2PVOC

Crystal srtucture of the ternary complex between thioredoxin f, ferredoxin, and ferredoxin: thioredoxin reductase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
111
structure length
111
Chain Sequence
EAIVGKVTEVNKDTFWPIVKAAGDKPVVLDMFTQWCGPSKAMAPKYEKLAEEYLDVIFLKLDCNQENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 29
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pvoC00
1GH2A 2HLSA 3WT2A 2PPTA 3LWAA 14GSA 2A2RA 3FEUA 1GSDA 2GZZA 4D73B 5F07A 2QGVA 5DJMA 3C1RA 3F3RA 1QGVA 2JACA 2L5LA 4PQHA 4MF7A 1MDKA 5IMVA 1PN9A 3KXOA 4WF4A 2OBIA 3F4RA 1R5PA 1SK2A 2F8FA 1M99A 1OAZA 3EU3A 3D21A 3EE2A 1B8XA 4ZIJA 4WF5A 1ON4A 1ST9A 3GYKA 3DD3A 5IM9A 3C7MA 4KUNA 2LTKA 1PD21 2C1YA 4GSSA 3RHCA 5ID2A 3ZVJD 4F0CA 4RI7A 7GSSA 1O7UA 3KCMA 4MPGA 2RUFA 4E8EA 4WBRD 1EOGA 2NDOA 4J2FA 1F9MA 2NVLA 3GUSA 3A5WA 3IBHA 2O7KA 2VL9A 1AIUA 4K9ZA 4RI6A 2GZYA 2IMIA 2AJQB 1EOHA 4AJ6A 4L5LA 3LGCA 4N11A 3DKSA 5HR3A 3QOUA 2MYGA 5G1KA 2H30A 4EL1A 1ZCPA 1EGRA 2WCIA 1YQ1A 2N5BA 4Q5QA 2LQQA 1THOA 1FW1A 5EVOA 4G9HA 3QAVA 2L6CA 2FWFA 2H6XA 3G7JA 3BCKA 1V9WA 3GX0A 3KD0A 1FOVA 3KP9A 3J7Yb 2FUG2 1GTAA 1OE8A 2O87A 3HJMA 4OD7A 2ALBA 3I6AA 3ZFLA 1T1VA 3MWHA 2I81A 1MDIA 2I9HA 4PX1A 4WBJA 2H75A 4JE1A 2DMLA 12GSA 5G2ZA 2YOIA 3H8QA 2I1UA 3TOUA 5DAKB 19GSA 1PL1A 2AHEA 2QSIA 4EVMA 2YP6A 1OC8A 5ELGA 2DC5A 5A4UA 4TR0A 2OACA 5EPFA 1SYRA 3ZREA 1JHBA 1WRYA 2C3TA 2BTOT 3Q18A 1RK4A 1XWCA 5EL8A 2C80A 3BBYA 3CMIA 1PMTA 3ERWA 4TR1A 5IMDA 4WEYA 5ECIB 2AYTA 1B9YC 3A2XA 4MJCA 4POLA 5GAND 3C71A 4K0NA 3CBUA 4CHSA 1PGTA 1YF1A 22GSA 4PGTA 4RQXA 20GSA 5ECMB 3ZIVA 1GULA 2JL4A 2XPEA 5IIZA 5IMFA 4G19A 4KDUA 4XS4B 4POKA 4MCUA 4DEJA 1G0TA 2AB6A 3P7XA 3O76A 3GH9A 3HVVA 1X9MB 1V57A 2TRXA 2B1LA 1GSSA 1HNCA 2YZUA 1KTEA 3FR3A 2F8AA 3LXTA 3F6FA 2C0GA 10GSA 2LJRA 4TR4A 3VWWA 3WGDA 1FB6A 2IFQB 3WYWA 1ML6A 1K3OA 5DQYA 3A3TA 5ECRB 4K7IA 3ZL5A 2PVOC 1GTUA 5GSSA 2L4QA 3I9V2 3TRPA 1PA3A 3VWVA 3UAPA 2OKAA 3HXSA 18GSA 3US3A 1M2AA 3E3EA 3KEBA 2C0DA 4BWQA 4OCEA 1O6JA 4G2EA 2HZEB 1K0MA 4BL7A 1QQ2A 2NBSA 4X43A 3FHKA 4F9ZA 4IP6A 3K8NA 4EF0A 1GUHA 3GV1A 4FYUA 4PUFC 2R37A 1I9DA 3G7YA 4EDYA 1EV4A 2LJKA 2NTOA 4GXZA 3NOFA 3CRUA 4L0UA 3LG6A 5E4WA 1BEDA 5D96A 4IJIA 2K8SA 2QC7A 2GQKA 5DALA 2K18A 1PX6A 4PXOA 4N0VA 3C8EA 1A2MA 5INYA 1M9BA 3TJFA 3QFBC 4TXOB 4N30A 1ZMAA 6GSSA 1GLQA 2KP1A 2V41A 4BWSA 2X99A 2WZ9A 1LJRA 4IP1A 1PKZA 3EURA 4WR5A 2DSAA 4HU7A 3ZIJA 3IK9A 4Z7XA 1XBSA 4GRFA 4RQRA 2REMA 3F63A 2IPAA 4L8EA 1URMA 4F2IA 3TUEA 3G9BA 2GQMA 2P31A 4J56E 1Z7RA 3MNGA 4HQZA 3M0FA 2H1DA 4ACSA 3ZFBA 2YJHA 1EEMA 1K0CA 2GSQA 2H72A 4XTSA 5JCGA 4V1Ag 1DE1A 4MH2A 5JWOB 1AQXA 4JBBA 2L4CA 2PBJA 1JZDA 2K8VA 5DDLA 5HQPA 2FD3A 2VOCA 3UBLA 1BJXA 1OVNA 1ZZYA 1A8LA 1TRWA 5D73A 1Z3EA 4XRAA 1R5AA 3DRNA 4DVCA 3DEXA 3IAS2 4PQIA 2VL3A 5H5QA 5CRGA 5HFGA 1KEBA 1T4ZA 5C04A 1BQ7A 2HSYA 3C1SA 3PGTA 1MDJA 4GSNA 4DSSA 4BA7A 5JWQB 3QD9A 1NHYA 5DCHA 2XBQA 3LXZA 5JCUA 4QL7A 3GKKA 3IC4A 4BPYA 2DJJA 1TK8B 4POBA 4JRRA 3EMXA 3A2VA 2XHFA 4MA9A 3FZAA 1YY7A 1V58A 4IBPA 1M9AA 1FVKA 3ZRDA 2LJAA 1DE2A 4NHZA 2JZRA 3S9FA 1YDKA 2VO4A 5GZZB 4ZXGA 1TDIA 2IWTA 1TJDA 4MP4A 3E0UA 4TKYA 3HJPA 1S3DA 4ML6A 3KP8A 4QL9A 5IPHA 2WDUA 4YH2A 4KDYA 3UVHA 4EC0A 3HZ8A 5IPGA 2VL2C 4DSQA 1NM3A 3F3QA 4FH8A 3L78A 4KCAA 1FG4A 1G7EA 3C73A 5LD0A 6GSXA 4L5OA 1XW6A 2VM1A 4K1FA 2TIRA 2CA8A 1H75A 1GUMA 1B4PA 1PRXA 2FY6A 3IAM2 3KM6A 3TKQA 1LBKA 3F4TA 1XCCA 1QUWA 3L9VA 3WGEA 5J4UA 2H1BA 5IOXA 3CYNA 4AGSA 4J57E 1F3BA 2YWOA 3EWLA 3UMAA 1U88A 2C8UA 2IMKA 3VURA 6GSVA 4HI7A 4XCSA 3TKSC 2DJ1A 1ZYQB 3HVXA 3UOMA 2JADA 3A2WA 2Z9SA 1GP1A 1VF3A 2H71A 4KSOA 2LV3A 3UL3A 4WR4A 5AGYA 1KBNA 3FK8A 5C00A 1U87A 1TK0B 4ZL9A 2A2SA 5KN1A 3VPQA 2KLXA 3KGKA 4GCIA 3TRXA 2GLRA 3HA9A 1X9SB 2C0FA 2DBCA 3EMPA 1GSFA 2DJ3A 1YKCA 1DBYA 3W8SA 4KX4A 2LRNA 2RUEA 5D9VA 1I5GA 4ML1A 3EC3A 4TR3A 3Q19A 1R4WA 1GSUA 3L9SA 1HYUA 3APQA 1X9WB 1UC7A 1E6BA 3APOA 1MTCA 3PR8A 3UEMA 2LKUA 4TN8A 3ZMLA 2GQLA 3GFKA 2RIIA 2E2MA 3CRTA 4X1UA 3F8UA 4AJ7A 3ZITA 2OADA 2H6ZA 2C0EA 1EV9A 2ON7A 3GRXA 5ECLB 2B7KA 4OCFA 2GVPA 1A24A 2VAFA 2FWGA 3I69A 2PWJA 4L0WA 1GSEA 3Q74A 2EIOA 2CVDA 3P90A 1WIKA 3H79A 2CX3A 5F05A 2DJ0A 4K7NA 2HZFA 4KE3A 1PKWA 3LFLA 3VI5A 1XW9A 3TGZA 5ECKB 1E2YA 1K0AA 1ILOA 1XWKA 3RBTA 3RPPA 1B4QA 1FVJA 2X8HA 4BVXA 2K9FA 5F8BA 1JZRA 1XWAA 2VCXA 4IHUA 4F82A 2IMDA 5J3RA 4HS1A 1FHEA 1HD2A 4IKHA 3L4NA 3GSSA 2JSYA 4ZL7A 2WJUA 1M7TA 5LCZA 1X5EA 4MZCA 5A4VA 5G5FA 4POMA 2PERA 2VCWA 4LA1A 1TP9A 4IVFA 1SK1A 2B5EA 2H1GA 1M2BA 3H1NA 1TI1A 2RM5A 4XS1A 4I8BA 4LLRA 4MH3A 1OKDA 2GDRA 5H5SA 5J9BA 2M46A 2C4JA 1AQVA 1T8EB 4QQ7A 4ECCA 4NV2A 2K6VA 1FO5A 1RW1A 3D6IA 3HCZA 2M72A 2MBSA 1XVQA 3IRAA 4NAXA 2HRFA 3H4KA 3TJBA 1VF4A 4E8HA 5H5RA 3ZYWA 5AIXA 1SU9A 1THXA 3EINA 1CQHA 4DSSB 4LL4B 1ZL9A 5D9TA 4DSRA 3ZTLA 5G1LA 3KZQA 2BJXA 3QFAC 1J9BA 4MJBA 1TK5B 4D73A 2V1MA 5CYYA 3IE3A 3UJ1A 1WOUA 3D22A 2CX4A 5B8BA 4O7HA 3DIEA 2B1KA 1UA5A 3EYTA 2LNSA 5E59A 2IMEA 3IR4A 1GLPA 4FYCA 1EEJA 1Z5YE 5DCGA 4OO5A 3J7Yk 5AISA 3IHQA 3QCPA 2P5RA 5A5KA 1CQGA 3VLNA 4KAEA 5COHA 1AUCA 2G0FA 5ECNB 1B9XC 2WFCA 1SL2B 4PQ1A 4IELA 3TKSE 1XWBA 4AF2A 2LS5A 3QPMA 1EP7A 2AAWA 2X64A 2HXKA 4GTUA 4MF6A 2XC2A 2F9SA 2YV7A 1IYIA 1GSYA 3DMLA 2V6KA 5B6NA 5JCWA 5CO3A 17GSA 4ZBAA 4MZWA 1FB0A 4ECJA 5J5NA 4AJ8A 1Z9HA 1TI3A 1XFLA 1YJ6A 1T00A 2LEGA 4K8MA 1TTZA 4ZB8A 2H6YA 5HFKA 1Z6NA 2KHPA 2CVKA 3DGQA 3BD2A 1EZKA 2KOKA 1O73A 1WMJA 5FT3A 3VWXA 5D9XA 4GSTA 1SK0A 2I4AA 2HRNA 4JEDA 2WS2A 4ZB6A 3KIJA 1F2EA 1F37A 2PN8A 3RAZA 5HR1A 4KDXA 4YQUA 1TU8A 5G30A 3F4SA 3CSJA 2RM6A 4I2UA 4XHMA 4O92A 3QAGA 3GNJA 5DAKA 1M0UA 1YF0A 2VM2A 4LMWA 3IA1A 5ID2B 1OE7A 2OJLA 1G6WA 3CXGA 1GSQA 2R2JA 2R5GA 5D9WA 4IGJA 2PMTA 4PNFA 3GL5A 3GTUA 3TCOA 3BOAA 5KN3A 5IMAA 4Q5NA 1MEKA 3HHVA 4XS6A 5CRWA 1ERUA 2KUCA 4NMUA 1NW2A 3CTFA 2GSTA 3APSA 2YNXA 3RPNA 1J0FA 4ILFA 1SKSB 2E0QA 1QK8A 2HI7A 2DIZA 5DBQA 4NV5A 4XS4A 4MPFA 2CQ9A 2IMFA 1V2AA 3O6TA 3VI7A 3D0ZA 2YWIA 1K0NA 4OFMA 4IN0A 5FWGA 4GF0A 2FHEA 1GWCA 5JWRB 2P0GA 4FO5A 2O89A 4EDZA 3VPTA 1OC3A 1XVWA 4LMVA 2VLUA 1Y25A 2ES7A 2IFQA 1PX7A 5D8IA 1Y6EA 4MLYA 1EWXA 4OFTA 2L57A 5CAXA 1R7HA 4O5RA 2H66A 3KTLA 6GSTA 1USBA 1AXDA 3PH9A 3UBKA 1GL8A 4NPBA 2HFDA 3Q6OA 4RUVA 3FKFA 4YAPA 3ERGA 5DQSA 4KNDA 2ZUPA 1ZOFA 3SBCA 5CRDA 3GIXA 3ZZXA 3VFIA 3WGXA 2HT9A 2X8CA 2GTUA 2GGTA 2VL2A 4GWRA 1OYJA 3QR6A 2CV4A 1S3CA 1DUGA 2HZEA 4ZBBA 3RDWA 2HSHA 4TR1B 2V32A 5GAPD 2MZCA 1Z7PA 3NIVA 1SKWB 4Q5RA 5DVBA 2IJYA 2R6KA 2YJ7A 4TRXA 3ZVJA 4ECIA 1T7PB 5B7CA 2R4VA 1XPVA 5B8AA 3KMOA 1JFUA 5ECPB 1OC9A 3FZ9A 1ACVA 4TXVA 1V40A 1TXXA 2WB9A 2MMZA 3QMXA 3F0IA 4TXOA 1YZXA 4HJMA 2MMAA 1X5DA 1A0RP 3ISOA 2FGXA 3ME7A 1T3BA 3GKNA 3M9KA 5DJLA 1ERVA 2H8LA 2WGRA 2EIRA 3IV4A 3WT1A 2H0GA 4HQSA 5LNKe 4F03A 3DXBA 5CRHA 1ZGNA 2VLVA 5F06A 2FA8A 2O8VB 2AV4A 3FRCA 1UN2A 5D93A 2H1AA 1JLVA 2PU9C 4IQAA 2MMOA 1X5CA 2IL3A 1ERTA 3U6VA 1N8JA 1ERWA 4I6XA 1BAYA 2GSSA 2YN1A 1QFNA 1UVZA 2B5YA 4PUAA 5G5EA 3R2QA 3IOSA 4HEA2 1TOFA 2G2QA 2XBIA 3UVTA 4MJAA 4GQCA 4OFNA 1BYEA 2A4VA 2V2GA 9GSSA 2I3YA 2H76A 1TRVA 2TRCP 4MK3A 2VIMA 3GN3A 3BJ5A 3GH6A 3LYKA 3H93A 5J9CA 3ZMKA 5IO0A 3TJGA 2H19A 3TDGA 4EO3A 4YAVA 1WPIA 8GSSA 2E7PA 2B3SA 5DALB 1JZOA 3TB2A 1PSQA 4EKZA 2FA4A 2DJKA 2YZHA 3CSIA 4EXJA 1Z6MA 1U3IA 5IOWA 3F9UA 2JU5A 4K0GA 3D5JA 1YEPA 1K0BA 1LU4A 2HYXA 2RLIA 3HKRA 5ECHB 2FNOA 3GL3A 1X0RA 1C72A 5KEJA 1A23A 2LRTA 2H01A 4NHWA 4WETA 1WJKA 2B6MA 2R3XA 2VD1A 2VUPA 3W6GA 16GSA 4KGIA 3VWUA 1N2AA 3QAWA 2C3NA 2OE3A 4TOPA 1F6MC 1XXUA 4JR4A 4K6XA 2XPDA 3E9JB 1AW9A 4ZB9A 2MMNA 2YPMA 2AUVA 2HNLA 1SENA 3TRQA 2LQOA 3KH7A 3LSZA 4FIWA 1SD9A 2E2GA 1H4OA 3ME8A 5A4WA 3L0HA 1A8YA 3M3MA 4JZQA 3KJYA 5G31A 3FR6A 1WP0A 2GS3A 2LNTA 3GKMA 4ZL8A 4K7OA 2J9HA 1JLWA 2CAIA 3D4MA 4MJEA 1HNBA 4NWYA 3GTUB 1Q98A 4JU5A 4EUYA 1KNGA 4ULXA 2LRCA 3ZLPA 3HD5A 2F51A 2VCQA 4JR6A 1GTBA 2L6DA 3HJOA 2V6OA 3FYGA 5ECQB 1XZOA 3TKRA 3U5RE 1XW5A 3LJRA 3GA4A 3UIWA 4WKWA 1QMVA 3BCIA 2YWNA 5HR0A 4YQVA 4MF5A 1YEXA 3MAKA 2H70A 1SL0B 4MMMA 3JCML 3HVSA 1WE0A 2LUSA 2CVBA 5L71A 4OWYA 2QKEA 4OMVA 2PVQA 2KP2A 1Q4JA 2WULA 4KH7A 5GSTA 1GNEA 3FZ5A 1NHOA 1O8WA 3L9UA 3TJKA 1V98A 2B7JA 3N5OA 4MABA 3G7IA 4P3YB 3GMFA 1O85A 4V2MA 1SD8A 2MBTA 4GLTA 2JZTA 3KMNA 1B48A 1IYHA 1SJZA 11GSA 2FLSA 1XIYA 3GKXA 3IK7A 3DWVA 1PL2A 1HNAA 3FW2A 1XWGA 1W4VA 2IIYA 3ED3A 1SJ6A 4HOJA 3P8WA 3DVXA 5ECSA 3KTBA 1TU7A 2OE0A 1G7OA 2H0HA 4OO4A 4I5QA 3HDCA 1WWJA 1R26A 1OKTA 2EIQA 4H86A 3NZNA 2DLXA 6GSWA 5CP1A 3TOTA 5HFIA 4ID0A 4HJ2A 1QXHA 2YWMA 5KN0A 4KCEA 2FCHA 3EVIA 2OBKA 1SKRB 1U3AA 5IMCA 3P2AA 4F0BA 1K0DA 3PINA 3EU4A 1OC9B 5IO2A 1K0OA 1DSBA 1XOBA 1SYXA 1GNWA 1K3YA 4HUAA 1NSWA 1PQNA 2GZPA 5F0GA 2L59A 1GTIA 2OA7A 1YKAA 2DIYA 4K2DA 4N10A 5ABRA 4N0ZA 3KH9A 1U6TA 4XRDA 4MZBA 2WRTA 4LL1B 2ZCTA 1MD4A 4I97A 4FYBA 3LQ7A 3W8JA 1TKDB 2YANA 3SWLA 3FR9A 3MSZA 5FHIA 5AIVA 4WXTA 4KW6A 1W89A 2VCVA 4IS0A 2VCTA 1BG5A 5CNWA 2VCZA 2GT6A 1HQOA 1SL1B 3IPZA 4YQMA 3AY8A 3TJJA 2GT5A 4IW9A 2DJ2A 1O8XA 1T4YA 2JSZA 5CREA 2D2ZA 2H74A 2CAQA 2YCDA 3LORA 1JZWA 2F3MA 3HZ4A 2VLTA 2DMMA 1RQMA 3M9JA 5EY6A 3I43A 4HZ2A 3IDVA 3ERFA 4PURA 3DVWA 4TVEA 2GSRA 13GSA 4G10A 4CW9A 1EGOA 2CT6A 2CZ3A 4O32A 4KSMA 3LEFA 3O3TA 1A2JA 2HE3A 1VF2A 3GHAA 3LYPA 2VD0A 5ELAA 3FY7A 2JZSA 2BMXA 2N5FA 1BX9A 2ON5A 3N9JA 1TRSA 1VF1A 3TKPA 4HDEA 1VGLA 4ZBDA 4IJ3A 1MD3A 3GX8A 4CDOA 4HU9A 3QDNA 1GRXA 1M2DA 1GUKA 1TW9A 5AN1A 4I2TA 4MDCA 2C3QA 2PGTA 3M8NA 2YV9A 6GSUA 1TRUA 2B5XA 2O85A 3VK9A 4HZ4A 2H0IA 3CTGA 3MDKA 4IQ1A 4ZILA 4BVYA 2FWHA 5KN2A 5B6MA 1S3AA 5ENUA 3V1WA 4KB3A 3WD6A 3M1GA 3HY2A 3F6DA 3UARA 5ECOB 4NXIA 5IQYA 3DYRA 1A2LA 4EE0A 2IN3A 1AAZA 1G6YA 1AC1A 4V1Ap 4ECBA 2ZNMA 2X8GA 3D4TA 1EP8A 2M80A 3GURA 1F3AA 1ZYEA 4V2NA 3OR5A 1AQWA 3FZ4A 4GQFA 2PUKC 4TW5A 1ABAA 1O81A 3IXRA 2LSTA 1VRSD 6GSYA 3GSTA 3RHBA 4KA0A 2CZ2A 2N5AA 2P5QA 4X0XA 2OE1A 1XOAA 1J08A 2H73A 3CSHA 4XIHA 4Q5FA 1FAAA 2L5OA 1A0FA 2NPBA 5J41A 4PNGA 3HYPA 3TKSA 5HR2A 2J23A 4ISDA 2FWEA 2EC4A 5IMZA 4V2LA 1SJIA 1K3LA
chains in the Genus database with same CATH superfamily
1GH2A 2HLSA 3WT2A 2PPTA 3LWAA 14GSA 2A2RA 3FEUA 1GSDA 2GZZA 4D73B 5F07A 2QGVA 5DJMA 3C1RA 3F3RA 1QGVA 2JACA 2L5LA 4PQHA 4MF7A 1MDKA 5IMVA 1PN9A 3KXOA 4WF4A 2OBIA 3F4RA 1R5PA 1SK2A 2F8FA 1M99A 1OAZA 3EU3A 3D21A 3EE2A 1B8XA 4ZIJA 4WF5A 1ON4A 1ST9A 3GYKA 3DD3A 4K5SA 5IM9A 3C7MA 4KUNA 2LTKA 1PD21 2C1YA 4GSSA 3RHCA 5ID2A 3ZVJD 4F0CA 4RI7A 7GSSA 1O7UA 3KCMA 4MPGA 2RUFA 4E8EA 4WBRD 1EOGA 2NDOA 4J2FA 1F9MA 2NVLA 3GUSA 3A5WA 3IBHA 2O7KA 2VL9A 1AIUA 4K9ZA 4RI6A 2GZYA 2IMIA 2AJQB 3LW9A 1EOHA 4AJ6A 4L5LA 3LGCA 4N11A 3DKSA 5HR3A 3QOUA 2MYGA 5G1KA 2H30A 4EL1A 1ZCPA 1EGRA 2WCIA 1YQ1A 2N5BA 4Q5QA 2LQQA 4X4JA 1THOA 2X49A 1FW1A 5EVOA 4G9HA 3QAVA 2L6CA 2FWFA 2H6XA 3G7JA 3BCKA 1V9WA 3GX0A 3KD0A 1FOVA 3KP9A 3J7Yb 2FUG2 1GTAA 1OE8A 2O87A 3HJMA 4OD7A 2ALBA 3I6AA 3ZFLA 1T1VA 3MWHA 2I81A 1MDIA 2I9HA 4PX1A 4WBJA 2H75A 4JE1A 2DKHA 2DMLA 12GSA 5G2ZA 2YOIA 3H8QA 2I1UA 3TOUA 5DAKB 19GSA 1PL1A 2AHEA 2QSIA 4EVMA 2YP6A 1OC8A 5ELGA 2DC5A 5A4UA 4TR0A 5KOXA 2OACA 2A2PA 5EPFA 1SYRA 3ZREA 1JHBA 1WRYA 2C3TA 2BTOT 3Q18A 1RK4A 1XWCA 5EL8A 2C80A 2R0GA 3BBYA 3CMIA 1PMTA 3ERWA 4TR1A 5IMDA 4WEYA 5ECIB 2AYTA 1B9YC 3A2XA 4MJCA 4POLA 5GAND 3C71A 4K0NA 3CBUA 4CHSA 1PGTA 1YF1A 22GSA 4PGTA 4RQXA 20GSA 4CY8A 5ECMB 3ZIVA 1GULA 2JL4A 2XPEA 5IIZA 5IMFA 4G19A 4KDUA 4XS4B 4POKA 4MCUA 4DEJA 1G0TA 2AB6A 3P7XA 3O76A 3GH9A 3HVVA 1X9MB 1V57A 2TRXA 2B1LA 1GSSA 1HNCA 2YZUA 1KTEA 3FR3A 2F8AA 3LXTA 3F6FA 2C0GA 10GSA 2LJRA 4TR4A 1XG8A 3VWWA 3WGDA 1FB6A 2IFQB 3WYWA 1ML6A 1K3OA 5DQYA 3A3TA 5ECRB 4K7IA 3ZL5A 2PVOC 1GTUA 5GSSA 2L4QA 3I9V2 3TRPA 4BVYB 1PA3A 3VWVA 3UAPA 2OKAA 3HXSA 18GSA 3US3A 1M2AA 3E3EA 3KEBA 2C0DA 4BWQA 4OCEA 1O6JA 4G2EA 2HZEB 1K0MA 4BL7A 1QQ2A 2NBSA 4X43A 3FHKA 4F9ZA 4IP6A 3K8NA 4EF0A 1GUHA 3GV1A 4FYUA 4PUFC 2R37A 1I9DA 3G7YA 4EDYA 1EV4A 2LJKA 2NTOA 4GXZA 3NOFA 3CRUA 4L0UA 3LG6A 5E4WA 1BEDA 5D96A 4IJIA 2K8SA 2QC7A 2GQKA 5DALA 2K18A 1PX6A 4PXOA 4N0VA 3C8EA 1A2MA 5INYA 1M9BA 3TJFA 3QFBC 4TXOB 4N30A 1ZMAA 6GSSA 1GLQA 2KP1A 2V41A 4BWSA 2X99A 2WZ9A 1LJRA 4IP1A 1PKZA 3EURA 4WR5A 2DSAA 4HU7A 3ZIJA 3IK9A 4Z7XA 1XBSA 4GRFA 4RQRA 2REMA 3F63A 2IPAA 4L8EA 1URMA 4F2IA 3TUEA 3G9BA 2GQMA 2P31A 4J56E 4O5QA 1Z7RA 3MNGA 4HQZA 3M0FA 2H1DA 4ACSA 3ZFBA 2YJHA 1EEMA 1PFOA 3R3EA 1K0CA 2GSQA 2H72A 4XTSA 5BRTA 5JCGA 4V1Ag 1DE1A 4MH2A 5JWOB 1AQXA 4JBBA 2L4CA 2PBJA 1JZDA 2K8VA 5DDLA 5HQPA 2FD3A 2R0CA 2VOCA 4O5UA 3UBLA 1BJXA 1OVNA 1ZZYA 1A8LA 1TRWA 5D73A 1Z3EA 2QA1A 4XRAA 1R5AA 3DRNA 4DVCA 3DEXA 3IAS2 4PQIA 2VL3A 5H5QA 5CRGA 5HFGA 1KEBA 1T4ZA 2HRKA 5C04A 1BQ7A 2HSYA 3C1SA 3PGTA 4CY6A 2HSMA 1MDJA 4GSNA 4DSSA 4BA7A 5JWQB 3QD9A 1NHYA 5DCHA 2XBQA 3LXZA 5JCUA 4QL7A 3GKKA 3IC4A 4BPYA 2DJJA 1TK8B 4POBA 4JRRA 3EMXA 3A2VA 2XHFA 4MA9A 3FZAA 1YY7A 1V58A 4IBPA 1M9AA 1FVKA 3ZRDA 2LJAA 1DE2A 4NHZA 2JZRA 3S9FA 1YDKA 2VO4A 5GZZB 1ZYNA 4ZXGA 3IHGA 1TDIA 2IWTA 1TJDA 4MP4A 3E0UA 4TKYA 3HJPA 1S3DA 4ML6A 3KP8A 4QL9A 5IPHA 2WDUA 4YH2A 4KDYA 3UVHA 4EC0A 3HZ8A 5IPGA 2VL2C 4DSQA 1NM3A 3F3QA 4FH8A 3L78A 4KCAA 1FG4A 1G7EA 3C73A 5LD0A 6GSXA 4L5OA 1XW6A 2VM1A 4K1FA 2TIRA 4MNNA 2CA8A 1H75A 1GUMA 1B4PA 1PRXA 2FY6A 3IAM2 3KM6A 3TKQA 1LBKA 3F4TA 1XCCA 1QUWA 3L9VA 3WGEA 5J4UA 2H1BA 5IOXA 3CYNA 4AGSA 4J57E 1F3BA 2YWOA 3EWLA 3UMAA 1U88A 2C8UA 2IMKA 3VURA 6GSVA 4HI7A 4XCSA 3TKSC 2DJ1A 1ZYQB 3HVXA 2UZ8A 3UOMA 2JADA 3A2WA 2Z9SA 1GP1A 1VF3A 2H71A 4KSOA 2LV3A 3UL3A 4WR4A 5AGYA 1KBNA 3FK8A 5C00A 1U87A 1TK0B 4ZL9A 2A2SA 5KN1A 3VPQA 2KLXA 3KGKA 4GCIA 3TRXA 2GLRA 3HA9A 1X9SB 2C0FA 3IC8A 2DBCA 3EMPA 1GSFA 2DJ3A 1YKCA 4EIQA 3W8SA 1DBYA 4KX4A 2LRNA 2RUEA 5D9VA 1I5GA 4ML1A 3EC3A 4TR3A 3Q19A 1R4WA 1GSUA 3L9SA 1HYUA 3APQA 1X9WB 1UC7A 1E6BA 3APOA 1MTCA 3PR8A 3UEMA 2LKUA 4TN8A 3ZMLA 2GQLA 3GFKA 2RIIA 2E2MA 3CRTA 4X1UA 3F8UA 4AJ7A 3EPTA 3ZITA 2OADA 2H6ZA 2C0EA 1EV9A 2ON7A 3GRXA 5ECLB 2B7KA 4OCFA 2GVPA 1A24A 2VAFA 2FWGA 3I69A 2PWJA 4L0WA 1GSEA 2R0PA 3Q74A 2EIOA 2CVDA 3P90A 1WIKA 3H79A 2CX3A 5F05A 2DJ0A 4K7NA 2HZFA 4KE3A 1PKWA 4G0IA 3LFLA 3VI5A 1XW9A 3TGZA 5ECKB 1E2YA 1K0AA 1ILOA 1XWKA 3RBTA 3RPPA 1B4QA 1FVJA 2X8HA 4BVXA 2K9FA 5F8BA 1JZRA 1XWAA 2VCXA 4IHUA 4F82A 2IMDA 5J3RA 4HS1A 1FHEA 1HD2A 4IKHA 3L4NA 4K2XA 3GSSA 2JSYA 4ZL7A 2WJUA 1M7TA 5LCZA 1X5EA 4MZCA 5A4VA 5G5FA 3A5IA 4POMA 2PERA 2VCWA 4LA1A 1TP9A 4IVFA 1SK1A 2B5EA 2H1GA 1M2BA 3H1NA 1TI1A 2RM5A 4XS1A 4I8BA 4LLRA 4MH3A 1OKDA 2GDRA 5H5SA 5J9BA 2M46A 2C4JA 1AQVA 1T8EB 4QQ7A 4ECCA 4NV2A 2K6VA 1FO5A 1RW1A 3D6IA 3HCZA 2M72A 2MBSA 1XVQA 3IRAA 4NAXA 2HRFA 3H4KA 3TJBA 1VF4A 4E8HA 5H5RA 3ZYWA 5AIXA 1SU9A 1THXA 3EINA 1CQHA 4DSSB 4LL4B 1ZL9A 5D9TA 4DSRA 3ZTLA 4PTSA 5G1LA 3KZQA 2BJXA 3QFAC 1J9BA 4MJBA 1TK5B 4D73A 2V1MA 3HVNA 2DKIA 5CYYA 3PPUA 3IE3A 3UJ1A 1WOUA 3D22A 2CX4A 5B8BA 4O7HA 3DIEA 2B1KA 1UA5A 3EYTA 2LNSA 5E59A 2IMEA 3IR4A 1GLPA 2QA2A 4FYCA 1EEJA 1Z5YE 1PN0A 5DCGA 4OO5A 3J7Yk 5AISA 4Z2UA 3IHQA 3QCPA 2P5RA 5A5KA 1CQGA 3VLNA 4KAEA 5COHA 1AUCA 2G0FA 5ECNB 1B9XC 2WFCA 1SL2B 4PQ1A 4IELA 3TKSE 1XWBA 4AF2A 2LS5A 3QPMA 1EP7A 2AAWA 2X64A 2HXKA 4GTUA 4MF6A 2XC2A 2F9SA 2YV7A 1IYIA 1GSYA 4YKFA 3DMLA 2V6KA 5B6NA 5JCWA 5CO3A 17GSA 4ZBAA 4MZWA 1FB0A 4ECJA 5J5NA 4AJ8A 4HSCX 1Z9HA 1TI3A 1XFLA 1YJ6A 1T00A 2LEGA 4K8MA 1TTZA 4ZB8A 2H6YA 5HFKA 1Z6NA 2KHPA 2CVKA 3DGQA 3BD2A 4USSA 1EZKA 2KOKA 1O73A 1WMJA 5FT3A 3VWXA 5D9XA 4GSTA 1SK0A 2I4AA 2HRNA 4JEDA 2WS2A 4ZB6A 3KIJA 1F2EA 1F37A 2PN8A 3RAZA 5HR1A 4KDXA 4YQUA 1TU8A 3MYDA 5G30A 3F4SA 3CSJA 2RM6A 4I2UA 4XHMA 4O92A 3QAGA 3GNJA 5DAKA 1M0UA 1YF0A 2VM2A 4LMWA 3IA1A 5ID2B 1OE7A 2OJLA 1G6WA 3CXGA 1GSQA 2R2JA 2R5GA 5D9WA 4IGJA 2PMTA 4PNFA 3GL5A 3GTUA 4Z2RA 3TCOA 3BOAA 5KN3A 5IMAA 4Q5NA 1MEKA 3HHVA 4XS6A 5CRWA 1ERUA 2KUCA 4NMUA 1NW2A 3CTFA 2GSTA 3APSA 2YNXA 3RPNA 1J0FA 4ILFA 1SKSB 2E0QA 1QK8A 2HI7A 2DIZA 5DBQA 4NV5A 4XS4A 4MPFA 2CQ9A 2IMFA 1V2AA 3O6TA 3VI7A 3D0ZA 2YWIA 1K0NA 4OFMA 4IN0A 5FWGA 4GF0A 4Z2TA 2FHEA 1GWCA 5JWRB 2P0GA 4FO5A 2O89A 4EDZA 4EIPA 3VPTA 1OC3A 1XVWA 4LMVA 2VLUA 1Y25A 2ES7A 2IFQA 1PX7A 5D8IA 1Y6EA 4MLYA 1EWXA 4OFTA 2L57A 5CAXA 1R7HA 4O5RA 2H66A 3KTLA 6GSTA 1USBA 1AXDA 3PH9A 3UBKA 1GL8A 4NPBA 2HFDA 3Q6OA 4RUVA 3FKFA 4YAPA 3ERGA 5DQSA 4KNDA 2ZUPA 1ZOFA 3SBCA 5CRDA 3GIXA 3ZZXA 3VFIA 3WGXA 2HT9A 2X8CA 2GTUA 2GGTA 2VL2A 4GWRA 1OYJA 3QR6A 2CV4A 1S3CA 1DUGA 2HZEA 4ZBBA 3RDWA 2HSHA 4TR1B 2V32A 5GAPD 2MZCA 1Z7PA 3NIVA 1SKWB 4Q5RA 5DVBA 1FOHA 2IJYA 2R6KA 2YJ7A 4TRXA 3ZVJA 4ECIA 5BMUA 1T7PB 5B7CA 2R4VA 1XPVA 5B8AA 3KMOA 1JFUA 5ECPB 1OC9A 3FZ9A 1ACVA 4TXVA 1V40A 1TXXA 2WB9A 2MMZA 3QMXA 3F0IA 4TXOA 1YZXA 4HJMA 2MMAA 1X5DA 1A0RP 3ISOA 2FGXA 4FQUA 3ME7A 1T3BA 3GKNA 3M9KA 5DJLA 1ERVA 2H8LA 3FMWA 2WGRA 2EIRA 3IV4A 3WT1A 2H0GA 4HQSA 5LNKe 4F03A 3DXBA 5CRHA 1ZGNA 2VLVA 5F06A 2FA8A 2O8VB 2AV4A 3FRCA 1UN2A 5D93A 2H1AA 1JLVA 2PU9C 4IQAA 2MMOA 1X5CA 2IL3A 1ERTA 3U6VA 1N8JA 1ERWA 4I6XA 1BAYA 1M3IA 4BIKA 2GSSA 2YN1A 1QFNA 1UVZA 2B5YA 4PUAA 5G5EA 3R2QA 3IOSA 4HEA2 1TOFA 2G2QA 2XBIA 3UVTA 4BL7B 4MJAA 4GQCA 4OFNA 1BYEA 2A4VA 2V2GA 9GSSA 2I3YA 2H76A 1TRVA 2TRCP 4A5PA 4MK3A 2VIMA 3GN3A 3BJ5A 3GH6A 3LYKA 3H93A 5J9CA 3ZMKA 5IO0A 3TJGA 2H19A 3TDGA 4EO3A 4YAVA 1WPIA 8GSSA 2E7PA 2B3SA 5DALB 1JZOA 3TB2A 1PSQA 4EKZA 2FA4A 2DJKA 2YZHA 3CSIA 4EXJA 1Z6MA 1U3IA 5IOWA 3F9UA 2JU5A 4K0GA 3D5JA 1YEPA 1K0BA 1LU4A 2HYXA 2RLIA 3HKRA 5ECHB 2FNOA 3GL3A 1X0RA 1C72A 5KEJA 1A23A 2LRTA 2H01A 4NHWA 4WETA 1WJKA 2B6MA 2R3XA 2VD1A 2VUPA 3W6GA 16GSA 4KGIA 3VWUA 1N2AA 3QAWA 2C3NA 2OE3A 4TOPA 1F6MC 1XXUA 4JR4A 4K6XA 2XPDA 3E9JB 1AW9A 4ZB9A 2MMNA 2YPMA 2AUVA 2HNLA 1SENA 3TRQA 2LQOA 3KH7A 3LSZA 4FIWA 1SD9A 2E2GA 1H4OA 3ME8A 5A4WA 3L0HA 1A8YA 3M3MA 4JZQA 3KJYA 5G31A 3FR6A 1WP0A 2GS3A 2LNTA 3GKMA 4ZL8A 4K7OA 2J9HA 1JLWA 2CAIA 3D4MA 4MJEA 1HNBA 4NWYA 3GTUB 1Q98A 4JU5A 4EUYA 1KNGA 4ULXA 2LRCA 3ZLPA 3HD5A 2F51A 2VCQA 4JR6A 1GTBA 2L6DA 3HJOA 2V6OA 3FYGA 5ECQB 1XZOA 3TKRA 3U5RE 1XW5A 3LJRA 3GA4A 3UIWA 4WKWA 1QMVA 5KOWA 3BCIA 3MIXA 2YWNA 5HR0A 4YQVA 4MF5A 1YEXA 3MAKA 2H70A 1SL0B 4MMMA 3JCML 3HVSA 1WE0A 2LUSA 2CVBA 5L71A 4OWYA 2QKEA 4OMVA 2PVQA 2KP2A 1Q4JA 2WULA 4KH7A 5GSTA 1GNEA 3FZ5A 1NHOA 1O8WA 3L9UA 3TJKA 1V98A 2B7JA 3N5OA 4MABA 3G7IA 4P3YB 3GMFA 1O85A 4V2MA 1SD8A 2MBTA 4GLTA 2JZTA 3KMNA 1B48A 1IYHA 1SJZA 11GSA 2FLSA 1XIYA 3GKXA 3IK7A 3DWVA 1PL2A 1HNAA 3FW2A 1XWGA 1W4VA 2IIYA 3ED3A 1SJ6A 4HOJA 4K5RA 3P8WA 3DVXA 5ECSA 3KTBA 1TU7A 2OE0A 1G7OA 2H0HA 4OO4A 4I5QA 3HDCA 1WWJA 1R26A 1OKTA 2EIQA 4H86A 3NZNA 2DLXA 6GSWA 5CP1A 3TOTA 5HFIA 4ID0A 4HJ2A 4G0KA 1QXHA 2YWMA 5KN0A 4KCEA 2FCHA 3EVIA 2OBKA 1SKRB 1U3AA 5IMCA 3P2AA 4F0BA 1K0DA 3PINA 3EU4A 1OC9B 5IO2A 1K0OA 1DSBA 1XOBA 1SYXA 1GNWA 1K3YA 4HUAA 1NSWA 1PQNA 2GZPA 5F0GA 2L59A 1GTIA 2OA7A 1YKAA 2DIYA 4K2DA 4N10A 5ABRA 4N0ZA 3KH9A 1U6TA 4XRDA 4MZBA 2WRTA 4LL1B 2ZCTA 1MD4A 4I97A 4FYBA 3LQ7A 3W8JA 1TKDB 2YANA 3SWLA 3FR9A 3MSZA 5FHIA 5AIVA 4WXTA 4KW6A 1W89A 2VCVA 4IS0A 2VCTA 1BG5A 5CNWA 2VCZA 2GT6A 4KF9A 1HQOA 1SL1B 3IPZA 4YQMA 3AY8A 3TJJA 2GT5A 2A4HA 4IW9A 2DJ2A 1O8XA 1T4YA 2JSZA 5CREA 2D2ZA 2H74A 2CAQA 2YCDA 3LORA 1JZWA 2F3MA 3HZ4A 2VLTA 2DMMA 1RQMA 3M9JA 5EY6A 3I43A 4HZ2A 3IDVA 3ERFA 4PURA 3DVWA 4TVEA 2GSRA 13GSA 4G10A 4CW9A 1EGOA 2CT6A 2CZ3A 2HRAA 4O32A 4KSMA 3LEFA 3O3TA 1A2JA 2HE3A 1VF2A 3GHAA 3LYPA 2VD0A 5ELAA 3FY7A 2JZSA 2BMXA 2N5FA 1BX9A 2ON5A 3N9JA 1TRSA 1VF1A 3TKPA 4HDEA 1VGLA 4ZBDA 4IJ3A 1MD3A 1S3RA 3GX8A 4CDOA 4HU9A 3QDNA 1GRXA 1M2DA 1GUKA 2X4AA 1TW9A 5AN1A 4I2TA 4MDCA 2C3QA 2PGTA 3M8NA 2YV9A 6GSUA 1TRUA 2B5XA 2O85A 4BVXB 3VK9A 4HZ4A 2H0IA 3CTGA 3MDKA 4IQ1A 4ZILA 4BVYA 2FWHA 5KN2A 5B6MA 1S3AA 5ENUA 4G0LA 3V1WA 4KB3A 3WD6A 3M1GA 3HY2A 3F6DA 3UARA 5ECOB 4NXIA 5IQYA 3DYRA 1A2LA 4EE0A 2IN3A 1AAZA 1G6YA 1AC1A 1ZYPA 4V1Ap 4ECBA 2ZNMA 2X8GA 3D4TA 1EP8A 2M80A 3GURA 1F3AA 1ZYEA 4V2NA 3OR5A 1AQWA 3FZ4A 4GQFA 2PUKC 4TW5A 1ABAA 1O81A 3IXRA 2LSTA 1VRSD 6GSYA 4YKGA 3GSTA 3RHBA 4KA0A 2CZ2A 2N5AA 2P5QA 4X0XA 3CQFA 2OE1A 1XOAA 1M3JA 1J08A 2H73A 3CSHA 4XIHA 4Q5FA 1FAAA 2L5OA 1A0FA 2NPBA 4ICYA 5J41A 4PNGA 3HYPA 3TKSA 5HR2A 2J23A 4ISDA 2FWEA 2EC4A 5IMZA 4V2LA 1SJIA 1K3LA
chains in the Genus database with same CATH topology
1GH2A 2HLSA 3WT2A 2PPTA 3LWAA 14GSA 2A2RA 3FEUA 1GSDA 2GZZA 4D73B 5F07A 2QGVA 5DJMA 3C1RA 3F3RA 1QGVA 2JACA 2L5LA 4PQHA 4MF7A 1MDKA 5IMVA 1PN9A 3KXOA 4WF4A 2OBIA 3F4RA 1R5PA 1SK2A 2F8FA 1M99A 1OAZA 3EU3A 3D21A 3EE2A 1B8XA 4ZIJA 4WF5A 1ON4A 1ST9A 3GYKA 3DD3A 4K5SA 5IM9A 3C7MA 4KUNA 2LTKA 1PD21 2C1YA 4GSSA 3RHCA 5ID2A 3ZVJD 4F0CA 4RI7A 7GSSA 1O7UA 3KCMA 4MPGA 2RUFA 4E8EA 4WBRD 1EOGA 2NDOA 4J2FA 1F9MA 2NVLA 3GUSA 3A5WA 3IBHA 2O7KA 2VL9A 1AIUA 4K9ZA 4RI6A 2GZYA 2IMIA 2AJQB 3LW9A 1EOHA 4AJ6A 4L5LA 3LGCA 4N11A 3DKSA 5HR3A 3QOUA 2MYGA 5G1KA 2H30A 4EL1A 1ZCPA 1EGRA 2WCIA 1YQ1A 2N5BA 4Q5QA 2LQQA 4X4JA 1THOA 2X49A 1FW1A 5EVOA 4G9HA 3QAVA 2L6CA 2FWFA 2H6XA 3G7JA 3BCKA 1V9WA 3GX0A 3KD0A 1FOVA 3KP9A 3J7Yb 2FUG2 1GTAA 1OE8A 2O87A 3HJMA 4OD7A 2ALBA 3I6AA 3ZFLA 1T1VA 3MWHA 2I81A 1MDIA 2I9HA 4PX1A 4WBJA 2H75A 4JE1A 2DKHA 2DMLA 12GSA 5G2ZA 2YOIA 3H8QA 2I1UA 3TOUA 5DAKB 19GSA 1PL1A 2AHEA 2QSIA 4EVMA 2YP6A 1OC8A 5ELGA 2DC5A 5A4UA 4TR0A 5KOXA 2OACA 2A2PA 5EPFA 1SYRA 3ZREA 1JHBA 1WRYA 2C3TA 2BTOT 3Q18A 1RK4A 1XWCA 5EL8A 2C80A 2R0GA 3BBYA 3CMIA 1PMTA 3ERWA 4TR1A 5IMDA 4WEYA 5ECIB 2AYTA 1B9YC 3A2XA 4MJCA 4POLA 5GAND 3C71A 4K0NA 3CBUA 4CHSA 1PGTA 1YF1A 22GSA 4PGTA 4RQXA 20GSA 4CY8A 5ECMB 3ZIVA 1GULA 2JL4A 2XPEA 5IIZA 5IMFA 4G19A 4KDUA 4XS4B 4POKA 4MCUA 4DEJA 1G0TA 2AB6A 3P7XA 3O76A 3GH9A 3HVVA 1X9MB 1V57A 2TRXA 2B1LA 1GSSA 1HNCA 2YZUA 1KTEA 3FR3A 2F8AA 3LXTA 3F6FA 2C0GA 10GSA 2LJRA 4TR4A 3VWWA 3WGDA 1FB6A 2IFQB 3WYWA 1ML6A 1K3OA 5DQYA 3A3TA 5ECRB 4K7IA 3ZL5A 2PVOC 1GTUA 5GSSA 2L4QA 3I9V2 3TRPA 4BVYB 1PA3A 3VWVA 3UAPA 2OKAA 3HXSA 18GSA 3US3A 1M2AA 3E3EA 3KEBA 2C0DA 4BWQA 4OCEA 1O6JA 4G2EA 2HZEB 1K0MA 4BL7A 1QQ2A 2NBSA 4X43A 3FHKA 4F9ZA 4IP6A 3K8NA 4EF0A 1GUHA 3GV1A 4FYUA 4PUFC 2R37A 1I9DA 3G7YA 4EDYA 1EV4A 2LJKA 2NTOA 4GXZA 3NOFA 3CRUA 4L0UA 3LG6A 5E4WA 1BEDA 5D96A 4IJIA 2K8SA 2QC7A 2GQKA 5DALA 2K18A 1PX6A 4PXOA 4N0VA 3C8EA 1A2MA 5INYA 1M9BA 3TJFA 3QFBC 4TXOB 4N30A 1ZMAA 6GSSA 1GLQA 2KP1A 2V41A 4BWSA 2X99A 2WZ9A 1LJRA 4IP1A 1PKZA 3EURA 4WR5A 2DSAA 4HU7A 3ZIJA 3IK9A 4Z7XA 1XBSA 4GRFA 4RQRA 2REMA 3F63A 2IPAA 4L8EA 1URMA 4F2IA 3TUEA 3G9BA 2GQMA 2P31A 4J56E 4O5QA 1Z7RA 3MNGA 4HQZA 3M0FA 2H1DA 4ACSA 3ZFBA 2YJHA 1EEMA 3R3EA 1K0CA 2GSQA 2H72A 4XTSA 5BRTA 5JCGA 4V1Ag 1DE1A 4MH2A 5JWOB 1AQXA 4JBBA 2L4CA 2PBJA 1JZDA 2K8VA 5DDLA 5HQPA 2FD3A 2R0CA 2VOCA 4O5UA 3UBLA 1BJXA 1OVNA 1ZZYA 1A8LA 1TRWA 5D73A 1Z3EA 2QA1A 4XRAA 1R5AA 3DRNA 4DVCA 3DEXA 3IAS2 4PQIA 2VL3A 5H5QA 5CRGA 5HFGA 1KEBA 1T4ZA 2HRKA 5C04A 1BQ7A 2HSYA 3C1SA 3PGTA 4CY6A 2HSMA 1MDJA 4GSNA 4DSSA 4BA7A 5JWQB 3QD9A 1NHYA 5DCHA 2XBQA 3LXZA 5JCUA 4QL7A 3GKKA 3IC4A 4BPYA 2DJJA 1TK8B 4POBA 4JRRA 3EMXA 3A2VA 2XHFA 4MA9A 3FZAA 1YY7A 1V58A 4IBPA 1M9AA 1FVKA 3ZRDA 2LJAA 1DE2A 4NHZA 2JZRA 3S9FA 1YDKA 2VO4A 5GZZB 1ZYNA 4ZXGA 3IHGA 1TDIA 2IWTA 1TJDA 4MP4A 3E0UA 4TKYA 3HJPA 1S3DA 4ML6A 3KP8A 4QL9A 5IPHA 2WDUA 4YH2A 4KDYA 3UVHA 4EC0A 3HZ8A 5IPGA 2VL2C 4DSQA 1NM3A 3F3QA 4FH8A 3L78A 4KCAA 1FG4A 1G7EA 3C73A 5LD0A 6GSXA 4L5OA 1XW6A 2VM1A 4K1FA 2TIRA 4MNNA 2CA8A 1H75A 1GUMA 1B4PA 1PRXA 2FY6A 3IAM2 3KM6A 3TKQA 1LBKA 3F4TA 1XCCA 1QUWA 3L9VA 3WGEA 5J4UA 2H1BA 5IOXA 3CYNA 4AGSA 4J57E 1F3BA 2YWOA 3EWLA 3UMAA 1U88A 2C8UA 2IMKA 3VURA 6GSVA 4HI7A 4XCSA 3TKSC 2DJ1A 1ZYQB 3HVXA 2UZ8A 3UOMA 2JADA 3A2WA 2Z9SA 1GP1A 1VF3A 2H71A 4KSOA 2LV3A 3UL3A 4WR4A 5AGYA 1KBNA 3FK8A 5C00A 1U87A 1TK0B 4ZL9A 2A2SA 5KN1A 3VPQA 2KLXA 3KGKA 4GCIA 3TRXA 2GLRA 3HA9A 1X9SB 2C0FA 3IC8A 2DBCA 3EMPA 1GSFA 2DJ3A 1YKCA 4EIQA 3W8SA 1DBYA 4KX4A 2LRNA 2RUEA 5D9VA 1I5GA 4ML1A 3EC3A 4TR3A 3Q19A 1R4WA 1GSUA 3L9SA 1HYUA 3APQA 1X9WB 1UC7A 1E6BA 3APOA 1MTCA 3PR8A 3UEMA 2LKUA 4TN8A 3ZMLA 2GQLA 3GFKA 2RIIA 2E2MA 3CRTA 4X1UA 3F8UA 4AJ7A 3EPTA 3ZITA 2OADA 2H6ZA 2C0EA 1EV9A 2ON7A 3GRXA 5ECLB 2B7KA 4OCFA 2GVPA 1A24A 2VAFA 2FWGA 3I69A 2PWJA 4L0WA 1GSEA 2R0PA 3Q74A 2EIOA 2CVDA 3P90A 1WIKA 3H79A 2CX3A 5F05A 2DJ0A 4K7NA 2HZFA 4KE3A 1PKWA 4G0IA 3LFLA 3VI5A 1XW9A 3TGZA 5ECKB 1E2YA 1K0AA 1ILOA 1XWKA 3RBTA 3RPPA 1B4QA 1FVJA 2X8HA 4BVXA 2K9FA 5F8BA 1JZRA 1XWAA 2VCXA 4IHUA 4F82A 2IMDA 5J3RA 4HS1A 1FHEA 1HD2A 4IKHA 3L4NA 4K2XA 3GSSA 2JSYA 4ZL7A 2WJUA 1M7TA 5LCZA 1X5EA 4MZCA 5A4VA 5G5FA 3A5IA 4POMA 2PERA 2VCWA 4LA1A 1TP9A 4IVFA 1SK1A 2B5EA 2H1GA 1M2BA 3H1NA 1TI1A 2RM5A 4XS1A 4I8BA 4LLRA 4MH3A 1OKDA 2GDRA 5H5SA 5J9BA 2M46A 2C4JA 1AQVA 1T8EB 4QQ7A 4ECCA 4NV2A 2K6VA 1FO5A 1RW1A 3D6IA 3HCZA 2M72A 2MBSA 1XVQA 3IRAA 4NAXA 2HRFA 3H4KA 3TJBA 1VF4A 4E8HA 5H5RA 3ZYWA 5AIXA 1SU9A 1THXA 3EINA 1CQHA 4DSSB 4LL4B 1ZL9A 5D9TA 4DSRA 3ZTLA 4PTSA 5G1LA 3KZQA 2BJXA 3QFAC 1J9BA 4MJBA 1TK5B 4D73A 2V1MA 2DKIA 5CYYA 3PPUA 3IE3A 3UJ1A 1WOUA 3D22A 2CX4A 5B8BA 4O7HA 3DIEA 2B1KA 1UA5A 3EYTA 2LNSA 5E59A 2IMEA 3IR4A 1GLPA 2QA2A 4FYCA 1EEJA 1Z5YE 1PN0A 5DCGA 4OO5A 3J7Yk 5AISA 4Z2UA 3IHQA 3QCPA 2P5RA 5A5KA 1CQGA 3VLNA 4KAEA 5COHA 1AUCA 2G0FA 5ECNB 1B9XC 2WFCA 1SL2B 4PQ1A 4IELA 3TKSE 1XWBA 4AF2A 2LS5A 3QPMA 1EP7A 2AAWA 2X64A 2HXKA 4GTUA 4MF6A 2XC2A 2F9SA 2YV7A 1IYIA 1GSYA 4YKFA 3DMLA 2V6KA 5B6NA 5JCWA 5CO3A 17GSA 4ZBAA 4MZWA 1FB0A 4ECJA 5J5NA 4AJ8A 1Z9HA 1TI3A 1XFLA 1YJ6A 1T00A 2LEGA 4K8MA 1TTZA 4ZB8A 2H6YA 5HFKA 1Z6NA 2KHPA 2CVKA 3DGQA 3BD2A 4USSA 1EZKA 2KOKA 1O73A 1WMJA 5FT3A 3VWXA 5D9XA 4GSTA 1SK0A 2I4AA 2HRNA 4JEDA 2WS2A 4ZB6A 3KIJA 1F2EA 1F37A 2PN8A 3RAZA 5HR1A 4KDXA 4YQUA 1TU8A 3MYDA 5G30A 3F4SA 3CSJA 2RM6A 4I2UA 4XHMA 4O92A 3QAGA 3GNJA 5DAKA 1M0UA 1YF0A 2VM2A 4LMWA 3IA1A 5ID2B 1OE7A 2OJLA 1G6WA 3CXGA 1GSQA 2R2JA 2R5GA 5D9WA 4IGJA 2PMTA 4PNFA 3GL5A 3GTUA 4Z2RA 3TCOA 3BOAA 5KN3A 5IMAA 4Q5NA 1MEKA 3HHVA 4XS6A 5CRWA 1ERUA 2KUCA 4NMUA 1NW2A 3CTFA 2GSTA 3APSA 2YNXA 3RPNA 1J0FA 4ILFA 1SKSB 2E0QA 1QK8A 2HI7A 2DIZA 5DBQA 4NV5A 4XS4A 4MPFA 2CQ9A 2IMFA 1V2AA 3O6TA 3VI7A 3D0ZA 2YWIA 1K0NA 4OFMA 4IN0A 5FWGA 4GF0A 4Z2TA 2FHEA 1GWCA 5JWRB 2P0GA 4FO5A 2O89A 4EDZA 4EIPA 3VPTA 1OC3A 1XVWA 4LMVA 2VLUA 1Y25A 2ES7A 2IFQA 1PX7A 5D8IA 1Y6EA 4MLYA 1EWXA 4OFTA 2L57A 5CAXA 1R7HA 4O5RA 2H66A 3KTLA 6GSTA 1USBA 1AXDA 3PH9A 3UBKA 1GL8A 4NPBA 2HFDA 3Q6OA 4RUVA 3FKFA 4YAPA 3ERGA 5DQSA 4KNDA 2ZUPA 1ZOFA 3SBCA 5CRDA 3GIXA 3ZZXA 3VFIA 3WGXA 2HT9A 2X8CA 2GTUA 2GGTA 2VL2A 4GWRA 1OYJA 3QR6A 2CV4A 1S3CA 1DUGA 2HZEA 4ZBBA 3RDWA 2HSHA 4TR1B 2V32A 5GAPD 2MZCA 1Z7PA 3NIVA 1SKWB 4Q5RA 5DVBA 1FOHA 2IJYA 2R6KA 2YJ7A 4TRXA 3ZVJA 4ECIA 5BMUA 1T7PB 5B7CA 2R4VA 1XPVA 5B8AA 3KMOA 1JFUA 5ECPB 1OC9A 3FZ9A 1ACVA 4TXVA 1V40A 1TXXA 2WB9A 2MMZA 3QMXA 3F0IA 4TXOA 1YZXA 4HJMA 2MMAA 1X5DA 1A0RP 3ISOA 2FGXA 4FQUA 3ME7A 1T3BA 3GKNA 3M9KA 5DJLA 1ERVA 2H8LA 3FMWA 2WGRA 2EIRA 3IV4A 3WT1A 2H0GA 4HQSA 5LNKe 4F03A 3DXBA 5CRHA 1ZGNA 2VLVA 5F06A 2FA8A 2O8VB 2AV4A 3FRCA 1UN2A 5D93A 2H1AA 1JLVA 2PU9C 4IQAA 2MMOA 1X5CA 2IL3A 1ERTA 3U6VA 1N8JA 1ERWA 4I6XA 1BAYA 2GSSA 2YN1A 1QFNA 1UVZA 2B5YA 4PUAA 5G5EA 3R2QA 3IOSA 4HEA2 1TOFA 2G2QA 2XBIA 3UVTA 4BL7B 4MJAA 4GQCA 4OFNA 1BYEA 2A4VA 2V2GA 9GSSA 2I3YA 2H76A 1TRVA 2TRCP 4A5PA 4MK3A 2VIMA 3GN3A 3BJ5A 3GH6A 3LYKA 3H93A 5J9CA 3ZMKA 5IO0A 3TJGA 2H19A 3TDGA 4EO3A 4YAVA 1WPIA 8GSSA 2E7PA 2B3SA 5DALB 1JZOA 3TB2A 1PSQA 4EKZA 2FA4A 2DJKA 2YZHA 3CSIA 4EXJA 1Z6MA 1U3IA 5IOWA 3F9UA 2JU5A 4K0GA 3D5JA 1YEPA 1K0BA 1LU4A 2HYXA 2RLIA 3HKRA 5ECHB 2FNOA 3GL3A 1X0RA 1C72A 5KEJA 1A23A 2LRTA 2H01A 4NHWA 4WETA 1WJKA 2B6MA 2R3XA 2VD1A 2VUPA 3W6GA 16GSA 4KGIA 3VWUA 1N2AA 3QAWA 2C3NA 2OE3A 4TOPA 1F6MC 1XXUA 4JR4A 4K6XA 2XPDA 3E9JB 1AW9A 4ZB9A 2MMNA 2YPMA 2AUVA 2HNLA 1SENA 3TRQA 2LQOA 3KH7A 3LSZA 4FIWA 1SD9A 2E2GA 1H4OA 3ME8A 5A4WA 3L0HA 1A8YA 3M3MA 4JZQA 3KJYA 5G31A 3FR6A 1WP0A 2GS3A 2LNTA 3GKMA 4ZL8A 4K7OA 2J9HA 1JLWA 2CAIA 3D4MA 4MJEA 1HNBA 4NWYA 3GTUB 1Q98A 4JU5A 4EUYA 1KNGA 4ULXA 2LRCA 3ZLPA 3HD5A 2F51A 2VCQA 4JR6A 1GTBA 2L6DA 3HJOA 2V6OA 3FYGA 5ECQB 1XZOA 3TKRA 3U5RE 1XW5A 3LJRA 3GA4A 3UIWA 4WKWA 1QMVA 5KOWA 3BCIA 3MIXA 2YWNA 5HR0A 4YQVA 4MF5A 1YEXA 3MAKA 2H70A 1SL0B 4MMMA 3JCML 3HVSA 1WE0A 2LUSA 2CVBA 5L71A 4OWYA 2QKEA 4OMVA 2PVQA 2KP2A 1Q4JA 2WULA 4KH7A 5GSTA 1GNEA 3FZ5A 1NHOA 1O8WA 3L9UA 3TJKA 1V98A 2B7JA 3N5OA 4MABA 3G7IA 4P3YB 3GMFA 1O85A 4V2MA 1SD8A 2MBTA 4GLTA 2JZTA 3KMNA 1B48A 1IYHA 1SJZA 11GSA 2FLSA 1XIYA 3GKXA 3IK7A 3DWVA 1PL2A 1HNAA 3FW2A 1XWGA 1W4VA 2IIYA 3ED3A 1SJ6A 4HOJA 4K5RA 3P8WA 3DVXA 5ECSA 3KTBA 1TU7A 2OE0A 1G7OA 2H0HA 4OO4A 4I5QA 3HDCA 1WWJA 1R26A 1OKTA 2EIQA 4H86A 3NZNA 2DLXA 6GSWA 5CP1A 3TOTA 5HFIA 4ID0A 4HJ2A 4G0KA 1QXHA 2YWMA 5KN0A 4KCEA 2FCHA 3EVIA 2OBKA 1SKRB 1U3AA 5IMCA 3P2AA 4F0BA 1K0DA 3PINA 3EU4A 1OC9B 5IO2A 1K0OA 1DSBA 1XOBA 1SYXA 1GNWA 1K3YA 4HUAA 1NSWA 1PQNA 2GZPA 5F0GA 2L59A 1GTIA 2OA7A 1YKAA 2DIYA 4K2DA 4N10A 5ABRA 4N0ZA 3KH9A 1U6TA 4XRDA 4MZBA 2WRTA 4LL1B 2ZCTA 1MD4A 4I97A 4FYBA 3LQ7A 3W8JA 1TKDB 2YANA 3SWLA 3FR9A 3MSZA 5FHIA 5AIVA 4WXTA 4KW6A 1W89A 2VCVA 4IS0A 2VCTA 1BG5A 5CNWA 2VCZA 2GT6A 4KF9A 1HQOA 1SL1B 3IPZA 4YQMA 3AY8A 3TJJA 2GT5A 2A4HA 4IW9A 2DJ2A 1O8XA 1T4YA 2JSZA 5CREA 2D2ZA 2H74A 2CAQA 2YCDA 3LORA 1JZWA 2F3MA 3HZ4A 2VLTA 2DMMA 1RQMA 3M9JA 5EY6A 3I43A 4HZ2A 3IDVA 3ERFA 4PURA 3DVWA 4TVEA 2GSRA 13GSA 4G10A 4CW9A 1EGOA 2CT6A 2CZ3A 2HRAA 4O32A 4KSMA 3LEFA 3O3TA 1A2JA 2HE3A 1VF2A 3GHAA 3LYPA 2VD0A 5ELAA 3FY7A 2JZSA 2BMXA 2N5FA 1BX9A 2ON5A 3N9JA 1TRSA 1VF1A 3TKPA 4HDEA 1VGLA 4ZBDA 4IJ3A 1MD3A 3GX8A 4CDOA 4HU9A 3QDNA 1GRXA 1M2DA 1GUKA 2X4AA 1TW9A 5AN1A 4I2TA 4MDCA 2C3QA 2PGTA 3M8NA 2YV9A 6GSUA 1TRUA 2B5XA 2O85A 4BVXB 3VK9A 4HZ4A 2H0IA 3CTGA 3MDKA 4IQ1A 4ZILA 4BVYA 2FWHA 5KN2A 5B6MA 1S3AA 5ENUA 4G0LA 3V1WA 4KB3A 3WD6A 3M1GA 3HY2A 3F6DA 3UARA 5ECOB 4NXIA 5IQYA 3DYRA 1A2LA 4EE0A 2IN3A 1AAZA 1G6YA 1AC1A 1ZYPA 4V1Ap 4ECBA 2ZNMA 2X8GA 3D4TA 1EP8A 2M80A 3GURA 1F3AA 1ZYEA 4V2NA 3OR5A 1AQWA 3FZ4A 4GQFA 2PUKC 4TW5A 1ABAA 1O81A 3IXRA 2LSTA 1VRSD 6GSYA 4YKGA 3GSTA 3RHBA 4KA0A 2CZ2A 2N5AA 2P5QA 4X0XA 2OE1A 1XOAA 1J08A 2H73A 3CSHA 4XIHA 4Q5FA 1FAAA 2L5OA 1A0FA 2NPBA 4ICYA 5J41A 4PNGA 3HYPA 3TKSA 5HR2A 2J23A 4ISDA 2FWEA 2EC4A 5IMZA 4V2LA 1SJIA 1K3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GH2 A;  2HLS A;  3WT2 A;  2PPT A;  3LWA A;  14GS A;  2A2R A;  3FEU A;  1GSD A;  2GZZ A;  4D73 B;  5F07 A;  2QGV A;  5DJM A;  3C1R A;  3F3R A;  1QGV A;  2JAC A;  2L5L A;  4PQH A;  4MF7 A;  1MDK A;  5IMV A;  1PN9 A;  3KXO A;  4WF4 A;  2OBI A;  3F4R A;  1R5P A;  1SK2 A;  2F8F A;  1M99 A;  1OAZ A;  3EU3 A;  3D21 A;  3EE2 A;  1B8X A;  4ZIJ A;  4WF5 A;  1ON4 A;  1ST9 A;  3GYK A;  3DD3 A;  5IM9 A;  3C7M A;  4KUN A;  2LTK A;  1PD2 1;  2C1Y A;  4GSS A;  3RHC A;  5ID2 A;  3ZVJ D;  4F0C A;  4RI7 A;  7GSS A;  1O7U A;  3KCM A;  4MPG A;  2RUF A;  4E8E A;  4WBR D;  1EOG A;  2NDO A;  4J2F A;  1F9M A;  2NVL A;  3GUS A;  3A5W A;  3IBH A;  2O7K A;  2VL9 A;  1AIU A;  4K9Z A;  4RI6 A;  2GZY A;  2IMI A;  2AJQ B;  1EOH A;  4AJ6 A;  4L5L A;  3LGC A;  4N11 A;  3DKS A;  5HR3 A;  3QOU A;  2MYG A;  5G1K A;  2H30 A;  4EL1 A;  1ZCP A;  1EGR A;  2WCI A;  1YQ1 A;  2N5B A;  4Q5Q A;  2LQQ A;  1THO A;  1FW1 A;  5EVO A;  4G9H A;  3QAV A;  2L6C A;  2FWF A;  2H6X A;  3G7J A;  3BCK A;  1V9W A;  3GX0 A;  3KD0 A;  1FOV A;  3KP9 A;  3J7Y b;  2FUG 2;  1GTA A;  1OE8 A;  2O87 A;  3HJM A;  4OD7 A;  2ALB A;  3I6A A;  3ZFL A;  1T1V A;  3MWH A;  2I81 A;  1MDI A;  2I9H A;  4PX1 A;  4WBJ A;  2H75 A;  4JE1 A;  2DML A;  12GS A;  5G2Z A;  2YOI A;  3H8Q A;  2I1U A;  3TOU A;  5DAK B;  19GS A;  1PL1 A;  2AHE A;  2QSI A;  4EVM A;  2YP6 A;  1OC8 A;  5ELG A;  2DC5 A;  5A4U A;  4TR0 A;  2OAC A;  5EPF A;  1SYR A;  3ZRE A;  1JHB A;  1WRY A;  2C3T A;  2BTO T;  3Q18 A;  1RK4 A;  1XWC A;  5EL8 A;  2C80 A;  3BBY A;  3CMI A;  1PMT A;  3ERW A;  4TR1 A;  5IMD A;  4WEY A;  5ECI B;  2AYT A;  1B9Y C;  3A2X A;  4MJC A;  4POL A;  5GAN D;  3C71 A;  4K0N A;  3CBU A;  4CHS A;  1PGT A;  1YF1 A;  22GS A;  4PGT A;  4RQX A;  20GS A;  5ECM B;  3ZIV A;  1GUL A;  2JL4 A;  2XPE A;  5IIZ A;  5IMF A;  4G19 A;  4KDU A;  4XS4 B;  4POK A;  4MCU A;  4DEJ A;  1G0T A;  2AB6 A;  3P7X A;  3O76 A;  3GH9 A;  3HVV A;  1X9M B;  1V57 A;  2TRX A;  2B1L A;  1GSS A;  1HNC A;  2YZU A;  1KTE A;  3FR3 A;  2F8A A;  3LXT A;  3F6F A;  2C0G A;  10GS A;  2LJR A;  4TR4 A;  3VWW A;  3WGD A;  1FB6 A;  2IFQ B;  3WYW A;  1ML6 A;  1K3O A;  5DQY A;  3A3T A;  5ECR B;  4K7I A;  3ZL5 A;  2PVO C;  1GTU A;  5GSS A;  2L4Q A;  3I9V 2;  3TRP A;  1PA3 A;  3VWV A;  3UAP A;  2OKA A;  3HXS A;  18GS A;  3US3 A;  1M2A A;  3E3E A;  3KEB A;  2C0D A;  4BWQ A;  4OCE A;  1O6J A;  4G2E A;  2HZE B;  1K0M A;  4BL7 A;  1QQ2 A;  2NBS A;  4X43 A;  3FHK A;  4F9Z A;  4IP6 A;  3K8N A;  4EF0 A;  1GUH A;  3GV1 A;  4FYU A;  4PUF C;  2R37 A;  1I9D A;  3G7Y A;  4EDY A;  1EV4 A;  2LJK A;  2NTO A;  4GXZ A;  3NOF A;  3CRU A;  4L0U A;  3LG6 A;  5E4W A;  1BED A;  5D96 A;  4IJI A;  2K8S A;  2QC7 A;  2GQK A;  5DAL A;  2K18 A;  1PX6 A;  4PXO A;  4N0V A;  3C8E A;  1A2M A;  5INY A;  1M9B A;  3TJF A;  3QFB C;  4TXO B;  4N30 A;  1ZMA A;  6GSS A;  1GLQ A;  2KP1 A;  2V41 A;  4BWS A;  2X99 A;  2WZ9 A;  1LJR A;  4IP1 A;  1PKZ A;  3EUR A;  4WR5 A;  2DSA A;  4HU7 A;  3ZIJ A;  3IK9 A;  4Z7X A;  1XBS A;  4GRF A;  4RQR A;  2REM A;  3F63 A;  2IPA A;  4L8E A;  1URM A;  4F2I A;  3TUE A;  3G9B A;  2GQM A;  2P31 A;  4J56 E;  1Z7R A;  3MNG A;  4HQZ A;  3M0F A;  2H1D A;  4ACS A;  3ZFB A;  2YJH A;  1EEM A;  1K0C A;  2GSQ A;  2H72 A;  4XTS A;  5JCG A;  4V1A g;  1DE1 A;  4MH2 A;  5JWO B;  1AQX A;  4JBB A;  2L4C A;  2PBJ A;  1JZD A;  2K8V A;  5DDL A;  5HQP A;  2FD3 A;  2VOC A;  3UBL A;  1BJX A;  1OVN A;  1ZZY A;  1A8L A;  1TRW A;  5D73 A;  1Z3E A;  4XRA A;  1R5A A;  3DRN A;  4DVC A;  3DEX A;  3IAS 2;  4PQI A;  2VL3 A;  5H5Q A;  5CRG A;  5HFG A;  1KEB A;  1T4Z A;  5C04 A;  1BQ7 A;  2HSY A;  3C1S A;  3PGT A;  1MDJ A;  4GSN A;  4DSS A;  4BA7 A;  5JWQ B;  3QD9 A;  1NHY A;  5DCH A;  2XBQ A;  3LXZ A;  5JCU A;  4QL7 A;  3GKK A;  3IC4 A;  4BPY A;  2DJJ A;  1TK8 B;  4POB A;  4JRR A;  3EMX A;  3A2V A;  2XHF A;  4MA9 A;  3FZA A;  1YY7 A;  1V58 A;  4IBP A;  1M9A A;  1FVK A;  3ZRD A;  2LJA A;  1DE2 A;  4NHZ A;  2JZR A;  3S9F A;  1YDK A;  2VO4 A;  5GZZ B;  4ZXG A;  1TDI A;  2IWT A;  1TJD A;  4MP4 A;  3E0U A;  4TKY A;  3HJP A;  1S3D A;  4ML6 A;  3KP8 A;  4QL9 A;  5IPH A;  2WDU A;  4YH2 A;  4KDY A;  3UVH A;  4EC0 A;  3HZ8 A;  5IPG A;  2VL2 C;  4DSQ A;  1NM3 A;  3F3Q A;  4FH8 A;  3L78 A;  4KCA A;  1FG4 A;  1G7E A;  3C73 A;  5LD0 A;  6GSX A;  4L5O A;  1XW6 A;  2VM1 A;  4K1F A;  2TIR A;  2CA8 A;  1H75 A;  1GUM A;  1B4P A;  1PRX A;  2FY6 A;  3IAM 2;  3KM6 A;  3TKQ A;  1LBK A;  3F4T A;  1XCC A;  1QUW A;  3L9V A;  3WGE A;  5J4U A;  2H1B A;  5IOX A;  3CYN A;  4AGS A;  4J57 E;  1F3B A;  2YWO A;  3EWL A;  3UMA A;  1U88 A;  2C8U A;  2IMK A;  3VUR A;  6GSV A;  4HI7 A;  4XCS A;  3TKS C;  2DJ1 A;  1ZYQ B;  3HVX A;  3UOM A;  2JAD A;  3A2W A;  2Z9S A;  1GP1 A;  1VF3 A;  2H71 A;  4KSO A;  2LV3 A;  3UL3 A;  4WR4 A;  5AGY A;  1KBN A;  3FK8 A;  5C00 A;  1U87 A;  1TK0 B;  4ZL9 A;  2A2S A;  5KN1 A;  3VPQ A;  2KLX A;  3KGK A;  4GCI A;  3TRX A;  2GLR A;  3HA9 A;  1X9S B;  2C0F A;  2DBC A;  3EMP A;  1GSF A;  2DJ3 A;  1YKC A;  1DBY A;  3W8S A;  4KX4 A;  2LRN A;  2RUE A;  5D9V A;  1I5G A;  4ML1 A;  3EC3 A;  4TR3 A;  3Q19 A;  1R4W A;  1GSU A;  3L9S A;  1HYU A;  3APQ A;  1X9W B;  1UC7 A;  1E6B A;  3APO A;  1MTC A;  3PR8 A;  3UEM A;  2LKU A;  4TN8 A;  3ZML A;  2GQL A;  3GFK A;  2RII A;  2E2M A;  3CRT A;  4X1U A;  3F8U A;  4AJ7 A;  3ZIT A;  2OAD A;  2H6Z A;  2C0E A;  1EV9 A;  2ON7 A;  3GRX A;  5ECL B;  2B7K A;  4OCF A;  2GVP A;  1A24 A;  2VAF A;  2FWG A;  3I69 A;  2PWJ A;  4L0W A;  1GSE A;  3Q74 A;  2EIO A;  2CVD A;  3P90 A;  1WIK A;  3H79 A;  2CX3 A;  5F05 A;  2DJ0 A;  4K7N A;  2HZF A;  4KE3 A;  1PKW A;  3LFL A;  3VI5 A;  1XW9 A;  3TGZ A;  5ECK B;  1E2Y A;  1K0A A;  1ILO A;  1XWK A;  3RBT A;  3RPP A;  1B4Q A;  1FVJ A;  2X8H A;  4BVX A;  2K9F A;  5F8B A;  1JZR A;  1XWA A;  2VCX A;  4IHU A;  4F82 A;  2IMD A;  5J3R A;  4HS1 A;  1FHE A;  1HD2 A;  4IKH A;  3L4N A;  3GSS A;  2JSY A;  4ZL7 A;  2WJU A;  1M7T A;  5LCZ A;  1X5E A;  4MZC A;  5A4V A;  5G5F A;  4POM A;  2PER A;  2VCW A;  4LA1 A;  1TP9 A;  4IVF A;  1SK1 A;  2B5E A;  2H1G A;  1M2B A;  3H1N A;  1TI1 A;  2RM5 A;  4XS1 A;  4I8B A;  4LLR A;  4MH3 A;  1OKD A;  2GDR A;  5H5S A;  5J9B A;  2M46 A;  2C4J A;  1AQV A;  1T8E B;  4QQ7 A;  4ECC A;  4NV2 A;  2K6V A;  1FO5 A;  1RW1 A;  3D6I A;  3HCZ A;  2M72 A;  2MBS A;  1XVQ A;  3IRA A;  4NAX A;  2HRF A;  3H4K A;  3TJB A;  1VF4 A;  4E8H A;  5H5R A;  3ZYW A;  5AIX A;  1SU9 A;  1THX A;  3EIN A;  1CQH A;  4DSS B;  4LL4 B;  1ZL9 A;  5D9T A;  4DSR A;  3ZTL A;  5G1L A;  3KZQ A;  2BJX A;  3QFA C;  1J9B A;  4MJB A;  1TK5 B;  4D73 A;  2V1M A;  5CYY A;  3IE3 A;  3UJ1 A;  1WOU A;  3D22 A;  2CX4 A;  5B8B A;  4O7H A;  3DIE A;  2B1K A;  1UA5 A;  3EYT A;  2LNS A;  5E59 A;  2IME A;  3IR4 A;  1GLP A;  4FYC A;  1EEJ A;  1Z5Y E;  5DCG A;  4OO5 A;  3J7Y k;  5AIS A;  3IHQ A;  3QCP A;  2P5R A;  5A5K A;  1CQG A;  3VLN A;  4KAE A;  5COH A;  1AUC A;  2G0F A;  5ECN B;  1B9X C;  2WFC A;  1SL2 B;  4PQ1 A;  4IEL A;  3TKS E;  1XWB A;  4AF2 A;  2LS5 A;  3QPM A;  1EP7 A;  2AAW A;  2X64 A;  2HXK A;  4GTU A;  4MF6 A;  2XC2 A;  2F9S A;  2YV7 A;  1IYI A;  1GSY A;  3DML A;  2V6K A;  5B6N A;  5JCW A;  5CO3 A;  17GS A;  4ZBA A;  4MZW A;  1FB0 A;  4ECJ A;  5J5N A;  4AJ8 A;  1Z9H A;  1TI3 A;  1XFL A;  1YJ6 A;  1T00 A;  2LEG A;  4K8M A;  1TTZ A;  4ZB8 A;  2H6Y A;  5HFK A;  1Z6N A;  2KHP A;  2CVK A;  3DGQ A;  3BD2 A;  1EZK A;  2KOK A;  1O73 A;  1WMJ A;  5FT3 A;  3VWX A;  5D9X A;  4GST A;  1SK0 A;  2I4A A;  2HRN A;  4JED A;  2WS2 A;  4ZB6 A;  3KIJ A;  1F2E A;  1F37 A;  2PN8 A;  3RAZ A;  5HR1 A;  4KDX A;  4YQU A;  1TU8 A;  5G30 A;  3F4S A;  3CSJ A;  2RM6 A;  4I2U A;  4XHM A;  4O92 A;  3QAG A;  3GNJ A;  5DAK A;  1M0U A;  1YF0 A;  2VM2 A;  4LMW A;  3IA1 A;  5ID2 B;  1OE7 A;  2OJL A;  1G6W A;  3CXG A;  1GSQ A;  2R2J A;  2R5G A;  5D9W A;  4IGJ A;  2PMT A;  4PNF A;  3GL5 A;  3GTU A;  3TCO A;  3BOA A;  5KN3 A;  5IMA A;  4Q5N A;  1MEK A;  3HHV A;  4XS6 A;  5CRW A;  1ERU A;  2KUC A;  4NMU A;  1NW2 A;  3CTF A;  2GST A;  3APS A;  2YNX A;  3RPN A;  1J0F A;  4ILF A;  1SKS B;  2E0Q A;  1QK8 A;  2HI7 A;  2DIZ A;  5DBQ A;  4NV5 A;  4XS4 A;  4MPF A;  2CQ9 A;  2IMF A;  1V2A A;  3O6T A;  3VI7 A;  3D0Z A;  2YWI A;  1K0N A;  4OFM A;  4IN0 A;  5FWG A;  4GF0 A;  2FHE A;  1GWC A;  5JWR B;  2P0G A;  4FO5 A;  2O89 A;  4EDZ A;  3VPT A;  1OC3 A;  1XVW A;  4LMV A;  2VLU A;  1Y25 A;  2ES7 A;  2IFQ A;  1PX7 A;  5D8I A;  1Y6E A;  4MLY A;  1EWX A;  4OFT A;  2L57 A;  5CAX A;  1R7H A;  4O5R A;  2H66 A;  3KTL A;  6GST A;  1USB A;  1AXD A;  3PH9 A;  3UBK A;  1GL8 A;  4NPB A;  2HFD A;  3Q6O A;  4RUV A;  3FKF A;  4YAP A;  3ERG A;  5DQS A;  4KND A;  2ZUP A;  1ZOF A;  3SBC A;  5CRD A;  3GIX A;  3ZZX A;  3VFI A;  3WGX A;  2HT9 A;  2X8C A;  2GTU A;  2GGT A;  2VL2 A;  4GWR A;  1OYJ A;  3QR6 A;  2CV4 A;  1S3C A;  1DUG A;  2HZE A;  4ZBB A;  3RDW A;  2HSH A;  4TR1 B;  2V32 A;  5GAP D;  2MZC A;  1Z7P A;  3NIV A;  1SKW B;  4Q5R A;  5DVB A;  2IJY A;  2R6K A;  2YJ7 A;  4TRX A;  3ZVJ A;  4ECI A;  1T7P B;  5B7C A;  2R4V A;  1XPV A;  5B8A A;  3KMO A;  1JFU A;  5ECP B;  1OC9 A;  3FZ9 A;  1ACV A;  4TXV A;  1V40 A;  1TXX A;  2WB9 A;  2MMZ A;  3QMX A;  3F0I A;  4TXO A;  1YZX A;  4HJM A;  2MMA A;  1X5D A;  1A0R P;  3ISO A;  2FGX A;  3ME7 A;  1T3B A;  3GKN A;  3M9K A;  5DJL A;  1ERV A;  2H8L A;  2WGR A;  2EIR A;  3IV4 A;  3WT1 A;  2H0G A;  4HQS A;  5LNK e;  4F03 A;  3DXB A;  5CRH A;  1ZGN A;  2VLV A;  5F06 A;  2FA8 A;  2O8V B;  2AV4 A;  3FRC A;  1UN2 A;  5D93 A;  2H1A A;  1JLV A;  2PU9 C;  4IQA A;  2MMO A;  1X5C A;  2IL3 A;  1ERT A;  3U6V A;  1N8J A;  1ERW A;  4I6X A;  1BAY A;  2GSS A;  2YN1 A;  1QFN A;  1UVZ A;  2B5Y A;  4PUA A;  5G5E A;  3R2Q A;  3IOS A;  4HEA 2;  1TOF A;  2G2Q A;  2XBI A;  3UVT A;  4MJA A;  4GQC A;  4OFN A;  1BYE A;  2A4V A;  2V2G A;  9GSS A;  2I3Y A;  2H76 A;  1TRV A;  2TRC P;  4MK3 A;  2VIM A;  3GN3 A;  3BJ5 A;  3GH6 A;  3LYK A;  3H93 A;  5J9C A;  3ZMK A;  5IO0 A;  3TJG A;  2H19 A;  3TDG A;  4EO3 A;  4YAV A;  1WPI A;  8GSS A;  2E7P A;  2B3S A;  5DAL B;  1JZO A;  3TB2 A;  1PSQ A;  4EKZ A;  2FA4 A;  2DJK A;  2YZH A;  3CSI A;  4EXJ A;  1Z6M A;  1U3I A;  5IOW A;  3F9U A;  2JU5 A;  4K0G A;  3D5J A;  1YEP A;  1K0B A;  1LU4 A;  2HYX A;  2RLI A;  3HKR A;  5ECH B;  2FNO A;  3GL3 A;  1X0R A;  1C72 A;  5KEJ A;  1A23 A;  2LRT A;  2H01 A;  4NHW A;  4WET A;  1WJK A;  2B6M A;  2R3X A;  2VD1 A;  2VUP A;  3W6G A;  16GS A;  4KGI A;  3VWU A;  1N2A A;  3QAW A;  2C3N A;  2OE3 A;  4TOP A;  1F6M C;  1XXU A;  4JR4 A;  4K6X A;  2XPD A;  3E9J B;  1AW9 A;  4ZB9 A;  2MMN A;  2YPM A;  2AUV A;  2HNL A;  1SEN A;  3TRQ A;  2LQO A;  3KH7 A;  3LSZ A;  4FIW A;  1SD9 A;  2E2G A;  1H4O A;  3ME8 A;  5A4W A;  3L0H A;  1A8Y A;  3M3M A;  4JZQ A;  3KJY A;  5G31 A;  3FR6 A;  1WP0 A;  2GS3 A;  2LNT A;  3GKM A;  4ZL8 A;  4K7O A;  2J9H A;  1JLW A;  2CAI A;  3D4M A;  4MJE A;  1HNB A;  4NWY A;  3GTU B;  1Q98 A;  4JU5 A;  4EUY A;  1KNG A;  4ULX A;  2LRC A;  3ZLP A;  3HD5 A;  2F51 A;  2VCQ A;  4JR6 A;  1GTB A;  2L6D A;  3HJO A;  2V6O A;  3FYG A;  5ECQ B;  1XZO A;  3TKR A;  3U5R E;  1XW5 A;  3LJR A;  3GA4 A;  3UIW A;  4WKW A;  1QMV A;  3BCI A;  2YWN A;  5HR0 A;  4YQV A;  4MF5 A;  1YEX A;  3MAK A;  2H70 A;  1SL0 B;  4MMM A;  3JCM L;  3HVS A;  1WE0 A;  2LUS A;  2CVB A;  5L71 A;  4OWY A;  2QKE A;  4OMV A;  2PVQ A;  2KP2 A;  1Q4J A;  2WUL A;  4KH7 A;  5GST A;  1GNE A;  3FZ5 A;  1NHO A;  1O8W A;  3L9U A;  3TJK A;  1V98 A;  2B7J A;  3N5O A;  4MAB A;  3G7I A;  4P3Y B;  3GMF A;  1O85 A;  4V2M A;  1SD8 A;  2MBT A;  4GLT A;  2JZT A;  3KMN A;  1B48 A;  1IYH A;  1SJZ A;  11GS A;  2FLS A;  1XIY A;  3GKX A;  3IK7 A;  3DWV A;  1PL2 A;  1HNA A;  3FW2 A;  1XWG A;  1W4V A;  2IIY A;  3ED3 A;  1SJ6 A;  4HOJ A;  3P8W A;  3DVX A;  5ECS A;  3KTB A;  1TU7 A;  2OE0 A;  1G7O A;  2H0H A;  4OO4 A;  4I5Q A;  3HDC A;  1WWJ A;  1R26 A;  1OKT A;  2EIQ A;  4H86 A;  3NZN A;  2DLX A;  6GSW A;  5CP1 A;  3TOT A;  5HFI A;  4ID0 A;  4HJ2 A;  1QXH A;  2YWM A;  5KN0 A;  4KCE A;  2FCH A;  3EVI A;  2OBK A;  1SKR B;  1U3A A;  5IMC A;  3P2A A;  4F0B A;  1K0D A;  3PIN A;  3EU4 A;  1OC9 B;  5IO2 A;  1K0O A;  1DSB A;  1XOB A;  1SYX A;  1GNW A;  1K3Y A;  4HUA A;  1NSW A;  1PQN A;  2GZP A;  5F0G A;  2L59 A;  1GTI A;  2OA7 A;  1YKA A;  2DIY A;  4K2D A;  4N10 A;  5ABR A;  4N0Z A;  3KH9 A;  1U6T A;  4XRD A;  4MZB A;  2WRT A;  4LL1 B;  2ZCT A;  1MD4 A;  4I97 A;  4FYB A;  3LQ7 A;  3W8J A;  1TKD B;  2YAN A;  3SWL A;  3FR9 A;  3MSZ A;  5FHI A;  5AIV A;  4WXT A;  4KW6 A;  1W89 A;  2VCV A;  4IS0 A;  2VCT A;  1BG5 A;  5CNW A;  2VCZ A;  2GT6 A;  1HQO A;  1SL1 B;  3IPZ A;  4YQM A;  3AY8 A;  3TJJ A;  2GT5 A;  4IW9 A;  2DJ2 A;  1O8X A;  1T4Y A;  2JSZ A;  5CRE A;  2D2Z A;  2H74 A;  2CAQ A;  2YCD A;  3LOR A;  1JZW A;  2F3M A;  3HZ4 A;  2VLT A;  2DMM A;  1RQM A;  3M9J A;  5EY6 A;  3I43 A;  4HZ2 A;  3IDV A;  3ERF A;  4PUR A;  3DVW A;  4TVE A;  2GSR A;  13GS A;  4G10 A;  4CW9 A;  1EGO A;  2CT6 A;  2CZ3 A;  4O32 A;  4KSM A;  3LEF A;  3O3T A;  1A2J A;  2HE3 A;  1VF2 A;  3GHA A;  3LYP A;  2VD0 A;  5ELA A;  3FY7 A;  2JZS A;  2BMX A;  2N5F A;  1BX9 A;  2ON5 A;  3N9J A;  1TRS A;  1VF1 A;  3TKP A;  4HDE A;  1VGL A;  4ZBD A;  4IJ3 A;  1MD3 A;  3GX8 A;  4CDO A;  4HU9 A;  3QDN A;  1GRX A;  1M2D A;  1GUK A;  1TW9 A;  5AN1 A;  4I2T A;  4MDC A;  2C3Q A;  2PGT A;  3M8N A;  2YV9 A;  6GSU A;  1TRU A;  2B5X A;  2O85 A;  3VK9 A;  4HZ4 A;  2H0I A;  3CTG A;  3MDK A;  4IQ1 A;  4ZIL A;  4BVY A;  2FWH A;  5KN2 A;  5B6M A;  1S3A A;  5ENU A;  3V1W A;  4KB3 A;  3WD6 A;  3M1G A;  3HY2 A;  3F6D A;  3UAR A;  5ECO B;  4NXI A;  5IQY A;  3DYR A;  1A2L A;  4EE0 A;  2IN3 A;  1AAZ A;  1G6Y A;  1AC1 A;  4V1A p;  4ECB A;  2ZNM A;  2X8G A;  3D4T A;  1EP8 A;  2M80 A;  3GUR A;  1F3A A;  1ZYE A;  4V2N A;  3OR5 A;  1AQW A;  3FZ4 A;  4GQF A;  2PUK C;  4TW5 A;  1ABA A;  1O81 A;  3IXR A;  2LST A;  1VRS D;  6GSY A;  3GST A;  3RHB A;  4KA0 A;  2CZ2 A;  2N5A A;  2P5Q A;  4X0X A;  2OE1 A;  1XOA A;  1J08 A;  2H73 A;  3CSH A;  4XIH A;  4Q5F A;  1FAA A;  2L5O A;  1A0F A;  2NPB A;  5J41 A;  4PNG A;  3HYP A;  3TKS A;  5HR2 A;  2J23 A;  4ISD A;  2FWE A;  2EC4 A;  5IMZ A;  4V2L A;  1SJI A;  1K3L A; 
#chains in the Genus database with same CATH topology
 1GH2 A;  2HLS A;  3WT2 A;  2PPT A;  3LWA A;  14GS A;  2A2R A;  3FEU A;  1GSD A;  2GZZ A;  4D73 B;  5F07 A;  2QGV A;  5DJM A;  3C1R A;  3F3R A;  1QGV A;  2JAC A;  2L5L A;  4PQH A;  4MF7 A;  1MDK A;  5IMV A;  1PN9 A;  3KXO A;  4WF4 A;  2OBI A;  3F4R A;  1R5P A;  1SK2 A;  2F8F A;  1M99 A;  1OAZ A;  3EU3 A;  3D21 A;  3EE2 A;  1B8X A;  4ZIJ A;  4WF5 A;  1ON4 A;  1ST9 A;  3GYK A;  3DD3 A;  4K5S A;  5IM9 A;  3C7M A;  4KUN A;  2LTK A;  1PD2 1;  2C1Y A;  4GSS A;  3RHC A;  5ID2 A;  3ZVJ D;  4F0C A;  4RI7 A;  7GSS A;  1O7U A;  3KCM A;  4MPG A;  2RUF A;  4E8E A;  4WBR D;  1EOG A;  2NDO A;  4J2F A;  1F9M A;  2NVL A;  3GUS A;  3A5W A;  3IBH A;  2O7K A;  2VL9 A;  1AIU A;  4K9Z A;  4RI6 A;  2GZY A;  2IMI A;  2AJQ B;  3LW9 A;  1EOH A;  4AJ6 A;  4L5L A;  3LGC A;  4N11 A;  3DKS A;  5HR3 A;  3QOU A;  2MYG A;  5G1K A;  2H30 A;  4EL1 A;  1ZCP A;  1EGR A;  2WCI A;  1YQ1 A;  2N5B A;  4Q5Q A;  2LQQ A;  4X4J A;  1THO A;  2X49 A;  1FW1 A;  5EVO A;  4G9H A;  3QAV A;  2L6C A;  2FWF A;  2H6X A;  3G7J A;  3BCK A;  1V9W A;  3GX0 A;  3KD0 A;  1FOV A;  3KP9 A;  3J7Y b;  2FUG 2;  1GTA A;  1OE8 A;  2O87 A;  3HJM A;  4OD7 A;  2ALB A;  3I6A A;  3ZFL A;  1T1V A;  3MWH A;  2I81 A;  1MDI A;  2I9H A;  4PX1 A;  4WBJ A;  2H75 A;  4JE1 A;  2DKH A;  2DML A;  12GS A;  5G2Z A;  2YOI A;  3H8Q A;  2I1U A;  3TOU A;  5DAK B;  19GS A;  1PL1 A;  2AHE A;  2QSI A;  4EVM A;  2YP6 A;  1OC8 A;  5ELG A;  2DC5 A;  5A4U A;  4TR0 A;  5KOX A;  2OAC A;  2A2P A;  5EPF A;  1SYR A;  3ZRE A;  1JHB A;  1WRY A;  2C3T A;  2BTO T;  3Q18 A;  1RK4 A;  1XWC A;  5EL8 A;  2C80 A;  2R0G A;  3BBY A;  3CMI A;  1PMT A;  3ERW A;  4TR1 A;  5IMD A;  4WEY A;  5ECI B;  2AYT A;  1B9Y C;  3A2X A;  4MJC A;  4POL A;  5GAN D;  3C71 A;  4K0N A;  3CBU A;  4CHS A;  1PGT A;  1YF1 A;  22GS A;  4PGT A;  4RQX A;  20GS A;  4CY8 A;  5ECM B;  3ZIV A;  1GUL A;  2JL4 A;  2XPE A;  5IIZ A;  5IMF A;  4G19 A;  4KDU A;  4XS4 B;  4POK A;  4MCU A;  4DEJ A;  1G0T A;  2AB6 A;  3P7X A;  3O76 A;  3GH9 A;  3HVV A;  1X9M B;  1V57 A;  2TRX A;  2B1L A;  1GSS A;  1HNC A;  2YZU A;  1KTE A;  3FR3 A;  2F8A A;  3LXT A;  3F6F A;  2C0G A;  10GS A;  2LJR A;  4TR4 A;  1XG8 A;  3VWW A;  3WGD A;  1FB6 A;  2IFQ B;  3WYW A;  1ML6 A;  1K3O A;  5DQY A;  3A3T A;  5ECR B;  4K7I A;  3ZL5 A;  2PVO C;  1GTU A;  5GSS A;  2L4Q A;  3I9V 2;  3TRP A;  4BVY B;  1PA3 A;  3VWV A;  3UAP A;  2OKA A;  3HXS A;  18GS A;  3US3 A;  1M2A A;  3E3E A;  3KEB A;  2C0D A;  4BWQ A;  4OCE A;  1O6J A;  4G2E A;  2HZE B;  1K0M A;  4BL7 A;  1QQ2 A;  2NBS A;  4X43 A;  3FHK A;  4F9Z A;  4IP6 A;  3K8N A;  4EF0 A;  1GUH A;  3GV1 A;  4FYU A;  4PUF C;  2R37 A;  1I9D A;  3G7Y A;  4EDY A;  1EV4 A;  2LJK A;  2NTO A;  4GXZ A;  3NOF A;  3CRU A;  4L0U A;  3LG6 A;  5E4W A;  1BED A;  5D96 A;  4IJI A;  2K8S A;  2QC7 A;  2GQK A;  5DAL A;  2K18 A;  1PX6 A;  4PXO A;  4N0V A;  3C8E A;  1A2M A;  5INY A;  1M9B A;  3TJF A;  3QFB C;  4TXO B;  4N30 A;  1ZMA A;  6GSS A;  1GLQ A;  2KP1 A;  2V41 A;  4BWS A;  2X99 A;  2WZ9 A;  1LJR A;  4IP1 A;  1PKZ A;  3EUR A;  4WR5 A;  2DSA A;  4HU7 A;  3ZIJ A;  3IK9 A;  4Z7X A;  1XBS A;  4GRF A;  4RQR A;  2REM A;  3F63 A;  2IPA A;  4L8E A;  1URM A;  4F2I A;  3TUE A;  3G9B A;  2GQM A;  2P31 A;  4J56 E;  4O5Q A;  1Z7R A;  3MNG A;  4HQZ A;  3M0F A;  2H1D A;  4ACS A;  3ZFB A;  2YJH A;  1EEM A;  1PFO A;  3R3E A;  1K0C A;  2GSQ A;  2H72 A;  4XTS A;  5BRT A;  5JCG A;  4V1A g;  1DE1 A;  4MH2 A;  5JWO B;  1AQX A;  4JBB A;  2L4C A;  2PBJ A;  1JZD A;  2K8V A;  5DDL A;  5HQP A;  2FD3 A;  2R0C A;  2VOC A;  4O5U A;  3UBL A;  1BJX A;  1OVN A;  1ZZY A;  1A8L A;  1TRW A;  5D73 A;  1Z3E A;  2QA1 A;  4XRA A;  1R5A A;  3DRN A;  4DVC A;  3DEX A;  3IAS 2;  4PQI A;  2VL3 A;  5H5Q A;  5CRG A;  5HFG A;  1KEB A;  1T4Z A;  2HRK A;  5C04 A;  1BQ7 A;  2HSY A;  3C1S A;  3PGT A;  4CY6 A;  2HSM A;  1MDJ A;  4GSN A;  4DSS A;  4BA7 A;  5JWQ B;  3QD9 A;  1NHY A;  5DCH A;  2XBQ A;  3LXZ A;  5JCU A;  4QL7 A;  3GKK A;  3IC4 A;  4BPY A;  2DJJ A;  1TK8 B;  4POB A;  4JRR A;  3EMX A;  3A2V A;  2XHF A;  4MA9 A;  3FZA A;  1YY7 A;  1V58 A;  4IBP A;  1M9A A;  1FVK A;  3ZRD A;  2LJA A;  1DE2 A;  4NHZ A;  2JZR A;  3S9F A;  1YDK A;  2VO4 A;  5GZZ B;  1ZYN A;  4ZXG A;  3IHG A;  1TDI A;  2IWT A;  1TJD A;  4MP4 A;  3E0U A;  4TKY A;  3HJP A;  1S3D A;  4ML6 A;  3KP8 A;  4QL9 A;  5IPH A;  2WDU A;  4YH2 A;  4KDY A;  3UVH A;  4EC0 A;  3HZ8 A;  5IPG A;  2VL2 C;  4DSQ A;  1NM3 A;  3F3Q A;  4FH8 A;  3L78 A;  4KCA A;  1FG4 A;  1G7E A;  3C73 A;  5LD0 A;  6GSX A;  4L5O A;  1XW6 A;  2VM1 A;  4K1F A;  2TIR A;  4MNN A;  2CA8 A;  1H75 A;  1GUM A;  1B4P A;  1PRX A;  2FY6 A;  3IAM 2;  3KM6 A;  3TKQ A;  1LBK A;  3F4T A;  1XCC A;  1QUW A;  3L9V A;  3WGE A;  5J4U A;  2H1B A;  5IOX A;  3CYN A;  4AGS A;  4J57 E;  1F3B A;  2YWO A;  3EWL A;  3UMA A;  1U88 A;  2C8U A;  2IMK A;  3VUR A;  6GSV A;  4HI7 A;  4XCS A;  3TKS C;  2DJ1 A;  1ZYQ B;  3HVX A;  2UZ8 A;  3UOM A;  2JAD A;  3A2W A;  2Z9S A;  1GP1 A;  1VF3 A;  2H71 A;  4KSO A;  2LV3 A;  3UL3 A;  4WR4 A;  5AGY A;  1KBN A;  3FK8 A;  5C00 A;  1U87 A;  1TK0 B;  4ZL9 A;  2A2S A;  5KN1 A;  3VPQ A;  2KLX A;  3KGK A;  4GCI A;  3TRX A;  2GLR A;  3HA9 A;  1X9S B;  2C0F A;  3IC8 A;  2DBC A;  3EMP A;  1GSF A;  2DJ3 A;  1YKC A;  4EIQ A;  3W8S A;  1DBY A;  4KX4 A;  2LRN A;  2RUE A;  5D9V A;  1I5G A;  4ML1 A;  3EC3 A;  4TR3 A;  3Q19 A;  1R4W A;  1GSU A;  3L9S A;  1HYU A;  3APQ A;  1X9W B;  1UC7 A;  1E6B A;  3APO A;  1MTC A;  3PR8 A;  3UEM A;  2LKU A;  4TN8 A;  3ZML A;  2GQL A;  3GFK A;  2RII A;  2E2M A;  3CRT A;  4X1U A;  3F8U A;  4AJ7 A;  3EPT A;  3ZIT A;  2OAD A;  2H6Z A;  2C0E A;  1EV9 A;  2ON7 A;  3GRX A;  5ECL B;  2B7K A;  4OCF A;  2GVP A;  1A24 A;  2VAF A;  2FWG A;  3I69 A;  2PWJ A;  4L0W A;  1GSE A;  2R0P A;  3Q74 A;  2EIO A;  2CVD A;  3P90 A;  1WIK A;  3H79 A;  2CX3 A;  5F05 A;  2DJ0 A;  4K7N A;  2HZF A;  4KE3 A;  1PKW A;  4G0I A;  3LFL A;  3VI5 A;  1XW9 A;  3TGZ A;  5ECK B;  1E2Y A;  1K0A A;  1ILO A;  1XWK A;  3RBT A;  3RPP A;  1B4Q A;  1FVJ A;  2X8H A;  4BVX A;  2K9F A;  5F8B A;  1JZR A;  1XWA A;  2VCX A;  4IHU A;  4F82 A;  2IMD A;  5J3R A;  4HS1 A;  1FHE A;  1HD2 A;  4IKH A;  3L4N A;  4K2X A;  3GSS A;  2JSY A;  4ZL7 A;  2WJU A;  1M7T A;  5LCZ A;  1X5E A;  4MZC A;  5A4V A;  5G5F A;  3A5I A;  4POM A;  2PER A;  2VCW A;  4LA1 A;  1TP9 A;  4IVF A;  1SK1 A;  2B5E A;  2H1G A;  1M2B A;  3H1N A;  1TI1 A;  2RM5 A;  4XS1 A;  4I8B A;  4LLR A;  4MH3 A;  1OKD A;  2GDR A;  5H5S A;  5J9B A;  2M46 A;  2C4J A;  1AQV A;  1T8E B;  4QQ7 A;  4ECC A;  4NV2 A;  2K6V A;  1FO5 A;  1RW1 A;  3D6I A;  3HCZ A;  2M72 A;  2MBS A;  1XVQ A;  3IRA A;  4NAX A;  2HRF A;  3H4K A;  3TJB A;  1VF4 A;  4E8H A;  5H5R A;  3ZYW A;  5AIX A;  1SU9 A;  1THX A;  3EIN A;  1CQH A;  4DSS B;  4LL4 B;  1ZL9 A;  5D9T A;  4DSR A;  3ZTL A;  4PTS A;  5G1L A;  3KZQ A;  2BJX A;  3QFA C;  1J9B A;  4MJB A;  1TK5 B;  4D73 A;  2V1M A;  3HVN A;  2DKI A;  5CYY A;  3PPU A;  3IE3 A;  3UJ1 A;  1WOU A;  3D22 A;  2CX4 A;  5B8B A;  4O7H A;  3DIE A;  2B1K A;  1UA5 A;  3EYT A;  2LNS A;  5E59 A;  2IME A;  3IR4 A;  1GLP A;  2QA2 A;  4FYC A;  1EEJ A;  1Z5Y E;  1PN0 A;  5DCG A;  4OO5 A;  3J7Y k;  5AIS A;  4Z2U A;  3IHQ A;  3QCP A;  2P5R A;  5A5K A;  1CQG A;  3VLN A;  4KAE A;  5COH A;  1AUC A;  2G0F A;  5ECN B;  1B9X C;  2WFC A;  1SL2 B;  4PQ1 A;  4IEL A;  3TKS E;  1XWB A;  4AF2 A;  2LS5 A;  3QPM A;  1EP7 A;  2AAW A;  2X64 A;  2HXK A;  4GTU A;  4MF6 A;  2XC2 A;  2F9S A;  2YV7 A;  1IYI A;  1GSY A;  4YKF A;  3DML A;  2V6K A;  5B6N A;  5JCW A;  5CO3 A;  17GS A;  4ZBA A;  4MZW A;  1FB0 A;  4ECJ A;  5J5N A;  4AJ8 A;  4HSC X;  1Z9H A;  1TI3 A;  1XFL A;  1YJ6 A;  1T00 A;  2LEG A;  4K8M A;  1TTZ A;  4ZB8 A;  2H6Y A;  5HFK A;  1Z6N A;  2KHP A;  2CVK A;  3DGQ A;  3BD2 A;  4USS A;  1EZK A;  2KOK A;  1O73 A;  1WMJ A;  5FT3 A;  3VWX A;  5D9X A;  4GST A;  1SK0 A;  2I4A A;  2HRN A;  4JED A;  2WS2 A;  4ZB6 A;  3KIJ A;  1F2E A;  1F37 A;  2PN8 A;  3RAZ A;  5HR1 A;  4KDX A;  4YQU A;  1TU8 A;  3MYD A;  5G30 A;  3F4S A;  3CSJ A;  2RM6 A;  4I2U A;  4XHM A;  4O92 A;  3QAG A;  3GNJ A;  5DAK A;  1M0U A;  1YF0 A;  2VM2 A;  4LMW A;  3IA1 A;  5ID2 B;  1OE7 A;  2OJL A;  1G6W A;  3CXG A;  1GSQ A;  2R2J A;  2R5G A;  5D9W A;  4IGJ A;  2PMT A;  4PNF A;  3GL5 A;  3GTU A;  4Z2R A;  3TCO A;  3BOA A;  5KN3 A;  5IMA A;  4Q5N A;  1MEK A;  3HHV A;  4XS6 A;  5CRW A;  1ERU A;  2KUC A;  4NMU A;  1NW2 A;  3CTF A;  2GST A;  3APS A;  2YNX A;  3RPN A;  1J0F A;  4ILF A;  1SKS B;  2E0Q A;  1QK8 A;  2HI7 A;  2DIZ A;  5DBQ A;  4NV5 A;  4XS4 A;  4MPF A;  2CQ9 A;  2IMF A;  1V2A A;  3O6T A;  3VI7 A;  3D0Z A;  2YWI A;  1K0N A;  4OFM A;  4IN0 A;  5FWG A;  4GF0 A;  4Z2T A;  2FHE A;  1GWC A;  5JWR B;  2P0G A;  4FO5 A;  2O89 A;  4EDZ A;  4EIP A;  3VPT A;  1OC3 A;  1XVW A;  4LMV A;  2VLU A;  1Y25 A;  2ES7 A;  2IFQ A;  1PX7 A;  5D8I A;  1Y6E A;  4MLY A;  1EWX A;  4OFT A;  2L57 A;  5CAX A;  1R7H A;  4O5R A;  2H66 A;  3KTL A;  6GST A;  1USB A;  1AXD A;  3PH9 A;  3UBK A;  1GL8 A;  4NPB A;  2HFD A;  3Q6O A;  4RUV A;  3FKF A;  4YAP A;  3ERG A;  5DQS A;  4KND A;  2ZUP A;  1ZOF A;  3SBC A;  5CRD A;  3GIX A;  3ZZX A;  3VFI A;  3WGX A;  2HT9 A;  2X8C A;  2GTU A;  2GGT A;  2VL2 A;  4GWR A;  1OYJ A;  3QR6 A;  2CV4 A;  1S3C A;  1DUG A;  2HZE A;  4ZBB A;  3RDW A;  2HSH A;  4TR1 B;  2V32 A;  5GAP D;  2MZC A;  1Z7P A;  3NIV A;  1SKW B;  4Q5R A;  5DVB A;  1FOH A;  2IJY A;  2R6K A;  2YJ7 A;  4TRX A;  3ZVJ A;  4ECI A;  5BMU A;  1T7P B;  5B7C A;  2R4V A;  1XPV A;  5B8A A;  3KMO A;  1JFU A;  5ECP B;  1OC9 A;  3FZ9 A;  1ACV A;  4TXV A;  1V40 A;  1TXX A;  2WB9 A;  2MMZ A;  3QMX A;  3F0I A;  4TXO A;  1YZX A;  4HJM A;  2MMA A;  1X5D A;  1A0R P;  3ISO A;  2FGX A;  4FQU A;  3ME7 A;  1T3B A;  3GKN A;  3M9K A;  5DJL A;  1ERV A;  2H8L A;  3FMW A;  2WGR A;  2EIR A;  3IV4 A;  3WT1 A;  2H0G A;  4HQS A;  5LNK e;  4F03 A;  3DXB A;  5CRH A;  1ZGN A;  2VLV A;  5F06 A;  2FA8 A;  2O8V B;  2AV4 A;  3FRC A;  1UN2 A;  5D93 A;  2H1A A;  1JLV A;  2PU9 C;  4IQA A;  2MMO A;  1X5C A;  2IL3 A;  1ERT A;  3U6V A;  1N8J A;  1ERW A;  4I6X A;  1BAY A;  1M3I A;  4BIK A;  2GSS A;  2YN1 A;  1QFN A;  1UVZ A;  2B5Y A;  4PUA A;  5G5E A;  3R2Q A;  3IOS A;  4HEA 2;  1TOF A;  2G2Q A;  2XBI A;  3UVT A;  4BL7 B;  4MJA A;  4GQC A;  4OFN A;  1BYE A;  2A4V A;  2V2G A;  9GSS A;  2I3Y A;  2H76 A;  1TRV A;  2TRC P;  4A5P A;  4MK3 A;  2VIM A;  3GN3 A;  3BJ5 A;  3GH6 A;  3LYK A;  3H93 A;  5J9C A;  3ZMK A;  5IO0 A;  3TJG A;  2H19 A;  3TDG A;  4EO3 A;  4YAV A;  1WPI A;  8GSS A;  2E7P A;  2B3S A;  5DAL B;  1JZO A;  3TB2 A;  1PSQ A;  4EKZ A;  2FA4 A;  2DJK A;  2YZH A;  3CSI A;  4EXJ A;  1Z6M A;  1U3I A;  5IOW A;  3F9U A;  2JU5 A;  4K0G A;  3D5J A;  1YEP A;  1K0B A;  1LU4 A;  2HYX A;  2RLI A;  3HKR A;  5ECH B;  2FNO A;  3GL3 A;  1X0R A;  1C72 A;  5KEJ A;  1A23 A;  2LRT A;  2H01 A;  4NHW A;  4WET A;  1WJK A;  2B6M A;  2R3X A;  2VD1 A;  2VUP A;  3W6G A;  16GS A;  4KGI A;  3VWU A;  1N2A A;  3QAW A;  2C3N A;  2OE3 A;  4TOP A;  1F6M C;  1XXU A;  4JR4 A;  4K6X A;  2XPD A;  3E9J B;  1AW9 A;  4ZB9 A;  2MMN A;  2YPM A;  2AUV A;  2HNL A;  1SEN A;  3TRQ A;  2LQO A;  3KH7 A;  3LSZ A;  4FIW A;  1SD9 A;  2E2G A;  1H4O A;  3ME8 A;  5A4W A;  3L0H A;  1A8Y A;  3M3M A;  4JZQ A;  3KJY A;  5G31 A;  3FR6 A;  1WP0 A;  2GS3 A;  2LNT A;  3GKM A;  4ZL8 A;  4K7O A;  2J9H A;  1JLW A;  2CAI A;  3D4M A;  4MJE A;  1HNB A;  4NWY A;  3GTU B;  1Q98 A;  4JU5 A;  4EUY A;  1KNG A;  4ULX A;  2LRC A;  3ZLP A;  3HD5 A;  2F51 A;  2VCQ A;  4JR6 A;  1GTB A;  2L6D A;  3HJO A;  2V6O A;  3FYG A;  5ECQ B;  1XZO A;  3TKR A;  3U5R E;  1XW5 A;  3LJR A;  3GA4 A;  3UIW A;  4WKW A;  1QMV A;  5KOW A;  3BCI A;  3MIX A;  2YWN A;  5HR0 A;  4YQV A;  4MF5 A;  1YEX A;  3MAK A;  2H70 A;  1SL0 B;  4MMM A;  3JCM L;  3HVS A;  1WE0 A;  2LUS A;  2CVB A;  5L71 A;  4OWY A;  2QKE A;  4OMV A;  2PVQ A;  2KP2 A;  1Q4J A;  2WUL A;  4KH7 A;  5GST A;  1GNE A;  3FZ5 A;  1NHO A;  1O8W A;  3L9U A;  3TJK A;  1V98 A;  2B7J A;  3N5O A;  4MAB A;  3G7I A;  4P3Y B;  3GMF A;  1O85 A;  4V2M A;  1SD8 A;  2MBT A;  4GLT A;  2JZT A;  3KMN A;  1B48 A;  1IYH A;  1SJZ A;  11GS A;  2FLS A;  1XIY A;  3GKX A;  3IK7 A;  3DWV A;  1PL2 A;  1HNA A;  3FW2 A;  1XWG A;  1W4V A;  2IIY A;  3ED3 A;  1SJ6 A;  4HOJ A;  4K5R A;  3P8W A;  3DVX A;  5ECS A;  3KTB A;  1TU7 A;  2OE0 A;  1G7O A;  2H0H A;  4OO4 A;  4I5Q A;  3HDC A;  1WWJ A;  1R26 A;  1OKT A;  2EIQ A;  4H86 A;  3NZN A;  2DLX A;  6GSW A;  5CP1 A;  3TOT A;  5HFI A;  4ID0 A;  4HJ2 A;  4G0K A;  1QXH A;  2YWM A;  5KN0 A;  4KCE A;  2FCH A;  3EVI A;  2OBK A;  1SKR B;  1U3A A;  5IMC A;  3P2A A;  4F0B A;  1K0D A;  3PIN A;  3EU4 A;  1OC9 B;  5IO2 A;  1K0O A;  1DSB A;  1XOB A;  1SYX A;  1GNW A;  1K3Y A;  4HUA A;  1NSW A;  1PQN A;  2GZP A;  5F0G A;  2L59 A;  1GTI A;  2OA7 A;  1YKA A;  2DIY A;  4K2D A;  4N10 A;  5ABR A;  4N0Z A;  3KH9 A;  1U6T A;  4XRD A;  4MZB A;  2WRT A;  4LL1 B;  2ZCT A;  1MD4 A;  4I97 A;  4FYB A;  3LQ7 A;  3W8J A;  1TKD B;  2YAN A;  3SWL A;  3FR9 A;  3MSZ A;  5FHI A;  5AIV A;  4WXT A;  4KW6 A;  1W89 A;  2VCV A;  4IS0 A;  2VCT A;  1BG5 A;  5CNW A;  2VCZ A;  2GT6 A;  4KF9 A;  1HQO A;  1SL1 B;  3IPZ A;  4YQM A;  3AY8 A;  3TJJ A;  2GT5 A;  2A4H A;  4IW9 A;  2DJ2 A;  1O8X A;  1T4Y A;  2JSZ A;  5CRE A;  2D2Z A;  2H74 A;  2CAQ A;  2YCD A;  3LOR A;  1JZW A;  2F3M A;  3HZ4 A;  2VLT A;  2DMM A;  1RQM A;  3M9J A;  5EY6 A;  3I43 A;  4HZ2 A;  3IDV A;  3ERF A;  4PUR A;  3DVW A;  4TVE A;  2GSR A;  13GS A;  4G10 A;  4CW9 A;  1EGO A;  2CT6 A;  2CZ3 A;  2HRA A;  4O32 A;  4KSM A;  3LEF A;  3O3T A;  1A2J A;  2HE3 A;  1VF2 A;  3GHA A;  3LYP A;  2VD0 A;  5ELA A;  3FY7 A;  2JZS A;  2BMX A;  2N5F A;  1BX9 A;  2ON5 A;  3N9J A;  1TRS A;  1VF1 A;  3TKP A;  4HDE A;  1VGL A;  4ZBD A;  4IJ3 A;  1MD3 A;  1S3R A;  3GX8 A;  4CDO A;  4HU9 A;  3QDN A;  1GRX A;  1M2D A;  1GUK A;  2X4A A;  1TW9 A;  5AN1 A;  4I2T A;  4MDC A;  2C3Q A;  2PGT A;  3M8N A;  2YV9 A;  6GSU A;  1TRU A;  2B5X A;  2O85 A;  4BVX B;  3VK9 A;  4HZ4 A;  2H0I A;  3CTG A;  3MDK A;  4IQ1 A;  4ZIL A;  4BVY A;  2FWH A;  5KN2 A;  5B6M A;  1S3A A;  5ENU A;  4G0L A;  3V1W A;  4KB3 A;  3WD6 A;  3M1G A;  3HY2 A;  3F6D A;  3UAR A;  5ECO B;  4NXI A;  5IQY A;  3DYR A;  1A2L A;  4EE0 A;  2IN3 A;  1AAZ A;  1G6Y A;  1AC1 A;  1ZYP A;  4V1A p;  4ECB A;  2ZNM A;  2X8G A;  3D4T A;  1EP8 A;  2M80 A;  3GUR A;  1F3A A;  1ZYE A;  4V2N A;  3OR5 A;  1AQW A;  3FZ4 A;  4GQF A;  2PUK C;  4TW5 A;  1ABA A;  1O81 A;  3IXR A;  2LST A;  1VRS D;  6GSY A;  4YKG A;  3GST A;  3RHB A;  4KA0 A;  2CZ2 A;  2N5A A;  2P5Q A;  4X0X A;  3CQF A;  2OE1 A;  1XOA A;  1M3J A;  1J08 A;  2H73 A;  3CSH A;  4XIH A;  4Q5F A;  1FAA A;  2L5O A;  1A0F A;  2NPB A;  4ICY A;  5J41 A;  4PNG A;  3HYP A;  3TKS A;  5HR2 A;  2J23 A;  4ISD A;  2FWE A;  2EC4 A;  5IMZ A;  4V2L A;  1SJI A;  1K3L A; 
#chains in the Genus database with same CATH homology
 1GH2 A;  2HLS A;  3WT2 A;  2PPT A;  3LWA A;  14GS A;  2A2R A;  3FEU A;  1GSD A;  2GZZ A;  4D73 B;  5F07 A;  2QGV A;  5DJM A;  3C1R A;  3F3R A;  1QGV A;  2JAC A;  2L5L A;  4PQH A;  4MF7 A;  1MDK A;  5IMV A;  1PN9 A;  3KXO A;  4WF4 A;  2OBI A;  3F4R A;  1R5P A;  1SK2 A;  2F8F A;  1M99 A;  1OAZ A;  3EU3 A;  3D21 A;  3EE2 A;  1B8X A;  4ZIJ A;  4WF5 A;  1ON4 A;  1ST9 A;  3GYK A;  3DD3 A;  4K5S A;  5IM9 A;  3C7M A;  4KUN A;  2LTK A;  1PD2 1;  2C1Y A;  4GSS A;  3RHC A;  5ID2 A;  3ZVJ D;  4F0C A;  4RI7 A;  7GSS A;  1O7U A;  3KCM A;  4MPG A;  2RUF A;  4E8E A;  4WBR D;  1EOG A;  2NDO A;  4J2F A;  1F9M A;  2NVL A;  3GUS A;  3A5W A;  3IBH A;  2O7K A;  2VL9 A;  1AIU A;  4K9Z A;  4RI6 A;  2GZY A;  2IMI A;  2AJQ B;  3LW9 A;  1EOH A;  4AJ6 A;  4L5L A;  3LGC A;  4N11 A;  3DKS A;  5HR3 A;  3QOU A;  2MYG A;  5G1K A;  2H30 A;  4EL1 A;  1ZCP A;  1EGR A;  2WCI A;  1YQ1 A;  2N5B A;  4Q5Q A;  2LQQ A;  4X4J A;  1THO A;  2X49 A;  1FW1 A;  5EVO A;  4G9H A;  3QAV A;  2L6C A;  2FWF A;  2H6X A;  3G7J A;  3BCK A;  1V9W A;  3GX0 A;  3KD0 A;  1FOV A;  3KP9 A;  3J7Y b;  2FUG 2;  1GTA A;  1OE8 A;  2O87 A;  3HJM A;  4OD7 A;  2ALB A;  3I6A A;  3ZFL A;  1T1V A;  3MWH A;  2I81 A;  1MDI A;  2I9H A;  4PX1 A;  4WBJ A;  2H75 A;  4JE1 A;  2DKH A;  2DML A;  12GS A;  5G2Z A;  2YOI A;  3H8Q A;  2I1U A;  3TOU A;  5DAK B;  19GS A;  1PL1 A;  2AHE A;  2QSI A;  4EVM A;  2YP6 A;  1OC8 A;  5ELG A;  2DC5 A;  5A4U A;  4TR0 A;  5KOX A;  2OAC A;  2A2P A;  5EPF A;  1SYR A;  3ZRE A;  1JHB A;  1WRY A;  2C3T A;  2BTO T;  3Q18 A;  1RK4 A;  1XWC A;  5EL8 A;  2C80 A;  2R0G A;  3BBY A;  3CMI A;  1PMT A;  3ERW A;  4TR1 A;  5IMD A;  4WEY A;  5ECI B;  2AYT A;  1B9Y C;  3A2X A;  4MJC A;  4POL A;  5GAN D;  3C71 A;  4K0N A;  3CBU A;  4CHS A;  1PGT A;  1YF1 A;  22GS A;  4PGT A;  4RQX A;  20GS A;  4CY8 A;  5ECM B;  3ZIV A;  1GUL A;  2JL4 A;  2XPE A;  5IIZ A;  5IMF A;  4G19 A;  4KDU A;  4XS4 B;  4POK A;  4MCU A;  4DEJ A;  1G0T A;  2AB6 A;  3P7X A;  3O76 A;  3GH9 A;  3HVV A;  1X9M B;  1V57 A;  2TRX A;  2B1L A;  1GSS A;  1HNC A;  2YZU A;  1KTE A;  3FR3 A;  2F8A A;  3LXT A;  3F6F A;  2C0G A;  10GS A;  2LJR A;  4TR4 A;  3VWW A;  3WGD A;  1FB6 A;  2IFQ B;  3WYW A;  1ML6 A;  1K3O A;  5DQY A;  3A3T A;  5ECR B;  4K7I A;  3ZL5 A;  2PVO C;  1GTU A;  5GSS A;  2L4Q A;  3I9V 2;  3TRP A;  4BVY B;  1PA3 A;  3VWV A;  3UAP A;  2OKA A;  3HXS A;  18GS A;  3US3 A;  1M2A A;  3E3E A;  3KEB A;  2C0D A;  4BWQ A;  4OCE A;  1O6J A;  4G2E A;  2HZE B;  1K0M A;  4BL7 A;  1QQ2 A;  2NBS A;  4X43 A;  3FHK A;  4F9Z A;  4IP6 A;  3K8N A;  4EF0 A;  1GUH A;  3GV1 A;  4FYU A;  4PUF C;  2R37 A;  1I9D A;  3G7Y A;  4EDY A;  1EV4 A;  2LJK A;  2NTO A;  4GXZ A;  3NOF A;  3CRU A;  4L0U A;  3LG6 A;  5E4W A;  1BED A;  5D96 A;  4IJI A;  2K8S A;  2QC7 A;  2GQK A;  5DAL A;  2K18 A;  1PX6 A;  4PXO A;  4N0V A;  3C8E A;  1A2M A;  5INY A;  1M9B A;  3TJF A;  3QFB C;  4TXO B;  4N30 A;  1ZMA A;  6GSS A;  1GLQ A;  2KP1 A;  2V41 A;  4BWS A;  2X99 A;  2WZ9 A;  1LJR A;  4IP1 A;  1PKZ A;  3EUR A;  4WR5 A;  2DSA A;  4HU7 A;  3ZIJ A;  3IK9 A;  4Z7X A;  1XBS A;  4GRF A;  4RQR A;  2REM A;  3F63 A;  2IPA A;  4L8E A;  1URM A;  4F2I A;  3TUE A;  3G9B A;  2GQM A;  2P31 A;  4J56 E;  4O5Q A;  1Z7R A;  3MNG A;  4HQZ A;  3M0F A;  2H1D A;  4ACS A;  3ZFB A;  2YJH A;  1EEM A;  3R3E A;  1K0C A;  2GSQ A;  2H72 A;  4XTS A;  5BRT A;  5JCG A;  4V1A g;  1DE1 A;  4MH2 A;  5JWO B;  1AQX A;  4JBB A;  2L4C A;  2PBJ A;  1JZD A;  2K8V A;  5DDL A;  5HQP A;  2FD3 A;  2R0C A;  2VOC A;  4O5U A;  3UBL A;  1BJX A;  1OVN A;  1ZZY A;  1A8L A;  1TRW A;  5D73 A;  1Z3E A;  2QA1 A;  4XRA A;  1R5A A;  3DRN A;  4DVC A;  3DEX A;  3IAS 2;  4PQI A;  2VL3 A;  5H5Q A;  5CRG A;  5HFG A;  1KEB A;  1T4Z A;  2HRK A;  5C04 A;  1BQ7 A;  2HSY A;  3C1S A;  3PGT A;  4CY6 A;  2HSM A;  1MDJ A;  4GSN A;  4DSS A;  4BA7 A;  5JWQ B;  3QD9 A;  1NHY A;  5DCH A;  2XBQ A;  3LXZ A;  5JCU A;  4QL7 A;  3GKK A;  3IC4 A;  4BPY A;  2DJJ A;  1TK8 B;  4POB A;  4JRR A;  3EMX A;  3A2V A;  2XHF A;  4MA9 A;  3FZA A;  1YY7 A;  1V58 A;  4IBP A;  1M9A A;  1FVK A;  3ZRD A;  2LJA A;  1DE2 A;  4NHZ A;  2JZR A;  3S9F A;  1YDK A;  2VO4 A;  5GZZ B;  1ZYN A;  4ZXG A;  3IHG A;  1TDI A;  2IWT A;  1TJD A;  4MP4 A;  3E0U A;  4TKY A;  3HJP A;  1S3D A;  4ML6 A;  3KP8 A;  4QL9 A;  5IPH A;  2WDU A;  4YH2 A;  4KDY A;  3UVH A;  4EC0 A;  3HZ8 A;  5IPG A;  2VL2 C;  4DSQ A;  1NM3 A;  3F3Q A;  4FH8 A;  3L78 A;  4KCA A;  1FG4 A;  1G7E A;  3C73 A;  5LD0 A;  6GSX A;  4L5O A;  1XW6 A;  2VM1 A;  4K1F A;  2TIR A;  4MNN A;  2CA8 A;  1H75 A;  1GUM A;  1B4P A;  1PRX A;  2FY6 A;  3IAM 2;  3KM6 A;  3TKQ A;  1LBK A;  3F4T A;  1XCC A;  1QUW A;  3L9V A;  3WGE A;  5J4U A;  2H1B A;  5IOX A;  3CYN A;  4AGS A;  4J57 E;  1F3B A;  2YWO A;  3EWL A;  3UMA A;  1U88 A;  2C8U A;  2IMK A;  3VUR A;  6GSV A;  4HI7 A;  4XCS A;  3TKS C;  2DJ1 A;  1ZYQ B;  3HVX A;  2UZ8 A;  3UOM A;  2JAD A;  3A2W A;  2Z9S A;  1GP1 A;  1VF3 A;  2H71 A;  4KSO A;  2LV3 A;  3UL3 A;  4WR4 A;  5AGY A;  1KBN A;  3FK8 A;  5C00 A;  1U87 A;  1TK0 B;  4ZL9 A;  2A2S A;  5KN1 A;  3VPQ A;  2KLX A;  3KGK A;  4GCI A;  3TRX A;  2GLR A;  3HA9 A;  1X9S B;  2C0F A;  3IC8 A;  2DBC A;  3EMP A;  1GSF A;  2DJ3 A;  1YKC A;  4EIQ A;  3W8S A;  1DBY A;  4KX4 A;  2LRN A;  2RUE A;  5D9V A;  1I5G A;  4ML1 A;  3EC3 A;  4TR3 A;  3Q19 A;  1R4W A;  1GSU A;  3L9S A;  1HYU A;  3APQ A;  1X9W B;  1UC7 A;  1E6B A;  3APO A;  1MTC A;  3PR8 A;  3UEM A;  2LKU A;  4TN8 A;  3ZML A;  2GQL A;  3GFK A;  2RII A;  2E2M A;  3CRT A;  4X1U A;  3F8U A;  4AJ7 A;  3EPT A;  3ZIT A;  2OAD A;  2H6Z A;  2C0E A;  1EV9 A;  2ON7 A;  3GRX A;  5ECL B;  2B7K A;  4OCF A;  2GVP A;  1A24 A;  2VAF A;  2FWG A;  3I69 A;  2PWJ A;  4L0W A;  1GSE A;  2R0P A;  3Q74 A;  2EIO A;  2CVD A;  3P90 A;  1WIK A;  3H79 A;  2CX3 A;  5F05 A;  2DJ0 A;  4K7N A;  2HZF A;  4KE3 A;  1PKW A;  4G0I A;  3LFL A;  3VI5 A;  1XW9 A;  3TGZ A;  5ECK B;  1E2Y A;  1K0A A;  1ILO A;  1XWK A;  3RBT A;  3RPP A;  1B4Q A;  1FVJ A;  2X8H A;  4BVX A;  2K9F A;  5F8B A;  1JZR A;  1XWA A;  2VCX A;  4IHU A;  4F82 A;  2IMD A;  5J3R A;  4HS1 A;  1FHE A;  1HD2 A;  4IKH A;  3L4N A;  4K2X A;  3GSS A;  2JSY A;  4ZL7 A;  2WJU A;  1M7T A;  5LCZ A;  1X5E A;  4MZC A;  5A4V A;  5G5F A;  3A5I A;  4POM A;  2PER A;  2VCW A;  4LA1 A;  1TP9 A;  4IVF A;  1SK1 A;  2B5E A;  2H1G A;  1M2B A;  3H1N A;  1TI1 A;  2RM5 A;  4XS1 A;  4I8B A;  4LLR A;  4MH3 A;  1OKD A;  2GDR A;  5H5S A;  5J9B A;  2M46 A;  2C4J A;  1AQV A;  1T8E B;  4QQ7 A;  4ECC A;  4NV2 A;  2K6V A;  1FO5 A;  1RW1 A;  3D6I A;  3HCZ A;  2M72 A;  2MBS A;  1XVQ A;  3IRA A;  4NAX A;  2HRF A;  3H4K A;  3TJB A;  1VF4 A;  4E8H A;  5H5R A;  3ZYW A;  5AIX A;  1SU9 A;  1THX A;  3EIN A;  1CQH A;  4DSS B;  4LL4 B;  1ZL9 A;  5D9T A;  4DSR A;  3ZTL A;  4PTS A;  5G1L A;  3KZQ A;  2BJX A;  3QFA C;  1J9B A;  4MJB A;  1TK5 B;  4D73 A;  2V1M A;  2DKI A;  5CYY A;  3PPU A;  3IE3 A;  3UJ1 A;  1WOU A;  3D22 A;  2CX4 A;  5B8B A;  4O7H A;  3DIE A;  2B1K A;  1UA5 A;  3EYT A;  2LNS A;  5E59 A;  2IME A;  3IR4 A;  1GLP A;  2QA2 A;  4FYC A;  1EEJ A;  1Z5Y E;  1PN0 A;  5DCG A;  4OO5 A;  3J7Y k;  5AIS A;  4Z2U A;  3IHQ A;  3QCP A;  2P5R A;  5A5K A;  1CQG A;  3VLN A;  4KAE A;  5COH A;  1AUC A;  2G0F A;  5ECN B;  1B9X C;  2WFC A;  1SL2 B;  4PQ1 A;  4IEL A;  3TKS E;  1XWB A;  4AF2 A;  2LS5 A;  3QPM A;  1EP7 A;  2AAW A;  2X64 A;  2HXK A;  4GTU A;  4MF6 A;  2XC2 A;  2F9S A;  2YV7 A;  1IYI A;  1GSY A;  4YKF A;  3DML A;  2V6K A;  5B6N A;  5JCW A;  5CO3 A;  17GS A;  4ZBA A;  4MZW A;  1FB0 A;  4ECJ A;  5J5N A;  4AJ8 A;  1Z9H A;  1TI3 A;  1XFL A;  1YJ6 A;  1T00 A;  2LEG A;  4K8M A;  1TTZ A;  4ZB8 A;  2H6Y A;  5HFK A;  1Z6N A;  2KHP A;  2CVK A;  3DGQ A;  3BD2 A;  4USS A;  1EZK A;  2KOK A;  1O73 A;  1WMJ A;  5FT3 A;  3VWX A;  5D9X A;  4GST A;  1SK0 A;  2I4A A;  2HRN A;  4JED A;  2WS2 A;  4ZB6 A;  3KIJ A;  1F2E A;  1F37 A;  2PN8 A;  3RAZ A;  5HR1 A;  4KDX A;  4YQU A;  1TU8 A;  3MYD A;  5G30 A;  3F4S A;  3CSJ A;  2RM6 A;  4I2U A;  4XHM A;  4O92 A;  3QAG A;  3GNJ A;  5DAK A;  1M0U A;  1YF0 A;  2VM2 A;  4LMW A;  3IA1 A;  5ID2 B;  1OE7 A;  2OJL A;  1G6W A;  3CXG A;  1GSQ A;  2R2J A;  2R5G A;  5D9W A;  4IGJ A;  2PMT A;  4PNF A;  3GL5 A;  3GTU A;  4Z2R A;  3TCO A;  3BOA A;  5KN3 A;  5IMA A;  4Q5N A;  1MEK A;  3HHV A;  4XS6 A;  5CRW A;  1ERU A;  2KUC A;  4NMU A;  1NW2 A;  3CTF A;  2GST A;  3APS A;  2YNX A;  3RPN A;  1J0F A;  4ILF A;  1SKS B;  2E0Q A;  1QK8 A;  2HI7 A;  2DIZ A;  5DBQ A;  4NV5 A;  4XS4 A;  4MPF A;  2CQ9 A;  2IMF A;  1V2A A;  3O6T A;  3VI7 A;  3D0Z A;  2YWI A;  1K0N A;  4OFM A;  4IN0 A;  5FWG A;  4GF0 A;  4Z2T A;  2FHE A;  1GWC A;  5JWR B;  2P0G A;  4FO5 A;  2O89 A;  4EDZ A;  4EIP A;  3VPT A;  1OC3 A;  1XVW A;  4LMV A;  2VLU A;  1Y25 A;  2ES7 A;  2IFQ A;  1PX7 A;  5D8I A;  1Y6E A;  4MLY A;  1EWX A;  4OFT A;  2L57 A;  5CAX A;  1R7H A;  4O5R A;  2H66 A;  3KTL A;  6GST A;  1USB A;  1AXD A;  3PH9 A;  3UBK A;  1GL8 A;  4NPB A;  2HFD A;  3Q6O A;  4RUV A;  3FKF A;  4YAP A;  3ERG A;  5DQS A;  4KND A;  2ZUP A;  1ZOF A;  3SBC A;  5CRD A;  3GIX A;  3ZZX A;  3VFI A;  3WGX A;  2HT9 A;  2X8C A;  2GTU A;  2GGT A;  2VL2 A;  4GWR A;  1OYJ A;  3QR6 A;  2CV4 A;  1S3C A;  1DUG A;  2HZE A;  4ZBB A;  3RDW A;  2HSH A;  4TR1 B;  2V32 A;  5GAP D;  2MZC A;  1Z7P A;  3NIV A;  1SKW B;  4Q5R A;  5DVB A;  1FOH A;  2IJY A;  2R6K A;  2YJ7 A;  4TRX A;  3ZVJ A;  4ECI A;  5BMU A;  1T7P B;  5B7C A;  2R4V A;  1XPV A;  5B8A A;  3KMO A;  1JFU A;  5ECP B;  1OC9 A;  3FZ9 A;  1ACV A;  4TXV A;  1V40 A;  1TXX A;  2WB9 A;  2MMZ A;  3QMX A;  3F0I A;  4TXO A;  1YZX A;  4HJM A;  2MMA A;  1X5D A;  1A0R P;  3ISO A;  2FGX A;  4FQU A;  3ME7 A;  1T3B A;  3GKN A;  3M9K A;  5DJL A;  1ERV A;  2H8L A;  3FMW A;  2WGR A;  2EIR A;  3IV4 A;  3WT1 A;  2H0G A;  4HQS A;  5LNK e;  4F03 A;  3DXB A;  5CRH A;  1ZGN A;  2VLV A;  5F06 A;  2FA8 A;  2O8V B;  2AV4 A;  3FRC A;  1UN2 A;  5D93 A;  2H1A A;  1JLV A;  2PU9 C;  4IQA A;  2MMO A;  1X5C A;  2IL3 A;  1ERT A;  3U6V A;  1N8J A;  1ERW A;  4I6X A;  1BAY A;  2GSS A;  2YN1 A;  1QFN A;  1UVZ A;  2B5Y A;  4PUA A;  5G5E A;  3R2Q A;  3IOS A;  4HEA 2;  1TOF A;  2G2Q A;  2XBI A;  3UVT A;  4BL7 B;  4MJA A;  4GQC A;  4OFN A;  1BYE A;  2A4V A;  2V2G A;  9GSS A;  2I3Y A;  2H76 A;  1TRV A;  2TRC P;  4A5P A;  4MK3 A;  2VIM A;  3GN3 A;  3BJ5 A;  3GH6 A;  3LYK A;  3H93 A;  5J9C A;  3ZMK A;  5IO0 A;  3TJG A;  2H19 A;  3TDG A;  4EO3 A;  4YAV A;  1WPI A;  8GSS A;  2E7P A;  2B3S A;  5DAL B;  1JZO A;  3TB2 A;  1PSQ A;  4EKZ A;  2FA4 A;  2DJK A;  2YZH A;  3CSI A;  4EXJ A;  1Z6M A;  1U3I A;  5IOW A;  3F9U A;  2JU5 A;  4K0G A;  3D5J A;  1YEP A;  1K0B A;  1LU4 A;  2HYX A;  2RLI A;  3HKR A;  5ECH B;  2FNO A;  3GL3 A;  1X0R A;  1C72 A;  5KEJ A;  1A23 A;  2LRT A;  2H01 A;  4NHW A;  4WET A;  1WJK A;  2B6M A;  2R3X A;  2VD1 A;  2VUP A;  3W6G A;  16GS A;  4KGI A;  3VWU A;  1N2A A;  3QAW A;  2C3N A;  2OE3 A;  4TOP A;  1F6M C;  1XXU A;  4JR4 A;  4K6X A;  2XPD A;  3E9J B;  1AW9 A;  4ZB9 A;  2MMN A;  2YPM A;  2AUV A;  2HNL A;  1SEN A;  3TRQ A;  2LQO A;  3KH7 A;  3LSZ A;  4FIW A;  1SD9 A;  2E2G A;  1H4O A;  3ME8 A;  5A4W A;  3L0H A;  1A8Y A;  3M3M A;  4JZQ A;  3KJY A;  5G31 A;  3FR6 A;  1WP0 A;  2GS3 A;  2LNT A;  3GKM A;  4ZL8 A;  4K7O A;  2J9H A;  1JLW A;  2CAI A;  3D4M A;  4MJE A;  1HNB A;  4NWY A;  3GTU B;  1Q98 A;  4JU5 A;  4EUY A;  1KNG A;  4ULX A;  2LRC A;  3ZLP A;  3HD5 A;  2F51 A;  2VCQ A;  4JR6 A;  1GTB A;  2L6D A;  3HJO A;  2V6O A;  3FYG A;  5ECQ B;  1XZO A;  3TKR A;  3U5R E;  1XW5 A;  3LJR A;  3GA4 A;  3UIW A;  4WKW A;  1QMV A;  5KOW A;  3BCI A;  3MIX A;  2YWN A;  5HR0 A;  4YQV A;  4MF5 A;  1YEX A;  3MAK A;  2H70 A;  1SL0 B;  4MMM A;  3JCM L;  3HVS A;  1WE0 A;  2LUS A;  2CVB A;  5L71 A;  4OWY A;  2QKE A;  4OMV A;  2PVQ A;  2KP2 A;  1Q4J A;  2WUL A;  4KH7 A;  5GST A;  1GNE A;  3FZ5 A;  1NHO A;  1O8W A;  3L9U A;  3TJK A;  1V98 A;  2B7J A;  3N5O A;  4MAB A;  3G7I A;  4P3Y B;  3GMF A;  1O85 A;  4V2M A;  1SD8 A;  2MBT A;  4GLT A;  2JZT A;  3KMN A;  1B48 A;  1IYH A;  1SJZ A;  11GS A;  2FLS A;  1XIY A;  3GKX A;  3IK7 A;  3DWV A;  1PL2 A;  1HNA A;  3FW2 A;  1XWG A;  1W4V A;  2IIY A;  3ED3 A;  1SJ6 A;  4HOJ A;  4K5R A;  3P8W A;  3DVX A;  5ECS A;  3KTB A;  1TU7 A;  2OE0 A;  1G7O A;  2H0H A;  4OO4 A;  4I5Q A;  3HDC A;  1WWJ A;  1R26 A;  1OKT A;  2EIQ A;  4H86 A;  3NZN A;  2DLX A;  6GSW A;  5CP1 A;  3TOT A;  5HFI A;  4ID0 A;  4HJ2 A;  4G0K A;  1QXH A;  2YWM A;  5KN0 A;  4KCE A;  2FCH A;  3EVI A;  2OBK A;  1SKR B;  1U3A A;  5IMC A;  3P2A A;  4F0B A;  1K0D A;  3PIN A;  3EU4 A;  1OC9 B;  5IO2 A;  1K0O A;  1DSB A;  1XOB A;  1SYX A;  1GNW A;  1K3Y A;  4HUA A;  1NSW A;  1PQN A;  2GZP A;  5F0G A;  2L59 A;  1GTI A;  2OA7 A;  1YKA A;  2DIY A;  4K2D A;  4N10 A;  5ABR A;  4N0Z A;  3KH9 A;  1U6T A;  4XRD A;  4MZB A;  2WRT A;  4LL1 B;  2ZCT A;  1MD4 A;  4I97 A;  4FYB A;  3LQ7 A;  3W8J A;  1TKD B;  2YAN A;  3SWL A;  3FR9 A;  3MSZ A;  5FHI A;  5AIV A;  4WXT A;  4KW6 A;  1W89 A;  2VCV A;  4IS0 A;  2VCT A;  1BG5 A;  5CNW A;  2VCZ A;  2GT6 A;  4KF9 A;  1HQO A;  1SL1 B;  3IPZ A;  4YQM A;  3AY8 A;  3TJJ A;  2GT5 A;  2A4H A;  4IW9 A;  2DJ2 A;  1O8X A;  1T4Y A;  2JSZ A;  5CRE A;  2D2Z A;  2H74 A;  2CAQ A;  2YCD A;  3LOR A;  1JZW A;  2F3M A;  3HZ4 A;  2VLT A;  2DMM A;  1RQM A;  3M9J A;  5EY6 A;  3I43 A;  4HZ2 A;  3IDV A;  3ERF A;  4PUR A;  3DVW A;  4TVE A;  2GSR A;  13GS A;  4G10 A;  4CW9 A;  1EGO A;  2CT6 A;  2CZ3 A;  2HRA A;  4O32 A;  4KSM A;  3LEF A;  3O3T A;  1A2J A;  2HE3 A;  1VF2 A;  3GHA A;  3LYP A;  2VD0 A;  5ELA A;  3FY7 A;  2JZS A;  2BMX A;  2N5F A;  1BX9 A;  2ON5 A;  3N9J A;  1TRS A;  1VF1 A;  3TKP A;  4HDE A;  1VGL A;  4ZBD A;  4IJ3 A;  1MD3 A;  3GX8 A;  4CDO A;  4HU9 A;  3QDN A;  1GRX A;  1M2D A;  1GUK A;  2X4A A;  1TW9 A;  5AN1 A;  4I2T A;  4MDC A;  2C3Q A;  2PGT A;  3M8N A;  2YV9 A;  6GSU A;  1TRU A;  2B5X A;  2O85 A;  4BVX B;  3VK9 A;  4HZ4 A;  2H0I A;  3CTG A;  3MDK A;  4IQ1 A;  4ZIL A;  4BVY A;  2FWH A;  5KN2 A;  5B6M A;  1S3A A;  5ENU A;  4G0L A;  3V1W A;  4KB3 A;  3WD6 A;  3M1G A;  3HY2 A;  3F6D A;  3UAR A;  5ECO B;  4NXI A;  5IQY A;  3DYR A;  1A2L A;  4EE0 A;  2IN3 A;  1AAZ A;  1G6Y A;  1AC1 A;  1ZYP A;  4V1A p;  4ECB A;  2ZNM A;  2X8G A;  3D4T A;  1EP8 A;  2M80 A;  3GUR A;  1F3A A;  1ZYE A;  4V2N A;  3OR5 A;  1AQW A;  3FZ4 A;  4GQF A;  2PUK C;  4TW5 A;  1ABA A;  1O81 A;  3IXR A;  2LST A;  1VRS D;  6GSY A;  4YKG A;  3GST A;  3RHB A;  4KA0 A;  2CZ2 A;  2N5A A;  2P5Q A;  4X0X A;  2OE1 A;  1XOA A;  1J08 A;  2H73 A;  3CSH A;  4XIH A;  4Q5F A;  1FAA A;  2L5O A;  1A0F A;  2NPB A;  4ICY A;  5J41 A;  4PNG A;  3HYP A;  3TKS A;  5HR2 A;  2J23 A;  4ISD A;  2FWE A;  2EC4 A;  5IMZ A;  4V2L A;  1SJI A;  1K3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...