4K7OA

Human peroxiredoxin 5 with a fragment
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
162
structure length
162
Chain Sequence
SAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin-5, mitochondrial
publication title Comparing Binding Modes of Analogous Fragments Using NMR in Fragment-Based Drug Design: Application to PRDX5
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 162
sequence length 162
chains with identical sequence B, C
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4k7oA00
1BG5A 3MWHA 3UAPA 5A4UA 4POLA 3GUSA 3N5OA 4MPGA 3APQA 1PMTA 3ZMKA 4N30A 4G10A 1OE8A 2PGTA 3HCZA 5COHA 2NDOA 1M9AA 2IJYA 1WMJA 1MDKA 5GAPD 3A5WA 1OKTA 3WT2A 4V2NA 5B7CA 2X8CA 3A2VA 3RHCA 2B5EA 3KMNA 2IFQB 2C1YA 4Q5FA 3G7YA 1X9WB 2H1AA 4JU5A 1K3OA 5IPGA 2B6MA 4MCUA 2FWFA 3UVHA 2I9HA 2MMOA 3TKSE 2GSRA 4ZL8A 4AF2A 4DSQA 3PR8A 5CP1A 1I5GA 5AIXA 3TJFA 3IA1A 5ECPB 2J23A 1EEMA 2PN8A 2AHEA 5B6NA 4EL1A 2RM5A 4TXOB 1FG4A 3E9JB 3GKKA 1TK8B 4PUAA 6GSYA 5ID2B 2VCWA 4IN0A 2H6ZA 4PURA 4F0BA 5DAKB 2R5GA 4AJ6A 3GV1A 1GTIA 2X99A 3H4KA 1R5AA 1Z3EA 2C0FA 1TK0B 2H66A 2LV3A 3D21A 1M0UA 1Z9HA 1F3AA 5F0GA 5DALA 2YWIA 4BL7A 4E8HA 2WCIA 4POMA 4LL1B 2L6DA 3J7Yb 5F8BA 2R6KA 2VCVA 2OADA 2V1MA 5ABRA 1J0FA 3F9UA 1XXUA 2C3NA 2CZ2A 1NW2A 4K7NA 3VWWA 2H1GA 4GSSA 5LNKe 1EP8A 2X8HA 1T00A 4ZBAA 4WR4A 9GSSA 2DIYA 2B1LA 1TU7A 4MZWA 4F2IA 4QL7A 2R37A 2HXKA 3FKFA 1GL8A 2QGVA 3UIWA 1MD4A 2GGTA 1EV4A 2R4VA 3HDCA 1AIUA 2C3TA 4TOPA 1TDIA 4KX4A 1H4OA 1W89A 3IV4A 2KHPA 3Q6OA 1PD21 5IMDA 5DBQA 2DBCA 4Q5RA 1TTZA 3BCIA 4O7HA 1KBNA 2NTOA 3VWUA 4BWQA 5FHIA 5DJLA 4DSSB 1R7HA 3US3A 3FZ9A 1O6JA 2A2SA 1AXDA 4FYUA 2IMIA 3F6FA 5J9CA 1XWGA 2CX4A 4TVEA 1T3BA 2H6XA 1X5DA 4ZXGA 4NWYA 1A8YA 1XVQA 1ZOFA 1GTBA 4O32A 1YY7A 4FYCA 2JZSA 3VLNA 2VL2C 4HZ4A 1VF4A 2GVPA 3ERGA 5GSTA 3GRXA 4I6XA 2GSTA 4IP6A 4KH7A 2YNXA 4CW9A 4F82A 4NV5A 1BYEA 2P5QA 1GLQA 1KEBA 4MP4A 4MF5A 1OC9A 5G2ZA 4GQCA 4NHWA 3DVXA 1GULA 4L5OA 4KSMA 1YF1A 4L0WA 4ECJA 2KOKA 3M0FA 1NHOA 1SENA 3TDGA 1A2LA 1JZRA 4MPFA 1TRSA 3D0ZA 2WULA 3GH9A 1T1VA 5CRDA 2DJ3A 2GZPA 3W8JA 4TXVA 1GRXA 4RQRA 5ECMB 1RQMA 2E2GA 2OJLA 1B8XA 3BCKA 6GSSA 2LTKA 4WETA 3IR4A 3EVIA 4ID0A 5KN3A 1Z7RA 1YF0A 3IK9A 10GSA 1JZOA 2H75A 2F9SA 3TJGA 4YAPA 3ZMLA 1K0OA 2OACA 4H86A 3DYRA 1Z6NA 4GQFA 1WOUA 4IGJA 5KN1A 1RK4A 3FR9A 2IIYA 1XCCA 4V1Ap 5ENUA 5DVBA 2GT5A 2FCHA 4YQVA 2IL3A 1K3YA 3A3TA 5DCGA 2JZRA 2LUSA 3IHQA 4GXZA 3OR5A 3RDWA 4MJEA 5FWGA 3KMOA 2B5XA 5DAKA 4KE3A 1K3LA 5B6MA 2WJUA 6GSWA 1Y6EA 3ISOA 4PXOA 4WXTA 2AUVA 3HJMA 3FK8A 1EP7A 1XOBA 2MBTA 1HNCA 3L9VA 2CVBA 1AW9A 4KGIA 1NM3A 2DJ2A 5G30A 2AV4A 4OCFA 4F0CA 5IIZA 2I1UA 2IN3A 6GSVA 2PUKC 3L9UA 1XWBA 1PA3A 14GSA 1EOHA 3F6DA 2XBQA 3E3EA 1SKWB 3SWLA 3TKSA 2H70A 3KP9A 1DBYA 2HRNA 5D8IA 1GSSA 1WRYA 2EIQA 1N8JA 5FT3A 1T8EB 3DRNA 3HJPA 1G6WA 4Q5QA 1FW1A 1JZDA 1YJ6A 1QK8A 13GSA 3WGEA 4HUAA 5HFGA 3UJ1A 1GSDA 3WGXA 4G2EA 2VM2A 1BX9A 3HXSA 1YKCA 3KJYA 2K6VA 1V40A 3UEMA 1E2YA 1BEDA 4DVCA 4IP1A 1ZYQB 3LEFA 2H72A 1FVKA 1YEPA 5CYYA 5ECHB 3KP8A 4MF7A 4F9ZA 2HE3A 5J3RA 3FRCA 1FAAA 3N9JA 2YN1A 3IK7A 2F8AA 3H1NA 5IO0A 4IQ1A 18GSA 3DD3A 1MDJA 4JR4A 2FWGA 2LRCA 1MDIA 1ML6A 5IQYA 2HT9A 2IMKA 1ON4A 2ALBA 1QXHA 3C73A 4ULXA 1GLPA 1HNBA 2JSZA 2G2QA 5ELGA 2P0GA 2CT6A 4AJ8A 1O73A 1X9SB 4V2LA 3QAWA 3CMIA 1PL2A 4EXJA 4JZQA 2NBSA 1PKZA 6GSXA 1ILOA 2VCQA 1GH2A 4TR1A 3R2QA 5D93A 2C8UA 4EF0A 3LORA 3F0IA 2PBJA 3TJJA 5HR3A 3CSJA 1EZKA 2FWEA 4I2TA 2MBSA 1Q4JA 2WZ9A 4J57E 1QFNA 5C04A 3TB2A 2H19A 1TW9A 5DCHA 5IM9A 4FYBA 2VD0A 4XRDA 2WB9A 1WPIA 3KD0A 1O81A 4MABA 2DC5A 4KB3A 3ZZXA 1TI1A 3C1RA 5AISA 5IPHA 1UA5A 2VCTA 3EINA 1A0RP 4DEJA 4NAXA 2LJKA 3QAVA 4PNGA 2O87A 1XPVA 3F4TA 2C0EA 2VO4A 5J4UA 3ME7A 1SD9A 2G0FA 1WP0A 2M46A 2GSSA 3TOUA 5AGYA 1VF1A 4KDXA 3EWLA 5A4VA 2O85A 3KM6A 2VM1A 3ZTLA 5C00A 1OC3A 2FHEA 1SD8A 2LS5A 1UN2A 4HJ2A 1ZL9A 3TJBA 1IYHA 5ECLB 4LMWA 4L5LA 1TK5B 5JWOB 2AB6A 3UVTA 1V98A 2TIRA 1MTCA 3TRQA 2YP6A 1CQGA 4HI7A 4EO3A 5D9TA 4OFTA 1SL0B 5ECNB 5D9VA 4TR0A 2AYTA 1WJKA 2RM6A 1FOVA 1K0NA 1BJXA 1EGRA 2P31A 1AQVA 5IO2A 3DWVA 1TJDA 5DQSA 2O7KA 1USBA 5CRWA 2K8SA 5F07A 1ST9A 1N2AA 3ZLPA 3EC3A 3KZQA 1GTAA 4BWSA 3GYKA 3BD2A 3P8WA 2LEGA 4MJBA 2EC4A 3CSHA 2YOIA 3VI7A 1K0DA 2H01A 3QCPA 4NXIA 3CSIA 1K0CA 3ZL5A 3U5RE 3P7XA 4POKA 3TKSC 3FHKA 3LYPA 3EMXA 1F3BA 3MDKA 3QD9A 4G9HA 5H5QA 3DGQA 5JWQB 5IMZA 5ECSA 1PX6A 1V57A 1GSEA 2PMTA 2J9HA 1PKWA 4XS4B 4BVXA 3GX0A 4YQMA 3MSZA 2FNOA 1U3AA 3VWXA 2H0IA 2LQQA 4CHSA 2LRNA 4PQHA 4WF5A 4WR5A 3LJRA 3RPNA 2HFDA 4XS1A 2AAWA 5HFKA 19GSA 4ISDA 4KAEA 1DUGA 2PVOC 5KN2A 3IRAA 2F51A 3ZVJD 4N0ZA 3GTUA 2VLTA 2H73A 4N10A 1O8WA 2V6KA 2FA8A 3KH9A 2N5FA 1XW9A 3DEXA 5G5FA 2DIZA 4X1UA 2HYXA 1Z6MA 4EDYA 2GSQA 2M80A 1OVNA 1KNGA 2K9FA 4X0XA 3CTGA 4HU7A 4HEA2 3GKXA 1YQ1A 5JCWA 3LQ7A 1OYJA 2QSIA 1J08A 4QQ7A 4KCEA 4XIHA 1R4WA 3GMFA 1B48A 3ZIJA 3PH9A 2R3XA 3GH6A 2HZFA 3IXRA 1PN9A 1FHEA 5ECIB 2CQ9A 3ZRDA 2IMDA 3UL3A 5KEJA 5D73A 5CO3A 2H6YA 1M7TA 1WE0A 3QFBC 2DMMA 3W6GA 16GSA 4TN8A 2VCXA 1GUMA 1TRWA 2IMFA 1TI3A 5EVOA 2IWTA 5D9XA 2YJHA 2MMAA 3W8SA 2D2ZA 4OFMA 2IPAA 1SL2B 1SKSB 3O6TA 2C4JA 5HR1A 3I43A 1ZCPA 3KCMA 4TR1B 2TRXA 2M72A 4JRRA 2LNTA 3TCOA 3UOMA 1EV9A 2JADA 4ZBDA 1M99A 5ECQB 1LU4A 4CDOA 1R5PA 3VPQA 5B8BA 4X43A 1B4QA 1G0TA 1HNAA 2HZEB 5GZZB 1YDKA 4ECBA 1GSFA 3RAZA 3HVVA 1CQHA 4KDUA 3BBYA 2K8VA 2DLXA 4K6XA 4LL4B 4TKYA 2CVDA 2OA7A 4N0VA 1THXA 4MJAA 4ML1A 1F37A 1GP1A 2DJ1A 2FLSA 3D6IA 3GSSA 3Q18A 3FY7A 17GSA 2GQMA 4RUVA 2H8LA 2GDRA 1ABAA 4RQXA 2PVQA 2FWHA 3LG6A 4J2FA 2FD3A 2P5RA 4XTSA 1U87A 4WKWA 4P3YB 4HS1A 2BJXA 2GTUA 3S9FA 3LSZA 3NOFA 2VLUA 1VF3A 1JFUA 5AN1A 2K18A 3BOAA 4K0GA 5G1LA 2VCZA 3HA9A 1BQ7A 1A23A 4EE0A 3D4MA 3CTFA 4QL9A 1B9XC 5IOXA 4DSRA 3HD5A 3O76A 5D96A 4J56E 2MZCA 2HSYA 4MDCA 3D4TA 4OWYA 3U6VA 4GCIA 3MAKA 2V2GA 4XS4A 2E7PA 2KP1A 3QMXA 1B4PA 1UVZA 2LJAA 2YWNA 2A4VA 3P2AA 4ZB8A 4BPYA 4BVYA 4EUYA 2LQOA 3LFLA 3VI5A 4ECIA 3L0HA 1A2MA 5LD0A 5JCUA 3APOA 2E0QA 3EMPA 3ED3A 3HKRA 3O3TA 5KN0A 1FB6A 2ON7A 4MH2A 2WFCA 1DSBA 5F06A 1X5EA 3TOTA 1A2JA 1S3CA 2I3YA 1GSYA 22GSA 4POBA 4F03A 4O5RA 1HQOA 1VF2A 2L4CA 3H79A 3GKMA 3IPZA 1AAZA 3MNGA 4RI7A 3EE2A 2HSHA 2H0HA 4MF6A 1GUHA 4IELA 2QKEA 5E59A 2OE0A 1ERTA 1TOFA 1GWCA 2NPBA 4ZL9A 4D73A 1SJZA 3DKSA 3BJ5A 1EOGA 2DJJA 5EL8A 3CXGA 1A8LA 3HZ4A 3LXZA 1F2EA 3GTUB 4IVFA 2CA8A 4MH3A 1T4ZA 5JWRB 4XS6A 1X5CA 2LRTA 5J41A 5A5KA 3VK9A 1I9DA 3C8EA 1SJ6A 3J7Yk 8GSSA 2E2MA 4G19A 3G7JA 5A4WA 2C0DA 1X0RA 4ACSA 2L5LA 4K9ZA 3VFIA 2VLVA 4JEDA 1IYIA 1A0FA 3M9JA 2CVKA 3I69A 3M1GA 2HRFA 1S3AA 3D22A 4WBRD 5AIVA 3IAM2 4EDZA 1NHYA 4KW6A 1JZWA 4ILFA 2WRTA 1H75A 1V2AA 2B5YA 3A2WA 4RI6A 5F05A 3GN3A 3TRXA 5IMCA 3PINA 3Q19A 3TJKA 3QFAC 2PWJA 5INYA 1EWXA 2GLRA 3FZ5A 4GF0A 5ECKB 2HZEA 1A24A 1OAZA 3RHBA 2XBIA 1ACVA 3APSA 3M8NA 2NVLA 4MK3A 3TRPA 3NZNA 1E6BA 1C72A 5G31A 1LBKA 1M2BA 4HU9A 2JU5A 3FZ4A 3IBHA 2C3QA 3QDNA 4LLRA 4Z7XA 1JLVA 2RLIA 3RBTA 3C71A 5JCGA 1NSWA 1Y25A 2FGXA 3E0UA 1F6MC 2YJ7A 2VUPA 4K8MA 2EIOA 2WGRA 3CRTA 2AJQB 2DMLA 3F8UA 4JE1A 2H0GA 1TRUA 1HD2A 1JLWA 4MZCA 3CBUA 1XW6A 3FR3A 3ZIVA 4IBPA 3CRUA 5CNWA 4K0NA 5B8AA 5CRHA 2C80A 2L4QA 2L59A 5DJMA 3A2XA 5H5RA 3RPPA 4WBJA 1U3IA 5J5NA 3I6AA 1XOAA 2ES7A 2YZUA 1SK0A 5HQPA 3G7IA 1K0MA 1G6YA 3FYGA 4KUNA 4K2DA 4V2MA 4I2UA 1WIKA 3F63A 2DJKA 1QQ2A 1O7UA 5DQYA 3TUEA 3M9KA 4ZB6A 1B9YC 4YQUA 3Q74A 5HR0A 1WWJA 2JZTA 1BAYA 2YV7A 2O89A 2H76A 4EC0A 2X64A 5IOWA 1XVWA 1U88A 1QUWA 3GX8A 5IMFA 4BA7A 3EYTA 3HHVA 4AGSA 2MMNA 4PX1A 2OBIA 3ZREA 1G7EA 1MD3A 1QGVA 1TU8A 1T4YA 4LA1A 2MMZA 1O8XA 4HZ2A 4GSNA 1UC7A 4KSOA 5H5SA 4TR3A 2I81A 3ZFLA 3CYNA 3TKRA 3GFKA 3KXOA 4N11A 4Q5NA 1SKRB 4E8EA 2F3MA 5CAXA 2H71A 1GSUA 3C1SA 1SU9A 3FW2A 4IQAA 3EURA 3F3QA 3P90A 4WF4A 1XWAA 2RIIA 3QAGA 2O8VB 3HVSA 4ML6A 2PU9C 1O85A 2WDUA 2GT6A 4PQIA 1M9BA 3ERFA 2PPTA 3HZ8A 2I4AA 4WEYA 2B7KA 3F3RA 3HY2A 3L78A 3KEBA 1JHBA 3KTLA 1LJRA 4XHMA 3UBKA 5G5EA 1VRSD 1XIYA 3M3MA 3NIVA 4KCAA 4D73B 2H1BA 4I97A 5EY6A 1RW1A 4IW9A 3C7MA 3GKNA 1AC1A 2LJRA 4ZB9A 4PUFC 2GS3A 2VAFA 1ZZYA 2N5AA 2ON5A 5DDLA 3GURA 1AQXA 1Q98A 3GIXA 2REMA 3EU3A 4EKZA 1Z5YE 6GSUA 3GHAA 4I5QA 2JSYA 4PNFA 1G7OA 2YV9A 3QPMA 3AY8A 2KP2A 3HYPA 4OCEA 3IOSA 2HI7A 3QR6A 2BMXA 1Z7PA 7GSSA 2QC7A 4OFNA 2C0GA 2XC2A 3GA4A 3UARA 1M2AA 1QMVA 3IAS2 4KNDA 4ZL7A 3H8QA 3PGTA 2LNSA 5CREA 1V9WA 3TGZA 2YWOA 3EU4A 3LXTA 1K0BA 4GTUA 4YH2A 4NPBA 3VURA 4MLYA 2A2RA 2HLSA 4L0UA 4O92A 2ZNMA 4ZILA 1ZGNA 1SK2A 3L9SA 3LYKA 4PQ1A 2OE1A 1GNEA 2MYGA 2RUEA 3FR6A 1SYXA 3GL3A 2V41A 4IKHA 2V32A 4JR6A 2IFQA 2FA4A 3DXBA 3SBCA 4NHZA 1U6TA 1PQNA 3KTBA 1DE2A 4I8BA 3ERWA 2IMEA 1GNWA 1V58A 3WGDA 1AQWA 2TRCP 1YKAA 1GTUA 3LGCA 4L8EA 1PGTA 2LSTA 2VOCA 1XWCA 4HOJA 4NV2A 2WS2A 3WT1A 2GZZA 3KGKA 1FB0A 1OE7A 1PL1A 1GSQA 4K7OA 2XPDA 1XZOA 1S3DA 1PRXA 1TXXA 1J9BA 4TXOA 4ECCA 2L57A 5EPFA 4ZIJA 2XPEA 5J9BA 5D9WA 5ID2A 4YAVA 2ZCTA 1URMA 1EGOA 1TP9A 3I9V2 1SK1A 3VPTA 2XHFA 3G9BA 4OD7A 12GSA 4FO5A 5IMAA 4MA9A 5G1KA 1ERVA 3IE3A 2KUCA 5CRGA 4OO4A 1K0AA 1VGLA 2DJ0A 2EIRA 3LWAA 5ECRB 3L4NA 4K1FA 4KDYA 3DIEA 11GSA 4LMVA 2VD1A 4EVMA 4NMUA 4TR4A 6GSTA 2F8FA 2DSAA 4MZBA 5E4WA 2CAIA 3UMAA 4HQSA 1TRVA 2H74A 2JL4A 5LCZA 2PERA 1ZYEA 1XW5A 2CAQA 1SYRA 3K8NA 4TW5A 4GWRA 3V1WA 2OKAA 1R26A 3ZYWA 1X9MB 2VL9A 2R2JA 4TRXA 4IHUA 3HVXA 2BTOT 1PX7A 5DALB 3ZVJA 1SL1B 1W4VA 3FEUA 5GSSA 4HJMA 3KIJA 3F4SA 4FH8A 2CZ3A 2YZHA 1THOA 1XBSA 20GSA 2GQKA 2YWMA 2Z9SA 2RUFA 3UBLA 4XCSA 2YPMA 2H1DA 2L6CA 4DSSA 1M2DA 3ME8A 5HR2A 4OO5A 2JACA 1OC8A 3IC4A 4GLTA 2VIMA 2LKUA 3WD6A 2YANA 1KTEA 5GAND 1XFLA 2H30A 2HNLA 3DMLA 4OMVA 4JBBA 1MEKA 1OKDA 3QOUA 1AUCA 5HFIA 4PGTA 1ERUA 1EEJA 2FUG2 2V6OA 2X8GA 1XWKA 1DE1A 1FVJA 2N5BA 4AJ7A 1PSQA 1F9MA 3ZFBA 1GUKA 2OBKA 4FIWA 4HDEA 3JCML 4K7IA 1T7PB 5ECOB 3F4RA 4IS0A 3VWVA 3WYWA 2VL2A 3GL5A 3GSTA 1YEXA 1SJIA 3KH7A 2L5OA 1ZMAA 4IJ3A 4ZBBA 1FO5A 4GRFA 3DVWA 2OE3A 1ERWA 2VL3A 5IMVA 3D5JA 3TKQA 2B3SA 2FY6A 4MJCA 5ELAA 2YCDA 1TKDB 3HJOA 4GSTA 3H93A 4MMMA 2B1KA 5L71A 1YZXA 3GNJA 3TKPA 2B7JA 4IJIA 2KLXA 4XRAA 3ZITA 1OC9B 2ZUPA 1HYUA 3IDVA 4HQZA 4V1Ag 2GQLA 3FZAA 4KA0A 2CX3A 2GZYA 2CV4A
chains in the Genus database with same CATH superfamily
1BG5A 3MWHA 3UAPA 5A4UA 4POLA 3GUSA 3N5OA 4MPGA 3APQA 1PMTA 3ZMKA 4N30A 4G10A 1OE8A 2PGTA 3HCZA 5COHA 2NDOA 1M9AA 2IJYA 1WMJA 1MDKA 5GAPD 3A5WA 1OKTA 3WT2A 4V2NA 3MIXA 5B7CA 2X8CA 3A2VA 3RHCA 2B5EA 3KMNA 2IFQB 2C1YA 4Q5FA 3G7YA 4YKGA 1X9WB 2H1AA 4JU5A 1K3OA 5IPGA 2B6MA 4MCUA 2FWFA 3UVHA 2I9HA 2MMOA 3TKSE 2GSRA 4ZL8A 4AF2A 4DSQA 3PR8A 1S3RA 5CP1A 1I5GA 5AIXA 3TJFA 3IA1A 5ECPB 2J23A 1ZYPA 1EEMA 2PN8A 2AHEA 5B6NA 4EL1A 2RM5A 4TXOB 1FG4A 3E9JB 3GKKA 1TK8B 4PUAA 4EIPA 6GSYA 2VCWA 5ID2B 4IN0A 2H6ZA 4PURA 4F0BA 2R5GA 5DAKB 4AJ6A 3GV1A 1GTIA 2X99A 3H4KA 1R5AA 1Z3EA 2C0FA 1TK0B 2H66A 2LV3A 2X4AA 3D21A 1M0UA 1Z9HA 1F3AA 5F0GA 5DALA 2YWIA 4BL7A 4E8HA 2WCIA 4POMA 4LL1B 2L6DA 3J7Yb 5F8BA 2R6KA 2VCVA 2OADA 2V1MA 5ABRA 2DKHA 1J0FA 3F9UA 1XXUA 2C3NA 2CZ2A 1NW2A 4K7NA 3VWWA 2H1GA 4GSSA 5LNKe 1EP8A 2X8HA 1T00A 4ZBAA 4WR4A 9GSSA 2DIYA 2B1LA 1TU7A 4MZWA 4F2IA 4QL7A 2R37A 2HXKA 3FKFA 1GL8A 2QGVA 3UIWA 1MD4A 2GGTA 1EV4A 2R4VA 3HDCA 1AIUA 2C3TA 4TOPA 1TDIA 4KX4A 1H4OA 1W89A 3IV4A 2KHPA 3Q6OA 1PD21 5IMDA 5DBQA 2DBCA 4Q5RA 1TTZA 3BCIA 4O7HA 1KBNA 2NTOA 3VWUA 4BWQA 5FHIA 5DJLA 4DSSB 1R7HA 3US3A 3FZ9A 1O6JA 2A2SA 1AXDA 4FYUA 2IMIA 3F6FA 5J9CA 1XWGA 2CX4A 4TVEA 1T3BA 2H6XA 1X5DA 4ZXGA 4NWYA 4X4JA 1A8YA 1XVQA 1ZOFA 1GTBA 4O32A 1YY7A 4FYCA 2JZSA 3VLNA 2VL2C 4HZ4A 1VF4A 2GVPA 3ERGA 4G0LA 5GSTA 3GRXA 4I6XA 2GSTA 4IP6A 4KH7A 2YNXA 4CW9A 4F82A 4NV5A 1BYEA 2P5QA 1GLQA 1KEBA 4MP4A 4MF5A 1OC9A 5G2ZA 4GQCA 4NHWA 3DVXA 1GULA 4L5OA 4KSMA 1M3JA 1YF1A 4L0WA 4ECJA 2KOKA 3M0FA 1NHOA 1SENA 3TDGA 1A2LA 1JZRA 4MPFA 1TRSA 3D0ZA 2WULA 3GH9A 1T1VA 5CRDA 2DJ3A 2QA2A 2GZPA 3W8JA 4TXVA 2QA1A 1GRXA 4RQRA 5ECMB 1RQMA 2E2GA 2OJLA 1B8XA 3BCKA 6GSSA 2LTKA 4WETA 3IR4A 3EVIA 4ID0A 5KN3A 1Z7RA 1YF0A 3IK9A 10GSA 1JZOA 2H75A 2F9SA 3TJGA 4YAPA 3ZMLA 1K0OA 2OACA 4H86A 3DYRA 1Z6NA 4GQFA 1WOUA 4IGJA 5KN1A 1RK4A 3FR9A 2IIYA 1XCCA 4V1Ap 5ENUA 5DVBA 2GT5A 2FCHA 4YQVA 2IL3A 1K3YA 3A3TA 5DCGA 2JZRA 2LUSA 3IHQA 4A5PA 4GXZA 3OR5A 3RDWA 4MJEA 5FWGA 3KMOA 2B5XA 5DAKA 4KE3A 1K3LA 5B6MA 2WJUA 6GSWA 1Y6EA 3ISOA 4PXOA 4WXTA 2AUVA 3HJMA 3FK8A 1EP7A 1XOBA 2MBTA 1HNCA 3L9VA 2CVBA 1AW9A 4KGIA 1NM3A 2DJ2A 5G30A 2AV4A 4OCFA 4F0CA 5IIZA 2I1UA 4YKFA 2IN3A 2A2PA 4O5UA 6GSVA 2PUKC 3L9UA 1XWBA 1PA3A 14GSA 1EOHA 3F6DA 2XBQA 3E3EA 1SKWB 3SWLA 3TKSA 2H70A 3KP9A 1DBYA 2HRNA 5D8IA 1GSSA 1WRYA 2EIQA 1N8JA 5FT3A 1T8EB 3DRNA 3HJPA 1G6WA 4Q5QA 1FW1A 1JZDA 1YJ6A 1QK8A 13GSA 3WGEA 4HUAA 5HFGA 3UJ1A 4BL7B 1GSDA 3WGXA 4G2EA 2VM2A 1BX9A 4K5SA 3HXSA 1YKCA 4EIQA 3KJYA 2K6VA 1V40A 3UEMA 1E2YA 1BEDA 4DVCA 4USSA 4IP1A 1ZYQB 3LEFA 2H72A 1FVKA 1YEPA 5CYYA 5ECHB 3KP8A 4MF7A 4F9ZA 2HE3A 5J3RA 3FRCA 1FAAA 3N9JA 2YN1A 3IK7A 2F8AA 3H1NA 5IO0A 4IQ1A 18GSA 3DD3A 1MDJA 4JR4A 2FWGA 2LRCA 1MDIA 1ML6A 5IQYA 2HT9A 2IMKA 1ZYNA 1ON4A 2ALBA 1QXHA 3C73A 4ULXA 1GLPA 1HNBA 2JSZA 2G2QA 5ELGA 2P0GA 2CT6A 4AJ8A 1O73A 1X9SB 4V2LA 3QAWA 3CMIA 1PL2A 4EXJA 4JZQA 2NBSA 1PKZA 6GSXA 1ILOA 2VCQA 1GH2A 4TR1A 3R2QA 5D93A 2C8UA 4EF0A 3LORA 3F0IA 2PBJA 3TJJA 5HR3A 3CSJA 1EZKA 2FWEA 4I2TA 2MBSA 1Q4JA 2WZ9A 4J57E 1QFNA 5C04A 3TB2A 2H19A 1TW9A 5DCHA 5IM9A 4FYBA 2VD0A 4XRDA 2WB9A 3HVNA 1WPIA 3KD0A 1O81A 4MABA 2DC5A 4KB3A 3ZZXA 1TI1A 3C1RA 5AISA 5IPHA 1UA5A 2VCTA 3EINA 1A0RP 4DEJA 4NAXA 2LJKA 3QAVA 4PNGA 2O87A 1XPVA 3F4TA 2C0EA 2VO4A 5J4UA 3ME7A 1SD9A 2G0FA 1WP0A 2M46A 2GSSA 3TOUA 5AGYA 3R3EA 1VF1A 4KDXA 3EWLA 5A4VA 2O85A 3KM6A 2VM1A 3ZTLA 5C00A 1OC3A 2FHEA 1SD8A 2LS5A 1UN2A 4HJ2A 1ZL9A 3TJBA 1IYHA 5ECLB 4LMWA 4L5LA 1TK5B 5JWOB 2AB6A 3UVTA 1V98A 5KOWA 2TIRA 1MTCA 2UZ8A 3TRQA 2YP6A 1CQGA 4HI7A 4EO3A 5D9TA 4OFTA 1SL0B 4G0KA 5ECNB 5D9VA 4TR0A 2AYTA 2A4HA 1WJKA 2RM6A 1FOVA 1K0NA 1BJXA 1EGRA 2P31A 1AQVA 5IO2A 3DWVA 1TJDA 5CRWA 2O7KA 1USBA 5DQSA 2K8SA 5F07A 1ST9A 1N2AA 3ZLPA 1M3IA 3EC3A 3KZQA 1GTAA 4BWSA 3GYKA 3BD2A 3P8WA 2LEGA 4MJBA 2EC4A 3CSHA 2YOIA 3VI7A 1K0DA 2H01A 3QCPA 4NXIA 3CSIA 1K0CA 3ZL5A 3U5RE 3P7XA 4POKA 3TKSC 3FHKA 3LYPA 3EMXA 1F3BA 3MDKA 3QD9A 4G9HA 5H5QA 3DGQA 5JWQB 5IMZA 5ECSA 1PX6A 1V57A 1GSEA 2PMTA 2J9HA 2DKIA 1PKWA 4XS4B 4BVXA 3GX0A 4YQMA 3MSZA 2FNOA 1U3AA 2R0CA 3VWXA 4FQUA 4K2XA 2H0IA 2LQQA 4CHSA 2LRNA 4PQHA 4WF5A 4WR5A 3LJRA 3RPNA 2HFDA 4XS1A 2AAWA 5HFKA 19GSA 4ISDA 4KAEA 1DUGA 2PVOC 5KN2A 3IRAA 2F51A 3ZVJD 4N0ZA 3GTUA 2VLTA 2H73A 4N10A 1O8WA 2V6KA 2FA8A 3KH9A 2N5FA 1XW9A 4KF9A 3DEXA 5G5FA 2DIZA 4X1UA 2HYXA 1Z6MA 4EDYA 2GSQA 2M80A 1OVNA 1KNGA 2K9FA 4X0XA 3CTGA 4HU7A 4HEA2 4CY8A 3GKXA 1YQ1A 5JCWA 3LQ7A 1OYJA 2QSIA 1J08A 4QQ7A 4KCEA 4XIHA 1R4WA 3GMFA 1B48A 3ZIJA 3PH9A 2R3XA 3GH6A 2HZFA 3IXRA 1PN9A 1FHEA 5ECIB 2CQ9A 3ZRDA 2IMDA 3UL3A 5KEJA 5D73A 5CO3A 2H6YA 1M7TA 1WE0A 3QFBC 2DMMA 3W6GA 16GSA 2HRAA 4TN8A 2VCXA 1GUMA 1TRWA 2IMFA 1TI3A 4PTSA 5EVOA 2IWTA 5D9XA 2YJHA 2MMAA 3W8SA 2D2ZA 4OFMA 2IPAA 1SL2B 1SKSB 3O6TA 2C4JA 5HR1A 3I43A 2HRKA 1ZCPA 3KCMA 4TR1B 2TRXA 2M72A 3CQFA 4JRRA 2LNTA 3TCOA 3UOMA 1EV9A 2JADA 4ZBDA 2X49A 1M99A 5ECQB 1LU4A 4CDOA 1R5PA 3VPQA 5B8BA 4X43A 1B4QA 1G0TA 1HNAA 2HZEB 5GZZB 1YDKA 4ECBA 1GSFA 3RAZA 3HVVA 1CQHA 4KDUA 3BBYA 2K8VA 2DLXA 4K6XA 4LL4B 4TKYA 2CVDA 2OA7A 4N0VA 1THXA 4MJAA 4ML1A 1F37A 1GP1A 2DJ1A 2FLSA 3D6IA 3GSSA 3Q18A 3FY7A 17GSA 2GQMA 4RUVA 2H8LA 2GDRA 1ABAA 4RQXA 2PVQA 2FWHA 3LG6A 4J2FA 2FD3A 2P5RA 4XTSA 1U87A 4WKWA 4P3YB 4HS1A 2BJXA 2GTUA 3S9FA 3LSZA 3NOFA 2VLUA 1VF3A 3EPTA 1JFUA 5AN1A 2K18A 3BOAA 4K0GA 5KOXA 5G1LA 2VCZA 3HA9A 1BQ7A 1A23A 4EE0A 3D4MA 3CTFA 4QL9A 1B9XC 5IOXA 4DSRA 3HD5A 3O76A 5D96A 4J56E 4HSCX 2MZCA 2HSYA 4MDCA 3D4TA 4OWYA 3U6VA 4GCIA 3MAKA 2V2GA 4XS4A 2E7PA 2KP1A 3QMXA 1B4PA 1UVZA 2LJAA 2YWNA 2A4VA 3P2AA 4ZB8A 4BPYA 4BVYA 4EUYA 2LQOA 3LFLA 3VI5A 4ECIA 3L0HA 1A2MA 5LD0A 5JCUA 3APOA 2E0QA 3EMPA 3ED3A 1PN0A 3HKRA 3O3TA 5KN0A 1FB6A 2ON7A 4MH2A 2WFCA 1DSBA 5F06A 1X5EA 2HSMA 3TOTA 1A2JA 1S3CA 2I3YA 1GSYA 4BVXB 22GSA 4POBA 4F03A 4O5RA 1HQOA 1VF2A 2L4CA 3H79A 3GKMA 3IPZA 1AAZA 3MNGA 4RI7A 3EE2A 2HSHA 2H0HA 4MF6A 1GUHA 4IELA 2QKEA 5E59A 2OE0A 1ERTA 1TOFA 1GWCA 2NPBA 4ZL9A 4D73A 1SJZA 3DKSA 3BJ5A 1EOGA 3IC8A 2DJJA 5EL8A 3CXGA 1A8LA 3HZ4A 3LXZA 1F2EA 3GTUB 4IVFA 2CA8A 4MH3A 1T4ZA 5JWRB 4XS6A 1X5CA 2LRTA 5J41A 5A5KA 3VK9A 1I9DA 3C8EA 1SJ6A 3J7Yk 8GSSA 2E2MA 4G19A 3G7JA 5A4WA 2C0DA 4O5QA 1X0RA 4ACSA 2L5LA 4K9ZA 3VFIA 2VLVA 4JEDA 1IYIA 1A0FA 3M9JA 2CVKA 3I69A 3M1GA 2HRFA 1S3AA 3D22A 2R0PA 4WBRD 5AIVA 3IAM2 4EDZA 1NHYA 4KW6A 1JZWA 4ILFA 2WRTA 1H75A 1V2AA 2B5YA 3A2WA 4RI6A 5F05A 3GN3A 3TRXA 5IMCA 3PINA 3Q19A 3TJKA 3QFAC 2PWJA 5INYA 1EWXA 2GLRA 3FZ5A 4GF0A 5ECKB 2HZEA 1A24A 1OAZA 3RHBA 2XBIA 1ACVA 3APSA 3M8NA 2NVLA 4MK3A 3TRPA 3NZNA 1E6BA 1C72A 5G31A 1LBKA 1M2BA 4HU9A 2JU5A 3FZ4A 3IBHA 2C3QA 3QDNA 4LLRA 1PFOA 4Z7XA 1JLVA 2RLIA 3RBTA 3C71A 5JCGA 1NSWA 1Y25A 2FGXA 3E0UA 1F6MC 2YJ7A 2VUPA 4K8MA 2EIOA 2WGRA 3CRTA 2AJQB 2DMLA 3F8UA 4JE1A 2H0GA 3MYDA 1TRUA 1HD2A 1JLWA 4MZCA 3CBUA 1XW6A 3FR3A 3ZIVA 4IBPA 3CRUA 5CNWA 4K0NA 5B8AA 5CRHA 2C80A 2L4QA 2L59A 5DJMA 3A2XA 5H5RA 3RPPA 4WBJA 1U3IA 5J5NA 3I6AA 1XOAA 2ES7A 2YZUA 1SK0A 5HQPA 3G7IA 1K0MA 1G6YA 3FYGA 4KUNA 4K2DA 4V2MA 4I2UA 1WIKA 3F63A 2DJKA 1QQ2A 1O7UA 5DQYA 3TUEA 3M9KA 4ZB6A 1B9YC 4YQUA 3Q74A 5HR0A 1WWJA 2JZTA 1BAYA 2YV7A 2O89A 2H76A 4EC0A 2X64A 5IOWA 1XVWA 1U88A 1QUWA 3GX8A 5IMFA 4BA7A 3EYTA 4MNNA 3HHVA 4AGSA 2MMNA 4PX1A 2OBIA 3ZREA 1G7EA 1MD3A 1QGVA 1TU8A 1T4YA 4LA1A 2MMZA 1O8XA 4HZ2A 3FMWA 4GSNA 1UC7A 4KSOA 5H5SA 4BVYB 4TR3A 2I81A 3ZFLA 3CYNA 3TKRA 3GFKA 3KXOA 4N11A 4Q5NA 1SKRB 4Z2RA 4E8EA 2F3MA 5CAXA 2H71A 1GSUA 3C1SA 1SU9A 3FW2A 4IQAA 3EURA 3F3QA 3P90A 4WF4A 1XWAA 2RIIA 3QAGA 2O8VB 3HVSA 4ICYA 4ML6A 2PU9C 1O85A 2WDUA 2GT6A 4PQIA 1M9BA 3ERFA 2PPTA 3HZ8A 2I4AA 4WEYA 2B7KA 3F3RA 3HY2A 3L78A 3KEBA 1JHBA 3KTLA 1LJRA 4XHMA 3UBKA 5G5EA 1VRSD 1XIYA 3M3MA 3NIVA 4KCAA 4D73B 2H1BA 4I97A 5EY6A 1RW1A 4IW9A 3IHGA 3C7MA 3GKNA 1AC1A 2LJRA 3LW9A 4ZB9A 4PUFC 2GS3A 2VAFA 1ZZYA 2N5AA 2ON5A 5DDLA 3GURA 1AQXA 1Q98A 3GIXA 2REMA 3EU3A 4EKZA 4Z2UA 1Z5YE 6GSUA 3GHAA 4I5QA 2JSYA 4PNFA 1G7OA 2YV9A 3QPMA 3AY8A 2KP2A 3HYPA 4OCEA 3IOSA 2HI7A 3QR6A 2BMXA 1Z7PA 7GSSA 2QC7A 4OFNA 2C0GA 2XC2A 3GA4A 3UARA 5BRTA 1M2AA 1QMVA 3IAS2 4KNDA 4ZL7A 3H8QA 3PGTA 2LNSA 5CREA 1V9WA 3TGZA 2YWOA 3EU4A 3LXTA 1K0BA 4GTUA 4YH2A 4NPBA 3VURA 4MLYA 2A2RA 2HLSA 4L0UA 4O92A 2ZNMA 4ZILA 1ZGNA 4K5RA 1SK2A 3L9SA 3LYKA 4PQ1A 2OE1A 1GNEA 2MYGA 2RUEA 3FR6A 1SYXA 3GL3A 2V41A 4IKHA 2V32A 4JR6A 2IFQA 2FA4A 3DXBA 3SBCA 4NHZA 1U6TA 1PQNA 3KTBA 1DE2A 4I8BA 3ERWA 2IMEA 1GNWA 1V58A 3WGDA 1AQWA 2TRCP 1YKAA 1GTUA 3LGCA 4L8EA 1PGTA 2LSTA 2VOCA 1XWCA 4HOJA 4NV2A 2WS2A 3WT1A 2GZZA 3KGKA 1FB0A 1OE7A 1PL1A 1GSQA 4K7OA 2XPDA 1XZOA 1S3DA 1PRXA 1TXXA 1J9BA 4TXOA 4ECCA 2L57A 5EPFA 4ZIJA 2XPEA 5J9BA 5D9WA 5ID2A 4YAVA 2ZCTA 4CY6A 1URMA 1EGOA 1TP9A 3I9V2 1SK1A 4BIKA 3VPTA 2XHFA 3G9BA 4OD7A 12GSA 4FO5A 5IMAA 4MA9A 5G1KA 1ERVA 3IE3A 2KUCA 5CRGA 4OO4A 1K0AA 1VGLA 2DJ0A 2EIRA 3LWAA 5ECRB 3L4NA 4K1FA 4KDYA 3DIEA 1FOHA 3A5IA 11GSA 4LMVA 2VD1A 4EVMA 4NMUA 4TR4A 6GSTA 2F8FA 2DSAA 4MZBA 5E4WA 2CAIA 3UMAA 5BMUA 4HQSA 1TRVA 2H74A 2JL4A 5LCZA 2PERA 1ZYEA 3PPUA 1XW5A 2CAQA 1SYRA 3K8NA 4TW5A 2R0GA 4GWRA 3V1WA 2OKAA 1R26A 3ZYWA 1X9MB 2VL9A 2R2JA 4TRXA 4IHUA 3HVXA 2BTOT 1PX7A 5DALB 3ZVJA 1SL1B 1W4VA 3FEUA 5GSSA 4HJMA 3KIJA 3F4SA 4G0IA 4FH8A 2CZ3A 2YZHA 1THOA 1XBSA 20GSA 2GQKA 2YWMA 2Z9SA 2RUFA 3UBLA 4XCSA 2YPMA 2H1DA 2L6CA 4DSSA 1M2DA 3ME8A 5HR2A 1XG8A 4OO5A 2JACA 1OC8A 3IC4A 4GLTA 2VIMA 2LKUA 3WD6A 2YANA 1KTEA 5GAND 1XFLA 2H30A 2HNLA 3DMLA 4OMVA 4JBBA 1MEKA 1OKDA 3QOUA 1AUCA 5HFIA 4PGTA 1ERUA 1EEJA 2FUG2 2V6OA 2X8GA 1XWKA 1DE1A 1FVJA 2N5BA 4AJ7A 1PSQA 1F9MA 3ZFBA 1GUKA 2OBKA 4FIWA 4HDEA 3JCML 4K7IA 1T7PB 5ECOB 3F4RA 4IS0A 3VWVA 3WYWA 2VL2A 3GL5A 3GSTA 1YEXA 1SJIA 3KH7A 2L5OA 1ZMAA 4IJ3A 4ZBBA 1FO5A 4GRFA 3DVWA 2OE3A 1ERWA 2VL3A 5IMVA 3D5JA 3TKQA 2B3SA 2FY6A 4MJCA 4Z2TA 5ELAA 2YCDA 1TKDB 3HJOA 4GSTA 3H93A 4MMMA 2B1KA 5L71A 1YZXA 3GNJA 3TKPA 2B7JA 4IJIA 2KLXA 4XRAA 3ZITA 1OC9B 2ZUPA 1HYUA 3IDVA 4HQZA 4V1Ag 2GQLA 3FZAA 4KA0A 2CX3A 2GZYA 2CV4A
chains in the Genus database with same CATH topology
1BG5A 3MWHA 3UAPA 5A4UA 4POLA 3GUSA 3N5OA 4MPGA 3APQA 1PMTA 3ZMKA 4N30A 4G10A 1OE8A 2PGTA 3HCZA 5COHA 2NDOA 1M9AA 2IJYA 1WMJA 1MDKA 5GAPD 3A5WA 1OKTA 3WT2A 4V2NA 3MIXA 5B7CA 2X8CA 3A2VA 3RHCA 2B5EA 3KMNA 2IFQB 2C1YA 4Q5FA 3G7YA 4YKGA 1X9WB 2H1AA 4JU5A 1K3OA 5IPGA 2B6MA 4MCUA 2FWFA 3UVHA 2I9HA 2MMOA 3TKSE 2GSRA 4ZL8A 4AF2A 4DSQA 3PR8A 5CP1A 1I5GA 5AIXA 3TJFA 3IA1A 5ECPB 2J23A 1ZYPA 1EEMA 2PN8A 2AHEA 5B6NA 4EL1A 2RM5A 4TXOB 1FG4A 3E9JB 3GKKA 1TK8B 4PUAA 4EIPA 6GSYA 2VCWA 5ID2B 4IN0A 2H6ZA 4PURA 4F0BA 2R5GA 5DAKB 4AJ6A 3GV1A 1GTIA 2X99A 3H4KA 1R5AA 1Z3EA 2C0FA 1TK0B 2H66A 2LV3A 2X4AA 3D21A 1M0UA 1Z9HA 1F3AA 5F0GA 5DALA 2YWIA 4BL7A 4E8HA 2WCIA 4POMA 4LL1B 2L6DA 3J7Yb 5F8BA 2R6KA 2VCVA 2OADA 2V1MA 5ABRA 2DKHA 1J0FA 3F9UA 1XXUA 2C3NA 2CZ2A 1NW2A 4K7NA 3VWWA 2H1GA 4GSSA 5LNKe 1EP8A 2X8HA 1T00A 4ZBAA 4WR4A 9GSSA 2DIYA 2B1LA 1TU7A 4MZWA 4F2IA 4QL7A 2R37A 2HXKA 3FKFA 1GL8A 2QGVA 3UIWA 1MD4A 2GGTA 1EV4A 2R4VA 3HDCA 1AIUA 2C3TA 4TOPA 1TDIA 4KX4A 1H4OA 1W89A 3IV4A 2KHPA 3Q6OA 1PD21 5IMDA 5DBQA 2DBCA 4Q5RA 1TTZA 3BCIA 4O7HA 1KBNA 2NTOA 3VWUA 4BWQA 5FHIA 5DJLA 4DSSB 1R7HA 3US3A 3FZ9A 1O6JA 2A2SA 1AXDA 4FYUA 2IMIA 3F6FA 5J9CA 1XWGA 2CX4A 4TVEA 1T3BA 2H6XA 1X5DA 4ZXGA 4NWYA 4X4JA 1A8YA 1XVQA 1ZOFA 1GTBA 4O32A 1YY7A 4FYCA 2JZSA 3VLNA 2VL2C 4HZ4A 1VF4A 2GVPA 3ERGA 4G0LA 5GSTA 3GRXA 4I6XA 2GSTA 4IP6A 4KH7A 2YNXA 4CW9A 4F82A 4NV5A 1BYEA 2P5QA 1GLQA 1KEBA 4MP4A 4MF5A 1OC9A 5G2ZA 4GQCA 4NHWA 3DVXA 1GULA 4L5OA 4KSMA 1YF1A 4L0WA 4ECJA 2KOKA 3M0FA 1NHOA 1SENA 3TDGA 1A2LA 1JZRA 4MPFA 1TRSA 3D0ZA 2WULA 3GH9A 1T1VA 5CRDA 2DJ3A 2QA2A 2GZPA 3W8JA 4TXVA 2QA1A 1GRXA 4RQRA 5ECMB 1RQMA 2E2GA 2OJLA 1B8XA 3BCKA 6GSSA 2LTKA 4WETA 3IR4A 3EVIA 4ID0A 5KN3A 1Z7RA 1YF0A 3IK9A 10GSA 1JZOA 2H75A 2F9SA 3TJGA 4YAPA 3ZMLA 1K0OA 2OACA 4H86A 3DYRA 1Z6NA 4GQFA 1WOUA 4IGJA 5KN1A 1RK4A 3FR9A 2IIYA 1XCCA 4V1Ap 5ENUA 5DVBA 2GT5A 2FCHA 4YQVA 2IL3A 1K3YA 3A3TA 5DCGA 2JZRA 2LUSA 3IHQA 4A5PA 4GXZA 3OR5A 3RDWA 4MJEA 5FWGA 3KMOA 2B5XA 5DAKA 4KE3A 1K3LA 5B6MA 2WJUA 6GSWA 1Y6EA 3ISOA 4PXOA 4WXTA 2AUVA 3HJMA 3FK8A 1EP7A 1XOBA 2MBTA 1HNCA 3L9VA 2CVBA 1AW9A 4KGIA 1NM3A 2DJ2A 5G30A 2AV4A 4OCFA 4F0CA 5IIZA 2I1UA 4YKFA 2IN3A 2A2PA 4O5UA 6GSVA 2PUKC 3L9UA 1XWBA 1PA3A 14GSA 1EOHA 3F6DA 2XBQA 3E3EA 1SKWB 3SWLA 3TKSA 2H70A 3KP9A 1DBYA 2HRNA 5D8IA 1GSSA 1WRYA 2EIQA 1N8JA 5FT3A 1T8EB 3DRNA 3HJPA 1G6WA 4Q5QA 1FW1A 1JZDA 1YJ6A 1QK8A 13GSA 3WGEA 4HUAA 5HFGA 3UJ1A 4BL7B 1GSDA 3WGXA 4G2EA 2VM2A 1BX9A 4K5SA 3HXSA 1YKCA 4EIQA 3KJYA 2K6VA 1V40A 3UEMA 1E2YA 1BEDA 4DVCA 4USSA 4IP1A 1ZYQB 3LEFA 2H72A 1FVKA 1YEPA 5CYYA 5ECHB 3KP8A 4MF7A 4F9ZA 2HE3A 5J3RA 3FRCA 1FAAA 3N9JA 2YN1A 3IK7A 2F8AA 3H1NA 5IO0A 4IQ1A 18GSA 3DD3A 1MDJA 4JR4A 2FWGA 2LRCA 1MDIA 1ML6A 5IQYA 2HT9A 2IMKA 1ZYNA 1ON4A 2ALBA 1QXHA 3C73A 4ULXA 1GLPA 1HNBA 2JSZA 2G2QA 5ELGA 2P0GA 2CT6A 4AJ8A 1O73A 1X9SB 4V2LA 3QAWA 3CMIA 1PL2A 4EXJA 4JZQA 2NBSA 1PKZA 6GSXA 1ILOA 2VCQA 1GH2A 4TR1A 3R2QA 5D93A 2C8UA 4EF0A 3LORA 3F0IA 2PBJA 3TJJA 5HR3A 3CSJA 1EZKA 2FWEA 4I2TA 2MBSA 1Q4JA 2WZ9A 4J57E 1QFNA 5C04A 3TB2A 2H19A 1TW9A 5DCHA 5IM9A 4FYBA 2VD0A 4XRDA 2WB9A 1WPIA 3KD0A 1O81A 4MABA 2DC5A 4KB3A 3ZZXA 1TI1A 3C1RA 5AISA 5IPHA 1UA5A 2VCTA 3EINA 1A0RP 4DEJA 4NAXA 2LJKA 3QAVA 4PNGA 2O87A 1XPVA 3F4TA 2C0EA 2VO4A 5J4UA 3ME7A 1SD9A 2G0FA 1WP0A 2M46A 2GSSA 3TOUA 5AGYA 3R3EA 1VF1A 4KDXA 3EWLA 5A4VA 2O85A 3KM6A 2VM1A 3ZTLA 5C00A 1OC3A 2FHEA 1SD8A 2LS5A 1UN2A 4HJ2A 1ZL9A 3TJBA 1IYHA 5ECLB 4LMWA 4L5LA 1TK5B 5JWOB 2AB6A 3UVTA 1V98A 5KOWA 2TIRA 1MTCA 2UZ8A 3TRQA 2YP6A 1CQGA 4HI7A 4EO3A 5D9TA 4OFTA 1SL0B 4G0KA 5ECNB 5D9VA 4TR0A 2AYTA 2A4HA 1WJKA 2RM6A 1FOVA 1K0NA 1BJXA 1EGRA 2P31A 1AQVA 5IO2A 3DWVA 1TJDA 5CRWA 2O7KA 1USBA 5DQSA 2K8SA 5F07A 1ST9A 1N2AA 3ZLPA 3EC3A 3KZQA 1GTAA 4BWSA 3GYKA 3BD2A 3P8WA 2LEGA 4MJBA 2EC4A 3CSHA 2YOIA 3VI7A 1K0DA 2H01A 3QCPA 4NXIA 3CSIA 1K0CA 3ZL5A 3U5RE 3P7XA 4POKA 3TKSC 3FHKA 3LYPA 3EMXA 1F3BA 3MDKA 3QD9A 4G9HA 5H5QA 3DGQA 5JWQB 5IMZA 5ECSA 1PX6A 1V57A 1GSEA 2PMTA 2J9HA 2DKIA 1PKWA 4XS4B 4BVXA 3GX0A 4YQMA 3MSZA 2FNOA 1U3AA 2R0CA 3VWXA 4FQUA 4K2XA 2H0IA 2LQQA 4CHSA 2LRNA 4PQHA 4WF5A 4WR5A 3LJRA 3RPNA 2HFDA 4XS1A 2AAWA 5HFKA 19GSA 4ISDA 4KAEA 1DUGA 2PVOC 5KN2A 3IRAA 2F51A 3ZVJD 4N0ZA 3GTUA 2VLTA 2H73A 4N10A 1O8WA 2V6KA 2FA8A 3KH9A 2N5FA 1XW9A 4KF9A 3DEXA 5G5FA 2DIZA 4X1UA 2HYXA 1Z6MA 4EDYA 2GSQA 2M80A 1OVNA 1KNGA 2K9FA 4X0XA 3CTGA 4HU7A 4HEA2 4CY8A 3GKXA 1YQ1A 5JCWA 3LQ7A 1OYJA 2QSIA 1J08A 4QQ7A 4KCEA 4XIHA 1R4WA 3GMFA 1B48A 3ZIJA 3PH9A 2R3XA 3GH6A 2HZFA 3IXRA 1PN9A 1FHEA 5ECIB 2CQ9A 3ZRDA 2IMDA 3UL3A 5KEJA 5D73A 5CO3A 2H6YA 1M7TA 1WE0A 3QFBC 2DMMA 3W6GA 16GSA 2HRAA 4TN8A 2VCXA 1GUMA 1TRWA 2IMFA 1TI3A 4PTSA 5EVOA 2IWTA 5D9XA 2YJHA 2MMAA 3W8SA 2D2ZA 4OFMA 2IPAA 1SL2B 1SKSB 3O6TA 2C4JA 5HR1A 3I43A 2HRKA 1ZCPA 3KCMA 4TR1B 2TRXA 2M72A 4JRRA 2LNTA 3TCOA 3UOMA 1EV9A 2JADA 4ZBDA 2X49A 1M99A 5ECQB 1LU4A 4CDOA 1R5PA 3VPQA 5B8BA 4X43A 1B4QA 1G0TA 1HNAA 2HZEB 5GZZB 1YDKA 4ECBA 1GSFA 3RAZA 3HVVA 1CQHA 4KDUA 3BBYA 2K8VA 2DLXA 4K6XA 4LL4B 4TKYA 2CVDA 2OA7A 4N0VA 1THXA 4MJAA 4ML1A 1F37A 1GP1A 2DJ1A 2FLSA 3D6IA 3GSSA 3Q18A 3FY7A 17GSA 2GQMA 4RUVA 2H8LA 2GDRA 1ABAA 4RQXA 2PVQA 2FWHA 3LG6A 4J2FA 2FD3A 2P5RA 4XTSA 1U87A 4WKWA 4P3YB 4HS1A 2BJXA 2GTUA 3S9FA 3LSZA 3NOFA 2VLUA 1VF3A 3EPTA 1JFUA 5AN1A 2K18A 3BOAA 4K0GA 5KOXA 5G1LA 2VCZA 3HA9A 1BQ7A 1A23A 4EE0A 3D4MA 3CTFA 4QL9A 1B9XC 5IOXA 4DSRA 3HD5A 3O76A 5D96A 4J56E 2MZCA 2HSYA 4MDCA 3D4TA 4OWYA 3U6VA 4GCIA 3MAKA 2V2GA 4XS4A 2E7PA 2KP1A 3QMXA 1B4PA 1UVZA 2LJAA 2YWNA 2A4VA 3P2AA 4ZB8A 4BPYA 4BVYA 4EUYA 2LQOA 3LFLA 3VI5A 4ECIA 3L0HA 1A2MA 5LD0A 5JCUA 3APOA 2E0QA 3EMPA 3ED3A 1PN0A 3HKRA 3O3TA 5KN0A 1FB6A 2ON7A 4MH2A 2WFCA 1DSBA 5F06A 1X5EA 2HSMA 3TOTA 1A2JA 1S3CA 2I3YA 1GSYA 4BVXB 22GSA 4POBA 4F03A 4O5RA 1HQOA 1VF2A 2L4CA 3H79A 3GKMA 3IPZA 1AAZA 3MNGA 4RI7A 3EE2A 2HSHA 2H0HA 4MF6A 1GUHA 4IELA 2QKEA 5E59A 2OE0A 1ERTA 1TOFA 1GWCA 2NPBA 4ZL9A 4D73A 1SJZA 3DKSA 3BJ5A 1EOGA 3IC8A 2DJJA 5EL8A 3CXGA 1A8LA 3HZ4A 3LXZA 1F2EA 3GTUB 4IVFA 2CA8A 4MH3A 1T4ZA 5JWRB 4XS6A 1X5CA 2LRTA 5J41A 5A5KA 3VK9A 1I9DA 3C8EA 1SJ6A 3J7Yk 8GSSA 2E2MA 4G19A 3G7JA 5A4WA 2C0DA 4O5QA 1X0RA 4ACSA 2L5LA 4K9ZA 3VFIA 2VLVA 4JEDA 1IYIA 1A0FA 3M9JA 2CVKA 3I69A 3M1GA 2HRFA 1S3AA 3D22A 2R0PA 4WBRD 5AIVA 3IAM2 4EDZA 1NHYA 4KW6A 1JZWA 4ILFA 2WRTA 1H75A 1V2AA 2B5YA 3A2WA 4RI6A 5F05A 3GN3A 3TRXA 5IMCA 3PINA 3Q19A 3TJKA 3QFAC 2PWJA 5INYA 1EWXA 2GLRA 3FZ5A 4GF0A 5ECKB 2HZEA 1A24A 1OAZA 3RHBA 2XBIA 1ACVA 3APSA 3M8NA 2NVLA 4MK3A 3TRPA 3NZNA 1E6BA 1C72A 5G31A 1LBKA 1M2BA 4HU9A 2JU5A 3FZ4A 3IBHA 2C3QA 3QDNA 4LLRA 4Z7XA 1JLVA 2RLIA 3RBTA 3C71A 5JCGA 1NSWA 1Y25A 2FGXA 3E0UA 1F6MC 2YJ7A 2VUPA 4K8MA 2EIOA 2WGRA 3CRTA 2AJQB 2DMLA 3F8UA 4JE1A 2H0GA 3MYDA 1TRUA 1HD2A 1JLWA 4MZCA 3CBUA 1XW6A 3FR3A 3ZIVA 4IBPA 3CRUA 5CNWA 4K0NA 5B8AA 5CRHA 2C80A 2L4QA 2L59A 5DJMA 3A2XA 5H5RA 3RPPA 4WBJA 1U3IA 5J5NA 3I6AA 1XOAA 2ES7A 2YZUA 1SK0A 5HQPA 3G7IA 1K0MA 1G6YA 3FYGA 4KUNA 4K2DA 4V2MA 4I2UA 1WIKA 3F63A 2DJKA 1QQ2A 1O7UA 5DQYA 3TUEA 3M9KA 4ZB6A 1B9YC 4YQUA 3Q74A 5HR0A 1WWJA 2JZTA 1BAYA 2YV7A 2O89A 2H76A 4EC0A 2X64A 5IOWA 1XVWA 1U88A 1QUWA 3GX8A 5IMFA 4BA7A 3EYTA 4MNNA 3HHVA 4AGSA 2MMNA 4PX1A 2OBIA 3ZREA 1G7EA 1MD3A 1QGVA 1TU8A 1T4YA 4LA1A 2MMZA 1O8XA 4HZ2A 3FMWA 4GSNA 1UC7A 4KSOA 5H5SA 4BVYB 4TR3A 2I81A 3ZFLA 3CYNA 3TKRA 3GFKA 3KXOA 4N11A 4Q5NA 1SKRB 4Z2RA 4E8EA 2F3MA 5CAXA 2H71A 1GSUA 3C1SA 1SU9A 3FW2A 4IQAA 3EURA 3F3QA 3P90A 4WF4A 1XWAA 2RIIA 3QAGA 2O8VB 3HVSA 4ICYA 4ML6A 2PU9C 1O85A 2WDUA 2GT6A 4PQIA 1M9BA 3ERFA 2PPTA 3HZ8A 2I4AA 4WEYA 2B7KA 3F3RA 3HY2A 3L78A 3KEBA 1JHBA 3KTLA 1LJRA 4XHMA 3UBKA 5G5EA 1VRSD 1XIYA 3M3MA 3NIVA 4KCAA 4D73B 2H1BA 4I97A 5EY6A 1RW1A 4IW9A 3IHGA 3C7MA 3GKNA 1AC1A 2LJRA 3LW9A 4ZB9A 4PUFC 2GS3A 2VAFA 1ZZYA 2N5AA 2ON5A 5DDLA 3GURA 1AQXA 1Q98A 3GIXA 2REMA 3EU3A 4EKZA 4Z2UA 1Z5YE 6GSUA 3GHAA 4I5QA 2JSYA 4PNFA 1G7OA 2YV9A 3QPMA 3AY8A 2KP2A 3HYPA 4OCEA 3IOSA 2HI7A 3QR6A 2BMXA 1Z7PA 7GSSA 2QC7A 4OFNA 2C0GA 2XC2A 3GA4A 3UARA 5BRTA 1M2AA 1QMVA 3IAS2 4KNDA 4ZL7A 3H8QA 3PGTA 2LNSA 5CREA 1V9WA 3TGZA 2YWOA 3EU4A 3LXTA 1K0BA 4GTUA 4YH2A 4NPBA 3VURA 4MLYA 2A2RA 2HLSA 4L0UA 4O92A 2ZNMA 4ZILA 1ZGNA 4K5RA 1SK2A 3L9SA 3LYKA 4PQ1A 2OE1A 1GNEA 2MYGA 2RUEA 3FR6A 1SYXA 3GL3A 2V41A 4IKHA 2V32A 4JR6A 2IFQA 2FA4A 3DXBA 3SBCA 4NHZA 1U6TA 1PQNA 3KTBA 1DE2A 4I8BA 3ERWA 2IMEA 1GNWA 1V58A 3WGDA 1AQWA 2TRCP 1YKAA 1GTUA 3LGCA 4L8EA 1PGTA 2LSTA 2VOCA 1XWCA 4HOJA 4NV2A 2WS2A 3WT1A 2GZZA 3KGKA 1FB0A 1OE7A 1PL1A 1GSQA 4K7OA 2XPDA 1XZOA 1S3DA 1PRXA 1TXXA 1J9BA 4TXOA 4ECCA 2L57A 5EPFA 4ZIJA 2XPEA 5J9BA 5D9WA 5ID2A 4YAVA 2ZCTA 4CY6A 1URMA 1EGOA 1TP9A 3I9V2 1SK1A 3VPTA 2XHFA 3G9BA 4OD7A 12GSA 4FO5A 5IMAA 4MA9A 5G1KA 1ERVA 3IE3A 2KUCA 5CRGA 4OO4A 1K0AA 1VGLA 2DJ0A 2EIRA 3LWAA 5ECRB 3L4NA 4K1FA 4KDYA 3DIEA 1FOHA 3A5IA 11GSA 4LMVA 2VD1A 4EVMA 4NMUA 4TR4A 6GSTA 2F8FA 2DSAA 4MZBA 5E4WA 2CAIA 3UMAA 5BMUA 4HQSA 1TRVA 2H74A 2JL4A 5LCZA 2PERA 1ZYEA 3PPUA 1XW5A 2CAQA 1SYRA 3K8NA 4TW5A 2R0GA 4GWRA 3V1WA 2OKAA 1R26A 3ZYWA 1X9MB 2VL9A 2R2JA 4TRXA 4IHUA 3HVXA 2BTOT 1PX7A 5DALB 3ZVJA 1SL1B 1W4VA 3FEUA 5GSSA 4HJMA 3KIJA 3F4SA 4G0IA 4FH8A 2CZ3A 2YZHA 1THOA 1XBSA 20GSA 2GQKA 2YWMA 2Z9SA 2RUFA 3UBLA 4XCSA 2YPMA 2H1DA 2L6CA 4DSSA 1M2DA 3ME8A 5HR2A 4OO5A 2JACA 1OC8A 3IC4A 4GLTA 2VIMA 2LKUA 3WD6A 2YANA 1KTEA 5GAND 1XFLA 2H30A 2HNLA 3DMLA 4OMVA 4JBBA 1MEKA 1OKDA 3QOUA 1AUCA 5HFIA 4PGTA 1ERUA 1EEJA 2FUG2 2V6OA 2X8GA 1XWKA 1DE1A 1FVJA 2N5BA 4AJ7A 1PSQA 1F9MA 3ZFBA 1GUKA 2OBKA 4FIWA 4HDEA 3JCML 4K7IA 1T7PB 5ECOB 3F4RA 4IS0A 3VWVA 3WYWA 2VL2A 3GL5A 3GSTA 1YEXA 1SJIA 3KH7A 2L5OA 1ZMAA 4IJ3A 4ZBBA 1FO5A 4GRFA 3DVWA 2OE3A 1ERWA 2VL3A 5IMVA 3D5JA 3TKQA 2B3SA 2FY6A 4MJCA 4Z2TA 5ELAA 2YCDA 1TKDB 3HJOA 4GSTA 3H93A 4MMMA 2B1KA 5L71A 1YZXA 3GNJA 3TKPA 2B7JA 4IJIA 2KLXA 4XRAA 3ZITA 1OC9B 2ZUPA 1HYUA 3IDVA 4HQZA 4V1Ag 2GQLA 3FZAA 4KA0A 2CX3A 2GZYA 2CV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BG5 A;  3MWH A;  3UAP A;  5A4U A;  4POL A;  3GUS A;  3N5O A;  4MPG A;  3APQ A;  1PMT A;  3ZMK A;  4N30 A;  4G10 A;  1OE8 A;  2PGT A;  3HCZ A;  5COH A;  2NDO A;  1M9A A;  2IJY A;  1WMJ A;  1MDK A;  5GAP D;  3A5W A;  1OKT A;  3WT2 A;  4V2N A;  5B7C A;  2X8C A;  3A2V A;  3RHC A;  2B5E A;  3KMN A;  2IFQ B;  2C1Y A;  4Q5F A;  3G7Y A;  1X9W B;  2H1A A;  4JU5 A;  1K3O A;  5IPG A;  2B6M A;  4MCU A;  2FWF A;  3UVH A;  2I9H A;  2MMO A;  3TKS E;  2GSR A;  4ZL8 A;  4AF2 A;  4DSQ A;  3PR8 A;  5CP1 A;  1I5G A;  5AIX A;  3TJF A;  3IA1 A;  5ECP B;  2J23 A;  1EEM A;  2PN8 A;  2AHE A;  5B6N A;  4EL1 A;  2RM5 A;  4TXO B;  1FG4 A;  3E9J B;  3GKK A;  1TK8 B;  4PUA A;  6GSY A;  5ID2 B;  2VCW A;  4IN0 A;  2H6Z A;  4PUR A;  4F0B A;  5DAK B;  2R5G A;  4AJ6 A;  3GV1 A;  1GTI A;  2X99 A;  3H4K A;  1R5A A;  1Z3E A;  2C0F A;  1TK0 B;  2H66 A;  2LV3 A;  3D21 A;  1M0U A;  1Z9H A;  1F3A A;  5F0G A;  5DAL A;  2YWI A;  4BL7 A;  4E8H A;  2WCI A;  4POM A;  4LL1 B;  2L6D A;  3J7Y b;  5F8B A;  2R6K A;  2VCV A;  2OAD A;  2V1M A;  5ABR A;  1J0F A;  3F9U A;  1XXU A;  2C3N A;  2CZ2 A;  1NW2 A;  4K7N A;  3VWW A;  2H1G A;  4GSS A;  5LNK e;  1EP8 A;  2X8H A;  1T00 A;  4ZBA A;  4WR4 A;  9GSS A;  2DIY A;  2B1L A;  1TU7 A;  4MZW A;  4F2I A;  4QL7 A;  2R37 A;  2HXK A;  3FKF A;  1GL8 A;  2QGV A;  3UIW A;  1MD4 A;  2GGT A;  1EV4 A;  2R4V A;  3HDC A;  1AIU A;  2C3T A;  4TOP A;  1TDI A;  4KX4 A;  1H4O A;  1W89 A;  3IV4 A;  2KHP A;  3Q6O A;  1PD2 1;  5IMD A;  5DBQ A;  2DBC A;  4Q5R A;  1TTZ A;  3BCI A;  4O7H A;  1KBN A;  2NTO A;  3VWU A;  4BWQ A;  5FHI A;  5DJL A;  4DSS B;  1R7H A;  3US3 A;  3FZ9 A;  1O6J A;  2A2S A;  1AXD A;  4FYU A;  2IMI A;  3F6F A;  5J9C A;  1XWG A;  2CX4 A;  4TVE A;  1T3B A;  2H6X A;  1X5D A;  4ZXG A;  4NWY A;  1A8Y A;  1XVQ A;  1ZOF A;  1GTB A;  4O32 A;  1YY7 A;  4FYC A;  2JZS A;  3VLN A;  2VL2 C;  4HZ4 A;  1VF4 A;  2GVP A;  3ERG A;  5GST A;  3GRX A;  4I6X A;  2GST A;  4IP6 A;  4KH7 A;  2YNX A;  4CW9 A;  4F82 A;  4NV5 A;  1BYE A;  2P5Q A;  1GLQ A;  1KEB A;  4MP4 A;  4MF5 A;  1OC9 A;  5G2Z A;  4GQC A;  4NHW A;  3DVX A;  1GUL A;  4L5O A;  4KSM A;  1YF1 A;  4L0W A;  4ECJ A;  2KOK A;  3M0F A;  1NHO A;  1SEN A;  3TDG A;  1A2L A;  1JZR A;  4MPF A;  1TRS A;  3D0Z A;  2WUL A;  3GH9 A;  1T1V A;  5CRD A;  2DJ3 A;  2GZP A;  3W8J A;  4TXV A;  1GRX A;  4RQR A;  5ECM B;  1RQM A;  2E2G A;  2OJL A;  1B8X A;  3BCK A;  6GSS A;  2LTK A;  4WET A;  3IR4 A;  3EVI A;  4ID0 A;  5KN3 A;  1Z7R A;  1YF0 A;  3IK9 A;  10GS A;  1JZO A;  2H75 A;  2F9S A;  3TJG A;  4YAP A;  3ZML A;  1K0O A;  2OAC A;  4H86 A;  3DYR A;  1Z6N A;  4GQF A;  1WOU A;  4IGJ A;  5KN1 A;  1RK4 A;  3FR9 A;  2IIY A;  1XCC A;  4V1A p;  5ENU A;  5DVB A;  2GT5 A;  2FCH A;  4YQV A;  2IL3 A;  1K3Y A;  3A3T A;  5DCG A;  2JZR A;  2LUS A;  3IHQ A;  4GXZ A;  3OR5 A;  3RDW A;  4MJE A;  5FWG A;  3KMO A;  2B5X A;  5DAK A;  4KE3 A;  1K3L A;  5B6M A;  2WJU A;  6GSW A;  1Y6E A;  3ISO A;  4PXO A;  4WXT A;  2AUV A;  3HJM A;  3FK8 A;  1EP7 A;  1XOB A;  2MBT A;  1HNC A;  3L9V A;  2CVB A;  1AW9 A;  4KGI A;  1NM3 A;  2DJ2 A;  5G30 A;  2AV4 A;  4OCF A;  4F0C A;  5IIZ A;  2I1U A;  2IN3 A;  6GSV A;  2PUK C;  3L9U A;  1XWB A;  1PA3 A;  14GS A;  1EOH A;  3F6D A;  2XBQ A;  3E3E A;  1SKW B;  3SWL A;  3TKS A;  2H70 A;  3KP9 A;  1DBY A;  2HRN A;  5D8I A;  1GSS A;  1WRY A;  2EIQ A;  1N8J A;  5FT3 A;  1T8E B;  3DRN A;  3HJP A;  1G6W A;  4Q5Q A;  1FW1 A;  1JZD A;  1YJ6 A;  1QK8 A;  13GS A;  3WGE A;  4HUA A;  5HFG A;  3UJ1 A;  1GSD A;  3WGX A;  4G2E A;  2VM2 A;  1BX9 A;  3HXS A;  1YKC A;  3KJY A;  2K6V A;  1V40 A;  3UEM A;  1E2Y A;  1BED A;  4DVC A;  4IP1 A;  1ZYQ B;  3LEF A;  2H72 A;  1FVK A;  1YEP A;  5CYY A;  5ECH B;  3KP8 A;  4MF7 A;  4F9Z A;  2HE3 A;  5J3R A;  3FRC A;  1FAA A;  3N9J A;  2YN1 A;  3IK7 A;  2F8A A;  3H1N A;  5IO0 A;  4IQ1 A;  18GS A;  3DD3 A;  1MDJ A;  4JR4 A;  2FWG A;  2LRC A;  1MDI A;  1ML6 A;  5IQY A;  2HT9 A;  2IMK A;  1ON4 A;  2ALB A;  1QXH A;  3C73 A;  4ULX A;  1GLP A;  1HNB A;  2JSZ A;  2G2Q A;  5ELG A;  2P0G A;  2CT6 A;  4AJ8 A;  1O73 A;  1X9S B;  4V2L A;  3QAW A;  3CMI A;  1PL2 A;  4EXJ A;  4JZQ A;  2NBS A;  1PKZ A;  6GSX A;  1ILO A;  2VCQ A;  1GH2 A;  4TR1 A;  3R2Q A;  5D93 A;  2C8U A;  4EF0 A;  3LOR A;  3F0I A;  2PBJ A;  3TJJ A;  5HR3 A;  3CSJ A;  1EZK A;  2FWE A;  4I2T A;  2MBS A;  1Q4J A;  2WZ9 A;  4J57 E;  1QFN A;  5C04 A;  3TB2 A;  2H19 A;  1TW9 A;  5DCH A;  5IM9 A;  4FYB A;  2VD0 A;  4XRD A;  2WB9 A;  1WPI A;  3KD0 A;  1O81 A;  4MAB A;  2DC5 A;  4KB3 A;  3ZZX A;  1TI1 A;  3C1R A;  5AIS A;  5IPH A;  1UA5 A;  2VCT A;  3EIN A;  1A0R P;  4DEJ A;  4NAX A;  2LJK A;  3QAV A;  4PNG A;  2O87 A;  1XPV A;  3F4T A;  2C0E A;  2VO4 A;  5J4U A;  3ME7 A;  1SD9 A;  2G0F A;  1WP0 A;  2M46 A;  2GSS A;  3TOU A;  5AGY A;  1VF1 A;  4KDX A;  3EWL A;  5A4V A;  2O85 A;  3KM6 A;  2VM1 A;  3ZTL A;  5C00 A;  1OC3 A;  2FHE A;  1SD8 A;  2LS5 A;  1UN2 A;  4HJ2 A;  1ZL9 A;  3TJB A;  1IYH A;  5ECL B;  4LMW A;  4L5L A;  1TK5 B;  5JWO B;  2AB6 A;  3UVT A;  1V98 A;  2TIR A;  1MTC A;  3TRQ A;  2YP6 A;  1CQG A;  4HI7 A;  4EO3 A;  5D9T A;  4OFT A;  1SL0 B;  5ECN B;  5D9V A;  4TR0 A;  2AYT A;  1WJK A;  2RM6 A;  1FOV A;  1K0N A;  1BJX A;  1EGR A;  2P31 A;  1AQV A;  5IO2 A;  3DWV A;  1TJD A;  5DQS A;  2O7K A;  1USB A;  5CRW A;  2K8S A;  5F07 A;  1ST9 A;  1N2A A;  3ZLP A;  3EC3 A;  3KZQ A;  1GTA A;  4BWS A;  3GYK A;  3BD2 A;  3P8W A;  2LEG A;  4MJB A;  2EC4 A;  3CSH A;  2YOI A;  3VI7 A;  1K0D A;  2H01 A;  3QCP A;  4NXI A;  3CSI A;  1K0C A;  3ZL5 A;  3U5R E;  3P7X A;  4POK A;  3TKS C;  3FHK A;  3LYP A;  3EMX A;  1F3B A;  3MDK A;  3QD9 A;  4G9H A;  5H5Q A;  3DGQ A;  5JWQ B;  5IMZ A;  5ECS A;  1PX6 A;  1V57 A;  1GSE A;  2PMT A;  2J9H A;  1PKW A;  4XS4 B;  4BVX A;  3GX0 A;  4YQM A;  3MSZ A;  2FNO A;  1U3A A;  3VWX A;  2H0I A;  2LQQ A;  4CHS A;  2LRN A;  4PQH A;  4WF5 A;  4WR5 A;  3LJR A;  3RPN A;  2HFD A;  4XS1 A;  2AAW A;  5HFK A;  19GS A;  4ISD A;  4KAE A;  1DUG A;  2PVO C;  5KN2 A;  3IRA A;  2F51 A;  3ZVJ D;  4N0Z A;  3GTU A;  2VLT A;  2H73 A;  4N10 A;  1O8W A;  2V6K A;  2FA8 A;  3KH9 A;  2N5F A;  1XW9 A;  3DEX A;  5G5F A;  2DIZ A;  4X1U A;  2HYX A;  1Z6M A;  4EDY A;  2GSQ A;  2M80 A;  1OVN A;  1KNG A;  2K9F A;  4X0X A;  3CTG A;  4HU7 A;  4HEA 2;  3GKX A;  1YQ1 A;  5JCW A;  3LQ7 A;  1OYJ A;  2QSI A;  1J08 A;  4QQ7 A;  4KCE A;  4XIH A;  1R4W A;  3GMF A;  1B48 A;  3ZIJ A;  3PH9 A;  2R3X A;  3GH6 A;  2HZF A;  3IXR A;  1PN9 A;  1FHE A;  5ECI B;  2CQ9 A;  3ZRD A;  2IMD A;  3UL3 A;  5KEJ A;  5D73 A;  5CO3 A;  2H6Y A;  1M7T A;  1WE0 A;  3QFB C;  2DMM A;  3W6G A;  16GS A;  4TN8 A;  2VCX A;  1GUM A;  1TRW A;  2IMF A;  1TI3 A;  5EVO A;  2IWT A;  5D9X A;  2YJH A;  2MMA A;  3W8S A;  2D2Z A;  4OFM A;  2IPA A;  1SL2 B;  1SKS B;  3O6T A;  2C4J A;  5HR1 A;  3I43 A;  1ZCP A;  3KCM A;  4TR1 B;  2TRX A;  2M72 A;  4JRR A;  2LNT A;  3TCO A;  3UOM A;  1EV9 A;  2JAD A;  4ZBD A;  1M99 A;  5ECQ B;  1LU4 A;  4CDO A;  1R5P A;  3VPQ A;  5B8B A;  4X43 A;  1B4Q A;  1G0T A;  1HNA A;  2HZE B;  5GZZ B;  1YDK A;  4ECB A;  1GSF A;  3RAZ A;  3HVV A;  1CQH A;  4KDU A;  3BBY A;  2K8V A;  2DLX A;  4K6X A;  4LL4 B;  4TKY A;  2CVD A;  2OA7 A;  4N0V A;  1THX A;  4MJA A;  4ML1 A;  1F37 A;  1GP1 A;  2DJ1 A;  2FLS A;  3D6I A;  3GSS A;  3Q18 A;  3FY7 A;  17GS A;  2GQM A;  4RUV A;  2H8L A;  2GDR A;  1ABA A;  4RQX A;  2PVQ A;  2FWH A;  3LG6 A;  4J2F A;  2FD3 A;  2P5R A;  4XTS A;  1U87 A;  4WKW A;  4P3Y B;  4HS1 A;  2BJX A;  2GTU A;  3S9F A;  3LSZ A;  3NOF A;  2VLU A;  1VF3 A;  1JFU A;  5AN1 A;  2K18 A;  3BOA A;  4K0G A;  5G1L A;  2VCZ A;  3HA9 A;  1BQ7 A;  1A23 A;  4EE0 A;  3D4M A;  3CTF A;  4QL9 A;  1B9X C;  5IOX A;  4DSR A;  3HD5 A;  3O76 A;  5D96 A;  4J56 E;  2MZC A;  2HSY A;  4MDC A;  3D4T A;  4OWY A;  3U6V A;  4GCI A;  3MAK A;  2V2G A;  4XS4 A;  2E7P A;  2KP1 A;  3QMX A;  1B4P A;  1UVZ A;  2LJA A;  2YWN A;  2A4V A;  3P2A A;  4ZB8 A;  4BPY A;  4BVY A;  4EUY A;  2LQO A;  3LFL A;  3VI5 A;  4ECI A;  3L0H A;  1A2M A;  5LD0 A;  5JCU A;  3APO A;  2E0Q A;  3EMP A;  3ED3 A;  3HKR A;  3O3T A;  5KN0 A;  1FB6 A;  2ON7 A;  4MH2 A;  2WFC A;  1DSB A;  5F06 A;  1X5E A;  3TOT A;  1A2J A;  1S3C A;  2I3Y A;  1GSY A;  22GS A;  4POB A;  4F03 A;  4O5R A;  1HQO A;  1VF2 A;  2L4C A;  3H79 A;  3GKM A;  3IPZ A;  1AAZ A;  3MNG A;  4RI7 A;  3EE2 A;  2HSH A;  2H0H A;  4MF6 A;  1GUH A;  4IEL A;  2QKE A;  5E59 A;  2OE0 A;  1ERT A;  1TOF A;  1GWC A;  2NPB A;  4ZL9 A;  4D73 A;  1SJZ A;  3DKS A;  3BJ5 A;  1EOG A;  2DJJ A;  5EL8 A;  3CXG A;  1A8L A;  3HZ4 A;  3LXZ A;  1F2E A;  3GTU B;  4IVF A;  2CA8 A;  4MH3 A;  1T4Z A;  5JWR B;  4XS6 A;  1X5C A;  2LRT A;  5J41 A;  5A5K A;  3VK9 A;  1I9D A;  3C8E A;  1SJ6 A;  3J7Y k;  8GSS A;  2E2M A;  4G19 A;  3G7J A;  5A4W A;  2C0D A;  1X0R A;  4ACS A;  2L5L A;  4K9Z A;  3VFI A;  2VLV A;  4JED A;  1IYI A;  1A0F A;  3M9J A;  2CVK A;  3I69 A;  3M1G A;  2HRF A;  1S3A A;  3D22 A;  4WBR D;  5AIV A;  3IAM 2;  4EDZ A;  1NHY A;  4KW6 A;  1JZW A;  4ILF A;  2WRT A;  1H75 A;  1V2A A;  2B5Y A;  3A2W A;  4RI6 A;  5F05 A;  3GN3 A;  3TRX A;  5IMC A;  3PIN A;  3Q19 A;  3TJK A;  3QFA C;  2PWJ A;  5INY A;  1EWX A;  2GLR A;  3FZ5 A;  4GF0 A;  5ECK B;  2HZE A;  1A24 A;  1OAZ A;  3RHB A;  2XBI A;  1ACV A;  3APS A;  3M8N A;  2NVL A;  4MK3 A;  3TRP A;  3NZN A;  1E6B A;  1C72 A;  5G31 A;  1LBK A;  1M2B A;  4HU9 A;  2JU5 A;  3FZ4 A;  3IBH A;  2C3Q A;  3QDN A;  4LLR A;  4Z7X A;  1JLV A;  2RLI A;  3RBT A;  3C71 A;  5JCG A;  1NSW A;  1Y25 A;  2FGX A;  3E0U A;  1F6M C;  2YJ7 A;  2VUP A;  4K8M A;  2EIO A;  2WGR A;  3CRT A;  2AJQ B;  2DML A;  3F8U A;  4JE1 A;  2H0G A;  1TRU A;  1HD2 A;  1JLW A;  4MZC A;  3CBU A;  1XW6 A;  3FR3 A;  3ZIV A;  4IBP A;  3CRU A;  5CNW A;  4K0N A;  5B8A A;  5CRH A;  2C80 A;  2L4Q A;  2L59 A;  5DJM A;  3A2X A;  5H5R A;  3RPP A;  4WBJ A;  1U3I A;  5J5N A;  3I6A A;  1XOA A;  2ES7 A;  2YZU A;  1SK0 A;  5HQP A;  3G7I A;  1K0M A;  1G6Y A;  3FYG A;  4KUN A;  4K2D A;  4V2M A;  4I2U A;  1WIK A;  3F63 A;  2DJK A;  1QQ2 A;  1O7U A;  5DQY A;  3TUE A;  3M9K A;  4ZB6 A;  1B9Y C;  4YQU A;  3Q74 A;  5HR0 A;  1WWJ A;  2JZT A;  1BAY A;  2YV7 A;  2O89 A;  2H76 A;  4EC0 A;  2X64 A;  5IOW A;  1XVW A;  1U88 A;  1QUW A;  3GX8 A;  5IMF A;  4BA7 A;  3EYT A;  3HHV A;  4AGS A;  2MMN A;  4PX1 A;  2OBI A;  3ZRE A;  1G7E A;  1MD3 A;  1QGV A;  1TU8 A;  1T4Y A;  4LA1 A;  2MMZ A;  1O8X A;  4HZ2 A;  4GSN A;  1UC7 A;  4KSO A;  5H5S A;  4TR3 A;  2I81 A;  3ZFL A;  3CYN A;  3TKR A;  3GFK A;  3KXO A;  4N11 A;  4Q5N A;  1SKR B;  4E8E A;  2F3M A;  5CAX A;  2H71 A;  1GSU A;  3C1S A;  1SU9 A;  3FW2 A;  4IQA A;  3EUR A;  3F3Q A;  3P90 A;  4WF4 A;  1XWA A;  2RII A;  3QAG A;  2O8V B;  3HVS A;  4ML6 A;  2PU9 C;  1O85 A;  2WDU A;  2GT6 A;  4PQI A;  1M9B A;  3ERF A;  2PPT A;  3HZ8 A;  2I4A A;  4WEY A;  2B7K A;  3F3R A;  3HY2 A;  3L78 A;  3KEB A;  1JHB A;  3KTL A;  1LJR A;  4XHM A;  3UBK A;  5G5E A;  1VRS D;  1XIY A;  3M3M A;  3NIV A;  4KCA A;  4D73 B;  2H1B A;  4I97 A;  5EY6 A;  1RW1 A;  4IW9 A;  3C7M A;  3GKN A;  1AC1 A;  2LJR A;  4ZB9 A;  4PUF C;  2GS3 A;  2VAF A;  1ZZY A;  2N5A A;  2ON5 A;  5DDL A;  3GUR A;  1AQX A;  1Q98 A;  3GIX A;  2REM A;  3EU3 A;  4EKZ A;  1Z5Y E;  6GSU A;  3GHA A;  4I5Q A;  2JSY A;  4PNF A;  1G7O A;  2YV9 A;  3QPM A;  3AY8 A;  2KP2 A;  3HYP A;  4OCE A;  3IOS A;  2HI7 A;  3QR6 A;  2BMX A;  1Z7P A;  7GSS A;  2QC7 A;  4OFN A;  2C0G A;  2XC2 A;  3GA4 A;  3UAR A;  1M2A A;  1QMV A;  3IAS 2;  4KND A;  4ZL7 A;  3H8Q A;  3PGT A;  2LNS A;  5CRE A;  1V9W A;  3TGZ A;  2YWO A;  3EU4 A;  3LXT A;  1K0B A;  4GTU A;  4YH2 A;  4NPB A;  3VUR A;  4MLY A;  2A2R A;  2HLS A;  4L0U A;  4O92 A;  2ZNM A;  4ZIL A;  1ZGN A;  1SK2 A;  3L9S A;  3LYK A;  4PQ1 A;  2OE1 A;  1GNE A;  2MYG A;  2RUE A;  3FR6 A;  1SYX A;  3GL3 A;  2V41 A;  4IKH A;  2V32 A;  4JR6 A;  2IFQ A;  2FA4 A;  3DXB A;  3SBC A;  4NHZ A;  1U6T A;  1PQN A;  3KTB A;  1DE2 A;  4I8B A;  3ERW A;  2IME A;  1GNW A;  1V58 A;  3WGD A;  1AQW A;  2TRC P;  1YKA A;  1GTU A;  3LGC A;  4L8E A;  1PGT A;  2LST A;  2VOC A;  1XWC A;  4HOJ A;  4NV2 A;  2WS2 A;  3WT1 A;  2GZZ A;  3KGK A;  1FB0 A;  1OE7 A;  1PL1 A;  1GSQ A;  4K7O A;  2XPD A;  1XZO A;  1S3D A;  1PRX A;  1TXX A;  1J9B A;  4TXO A;  4ECC A;  2L57 A;  5EPF A;  4ZIJ A;  2XPE A;  5J9B A;  5D9W A;  5ID2 A;  4YAV A;  2ZCT A;  1URM A;  1EGO A;  1TP9 A;  3I9V 2;  1SK1 A;  3VPT A;  2XHF A;  3G9B A;  4OD7 A;  12GS A;  4FO5 A;  5IMA A;  4MA9 A;  5G1K A;  1ERV A;  3IE3 A;  2KUC A;  5CRG A;  4OO4 A;  1K0A A;  1VGL A;  2DJ0 A;  2EIR A;  3LWA A;  5ECR B;  3L4N A;  4K1F A;  4KDY A;  3DIE A;  11GS A;  4LMV A;  2VD1 A;  4EVM A;  4NMU A;  4TR4 A;  6GST A;  2F8F A;  2DSA A;  4MZB A;  5E4W A;  2CAI A;  3UMA A;  4HQS A;  1TRV A;  2H74 A;  2JL4 A;  5LCZ A;  2PER A;  1ZYE A;  1XW5 A;  2CAQ A;  1SYR A;  3K8N A;  4TW5 A;  4GWR A;  3V1W A;  2OKA A;  1R26 A;  3ZYW A;  1X9M B;  2VL9 A;  2R2J A;  4TRX A;  4IHU A;  3HVX A;  2BTO T;  1PX7 A;  5DAL B;  3ZVJ A;  1SL1 B;  1W4V A;  3FEU A;  5GSS A;  4HJM A;  3KIJ A;  3F4S A;  4FH8 A;  2CZ3 A;  2YZH A;  1THO A;  1XBS A;  20GS A;  2GQK A;  2YWM A;  2Z9S A;  2RUF A;  3UBL A;  4XCS A;  2YPM A;  2H1D A;  2L6C A;  4DSS A;  1M2D A;  3ME8 A;  5HR2 A;  4OO5 A;  2JAC A;  1OC8 A;  3IC4 A;  4GLT A;  2VIM A;  2LKU A;  3WD6 A;  2YAN A;  1KTE A;  5GAN D;  1XFL A;  2H30 A;  2HNL A;  3DML A;  4OMV A;  4JBB A;  1MEK A;  1OKD A;  3QOU A;  1AUC A;  5HFI A;  4PGT A;  1ERU A;  1EEJ A;  2FUG 2;  2V6O A;  2X8G A;  1XWK A;  1DE1 A;  1FVJ A;  2N5B A;  4AJ7 A;  1PSQ A;  1F9M A;  3ZFB A;  1GUK A;  2OBK A;  4FIW A;  4HDE A;  3JCM L;  4K7I A;  1T7P B;  5ECO B;  3F4R A;  4IS0 A;  3VWV A;  3WYW A;  2VL2 A;  3GL5 A;  3GST A;  1YEX A;  1SJI A;  3KH7 A;  2L5O A;  1ZMA A;  4IJ3 A;  4ZBB A;  1FO5 A;  4GRF A;  3DVW A;  2OE3 A;  1ERW A;  2VL3 A;  5IMV A;  3D5J A;  3TKQ A;  2B3S A;  2FY6 A;  4MJC A;  5ELA A;  2YCD A;  1TKD B;  3HJO A;  4GST A;  3H93 A;  4MMM A;  2B1K A;  5L71 A;  1YZX A;  3GNJ A;  3TKP A;  2B7J A;  4IJI A;  2KLX A;  4XRA A;  3ZIT A;  1OC9 B;  2ZUP A;  1HYU A;  3IDV A;  4HQZ A;  4V1A g;  2GQL A;  3FZA A;  4KA0 A;  2CX3 A;  2GZY A;  2CV4 A; 
#chains in the Genus database with same CATH topology
 1BG5 A;  3MWH A;  3UAP A;  5A4U A;  4POL A;  3GUS A;  3N5O A;  4MPG A;  3APQ A;  1PMT A;  3ZMK A;  4N30 A;  4G10 A;  1OE8 A;  2PGT A;  3HCZ A;  5COH A;  2NDO A;  1M9A A;  2IJY A;  1WMJ A;  1MDK A;  5GAP D;  3A5W A;  1OKT A;  3WT2 A;  4V2N A;  3MIX A;  5B7C A;  2X8C A;  3A2V A;  3RHC A;  2B5E A;  3KMN A;  2IFQ B;  2C1Y A;  4Q5F A;  3G7Y A;  4YKG A;  1X9W B;  2H1A A;  4JU5 A;  1K3O A;  5IPG A;  2B6M A;  4MCU A;  2FWF A;  3UVH A;  2I9H A;  2MMO A;  3TKS E;  2GSR A;  4ZL8 A;  4AF2 A;  4DSQ A;  3PR8 A;  1S3R A;  5CP1 A;  1I5G A;  5AIX A;  3TJF A;  3IA1 A;  5ECP B;  2J23 A;  1ZYP A;  1EEM A;  2PN8 A;  2AHE A;  5B6N A;  4EL1 A;  2RM5 A;  4TXO B;  1FG4 A;  3E9J B;  3GKK A;  1TK8 B;  4PUA A;  4EIP A;  6GSY A;  2VCW A;  5ID2 B;  4IN0 A;  2H6Z A;  4PUR A;  4F0B A;  2R5G A;  5DAK B;  4AJ6 A;  3GV1 A;  1GTI A;  2X99 A;  3H4K A;  1R5A A;  1Z3E A;  2C0F A;  1TK0 B;  2H66 A;  2LV3 A;  2X4A A;  3D21 A;  1M0U A;  1Z9H A;  1F3A A;  5F0G A;  5DAL A;  2YWI A;  4BL7 A;  4E8H A;  2WCI A;  4POM A;  4LL1 B;  2L6D A;  3J7Y b;  5F8B A;  2R6K A;  2VCV A;  2OAD A;  2V1M A;  5ABR A;  2DKH A;  1J0F A;  3F9U A;  1XXU A;  2C3N A;  2CZ2 A;  1NW2 A;  4K7N A;  3VWW A;  2H1G A;  4GSS A;  5LNK e;  1EP8 A;  2X8H A;  1T00 A;  4ZBA A;  4WR4 A;  9GSS A;  2DIY A;  2B1L A;  1TU7 A;  4MZW A;  4F2I A;  4QL7 A;  2R37 A;  2HXK A;  3FKF A;  1GL8 A;  2QGV A;  3UIW A;  1MD4 A;  2GGT A;  1EV4 A;  2R4V A;  3HDC A;  1AIU A;  2C3T A;  4TOP A;  1TDI A;  4KX4 A;  1H4O A;  1W89 A;  3IV4 A;  2KHP A;  3Q6O A;  1PD2 1;  5IMD A;  5DBQ A;  2DBC A;  4Q5R A;  1TTZ A;  3BCI A;  4O7H A;  1KBN A;  2NTO A;  3VWU A;  4BWQ A;  5FHI A;  5DJL A;  4DSS B;  1R7H A;  3US3 A;  3FZ9 A;  1O6J A;  2A2S A;  1AXD A;  4FYU A;  2IMI A;  3F6F A;  5J9C A;  1XWG A;  2CX4 A;  4TVE A;  1T3B A;  2H6X A;  1X5D A;  4ZXG A;  4NWY A;  4X4J A;  1A8Y A;  1XVQ A;  1ZOF A;  1GTB A;  4O32 A;  1YY7 A;  4FYC A;  2JZS A;  3VLN A;  2VL2 C;  4HZ4 A;  1VF4 A;  2GVP A;  3ERG A;  4G0L A;  5GST A;  3GRX A;  4I6X A;  2GST A;  4IP6 A;  4KH7 A;  2YNX A;  4CW9 A;  4F82 A;  4NV5 A;  1BYE A;  2P5Q A;  1GLQ A;  1KEB A;  4MP4 A;  4MF5 A;  1OC9 A;  5G2Z A;  4GQC A;  4NHW A;  3DVX A;  1GUL A;  4L5O A;  4KSM A;  1M3J A;  1YF1 A;  4L0W A;  4ECJ A;  2KOK A;  3M0F A;  1NHO A;  1SEN A;  3TDG A;  1A2L A;  1JZR A;  4MPF A;  1TRS A;  3D0Z A;  2WUL A;  3GH9 A;  1T1V A;  5CRD A;  2DJ3 A;  2QA2 A;  2GZP A;  3W8J A;  4TXV A;  2QA1 A;  1GRX A;  4RQR A;  5ECM B;  1RQM A;  2E2G A;  2OJL A;  1B8X A;  3BCK A;  6GSS A;  2LTK A;  4WET A;  3IR4 A;  3EVI A;  4ID0 A;  5KN3 A;  1Z7R A;  1YF0 A;  3IK9 A;  10GS A;  1JZO A;  2H75 A;  2F9S A;  3TJG A;  4YAP A;  3ZML A;  1K0O A;  2OAC A;  4H86 A;  3DYR A;  1Z6N A;  4GQF A;  1WOU A;  4IGJ A;  5KN1 A;  1RK4 A;  3FR9 A;  2IIY A;  1XCC A;  4V1A p;  5ENU A;  5DVB A;  2GT5 A;  2FCH A;  4YQV A;  2IL3 A;  1K3Y A;  3A3T A;  5DCG A;  2JZR A;  2LUS A;  3IHQ A;  4A5P A;  4GXZ A;  3OR5 A;  3RDW A;  4MJE A;  5FWG A;  3KMO A;  2B5X A;  5DAK A;  4KE3 A;  1K3L A;  5B6M A;  2WJU A;  6GSW A;  1Y6E A;  3ISO A;  4PXO A;  4WXT A;  2AUV A;  3HJM A;  3FK8 A;  1EP7 A;  1XOB A;  2MBT A;  1HNC A;  3L9V A;  2CVB A;  1AW9 A;  4KGI A;  1NM3 A;  2DJ2 A;  5G30 A;  2AV4 A;  4OCF A;  4F0C A;  5IIZ A;  2I1U A;  4YKF A;  2IN3 A;  2A2P A;  4O5U A;  6GSV A;  2PUK C;  3L9U A;  1XWB A;  1PA3 A;  14GS A;  1EOH A;  3F6D A;  2XBQ A;  3E3E A;  1SKW B;  3SWL A;  3TKS A;  2H70 A;  3KP9 A;  1DBY A;  2HRN A;  5D8I A;  1GSS A;  1WRY A;  2EIQ A;  1N8J A;  5FT3 A;  1T8E B;  3DRN A;  3HJP A;  1G6W A;  4Q5Q A;  1FW1 A;  1JZD A;  1YJ6 A;  1QK8 A;  13GS A;  3WGE A;  4HUA A;  5HFG A;  3UJ1 A;  4BL7 B;  1GSD A;  3WGX A;  4G2E A;  2VM2 A;  1BX9 A;  4K5S A;  3HXS A;  1YKC A;  4EIQ A;  3KJY A;  2K6V A;  1V40 A;  3UEM A;  1E2Y A;  1BED A;  4DVC A;  4USS A;  4IP1 A;  1ZYQ B;  3LEF A;  2H72 A;  1FVK A;  1YEP A;  5CYY A;  5ECH B;  3KP8 A;  4MF7 A;  4F9Z A;  2HE3 A;  5J3R A;  3FRC A;  1FAA A;  3N9J A;  2YN1 A;  3IK7 A;  2F8A A;  3H1N A;  5IO0 A;  4IQ1 A;  18GS A;  3DD3 A;  1MDJ A;  4JR4 A;  2FWG A;  2LRC A;  1MDI A;  1ML6 A;  5IQY A;  2HT9 A;  2IMK A;  1ZYN A;  1ON4 A;  2ALB A;  1QXH A;  3C73 A;  4ULX A;  1GLP A;  1HNB A;  2JSZ A;  2G2Q A;  5ELG A;  2P0G A;  2CT6 A;  4AJ8 A;  1O73 A;  1X9S B;  4V2L A;  3QAW A;  3CMI A;  1PL2 A;  4EXJ A;  4JZQ A;  2NBS A;  1PKZ A;  6GSX A;  1ILO A;  2VCQ A;  1GH2 A;  4TR1 A;  3R2Q A;  5D93 A;  2C8U A;  4EF0 A;  3LOR A;  3F0I A;  2PBJ A;  3TJJ A;  5HR3 A;  3CSJ A;  1EZK A;  2FWE A;  4I2T A;  2MBS A;  1Q4J A;  2WZ9 A;  4J57 E;  1QFN A;  5C04 A;  3TB2 A;  2H19 A;  1TW9 A;  5DCH A;  5IM9 A;  4FYB A;  2VD0 A;  4XRD A;  2WB9 A;  3HVN A;  1WPI A;  3KD0 A;  1O81 A;  4MAB A;  2DC5 A;  4KB3 A;  3ZZX A;  1TI1 A;  3C1R A;  5AIS A;  5IPH A;  1UA5 A;  2VCT A;  3EIN A;  1A0R P;  4DEJ A;  4NAX A;  2LJK A;  3QAV A;  4PNG A;  2O87 A;  1XPV A;  3F4T A;  2C0E A;  2VO4 A;  5J4U A;  3ME7 A;  1SD9 A;  2G0F A;  1WP0 A;  2M46 A;  2GSS A;  3TOU A;  5AGY A;  3R3E A;  1VF1 A;  4KDX A;  3EWL A;  5A4V A;  2O85 A;  3KM6 A;  2VM1 A;  3ZTL A;  5C00 A;  1OC3 A;  2FHE A;  1SD8 A;  2LS5 A;  1UN2 A;  4HJ2 A;  1ZL9 A;  3TJB A;  1IYH A;  5ECL B;  4LMW A;  4L5L A;  1TK5 B;  5JWO B;  2AB6 A;  3UVT A;  1V98 A;  5KOW A;  2TIR A;  1MTC A;  2UZ8 A;  3TRQ A;  2YP6 A;  1CQG A;  4HI7 A;  4EO3 A;  5D9T A;  4OFT A;  1SL0 B;  4G0K A;  5ECN B;  5D9V A;  4TR0 A;  2AYT A;  2A4H A;  1WJK A;  2RM6 A;  1FOV A;  1K0N A;  1BJX A;  1EGR A;  2P31 A;  1AQV A;  5IO2 A;  3DWV A;  1TJD A;  5CRW A;  2O7K A;  1USB A;  5DQS A;  2K8S A;  5F07 A;  1ST9 A;  1N2A A;  3ZLP A;  1M3I A;  3EC3 A;  3KZQ A;  1GTA A;  4BWS A;  3GYK A;  3BD2 A;  3P8W A;  2LEG A;  4MJB A;  2EC4 A;  3CSH A;  2YOI A;  3VI7 A;  1K0D A;  2H01 A;  3QCP A;  4NXI A;  3CSI A;  1K0C A;  3ZL5 A;  3U5R E;  3P7X A;  4POK A;  3TKS C;  3FHK A;  3LYP A;  3EMX A;  1F3B A;  3MDK A;  3QD9 A;  4G9H A;  5H5Q A;  3DGQ A;  5JWQ B;  5IMZ A;  5ECS A;  1PX6 A;  1V57 A;  1GSE A;  2PMT A;  2J9H A;  2DKI A;  1PKW A;  4XS4 B;  4BVX A;  3GX0 A;  4YQM A;  3MSZ A;  2FNO A;  1U3A A;  2R0C A;  3VWX A;  4FQU A;  4K2X A;  2H0I A;  2LQQ A;  4CHS A;  2LRN A;  4PQH A;  4WF5 A;  4WR5 A;  3LJR A;  3RPN A;  2HFD A;  4XS1 A;  2AAW A;  5HFK A;  19GS A;  4ISD A;  4KAE A;  1DUG A;  2PVO C;  5KN2 A;  3IRA A;  2F51 A;  3ZVJ D;  4N0Z A;  3GTU A;  2VLT A;  2H73 A;  4N10 A;  1O8W A;  2V6K A;  2FA8 A;  3KH9 A;  2N5F A;  1XW9 A;  4KF9 A;  3DEX A;  5G5F A;  2DIZ A;  4X1U A;  2HYX A;  1Z6M A;  4EDY A;  2GSQ A;  2M80 A;  1OVN A;  1KNG A;  2K9F A;  4X0X A;  3CTG A;  4HU7 A;  4HEA 2;  4CY8 A;  3GKX A;  1YQ1 A;  5JCW A;  3LQ7 A;  1OYJ A;  2QSI A;  1J08 A;  4QQ7 A;  4KCE A;  4XIH A;  1R4W A;  3GMF A;  1B48 A;  3ZIJ A;  3PH9 A;  2R3X A;  3GH6 A;  2HZF A;  3IXR A;  1PN9 A;  1FHE A;  5ECI B;  2CQ9 A;  3ZRD A;  2IMD A;  3UL3 A;  5KEJ A;  5D73 A;  5CO3 A;  2H6Y A;  1M7T A;  1WE0 A;  3QFB C;  2DMM A;  3W6G A;  16GS A;  2HRA A;  4TN8 A;  2VCX A;  1GUM A;  1TRW A;  2IMF A;  1TI3 A;  4PTS A;  5EVO A;  2IWT A;  5D9X A;  2YJH A;  2MMA A;  3W8S A;  2D2Z A;  4OFM A;  2IPA A;  1SL2 B;  1SKS B;  3O6T A;  2C4J A;  5HR1 A;  3I43 A;  2HRK A;  1ZCP A;  3KCM A;  4TR1 B;  2TRX A;  2M72 A;  3CQF A;  4JRR A;  2LNT A;  3TCO A;  3UOM A;  1EV9 A;  2JAD A;  4ZBD A;  2X49 A;  1M99 A;  5ECQ B;  1LU4 A;  4CDO A;  1R5P A;  3VPQ A;  5B8B A;  4X43 A;  1B4Q A;  1G0T A;  1HNA A;  2HZE B;  5GZZ B;  1YDK A;  4ECB A;  1GSF A;  3RAZ A;  3HVV A;  1CQH A;  4KDU A;  3BBY A;  2K8V A;  2DLX A;  4K6X A;  4LL4 B;  4TKY A;  2CVD A;  2OA7 A;  4N0V A;  1THX A;  4MJA A;  4ML1 A;  1F37 A;  1GP1 A;  2DJ1 A;  2FLS A;  3D6I A;  3GSS A;  3Q18 A;  3FY7 A;  17GS A;  2GQM A;  4RUV A;  2H8L A;  2GDR A;  1ABA A;  4RQX A;  2PVQ A;  2FWH A;  3LG6 A;  4J2F A;  2FD3 A;  2P5R A;  4XTS A;  1U87 A;  4WKW A;  4P3Y B;  4HS1 A;  2BJX A;  2GTU A;  3S9F A;  3LSZ A;  3NOF A;  2VLU A;  1VF3 A;  3EPT A;  1JFU A;  5AN1 A;  2K18 A;  3BOA A;  4K0G A;  5KOX A;  5G1L A;  2VCZ A;  3HA9 A;  1BQ7 A;  1A23 A;  4EE0 A;  3D4M A;  3CTF A;  4QL9 A;  1B9X C;  5IOX A;  4DSR A;  3HD5 A;  3O76 A;  5D96 A;  4J56 E;  4HSC X;  2MZC A;  2HSY A;  4MDC A;  3D4T A;  4OWY A;  3U6V A;  4GCI A;  3MAK A;  2V2G A;  4XS4 A;  2E7P A;  2KP1 A;  3QMX A;  1B4P A;  1UVZ A;  2LJA A;  2YWN A;  2A4V A;  3P2A A;  4ZB8 A;  4BPY A;  4BVY A;  4EUY A;  2LQO A;  3LFL A;  3VI5 A;  4ECI A;  3L0H A;  1A2M A;  5LD0 A;  5JCU A;  3APO A;  2E0Q A;  3EMP A;  3ED3 A;  1PN0 A;  3HKR A;  3O3T A;  5KN0 A;  1FB6 A;  2ON7 A;  4MH2 A;  2WFC A;  1DSB A;  5F06 A;  1X5E A;  2HSM A;  3TOT A;  1A2J A;  1S3C A;  2I3Y A;  1GSY A;  4BVX B;  22GS A;  4POB A;  4F03 A;  4O5R A;  1HQO A;  1VF2 A;  2L4C A;  3H79 A;  3GKM A;  3IPZ A;  1AAZ A;  3MNG A;  4RI7 A;  3EE2 A;  2HSH A;  2H0H A;  4MF6 A;  1GUH A;  4IEL A;  2QKE A;  5E59 A;  2OE0 A;  1ERT A;  1TOF A;  1GWC A;  2NPB A;  4ZL9 A;  4D73 A;  1SJZ A;  3DKS A;  3BJ5 A;  1EOG A;  3IC8 A;  2DJJ A;  5EL8 A;  3CXG A;  1A8L A;  3HZ4 A;  3LXZ A;  1F2E A;  3GTU B;  4IVF A;  2CA8 A;  4MH3 A;  1T4Z A;  5JWR B;  4XS6 A;  1X5C A;  2LRT A;  5J41 A;  5A5K A;  3VK9 A;  1I9D A;  3C8E A;  1SJ6 A;  3J7Y k;  8GSS A;  2E2M A;  4G19 A;  3G7J A;  5A4W A;  2C0D A;  4O5Q A;  1X0R A;  4ACS A;  2L5L A;  4K9Z A;  3VFI A;  2VLV A;  4JED A;  1IYI A;  1A0F A;  3M9J A;  2CVK A;  3I69 A;  3M1G A;  2HRF A;  1S3A A;  3D22 A;  2R0P A;  4WBR D;  5AIV A;  3IAM 2;  4EDZ A;  1NHY A;  4KW6 A;  1JZW A;  4ILF A;  2WRT A;  1H75 A;  1V2A A;  2B5Y A;  3A2W A;  4RI6 A;  5F05 A;  3GN3 A;  3TRX A;  5IMC A;  3PIN A;  3Q19 A;  3TJK A;  3QFA C;  2PWJ A;  5INY A;  1EWX A;  2GLR A;  3FZ5 A;  4GF0 A;  5ECK B;  2HZE A;  1A24 A;  1OAZ A;  3RHB A;  2XBI A;  1ACV A;  3APS A;  3M8N A;  2NVL A;  4MK3 A;  3TRP A;  3NZN A;  1E6B A;  1C72 A;  5G31 A;  1LBK A;  1M2B A;  4HU9 A;  2JU5 A;  3FZ4 A;  3IBH A;  2C3Q A;  3QDN A;  4LLR A;  1PFO A;  4Z7X A;  1JLV A;  2RLI A;  3RBT A;  3C71 A;  5JCG A;  1NSW A;  1Y25 A;  2FGX A;  3E0U A;  1F6M C;  2YJ7 A;  2VUP A;  4K8M A;  2EIO A;  2WGR A;  3CRT A;  2AJQ B;  2DML A;  3F8U A;  4JE1 A;  2H0G A;  3MYD A;  1TRU A;  1HD2 A;  1JLW A;  4MZC A;  3CBU A;  1XW6 A;  3FR3 A;  3ZIV A;  4IBP A;  3CRU A;  5CNW A;  4K0N A;  5B8A A;  5CRH A;  2C80 A;  2L4Q A;  2L59 A;  5DJM A;  3A2X A;  5H5R A;  3RPP A;  4WBJ A;  1U3I A;  5J5N A;  3I6A A;  1XOA A;  2ES7 A;  2YZU A;  1SK0 A;  5HQP A;  3G7I A;  1K0M A;  1G6Y A;  3FYG A;  4KUN A;  4K2D A;  4V2M A;  4I2U A;  1WIK A;  3F63 A;  2DJK A;  1QQ2 A;  1O7U A;  5DQY A;  3TUE A;  3M9K A;  4ZB6 A;  1B9Y C;  4YQU A;  3Q74 A;  5HR0 A;  1WWJ A;  2JZT A;  1BAY A;  2YV7 A;  2O89 A;  2H76 A;  4EC0 A;  2X64 A;  5IOW A;  1XVW A;  1U88 A;  1QUW A;  3GX8 A;  5IMF A;  4BA7 A;  3EYT A;  4MNN A;  3HHV A;  4AGS A;  2MMN A;  4PX1 A;  2OBI A;  3ZRE A;  1G7E A;  1MD3 A;  1QGV A;  1TU8 A;  1T4Y A;  4LA1 A;  2MMZ A;  1O8X A;  4HZ2 A;  3FMW A;  4GSN A;  1UC7 A;  4KSO A;  5H5S A;  4BVY B;  4TR3 A;  2I81 A;  3ZFL A;  3CYN A;  3TKR A;  3GFK A;  3KXO A;  4N11 A;  4Q5N A;  1SKR B;  4Z2R A;  4E8E A;  2F3M A;  5CAX A;  2H71 A;  1GSU A;  3C1S A;  1SU9 A;  3FW2 A;  4IQA A;  3EUR A;  3F3Q A;  3P90 A;  4WF4 A;  1XWA A;  2RII A;  3QAG A;  2O8V B;  3HVS A;  4ICY A;  4ML6 A;  2PU9 C;  1O85 A;  2WDU A;  2GT6 A;  4PQI A;  1M9B A;  3ERF A;  2PPT A;  3HZ8 A;  2I4A A;  4WEY A;  2B7K A;  3F3R A;  3HY2 A;  3L78 A;  3KEB A;  1JHB A;  3KTL A;  1LJR A;  4XHM A;  3UBK A;  5G5E A;  1VRS D;  1XIY A;  3M3M A;  3NIV A;  4KCA A;  4D73 B;  2H1B A;  4I97 A;  5EY6 A;  1RW1 A;  4IW9 A;  3IHG A;  3C7M A;  3GKN A;  1AC1 A;  2LJR A;  3LW9 A;  4ZB9 A;  4PUF C;  2GS3 A;  2VAF A;  1ZZY A;  2N5A A;  2ON5 A;  5DDL A;  3GUR A;  1AQX A;  1Q98 A;  3GIX A;  2REM A;  3EU3 A;  4EKZ A;  4Z2U A;  1Z5Y E;  6GSU A;  3GHA A;  4I5Q A;  2JSY A;  4PNF A;  1G7O A;  2YV9 A;  3QPM A;  3AY8 A;  2KP2 A;  3HYP A;  4OCE A;  3IOS A;  2HI7 A;  3QR6 A;  2BMX A;  1Z7P A;  7GSS A;  2QC7 A;  4OFN A;  2C0G A;  2XC2 A;  3GA4 A;  3UAR A;  5BRT A;  1M2A A;  1QMV A;  3IAS 2;  4KND A;  4ZL7 A;  3H8Q A;  3PGT A;  2LNS A;  5CRE A;  1V9W A;  3TGZ A;  2YWO A;  3EU4 A;  3LXT A;  1K0B A;  4GTU A;  4YH2 A;  4NPB A;  3VUR A;  4MLY A;  2A2R A;  2HLS A;  4L0U A;  4O92 A;  2ZNM A;  4ZIL A;  1ZGN A;  4K5R A;  1SK2 A;  3L9S A;  3LYK A;  4PQ1 A;  2OE1 A;  1GNE A;  2MYG A;  2RUE A;  3FR6 A;  1SYX A;  3GL3 A;  2V41 A;  4IKH A;  2V32 A;  4JR6 A;  2IFQ A;  2FA4 A;  3DXB A;  3SBC A;  4NHZ A;  1U6T A;  1PQN A;  3KTB A;  1DE2 A;  4I8B A;  3ERW A;  2IME A;  1GNW A;  1V58 A;  3WGD A;  1AQW A;  2TRC P;  1YKA A;  1GTU A;  3LGC A;  4L8E A;  1PGT A;  2LST A;  2VOC A;  1XWC A;  4HOJ A;  4NV2 A;  2WS2 A;  3WT1 A;  2GZZ A;  3KGK A;  1FB0 A;  1OE7 A;  1PL1 A;  1GSQ A;  4K7O A;  2XPD A;  1XZO A;  1S3D A;  1PRX A;  1TXX A;  1J9B A;  4TXO A;  4ECC A;  2L57 A;  5EPF A;  4ZIJ A;  2XPE A;  5J9B A;  5D9W A;  5ID2 A;  4YAV A;  2ZCT A;  4CY6 A;  1URM A;  1EGO A;  1TP9 A;  3I9V 2;  1SK1 A;  4BIK A;  3VPT A;  2XHF A;  3G9B A;  4OD7 A;  12GS A;  4FO5 A;  5IMA A;  4MA9 A;  5G1K A;  1ERV A;  3IE3 A;  2KUC A;  5CRG A;  4OO4 A;  1K0A A;  1VGL A;  2DJ0 A;  2EIR A;  3LWA A;  5ECR B;  3L4N A;  4K1F A;  4KDY A;  3DIE A;  1FOH A;  3A5I A;  11GS A;  4LMV A;  2VD1 A;  4EVM A;  4NMU A;  4TR4 A;  6GST A;  2F8F A;  2DSA A;  4MZB A;  5E4W A;  2CAI A;  3UMA A;  5BMU A;  4HQS A;  1TRV A;  2H74 A;  2JL4 A;  5LCZ A;  2PER A;  1ZYE A;  3PPU A;  1XW5 A;  2CAQ A;  1SYR A;  3K8N A;  4TW5 A;  2R0G A;  4GWR A;  3V1W A;  2OKA A;  1R26 A;  3ZYW A;  1X9M B;  2VL9 A;  2R2J A;  4TRX A;  4IHU A;  3HVX A;  2BTO T;  1PX7 A;  5DAL B;  3ZVJ A;  1SL1 B;  1W4V A;  3FEU A;  5GSS A;  4HJM A;  3KIJ A;  3F4S A;  4G0I A;  4FH8 A;  2CZ3 A;  2YZH A;  1THO A;  1XBS A;  20GS A;  2GQK A;  2YWM A;  2Z9S A;  2RUF A;  3UBL A;  4XCS A;  2YPM A;  2H1D A;  2L6C A;  4DSS A;  1M2D A;  3ME8 A;  5HR2 A;  1XG8 A;  4OO5 A;  2JAC A;  1OC8 A;  3IC4 A;  4GLT A;  2VIM A;  2LKU A;  3WD6 A;  2YAN A;  1KTE A;  5GAN D;  1XFL A;  2H30 A;  2HNL A;  3DML A;  4OMV A;  4JBB A;  1MEK A;  1OKD A;  3QOU A;  1AUC A;  5HFI A;  4PGT A;  1ERU A;  1EEJ A;  2FUG 2;  2V6O A;  2X8G A;  1XWK A;  1DE1 A;  1FVJ A;  2N5B A;  4AJ7 A;  1PSQ A;  1F9M A;  3ZFB A;  1GUK A;  2OBK A;  4FIW A;  4HDE A;  3JCM L;  4K7I A;  1T7P B;  5ECO B;  3F4R A;  4IS0 A;  3VWV A;  3WYW A;  2VL2 A;  3GL5 A;  3GST A;  1YEX A;  1SJI A;  3KH7 A;  2L5O A;  1ZMA A;  4IJ3 A;  4ZBB A;  1FO5 A;  4GRF A;  3DVW A;  2OE3 A;  1ERW A;  2VL3 A;  5IMV A;  3D5J A;  3TKQ A;  2B3S A;  2FY6 A;  4MJC A;  4Z2T A;  5ELA A;  2YCD A;  1TKD B;  3HJO A;  4GST A;  3H93 A;  4MMM A;  2B1K A;  5L71 A;  1YZX A;  3GNJ A;  3TKP A;  2B7J A;  4IJI A;  2KLX A;  4XRA A;  3ZIT A;  1OC9 B;  2ZUP A;  1HYU A;  3IDV A;  4HQZ A;  4V1A g;  2GQL A;  3FZA A;  4KA0 A;  2CX3 A;  2GZY A;  2CV4 A; 
#chains in the Genus database with same CATH homology
 1BG5 A;  3MWH A;  3UAP A;  5A4U A;  4POL A;  3GUS A;  3N5O A;  4MPG A;  3APQ A;  1PMT A;  3ZMK A;  4N30 A;  4G10 A;  1OE8 A;  2PGT A;  3HCZ A;  5COH A;  2NDO A;  1M9A A;  2IJY A;  1WMJ A;  1MDK A;  5GAP D;  3A5W A;  1OKT A;  3WT2 A;  4V2N A;  3MIX A;  5B7C A;  2X8C A;  3A2V A;  3RHC A;  2B5E A;  3KMN A;  2IFQ B;  2C1Y A;  4Q5F A;  3G7Y A;  4YKG A;  1X9W B;  2H1A A;  4JU5 A;  1K3O A;  5IPG A;  2B6M A;  4MCU A;  2FWF A;  3UVH A;  2I9H A;  2MMO A;  3TKS E;  2GSR A;  4ZL8 A;  4AF2 A;  4DSQ A;  3PR8 A;  5CP1 A;  1I5G A;  5AIX A;  3TJF A;  3IA1 A;  5ECP B;  2J23 A;  1ZYP A;  1EEM A;  2PN8 A;  2AHE A;  5B6N A;  4EL1 A;  2RM5 A;  4TXO B;  1FG4 A;  3E9J B;  3GKK A;  1TK8 B;  4PUA A;  4EIP A;  6GSY A;  2VCW A;  5ID2 B;  4IN0 A;  2H6Z A;  4PUR A;  4F0B A;  2R5G A;  5DAK B;  4AJ6 A;  3GV1 A;  1GTI A;  2X99 A;  3H4K A;  1R5A A;  1Z3E A;  2C0F A;  1TK0 B;  2H66 A;  2LV3 A;  2X4A A;  3D21 A;  1M0U A;  1Z9H A;  1F3A A;  5F0G A;  5DAL A;  2YWI A;  4BL7 A;  4E8H A;  2WCI A;  4POM A;  4LL1 B;  2L6D A;  3J7Y b;  5F8B A;  2R6K A;  2VCV A;  2OAD A;  2V1M A;  5ABR A;  2DKH A;  1J0F A;  3F9U A;  1XXU A;  2C3N A;  2CZ2 A;  1NW2 A;  4K7N A;  3VWW A;  2H1G A;  4GSS A;  5LNK e;  1EP8 A;  2X8H A;  1T00 A;  4ZBA A;  4WR4 A;  9GSS A;  2DIY A;  2B1L A;  1TU7 A;  4MZW A;  4F2I A;  4QL7 A;  2R37 A;  2HXK A;  3FKF A;  1GL8 A;  2QGV A;  3UIW A;  1MD4 A;  2GGT A;  1EV4 A;  2R4V A;  3HDC A;  1AIU A;  2C3T A;  4TOP A;  1TDI A;  4KX4 A;  1H4O A;  1W89 A;  3IV4 A;  2KHP A;  3Q6O A;  1PD2 1;  5IMD A;  5DBQ A;  2DBC A;  4Q5R A;  1TTZ A;  3BCI A;  4O7H A;  1KBN A;  2NTO A;  3VWU A;  4BWQ A;  5FHI A;  5DJL A;  4DSS B;  1R7H A;  3US3 A;  3FZ9 A;  1O6J A;  2A2S A;  1AXD A;  4FYU A;  2IMI A;  3F6F A;  5J9C A;  1XWG A;  2CX4 A;  4TVE A;  1T3B A;  2H6X A;  1X5D A;  4ZXG A;  4NWY A;  4X4J A;  1A8Y A;  1XVQ A;  1ZOF A;  1GTB A;  4O32 A;  1YY7 A;  4FYC A;  2JZS A;  3VLN A;  2VL2 C;  4HZ4 A;  1VF4 A;  2GVP A;  3ERG A;  4G0L A;  5GST A;  3GRX A;  4I6X A;  2GST A;  4IP6 A;  4KH7 A;  2YNX A;  4CW9 A;  4F82 A;  4NV5 A;  1BYE A;  2P5Q A;  1GLQ A;  1KEB A;  4MP4 A;  4MF5 A;  1OC9 A;  5G2Z A;  4GQC A;  4NHW A;  3DVX A;  1GUL A;  4L5O A;  4KSM A;  1YF1 A;  4L0W A;  4ECJ A;  2KOK A;  3M0F A;  1NHO A;  1SEN A;  3TDG A;  1A2L A;  1JZR A;  4MPF A;  1TRS A;  3D0Z A;  2WUL A;  3GH9 A;  1T1V A;  5CRD A;  2DJ3 A;  2QA2 A;  2GZP A;  3W8J A;  4TXV A;  2QA1 A;  1GRX A;  4RQR A;  5ECM B;  1RQM A;  2E2G A;  2OJL A;  1B8X A;  3BCK A;  6GSS A;  2LTK A;  4WET A;  3IR4 A;  3EVI A;  4ID0 A;  5KN3 A;  1Z7R A;  1YF0 A;  3IK9 A;  10GS A;  1JZO A;  2H75 A;  2F9S A;  3TJG A;  4YAP A;  3ZML A;  1K0O A;  2OAC A;  4H86 A;  3DYR A;  1Z6N A;  4GQF A;  1WOU A;  4IGJ A;  5KN1 A;  1RK4 A;  3FR9 A;  2IIY A;  1XCC A;  4V1A p;  5ENU A;  5DVB A;  2GT5 A;  2FCH A;  4YQV A;  2IL3 A;  1K3Y A;  3A3T A;  5DCG A;  2JZR A;  2LUS A;  3IHQ A;  4A5P A;  4GXZ A;  3OR5 A;  3RDW A;  4MJE A;  5FWG A;  3KMO A;  2B5X A;  5DAK A;  4KE3 A;  1K3L A;  5B6M A;  2WJU A;  6GSW A;  1Y6E A;  3ISO A;  4PXO A;  4WXT A;  2AUV A;  3HJM A;  3FK8 A;  1EP7 A;  1XOB A;  2MBT A;  1HNC A;  3L9V A;  2CVB A;  1AW9 A;  4KGI A;  1NM3 A;  2DJ2 A;  5G30 A;  2AV4 A;  4OCF A;  4F0C A;  5IIZ A;  2I1U A;  4YKF A;  2IN3 A;  2A2P A;  4O5U A;  6GSV A;  2PUK C;  3L9U A;  1XWB A;  1PA3 A;  14GS A;  1EOH A;  3F6D A;  2XBQ A;  3E3E A;  1SKW B;  3SWL A;  3TKS A;  2H70 A;  3KP9 A;  1DBY A;  2HRN A;  5D8I A;  1GSS A;  1WRY A;  2EIQ A;  1N8J A;  5FT3 A;  1T8E B;  3DRN A;  3HJP A;  1G6W A;  4Q5Q A;  1FW1 A;  1JZD A;  1YJ6 A;  1QK8 A;  13GS A;  3WGE A;  4HUA A;  5HFG A;  3UJ1 A;  4BL7 B;  1GSD A;  3WGX A;  4G2E A;  2VM2 A;  1BX9 A;  4K5S A;  3HXS A;  1YKC A;  4EIQ A;  3KJY A;  2K6V A;  1V40 A;  3UEM A;  1E2Y A;  1BED A;  4DVC A;  4USS A;  4IP1 A;  1ZYQ B;  3LEF A;  2H72 A;  1FVK A;  1YEP A;  5CYY A;  5ECH B;  3KP8 A;  4MF7 A;  4F9Z A;  2HE3 A;  5J3R A;  3FRC A;  1FAA A;  3N9J A;  2YN1 A;  3IK7 A;  2F8A A;  3H1N A;  5IO0 A;  4IQ1 A;  18GS A;  3DD3 A;  1MDJ A;  4JR4 A;  2FWG A;  2LRC A;  1MDI A;  1ML6 A;  5IQY A;  2HT9 A;  2IMK A;  1ZYN A;  1ON4 A;  2ALB A;  1QXH A;  3C73 A;  4ULX A;  1GLP A;  1HNB A;  2JSZ A;  2G2Q A;  5ELG A;  2P0G A;  2CT6 A;  4AJ8 A;  1O73 A;  1X9S B;  4V2L A;  3QAW A;  3CMI A;  1PL2 A;  4EXJ A;  4JZQ A;  2NBS A;  1PKZ A;  6GSX A;  1ILO A;  2VCQ A;  1GH2 A;  4TR1 A;  3R2Q A;  5D93 A;  2C8U A;  4EF0 A;  3LOR A;  3F0I A;  2PBJ A;  3TJJ A;  5HR3 A;  3CSJ A;  1EZK A;  2FWE A;  4I2T A;  2MBS A;  1Q4J A;  2WZ9 A;  4J57 E;  1QFN A;  5C04 A;  3TB2 A;  2H19 A;  1TW9 A;  5DCH A;  5IM9 A;  4FYB A;  2VD0 A;  4XRD A;  2WB9 A;  1WPI A;  3KD0 A;  1O81 A;  4MAB A;  2DC5 A;  4KB3 A;  3ZZX A;  1TI1 A;  3C1R A;  5AIS A;  5IPH A;  1UA5 A;  2VCT A;  3EIN A;  1A0R P;  4DEJ A;  4NAX A;  2LJK A;  3QAV A;  4PNG A;  2O87 A;  1XPV A;  3F4T A;  2C0E A;  2VO4 A;  5J4U A;  3ME7 A;  1SD9 A;  2G0F A;  1WP0 A;  2M46 A;  2GSS A;  3TOU A;  5AGY A;  3R3E A;  1VF1 A;  4KDX A;  3EWL A;  5A4V A;  2O85 A;  3KM6 A;  2VM1 A;  3ZTL A;  5C00 A;  1OC3 A;  2FHE A;  1SD8 A;  2LS5 A;  1UN2 A;  4HJ2 A;  1ZL9 A;  3TJB A;  1IYH A;  5ECL B;  4LMW A;  4L5L A;  1TK5 B;  5JWO B;  2AB6 A;  3UVT A;  1V98 A;  5KOW A;  2TIR A;  1MTC A;  2UZ8 A;  3TRQ A;  2YP6 A;  1CQG A;  4HI7 A;  4EO3 A;  5D9T A;  4OFT A;  1SL0 B;  4G0K A;  5ECN B;  5D9V A;  4TR0 A;  2AYT A;  2A4H A;  1WJK A;  2RM6 A;  1FOV A;  1K0N A;  1BJX A;  1EGR A;  2P31 A;  1AQV A;  5IO2 A;  3DWV A;  1TJD A;  5CRW A;  2O7K A;  1USB A;  5DQS A;  2K8S A;  5F07 A;  1ST9 A;  1N2A A;  3ZLP A;  3EC3 A;  3KZQ A;  1GTA A;  4BWS A;  3GYK A;  3BD2 A;  3P8W A;  2LEG A;  4MJB A;  2EC4 A;  3CSH A;  2YOI A;  3VI7 A;  1K0D A;  2H01 A;  3QCP A;  4NXI A;  3CSI A;  1K0C A;  3ZL5 A;  3U5R E;  3P7X A;  4POK A;  3TKS C;  3FHK A;  3LYP A;  3EMX A;  1F3B A;  3MDK A;  3QD9 A;  4G9H A;  5H5Q A;  3DGQ A;  5JWQ B;  5IMZ A;  5ECS A;  1PX6 A;  1V57 A;  1GSE A;  2PMT A;  2J9H A;  2DKI A;  1PKW A;  4XS4 B;  4BVX A;  3GX0 A;  4YQM A;  3MSZ A;  2FNO A;  1U3A A;  2R0C A;  3VWX A;  4FQU A;  4K2X A;  2H0I A;  2LQQ A;  4CHS A;  2LRN A;  4PQH A;  4WF5 A;  4WR5 A;  3LJR A;  3RPN A;  2HFD A;  4XS1 A;  2AAW A;  5HFK A;  19GS A;  4ISD A;  4KAE A;  1DUG A;  2PVO C;  5KN2 A;  3IRA A;  2F51 A;  3ZVJ D;  4N0Z A;  3GTU A;  2VLT A;  2H73 A;  4N10 A;  1O8W A;  2V6K A;  2FA8 A;  3KH9 A;  2N5F A;  1XW9 A;  4KF9 A;  3DEX A;  5G5F A;  2DIZ A;  4X1U A;  2HYX A;  1Z6M A;  4EDY A;  2GSQ A;  2M80 A;  1OVN A;  1KNG A;  2K9F A;  4X0X A;  3CTG A;  4HU7 A;  4HEA 2;  4CY8 A;  3GKX A;  1YQ1 A;  5JCW A;  3LQ7 A;  1OYJ A;  2QSI A;  1J08 A;  4QQ7 A;  4KCE A;  4XIH A;  1R4W A;  3GMF A;  1B48 A;  3ZIJ A;  3PH9 A;  2R3X A;  3GH6 A;  2HZF A;  3IXR A;  1PN9 A;  1FHE A;  5ECI B;  2CQ9 A;  3ZRD A;  2IMD A;  3UL3 A;  5KEJ A;  5D73 A;  5CO3 A;  2H6Y A;  1M7T A;  1WE0 A;  3QFB C;  2DMM A;  3W6G A;  16GS A;  2HRA A;  4TN8 A;  2VCX A;  1GUM A;  1TRW A;  2IMF A;  1TI3 A;  4PTS A;  5EVO A;  2IWT A;  5D9X A;  2YJH A;  2MMA A;  3W8S A;  2D2Z A;  4OFM A;  2IPA A;  1SL2 B;  1SKS B;  3O6T A;  2C4J A;  5HR1 A;  3I43 A;  2HRK A;  1ZCP A;  3KCM A;  4TR1 B;  2TRX A;  2M72 A;  4JRR A;  2LNT A;  3TCO A;  3UOM A;  1EV9 A;  2JAD A;  4ZBD A;  2X49 A;  1M99 A;  5ECQ B;  1LU4 A;  4CDO A;  1R5P A;  3VPQ A;  5B8B A;  4X43 A;  1B4Q A;  1G0T A;  1HNA A;  2HZE B;  5GZZ B;  1YDK A;  4ECB A;  1GSF A;  3RAZ A;  3HVV A;  1CQH A;  4KDU A;  3BBY A;  2K8V A;  2DLX A;  4K6X A;  4LL4 B;  4TKY A;  2CVD A;  2OA7 A;  4N0V A;  1THX A;  4MJA A;  4ML1 A;  1F37 A;  1GP1 A;  2DJ1 A;  2FLS A;  3D6I A;  3GSS A;  3Q18 A;  3FY7 A;  17GS A;  2GQM A;  4RUV A;  2H8L A;  2GDR A;  1ABA A;  4RQX A;  2PVQ A;  2FWH A;  3LG6 A;  4J2F A;  2FD3 A;  2P5R A;  4XTS A;  1U87 A;  4WKW A;  4P3Y B;  4HS1 A;  2BJX A;  2GTU A;  3S9F A;  3LSZ A;  3NOF A;  2VLU A;  1VF3 A;  3EPT A;  1JFU A;  5AN1 A;  2K18 A;  3BOA A;  4K0G A;  5KOX A;  5G1L A;  2VCZ A;  3HA9 A;  1BQ7 A;  1A23 A;  4EE0 A;  3D4M A;  3CTF A;  4QL9 A;  1B9X C;  5IOX A;  4DSR A;  3HD5 A;  3O76 A;  5D96 A;  4J56 E;  2MZC A;  2HSY A;  4MDC A;  3D4T A;  4OWY A;  3U6V A;  4GCI A;  3MAK A;  2V2G A;  4XS4 A;  2E7P A;  2KP1 A;  3QMX A;  1B4P A;  1UVZ A;  2LJA A;  2YWN A;  2A4V A;  3P2A A;  4ZB8 A;  4BPY A;  4BVY A;  4EUY A;  2LQO A;  3LFL A;  3VI5 A;  4ECI A;  3L0H A;  1A2M A;  5LD0 A;  5JCU A;  3APO A;  2E0Q A;  3EMP A;  3ED3 A;  1PN0 A;  3HKR A;  3O3T A;  5KN0 A;  1FB6 A;  2ON7 A;  4MH2 A;  2WFC A;  1DSB A;  5F06 A;  1X5E A;  2HSM A;  3TOT A;  1A2J A;  1S3C A;  2I3Y A;  1GSY A;  4BVX B;  22GS A;  4POB A;  4F03 A;  4O5R A;  1HQO A;  1VF2 A;  2L4C A;  3H79 A;  3GKM A;  3IPZ A;  1AAZ A;  3MNG A;  4RI7 A;  3EE2 A;  2HSH A;  2H0H A;  4MF6 A;  1GUH A;  4IEL A;  2QKE A;  5E59 A;  2OE0 A;  1ERT A;  1TOF A;  1GWC A;  2NPB A;  4ZL9 A;  4D73 A;  1SJZ A;  3DKS A;  3BJ5 A;  1EOG A;  3IC8 A;  2DJJ A;  5EL8 A;  3CXG A;  1A8L A;  3HZ4 A;  3LXZ A;  1F2E A;  3GTU B;  4IVF A;  2CA8 A;  4MH3 A;  1T4Z A;  5JWR B;  4XS6 A;  1X5C A;  2LRT A;  5J41 A;  5A5K A;  3VK9 A;  1I9D A;  3C8E A;  1SJ6 A;  3J7Y k;  8GSS A;  2E2M A;  4G19 A;  3G7J A;  5A4W A;  2C0D A;  4O5Q A;  1X0R A;  4ACS A;  2L5L A;  4K9Z A;  3VFI A;  2VLV A;  4JED A;  1IYI A;  1A0F A;  3M9J A;  2CVK A;  3I69 A;  3M1G A;  2HRF A;  1S3A A;  3D22 A;  2R0P A;  4WBR D;  5AIV A;  3IAM 2;  4EDZ A;  1NHY A;  4KW6 A;  1JZW A;  4ILF A;  2WRT A;  1H75 A;  1V2A A;  2B5Y A;  3A2W A;  4RI6 A;  5F05 A;  3GN3 A;  3TRX A;  5IMC A;  3PIN A;  3Q19 A;  3TJK A;  3QFA C;  2PWJ A;  5INY A;  1EWX A;  2GLR A;  3FZ5 A;  4GF0 A;  5ECK B;  2HZE A;  1A24 A;  1OAZ A;  3RHB A;  2XBI A;  1ACV A;  3APS A;  3M8N A;  2NVL A;  4MK3 A;  3TRP A;  3NZN A;  1E6B A;  1C72 A;  5G31 A;  1LBK A;  1M2B A;  4HU9 A;  2JU5 A;  3FZ4 A;  3IBH A;  2C3Q A;  3QDN A;  4LLR A;  4Z7X A;  1JLV A;  2RLI A;  3RBT A;  3C71 A;  5JCG A;  1NSW A;  1Y25 A;  2FGX A;  3E0U A;  1F6M C;  2YJ7 A;  2VUP A;  4K8M A;  2EIO A;  2WGR A;  3CRT A;  2AJQ B;  2DML A;  3F8U A;  4JE1 A;  2H0G A;  3MYD A;  1TRU A;  1HD2 A;  1JLW A;  4MZC A;  3CBU A;  1XW6 A;  3FR3 A;  3ZIV A;  4IBP A;  3CRU A;  5CNW A;  4K0N A;  5B8A A;  5CRH A;  2C80 A;  2L4Q A;  2L59 A;  5DJM A;  3A2X A;  5H5R A;  3RPP A;  4WBJ A;  1U3I A;  5J5N A;  3I6A A;  1XOA A;  2ES7 A;  2YZU A;  1SK0 A;  5HQP A;  3G7I A;  1K0M A;  1G6Y A;  3FYG A;  4KUN A;  4K2D A;  4V2M A;  4I2U A;  1WIK A;  3F63 A;  2DJK A;  1QQ2 A;  1O7U A;  5DQY A;  3TUE A;  3M9K A;  4ZB6 A;  1B9Y C;  4YQU A;  3Q74 A;  5HR0 A;  1WWJ A;  2JZT A;  1BAY A;  2YV7 A;  2O89 A;  2H76 A;  4EC0 A;  2X64 A;  5IOW A;  1XVW A;  1U88 A;  1QUW A;  3GX8 A;  5IMF A;  4BA7 A;  3EYT A;  4MNN A;  3HHV A;  4AGS A;  2MMN A;  4PX1 A;  2OBI A;  3ZRE A;  1G7E A;  1MD3 A;  1QGV A;  1TU8 A;  1T4Y A;  4LA1 A;  2MMZ A;  1O8X A;  4HZ2 A;  3FMW A;  4GSN A;  1UC7 A;  4KSO A;  5H5S A;  4BVY B;  4TR3 A;  2I81 A;  3ZFL A;  3CYN A;  3TKR A;  3GFK A;  3KXO A;  4N11 A;  4Q5N A;  1SKR B;  4Z2R A;  4E8E A;  2F3M A;  5CAX A;  2H71 A;  1GSU A;  3C1S A;  1SU9 A;  3FW2 A;  4IQA A;  3EUR A;  3F3Q A;  3P90 A;  4WF4 A;  1XWA A;  2RII A;  3QAG A;  2O8V B;  3HVS A;  4ICY A;  4ML6 A;  2PU9 C;  1O85 A;  2WDU A;  2GT6 A;  4PQI A;  1M9B A;  3ERF A;  2PPT A;  3HZ8 A;  2I4A A;  4WEY A;  2B7K A;  3F3R A;  3HY2 A;  3L78 A;  3KEB A;  1JHB A;  3KTL A;  1LJR A;  4XHM A;  3UBK A;  5G5E A;  1VRS D;  1XIY A;  3M3M A;  3NIV A;  4KCA A;  4D73 B;  2H1B A;  4I97 A;  5EY6 A;  1RW1 A;  4IW9 A;  3IHG A;  3C7M A;  3GKN A;  1AC1 A;  2LJR A;  3LW9 A;  4ZB9 A;  4PUF C;  2GS3 A;  2VAF A;  1ZZY A;  2N5A A;  2ON5 A;  5DDL A;  3GUR A;  1AQX A;  1Q98 A;  3GIX A;  2REM A;  3EU3 A;  4EKZ A;  4Z2U A;  1Z5Y E;  6GSU A;  3GHA A;  4I5Q A;  2JSY A;  4PNF A;  1G7O A;  2YV9 A;  3QPM A;  3AY8 A;  2KP2 A;  3HYP A;  4OCE A;  3IOS A;  2HI7 A;  3QR6 A;  2BMX A;  1Z7P A;  7GSS A;  2QC7 A;  4OFN A;  2C0G A;  2XC2 A;  3GA4 A;  3UAR A;  5BRT A;  1M2A A;  1QMV A;  3IAS 2;  4KND A;  4ZL7 A;  3H8Q A;  3PGT A;  2LNS A;  5CRE A;  1V9W A;  3TGZ A;  2YWO A;  3EU4 A;  3LXT A;  1K0B A;  4GTU A;  4YH2 A;  4NPB A;  3VUR A;  4MLY A;  2A2R A;  2HLS A;  4L0U A;  4O92 A;  2ZNM A;  4ZIL A;  1ZGN A;  4K5R A;  1SK2 A;  3L9S A;  3LYK A;  4PQ1 A;  2OE1 A;  1GNE A;  2MYG A;  2RUE A;  3FR6 A;  1SYX A;  3GL3 A;  2V41 A;  4IKH A;  2V32 A;  4JR6 A;  2IFQ A;  2FA4 A;  3DXB A;  3SBC A;  4NHZ A;  1U6T A;  1PQN A;  3KTB A;  1DE2 A;  4I8B A;  3ERW A;  2IME A;  1GNW A;  1V58 A;  3WGD A;  1AQW A;  2TRC P;  1YKA A;  1GTU A;  3LGC A;  4L8E A;  1PGT A;  2LST A;  2VOC A;  1XWC A;  4HOJ A;  4NV2 A;  2WS2 A;  3WT1 A;  2GZZ A;  3KGK A;  1FB0 A;  1OE7 A;  1PL1 A;  1GSQ A;  4K7O A;  2XPD A;  1XZO A;  1S3D A;  1PRX A;  1TXX A;  1J9B A;  4TXO A;  4ECC A;  2L57 A;  5EPF A;  4ZIJ A;  2XPE A;  5J9B A;  5D9W A;  5ID2 A;  4YAV A;  2ZCT A;  4CY6 A;  1URM A;  1EGO A;  1TP9 A;  3I9V 2;  1SK1 A;  3VPT A;  2XHF A;  3G9B A;  4OD7 A;  12GS A;  4FO5 A;  5IMA A;  4MA9 A;  5G1K A;  1ERV A;  3IE3 A;  2KUC A;  5CRG A;  4OO4 A;  1K0A A;  1VGL A;  2DJ0 A;  2EIR A;  3LWA A;  5ECR B;  3L4N A;  4K1F A;  4KDY A;  3DIE A;  1FOH A;  3A5I A;  11GS A;  4LMV A;  2VD1 A;  4EVM A;  4NMU A;  4TR4 A;  6GST A;  2F8F A;  2DSA A;  4MZB A;  5E4W A;  2CAI A;  3UMA A;  5BMU A;  4HQS A;  1TRV A;  2H74 A;  2JL4 A;  5LCZ A;  2PER A;  1ZYE A;  3PPU A;  1XW5 A;  2CAQ A;  1SYR A;  3K8N A;  4TW5 A;  2R0G A;  4GWR A;  3V1W A;  2OKA A;  1R26 A;  3ZYW A;  1X9M B;  2VL9 A;  2R2J A;  4TRX A;  4IHU A;  3HVX A;  2BTO T;  1PX7 A;  5DAL B;  3ZVJ A;  1SL1 B;  1W4V A;  3FEU A;  5GSS A;  4HJM A;  3KIJ A;  3F4S A;  4G0I A;  4FH8 A;  2CZ3 A;  2YZH A;  1THO A;  1XBS A;  20GS A;  2GQK A;  2YWM A;  2Z9S A;  2RUF A;  3UBL A;  4XCS A;  2YPM A;  2H1D A;  2L6C A;  4DSS A;  1M2D A;  3ME8 A;  5HR2 A;  4OO5 A;  2JAC A;  1OC8 A;  3IC4 A;  4GLT A;  2VIM A;  2LKU A;  3WD6 A;  2YAN A;  1KTE A;  5GAN D;  1XFL A;  2H30 A;  2HNL A;  3DML A;  4OMV A;  4JBB A;  1MEK A;  1OKD A;  3QOU A;  1AUC A;  5HFI A;  4PGT A;  1ERU A;  1EEJ A;  2FUG 2;  2V6O A;  2X8G A;  1XWK A;  1DE1 A;  1FVJ A;  2N5B A;  4AJ7 A;  1PSQ A;  1F9M A;  3ZFB A;  1GUK A;  2OBK A;  4FIW A;  4HDE A;  3JCM L;  4K7I A;  1T7P B;  5ECO B;  3F4R A;  4IS0 A;  3VWV A;  3WYW A;  2VL2 A;  3GL5 A;  3GST A;  1YEX A;  1SJI A;  3KH7 A;  2L5O A;  1ZMA A;  4IJ3 A;  4ZBB A;  1FO5 A;  4GRF A;  3DVW A;  2OE3 A;  1ERW A;  2VL3 A;  5IMV A;  3D5J A;  3TKQ A;  2B3S A;  2FY6 A;  4MJC A;  4Z2T A;  5ELA A;  2YCD A;  1TKD B;  3HJO A;  4GST A;  3H93 A;  4MMM A;  2B1K A;  5L71 A;  1YZX A;  3GNJ A;  3TKP A;  2B7J A;  4IJI A;  2KLX A;  4XRA A;  3ZIT A;  1OC9 B;  2ZUP A;  1HYU A;  3IDV A;  4HQZ A;  4V1A g;  2GQL A;  3FZA A;  4KA0 A;  2CX3 A;  2GZY A;  2CV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...