWIA 3EMXA 3KP8A 4JRRA 2MZCA 1ZL9A 4EKZA 3DXBA 1X5CA 5AIVA 2K8SA 5ECHB 2N5FA 4MF5A 4HJ2A 1GSYA 4RQXA 4GXZA 5KN3A 5DQSA 4D73B 3A2VA 2B7JA 5B8AA 3RDWA 4JBBA 1M2DA 1A2MA 2YPMA 2B7KA 3RPPA 3F63A 1GWCA 3VI7A 4GF0A 2YNXA 4XTSA 3FRCA 2X64A 2AJQB 2AB6A 1OYJA 1F3AA 2VL3A 1NHOA 2F8AA 4L5OA 1OC9A 3E0UA 3KP9A 1U3AA 2YV9A 4V1Ap 1MEKA 1SK1A 3IBHA 3TKSA 5F8BA 1Z9HA 1TU7A 4KW6A 1R5AA 4OD7A 3QFBC 3Q19A 5L71A 4MJAA 2GQMA 4AJ7A 4ECCA 4MPFA 2GZZA 5JCGA 5DBQA 3F4RA 3FZ5A 4K1FA 4BA7A 4N11A 5F06A 4KB3A 4EO3A 1BQ7A 4ACSA 2EC4A 3HVVA 1ACVA 4WBRD 4TXVA 5F05A 4MA9A 3BBYA 2VLVA 2GT6A 4HJMA 2HT9A 4EXJA 1WMJA 1HNBA 4POKA 1F6MC 4KE3A 2GLRA 4FYBA 3IE3A 4F9ZA 3ZITA 4IP1A 3QFAC 4IS0A 2WRTA 2VM1A 1DE2A 1UN2A 2C0EA 1XVWA 3GMFA 3FR6A 3G7IA 4NV5A 4ISDA 4ZILA 4MLYA 5D96A 5EL8A 1WP0A 3CSIA 5IMVA 5ECOB 4F0CA 5IMAA 4HS1A 5DAKA 1SL1B 1O81A 2V1MA 3LFLA 4N0VA 3LYPA 6GSTA 5ECLB 2HXKA 4PQHA 5IO2A 1W89A 3D4TA 4N0ZA 3ZYWA 3ZRDA 4ILFA 3LYKA 1A24A 5EY6A 1HNCA 1JHBA 2KLXA 5DALA 3U5RE 2CAQA 4TXOA 1DBYA 4K0GA 3DIEA 1TK0B 4HZ4A 1SU9A 2HZEB 3G9BA 4JEDA 3IAM2 3LQ7A 3KGKA 1H75A 5J41A 2L59A 3VFIA 2TRXA 3D21A 1B9XC 3UIWA 5F07A 1ZGNA 1CQGA 2X8GA 5C00A 3A5WA 2H71A 2IMFA 2IFQA 1FVKA 5A4VA 3RHBA 5INYA 5H5RA 2AHEA 5HR1A 3BD2A 2VO4A 13GSA 2VD0A 4PQIA 4EL1A 3F6FA 2LQQA 2MBSA 1PL1A 1EOGA 4EC0A 1R26A 2R37A 5HFGA 2KHPA 6GSWA 4Q5RA 1K0DA 1XPVA 3IHQA 1PRXA 2PWJA 3WYWA 4YAPA 1EGOA 4LMWA 2DIYA 1IYIA 1FW1A 3OR5A 4TR1B 2JSYA 1EV4A 2H72A 2L6DA 4PQ1A 4DSRA 2R4VA 1TU8A 2M80A 2V41A 3D4MA 3QCPA 1MDIA 3DVWA 1FVJA 3DKSA 1A0RP 22GSA 5IMCA 4O7HA 1SD9A 2MYGA 2C8UA 2IMKA 3GH9A 1O8WA 4JZQA 4HUAA 1JZOA 1UVZA 3EVIA 5ELGA 2CVBA 4MDCA 4KX4A 2HNLA 4OCFA 5IIZA 1JLVA 4K7NA 17GSA 3F0IA 2LRTA 4I5QA 1DE1A 5JCUA 11GSA 3ZMLA 2A2RA 1S3AA 3HKRA 5CRWA 1YY7A 4MZBA 1Y6EA 4MCUA 3H1NA 4TVEA 3O3TA 4P3YB 2WGRA 1OE7A 4JR4A 1ON4A 1F3BA 4KDXA 1A2LA 2DJ0A 2YZHA 6GSVA 5GAPD 1YEPA 3NOFA 1F2EA 1TI1A 1OC8A 4QQ7A 3APSA 3ERFA 2L5OA 2C4JA 1PL2A 5ECPB 3ERWA 3L0HA 1VF4A 4K6XA 3TRQA 1J9BA 2C0DA 2B5EA 4KA0A 2DJKA 3TJBA 4GQCA 1KBNA 5ECQB 4I6XA 2CVDA 16GSA 3HA9A 1XW5A 5IM9A 4J57E 1GTIA 5B6NA 3HJMA 3FZ4A 1FHEA 5E59A 3E3EA 5CRGA 2V6OA 1PD21 1M2AA 4L0WA 3WT2A 4YH2A 1MDKA 2NBSA 4V2MA 2RLIA 3W8SA 3N9JA 3DD3A 2H1DA 3KJYA 4DVCA 3TRXA 2I1UA 4GSTA 2C3TA 2DIZA 1NW2A 1BYEA 1K0MA 3H4KA 4IGJA 5CRHA 3CRUA 4YQMA 6GSSA 1Z6NA 1TTZA 1ILOA 2IMEA 4L5LA 1TK8B 2WS2A 4IELA 3L9SA 3EE2A 3VLNA 4JU5A 3D0ZA 5COHA 5LNKe 2DC5A 1GSEA 4F82A 1IYHA 5ABRA 3G7YA 4XS4A 2DJJA 3L78A 2YWNA 1NHYA 1N2AA 5J3RA 3GA4A 3F8UA 4HU7A 2K8VA 4EDZA 2H01A 4ZB6A 3VWUA 5FT3A 4TR3A 5ID2A 3TCOA 2LS5A 1OC9B 2GSSA 1ZYEA 4MF6A 1GTAA 2VL2C 3CYNA 3ZL5A 3HHVA 5IQYA 2I3YA 5ECMB 2H1AA 1AAZA 1PX7A 4J2FA 5AIXA 3CRTA 4KDYA 4V2LA 1KTEA 5D73A 3P90A 1USBA 4ZBDA 2H74A 2IMIA 3UEMA 2VCWA 1GP1A 3EC3A 2MMOA 2AV4A 2DMLA 1Z7RA 2A2SA 1T4YA 3DEXA 2H0HA 2ZCTA 3QOUA 3H8QA 3IC4A 2H6ZA 3GX8A 1B48A 2LRNA 3IV4A 3LORA 4V2NA 3QAGA 1EZKA 2EIRA 4HZ2A 3CMIA 2OJLA 4TN8A 3DVXA 2P5QA 3UJ1A 1PX6A 4BWQA 1TKDB 2GVPA 1Z3EA 2GSTA 1AW9A 1TRUA 5ENUA 2IIYA 2PBJA 2YANA 1ZCPA 3LWAA 1MD3A 5CP1A 3I6AA 1V9WA 4LMVA 3TOUA 4RQRA 2CA8A 5DQYA 4KCAA 1J0FA 4YQUA 1GNWA 1PQNA 1UA5A 1PMTA 1H4OA 2FWGA 2JADA 4H86A 3ZLPA 5C04A 4AF2A 4ZL8A 5DAKB 1RW1A 1HYUA 1M0UA 3CTGA 1Z6MA 2YJHA 1B8XA 1T1VA 1SL2B 5EPFA 2JSZA 1J08A 1SL0B 1EGRA 2V32A 4WF4A 1U3IA 2FWEA 4YQVA 1ERVA 2NPBA 4N10A 1TRSA 3CTFA 5DJMA 3TOTA 7GSSA 3UARA 2O87A 5DALB 3KIJA 2I9HA 3P8WA 1CQHA 4TXOB 1T7PB 2P31A 2H1BA 4IP6A 3EINA 4YAVA 2YZUA 1XZOA 2WFCA 1PKWA 1ERTA 5JCWA 3TJGA 4KDUA 1U6TA 2E7PA 2AYTA 4F03A 1GSQA 4ZIJA 2IFQB 2X99A 1X9WB 2GDRA 4WF5A 3GKKA 3QD9A 2IPAA 3HDCA 4NPBA 3H79A 2JZTA 3VWVA 5IOXA 4FH8A 3TDGA 3VK9A 1PGTA 3KD0A 4HI7A 1S3CA 4HU9A 1GLQA 3Q74A 4OCEA 3F6DA 5IPHA 5J9CA 3M9KA 4V1Ag 1ML6A 2H73A 2PPTA 2H0IA 2QSIA 3I43A 4OWYA 3QAWA 5CO3A 5ELAA 3TJKA 2GZPA 1GTBA 1WJKA 5KEJA 5IMFA 1DSBA 4NHZA 2IN3A 2B5XA 4Z7XA 3LXTA 4WR5A 2HE3A 3AY8A 1AC1A 1Q98A 4BL7A 1O7UA 1O8XA 4BVXA 1AXDA 1SKWB 1SKRB 2H66A 3W8JA 1WWJA 1QQ2A 3FEUA 2GS3A 1SENA 2CZ3A 4L8EA 1XVQA 5G5FA 1PN9A 2QKEA 1AUCA 1RK4A 3FR3A 2VCTA 3ZTLA 5ECNB 3QAVA 2BJXA 2GQKA 2HSYA 1JLWA 3D6IA 3ZIVA 2TIRA 4RI7A 1TJDA 4G19A 1A2JA 2XPDA 5D9TA 18GSA 3TKSC 3J7Yb 3H93A 3RAZA 4D73A 4GQFA 1EP7A 3CXGA 1TK5B 1R5PA 4K7OA 2YWMA 2CV4A 5IMDA 2L5LA 1TI3A 3ZREA 3LSZA 2KP2A 1G0TA 4I2TA 4K0NA 2YCDA 1GNEA 1U87A 2PN8A 4NMUA 2WB9A 3GNJA 4KNDA 1XCCA 3UBLA 2GSRA 2FCHA 3IA1A 1C72A 4I8BA 1BJXA 2I81A 1DUGA 3LEFA 3LXZA 1VGLA 3TJFA 1ABAA 2N5AA 1VRSD 3EMPA 3F3RA 5ECRB 3EU4A 2GTUA 4ZB8A 2OACA 4OO5A 3QR6A 3UVHA 2H8LA 2VCQA 1K0AA 4WKWA 1BG5A 4NAXA 2DMMA 4OMVA 2V2GA 2O7KA 1OKTA 4ZBAA 1QXHA 4N30A 2MMNA 2C0GA 1R4WA 3HD5A 4XS4B 1TP9A 2PUKC 2L4CA 2RM5A 4ZL9A 1XOBA 2DJ2A 1ERWA 5GSSA 2H76A 4PX1A 3DWVA 3GH6A 2OE3A 5ECKB 4XIHA 1OE8A 5ID2B 4OO4A 1X5EA 3MAKA 1NSWA 1X0RA 1Q4JA 2XC2A 2B1KA 4GTUA 1FOVA 2ZNMA 1GTUA 3CSJA 1SK0A 5CRDA 1OVNA 3L9UA 3IAS2 3VURA 3KH7A 1SYXA 2QC7A 3GSTA 2EIQA 3C7MA 1GUKA 2GQLA 1YQ1A 1V2AA 4I97A 2VCVA 4TRXA 4POLA 5H5QA 4GSSA 1QGVA 4CHSA 5HR3A 3GSSA 3IRAA 2BTOT 1WOUA 2XBIA 1XXUA 1HQOA 1GSFA 1K0BA 4PUAA 1AIUA 5ECIB 3W6GA 1K0OA 3GUSA 5B6MA 14GSA 1PA3A 1SJIA 4JE1A 1R7HA 3GX0A 4BPYA 2LJKA 2L57A 2VIMA 4AJ6A 3A2XA 2DJ1A 4PGTA 1TDIA 4TW5A 3M1GA 4MF7A 2WJUA 3PR8A 4KCEA 4NHWA 3FYGA 2H0GA 4KAEA 3UAPA 2BMXA 5D93A 4O92A 2IMDA 1XBSA 5JWOB 5KN2A 1XWCA 1XWGA 4LL4B 5B7CA 4ML6A 3GV1A 2REMA 1AQWA 1GH2A 3WGDA 2YJ7A 4ZB9A 12GSA 3HVXA 3VWWA 3FR9A 3U6VA 2M46A 5KN0A 4GRFA 4DSQA 2V6KA 4XS6A 2PMTA 3M0FA 4MPGA 3WGXA 3BJ5A 3GKMA 1XW9A 1EWXA 3ME8A 4OFNA 4E8EA 2CX4A 4IBPA 1X9SB 3J7Yk 5GAND 5D9VA 2VAFA 2KP1A 4XS1A 2JU5A 3KXOA 3WGEA 2YP6A 1Y25A 1GSSA 4WBJA 4EUYA 8GSSA 2B6MA 2FNOA 2VOCA 1GULA 2FWHA 5HFKA 2HI7A 1V98A 2YWOA 2PVQA 3QMXA 5G31A 3FKFA 1QMVA 2VCXA 2X8CA 4OFTA 2P0GA 5DVBA 2E2MA 1GSUA 1XWBA 1VF2A 4MABA 3N5OA 1U88A 2GSQA 3VPQA 2PVOC 4ID0A 3ZFLA 2WZ9A 2F8FA 1G6YA 3BCIA 4G10A 3M9JA 2ON5A 4DEJA 2IL3A 3GYKA 1EOHA 2EIOA 2LTKA 2DSAA 3MWHA 1B4QA 1OAZA
chains in the Genus database with same CATH superfamily
1YDKA 1T3BA 4WETA 2O8VB 2LQOA 3ISOA 4EDYA 3Q6OA 4EF0A 3S9FA 1G6WA 4MJEA 1X9MB 1T00A 3K8NA 4BL7B 4EIPA 1GLPA 4K2DA 3BCKA 2R6KA 5A4WA 4ZXGA 4BVXB 3KMOA 1XIYA 2NTOA 4HSCX 4Q5QA 2MBTA 4F0BA 1SJ6A 3ERGA 4BVYA 2DKIA 2ON7A 4YKFA 3GURA 4BWSA 5EVOA 2LKUA 3VI5A 2R2JA 3WD6A 2XHFA 4RI6A 5CNWA 5FHIA 1WIKA 5A5KA 2DBCA 1N8JA 2CVKA 3RPNA 2FHEA 1LBKA 5AISA 3FHKA 3RHCA 1BEDA 4HQZA 2DLXA 3MSZA 1TXXA 1MD4A 2H6YA 2HZFA 4HQSA 4LLRA 3FW2A 5DDLA 1LJRA 2R0PA 4FIWA 4MNNA 4FYCA 2OE1A 3CBUA 3ZFBA 5HR2A 2PU9C 4GWRA 1ZYNA 1B4PA 5LCZA 2FUG2 2I4AA 4ZBBA 5CREA 4MJBA 3O6TA 1V40A 2R5GA 2R0GA 1OC3A 1E6BA 2C80A 1FB0A 4ML1A 1KNGA 2JACA 4XRDA 5G30A 5HQPA 2H30A 2K18A 3US3A 2H75A 3R3EA 1X5DA 3EWLA 2VLUA 3C73A 1ZZYA 3HYPA 1K3YA 2FA4A 3UBKA 3VWXA 1WE0A 3P2AA 3DRNA 2IWTA 5E4WA 4Q5NA 1QUWA 2P5RA 6GSUA 1YEXA 2GT5A 3I69A 2R3XA 4HOJA 2PERA 1XFLA 4PXOA 5AGYA 3IPZA 5H5SA 4IQ1A 3VPTA 2FLSA 2J23A 5IOWA 2C1YA 3NIVA 6GSYA 1TRWA 1JZDA 4QL7A 1SKSB 4ECBA 2LSTA 1FAAA 2JZRA 2X4AA 1PSQA 1QFNA 3EYTA 2HFDA 3GTUA 2CZ2A 4MMMA 4AJ8A 3UMAA 3V1WA 1YZXA 2CX3A 4DSSA 1FG4A 2PGTA 2LV3A 3F4TA 3TKRA 1OKDA 2NVLA 4LA1A 2C3QA 3FK8A 3R2QA 4FO5A 2H6XA 2M72A 1Z5YE 4IVFA 1G7EA 4LL1B 6GSXA 2F3MA 2WCIA 4Z2UA 1JZWA 1JFUA 5CAXA 2VL9A 3GL3A 3TUEA 1THXA 4ULXA 3IXRA 5LD0A 2E2GA 1FO5A 4GCIA 9GSSA 4TR4A 2FA8A 2CQ9A 1KEBA 3BOAA 2OA7A 1S3DA 5G2ZA 5HR0A 4MZWA 4CW9A 2HYXA 1ZOFA 1SYRA 5BRTA 1MTCA 5A4UA 1XW6A 1XWAA 3LG6A 4OFMA 5GZZB 3TGZA 3ME7A 5D8IA 3TKPA 1K3OA 1E2YA 2XPEA 1M3JA 3EU3A 1F37A 1ZYQB 2KUCA 2H70A 5GSTA 4EVMA 1YJ6A 3MNGA 4F2IA 4E8HA 3APQA 5J9BA 3GHAA 4O32A 1B9YC 4MP4A 2D2ZA 3EURA 1LU4A 2NDOA 3DYRA 1PN0A 3IDVA 2B3SA 4CY6A 2LEGA 5F0GA 2JZSA 2OBIA 3GL5A 4TR0A 1TW9A 1GSDA 1K0CA 2JL4A 19GSA 3KTLA 4ECIA 4Q5FA 2A4VA 3ZVJA 1SJZA 1YF1A 3PH9A 2TRCP 4USSA 1G7OA 1M2BA 3MDKA 4IQAA 2ES7A 2VUPA 4KH7A 1EP8A 2K9FA 2RUFA 1HNAA 1A0FA 2FD3A 2VLTA 3HY2A 4G9HA 1Z7PA 4O5RA 4MK3A 5IPGA 3WT1A 1O6JA 1T8EB 3ZIJA 3F9UA 1A23A 3KZQA 2DJ3A 3F3QA 5CYYA 4TOPA 2XBQA 5BMUA 2AUVA 2HRFA 4RUVA 5HFIA 2RIIA 2YV7A 2ZUPA 1SD8A 1YKAA 5G5EA 1RQMA 1EV9A 2VM2A 3GIXA 2O85A 2A2PA 3ZMKA 2HLSA 3E9JB 3P7XA 4POBA 3QPMA 5IMZA 3GN3A 3L4NA 3L9VA 3NZNA 5JWRB 1ERUA 4ECJA 2LRCA 1K3LA 4HDEA 3D22A 3KMNA 4WR4A 3ZVJD 4KGIA 5KOWA 3M8NA 2FY6A 4IN0A 1YKCA 2F9SA 1AQVA 3UL3A 1MDJA 5DJLA 1QK8A 4MJCA 20GSA 3D5JA 1UC7A 1YF0A 2F51A 3Q18A 2HZEA 2VL2A 2RUEA 3SBCA 2C0FA 2LNSA 2QA2A 5ECSA 5IO0A 3JCML 1SK2A 4L0UA 4WXTA 2CAIA 4MH2A 3APOA 4KSMA 1ZMAA 1M7TA 4JR6A 3HZ8A 3KEBA 1EEJA 1XWKA 2HRNA 4XRAA 4IJIA 3G7JA 2FGXA 2MMAA 4K9ZA 3M3MA 4IJ3A 4K8MA 1VF3A 5D9WA 3F4SA 2X8HA 2IJYA 4J56E 2KOKA 5DCHA 1W4VA 2CT6A 10GSA 1AQXA 3SWLA 1I5GA 1I9DA 4Z2RA 5J5NA 3GFKA 3QDNA 4TKYA 2G2QA 2L6CA 2R0CA 2C3NA 1THOA 4NXIA 3FZ9A 1M99A 3KH9A 3C1SA 4AGSA 3KM6A 4PNGA 3RBTA 2L4QA 4WEYA 4XCSA 3IR4A 3ED3A 3HVSA 1BAYA 4GLTA 1T4ZA 2OBKA 4TR1A 1A8LA 4X1UA 3DGQA 3GRXA 4G2EA 4KUNA 5FWGA 4IKHA 3GKNA 2N5BA 2J9HA 2AAWA 2ALBA 4PTSA 3HZ4A 2MMZA 3UOMA 2B5YA 2OADA 3TRPA 1M9AA 2LJRA 4FYUA 4IHUA 3A3TA 3TJJA 4ZL7A 3A2WA 1GUHA 3PINA 1URMA 2GGTA 2B1LA 2LNTA 4MH3A 3ZZXA 1WRYA 2YN1A 3IK9A 2OE0A 1GUMA 1GL8A 4IW9A 2Z9SA 3IK7A 2QGVA 4KSOA 3C8EA 3UVTA 2H19A 1JZRA 1HD2A 4X43A 1M9BA 2LUSA 2LJAA 5DCGA 1NM3A 4A5PA 3TKSE 1V57A 5JWQB 4PUFC 2VD1A 4PURA 4NV2A 1V58A 1TOFA 1GRXA 3LJRA 5KN1A 5B8BA 2GZYA 4NWYA 2RM6A 3O76A 4GSNA 1VF1A 2WULA 1F9MA 3KTBA 1XOAA 1BX9A 2OKAA 5G1LA 5D9XA 4MZCA 3C1RA 1K0NA 4XHMA 1TRVA 3HXSA 3KCMA 3IOSA 3FZAA 3GTUB 4HEA2 1PKZA 2H1GA 5AN1A 1A8YA 1WPIA 1O73A 2FWFA 3TB2A 4CDOA 3C71A 3I9V2 4DSSB 3LGCA 3HCZA 3PPUA 2K6VA 5J4UA 3HJOA 3HJPA 3PGTA 2VCZA 3TKQA 4K7IA 4PNFA 1O85A 4I2UA 2YOIA 3DMLA 3FY7A 4POMA 4EE0A 1FB6A 2HSHA 3GKXA 3CSHA 2WDUA 2G0FA 4X0XA 5G1KA 2E0QA 2O89A 1ST9A 1EEMA 4QL9A 2YWIA 3EMXA 3KP8A 4JRRA 1ZYPA 4Z2TA 2MZCA 1ZL9A 4EKZA 3DXBA 1X5CA 5AIVA 2K8SA 5ECHB 2N5FA 4MF5A 4HJ2A 1GSYA 4RQXA 4GXZA 4O5UA 5KN3A 5DQSA 4D73B 3A2VA 2B7JA 5B8AA 3RDWA 4JBBA 1M2DA 1A2MA 2YPMA 2B7KA 3RPPA 3F63A 1GWCA 3VI7A 4GF0A 2YNXA 4XTSA 3FRCA 2X64A 2AJQB 2AB6A 1OYJA 1F3AA 2VL3A 1NHOA 2F8AA 4L5OA 1OC9A 3E0UA 3KP9A 4K2XA 1U3AA 2YV9A 4V1Ap 1MEKA 1SK1A 3IBHA 3TKSA 5F8BA 1Z9HA 1TU7A 4KW6A 1R5AA 2QA1A 4OD7A 3QFBC 3Q19A 5L71A 4MJAA 2GQMA 4X4JA 4AJ7A 4ECCA 4MPFA 2GZZA 5JCGA 5DBQA 3F4RA 3FZ5A 4K1FA 4BA7A 4N11A 5F06A 4KB3A 4EO3A 1BQ7A 4ACSA 2EC4A 3HVVA 1ACVA 4WBRD 3MIXA 4TXVA 5F05A 4MA9A 3BBYA 2VLVA 2GT6A 4HJMA 2HT9A 4EXJA 1WMJA 1HNBA 4POKA 1F6MC 4KE3A 2GLRA 4FYBA 3IE3A 4F9ZA 3ZITA 4IP1A 3QFAC 4IS0A 2WRTA 2HSMA 2VM1A 1DE2A 1UN2A 2C0EA 1XVWA 3GMFA 3FR6A 3G7IA 4NV5A 4ISDA 4ZILA 4MLYA 5D96A 5EL8A 1WP0A 3CSIA 5IMVA 5ECOB 4F0CA 5IMAA 4HS1A 5DAKA 1SL1B 1O81A 2V1MA 3LFLA 4N0VA 3LYPA 6GSTA 5ECLB 2HXKA 4PQHA 5IO2A 1W89A 3D4TA 4N0ZA 3ZYWA 3ZRDA 4ILFA 3LYKA 1A24A 5EY6A 1HNCA 1JHBA 2KLXA 2UZ8A 5DALA 3U5RE 2CAQA 4TXOA 1DBYA 4K0GA 3DIEA 1TK0B 4HZ4A 1SU9A 2HZEB 3G9BA 4JEDA 3IAM2 3LQ7A 3KGKA 1H75A 5J41A 2L59A 3VFIA 2TRXA 4G0KA 3D21A 1B9XC 3UIWA 5F07A 1ZGNA 1CQGA 2X8GA 5C00A 3A5WA 2H71A 2IMFA 2IFQA 1FVKA 5A4VA 3RHBA 5INYA 5H5RA 2AHEA 3A5IA 5HR1A 3BD2A 2VO4A 13GSA 2VD0A 4PQIA 1PFOA 4EL1A 3F6FA 2LQQA 2MBSA 1PL1A 1EOGA 4EC0A 4FQUA 1R26A 2R37A 5HFGA 2KHPA 6GSWA 4Q5RA 1K0DA 1XPVA 3IHQA 1PRXA 2PWJA 3WYWA 3IHGA 4YAPA 1EGOA 4LMWA 2DIYA 1IYIA 1FW1A 3OR5A 4TR1B 2JSYA 1EV4A 2H72A 2L6DA 4PQ1A 4DSRA 1XG8A 2R4VA 1TU8A 2M80A 2V41A 3D4MA 3QCPA 1MDIA 3DVWA 1FVJA 3DKSA 1A0RP 22GSA 5IMCA 4O7HA 1SD9A 2MYGA 2C8UA 2IMKA 3GH9A 1O8WA 4JZQA 4HUAA 1JZOA 1UVZA 3EVIA 5ELGA 2CVBA 4MDCA 4KX4A 2HNLA 4OCFA 5IIZA 1JLVA 4K7NA 17GSA 3F0IA 2LRTA 4I5QA 1DE1A 5JCUA 11GSA 3ZMLA 2A2RA 1S3AA 4K5SA 3HKRA 5CRWA 1YY7A 4MZBA 1Y6EA 4MCUA 3H1NA 4TVEA 3O3TA 4P3YB 4KF9A 2WGRA 1OE7A 4JR4A 1ON4A 1F3BA 4KDXA 1A2LA 2DJ0A 2YZHA 6GSVA 5GAPD 1YEPA 3NOFA 1F2EA 1TI1A 1OC8A 4QQ7A 3APSA 3ERFA 2L5OA 2C4JA 1PL2A 5ECPB 3ERWA 3L0HA 1VF4A 4K6XA 3TRQA 1J9BA 2C0DA 2B5EA 4KA0A 2DJKA 3TJBA 4GQCA 1KBNA 5ECQB 4I6XA 5KOXA 2CVDA 3IC8A 16GSA 3FMWA 3HA9A 1XW5A 5IM9A 4J57E 1GTIA 5B6NA 3HJMA 3FZ4A 1FHEA 5E59A 3E3EA 5CRGA 2V6OA 1PD21 1M2AA 4L0WA 3WT2A 4YH2A 1MDKA 2NBSA 4V2MA 2RLIA 3W8SA 3N9JA 3DD3A 2H1DA 4BVYB 3KJYA 4DVCA 3TRXA 2I1UA 4O5QA 4GSTA 2C3TA 2DIZA 1NW2A 1BYEA 1K0MA 3H4KA 4IGJA 5CRHA 3CRUA 4YQMA 6GSSA 1Z6NA 1TTZA 4BIKA 1ILOA 2IMEA 4L5LA 1TK8B 2WS2A 4IELA 3L9SA 3EE2A 2DKHA 3VLNA 4JU5A 3D0ZA 5COHA 5LNKe 4G0LA 2DC5A 1GSEA 4F82A 1IYHA 5ABRA 3G7YA 4XS4A 2DJJA 3L78A 3EPTA 2YWNA 1NHYA 1N2AA 5J3RA 3GA4A 3F8UA 4HU7A 2K8VA 4EDZA 2H01A 4ZB6A 3VWUA 5FT3A 4TR3A 5ID2A 3TCOA 2LS5A 1OC9B 2GSSA 1ZYEA 4MF6A 1GTAA 2VL2C 3CYNA 3ZL5A 3HHVA 5IQYA 2I3YA 5ECMB 2H1AA 1AAZA 1PX7A 4J2FA 5AIXA 3CRTA 4KDYA 4V2LA 1KTEA 5D73A 3P90A 1USBA 4ZBDA 2H74A 2IMIA 3UEMA 2VCWA 1GP1A 3EC3A 2MMOA 2AV4A 2DMLA 1Z7RA 2A2SA 1T4YA 3DEXA 2H0HA 2ZCTA 3QOUA 3H8QA 3IC4A 2H6ZA 3GX8A 1B48A 2LRNA 3IV4A 3LORA 4V2NA 3QAGA 1EZKA 2EIRA 4HZ2A 3CMIA 2OJLA 4TN8A 3DVXA 2P5QA 3UJ1A 1PX6A 4BWQA 1TKDB 2GVPA 1Z3EA 2GSTA 1AW9A 1TRUA 5ENUA 2IIYA 2PBJA 2YANA 1ZCPA 3LWAA 1MD3A 5CP1A 3I6AA 1V9WA 4LMVA 3TOUA 4RQRA 2CA8A 5DQYA 4KCAA 1J0FA 4YQUA 1GNWA 1PQNA 1UA5A 1PMTA 1H4OA 2FWGA 2JADA 4H86A 3ZLPA 5C04A 4AF2A 4ZL8A 5DAKB 1RW1A 1HYUA 1M0UA 3CTGA 1Z6MA 2YJHA 1B8XA 1T1VA 1SL2B 5EPFA 2JSZA 1J08A 1SL0B 1EGRA 2V32A 4WF4A 1U3IA 2FWEA 4YQVA 1ERVA 2NPBA 4N10A 1TRSA 3CTFA 5DJMA 3TOTA 7GSSA 3UARA 2O87A 5DALB 3KIJA 2I9HA 3P8WA 1CQHA 4TXOB 1T7PB 2P31A 4CY8A 2H1BA 4IP6A 3EINA 4YAVA 2YZUA 1XZOA 2WFCA 1PKWA 1ERTA 5JCWA 3TJGA 4KDUA 1U6TA 2E7PA 2AYTA 4F03A 1GSQA 4ZIJA 2IFQB 2X99A 1X9WB 2GDRA 4WF5A 3GKKA 3QD9A 2IPAA 3HDCA 4NPBA 3H79A 1M3IA 2JZTA 3VWVA 5IOXA 4FH8A 3TDGA 3VK9A 1PGTA 3KD0A 4HI7A 1S3CA 4HU9A 1GLQA 3Q74A 4OCEA 3F6DA 5IPHA 5J9CA 3M9KA 4V1Ag 1ML6A 2H73A 2PPTA 2H0IA 2QSIA 3I43A 4OWYA 3QAWA 5CO3A 5ELAA 3TJKA 2GZPA 1GTBA 1WJKA 5KEJA 5IMFA 1DSBA 4NHZA 2IN3A 2B5XA 4Z7XA 3LXTA 4WR5A 2HE3A 3AY8A 1AC1A 4K5RA 1Q98A 4BL7A 1O7UA 1O8XA 4BVXA 1AXDA 1SKWB 1SKRB 2H66A 3W8JA 1WWJA 1QQ2A 3FEUA 2GS3A 4ICYA 1SENA 2CZ3A 4L8EA 1XVQA 5G5FA 1PN9A 2QKEA 1AUCA 1RK4A 3FR3A 2VCTA 3ZTLA 5ECNB 3QAVA 3LW9A 2BJXA 2GQKA 2HSYA 1JLWA 3D6IA 3ZIVA 2TIRA 4RI7A 1TJDA 4G19A 1A2JA 2XPDA 5D9TA 18GSA 3TKSC 3J7Yb 3H93A 3RAZA 4D73A 4GQFA 1EP7A 3CXGA 1TK5B 1R5PA 4K7OA 2YWMA 4EIQA 2CV4A 5IMDA 2L5LA 1TI3A 3ZREA 3LSZA 2KP2A 1G0TA 4I2TA 4K0NA 2YCDA 1GNEA 1U87A 2PN8A 4NMUA 2WB9A 3GNJA 4KNDA 1XCCA 3UBLA 2HRKA 2GSRA 2FCHA 3IA1A 1C72A 4I8BA 1BJXA 2I81A 1DUGA 3LEFA 3LXZA 1VGLA 3TJFA 1ABAA 2N5AA 1VRSD 3EMPA 3F3RA 5ECRB 3EU4A 2GTUA 4ZB8A 2OACA 4OO5A 3QR6A 3UVHA 2H8LA 2VCQA 1K0AA 4WKWA 1BG5A 4NAXA 2DMMA 4OMVA 2V2GA 2O7KA 1OKTA 4ZBAA 1QXHA 4N30A 2MMNA 2C0GA 1R4WA 3HD5A 4XS4B 1TP9A 2PUKC 2L4CA 2RM5A 4ZL9A 1XOBA 2DJ2A 1ERWA 5GSSA 2H76A 4PX1A 3DWVA 3GH6A 2OE3A 5ECKB 4XIHA 1OE8A 5ID2B 4OO4A 1X5EA 3MAKA 1NSWA 3MYDA 1X0RA 1Q4JA 2XC2A 2B1KA 4GTUA 1FOVA 2ZNMA 1GTUA 3CSJA 1SK0A 5CRDA 1OVNA 3L9UA 3IAS2 3VURA 3KH7A 1SYXA 2QC7A 1S3RA 3GSTA 2EIQA 3C7MA 1GUKA 2GQLA 1YQ1A 1V2AA 4I97A 2VCVA 4TRXA 4POLA 5H5QA 4GSSA 1QGVA 4CHSA 5HR3A 3GSSA 3IRAA 2BTOT 1WOUA 2XBIA 1XXUA 1HQOA 1GSFA 1K0BA 4PUAA 1AIUA 5ECIB 3W6GA 1K0OA 3GUSA 5B6MA 14GSA 1PA3A 1SJIA 4JE1A 1R7HA 3GX0A 4G0IA 4BPYA 2LJKA 2L57A 2VIMA 4AJ6A 3A2XA 2DJ1A 4PGTA 1TDIA 4TW5A 3M1GA 4MF7A 2WJUA 3PR8A 4KCEA 4NHWA 3FYGA 2H0GA 3CQFA 2HRAA 4KAEA 3UAPA 2BMXA 5D93A 2X49A 4O92A 2IMDA 1XBSA 5JWOB 5KN2A 1XWCA 1XWGA 4LL4B 5B7CA 4ML6A 3GV1A 2REMA 1AQWA 1GH2A 3WGDA 2YJ7A 4ZB9A 12GSA 3HVXA 3VWWA 3FR9A 3U6VA 2M46A 5KN0A 4GRFA 4DSQA 2V6KA 4XS6A 2PMTA 3M0FA 4MPGA 3WGXA 3BJ5A 3GKMA 1XW9A 1EWXA 2A4HA 3ME8A 4OFNA 4E8EA 2CX4A 4IBPA 1X9SB 3J7Yk 5GAND 5D9VA 2VAFA 2KP1A 4XS1A 2JU5A 3KXOA 3WGEA 2YP6A 1Y25A 1GSSA 4WBJA 4EUYA 8GSSA 2B6MA 2FNOA 2VOCA 1GULA 1FOHA 2FWHA 5HFKA 2HI7A 1V98A 2YWOA 2PVQA 3QMXA 5G31A 3FKFA 1QMVA 2VCXA 2X8CA 4OFTA 2P0GA 5DVBA 2E2MA 1GSUA 3HVNA 1XWBA 1VF2A 4MABA 3N5OA 1U88A 2GSQA 4YKGA 3VPQA 2PVOC 4ID0A 3ZFLA 2WZ9A 2F8FA 1G6YA 3BCIA 4G10A 3M9JA 2ON5A 4DEJA 2IL3A 3GYKA 1EOHA 2EIOA 2LTKA 2DSAA 3MWHA 1B4QA 1OAZA
chains in the Genus database with same CATH topology
1YDKA 1T3BA 4WETA 2O8VB 2LQOA 3ISOA 4EDYA 3Q6OA 4EF0A 3S9FA 1G6WA 4MJEA 1X9MB 1T00A 3K8NA 4BL7B 4EIPA 1GLPA 4K2DA 3BCKA 2R6KA 5A4WA 4ZXGA 4BVXB 3KMOA 1XIYA 2NTOA 4Q5QA 2MBTA 4F0BA 1SJ6A 3ERGA 4BVYA 2DKIA 2ON7A 4YKFA 3GURA 4BWSA 5EVOA 2LKUA 3VI5A 2R2JA 3WD6A 2XHFA 4RI6A 5CNWA 5FHIA 1WIKA 5A5KA 2DBCA 1N8JA 2CVKA 3RPNA 2FHEA 1LBKA 5AISA 3FHKA 3RHCA 1BEDA 4HQZA 2DLXA 3MSZA 1TXXA 1MD4A 2H6YA 2HZFA 4HQSA 4LLRA 3FW2A 5DDLA 1LJRA 2R0PA 4FIWA 4MNNA 4FYCA 2OE1A 3CBUA 3ZFBA 5HR2A 2PU9C 4GWRA 1ZYNA 1B4PA 5LCZA 2FUG2 2I4AA 4ZBBA 5CREA 4MJBA 3O6TA 1V40A 2R5GA 2R0GA 1OC3A 1E6BA 2C80A 1FB0A 4ML1A 1KNGA 2JACA 4XRDA 5G30A 5HQPA 2H30A 2K18A 3US3A 2H75A 3R3EA 1X5DA 3EWLA 2VLUA 3C73A 1ZZYA 3HYPA 1K3YA 2FA4A 3UBKA 3VWXA 1WE0A 3P2AA 3DRNA 2IWTA 5E4WA 4Q5NA 1QUWA 2P5RA 6GSUA 1YEXA 2GT5A 3I69A 2R3XA 4HOJA 2PERA 1XFLA 4PXOA 5AGYA 3IPZA 5H5SA 4IQ1A 3VPTA 2FLSA 2J23A 5IOWA 2C1YA 3NIVA 6GSYA 1TRWA 1JZDA 4QL7A 1SKSB 4ECBA 2LSTA 1FAAA 2JZRA 2X4AA 1PSQA 1QFNA 3EYTA 2HFDA 3GTUA 2CZ2A 4MMMA 4AJ8A 3UMAA 3V1WA 1YZXA 2CX3A 4DSSA 1FG4A 2PGTA 2LV3A 3F4TA 3TKRA 1OKDA 2NVLA 4LA1A 2C3QA 3FK8A 3R2QA 4FO5A 2H6XA 2M72A 1Z5YE 4IVFA 1G7EA 4LL1B 6GSXA 2F3MA 2WCIA 4Z2UA 1JZWA 1JFUA 5CAXA 2VL9A 3GL3A 3TUEA 1THXA 4ULXA 3IXRA 5LD0A 2E2GA 1FO5A 4GCIA 9GSSA 4TR4A 2FA8A 2CQ9A 1KEBA 3BOAA 2OA7A 1S3DA 5G2ZA 5HR0A 4MZWA 4CW9A 2HYXA 1ZOFA 1SYRA 5BRTA 1MTCA 5A4UA 1XW6A 1XWAA 3LG6A 4OFMA 5GZZB 3TGZA 3ME7A 5D8IA 3TKPA 1K3OA 1E2YA 2XPEA 3EU3A 1F37A 1ZYQB 2KUCA 2H70A 5GSTA 4EVMA 1YJ6A 3MNGA 4F2IA 4E8HA 3APQA 5J9BA 3GHAA 4O32A 1B9YC 4MP4A 2D2ZA 3EURA 1LU4A 2NDOA 3DYRA 1PN0A 3IDVA 2B3SA 4CY6A 2LEGA 5F0GA 2JZSA 2OBIA 3GL5A 4TR0A 1TW9A 1GSDA 1K0CA 2JL4A 19GSA 3KTLA 4ECIA 4Q5FA 2A4VA 3ZVJA 1SJZA 1YF1A 3PH9A 2TRCP 4USSA 1G7OA 1M2BA 3MDKA 4IQAA 2ES7A 2VUPA 4KH7A 1EP8A 2K9FA 2RUFA 1HNAA 1A0FA 2FD3A 2VLTA 3HY2A 4G9HA 1Z7PA 4O5RA 4MK3A 5IPGA 3WT1A 1O6JA 1T8EB 3ZIJA 3F9UA 1A23A 3KZQA 2DJ3A 3F3QA 5CYYA 4TOPA 2XBQA 5BMUA 2AUVA 2HRFA 4RUVA 5HFIA 2RIIA 2YV7A 2ZUPA 1SD8A 1YKAA 5G5EA 1RQMA 1EV9A 2VM2A 3GIXA 2O85A 2A2PA 3ZMKA 2HLSA 3E9JB 3P7XA 4POBA 3QPMA 5IMZA 3GN3A 3L4NA 3L9VA 3NZNA 5JWRB 1ERUA 4ECJA 2LRCA 1K3LA 4HDEA 3D22A 3KMNA 4WR4A 3ZVJD 4KGIA 5KOWA 3M8NA 2FY6A 4IN0A 1YKCA 2F9SA 1AQVA 3UL3A 1MDJA 5DJLA 1QK8A 4MJCA 20GSA 3D5JA 1UC7A 1YF0A 2F51A 3Q18A 2HZEA 2VL2A 2RUEA 3SBCA 2C0FA 2LNSA 2QA2A 5ECSA 5IO0A 3JCML 1SK2A 4L0UA 4WXTA 2CAIA 4MH2A 3APOA 4KSMA 1ZMAA 1M7TA 4JR6A 3HZ8A 3KEBA 1EEJA 1XWKA 2HRNA 4XRAA 4IJIA 3G7JA 2FGXA 2MMAA 4K9ZA 3M3MA 4IJ3A 4K8MA 1VF3A 5D9WA 3F4SA 2X8HA 2IJYA 4J56E 2KOKA 5DCHA 1W4VA 2CT6A 10GSA 1AQXA 3SWLA 1I5GA 1I9DA 4Z2RA 5J5NA 3GFKA 3QDNA 4TKYA 2G2QA 2L6CA 2R0CA 2C3NA 1THOA 4NXIA 3FZ9A 1M99A 3KH9A 3C1SA 4AGSA 3KM6A 4PNGA 3RBTA 2L4QA 4WEYA 4XCSA 3IR4A 3ED3A 3HVSA 1BAYA 4GLTA 1T4ZA 2OBKA 4TR1A 1A8LA 4X1UA 3DGQA 3GRXA 4G2EA 4KUNA 5FWGA 4IKHA 3GKNA 2N5BA 2J9HA 2AAWA 2ALBA 4PTSA 3HZ4A 2MMZA 3UOMA 2B5YA 2OADA 3TRPA 1M9AA 2LJRA 4FYUA 4IHUA 3A3TA 3TJJA 4ZL7A 3A2WA 1GUHA 3PINA 1URMA 2GGTA 2B1LA 2LNTA 4MH3A 3ZZXA 1WRYA 2YN1A 3IK9A 2OE0A 1GUMA 1GL8A 4IW9A 2Z9SA 3IK7A 2QGVA 4KSOA 3C8EA 3UVTA 2H19A 1JZRA 1HD2A 4X43A 1M9BA 2LUSA 2LJAA 5DCGA 1NM3A 4A5PA 3TKSE 1V57A 5JWQB 4PUFC 2VD1A 4PURA 4NV2A 1V58A 1TOFA 1GRXA 3LJRA 5KN1A 5B8BA 2GZYA 4NWYA 2RM6A 3O76A 4GSNA 1VF1A 2WULA 1F9MA 3KTBA 1XOAA 1BX9A 2OKAA 5G1LA 5D9XA 4MZCA 3C1RA 1K0NA 4XHMA 1TRVA 3HXSA 3KCMA 3IOSA 3FZAA 3GTUB 4HEA2 1PKZA 2H1GA 5AN1A 1A8YA 1WPIA 1O73A 2FWFA 3TB2A 4CDOA 3C71A 3I9V2 4DSSB 3LGCA 3HCZA 3PPUA 2K6VA 5J4UA 3HJOA 3HJPA 3PGTA 2VCZA 3TKQA 4K7IA 4PNFA 1O85A 4I2UA 2YOIA 3DMLA 3FY7A 4POMA 4EE0A 1FB6A 2HSHA 3GKXA 3CSHA 2WDUA 2G0FA 4X0XA 5G1KA 2E0QA 2O89A 1ST9A 1EEMA 4QL9A 2YWIA 3EMXA 3KP8A 4JRRA 1ZYPA 4Z2TA 2MZCA 1ZL9A 4EKZA 3DXBA 1X5CA 5AIVA 2K8SA 5ECHB 2N5FA 4MF5A 4HJ2A 1GSYA 4RQXA 4GXZA 4O5UA 5KN3A 5DQSA 4D73B 3A2VA 2B7JA 5B8AA 3RDWA 4JBBA 1M2DA 1A2MA 2YPMA 2B7KA 3RPPA 3F63A 1GWCA 3VI7A 4GF0A 2YNXA 4XTSA 3FRCA 2X64A 2AJQB 2AB6A 1OYJA 1F3AA 2VL3A 1NHOA 2F8AA 4L5OA 1OC9A 3E0UA 3KP9A 4K2XA 1U3AA 2YV9A 4V1Ap 1MEKA 1SK1A 3IBHA 3TKSA 5F8BA 1Z9HA 1TU7A 4KW6A 1R5AA 2QA1A 4OD7A 3QFBC 3Q19A 5L71A 4MJAA 2GQMA 4X4JA 4AJ7A 4ECCA 4MPFA 2GZZA 5JCGA 5DBQA 3F4RA 3FZ5A 4K1FA 4BA7A 4N11A 5F06A 4KB3A 4EO3A 1BQ7A 4ACSA 2EC4A 3HVVA 1ACVA 4WBRD 3MIXA 4TXVA 5F05A 4MA9A 3BBYA 2VLVA 2GT6A 4HJMA 2HT9A 4EXJA 1WMJA 1HNBA 4POKA 1F6MC 4KE3A 2GLRA 4FYBA 3IE3A 4F9ZA 3ZITA 4IP1A 3QFAC 4IS0A 2WRTA 2HSMA 2VM1A 1DE2A 1UN2A 2C0EA 1XVWA 3GMFA 3FR6A 3G7IA 4NV5A 4ISDA 4ZILA 4MLYA 5D96A 5EL8A 1WP0A 3CSIA 5IMVA 5ECOB 4F0CA 5IMAA 4HS1A 5DAKA 1SL1B 1O81A 2V1MA 3LFLA 4N0VA 3LYPA 6GSTA 5ECLB 2HXKA 4PQHA 5IO2A 1W89A 3D4TA 4N0ZA 3ZYWA 3ZRDA 4ILFA 3LYKA 1A24A 5EY6A 1HNCA 1JHBA 2KLXA 2UZ8A 5DALA 3U5RE 2CAQA 4TXOA 1DBYA 4K0GA 3DIEA 1TK0B 4HZ4A 1SU9A 2HZEB 3G9BA 4JEDA 3IAM2 3LQ7A 3KGKA 1H75A 5J41A 2L59A 3VFIA 2TRXA 4G0KA 3D21A 1B9XC 3UIWA 5F07A 1ZGNA 1CQGA 2X8GA 5C00A 3A5WA 2H71A 2IMFA 2IFQA 1FVKA 5A4VA 3RHBA 5INYA 5H5RA 2AHEA 3A5IA 5HR1A 3BD2A 2VO4A 13GSA 2VD0A 4PQIA 4EL1A 3F6FA 2LQQA 2MBSA 1PL1A 1EOGA 4EC0A 4FQUA 1R26A 2R37A 5HFGA 2KHPA 6GSWA 4Q5RA 1K0DA 1XPVA 3IHQA 1PRXA 2PWJA 3WYWA 3IHGA 4YAPA 1EGOA 4LMWA 2DIYA 1IYIA 1FW1A 3OR5A 4TR1B 2JSYA 1EV4A 2H72A 2L6DA 4PQ1A 4DSRA 2R4VA 1TU8A 2M80A 2V41A 3D4MA 3QCPA 1MDIA 3DVWA 1FVJA 3DKSA 1A0RP 22GSA 5IMCA 4O7HA 1SD9A 2MYGA 2C8UA 2IMKA 3GH9A 1O8WA 4JZQA 4HUAA 1JZOA 1UVZA 3EVIA 5ELGA 2CVBA 4MDCA 4KX4A 2HNLA 4OCFA 5IIZA 1JLVA 4K7NA 17GSA 3F0IA 2LRTA 4I5QA 1DE1A 5JCUA 11GSA 3ZMLA 2A2RA 1S3AA 4K5SA 3HKRA 5CRWA 1YY7A 4MZBA 1Y6EA 4MCUA 3H1NA 4TVEA 3O3TA 4P3YB 4KF9A 2WGRA 1OE7A 4JR4A 1ON4A 1F3BA 4KDXA 1A2LA 2DJ0A 2YZHA 6GSVA 5GAPD 1YEPA 3NOFA 1F2EA 1TI1A 1OC8A 4QQ7A 3APSA 3ERFA 2L5OA 2C4JA 1PL2A 5ECPB 3ERWA 3L0HA 1VF4A 4K6XA 3TRQA 1J9BA 2C0DA 2B5EA 4KA0A 2DJKA 3TJBA 4GQCA 1KBNA 5ECQB 4I6XA 5KOXA 2CVDA 3IC8A 16GSA 3FMWA 3HA9A 1XW5A 5IM9A 4J57E 1GTIA 5B6NA 3HJMA 3FZ4A 1FHEA 5E59A 3E3EA 5CRGA 2V6OA 1PD21 1M2AA 4L0WA 3WT2A 4YH2A 1MDKA 2NBSA 4V2MA 2RLIA 3W8SA 3N9JA 3DD3A 2H1DA 4BVYB 3KJYA 4DVCA 3TRXA 2I1UA 4O5QA 4GSTA 2C3TA 2DIZA 1NW2A 1BYEA 1K0MA 3H4KA 4IGJA 5CRHA 3CRUA 4YQMA 6GSSA 1Z6NA 1TTZA 1ILOA 2IMEA 4L5LA 1TK8B 2WS2A 4IELA 3L9SA 3EE2A 2DKHA 3VLNA 4JU5A 3D0ZA 5COHA 5LNKe 4G0LA 2DC5A 1GSEA 4F82A 1IYHA 5ABRA 3G7YA 4XS4A 2DJJA 3L78A 3EPTA 2YWNA 1NHYA 1N2AA 5J3RA 3GA4A 3F8UA 4HU7A 2K8VA 4EDZA 2H01A 4ZB6A 3VWUA 5FT3A 4TR3A 5ID2A 3TCOA 2LS5A 1OC9B 2GSSA 1ZYEA 4MF6A 1GTAA 2VL2C 3CYNA 3ZL5A 3HHVA 5IQYA 2I3YA 5ECMB 2H1AA 1AAZA 1PX7A 4J2FA 5AIXA 3CRTA 4KDYA 4V2LA 1KTEA 5D73A 3P90A 1USBA 4ZBDA 2H74A 2IMIA 3UEMA 2VCWA 1GP1A 3EC3A 2MMOA 2AV4A 2DMLA 1Z7RA 2A2SA 1T4YA 3DEXA 2H0HA 2ZCTA 3QOUA 3H8QA 3IC4A 2H6ZA 3GX8A 1B48A 2LRNA 3IV4A 3LORA 4V2NA 3QAGA 1EZKA 2EIRA 4HZ2A 3CMIA 2OJLA 4TN8A 3DVXA 2P5QA 3UJ1A 1PX6A 4BWQA 1TKDB 2GVPA 1Z3EA 2GSTA 1AW9A 1TRUA 5ENUA 2IIYA 2PBJA 2YANA 1ZCPA 3LWAA 1MD3A 5CP1A 3I6AA 1V9WA 4LMVA 3TOUA 4RQRA 2CA8A 5DQYA 4KCAA 1J0FA 4YQUA 1GNWA 1PQNA 1UA5A 1PMTA 1H4OA 2FWGA 2JADA 4H86A 3ZLPA 5C04A 4AF2A 4ZL8A 5DAKB 1RW1A 1HYUA 1M0UA 3CTGA 1Z6MA 2YJHA 1B8XA 1T1VA 1SL2B 5EPFA 2JSZA 1J08A 1SL0B 1EGRA 2V32A 4WF4A 1U3IA 2FWEA 4YQVA 1ERVA 2NPBA 4N10A 1TRSA 3CTFA 5DJMA 3TOTA 7GSSA 3UARA 2O87A 5DALB 3KIJA 2I9HA 3P8WA 1CQHA 4TXOB 1T7PB 2P31A 4CY8A 2H1BA 4IP6A 3EINA 4YAVA 2YZUA 1XZOA 2WFCA 1PKWA 1ERTA 5JCWA 3TJGA 4KDUA 1U6TA 2E7PA 2AYTA 4F03A 1GSQA 4ZIJA 2IFQB 2X99A 1X9WB 2GDRA 4WF5A 3GKKA 3QD9A 2IPAA 3HDCA 4NPBA 3H79A 2JZTA 3VWVA 5IOXA 4FH8A 3TDGA 3VK9A 1PGTA 3KD0A 4HI7A 1S3CA 4HU9A 1GLQA 3Q74A 4OCEA 3F6DA 5IPHA 5J9CA 3M9KA 4V1Ag 1ML6A 2H73A 2PPTA 2H0IA 2QSIA 3I43A 4OWYA 3QAWA 5CO3A 5ELAA 3TJKA 2GZPA 1GTBA 1WJKA 5KEJA 5IMFA 1DSBA 4NHZA 2IN3A 2B5XA 4Z7XA 3LXTA 4WR5A 2HE3A 3AY8A 1AC1A 4K5RA 1Q98A 4BL7A 1O7UA 1O8XA 4BVXA 1AXDA 1SKWB 1SKRB 2H66A 3W8JA 1WWJA 1QQ2A 3FEUA 2GS3A 4ICYA 1SENA 2CZ3A 4L8EA 1XVQA 5G5FA 1PN9A 2QKEA 1AUCA 1RK4A 3FR3A 2VCTA 3ZTLA 5ECNB 3QAVA 3LW9A 2BJXA 2GQKA 2HSYA 1JLWA 3D6IA 3ZIVA 2TIRA 4RI7A 1TJDA 4G19A 1A2JA 2XPDA 5D9TA 18GSA 3TKSC 3J7Yb 3H93A 3RAZA 4D73A 4GQFA 1EP7A 3CXGA 1TK5B 1R5PA 4K7OA 2YWMA 4EIQA 2CV4A 5IMDA 2L5LA 1TI3A 3ZREA 3LSZA 2KP2A 1G0TA 4I2TA 4K0NA 2YCDA 1GNEA 1U87A 2PN8A 4NMUA 2WB9A 3GNJA 4KNDA 1XCCA 3UBLA 2HRKA 2GSRA 2FCHA 3IA1A 1C72A 4I8BA 1BJXA 2I81A 1DUGA 3LEFA 3LXZA 1VGLA 3TJFA 1ABAA 2N5AA 1VRSD 3EMPA 3F3RA 5ECRB 3EU4A 2GTUA 4ZB8A 2OACA 4OO5A 3QR6A 3UVHA 2H8LA 2VCQA 1K0AA 4WKWA 1BG5A 4NAXA 2DMMA 4OMVA 2V2GA 2O7KA 1OKTA 4ZBAA 1QXHA 4N30A 2MMNA 2C0GA 1R4WA 3HD5A 4XS4B 1TP9A 2PUKC 2L4CA 2RM5A 4ZL9A 1XOBA 2DJ2A 1ERWA 5GSSA 2H76A 4PX1A 3DWVA 3GH6A 2OE3A 5ECKB 4XIHA 1OE8A 5ID2B 4OO4A 1X5EA 3MAKA 1NSWA 3MYDA 1X0RA 1Q4JA 2XC2A 2B1KA 4GTUA 1FOVA 2ZNMA 1GTUA 3CSJA 1SK0A 5CRDA 1OVNA 3L9UA 3IAS2 3VURA 3KH7A 1SYXA 2QC7A 3GSTA 2EIQA 3C7MA 1GUKA 2GQLA 1YQ1A 1V2AA 4I97A 2VCVA 4TRXA 4POLA 5H5QA 4GSSA 1QGVA 4CHSA 5HR3A 3GSSA 3IRAA 2BTOT 1WOUA 2XBIA 1XXUA 1HQOA 1GSFA 1K0BA 4PUAA 1AIUA 5ECIB 3W6GA 1K0OA 3GUSA 5B6MA 14GSA 1PA3A 1SJIA 4JE1A 1R7HA 3GX0A 4G0IA 4BPYA 2LJKA 2L57A 2VIMA 4AJ6A 3A2XA 2DJ1A 4PGTA 1TDIA 4TW5A 3M1GA 4MF7A 2WJUA 3PR8A 4KCEA 4NHWA 3FYGA 2H0GA 2HRAA 4KAEA 3UAPA 2BMXA 5D93A 2X49A 4O92A 2IMDA 1XBSA 5JWOB 5KN2A 1XWCA 1XWGA 4LL4B 5B7CA 4ML6A 3GV1A 2REMA 1AQWA 1GH2A 3WGDA 2YJ7A 4ZB9A 12GSA 3HVXA 3VWWA 3FR9A 3U6VA 2M46A 5KN0A 4GRFA 4DSQA 2V6KA 4XS6A 2PMTA 3M0FA 4MPGA 3WGXA 3BJ5A 3GKMA 1XW9A 1EWXA 2A4HA 3ME8A 4OFNA 4E8EA 2CX4A 4IBPA 1X9SB 3J7Yk 5GAND 5D9VA 2VAFA 2KP1A 4XS1A 2JU5A 3KXOA 3WGEA 2YP6A 1Y25A 1GSSA 4WBJA 4EUYA 8GSSA 2B6MA 2FNOA 2VOCA 1GULA 1FOHA 2FWHA 5HFKA 2HI7A 1V98A 2YWOA 2PVQA 3QMXA 5G31A 3FKFA 1QMVA 2VCXA 2X8CA 4OFTA 2P0GA 5DVBA 2E2MA 1GSUA 1XWBA 1VF2A 4MABA 3N5OA 1U88A 2GSQA 4YKGA 3VPQA 2PVOC 4ID0A 3ZFLA 2WZ9A 2F8FA 1G6YA 3BCIA 4G10A 3M9JA 2ON5A 4DEJA 2IL3A 3GYKA 1EOHA 2EIOA 2LTKA 2DSAA 3MWHA 1B4QA 1OAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YDK A;  1T3B A;  4WET A;  2O8V B;  2LQO A;  3ISO A;  4EDY A;  3Q6O A;  4EF0 A;  3S9F A;  1G6W A;  4MJE A;  1X9M B;  1T00 A;  3K8N A;  1GLP A;  4K2D A;  3BCK A;  2R6K A;  5A4W A;  4ZXG A;  3KMO A;  1XIY A;  2NTO A;  4Q5Q A;  2MBT A;  4F0B A;  1SJ6 A;  3ERG A;  4BVY A;  2ON7 A;  3GUR A;  4BWS A;  5EVO A;  2LKU A;  3VI5 A;  2R2J A;  3WD6 A;  2XHF A;  4RI6 A;  5CNW A;  5FHI A;  1WIK A;  5A5K A;  2DBC A;  1N8J A;  2CVK A;  3RPN A;  2FHE A;  1LBK A;  5AIS A;  3FHK A;  3RHC A;  1BED A;  4HQZ A;  2DLX A;  3MSZ A;  1TXX A;  1MD4 A;  2H6Y A;  2HZF A;  4HQS A;  4LLR A;  3FW2 A;  5DDL A;  1LJR A;  4FIW A;  4FYC A;  2OE1 A;  3CBU A;  3ZFB A;  5HR2 A;  2PU9 C;  4GWR A;  1B4P A;  5LCZ A;  2FUG 2;  2I4A A;  4ZBB A;  5CRE A;  4MJB A;  3O6T A;  1V40 A;  2R5G A;  1OC3 A;  1E6B A;  2C80 A;  1FB0 A;  4ML1 A;  1KNG A;  2JAC A;  4XRD A;  5G30 A;  5HQP A;  2H30 A;  2K18 A;  3US3 A;  2H75 A;  1X5D A;  3EWL A;  2VLU A;  3C73 A;  1ZZY A;  3HYP A;  1K3Y A;  2FA4 A;  3UBK A;  3VWX A;  1WE0 A;  3P2A A;  3DRN A;  2IWT A;  5E4W A;  4Q5N A;  1QUW A;  2P5R A;  6GSU A;  1YEX A;  2GT5 A;  3I69 A;  2R3X A;  4HOJ A;  2PER A;  1XFL A;  4PXO A;  5AGY A;  3IPZ A;  5H5S A;  4IQ1 A;  3VPT A;  2FLS A;  2J23 A;  5IOW A;  2C1Y A;  3NIV A;  6GSY A;  1TRW A;  1JZD A;  4QL7 A;  1SKS B;  4ECB A;  2LST A;  1FAA A;  2JZR A;  1PSQ A;  1QFN A;  3EYT A;  2HFD A;  3GTU A;  2CZ2 A;  4MMM A;  4AJ8 A;  3UMA A;  3V1W A;  1YZX A;  2CX3 A;  4DSS A;  1FG4 A;  2PGT A;  2LV3 A;  3F4T A;  3TKR A;  1OKD A;  2NVL A;  4LA1 A;  2C3Q A;  3FK8 A;  3R2Q A;  4FO5 A;  2H6X A;  2M72 A;  1Z5Y E;  4IVF A;  1G7E A;  4LL1 B;  6GSX A;  2F3M A;  2WCI A;  1JZW A;  1JFU A;  5CAX A;  2VL9 A;  3GL3 A;  3TUE A;  1THX A;  4ULX A;  3IXR A;  5LD0 A;  2E2G A;  1FO5 A;  4GCI A;  9GSS A;  4TR4 A;  2FA8 A;  2CQ9 A;  1KEB A;  3BOA A;  2OA7 A;  1S3D A;  5G2Z A;  5HR0 A;  4MZW A;  4CW9 A;  2HYX A;  1ZOF A;  1SYR A;  1MTC A;  5A4U A;  1XW6 A;  1XWA A;  3LG6 A;  4OFM A;  5GZZ B;  3TGZ A;  3ME7 A;  5D8I A;  3TKP A;  1K3O A;  1E2Y A;  2XPE A;  3EU3 A;  1F37 A;  1ZYQ B;  2KUC A;  2H70 A;  5GST A;  4EVM A;  1YJ6 A;  3MNG A;  4F2I A;  4E8H A;  3APQ A;  5J9B A;  3GHA A;  4O32 A;  1B9Y C;  4MP4 A;  2D2Z A;  3EUR A;  1LU4 A;  2NDO A;  3DYR A;  3IDV A;  2B3S A;  2LEG A;  5F0G A;  2JZS A;  2OBI A;  3GL5 A;  4TR0 A;  1TW9 A;  1GSD A;  1K0C A;  2JL4 A;  19GS A;  3KTL A;  4ECI A;  4Q5F A;  2A4V A;  3ZVJ A;  1SJZ A;  1YF1 A;  3PH9 A;  2TRC P;  1G7O A;  1M2B A;  3MDK A;  4IQA A;  2ES7 A;  2VUP A;  4KH7 A;  1EP8 A;  2K9F A;  2RUF A;  1HNA A;  1A0F A;  2FD3 A;  2VLT A;  3HY2 A;  4G9H A;  1Z7P A;  4O5R A;  4MK3 A;  5IPG A;  3WT1 A;  1O6J A;  1T8E B;  3ZIJ A;  3F9U A;  1A23 A;  3KZQ A;  2DJ3 A;  3F3Q A;  5CYY A;  4TOP A;  2XBQ A;  2AUV A;  2HRF A;  4RUV A;  5HFI A;  2RII A;  2YV7 A;  2ZUP A;  1SD8 A;  1YKA A;  5G5E A;  1RQM A;  1EV9 A;  2VM2 A;  3GIX A;  2O85 A;  3ZMK A;  2HLS A;  3E9J B;  3P7X A;  4POB A;  3QPM A;  5IMZ A;  3GN3 A;  3L4N A;  3L9V A;  3NZN A;  5JWR B;  1ERU A;  4ECJ A;  2LRC A;  1K3L A;  4HDE A;  3D22 A;  3KMN A;  4WR4 A;  3ZVJ D;  4KGI A;  3M8N A;  2FY6 A;  4IN0 A;  1YKC A;  2F9S A;  1AQV A;  3UL3 A;  1MDJ A;  5DJL A;  1QK8 A;  4MJC A;  20GS A;  3D5J A;  1UC7 A;  1YF0 A;  2F51 A;  3Q18 A;  2HZE A;  2VL2 A;  2RUE A;  3SBC A;  2C0F A;  2LNS A;  5ECS A;  5IO0 A;  3JCM L;  1SK2 A;  4L0U A;  4WXT A;  2CAI A;  4MH2 A;  3APO A;  4KSM A;  1ZMA A;  1M7T A;  4JR6 A;  3HZ8 A;  3KEB A;  1EEJ A;  1XWK A;  2HRN A;  4XRA A;  4IJI A;  3G7J A;  2FGX A;  2MMA A;  4K9Z A;  3M3M A;  4IJ3 A;  4K8M A;  1VF3 A;  5D9W A;  3F4S A;  2X8H A;  2IJY A;  4J56 E;  2KOK A;  5DCH A;  1W4V A;  2CT6 A;  10GS A;  1AQX A;  3SWL A;  1I5G A;  1I9D A;  5J5N A;  3GFK A;  3QDN A;  4TKY A;  2G2Q A;  2L6C A;  2C3N A;  1THO A;  4NXI A;  3FZ9 A;  1M99 A;  3KH9 A;  3C1S A;  4AGS A;  3KM6 A;  4PNG A;  3RBT A;  2L4Q A;  4WEY A;  4XCS A;  3IR4 A;  3ED3 A;  3HVS A;  1BAY A;  4GLT A;  1T4Z A;  2OBK A;  4TR1 A;  1A8L A;  4X1U A;  3DGQ A;  3GRX A;  4G2E A;  4KUN A;  5FWG A;  4IKH A;  3GKN A;  2N5B A;  2J9H A;  2AAW A;  2ALB A;  3HZ4 A;  2MMZ A;  3UOM A;  2B5Y A;  2OAD A;  3TRP A;  1M9A A;  2LJR A;  4FYU A;  4IHU A;  3A3T A;  3TJJ A;  4ZL7 A;  3A2W A;  1GUH A;  3PIN A;  1URM A;  2GGT A;  2B1L A;  2LNT A;  4MH3 A;  3ZZX A;  1WRY A;  2YN1 A;  3IK9 A;  2OE0 A;  1GUM A;  1GL8 A;  4IW9 A;  2Z9S A;  3IK7 A;  2QGV A;  4KSO A;  3C8E A;  3UVT A;  2H19 A;  1JZR A;  1HD2 A;  4X43 A;  1M9B A;  2LUS A;  2LJA A;  5DCG A;  1NM3 A;  3TKS E;  1V57 A;  5JWQ B;  4PUF C;  2VD1 A;  4PUR A;  4NV2 A;  1V58 A;  1TOF A;  1GRX A;  3LJR A;  5KN1 A;  5B8B A;  2GZY A;  4NWY A;  2RM6 A;  3O76 A;  4GSN A;  1VF1 A;  2WUL A;  1F9M A;  3KTB A;  1XOA A;  1BX9 A;  2OKA A;  5G1L A;  5D9X A;  4MZC A;  3C1R A;  1K0N A;  4XHM A;  1TRV A;  3HXS A;  3KCM A;  3IOS A;  3FZA A;  3GTU B;  4HEA 2;  1PKZ A;  2H1G A;  5AN1 A;  1A8Y A;  1WPI A;  1O73 A;  2FWF A;  3TB2 A;  4CDO A;  3C71 A;  3I9V 2;  4DSS B;  3LGC A;  3HCZ A;  2K6V A;  5J4U A;  3HJO A;  3HJP A;  3PGT A;  2VCZ A;  3TKQ A;  4K7I A;  4PNF A;  1O85 A;  4I2U A;  2YOI A;  3DML A;  3FY7 A;  4POM A;  4EE0 A;  1FB6 A;  2HSH A;  3GKX A;  3CSH A;  2WDU A;  2G0F A;  4X0X A;  5G1K A;  2E0Q A;  2O89 A;  1ST9 A;  1EEM A;  4QL9 A;  2YWI A;  3EMX A;  3KP8 A;  4JRR A;  2MZC A;  1ZL9 A;  4EKZ A;  3DXB A;  1X5C A;  5AIV A;  2K8S A;  5ECH B;  2N5F A;  4MF5 A;  4HJ2 A;  1GSY A;  4RQX A;  4GXZ A;  5KN3 A;  5DQS A;  4D73 B;  3A2V A;  2B7J A;  5B8A A;  3RDW A;  4JBB A;  1M2D A;  1A2M A;  2YPM A;  2B7K A;  3RPP A;  3F63 A;  1GWC A;  3VI7 A;  4GF0 A;  2YNX A;  4XTS A;  3FRC A;  2X64 A;  2AJQ B;  2AB6 A;  1OYJ A;  1F3A A;  2VL3 A;  1NHO A;  2F8A A;  4L5O A;  1OC9 A;  3E0U A;  3KP9 A;  1U3A A;  2YV9 A;  4V1A p;  1MEK A;  1SK1 A;  3IBH A;  3TKS A;  5F8B A;  1Z9H A;  1TU7 A;  4KW6 A;  1R5A A;  4OD7 A;  3QFB C;  3Q19 A;  5L71 A;  4MJA A;  2GQM A;  4AJ7 A;  4ECC A;  4MPF A;  2GZZ A;  5JCG A;  5DBQ A;  3F4R A;  3FZ5 A;  4K1F A;  4BA7 A;  4N11 A;  5F06 A;  4KB3 A;  4EO3 A;  1BQ7 A;  4ACS A;  2EC4 A;  3HVV A;  1ACV A;  4WBR D;  4TXV A;  5F05 A;  4MA9 A;  3BBY A;  2VLV A;  2GT6 A;  4HJM A;  2HT9 A;  4EXJ A;  1WMJ A;  1HNB A;  4POK A;  1F6M C;  4KE3 A;  2GLR A;  4FYB A;  3IE3 A;  4F9Z A;  3ZIT A;  4IP1 A;  3QFA C;  4IS0 A;  2WRT A;  2VM1 A;  1DE2 A;  1UN2 A;  2C0E A;  1XVW A;  3GMF A;  3FR6 A;  3G7I A;  4NV5 A;  4ISD A;  4ZIL A;  4MLY A;  5D96 A;  5EL8 A;  1WP0 A;  3CSI A;  5IMV A;  5ECO B;  4F0C A;  5IMA A;  4HS1 A;  5DAK A;  1SL1 B;  1O81 A;  2V1M A;  3LFL A;  4N0V A;  3LYP A;  6GST A;  5ECL B;  2HXK A;  4PQH A;  5IO2 A;  1W89 A;  3D4T A;  4N0Z A;  3ZYW A;  3ZRD A;  4ILF A;  3LYK A;  1A24 A;  5EY6 A;  1HNC A;  1JHB A;  2KLX A;  5DAL A;  3U5R E;  2CAQ A;  4TXO A;  1DBY A;  4K0G A;  3DIE A;  1TK0 B;  4HZ4 A;  1SU9 A;  2HZE B;  3G9B A;  4JED A;  3IAM 2;  3LQ7 A;  3KGK A;  1H75 A;  5J41 A;  2L59 A;  3VFI A;  2TRX A;  3D21 A;  1B9X C;  3UIW A;  5F07 A;  1ZGN A;  1CQG A;  2X8G A;  5C00 A;  3A5W A;  2H71 A;  2IMF A;  2IFQ A;  1FVK A;  5A4V A;  3RHB A;  5INY A;  5H5R A;  2AHE A;  5HR1 A;  3BD2 A;  2VO4 A;  13GS A;  2VD0 A;  4PQI A;  4EL1 A;  3F6F A;  2LQQ A;  2MBS A;  1PL1 A;  1EOG A;  4EC0 A;  1R26 A;  2R37 A;  5HFG A;  2KHP A;  6GSW A;  4Q5R A;  1K0D A;  1XPV A;  3IHQ A;  1PRX A;  2PWJ A;  3WYW A;  4YAP A;  1EGO A;  4LMW A;  2DIY A;  1IYI A;  1FW1 A;  3OR5 A;  4TR1 B;  2JSY A;  1EV4 A;  2H72 A;  2L6D A;  4PQ1 A;  4DSR A;  2R4V A;  1TU8 A;  2M80 A;  2V41 A;  3D4M A;  3QCP A;  1MDI A;  3DVW A;  1FVJ A;  3DKS A;  1A0R P;  22GS A;  5IMC A;  4O7H A;  1SD9 A;  2MYG A;  2C8U A;  2IMK A;  3GH9 A;  1O8W A;  4JZQ A;  4HUA A;  1JZO A;  1UVZ A;  3EVI A;  5ELG A;  2CVB A;  4MDC A;  4KX4 A;  2HNL A;  4OCF A;  5IIZ A;  1JLV A;  4K7N A;  17GS A;  3F0I A;  2LRT A;  4I5Q A;  1DE1 A;  5JCU A;  11GS A;  3ZML A;  2A2R A;  1S3A A;  3HKR A;  5CRW A;  1YY7 A;  4MZB A;  1Y6E A;  4MCU A;  3H1N A;  4TVE A;  3O3T A;  4P3Y B;  2WGR A;  1OE7 A;  4JR4 A;  1ON4 A;  1F3B A;  4KDX A;  1A2L A;  2DJ0 A;  2YZH A;  6GSV A;  5GAP D;  1YEP A;  3NOF A;  1F2E A;  1TI1 A;  1OC8 A;  4QQ7 A;  3APS A;  3ERF A;  2L5O A;  2C4J A;  1PL2 A;  5ECP B;  3ERW A;  3L0H A;  1VF4 A;  4K6X A;  3TRQ A;  1J9B A;  2C0D A;  2B5E A;  4KA0 A;  2DJK A;  3TJB A;  4GQC A;  1KBN A;  5ECQ B;  4I6X A;  2CVD A;  16GS A;  3HA9 A;  1XW5 A;  5IM9 A;  4J57 E;  1GTI A;  5B6N A;  3HJM A;  3FZ4 A;  1FHE A;  5E59 A;  3E3E A;  5CRG A;  2V6O A;  1PD2 1;  1M2A A;  4L0W A;  3WT2 A;  4YH2 A;  1MDK A;  2NBS A;  4V2M A;  2RLI A;  3W8S A;  3N9J A;  3DD3 A;  2H1D A;  3KJY A;  4DVC A;  3TRX A;  2I1U A;  4GST A;  2C3T A;  2DIZ A;  1NW2 A;  1BYE A;  1K0M A;  3H4K A;  4IGJ A;  5CRH A;  3CRU A;  4YQM A;  6GSS A;  1Z6N A;  1TTZ A;  1ILO A;  2IME A;  4L5L A;  1TK8 B;  2WS2 A;  4IEL A;  3L9S A;  3EE2 A;  3VLN A;  4JU5 A;  3D0Z A;  5COH A;  5LNK e;  2DC5 A;  1GSE A;  4F82 A;  1IYH A;  5ABR A;  3G7Y A;  4XS4 A;  2DJJ A;  3L78 A;  2YWN A;  1NHY A;  1N2A A;  5J3R A;  3GA4 A;  3F8U A;  4HU7 A;  2K8V A;  4EDZ A;  2H01 A;  4ZB6 A;  3VWU A;  5FT3 A;  4TR3 A;  5ID2 A;  3TCO A;  2LS5 A;  1OC9 B;  2GSS A;  1ZYE A;  4MF6 A;  1GTA A;  2VL2 C;  3CYN A;  3ZL5 A;  3HHV A;  5IQY A;  2I3Y A;  5ECM B;  2H1A A;  1AAZ A;  1PX7 A;  4J2F A;  5AIX A;  3CRT A;  4KDY A;  4V2L A;  1KTE A;  5D73 A;  3P90 A;  1USB A;  4ZBD A;  2H74 A;  2IMI A;  3UEM A;  2VCW A;  1GP1 A;  3EC3 A;  2MMO A;  2AV4 A;  2DML A;  1Z7R A;  2A2S A;  1T4Y A;  3DEX A;  2H0H A;  2ZCT A;  3QOU A;  3H8Q A;  3IC4 A;  2H6Z A;  3GX8 A;  1B48 A;  2LRN A;  3IV4 A;  3LOR A;  4V2N A;  3QAG A;  1EZK A;  2EIR A;  4HZ2 A;  3CMI A;  2OJL A;  4TN8 A;  3DVX A;  2P5Q A;  3UJ1 A;  1PX6 A;  4BWQ A;  1TKD B;  2GVP A;  1Z3E A;  2GST A;  1AW9 A;  1TRU A;  5ENU A;  2IIY A;  2PBJ A;  2YAN A;  1ZCP A;  3LWA A;  1MD3 A;  5CP1 A;  3I6A A;  1V9W A;  4LMV A;  3TOU A;  4RQR A;  2CA8 A;  5DQY A;  4KCA A;  1J0F A;  4YQU A;  1GNW A;  1PQN A;  1UA5 A;  1PMT A;  1H4O A;  2FWG A;  2JAD A;  4H86 A;  3ZLP A;  5C04 A;  4AF2 A;  4ZL8 A;  5DAK B;  1RW1 A;  1HYU A;  1M0U A;  3CTG A;  1Z6M A;  2YJH A;  1B8X A;  1T1V A;  1SL2 B;  5EPF A;  2JSZ A;  1J08 A;  1SL0 B;  1EGR A;  2V32 A;  4WF4 A;  1U3I A;  2FWE A;  4YQV A;  1ERV A;  2NPB A;  4N10 A;  1TRS A;  3CTF A;  5DJM A;  3TOT A;  7GSS A;  3UAR A;  2O87 A;  5DAL B;  3KIJ A;  2I9H A;  3P8W A;  1CQH A;  4TXO B;  1T7P B;  2P31 A;  2H1B A;  4IP6 A;  3EIN A;  4YAV A;  2YZU A;  1XZO A;  2WFC A;  1PKW A;  1ERT A;  5JCW A;  3TJG A;  4KDU A;  1U6T A;  2E7P A;  2AYT A;  4F03 A;  1GSQ A;  4ZIJ A;  2IFQ B;  2X99 A;  1X9W B;  2GDR A;  4WF5 A;  3GKK A;  3QD9 A;  2IPA A;  3HDC A;  4NPB A;  3H79 A;  2JZT A;  3VWV A;  5IOX A;  4FH8 A;  3TDG A;  3VK9 A;  1PGT A;  3KD0 A;  4HI7 A;  1S3C A;  4HU9 A;  1GLQ A;  3Q74 A;  4OCE A;  3F6D A;  5IPH A;  5J9C A;  3M9K A;  4V1A g;  1ML6 A;  2H73 A;  2PPT A;  2H0I A;  2QSI A;  3I43 A;  4OWY A;  3QAW A;  5CO3 A;  5ELA A;  3TJK A;  2GZP A;  1GTB A;  1WJK A;  5KEJ A;  5IMF A;  1DSB A;  4NHZ A;  2IN3 A;  2B5X A;  4Z7X A;  3LXT A;  4WR5 A;  2HE3 A;  3AY8 A;  1AC1 A;  1Q98 A;  4BL7 A;  1O7U A;  1O8X A;  4BVX A;  1AXD A;  1SKW B;  1SKR B;  2H66 A;  3W8J A;  1WWJ A;  1QQ2 A;  3FEU A;  2GS3 A;  1SEN A;  2CZ3 A;  4L8E A;  1XVQ A;  5G5F A;  1PN9 A;  2QKE A;  1AUC A;  1RK4 A;  3FR3 A;  2VCT A;  3ZTL A;  5ECN B;  3QAV A;  2BJX A;  2GQK A;  2HSY A;  1JLW A;  3D6I A;  3ZIV A;  2TIR A;  4RI7 A;  1TJD A;  4G19 A;  1A2J A;  2XPD A;  5D9T A;  18GS A;  3TKS C;  3J7Y b;  3H93 A;  3RAZ A;  4D73 A;  4GQF A;  1EP7 A;  3CXG A;  1TK5 B;  1R5P A;  4K7O A;  2YWM A;  2CV4 A;  5IMD A;  2L5L A;  1TI3 A;  3ZRE A;  3LSZ A;  2KP2 A;  1G0T A;  4I2T A;  4K0N A;  2YCD A;  1GNE A;  1U87 A;  2PN8 A;  4NMU A;  2WB9 A;  3GNJ A;  4KND A;  1XCC A;  3UBL A;  2GSR A;  2FCH A;  3IA1 A;  1C72 A;  4I8B A;  1BJX A;  2I81 A;  1DUG A;  3LEF A;  3LXZ A;  1VGL A;  3TJF A;  1ABA A;  2N5A A;  1VRS D;  3EMP A;  3F3R A;  5ECR B;  3EU4 A;  2GTU A;  4ZB8 A;  2OAC A;  4OO5 A;  3QR6 A;  3UVH A;  2H8L A;  2VCQ A;  1K0A A;  4WKW A;  1BG5 A;  4NAX A;  2DMM A;  4OMV A;  2V2G A;  2O7K A;  1OKT A;  4ZBA A;  1QXH A;  4N30 A;  2MMN A;  2C0G A;  1R4W A;  3HD5 A;  4XS4 B;  1TP9 A;  2PUK C;  2L4C A;  2RM5 A;  4ZL9 A;  1XOB A;  2DJ2 A;  1ERW A;  5GSS A;  2H76 A;  4PX1 A;  3DWV A;  3GH6 A;  2OE3 A;  5ECK B;  4XIH A;  1OE8 A;  5ID2 B;  4OO4 A;  1X5E A;  3MAK A;  1NSW A;  1X0R A;  1Q4J A;  2XC2 A;  2B1K A;  4GTU A;  1FOV A;  2ZNM A;  1GTU A;  3CSJ A;  1SK0 A;  5CRD A;  1OVN A;  3L9U A;  3IAS 2;  3VUR A;  3KH7 A;  1SYX A;  2QC7 A;  3GST A;  2EIQ A;  3C7M A;  1GUK A;  2GQL A;  1YQ1 A;  1V2A A;  4I97 A;  2VCV A;  4TRX A;  4POL A;  5H5Q A;  4GSS A;  1QGV A;  4CHS A;  5HR3 A;  3GSS A;  3IRA A;  2BTO T;  1WOU A;  2XBI A;  1XXU A;  1HQO A;  1GSF A;  1K0B A;  4PUA A;  1AIU A;  5ECI B;  3W6G A;  1K0O A;  3GUS A;  5B6M A;  14GS A;  1PA3 A;  1SJI A;  4JE1 A;  1R7H A;  3GX0 A;  4BPY A;  2LJK A;  2L57 A;  2VIM A;  4AJ6 A;  3A2X A;  2DJ1 A;  4PGT A;  1TDI A;  4TW5 A;  3M1G A;  4MF7 A;  2WJU A;  3PR8 A;  4KCE A;  4NHW A;  3FYG A;  2H0G A;  4KAE A;  3UAP A;  2BMX A;  5D93 A;  4O92 A;  2IMD A;  1XBS A;  5JWO B;  5KN2 A;  1XWC A;  1XWG A;  4LL4 B;  5B7C A;  4ML6 A;  3GV1 A;  2REM A;  1AQW A;  1GH2 A;  3WGD A;  2YJ7 A;  4ZB9 A;  12GS A;  3HVX A;  3VWW A;  3FR9 A;  3U6V A;  2M46 A;  5KN0 A;  4GRF A;  4DSQ A;  2V6K A;  4XS6 A;  2PMT A;  3M0F A;  4MPG A;  3WGX A;  3BJ5 A;  3GKM A;  1XW9 A;  1EWX A;  3ME8 A;  4OFN A;  4E8E A;  2CX4 A;  4IBP A;  1X9S B;  3J7Y k;  5GAN D;  5D9V A;  2VAF A;  2KP1 A;  4XS1 A;  2JU5 A;  3KXO A;  3WGE A;  2YP6 A;  1Y25 A;  1GSS A;  4WBJ A;  4EUY A;  8GSS A;  2B6M A;  2FNO A;  2VOC A;  1GUL A;  2FWH A;  5HFK A;  2HI7 A;  1V98 A;  2YWO A;  2PVQ A;  3QMX A;  5G31 A;  3FKF A;  1QMV A;  2VCX A;  2X8C A;  4OFT A;  2P0G A;  5DVB A;  2E2M A;  1GSU A;  1XWB A;  1VF2 A;  4MAB A;  3N5O A;  1U88 A;  2GSQ A;  3VPQ A;  2PVO C;  4ID0 A;  3ZFL A;  2WZ9 A;  2F8F A;  1G6Y A;  3BCI A;  4G10 A;  3M9J A;  2ON5 A;  4DEJ A;  2IL3 A;  3GYK A;  1EOH A;  2EIO A;  2LTK A;  2DSA A;  3MWH A;  1B4Q A;  1OAZ A; 
#chains in the Genus database with same CATH topology
 1YDK A;  1T3B A;  4WET A;  2O8V B;  2LQO A;  3ISO A;  4EDY A;  3Q6O A;  4EF0 A;  3S9F A;  1G6W A;  4MJE A;  1X9M B;  1T00 A;  3K8N A;  4BL7 B;  4EIP A;  1GLP A;  4K2D A;  3BCK A;  2R6K A;  5A4W A;  4ZXG A;  4BVX B;  3KMO A;  1XIY A;  2NTO A;  4HSC X;  4Q5Q A;  2MBT A;  4F0B A;  1SJ6 A;  3ERG A;  4BVY A;  2DKI A;  2ON7 A;  4YKF A;  3GUR A;  4BWS A;  5EVO A;  2LKU A;  3VI5 A;  2R2J A;  3WD6 A;  2XHF A;  4RI6 A;  5CNW A;  5FHI A;  1WIK A;  5A5K A;  2DBC A;  1N8J A;  2CVK A;  3RPN A;  2FHE A;  1LBK A;  5AIS A;  3FHK A;  3RHC A;  1BED A;  4HQZ A;  2DLX A;  3MSZ A;  1TXX A;  1MD4 A;  2H6Y A;  2HZF A;  4HQS A;  4LLR A;  3FW2 A;  5DDL A;  1LJR A;  2R0P A;  4FIW A;  4MNN A;  4FYC A;  2OE1 A;  3CBU A;  3ZFB A;  5HR2 A;  2PU9 C;  4GWR A;  1ZYN A;  1B4P A;  5LCZ A;  2FUG 2;  2I4A A;  4ZBB A;  5CRE A;  4MJB A;  3O6T A;  1V40 A;  2R5G A;  2R0G A;  1OC3 A;  1E6B A;  2C80 A;  1FB0 A;  4ML1 A;  1KNG A;  2JAC A;  4XRD A;  5G30 A;  5HQP A;  2H30 A;  2K18 A;  3US3 A;  2H75 A;  3R3E A;  1X5D A;  3EWL A;  2VLU A;  3C73 A;  1ZZY A;  3HYP A;  1K3Y A;  2FA4 A;  3UBK A;  3VWX A;  1WE0 A;  3P2A A;  3DRN A;  2IWT A;  5E4W A;  4Q5N A;  1QUW A;  2P5R A;  6GSU A;  1YEX A;  2GT5 A;  3I69 A;  2R3X A;  4HOJ A;  2PER A;  1XFL A;  4PXO A;  5AGY A;  3IPZ A;  5H5S A;  4IQ1 A;  3VPT A;  2FLS A;  2J23 A;  5IOW A;  2C1Y A;  3NIV A;  6GSY A;  1TRW A;  1JZD A;  4QL7 A;  1SKS B;  4ECB A;  2LST A;  1FAA A;  2JZR A;  2X4A A;  1PSQ A;  1QFN A;  3EYT A;  2HFD A;  3GTU A;  2CZ2 A;  4MMM A;  4AJ8 A;  3UMA A;  3V1W A;  1YZX A;  2CX3 A;  4DSS A;  1FG4 A;  2PGT A;  2LV3 A;  3F4T A;  3TKR A;  1OKD A;  2NVL A;  4LA1 A;  2C3Q A;  3FK8 A;  3R2Q A;  4FO5 A;  2H6X A;  2M72 A;  1Z5Y E;  4IVF A;  1G7E A;  4LL1 B;  6GSX A;  2F3M A;  2WCI A;  4Z2U A;  1JZW A;  1JFU A;  5CAX A;  2VL9 A;  3GL3 A;  3TUE A;  1THX A;  4ULX A;  3IXR A;  5LD0 A;  2E2G A;  1FO5 A;  4GCI A;  9GSS A;  4TR4 A;  2FA8 A;  2CQ9 A;  1KEB A;  3BOA A;  2OA7 A;  1S3D A;  5G2Z A;  5HR0 A;  4MZW A;  4CW9 A;  2HYX A;  1ZOF A;  1SYR A;  5BRT A;  1MTC A;  5A4U A;  1XW6 A;  1XWA A;  3LG6 A;  4OFM A;  5GZZ B;  3TGZ A;  3ME7 A;  5D8I A;  3TKP A;  1K3O A;  1E2Y A;  2XPE A;  1M3J A;  3EU3 A;  1F37 A;  1ZYQ B;  2KUC A;  2H70 A;  5GST A;  4EVM A;  1YJ6 A;  3MNG A;  4F2I A;  4E8H A;  3APQ A;  5J9B A;  3GHA A;  4O32 A;  1B9Y C;  4MP4 A;  2D2Z A;  3EUR A;  1LU4 A;  2NDO A;  3DYR A;  1PN0 A;  3IDV A;  2B3S A;  4CY6 A;  2LEG A;  5F0G A;  2JZS A;  2OBI A;  3GL5 A;  4TR0 A;  1TW9 A;  1GSD A;  1K0C A;  2JL4 A;  19GS A;  3KTL A;  4ECI A;  4Q5F A;  2A4V A;  3ZVJ A;  1SJZ A;  1YF1 A;  3PH9 A;  2TRC P;  4USS A;  1G7O A;  1M2B A;  3MDK A;  4IQA A;  2ES7 A;  2VUP A;  4KH7 A;  1EP8 A;  2K9F A;  2RUF A;  1HNA A;  1A0F A;  2FD3 A;  2VLT A;  3HY2 A;  4G9H A;  1Z7P A;  4O5R A;  4MK3 A;  5IPG A;  3WT1 A;  1O6J A;  1T8E B;  3ZIJ A;  3F9U A;  1A23 A;  3KZQ A;  2DJ3 A;  3F3Q A;  5CYY A;  4TOP A;  2XBQ A;  5BMU A;  2AUV A;  2HRF A;  4RUV A;  5HFI A;  2RII A;  2YV7 A;  2ZUP A;  1SD8 A;  1YKA A;  5G5E A;  1RQM A;  1EV9 A;  2VM2 A;  3GIX A;  2O85 A;  2A2P A;  3ZMK A;  2HLS A;  3E9J B;  3P7X A;  4POB A;  3QPM A;  5IMZ A;  3GN3 A;  3L4N A;  3L9V A;  3NZN A;  5JWR B;  1ERU A;  4ECJ A;  2LRC A;  1K3L A;  4HDE A;  3D22 A;  3KMN A;  4WR4 A;  3ZVJ D;  4KGI A;  5KOW A;  3M8N A;  2FY6 A;  4IN0 A;  1YKC A;  2F9S A;  1AQV A;  3UL3 A;  1MDJ A;  5DJL A;  1QK8 A;  4MJC A;  20GS A;  3D5J A;  1UC7 A;  1YF0 A;  2F51 A;  3Q18 A;  2HZE A;  2VL2 A;  2RUE A;  3SBC A;  2C0F A;  2LNS A;  2QA2 A;  5ECS A;  5IO0 A;  3JCM L;  1SK2 A;  4L0U A;  4WXT A;  2CAI A;  4MH2 A;  3APO A;  4KSM A;  1ZMA A;  1M7T A;  4JR6 A;  3HZ8 A;  3KEB A;  1EEJ A;  1XWK A;  2HRN A;  4XRA A;  4IJI A;  3G7J A;  2FGX A;  2MMA A;  4K9Z A;  3M3M A;  4IJ3 A;  4K8M A;  1VF3 A;  5D9W A;  3F4S A;  2X8H A;  2IJY A;  4J56 E;  2KOK A;  5DCH A;  1W4V A;  2CT6 A;  10GS A;  1AQX A;  3SWL A;  1I5G A;  1I9D A;  4Z2R A;  5J5N A;  3GFK A;  3QDN A;  4TKY A;  2G2Q A;  2L6C A;  2R0C A;  2C3N A;  1THO A;  4NXI A;  3FZ9 A;  1M99 A;  3KH9 A;  3C1S A;  4AGS A;  3KM6 A;  4PNG A;  3RBT A;  2L4Q A;  4WEY A;  4XCS A;  3IR4 A;  3ED3 A;  3HVS A;  1BAY A;  4GLT A;  1T4Z A;  2OBK A;  4TR1 A;  1A8L A;  4X1U A;  3DGQ A;  3GRX A;  4G2E A;  4KUN A;  5FWG A;  4IKH A;  3GKN A;  2N5B A;  2J9H A;  2AAW A;  2ALB A;  4PTS A;  3HZ4 A;  2MMZ A;  3UOM A;  2B5Y A;  2OAD A;  3TRP A;  1M9A A;  2LJR A;  4FYU A;  4IHU A;  3A3T A;  3TJJ A;  4ZL7 A;  3A2W A;  1GUH A;  3PIN A;  1URM A;  2GGT A;  2B1L A;  2LNT A;  4MH3 A;  3ZZX A;  1WRY A;  2YN1 A;  3IK9 A;  2OE0 A;  1GUM A;  1GL8 A;  4IW9 A;  2Z9S A;  3IK7 A;  2QGV A;  4KSO A;  3C8E A;  3UVT A;  2H19 A;  1JZR A;  1HD2 A;  4X43 A;  1M9B A;  2LUS A;  2LJA A;  5DCG A;  1NM3 A;  4A5P A;  3TKS E;  1V57 A;  5JWQ B;  4PUF C;  2VD1 A;  4PUR A;  4NV2 A;  1V58 A;  1TOF A;  1GRX A;  3LJR A;  5KN1 A;  5B8B A;  2GZY A;  4NWY A;  2RM6 A;  3O76 A;  4GSN A;  1VF1 A;  2WUL A;  1F9M A;  3KTB A;  1XOA A;  1BX9 A;  2OKA A;  5G1L A;  5D9X A;  4MZC A;  3C1R A;  1K0N A;  4XHM A;  1TRV A;  3HXS A;  3KCM A;  3IOS A;  3FZA A;  3GTU B;  4HEA 2;  1PKZ A;  2H1G A;  5AN1 A;  1A8Y A;  1WPI A;  1O73 A;  2FWF A;  3TB2 A;  4CDO A;  3C71 A;  3I9V 2;  4DSS B;  3LGC A;  3HCZ A;  3PPU A;  2K6V A;  5J4U A;  3HJO A;  3HJP A;  3PGT A;  2VCZ A;  3TKQ A;  4K7I A;  4PNF A;  1O85 A;  4I2U A;  2YOI A;  3DML A;  3FY7 A;  4POM A;  4EE0 A;  1FB6 A;  2HSH A;  3GKX A;  3CSH A;  2WDU A;  2G0F A;  4X0X A;  5G1K A;  2E0Q A;  2O89 A;  1ST9 A;  1EEM A;  4QL9 A;  2YWI A;  3EMX A;  3KP8 A;  4JRR A;  1ZYP A;  4Z2T A;  2MZC A;  1ZL9 A;  4EKZ A;  3DXB A;  1X5C A;  5AIV A;  2K8S A;  5ECH B;  2N5F A;  4MF5 A;  4HJ2 A;  1GSY A;  4RQX A;  4GXZ A;  4O5U A;  5KN3 A;  5DQS A;  4D73 B;  3A2V A;  2B7J A;  5B8A A;  3RDW A;  4JBB A;  1M2D A;  1A2M A;  2YPM A;  2B7K A;  3RPP A;  3F63 A;  1GWC A;  3VI7 A;  4GF0 A;  2YNX A;  4XTS A;  3FRC A;  2X64 A;  2AJQ B;  2AB6 A;  1OYJ A;  1F3A A;  2VL3 A;  1NHO A;  2F8A A;  4L5O A;  1OC9 A;  3E0U A;  3KP9 A;  4K2X A;  1U3A A;  2YV9 A;  4V1A p;  1MEK A;  1SK1 A;  3IBH A;  3TKS A;  5F8B A;  1Z9H A;  1TU7 A;  4KW6 A;  1R5A A;  2QA1 A;  4OD7 A;  3QFB C;  3Q19 A;  5L71 A;  4MJA A;  2GQM A;  4X4J A;  4AJ7 A;  4ECC A;  4MPF A;  2GZZ A;  5JCG A;  5DBQ A;  3F4R A;  3FZ5 A;  4K1F A;  4BA7 A;  4N11 A;  5F06 A;  4KB3 A;  4EO3 A;  1BQ7 A;  4ACS A;  2EC4 A;  3HVV A;  1ACV A;  4WBR D;  3MIX A;  4TXV A;  5F05 A;  4MA9 A;  3BBY A;  2VLV A;  2GT6 A;  4HJM A;  2HT9 A;  4EXJ A;  1WMJ A;  1HNB A;  4POK A;  1F6M C;  4KE3 A;  2GLR A;  4FYB A;  3IE3 A;  4F9Z A;  3ZIT A;  4IP1 A;  3QFA C;  4IS0 A;  2WRT A;  2HSM A;  2VM1 A;  1DE2 A;  1UN2 A;  2C0E A;  1XVW A;  3GMF A;  3FR6 A;  3G7I A;  4NV5 A;  4ISD A;  4ZIL A;  4MLY A;  5D96 A;  5EL8 A;  1WP0 A;  3CSI A;  5IMV A;  5ECO B;  4F0C A;  5IMA A;  4HS1 A;  5DAK A;  1SL1 B;  1O81 A;  2V1M A;  3LFL A;  4N0V A;  3LYP A;  6GST A;  5ECL B;  2HXK A;  4PQH A;  5IO2 A;  1W89 A;  3D4T A;  4N0Z A;  3ZYW A;  3ZRD A;  4ILF A;  3LYK A;  1A24 A;  5EY6 A;  1HNC A;  1JHB A;  2KLX A;  2UZ8 A;  5DAL A;  3U5R E;  2CAQ A;  4TXO A;  1DBY A;  4K0G A;  3DIE A;  1TK0 B;  4HZ4 A;  1SU9 A;  2HZE B;  3G9B A;  4JED A;  3IAM 2;  3LQ7 A;  3KGK A;  1H75 A;  5J41 A;  2L59 A;  3VFI A;  2TRX A;  4G0K A;  3D21 A;  1B9X C;  3UIW A;  5F07 A;  1ZGN A;  1CQG A;  2X8G A;  5C00 A;  3A5W A;  2H71 A;  2IMF A;  2IFQ A;  1FVK A;  5A4V A;  3RHB A;  5INY A;  5H5R A;  2AHE A;  3A5I A;  5HR1 A;  3BD2 A;  2VO4 A;  13GS A;  2VD0 A;  4PQI A;  1PFO A;  4EL1 A;  3F6F A;  2LQQ A;  2MBS A;  1PL1 A;  1EOG A;  4EC0 A;  4FQU A;  1R26 A;  2R37 A;  5HFG A;  2KHP A;  6GSW A;  4Q5R A;  1K0D A;  1XPV A;  3IHQ A;  1PRX A;  2PWJ A;  3WYW A;  3IHG A;  4YAP A;  1EGO A;  4LMW A;  2DIY A;  1IYI A;  1FW1 A;  3OR5 A;  4TR1 B;  2JSY A;  1EV4 A;  2H72 A;  2L6D A;  4PQ1 A;  4DSR A;  1XG8 A;  2R4V A;  1TU8 A;  2M80 A;  2V41 A;  3D4M A;  3QCP A;  1MDI A;  3DVW A;  1FVJ A;  3DKS A;  1A0R P;  22GS A;  5IMC A;  4O7H A;  1SD9 A;  2MYG A;  2C8U A;  2IMK A;  3GH9 A;  1O8W A;  4JZQ A;  4HUA A;  1JZO A;  1UVZ A;  3EVI A;  5ELG A;  2CVB A;  4MDC A;  4KX4 A;  2HNL A;  4OCF A;  5IIZ A;  1JLV A;  4K7N A;  17GS A;  3F0I A;  2LRT A;  4I5Q A;  1DE1 A;  5JCU A;  11GS A;  3ZML A;  2A2R A;  1S3A A;  4K5S A;  3HKR A;  5CRW A;  1YY7 A;  4MZB A;  1Y6E A;  4MCU A;  3H1N A;  4TVE A;  3O3T A;  4P3Y B;  4KF9 A;  2WGR A;  1OE7 A;  4JR4 A;  1ON4 A;  1F3B A;  4KDX A;  1A2L A;  2DJ0 A;  2YZH A;  6GSV A;  5GAP D;  1YEP A;  3NOF A;  1F2E A;  1TI1 A;  1OC8 A;  4QQ7 A;  3APS A;  3ERF A;  2L5O A;  2C4J A;  1PL2 A;  5ECP B;  3ERW A;  3L0H A;  1VF4 A;  4K6X A;  3TRQ A;  1J9B A;  2C0D A;  2B5E A;  4KA0 A;  2DJK A;  3TJB A;  4GQC A;  1KBN A;  5ECQ B;  4I6X A;  5KOX A;  2CVD A;  3IC8 A;  16GS A;  3FMW A;  3HA9 A;  1XW5 A;  5IM9 A;  4J57 E;  1GTI A;  5B6N A;  3HJM A;  3FZ4 A;  1FHE A;  5E59 A;  3E3E A;  5CRG A;  2V6O A;  1PD2 1;  1M2A A;  4L0W A;  3WT2 A;  4YH2 A;  1MDK A;  2NBS A;  4V2M A;  2RLI A;  3W8S A;  3N9J A;  3DD3 A;  2H1D A;  4BVY B;  3KJY A;  4DVC A;  3TRX A;  2I1U A;  4O5Q A;  4GST A;  2C3T A;  2DIZ A;  1NW2 A;  1BYE A;  1K0M A;  3H4K A;  4IGJ A;  5CRH A;  3CRU A;  4YQM A;  6GSS A;  1Z6N A;  1TTZ A;  4BIK A;  1ILO A;  2IME A;  4L5L A;  1TK8 B;  2WS2 A;  4IEL A;  3L9S A;  3EE2 A;  2DKH A;  3VLN A;  4JU5 A;  3D0Z A;  5COH A;  5LNK e;  4G0L A;  2DC5 A;  1GSE A;  4F82 A;  1IYH A;  5ABR A;  3G7Y A;  4XS4 A;  2DJJ A;  3L78 A;  3EPT A;  2YWN A;  1NHY A;  1N2A A;  5J3R A;  3GA4 A;  3F8U A;  4HU7 A;  2K8V A;  4EDZ A;  2H01 A;  4ZB6 A;  3VWU A;  5FT3 A;  4TR3 A;  5ID2 A;  3TCO A;  2LS5 A;  1OC9 B;  2GSS A;  1ZYE A;  4MF6 A;  1GTA A;  2VL2 C;  3CYN A;  3ZL5 A;  3HHV A;  5IQY A;  2I3Y A;  5ECM B;  2H1A A;  1AAZ A;  1PX7 A;  4J2F A;  5AIX A;  3CRT A;  4KDY A;  4V2L A;  1KTE A;  5D73 A;  3P90 A;  1USB A;  4ZBD A;  2H74 A;  2IMI A;  3UEM A;  2VCW A;  1GP1 A;  3EC3 A;  2MMO A;  2AV4 A;  2DML A;  1Z7R A;  2A2S A;  1T4Y A;  3DEX A;  2H0H A;  2ZCT A;  3QOU A;  3H8Q A;  3IC4 A;  2H6Z A;  3GX8 A;  1B48 A;  2LRN A;  3IV4 A;  3LOR A;  4V2N A;  3QAG A;  1EZK A;  2EIR A;  4HZ2 A;  3CMI A;  2OJL A;  4TN8 A;  3DVX A;  2P5Q A;  3UJ1 A;  1PX6 A;  4BWQ A;  1TKD B;  2GVP A;  1Z3E A;  2GST A;  1AW9 A;  1TRU A;  5ENU A;  2IIY A;  2PBJ A;  2YAN A;  1ZCP A;  3LWA A;  1MD3 A;  5CP1 A;  3I6A A;  1V9W A;  4LMV A;  3TOU A;  4RQR A;  2CA8 A;  5DQY A;  4KCA A;  1J0F A;  4YQU A;  1GNW A;  1PQN A;  1UA5 A;  1PMT A;  1H4O A;  2FWG A;  2JAD A;  4H86 A;  3ZLP A;  5C04 A;  4AF2 A;  4ZL8 A;  5DAK B;  1RW1 A;  1HYU A;  1M0U A;  3CTG A;  1Z6M A;  2YJH A;  1B8X A;  1T1V A;  1SL2 B;  5EPF A;  2JSZ A;  1J08 A;  1SL0 B;  1EGR A;  2V32 A;  4WF4 A;  1U3I A;  2FWE A;  4YQV A;  1ERV A;  2NPB A;  4N10 A;  1TRS A;  3CTF A;  5DJM A;  3TOT A;  7GSS A;  3UAR A;  2O87 A;  5DAL B;  3KIJ A;  2I9H A;  3P8W A;  1CQH A;  4TXO B;  1T7P B;  2P31 A;  4CY8 A;  2H1B A;  4IP6 A;  3EIN A;  4YAV A;  2YZU A;  1XZO A;  2WFC A;  1PKW A;  1ERT A;  5JCW A;  3TJG A;  4KDU A;  1U6T A;  2E7P A;  2AYT A;  4F03 A;  1GSQ A;  4ZIJ A;  2IFQ B;  2X99 A;  1X9W B;  2GDR A;  4WF5 A;  3GKK A;  3QD9 A;  2IPA A;  3HDC A;  4NPB A;  3H79 A;  1M3I A;  2JZT A;  3VWV A;  5IOX A;  4FH8 A;  3TDG A;  3VK9 A;  1PGT A;  3KD0 A;  4HI7 A;  1S3C A;  4HU9 A;  1GLQ A;  3Q74 A;  4OCE A;  3F6D A;  5IPH A;  5J9C A;  3M9K A;  4V1A g;  1ML6 A;  2H73 A;  2PPT A;  2H0I A;  2QSI A;  3I43 A;  4OWY A;  3QAW A;  5CO3 A;  5ELA A;  3TJK A;  2GZP A;  1GTB A;  1WJK A;  5KEJ A;  5IMF A;  1DSB A;  4NHZ A;  2IN3 A;  2B5X A;  4Z7X A;  3LXT A;  4WR5 A;  2HE3 A;  3AY8 A;  1AC1 A;  4K5R A;  1Q98 A;  4BL7 A;  1O7U A;  1O8X A;  4BVX A;  1AXD A;  1SKW B;  1SKR B;  2H66 A;  3W8J A;  1WWJ A;  1QQ2 A;  3FEU A;  2GS3 A;  4ICY A;  1SEN A;  2CZ3 A;  4L8E A;  1XVQ A;  5G5F A;  1PN9 A;  2QKE A;  1AUC A;  1RK4 A;  3FR3 A;  2VCT A;  3ZTL A;  5ECN B;  3QAV A;  3LW9 A;  2BJX A;  2GQK A;  2HSY A;  1JLW A;  3D6I A;  3ZIV A;  2TIR A;  4RI7 A;  1TJD A;  4G19 A;  1A2J A;  2XPD A;  5D9T A;  18GS A;  3TKS C;  3J7Y b;  3H93 A;  3RAZ A;  4D73 A;  4GQF A;  1EP7 A;  3CXG A;  1TK5 B;  1R5P A;  4K7O A;  2YWM A;  4EIQ A;  2CV4 A;  5IMD A;  2L5L A;  1TI3 A;  3ZRE A;  3LSZ A;  2KP2 A;  1G0T A;  4I2T A;  4K0N A;  2YCD A;  1GNE A;  1U87 A;  2PN8 A;  4NMU A;  2WB9 A;  3GNJ A;  4KND A;  1XCC A;  3UBL A;  2HRK A;  2GSR A;  2FCH A;  3IA1 A;  1C72 A;  4I8B A;  1BJX A;  2I81 A;  1DUG A;  3LEF A;  3LXZ A;  1VGL A;  3TJF A;  1ABA A;  2N5A A;  1VRS D;  3EMP A;  3F3R A;  5ECR B;  3EU4 A;  2GTU A;  4ZB8 A;  2OAC A;  4OO5 A;  3QR6 A;  3UVH A;  2H8L A;  2VCQ A;  1K0A A;  4WKW A;  1BG5 A;  4NAX A;  2DMM A;  4OMV A;  2V2G A;  2O7K A;  1OKT A;  4ZBA A;  1QXH A;  4N30 A;  2MMN A;  2C0G A;  1R4W A;  3HD5 A;  4XS4 B;  1TP9 A;  2PUK C;  2L4C A;  2RM5 A;  4ZL9 A;  1XOB A;  2DJ2 A;  1ERW A;  5GSS A;  2H76 A;  4PX1 A;  3DWV A;  3GH6 A;  2OE3 A;  5ECK B;  4XIH A;  1OE8 A;  5ID2 B;  4OO4 A;  1X5E A;  3MAK A;  1NSW A;  3MYD A;  1X0R A;  1Q4J A;  2XC2 A;  2B1K A;  4GTU A;  1FOV A;  2ZNM A;  1GTU A;  3CSJ A;  1SK0 A;  5CRD A;  1OVN A;  3L9U A;  3IAS 2;  3VUR A;  3KH7 A;  1SYX A;  2QC7 A;  1S3R A;  3GST A;  2EIQ A;  3C7M A;  1GUK A;  2GQL A;  1YQ1 A;  1V2A A;  4I97 A;  2VCV A;  4TRX A;  4POL A;  5H5Q A;  4GSS A;  1QGV A;  4CHS A;  5HR3 A;  3GSS A;  3IRA A;  2BTO T;  1WOU A;  2XBI A;  1XXU A;  1HQO A;  1GSF A;  1K0B A;  4PUA A;  1AIU A;  5ECI B;  3W6G A;  1K0O A;  3GUS A;  5B6M A;  14GS A;  1PA3 A;  1SJI A;  4JE1 A;  1R7H A;  3GX0 A;  4G0I A;  4BPY A;  2LJK A;  2L57 A;  2VIM A;  4AJ6 A;  3A2X A;  2DJ1 A;  4PGT A;  1TDI A;  4TW5 A;  3M1G A;  4MF7 A;  2WJU A;  3PR8 A;  4KCE A;  4NHW A;  3FYG A;  2H0G A;  3CQF A;  2HRA A;  4KAE A;  3UAP A;  2BMX A;  5D93 A;  2X49 A;  4O92 A;  2IMD A;  1XBS A;  5JWO B;  5KN2 A;  1XWC A;  1XWG A;  4LL4 B;  5B7C A;  4ML6 A;  3GV1 A;  2REM A;  1AQW A;  1GH2 A;  3WGD A;  2YJ7 A;  4ZB9 A;  12GS A;  3HVX A;  3VWW A;  3FR9 A;  3U6V A;  2M46 A;  5KN0 A;  4GRF A;  4DSQ A;  2V6K A;  4XS6 A;  2PMT A;  3M0F A;  4MPG A;  3WGX A;  3BJ5 A;  3GKM A;  1XW9 A;  1EWX A;  2A4H A;  3ME8 A;  4OFN A;  4E8E A;  2CX4 A;  4IBP A;  1X9S B;  3J7Y k;  5GAN D;  5D9V A;  2VAF A;  2KP1 A;  4XS1 A;  2JU5 A;  3KXO A;  3WGE A;  2YP6 A;  1Y25 A;  1GSS A;  4WBJ A;  4EUY A;  8GSS A;  2B6M A;  2FNO A;  2VOC A;  1GUL A;  1FOH A;  2FWH A;  5HFK A;  2HI7 A;  1V98 A;  2YWO A;  2PVQ A;  3QMX A;  5G31 A;  3FKF A;  1QMV A;  2VCX A;  2X8C A;  4OFT A;  2P0G A;  5DVB A;  2E2M A;  1GSU A;  3HVN A;  1XWB A;  1VF2 A;  4MAB A;  3N5O A;  1U88 A;  2GSQ A;  4YKG A;  3VPQ A;  2PVO C;  4ID0 A;  3ZFL A;  2WZ9 A;  2F8F A;  1G6Y A;  3BCI A;  4G10 A;  3M9J A;  2ON5 A;  4DEJ A;  2IL3 A;  3GYK A;  1EOH A;  2EIO A;  2LTK A;  2DSA A;  3MWH A;  1B4Q A;  1OAZ A; 
#chains in the Genus database with same CATH homology
 1YDK A;  1T3B A;  4WET A;  2O8V B;  2LQO A;  3ISO A;  4EDY A;  3Q6O A;  4EF0 A;  3S9F A;  1G6W A;  4MJE A;  1X9M B;  1T00 A;  3K8N A;  4BL7 B;  4EIP A;  1GLP A;  4K2D A;  3BCK A;  2R6K A;  5A4W A;  4ZXG A;  4BVX B;  3KMO A;  1XIY A;  2NTO A;  4Q5Q A;  2MBT A;  4F0B A;  1SJ6 A;  3ERG A;  4BVY A;  2DKI A;  2ON7 A;  4YKF A;  3GUR A;  4BWS A;  5EVO A;  2LKU A;  3VI5 A;  2R2J A;  3WD6 A;  2XHF A;  4RI6 A;  5CNW A;  5FHI A;  1WIK A;  5A5K A;  2DBC A;  1N8J A;  2CVK A;  3RPN A;  2FHE A;  1LBK A;  5AIS A;  3FHK A;  3RHC A;  1BED A;  4HQZ A;  2DLX A;  3MSZ A;  1TXX A;  1MD4 A;  2H6Y A;  2HZF A;  4HQS A;  4LLR A;  3FW2 A;  5DDL A;  1LJR A;  2R0P A;  4FIW A;  4MNN A;  4FYC A;  2OE1 A;  3CBU A;  3ZFB A;  5HR2 A;  2PU9 C;  4GWR A;  1ZYN A;  1B4P A;  5LCZ A;  2FUG 2;  2I4A A;  4ZBB A;  5CRE A;  4MJB A;  3O6T A;  1V40 A;  2R5G A;  2R0G A;  1OC3 A;  1E6B A;  2C80 A;  1FB0 A;  4ML1 A;  1KNG A;  2JAC A;  4XRD A;  5G30 A;  5HQP A;  2H30 A;  2K18 A;  3US3 A;  2H75 A;  3R3E A;  1X5D A;  3EWL A;  2VLU A;  3C73 A;  1ZZY A;  3HYP A;  1K3Y A;  2FA4 A;  3UBK A;  3VWX A;  1WE0 A;  3P2A A;  3DRN A;  2IWT A;  5E4W A;  4Q5N A;  1QUW A;  2P5R A;  6GSU A;  1YEX A;  2GT5 A;  3I69 A;  2R3X A;  4HOJ A;  2PER A;  1XFL A;  4PXO A;  5AGY A;  3IPZ A;  5H5S A;  4IQ1 A;  3VPT A;  2FLS A;  2J23 A;  5IOW A;  2C1Y A;  3NIV A;  6GSY A;  1TRW A;  1JZD A;  4QL7 A;  1SKS B;  4ECB A;  2LST A;  1FAA A;  2JZR A;  2X4A A;  1PSQ A;  1QFN A;  3EYT A;  2HFD A;  3GTU A;  2CZ2 A;  4MMM A;  4AJ8 A;  3UMA A;  3V1W A;  1YZX A;  2CX3 A;  4DSS A;  1FG4 A;  2PGT A;  2LV3 A;  3F4T A;  3TKR A;  1OKD A;  2NVL A;  4LA1 A;  2C3Q A;  3FK8 A;  3R2Q A;  4FO5 A;  2H6X A;  2M72 A;  1Z5Y E;  4IVF A;  1G7E A;  4LL1 B;  6GSX A;  2F3M A;  2WCI A;  4Z2U A;  1JZW A;  1JFU A;  5CAX A;  2VL9 A;  3GL3 A;  3TUE A;  1THX A;  4ULX A;  3IXR A;  5LD0 A;  2E2G A;  1FO5 A;  4GCI A;  9GSS A;  4TR4 A;  2FA8 A;  2CQ9 A;  1KEB A;  3BOA A;  2OA7 A;  1S3D A;  5G2Z A;  5HR0 A;  4MZW A;  4CW9 A;  2HYX A;  1ZOF A;  1SYR A;  5BRT A;  1MTC A;  5A4U A;  1XW6 A;  1XWA A;  3LG6 A;  4OFM A;  5GZZ B;  3TGZ A;  3ME7 A;  5D8I A;  3TKP A;  1K3O A;  1E2Y A;  2XPE A;  3EU3 A;  1F37 A;  1ZYQ B;  2KUC A;  2H70 A;  5GST A;  4EVM A;  1YJ6 A;  3MNG A;  4F2I A;  4E8H A;  3APQ A;  5J9B A;  3GHA A;  4O32 A;  1B9Y C;  4MP4 A;  2D2Z A;  3EUR A;  1LU4 A;  2NDO A;  3DYR A;  1PN0 A;  3IDV A;  2B3S A;  4CY6 A;  2LEG A;  5F0G A;  2JZS A;  2OBI A;  3GL5 A;  4TR0 A;  1TW9 A;  1GSD A;  1K0C A;  2JL4 A;  19GS A;  3KTL A;  4ECI A;  4Q5F A;  2A4V A;  3ZVJ A;  1SJZ A;  1YF1 A;  3PH9 A;  2TRC P;  4USS A;  1G7O A;  1M2B A;  3MDK A;  4IQA A;  2ES7 A;  2VUP A;  4KH7 A;  1EP8 A;  2K9F A;  2RUF A;  1HNA A;  1A0F A;  2FD3 A;  2VLT A;  3HY2 A;  4G9H A;  1Z7P A;  4O5R A;  4MK3 A;  5IPG A;  3WT1 A;  1O6J A;  1T8E B;  3ZIJ A;  3F9U A;  1A23 A;  3KZQ A;  2DJ3 A;  3F3Q A;  5CYY A;  4TOP A;  2XBQ A;  5BMU A;  2AUV A;  2HRF A;  4RUV A;  5HFI A;  2RII A;  2YV7 A;  2ZUP A;  1SD8 A;  1YKA A;  5G5E A;  1RQM A;  1EV9 A;  2VM2 A;  3GIX A;  2O85 A;  2A2P A;  3ZMK A;  2HLS A;  3E9J B;  3P7X A;  4POB A;  3QPM A;  5IMZ A;  3GN3 A;  3L4N A;  3L9V A;  3NZN A;  5JWR B;  1ERU A;  4ECJ A;  2LRC A;  1K3L A;  4HDE A;  3D22 A;  3KMN A;  4WR4 A;  3ZVJ D;  4KGI A;  5KOW A;  3M8N A;  2FY6 A;  4IN0 A;  1YKC A;  2F9S A;  1AQV A;  3UL3 A;  1MDJ A;  5DJL A;  1QK8 A;  4MJC A;  20GS A;  3D5J A;  1UC7 A;  1YF0 A;  2F51 A;  3Q18 A;  2HZE A;  2VL2 A;  2RUE A;  3SBC A;  2C0F A;  2LNS A;  2QA2 A;  5ECS A;  5IO0 A;  3JCM L;  1SK2 A;  4L0U A;  4WXT A;  2CAI A;  4MH2 A;  3APO A;  4KSM A;  1ZMA A;  1M7T A;  4JR6 A;  3HZ8 A;  3KEB A;  1EEJ A;  1XWK A;  2HRN A;  4XRA A;  4IJI A;  3G7J A;  2FGX A;  2MMA A;  4K9Z A;  3M3M A;  4IJ3 A;  4K8M A;  1VF3 A;  5D9W A;  3F4S A;  2X8H A;  2IJY A;  4J56 E;  2KOK A;  5DCH A;  1W4V A;  2CT6 A;  10GS A;  1AQX A;  3SWL A;  1I5G A;  1I9D A;  4Z2R A;  5J5N A;  3GFK A;  3QDN A;  4TKY A;  2G2Q A;  2L6C A;  2R0C A;  2C3N A;  1THO A;  4NXI A;  3FZ9 A;  1M99 A;  3KH9 A;  3C1S A;  4AGS A;  3KM6 A;  4PNG A;  3RBT A;  2L4Q A;  4WEY A;  4XCS A;  3IR4 A;  3ED3 A;  3HVS A;  1BAY A;  4GLT A;  1T4Z A;  2OBK A;  4TR1 A;  1A8L A;  4X1U A;  3DGQ A;  3GRX A;  4G2E A;  4KUN A;  5FWG A;  4IKH A;  3GKN A;  2N5B A;  2J9H A;  2AAW A;  2ALB A;  4PTS A;  3HZ4 A;  2MMZ A;  3UOM A;  2B5Y A;  2OAD A;  3TRP A;  1M9A A;  2LJR A;  4FYU A;  4IHU A;  3A3T A;  3TJJ A;  4ZL7 A;  3A2W A;  1GUH A;  3PIN A;  1URM A;  2GGT A;  2B1L A;  2LNT A;  4MH3 A;  3ZZX A;  1WRY A;  2YN1 A;  3IK9 A;  2OE0 A;  1GUM A;  1GL8 A;  4IW9 A;  2Z9S A;  3IK7 A;  2QGV A;  4KSO A;  3C8E A;  3UVT A;  2H19 A;  1JZR A;  1HD2 A;  4X43 A;  1M9B A;  2LUS A;  2LJA A;  5DCG A;  1NM3 A;  4A5P A;  3TKS E;  1V57 A;  5JWQ B;  4PUF C;  2VD1 A;  4PUR A;  4NV2 A;  1V58 A;  1TOF A;  1GRX A;  3LJR A;  5KN1 A;  5B8B A;  2GZY A;  4NWY A;  2RM6 A;  3O76 A;  4GSN A;  1VF1 A;  2WUL A;  1F9M A;  3KTB A;  1XOA A;  1BX9 A;  2OKA A;  5G1L A;  5D9X A;  4MZC A;  3C1R A;  1K0N A;  4XHM A;  1TRV A;  3HXS A;  3KCM A;  3IOS A;  3FZA A;  3GTU B;  4HEA 2;  1PKZ A;  2H1G A;  5AN1 A;  1A8Y A;  1WPI A;  1O73 A;  2FWF A;  3TB2 A;  4CDO A;  3C71 A;  3I9V 2;  4DSS B;  3LGC A;  3HCZ A;  3PPU A;  2K6V A;  5J4U A;  3HJO A;  3HJP A;  3PGT A;  2VCZ A;  3TKQ A;  4K7I A;  4PNF A;  1O85 A;  4I2U A;  2YOI A;  3DML A;  3FY7 A;  4POM A;  4EE0 A;  1FB6 A;  2HSH A;  3GKX A;  3CSH A;  2WDU A;  2G0F A;  4X0X A;  5G1K A;  2E0Q A;  2O89 A;  1ST9 A;  1EEM A;  4QL9 A;  2YWI A;  3EMX A;  3KP8 A;  4JRR A;  1ZYP A;  4Z2T A;  2MZC A;  1ZL9 A;  4EKZ A;  3DXB A;  1X5C A;  5AIV A;  2K8S A;  5ECH B;  2N5F A;  4MF5 A;  4HJ2 A;  1GSY A;  4RQX A;  4GXZ A;  4O5U A;  5KN3 A;  5DQS A;  4D73 B;  3A2V A;  2B7J A;  5B8A A;  3RDW A;  4JBB A;  1M2D A;  1A2M A;  2YPM A;  2B7K A;  3RPP A;  3F63 A;  1GWC A;  3VI7 A;  4GF0 A;  2YNX A;  4XTS A;  3FRC A;  2X64 A;  2AJQ B;  2AB6 A;  1OYJ A;  1F3A A;  2VL3 A;  1NHO A;  2F8A A;  4L5O A;  1OC9 A;  3E0U A;  3KP9 A;  4K2X A;  1U3A A;  2YV9 A;  4V1A p;  1MEK A;  1SK1 A;  3IBH A;  3TKS A;  5F8B A;  1Z9H A;  1TU7 A;  4KW6 A;  1R5A A;  2QA1 A;  4OD7 A;  3QFB C;  3Q19 A;  5L71 A;  4MJA A;  2GQM A;  4X4J A;  4AJ7 A;  4ECC A;  4MPF A;  2GZZ A;  5JCG A;  5DBQ A;  3F4R A;  3FZ5 A;  4K1F A;  4BA7 A;  4N11 A;  5F06 A;  4KB3 A;  4EO3 A;  1BQ7 A;  4ACS A;  2EC4 A;  3HVV A;  1ACV A;  4WBR D;  3MIX A;  4TXV A;  5F05 A;  4MA9 A;  3BBY A;  2VLV A;  2GT6 A;  4HJM A;  2HT9 A;  4EXJ A;  1WMJ A;  1HNB A;  4POK A;  1F6M C;  4KE3 A;  2GLR A;  4FYB A;  3IE3 A;  4F9Z A;  3ZIT A;  4IP1 A;  3QFA C;  4IS0 A;  2WRT A;  2HSM A;  2VM1 A;  1DE2 A;  1UN2 A;  2C0E A;  1XVW A;  3GMF A;  3FR6 A;  3G7I A;  4NV5 A;  4ISD A;  4ZIL A;  4MLY A;  5D96 A;  5EL8 A;  1WP0 A;  3CSI A;  5IMV A;  5ECO B;  4F0C A;  5IMA A;  4HS1 A;  5DAK A;  1SL1 B;  1O81 A;  2V1M A;  3LFL A;  4N0V A;  3LYP A;  6GST A;  5ECL B;  2HXK A;  4PQH A;  5IO2 A;  1W89 A;  3D4T A;  4N0Z A;  3ZYW A;  3ZRD A;  4ILF A;  3LYK A;  1A24 A;  5EY6 A;  1HNC A;  1JHB A;  2KLX A;  2UZ8 A;  5DAL A;  3U5R E;  2CAQ A;  4TXO A;  1DBY A;  4K0G A;  3DIE A;  1TK0 B;  4HZ4 A;  1SU9 A;  2HZE B;  3G9B A;  4JED A;  3IAM 2;  3LQ7 A;  3KGK A;  1H75 A;  5J41 A;  2L59 A;  3VFI A;  2TRX A;  4G0K A;  3D21 A;  1B9X C;  3UIW A;  5F07 A;  1ZGN A;  1CQG A;  2X8G A;  5C00 A;  3A5W A;  2H71 A;  2IMF A;  2IFQ A;  1FVK A;  5A4V A;  3RHB A;  5INY A;  5H5R A;  2AHE A;  3A5I A;  5HR1 A;  3BD2 A;  2VO4 A;  13GS A;  2VD0 A;  4PQI A;  4EL1 A;  3F6F A;  2LQQ A;  2MBS A;  1PL1 A;  1EOG A;  4EC0 A;  4FQU A;  1R26 A;  2R37 A;  5HFG A;  2KHP A;  6GSW A;  4Q5R A;  1K0D A;  1XPV A;  3IHQ A;  1PRX A;  2PWJ A;  3WYW A;  3IHG A;  4YAP A;  1EGO A;  4LMW A;  2DIY A;  1IYI A;  1FW1 A;  3OR5 A;  4TR1 B;  2JSY A;  1EV4 A;  2H72 A;  2L6D A;  4PQ1 A;  4DSR A;  2R4V A;  1TU8 A;  2M80 A;  2V41 A;  3D4M A;  3QCP A;  1MDI A;  3DVW A;  1FVJ A;  3DKS A;  1A0R P;  22GS A;  5IMC A;  4O7H A;  1SD9 A;  2MYG A;  2C8U A;  2IMK A;  3GH9 A;  1O8W A;  4JZQ A;  4HUA A;  1JZO A;  1UVZ A;  3EVI A;  5ELG A;  2CVB A;  4MDC A;  4KX4 A;  2HNL A;  4OCF A;  5IIZ A;  1JLV A;  4K7N A;  17GS A;  3F0I A;  2LRT A;  4I5Q A;  1DE1 A;  5JCU A;  11GS A;  3ZML A;  2A2R A;  1S3A A;  4K5S A;  3HKR A;  5CRW A;  1YY7 A;  4MZB A;  1Y6E A;  4MCU A;  3H1N A;  4TVE A;  3O3T A;  4P3Y B;  4KF9 A;  2WGR A;  1OE7 A;  4JR4 A;  1ON4 A;  1F3B A;  4KDX A;  1A2L A;  2DJ0 A;  2YZH A;  6GSV A;  5GAP D;  1YEP A;  3NOF A;  1F2E A;  1TI1 A;  1OC8 A;  4QQ7 A;  3APS A;  3ERF A;  2L5O A;  2C4J A;  1PL2 A;  5ECP B;  3ERW A;  3L0H A;  1VF4 A;  4K6X A;  3TRQ A;  1J9B A;  2C0D A;  2B5E A;  4KA0 A;  2DJK A;  3TJB A;  4GQC A;  1KBN A;  5ECQ B;  4I6X A;  5KOX A;  2CVD A;  3IC8 A;  16GS A;  3FMW A;  3HA9 A;  1XW5 A;  5IM9 A;  4J57 E;  1GTI A;  5B6N A;  3HJM A;  3FZ4 A;  1FHE A;  5E59 A;  3E3E A;  5CRG A;  2V6O A;  1PD2 1;  1M2A A;  4L0W A;  3WT2 A;  4YH2 A;  1MDK A;  2NBS A;  4V2M A;  2RLI A;  3W8S A;  3N9J A;  3DD3 A;  2H1D A;  4BVY B;  3KJY A;  4DVC A;  3TRX A;  2I1U A;  4O5Q A;  4GST A;  2C3T A;  2DIZ A;  1NW2 A;  1BYE A;  1K0M A;  3H4K A;  4IGJ A;  5CRH A;  3CRU A;  4YQM A;  6GSS A;  1Z6N A;  1TTZ A;  1ILO A;  2IME A;  4L5L A;  1TK8 B;  2WS2 A;  4IEL A;  3L9S A;  3EE2 A;  2DKH A;  3VLN A;  4JU5 A;  3D0Z A;  5COH A;  5LNK e;  4G0L A;  2DC5 A;  1GSE A;  4F82 A;  1IYH A;  5ABR A;  3G7Y A;  4XS4 A;  2DJJ A;  3L78 A;  3EPT A;  2YWN A;  1NHY A;  1N2A A;  5J3R A;  3GA4 A;  3F8U A;  4HU7 A;  2K8V A;  4EDZ A;  2H01 A;  4ZB6 A;  3VWU A;  5FT3 A;  4TR3 A;  5ID2 A;  3TCO A;  2LS5 A;  1OC9 B;  2GSS A;  1ZYE A;  4MF6 A;  1GTA A;  2VL2 C;  3CYN A;  3ZL5 A;  3HHV A;  5IQY A;  2I3Y A;  5ECM B;  2H1A A;  1AAZ A;  1PX7 A;  4J2F A;  5AIX A;  3CRT A;  4KDY A;  4V2L A;  1KTE A;  5D73 A;  3P90 A;  1USB A;  4ZBD A;  2H74 A;  2IMI A;  3UEM A;  2VCW A;  1GP1 A;  3EC3 A;  2MMO A;  2AV4 A;  2DML A;  1Z7R A;  2A2S A;  1T4Y A;  3DEX A;  2H0H A;  2ZCT A;  3QOU A;  3H8Q A;  3IC4 A;  2H6Z A;  3GX8 A;  1B48 A;  2LRN A;  3IV4 A;  3LOR A;  4V2N A;  3QAG A;  1EZK A;  2EIR A;  4HZ2 A;  3CMI A;  2OJL A;  4TN8 A;  3DVX A;  2P5Q A;  3UJ1 A;  1PX6 A;  4BWQ A;  1TKD B;  2GVP A;  1Z3E A;  2GST A;  1AW9 A;  1TRU A;  5ENU A;  2IIY A;  2PBJ A;  2YAN A;  1ZCP A;  3LWA A;  1MD3 A;  5CP1 A;  3I6A A;  1V9W A;  4LMV A;  3TOU A;  4RQR A;  2CA8 A;  5DQY A;  4KCA A;  1J0F A;  4YQU A;  1GNW A;  1PQN A;  1UA5 A;  1PMT A;  1H4O A;  2FWG A;  2JAD A;  4H86 A;  3ZLP A;  5C04 A;  4AF2 A;  4ZL8 A;  5DAK B;  1RW1 A;  1HYU A;  1M0U A;  3CTG A;  1Z6M A;  2YJH A;  1B8X A;  1T1V A;  1SL2 B;  5EPF A;  2JSZ A;  1J08 A;  1SL0 B;  1EGR A;  2V32 A;  4WF4 A;  1U3I A;  2FWE A;  4YQV A;  1ERV A;  2NPB A;  4N10 A;  1TRS A;  3CTF A;  5DJM A;  3TOT A;  7GSS A;  3UAR A;  2O87 A;  5DAL B;  3KIJ A;  2I9H A;  3P8W A;  1CQH A;  4TXO B;  1T7P B;  2P31 A;  4CY8 A;  2H1B A;  4IP6 A;  3EIN A;  4YAV A;  2YZU A;  1XZO A;  2WFC A;  1PKW A;  1ERT A;  5JCW A;  3TJG A;  4KDU A;  1U6T A;  2E7P A;  2AYT A;  4F03 A;  1GSQ A;  4ZIJ A;  2IFQ B;  2X99 A;  1X9W B;  2GDR A;  4WF5 A;  3GKK A;  3QD9 A;  2IPA A;  3HDC A;  4NPB A;  3H79 A;  2JZT A;  3VWV A;  5IOX A;  4FH8 A;  3TDG A;  3VK9 A;  1PGT A;  3KD0 A;  4HI7 A;  1S3C A;  4HU9 A;  1GLQ A;  3Q74 A;  4OCE A;  3F6D A;  5IPH A;  5J9C A;  3M9K A;  4V1A g;  1ML6 A;  2H73 A;  2PPT A;  2H0I A;  2QSI A;  3I43 A;  4OWY A;  3QAW A;  5CO3 A;  5ELA A;  3TJK A;  2GZP A;  1GTB A;  1WJK A;  5KEJ A;  5IMF A;  1DSB A;  4NHZ A;  2IN3 A;  2B5X A;  4Z7X A;  3LXT A;  4WR5 A;  2HE3 A;  3AY8 A;  1AC1 A;  4K5R A;  1Q98 A;  4BL7 A;  1O7U A;  1O8X A;  4BVX A;  1AXD A;  1SKW B;  1SKR B;  2H66 A;  3W8J A;  1WWJ A;  1QQ2 A;  3FEU A;  2GS3 A;  4ICY A;  1SEN A;  2CZ3 A;  4L8E A;  1XVQ A;  5G5F A;  1PN9 A;  2QKE A;  1AUC A;  1RK4 A;  3FR3 A;  2VCT A;  3ZTL A;  5ECN B;  3QAV A;  3LW9 A;  2BJX A;  2GQK A;  2HSY A;  1JLW A;  3D6I A;  3ZIV A;  2TIR A;  4RI7 A;  1TJD A;  4G19 A;  1A2J A;  2XPD A;  5D9T A;  18GS A;  3TKS C;  3J7Y b;  3H93 A;  3RAZ A;  4D73 A;  4GQF A;  1EP7 A;  3CXG A;  1TK5 B;  1R5P A;  4K7O A;  2YWM A;  4EIQ A;  2CV4 A;  5IMD A;  2L5L A;  1TI3 A;  3ZRE A;  3LSZ A;  2KP2 A;  1G0T A;  4I2T A;  4K0N A;  2YCD A;  1GNE A;  1U87 A;  2PN8 A;  4NMU A;  2WB9 A;  3GNJ A;  4KND A;  1XCC A;  3UBL A;  2HRK A;  2GSR A;  2FCH A;  3IA1 A;  1C72 A;  4I8B A;  1BJX A;  2I81 A;  1DUG A;  3LEF A;  3LXZ A;  1VGL A;  3TJF A;  1ABA A;  2N5A A;  1VRS D;  3EMP A;  3F3R A;  5ECR B;  3EU4 A;  2GTU A;  4ZB8 A;  2OAC A;  4OO5 A;  3QR6 A;  3UVH A;  2H8L A;  2VCQ A;  1K0A A;  4WKW A;  1BG5 A;  4NAX A;  2DMM A;  4OMV A;  2V2G A;  2O7K A;  1OKT A;  4ZBA A;  1QXH A;  4N30 A;  2MMN A;  2C0G A;  1R4W A;  3HD5 A;  4XS4 B;  1TP9 A;  2PUK C;  2L4C A;  2RM5 A;  4ZL9 A;  1XOB A;  2DJ2 A;  1ERW A;  5GSS A;  2H76 A;  4PX1 A;  3DWV A;  3GH6 A;  2OE3 A;  5ECK B;  4XIH A;  1OE8 A;  5ID2 B;  4OO4 A;  1X5E A;  3MAK A;  1NSW A;  3MYD A;  1X0R A;  1Q4J A;  2XC2 A;  2B1K A;  4GTU A;  1FOV A;  2ZNM A;  1GTU A;  3CSJ A;  1SK0 A;  5CRD A;  1OVN A;  3L9U A;  3IAS 2;  3VUR A;  3KH7 A;  1SYX A;  2QC7 A;  3GST A;  2EIQ A;  3C7M A;  1GUK A;  2GQL A;  1YQ1 A;  1V2A A;  4I97 A;  2VCV A;  4TRX A;  4POL A;  5H5Q A;  4GSS A;  1QGV A;  4CHS A;  5HR3 A;  3GSS A;  3IRA A;  2BTO T;  1WOU A;  2XBI A;  1XXU A;  1HQO A;  1GSF A;  1K0B A;  4PUA A;  1AIU A;  5ECI B;  3W6G A;  1K0O A;  3GUS A;  5B6M A;  14GS A;  1PA3 A;  1SJI A;  4JE1 A;  1R7H A;  3GX0 A;  4G0I A;  4BPY A;  2LJK A;  2L57 A;  2VIM A;  4AJ6 A;  3A2X A;  2DJ1 A;  4PGT A;  1TDI A;  4TW5 A;  3M1G A;  4MF7 A;  2WJU A;  3PR8 A;  4KCE A;  4NHW A;  3FYG A;  2H0G A;  2HRA A;  4KAE A;  3UAP A;  2BMX A;  5D93 A;  2X49 A;  4O92 A;  2IMD A;  1XBS A;  5JWO B;  5KN2 A;  1XWC A;  1XWG A;  4LL4 B;  5B7C A;  4ML6 A;  3GV1 A;  2REM A;  1AQW A;  1GH2 A;  3WGD A;  2YJ7 A;  4ZB9 A;  12GS A;  3HVX A;  3VWW A;  3FR9 A;  3U6V A;  2M46 A;  5KN0 A;  4GRF A;  4DSQ A;  2V6K A;  4XS6 A;  2PMT A;  3M0F A;  4MPG A;  3WGX A;  3BJ5 A;  3GKM A;  1XW9 A;  1EWX A;  2A4H A;  3ME8 A;  4OFN A;  4E8E A;  2CX4 A;  4IBP A;  1X9S B;  3J7Y k;  5GAN D;  5D9V A;  2VAF A;  2KP1 A;  4XS1 A;  2JU5 A;  3KXO A;  3WGE A;  2YP6 A;  1Y25 A;  1GSS A;  4WBJ A;  4EUY A;  8GSS A;  2B6M A;  2FNO A;  2VOC A;  1GUL A;  1FOH A;  2FWH A;  5HFK A;  2HI7 A;  1V98 A;  2YWO A;  2PVQ A;  3QMX A;  5G31 A;  3FKF A;  1QMV A;  2VCX A;  2X8C A;  4OFT A;  2P0G A;  5DVB A;  2E2M A;  1GSU A;  1XWB A;  1VF2 A;  4MAB A;  3N5O A;  1U88 A;  2GSQ A;  4YKG A;  3VPQ A;  2PVO C;  4ID0 A;  3ZFL A;  2WZ9 A;  2F8F A;  1G6Y A;  3BCI A;  4G10 A;  3M9J A;  2ON5 A;  4DEJ A;  2IL3 A;  3GYK A;  1EOH A;  2EIO A;  2LTK A;  2DSA A;  3MWH A;  1B4Q A;  1OAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...