2PVOC

Crystal srtucture of the ternary complex between thioredoxin f, ferredoxin, and ferredoxin: thioredoxin reductase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
111
structure length
111
Chain Sequence
b'EAIVGKVTEVNKDTFWPIVKAAGDKPVVLDMFTQWCGPSKAMAPKYEKLAEEYLDVIFLKLDCNQENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAARS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 29
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pvoC00
2L59A 1Z3EA 5IMAA 1NSWA 4AF2A 1FVJA 1GSUA 2C1YA 3GKNA 5ECOB 4I2TA 3GTUA 1A2JA 1XWAA 2IMKA 4JBBA 3EU4A 4IQ1A 2MYGA 3F0IA 4ECIA 3EMXA 2WB9A 3GURA 1R5AA 2KUCA 5DJMA 4BWSA 4FIWA 3N5OA 4TW5A 2PGTA 3CMIA 1SL0B 3U5RE 3F4RA 4PUAA 5DJLA 1XW9A 2H0IA 2WS2A 4LMVA 3HHVA 4EXJA 5HFIA 1FB0A 2LRTA 3F6DA 2F3MA 3EMPA 3EC3A 5DCHA 5E4WA 5ID2A 1SD9A 1WOUA 4J2FA 4MCUA 4F0CA 3DMLA 4WR5A 1GH2A 4MA9A 5D73A 5D93A 2TRXA 3GIXA 3G7YA 2CVBA 1EGRA 1BX9A 5IQYA 4DSSB 4O32A 3HA9A 1X9WB 1XFLA 4OWYA 4HU7A 1LBKA 3DGQA 1V98A 2LJKA 4ML6A 4PGTA 4K1FA 3LSZA 3VWWA 1FAAA 2AV4A 10GSA 2WCIA 1VF1A 4IS0A 3BJ5A 4QQ7A 4KAEA 1OC3A 2VUPA 3CSIA 3IAS2 2H76A 4O5RA 4POMA 4IP1A 2LV3A 1JZWA 1A0FA 3L9UA 4RI7A 1O81A 1TJDA 2YCDA 5AIVA 4KSOA 4V1Ag 2H6XA 4PQ1A 1AQVA 2VL9A 4EE0A 3G7IA 4K0NA 2VL2C 3D4TA 5FHIA 3F4SA 1GUHA 1USBA 2IMDA 4XRAA 4E8EA 4ZBDA 3IK9A 1ZYQB 1NHOA 2H30A 3ZVJD 3KH9A 4O92A 1SL1B 4DVCA 4MZWA 1AQXA 2A2RA 2X8GA 1YJ6A 4F82A 4MZBA 2LQQA 2NPBA 3ME7A 3G7JA 2VM2A 4EO3A 2JSZA 3MNGA 4JRRA 1Q4JA 4OO5A 3IK7A 4Q5FA 3KJYA 1WWJA 1A8LA 4H86A 1NW2A 3N9JA 2O87A 1THXA 1MD3A 1O7UA 3NOFA 3BCIA 1VF2A 1KTEA 4HI7A 5ECQB 3HJPA 3HYPA 2EC4A 3ED3A 5G2ZA 1XVWA 4MMMA 1WE0A 5COHA 3UBLA 5ECMB 5ECHB 1Z7PA 1GTBA 2TRCP 5EPFA 2N5BA 3FKFA 5KN1A 2VCZA 1SJ6A 2GSQA 3UVHA 1GLPA 1DSBA 2HRFA 1YKCA 3ME8A 2HXKA 3FR9A 2EIRA 2I81A 6GSXA 3C7MA 2CVKA 4JEDA 1OKDA 4XCSA 5CP1A 3LXTA 4N0ZA 1PGTA 3ZIVA 3O6TA 1F9MA 3TKSE 3EINA 5ENUA 3VWXA 3RHCA 2EIQA 3OR5A 1IYHA 3M8NA 1H4OA 5FT3A 2VCQA 2CVDA 4EC0A 1TOFA 4N10A 5DALA 1KEBA 3FK8A 2LEGA 2J23A 4YH2A 2VOCA 3VI7A 2BJXA 2NVLA 2H8LA 1JFUA 2I1UA 2YWNA 1CQHA 1X9SB 1E2YA 4GSTA 3IXRA 5EVOA 2WFCA 5C04A 4L0UA 4HJ2A 4ZXGA 5EY6A 2GGTA 2LRCA 3DYRA 2VD1A 2HLSA 3IDVA 1XIYA 3QFAC 2OE0A 1K0BA 2KP2A 4YQVA 2D2ZA 1TRSA 2C3TA 5GAND 4IQAA 3TKQA 3HVVA 1SKRB 4MPGA 3D0ZA 2YWIA 1XZOA 3F4TA 1PQNA 1B4QA 2K6VA 1EP7A 5ECNB 5D9TA 5HR0A 4TR0A 1PX6A 3TJGA 6GSTA 2H66A 3QCPA 2OBKA 1EV4A 1U88A 2I4AA 4XHMA 3H1NA 3LG6A 4IELA 3CRTA 3F8UA 4RQRA 2AUVA 3QD9A 3HVSA 1XWGA 5CREA 2M80A 3FY7A 4WF4A 5IMFA 3TKSA 4I6XA 4IJ3A 4WETA 4EKZA 2F51A 3G9BA 3U6VA 5CAXA 1TTZA 3M1GA 4NXIA 1B4PA 5JCWA 3I9V2 7GSSA 5IOXA 1I5GA 2GZYA 3GUSA 1XCCA 4AJ6A 4V2LA 4K7OA 2AYTA 3ZMKA 3J7Yb 1JHBA 3EYTA 4EDYA 4YQUA 1UN2A 4BWQA 1MEKA 5CRWA 3IR4A 1VF3A 4CW9A 1K0NA 1YF0A 3CTFA 1N8JA 3E0UA 4OFTA 1SYXA 3FHKA 3BOAA 4MH2A 2FWEA 3GV1A 2YOIA 3HD5A 4WKWA 3NZNA 1GTUA 3I69A 5F07A 2B1LA 1A23A 2H1AA 1JLVA 3KIJA 2WZ9A 2RLIA 5B8BA 4MDCA 2FY6A 2FLSA 4X1UA 3ZYWA 1M2BA 2RUEA 3PINA 3A2VA 5F0GA 1QGVA 1JZOA 2OADA 4IJIA 3IAM2 1V58A 5B8AA 3C1RA 1AW9A 2YWOA 5JCUA 8GSSA 3D21A 2GTUA 2IL3A 1M99A 3MWHA 3TB2A 4ZL8A 2ON7A 2E2GA 1U3IA 4CDOA 1DE2A 1GSEA 4GLTA 2H6ZA 3GKKA 2KP1A 2JZRA 1SD8A 4PUFC 3TJKA 2K8SA 3FR6A 4JR4A 3LORA 1ABAA 4MJBA 1M2AA 3ERGA 1J9BA 2B3SA 4IKHA 2GQLA 2IN3A 1OKTA 5JWQB 3TJBA 1XWBA 2L57A 3KM6A 1YDKA 1FVKA 3TUEA 3TJFA 2XPDA 2ZCTA 3V1WA 1TK0B 5JCGA 3HJMA 4PNFA 3ZMLA 2P5RA 6GSYA 4NV2A 2LQOA 5DAKB 4QL7A 2H1GA 3D5JA 1SU9A 1B9XC 1N2AA 3QR6A 4PXOA 1DE1A 3GKXA 3ZTLA 1GWCA 1HNAA 3TRQA 4FO5A 2G2QA 5DBQA 4NWYA 1G6YA 3KMNA 4L5LA 2GZPA 1M9BA 2L6DA 4KUNA 5HR1A 4MJCA 4KCAA 1HD2A 2DMLA 2YV7A 3ZL5A 3WYWA 3KP8A 2F8AA 5HFKA 2G0FA 1OAZA 3DD3A 22GSA 3CRUA 3RAZA 3APOA 1T4YA 1F3AA 4K9ZA 3DRNA 3LJRA 2IIYA 2PPTA 5G1KA 2AAWA 4HZ2A 3UBKA 2YANA 2OACA 5G5EA 4TR1A 1V9WA 1BQ7A 5AGYA 3GL5A 2YN1A 4AJ8A 1M7TA 3PGTA 1YZXA 2O85A 1A24A 1GLQA 3US3A 3RPNA 3IHQA 1WJKA 2KLXA 4LLRA 3QPMA 1TI1A 2R6KA 2JZSA 1GSDA 1RK4A 2M46A 3EVIA 4X43A 2B7JA 1JLWA 3K8NA 5HR2A 2N5AA 2ZNMA 1EWXA 4I5QA 4TXOA 2V1MA 1GULA 1YEXA 2JL4A 1V57A 3DKSA 5F05A 2R3XA 3IA1A 3A5WA 5C00A 2C4JA 3KXOA 1T7PB 2H6YA 2WGRA 2I3YA 3KP9A 4KGIA 2MMNA 4G9HA 2J9HA 1F2EA 1TU7A 4WEYA 2B5XA 1ERWA 4NAXA 2CX3A 3KD0A 4XIHA 1XBSA 2HFDA 2N5FA 1SJIA 2L5OA 3UL3A 1PMTA 2IMIA 3CTGA 4KA0A 4G2EA 4L8EA 3APSA 1YEPA 5E59A 5A5KA 1MD4A 3P90A 5DDLA 5ECIB 3D6IA 4GCIA 5D8IA 3GL3A 4MJAA 2VD0A 3DWVA 1E6BA 4GXZA 4NMUA 3EWLA 1VGLA 4ECJA 4XRDA 3GA4A 3D4MA 2A2SA 2IFQA 3P2AA 2REMA 6GSWA 2YZUA 1B48A 1WIKA 1MTCA 2YNXA 2YP6A 2ZUPA 3CYNA 4NHZA 2LJRA 5F8BA 3UOMA 1ML6A 1TK5B 3MSZA 2DIYA 1GTIA 2X8HA 4GF0A 2BMXA 1HNBA 5IMCA 3WT1A 3MDKA 3GSTA 1JZDA 1G6WA 2DJKA 2QC7A 2H72A 4KNDA 4PQHA 2MBSA 2VLTA 3HVXA 1SENA 2GS3A 18GSA 6GSSA 1HNCA 4Q5RA 14GSA 1M9AA 3F63A 1SK1A 4JU5A 2HSHA 2PU9C 4GQCA 2CZ2A 4D73B 3GH9A 1EP8A 2DJ2A 3FZ5A 3IPZA 5IO2A 2CA8A 3ZIJA 5GAPD 4HS1A 2VCTA 3LFLA 4BPYA 3ZRDA 4XS4A 3HDCA 3I43A 5AISA 4GTUA 1SJZA 1DUGA 3KMOA 1AQWA 3VK9A 2VLUA 2ON5A 2EIOA 4IHUA 4DEJA 3GMFA 3M3MA 4RQXA 4MZCA 4Q5QA 2GT5A 2FUG2 2O8VB 3TRPA 3O76A 4EDZA 4ID0A 5H5QA 5EL8A 4MH3A 3TKRA 3C1SA 2GQKA 5IOWA 2C3NA 3GSSA 1AXDA 2ES7A 1K0MA 1QQ2A 2DIZA 3VI5A 1W89A 5ABRA 2DJ0A 4I97A 1EOGA 1OVNA 2HT9A 5G31A 1ZMAA 1PKZA 2C0GA 1XPVA 2CAQA 1YQ1A 3S9FA 1G7EA 3J7Yk 4FH8A 3D22A 4LL4B 1J0FA 1U6TA 3FZAA 4DSSA 3TKPA 2MMOA 1S3CA 2WDUA 3WGDA 4IBPA 4WBJA 1Z6MA 4GWRA 5HR3A 3E3EA 5D96A 4J57E 1NM3A 4PQIA 5GZZB 5J5NA 3LYKA 2H73A 2L5LA 5F06A 4GQFA 5D9VA 4KSMA 1ILOA 4WBRD 1O8WA 4V2NA 4EUYA 2V32A 2X99A 2L4CA 1GNWA 2YJHA 3GNJA 2H0GA 2HZFA 1ON4A 2XBQA 2BTOT 2O89A 4Z7XA 2WJUA 4P3YB 1EEMA 3TRXA 1K0OA 3TOUA 1OYJA 2FD3A 3HZ4A 4TOPA 1AAZA 4XS6A 19GSA 3DVXA 2C0FA 3Q6OA 1FW1A 2H0HA 4I2UA 1Z5YE 1XWCA 1PSQA 3UMAA 4ZB6A 3F9UA 5H5RA 4BL7A 3QDNA 4BVYA 4OD7A 2C0DA 1TRUA 2VM1A 2XBIA 3ZZXA 5LCZA 1AIUA 1XW5A 3HJOA 3NIVA 4TXVA 4KDXA 3EURA 4HUAA 3WT2A 3W8SA 1PA3A 1TRWA 2FHEA 5D9XA 3VWVA 3F6FA 1PL2A 1ZCPA 1EZKA 1BEDA 1O73A 2NDOA 5J41A 5CRDA 3RBTA 2JACA 2GLRA 3VURA 3GTUB 3GKMA 2PUKC 1TW9A 5G1LA 6GSUA 1VRSD 2GDRA 3JCML 1G0TA 1QXHA 1F6MC 1GNEA 3HXSA 4KW6A 4TXOB 1UC7A 3CSHA 5ELGA 1FOVA 4K0GA 3L0HA 4HDEA 3ZREA 4POLA 4JZQA 2F9SA 1TU8A 1V2AA 5ECKB 4KH7A 3LXZA 2VL2A 3C8EA 2RM6A 5ID2B 1XOBA 3GFKA 1ZYEA 1R5PA 1G7OA 1TI3A 3QAWA 2HZEA 1SKWB 1GSYA 2QSIA 2DC5A 2CZ3A 2VL3A 4WR4A 2VO4A 1EEJA 17GSA 4KB3A 3KZQA 1XWKA 3CSJA 5LNKe 4ML1A 1B8XA 1ZZYA 1U3AA 2F8FA 4ZBBA 2HSYA 4TR3A 5HFGA 2P31A 2PVQA 2Z9SA 1HYUA 5DVBA 3QOUA 3VLNA 3KGKA 1QK8A 2R5GA 2IPAA 4TN8A 2DJJA 4G10A 2KOKA 2H74A 3ISOA 2XHFA 1X0RA 5KN2A 5JWRB 5AN1A 5LD0A 4N11A 1AC1A 2C3QA 4DSRA 4EVMA 1BYEA 2XC2A 3L4NA 5ELAA 2P0GA 2B6MA 4NV5A 1WPIA 4Q5NA 3GYKA 2I9HA 2YWMA 5IMDA 3HY2A 4E8HA 1EV9A 3BD2A 1ACVA 1O85A 3RPPA 1S3DA 2DJ1A 2DJ3A 3H8QA 3Q18A 20GSA 2B5YA 4O7HA 3FW2A 1T3BA 5INYA 3DXBA 2B1KA 4OFNA 1CQGA 1GTAA 3LGCA 2HNLA 1XVQA 1UVZA 3H79A 1K3YA 5D9WA 3Q19A 4MPFA 2L4QA 13GSA 2LSTA 4DSQA 1FB6A 5HQPA 2OE3A 5IMZA 1XXUA 3ZLPA 4K6XA 3ERWA 3CBUA 2PVOC 4ISDA 4HEA2 2IMFA 5AIXA 1DBYA 2QKEA 2LUSA 3DEXA 2LS5A 5GSTA 5GSSA 2FCHA 1OC9A 2V6OA 4EF0A 3FZ9A 2B5EA 4F03A 3TKSC 4MK3A 5CRHA 1PRXA 4OFMA 2H71A 3VPQA 2IJYA 4HJMA 1K0DA 4OO4A 2CT6A 1O8XA 3UARA 3WGXA 5DALB 3P7XA 5ECLB 3GX8A 3IRAA 2DMMA 2XPEA 3WD6A 1GUKA 3W6GA 3P8WA 2DBCA 5B7CA 4POKA 4YQMA 3UIWA 4GSSA 2R4VA 2FWHA 3QFBC 2YJ7A 4KX4A 1BG5A 4MF5A 1SL2B 1K0AA 1X5DA 1K0CA 4TVEA 4KCEA 1X9MB 9GSSA 3A2WA 2LJAA 2FWFA 4YAPA 2M72A 1W4VA 2K8VA 3UAPA 4LMWA 1PL1A 4X0XA 5A4VA 1OC8A 3E9JB 2GSTA 1R4WA 5DAKA 1Z7RA 4PURA 3FR3A 3O3TA 4MF7A 2CAIA 5CYYA 4ZL7A 2OBIA 2AJQB 4OCEA 1MDIA 4MABA 1ERVA 1XW6A 4FYUA 4PNGA 2RIIA 4XTSA 3A2XA 4WF5A 4K7NA 5IPGA 4L5OA 4LL1B 1V40A 4TRXA 1ZOFA 1RQMA 1SK2A 3KCMA 1YY7A 1T00A 2VLVA 1NHYA 4LA1A 1FO5A 1Q98A 1A2LA 3M0FA 1LU4A 3GH6A 2LRNA 3LQ7A 4F9ZA 5IIZA 3HCZA 5CNWA 4GSNA 2LNTA 2PERA 1GUMA 3VPTA 5ECPB 4MLYA 1J08A 4XS1A 3A3TA 3UEMA 1X5EA 2K9FA 1TRVA 2HRNA 4J56E 4ZILA 2VIMA 2C8UA 3EE2A 1M2DA 1URMA 3LWAA 1A8YA 3ZITA 3LEFA 4HQSA 4IP6A 4ZB8A 5A4WA 1GL8A 4BVXA 4KE3A 2AB6A 2FA8A 2CX4A 2TIRA 2JSYA 3UJ1A 3IBHA 2C80A 2MMAA 2GZZA 2E7PA 4ZB9A 1PD21 2JZTA 4AGSA 4POBA 4ZBAA 3RHBA 4I8BA 4HQZA 1TKDB 4HOJA 1BAYA 2OJLA 2YV9A 4G19A 1IYIA 3TOTA 2O7KA 4GRFA 4RI6A 5KN0A 5FWGA 6GSVA 3R2QA 2HZEB 4F2IA 1PKWA 3WGEA 1KBNA 3C71A 4OMVA 5DQYA 1OE8A 4AJ7A 1Z9HA 2MMZA 4MJEA 2WULA 4KDYA 2DLXA 4RUVA 4N0VA 2JADA 3MAKA 1EOHA 2OKAA 1M0UA 3IOSA 4ULXA 3W8JA 2K18A 4JR6A 16GSA 4JE1A 1K3LA 2FWGA 1PN9A 1ZGNA 2L6CA 2IMEA 3FRCA 2FGXA 1JZRA 1EGOA 4MF6A 2HI7A 3QAVA 3TCOA 4HZ4A 3Q74A 5DQSA 4K2DA 3H93A 4TR4A 4MP4A 4ZL9A 1BJXA 3LYPA 2V6KA 1HQOA 2HYXA 1UA5A 4FYBA 4ECCA 3FZ4A 1K3OA 2GQMA 2JU5A 1ST9A 2NTOA 3AY8A 1GSQA 2R37A 4NPBA 2IWTA 4N30A 5IM9A 3FYGA 2YPMA 1B9YC 2CV4A 4HU9A 4IGJA 2MZCA 1RW1A 4TKYA 2VAFA 3DVWA 2H70A 4IW9A 2RM5A 4L0WA 1XOAA 1GP1A 1SKSB 5ECSA 2RUFA 1ERUA 3VWUA 5J3RA 5J9CA 2ALBA 4TR1B 3ZFLA 1X5CA 3BBYA 4D73A 1TXXA 1QMVA 1U87A 3L78A 4V2MA 1Y25A 3APQA 3QAGA 2B7KA 2LNSA 1WMJA 3SBCA 3GN3A 3DIEA 4ZIJA 1GRXA 1F37A 4K7IA 5IO0A 2X8CA 3KTLA 5J4UA 2LTKA 2A4VA 2VCXA 1ERTA 2WRTA 1O6JA 1OC9B 1LJRA 1ZL9A 2E0QA 2PWJA 3GX0A 1Z6NA 5KN3A 2FNOA 3PH9A 4EL1A 1TP9A 4FYCA 1R26A 3QMXA 1Y6EA 5CRGA 5DCGA 2YZHA 2FA4A 1SYRA 2OE1A 4ECBA 3IC4A 3TDGA 4ILFA 2HE3A 3H4KA 1MDJA 5H5SA 2QGVA 2H01A 1AUCA 2PMTA 3IV4A 1MDKA 1KNGA 3SWLA 1YKAA 2NBSA 1WP0A 5A4UA 3TJJA 3L9VA 2V2GA 4ACSA 1T8EB 3GHAA 1YF1A 5G5FA 5B6NA 2MBTA 3KEBA 2OA7A 4WXTA 5KEJA 5CO3A 2H1BA 4K8MA 3L9SA 1OE7A 1F3BA 3ZVJA 4PX1A 4BA7A 2R2JA 4F0BA 4IVFA 3EU3A 2GVPA 2IFQB 2GT6A 3VFIA 1VF4A 2KHPA 2AHEA 2PN8A 4IN0A 1WRYA 2PBJA 1A2MA 11GSA 2P5QA 1GSFA 3C73A 3HZ8A 3RDWA 1QFNA 3I6AA 5G30A 5J9BA 12GSA 2GSRA 3F3RA 3F3QA 3M9JA 2CQ9A 1H75A 2VCVA 4V1Ap 4YAVA 1QUWA 2H75A 2VCWA 2GSSA 1FG4A 2C0EA 3FEUA 1TDIA 4KDUA 1R7HA 3ERFA 3HKRA 3UVTA 3M9KA 2E2MA 1THOA 2V41A 1FHEA 3KH7A 2DSAA 2LKUA 1S3AA 2X64A 4CHSA 3ZFBA 2H1DA 3BCKA 4NHWA 1T1VA 3CXGA 1TK8B 1T4ZA 2H19A 5ECRB 1A0RP 3IE3A 5IMVA 1SK0A 1GSSA 5JWOB 3KTBA 3GRXA 4QL9A 5IPHA 4XS4B 1PX7A 5B6MA 1C72A 3TGZA 1I9DA 3PR8A 5L71A 4OCFA
chains in the Genus database with same CATH superfamily
2L59A 1Z3EA 5IMAA 3A5IA 1NSWA 4AF2A 1FVJA 1GSUA 2C1YA 3GKNA 5ECOB 4I2TA 3GTUA 1A2JA 1XWAA 2IMKA 4JBBA 3EU4A 4IQ1A 2MYGA 3F0IA 4ECIA 3EMXA 2WB9A 3GURA 1R5AA 2KUCA 5DJMA 4BWSA 4FIWA 3N5OA 4TW5A 2PGTA 3CMIA 1M3IA 1SL0B 3U5RE 3F4RA 4PUAA 5DJLA 1XW9A 2H0IA 2WS2A 4LMVA 3HHVA 4EXJA 5HFIA 1FB0A 2LRTA 3F6DA 2F3MA 3EMPA 3EC3A 5DCHA 5E4WA 5ID2A 1SD9A 1WOUA 4J2FA 4MCUA 4F0CA 3DMLA 4WR5A 1GH2A 4MA9A 5D73A 5D93A 2TRXA 3GIXA 3G7YA 2CVBA 1EGRA 1BX9A 5IQYA 4DSSB 4O32A 3HA9A 1X9WB 1XFLA 4OWYA 4HU7A 1LBKA 3DGQA 1V98A 2LJKA 4ML6A 4PGTA 4K1FA 3LSZA 3VWWA 1FAAA 2AV4A 10GSA 2WCIA 1VF1A 4IS0A 3BJ5A 4QQ7A 4KAEA 1OC3A 2VUPA 3CSIA 3IAS2 2H76A 4O5RA 4POMA 4IP1A 2LV3A 1JZWA 1A0FA 3L9UA 4RI7A 1O81A 1TJDA 2YCDA 5AIVA 4KSOA 4V1Ag 2H6XA 4PQ1A 1AQVA 2VL9A 4EE0A 3G7IA 1FOHA 4K0NA 2VL2C 3D4TA 5FHIA 3F4SA 1GUHA 1USBA 2IMDA 4XRAA 4E8EA 4ZBDA 3IK9A 1ZYQB 1NHOA 2H30A 3ZVJD 3KH9A 2A4HA 4O92A 1SL1B 4DVCA 4BL7B 4MZWA 4BVYB 1AQXA 2A2RA 2X8GA 1YJ6A 4F82A 4MZBA 2LQQA 2NPBA 3ME7A 3G7JA 2VM2A 4EO3A 2JSZA 3MNGA 4JRRA 1Q4JA 4OO5A 3IK7A 4Q5FA 3KJYA 1WWJA 1A8LA 4H86A 1NW2A 3N9JA 2O87A 1THXA 1MD3A 1O7UA 3NOFA 3BCIA 1VF2A 1KTEA 4HI7A 5ECQB 3HJPA 3HYPA 2EC4A 3ED3A 5G2ZA 1XVWA 4MMMA 1WE0A 5COHA 3UBLA 5ECMB 5ECHB 1Z7PA 1GTBA 2TRCP 5EPFA 2N5BA 3FKFA 5KN1A 2VCZA 1SJ6A 2GSQA 3UVHA 1GLPA 1DSBA 2HRFA 1YKCA 3ME8A 2HXKA 3FR9A 2EIRA 2I81A 1PN0A 6GSXA 3C7MA 2CVKA 2HRKA 4JEDA 1OKDA 4XCSA 5CP1A 3LXTA 4N0ZA 1PGTA 3ZIVA 3O6TA 1F9MA 3TKSE 3EINA 5ENUA 3VWXA 3RHCA 2EIQA 3OR5A 1IYHA 3M8NA 1H4OA 5FT3A 2VCQA 2CVDA 4EC0A 1TOFA 4N10A 5DALA 1KEBA 3FK8A 2LEGA 2J23A 4YH2A 2VOCA 3VI7A 2BJXA 2NVLA 2H8LA 1JFUA 2I1UA 2YWNA 1CQHA 1X9SB 1E2YA 4GSTA 3IXRA 5EVOA 2WFCA 5C04A 4L0UA 2R0PA 4HJ2A 4ZXGA 5EY6A 2GGTA 2LRCA 3DYRA 2VD1A 2HLSA 3IDVA 1XIYA 3QFAC 2OE0A 1K0BA 2KP2A 4YQVA 2D2ZA 1TRSA 2C3TA 5GAND 4IQAA 3TKQA 3HVVA 1SKRB 4MPGA 3D0ZA 2YWIA 1XZOA 3F4TA 1PQNA 1B4QA 2K6VA 1EP7A 5ECNB 5D9TA 5HR0A 4TR0A 1PX6A 3TJGA 6GSTA 2H66A 3QCPA 2OBKA 1EV4A 1U88A 2I4AA 4XHMA 4K5SA 3H1NA 3LG6A 4IELA 3CRTA 3F8UA 4RQRA 2AUVA 3QD9A 4EIPA 3HVSA 1XWGA 5CREA 2M80A 3FY7A 4WF4A 5IMFA 3TKSA 4I6XA 4IJ3A 4WETA 4EKZA 4Z2TA 2F51A 3G9BA 3U6VA 5CAXA 1TTZA 3M1GA 4NXIA 1B4PA 5JCWA 3I9V2 7GSSA 5IOXA 1I5GA 2GZYA 3GUSA 1XCCA 4AJ6A 4V2LA 4K7OA 2AYTA 3ZMKA 3J7Yb 1JHBA 3EYTA 4EDYA 4YQUA 1UN2A 4BWQA 1MEKA 5CRWA 3IR4A 1VF3A 4CW9A 1K0NA 1YF0A 3CTFA 1N8JA 3E0UA 4OFTA 1SYXA 3FHKA 3BOAA 4MH2A 2FWEA 3GV1A 2YOIA 3HD5A 4WKWA 3NZNA 1GTUA 3I69A 5F07A 2B1LA 1A23A 2H1AA 1JLVA 3KIJA 2WZ9A 2RLIA 5B8BA 4MDCA 2FY6A 2FLSA 4X1UA 3ZYWA 1M2BA 2RUEA 3PINA 3A2VA 5F0GA 1QGVA 1JZOA 2OADA 4IJIA 3IAM2 1V58A 5B8AA 3C1RA 1AW9A 2YWOA 5JCUA 8GSSA 3MWHA 3D21A 2GTUA 2IL3A 1M99A 3TB2A 4ZL8A 2ON7A 2E2GA 1U3IA 4CDOA 2X4AA 1GSEA 1DE2A 4GLTA 2H6ZA 3GKKA 2KP1A 2JZRA 1SD8A 4PUFC 4G0LA 3TJKA 2K8SA 3FR6A 4JR4A 3LORA 1ABAA 4MJBA 1M2AA 3ERGA 1J9BA 2B3SA 4IKHA 2GQLA 2IN3A 1OKTA 5JWQB 3TJBA 1XWBA 2L57A 3KM6A 1YDKA 1FVKA 3TUEA 3TJFA 2XPDA 2ZCTA 3V1WA 1TK0B 5JCGA 3HJMA 4PNFA 3ZMLA 2P5RA 6GSYA 4NV2A 2LQOA 5DAKB 4QL7A 2H1GA 3D5JA 4YKGA 1SU9A 1B9XC 1N2AA 3QR6A 4PXOA 1DE1A 3GKXA 3ZTLA 1GWCA 1HNAA 3TRQA 4FO5A 2G2QA 5DBQA 4NWYA 1G6YA 3KMNA 4L5LA 4EIQA 2GZPA 1M9BA 2L6DA 4KUNA 5HR1A 4MJCA 4KCAA 1HD2A 2DMLA 2YV7A 3ZL5A 2X49A 3WYWA 3KP8A 2F8AA 5HFKA 2G0FA 1OAZA 3DD3A 22GSA 3CRUA 3RAZA 3APOA 1T4YA 1F3AA 4K9ZA 3DRNA 3LJRA 2IIYA 2PPTA 5G1KA 2AAWA 4HZ2A 3UBKA 2YANA 2OACA 5G5EA 4TR1A 1V9WA 1BQ7A 5AGYA 3GL5A 2YN1A 3MIXA 4AJ8A 1M7TA 3PGTA 1YZXA 2O85A 1A24A 1GLQA 4BVXB 3US3A 3RPNA 3IHQA 1WJKA 2KLXA 4LLRA 3QPMA 1TI1A 2R6KA 2JZSA 1GSDA 1RK4A 2M46A 3EVIA 4X43A 2B7JA 1JLWA 3K8NA 5HR2A 1XG8A 2N5AA 2ZNMA 1EWXA 4I5QA 4TXOA 2QA1A 2V1MA 1GULA 1YEXA 2JL4A 1V57A 3EPTA 3DKSA 5F05A 2R3XA 3IA1A 3A5WA 5C00A 2C4JA 3KXOA 1T7PB 2H6YA 2WGRA 2I3YA 3KP9A 4KGIA 2MMNA 1ZYPA 4G9HA 2J9HA 1F2EA 1TU7A 4WEYA 2B5XA 1ERWA 4NAXA 2CX3A 3KD0A 4XIHA 1XBSA 2HFDA 2N5FA 1SJIA 2L5OA 3UL3A 1PMTA 2IMIA 3CTGA 4KA0A 4G2EA 4L8EA 3APSA 1YEPA 5E59A 5A5KA 1MD4A 3P90A 5DDLA 5ECIB 3D6IA 4GCIA 5D8IA 3GL3A 4MJAA 2VD0A 3DWVA 1E6BA 4GXZA 4NMUA 3EWLA 1VGLA 4ECJA 4XRDA 3GA4A 3D4MA 2A2SA 2IFQA 3P2AA 2REMA 6GSWA 2YZUA 1B48A 1WIKA 1MTCA 2YNXA 2YP6A 2ZUPA 3CYNA 4NHZA 2LJRA 5F8BA 3UOMA 1ML6A 1TK5B 4O5QA 3MSZA 2DIYA 1GTIA 2X8HA 4GF0A 2BMXA 1HNBA 5IMCA 3WT1A 3MDKA 3GSTA 1JZDA 1G6WA 4K2XA 2HSMA 2DJKA 2QC7A 2H72A 4KNDA 4PQHA 2MBSA 2VLTA 3HVXA 1SENA 2GS3A 3CQFA 18GSA 6GSSA 1HNCA 4Q5RA 14GSA 1M9AA 3F63A 1SK1A 4JU5A 2HSHA 2PU9C 4GQCA 2CZ2A 4D73B 3GH9A 1EP8A 2DJ2A 3FZ5A 3IPZA 5IO2A 2UZ8A 2CA8A 3ZIJA 5GAPD 4HS1A 2VCTA 3LFLA 4BPYA 3ZRDA 4XS4A 3HDCA 3R3EA 3I43A 5AISA 4GTUA 1SJZA 1DUGA 3KMOA 1AQWA 3VK9A 2VLUA 2ON5A 3IHGA 2EIOA 4IHUA 4DEJA 3GMFA 3M3MA 4RQXA 4MZCA 4Q5QA 2GT5A 2FUG2 2O8VB 3TRPA 3O76A 4EDZA 4ID0A 5H5QA 5EL8A 4MH3A 3TKRA 3C1SA 2GQKA 5IOWA 2C3NA 3GSSA 1AXDA 2ES7A 1K0MA 1QQ2A 5BRTA 2DIZA 3VI5A 1W89A 5ABRA 2DJ0A 4I97A 1EOGA 1OVNA 2HT9A 5G31A 1ZMAA 1PKZA 2C0GA 1XPVA 2CAQA 1YQ1A 3S9FA 1G7EA 3J7Yk 4FH8A 3D22A 4LL4B 1J0FA 1U6TA 1M3JA 3FZAA 4DSSA 3TKPA 2MMOA 1S3RA 3FMWA 1S3CA 2WDUA 3WGDA 4IBPA 4WBJA 1Z6MA 4GWRA 5HR3A 3E3EA 5D96A 4J57E 1NM3A 4PQIA 5GZZB 5J5NA 3LYKA 2H73A 2L5LA 5F06A 4GQFA 5D9VA 4KSMA 1ILOA 4WBRD 1O8WA 4V2NA 4EUYA 2V32A 2X99A 2L4CA 1GNWA 2YJHA 3GNJA 2H0GA 2HZFA 1ON4A 2XBQA 2BTOT 2O89A 4Z7XA 2WJUA 4P3YB 1EEMA 3TRXA 1K0OA 3TOUA 1OYJA 2FD3A 3HZ4A 4TOPA 1AAZA 4XS6A 19GSA 3DVXA 2C0FA 3Q6OA 1FW1A 2H0HA 4I2UA 1Z5YE 1XWCA 1PSQA 3UMAA 4ZB6A 3F9UA 4KF9A 5H5RA 4BL7A 3QDNA 4BVYA 4OD7A 2C0DA 1TRUA 2VM1A 2XBIA 3ZZXA 5LCZA 1AIUA 1XW5A 3HJOA 3NIVA 4TXVA 4KDXA 3EURA 4HUAA 3WT2A 3W8SA 1PA3A 1TRWA 2FHEA 5D9XA 3VWVA 3F6FA 1PL2A 1ZCPA 1EZKA 1BEDA 1O73A 2NDOA 5J41A 5CRDA 3RBTA 2JACA 2GLRA 3VURA 3GTUB 3GKMA 2PUKC 1TW9A 5G1LA 4X4JA 6GSUA 1VRSD 2GDRA 3JCML 1G0TA 1QXHA 1F6MC 2R0GA 1GNEA 3HXSA 4KW6A 4TXOB 1UC7A 3CSHA 5ELGA 1FOVA 4K0GA 3L0HA 4HDEA 3ZREA 4POLA 4JZQA 2F9SA 1TU8A 1V2AA 5ECKB 4KH7A 3LXZA 2VL2A 3C8EA 2RM6A 5ID2B 1XOBA 3GFKA 1ZYEA 1R5PA 1G7OA 1TI3A 3QAWA 2HZEA 1SKWB 1GSYA 2QSIA 2DC5A 2CZ3A 2VL3A 4WR4A 2VO4A 1EEJA 17GSA 4KB3A 3KZQA 1XWKA 3CSJA 5LNKe 4ML1A 1B8XA 1ZZYA 1U3AA 2F8FA 4ZBBA 2HSYA 4TR3A 5HFGA 2P31A 2PVQA 2Z9SA 1HYUA 5DVBA 3QOUA 3HVNA 3VLNA 3KGKA 1QK8A 2A2PA 2R5GA 2IPAA 4TN8A 2DJJA 4G10A 2KOKA 2H74A 3ISOA 2XHFA 1X0RA 5KN2A 5JWRB 5AN1A 5LD0A 4N11A 3MYDA 1AC1A 2C3QA 4DSRA 4EVMA 1BYEA 2XC2A 3L4NA 5ELAA 2P0GA 2B6MA 4NV5A 1WPIA 4Q5NA 3GYKA 2I9HA 2YWMA 5IMDA 4G0KA 3HY2A 4E8HA 1EV9A 3BD2A 1ACVA 1O85A 3RPPA 4FQUA 1S3DA 2DJ1A 2DJ3A 3H8QA 3Q18A 20GSA 2B5YA 4O7HA 3FW2A 1T3BA 5INYA 3DXBA 2B1KA 4OFNA 1CQGA 1GTAA 3LGCA 2HNLA 1XVQA 1UVZA 3H79A 1K3YA 5D9WA 3Q19A 4MPFA 2L4QA 13GSA 2LSTA 5BMUA 4DSQA 1FB6A 5HQPA 2OE3A 5IMZA 3LW9A 1XXUA 3ZLPA 4K6XA 3ERWA 3CBUA 2PVOC 4ISDA 4HEA2 2IMFA 4Z2RA 5AIXA 1DBYA 2QKEA 2LUSA 3DEXA 2LS5A 5GSTA 5GSSA 1PFOA 2FCHA 1OC9A 5KOXA 2V6OA 4EF0A 4USSA 3FZ9A 2B5EA 4F03A 3TKSC 4MK3A 5CRHA 1PRXA 4OFMA 5KOWA 2H71A 3VPQA 2IJYA 4HJMA 1K0DA 4OO4A 2CT6A 1O8XA 3UARA 3WGXA 5DALB 3P7XA 4YKFA 5ECLB 3GX8A 3IRAA 2DMMA 2XPEA 3WD6A 1GUKA 3W6GA 3P8WA 2DBCA 5B7CA 4POKA 4YQMA 3UIWA 4GSSA 2R4VA 2FWHA 3QFBC 2YJ7A 4KX4A 1BG5A 4MF5A 1SL2B 1K0AA 1X5DA 1K0CA 4TVEA 4KCEA 1X9MB 9GSSA 3A2WA 2LJAA 2FWFA 4YAPA 2M72A 1W4VA 2K8VA 3UAPA 4LMWA 1PL1A 2QA2A 4X0XA 5A4VA 1OC8A 3E9JB 2GSTA 1R4WA 5DAKA 1Z7RA 4PURA 3FR3A 3O3TA 4MF7A 2CAIA 5CYYA 4ZL7A 2OBIA 2AJQB 4OCEA 1MDIA 4MABA 1ERVA 1XW6A 4FYUA 4PNGA 2RIIA 4XTSA 3A2XA 4WF5A 4K7NA 5IPGA 4L5OA 4LL1B 1V40A 4TRXA 1ZOFA 1RQMA 1SK2A 3KCMA 1YY7A 1T00A 2VLVA 1NHYA 4LA1A 1FO5A 1Q98A 1A2LA 3M0FA 1LU4A 3GH6A 2LRNA 3LQ7A 4F9ZA 5IIZA 3HCZA 5CNWA 4GSNA 2LNTA 2PERA 1GUMA 3VPTA 5ECPB 4MLYA 1J08A 4XS1A 3A3TA 3UEMA 1X5EA 2K9FA 1TRVA 2HRNA 4J56E 4ZILA 2VIMA 2C8UA 3EE2A 1M2DA 1URMA 3LWAA 1A8YA 3ZITA 3LEFA 4CY6A 4HQSA 4IP6A 4ZB8A 5A4WA 1GL8A 4BVXA 4KE3A 2AB6A 2FA8A 2CX4A 2TIRA 2JSYA 3UJ1A 3IBHA 2C80A 2MMAA 2GZZA 2E7PA 4PTSA 4ZB9A 1PD21 2JZTA 4AGSA 4POBA 4ZBAA 3RHBA 4I8BA 4HQZA 1TKDB 3PPUA 4HOJA 1BAYA 2OJLA 4G0IA 2YV9A 4G19A 1IYIA 3TOTA 2O7KA 4GRFA 4RI6A 4K5RA 5KN0A 5FWGA 6GSVA 2DKHA 3R2QA 2HZEB 4F2IA 1PKWA 3WGEA 1KBNA 3C71A 4OMVA 5DQYA 1OE8A 4AJ7A 1Z9HA 2MMZA 4MJEA 2WULA 4KDYA 2DLXA 4RUVA 4N0VA 2JADA 3MAKA 1EOHA 2OKAA 1M0UA 3IOSA 4ULXA 3W8JA 2K18A 4JR6A 16GSA 4JE1A 1K3LA 2FWGA 1PN9A 1ZGNA 2L6CA 2IMEA 3FRCA 2FGXA 1JZRA 1EGOA 4MF6A 2HI7A 3QAVA 3TCOA 4HZ4A 3Q74A 5DQSA 4K2DA 3H93A 4TR4A 4MP4A 4ZL9A 4Z2UA 3LYPA 1BJXA 2V6KA 1HQOA 2HYXA 2R0CA 1UA5A 4FYBA 4ECCA 3FZ4A 1K3OA 2GQMA 2JU5A 1ST9A 2NTOA 3AY8A 1GSQA 2R37A 4NPBA 2IWTA 4N30A 5IM9A 4BIKA 3FYGA 2YPMA 1B9YC 2CV4A 4HU9A 4IGJA 2MZCA 1RW1A 4TKYA 2VAFA 3DVWA 2H70A 4IW9A 2RM5A 4L0WA 1XOAA 1GP1A 1SKSB 5ECSA 2RUFA 1ERUA 3VWUA 5J3RA 5J9CA 2ALBA 4TR1B 3ZFLA 1X5CA 3BBYA 4D73A 1TXXA 1QMVA 1U87A 3L78A 4V2MA 1Y25A 3APQA 3QAGA 2B7KA 2LNSA 1WMJA 3SBCA 3GN3A 3DIEA 4ZIJA 1GRXA 1F37A 4K7IA 5IO0A 2X8CA 3KTLA 5J4UA 2LTKA 4O5UA 2A4VA 2VCXA 1ERTA 2WRTA 1O6JA 4A5PA 1OC9B 1LJRA 1ZL9A 2E0QA 2PWJA 3GX0A 1Z6NA 5KN3A 2FNOA 3PH9A 4EL1A 1TP9A 2DKIA 4FYCA 1R26A 3QMXA 1Y6EA 5CRGA 5DCGA 2YZHA 2FA4A 1SYRA 2OE1A 4ECBA 3IC4A 3TDGA 4ILFA 2HE3A 3H4KA 1MDJA 5H5SA 2QGVA 2H01A 1AUCA 2PMTA 3IV4A 1MDKA 2HRAA 4MNNA 1KNGA 3SWLA 1YKAA 2NBSA 1WP0A 5A4UA 3TJJA 3L9VA 2V2GA 4ACSA 1T8EB 3GHAA 4HSCX 1YF1A 5G5FA 5B6NA 2MBTA 3KEBA 2OA7A 4WXTA 5KEJA 5CO3A 2H1BA 4K8MA 3L9SA 4ICYA 1OE7A 1F3BA 3ZVJA 4PX1A 4BA7A 2R2JA 4F0BA 4IVFA 3EU3A 1ZYNA 2GVPA 2IFQB 2GT6A 3VFIA 1VF4A 2KHPA 2AHEA 2PN8A 4IN0A 1WRYA 2PBJA 1A2MA 4CY8A 11GSA 2P5QA 1GSFA 3C73A 3HZ8A 3IC8A 3RDWA 1QFNA 3I6AA 5G30A 5J9BA 12GSA 2GSRA 3F3RA 3F3QA 3M9JA 2CQ9A 1H75A 2VCVA 4V1Ap 4YAVA 1QUWA 2H75A 2VCWA 2GSSA 1FG4A 2C0EA 3FEUA 1TDIA 4KDUA 1R7HA 3ERFA 3HKRA 3UVTA 3M9KA 2E2MA 1THOA 2V41A 1FHEA 3KH7A 2DSAA 2LKUA 1S3AA 2X64A 4CHSA 3ZFBA 2H1DA 3BCKA 4NHWA 1T1VA 3CXGA 1TK8B 1T4ZA 2H19A 5ECRB 1A0RP 3IE3A 5IMVA 1SK0A 1GSSA 5JWOB 3KTBA 3GRXA 4QL9A 5IPHA 4XS4B 1PX7A 5B6MA 1C72A 3TGZA 1I9DA 3PR8A 5L71A 4OCFA
chains in the Genus database with same CATH topology
2L59A 1Z3EA 5IMAA 3A5IA 1NSWA 4AF2A 1FVJA 1GSUA 2C1YA 3GKNA 5ECOB 4I2TA 3GTUA 1A2JA 1XWAA 2IMKA 4JBBA 3EU4A 4IQ1A 2MYGA 3F0IA 4ECIA 3EMXA 2WB9A 3GURA 1R5AA 2KUCA 5DJMA 4BWSA 4FIWA 3N5OA 4TW5A 2PGTA 3CMIA 1SL0B 3U5RE 3F4RA 4PUAA 5DJLA 1XW9A 2H0IA 2WS2A 4LMVA 3HHVA 4EXJA 5HFIA 1FB0A 2LRTA 3F6DA 2F3MA 3EMPA 3EC3A 5DCHA 5E4WA 5ID2A 1SD9A 1WOUA 4J2FA 4MCUA 4F0CA 3DMLA 4WR5A 1GH2A 4MA9A 5D73A 5D93A 2TRXA 3GIXA 3G7YA 2CVBA 1EGRA 1BX9A 5IQYA 4DSSB 4O32A 3HA9A 1X9WB 1XFLA 4OWYA 4HU7A 1LBKA 3DGQA 1V98A 2LJKA 4ML6A 4PGTA 4K1FA 3LSZA 3VWWA 1FAAA 2AV4A 10GSA 2WCIA 1VF1A 4IS0A 3BJ5A 4QQ7A 4KAEA 1OC3A 2VUPA 3CSIA 3IAS2 2H76A 4O5RA 4POMA 4IP1A 2LV3A 1JZWA 1A0FA 3L9UA 4RI7A 1O81A 1TJDA 2YCDA 5AIVA 4KSOA 4V1Ag 2H6XA 4PQ1A 1AQVA 2VL9A 4EE0A 3G7IA 1FOHA 4K0NA 2VL2C 3D4TA 5FHIA 3F4SA 1GUHA 1USBA 2IMDA 4XRAA 4E8EA 4ZBDA 3IK9A 1ZYQB 1NHOA 2H30A 3ZVJD 3KH9A 2A4HA 4O92A 1SL1B 4DVCA 4BL7B 4MZWA 4BVYB 1AQXA 2A2RA 2X8GA 1YJ6A 4F82A 4MZBA 2LQQA 2NPBA 3ME7A 3G7JA 2VM2A 4EO3A 2JSZA 3MNGA 4JRRA 1Q4JA 4OO5A 3IK7A 4Q5FA 3KJYA 1WWJA 1A8LA 4H86A 1NW2A 3N9JA 2O87A 1THXA 1MD3A 1O7UA 3NOFA 3BCIA 1VF2A 1KTEA 4HI7A 5ECQB 3HJPA 3HYPA 2EC4A 3ED3A 5G2ZA 1XVWA 4MMMA 1WE0A 5COHA 3UBLA 5ECMB 5ECHB 1Z7PA 1GTBA 2TRCP 5EPFA 2N5BA 3FKFA 5KN1A 2VCZA 1SJ6A 2GSQA 3UVHA 1GLPA 1DSBA 2HRFA 1YKCA 3ME8A 2HXKA 3FR9A 2EIRA 2I81A 1PN0A 6GSXA 3C7MA 2CVKA 2HRKA 4JEDA 1OKDA 4XCSA 5CP1A 3LXTA 4N0ZA 1PGTA 3ZIVA 3O6TA 1F9MA 3TKSE 3EINA 5ENUA 3VWXA 3RHCA 2EIQA 3OR5A 1IYHA 3M8NA 1H4OA 5FT3A 2VCQA 2CVDA 4EC0A 1TOFA 4N10A 5DALA 1KEBA 3FK8A 2LEGA 2J23A 4YH2A 2VOCA 3VI7A 2BJXA 2NVLA 2H8LA 1JFUA 2I1UA 2YWNA 1CQHA 1X9SB 1E2YA 4GSTA 3IXRA 5EVOA 2WFCA 5C04A 4L0UA 2R0PA 4HJ2A 4ZXGA 5EY6A 2GGTA 2LRCA 3DYRA 2VD1A 2HLSA 3IDVA 1XIYA 3QFAC 2OE0A 1K0BA 2KP2A 4YQVA 2D2ZA 1TRSA 2C3TA 5GAND 4IQAA 3TKQA 3HVVA 1SKRB 4MPGA 3D0ZA 2YWIA 1XZOA 3F4TA 1PQNA 1B4QA 2K6VA 1EP7A 5ECNB 5D9TA 5HR0A 4TR0A 1PX6A 3TJGA 6GSTA 2H66A 3QCPA 2OBKA 1EV4A 1U88A 2I4AA 4XHMA 4K5SA 3H1NA 3LG6A 4IELA 3CRTA 3F8UA 4RQRA 2AUVA 3QD9A 4EIPA 3HVSA 1XWGA 5CREA 2M80A 3FY7A 4WF4A 5IMFA 3TKSA 4I6XA 4IJ3A 4WETA 4EKZA 4Z2TA 2F51A 3G9BA 3U6VA 5CAXA 1TTZA 3M1GA 4NXIA 1B4PA 5JCWA 3I9V2 7GSSA 5IOXA 1I5GA 2GZYA 3GUSA 1XCCA 4AJ6A 4V2LA 4K7OA 2AYTA 3ZMKA 3J7Yb 1JHBA 3EYTA 4EDYA 4YQUA 1UN2A 4BWQA 1MEKA 5CRWA 3IR4A 1VF3A 4CW9A 1K0NA 1YF0A 3CTFA 1N8JA 3E0UA 4OFTA 1SYXA 3FHKA 3BOAA 4MH2A 2FWEA 3GV1A 2YOIA 3HD5A 4WKWA 3NZNA 1GTUA 3I69A 5F07A 2B1LA 1A23A 2H1AA 1JLVA 3KIJA 2WZ9A 2RLIA 5B8BA 4MDCA 2FY6A 2FLSA 4X1UA 3ZYWA 1M2BA 2RUEA 3PINA 3A2VA 5F0GA 1QGVA 1JZOA 2OADA 4IJIA 3IAM2 1V58A 5B8AA 3C1RA 1AW9A 2YWOA 5JCUA 8GSSA 3MWHA 3D21A 2GTUA 2IL3A 1M99A 3TB2A 4ZL8A 2ON7A 2E2GA 1U3IA 4CDOA 2X4AA 1GSEA 1DE2A 4GLTA 2H6ZA 3GKKA 2KP1A 2JZRA 1SD8A 4PUFC 4G0LA 3TJKA 2K8SA 3FR6A 4JR4A 3LORA 1ABAA 4MJBA 1M2AA 3ERGA 1J9BA 2B3SA 4IKHA 2GQLA 2IN3A 1OKTA 5JWQB 3TJBA 1XWBA 2L57A 3KM6A 1YDKA 1FVKA 3TUEA 3TJFA 2XPDA 2ZCTA 3V1WA 1TK0B 5JCGA 3HJMA 4PNFA 3ZMLA 2P5RA 6GSYA 4NV2A 2LQOA 5DAKB 4QL7A 2H1GA 3D5JA 4YKGA 1SU9A 1B9XC 1N2AA 3QR6A 4PXOA 1DE1A 3GKXA 3ZTLA 1GWCA 1HNAA 3TRQA 4FO5A 2G2QA 5DBQA 4NWYA 1G6YA 3KMNA 4L5LA 4EIQA 2GZPA 1M9BA 2L6DA 4KUNA 5HR1A 4MJCA 4KCAA 1HD2A 2DMLA 2YV7A 3ZL5A 2X49A 3WYWA 3KP8A 2F8AA 5HFKA 2G0FA 1OAZA 3DD3A 22GSA 3CRUA 3RAZA 3APOA 1T4YA 1F3AA 4K9ZA 3DRNA 3LJRA 2IIYA 2PPTA 5G1KA 2AAWA 4HZ2A 3UBKA 2YANA 2OACA 5G5EA 4TR1A 1V9WA 1BQ7A 5AGYA 3GL5A 2YN1A 3MIXA 4AJ8A 1M7TA 3PGTA 1YZXA 2O85A 1A24A 1GLQA 4BVXB 3US3A 3RPNA 3IHQA 1WJKA 2KLXA 4LLRA 3QPMA 1TI1A 2R6KA 2JZSA 1GSDA 1RK4A 2M46A 3EVIA 4X43A 2B7JA 1JLWA 3K8NA 5HR2A 2N5AA 2ZNMA 1EWXA 4I5QA 4TXOA 2QA1A 2V1MA 1GULA 1YEXA 2JL4A 1V57A 3EPTA 3DKSA 5F05A 2R3XA 3IA1A 3A5WA 5C00A 2C4JA 3KXOA 1T7PB 2H6YA 2WGRA 2I3YA 3KP9A 4KGIA 2MMNA 1ZYPA 4G9HA 2J9HA 1F2EA 1TU7A 4WEYA 2B5XA 1ERWA 4NAXA 2CX3A 3KD0A 4XIHA 1XBSA 2HFDA 2N5FA 1SJIA 2L5OA 3UL3A 1PMTA 2IMIA 3CTGA 4KA0A 4G2EA 4L8EA 3APSA 1YEPA 5E59A 5A5KA 1MD4A 3P90A 5DDLA 5ECIB 3D6IA 4GCIA 5D8IA 3GL3A 4MJAA 2VD0A 3DWVA 1E6BA 4GXZA 4NMUA 3EWLA 1VGLA 4ECJA 4XRDA 3GA4A 3D4MA 2A2SA 2IFQA 3P2AA 2REMA 6GSWA 2YZUA 1B48A 1WIKA 1MTCA 2YNXA 2YP6A 2ZUPA 3CYNA 4NHZA 2LJRA 5F8BA 3UOMA 1ML6A 1TK5B 4O5QA 3MSZA 2DIYA 1GTIA 2X8HA 4GF0A 2BMXA 1HNBA 5IMCA 3WT1A 3MDKA 3GSTA 1JZDA 1G6WA 4K2XA 2HSMA 2DJKA 2QC7A 2H72A 4KNDA 4PQHA 2MBSA 2VLTA 3HVXA 1SENA 2GS3A 18GSA 6GSSA 1HNCA 4Q5RA 14GSA 1M9AA 3F63A 1SK1A 4JU5A 2HSHA 2PU9C 4GQCA 2CZ2A 4D73B 3GH9A 1EP8A 2DJ2A 3FZ5A 3IPZA 5IO2A 2UZ8A 2CA8A 3ZIJA 5GAPD 4HS1A 2VCTA 3LFLA 4BPYA 3ZRDA 4XS4A 3HDCA 3R3EA 3I43A 5AISA 4GTUA 1SJZA 1DUGA 3KMOA 1AQWA 3VK9A 2VLUA 2ON5A 3IHGA 2EIOA 4IHUA 4DEJA 3GMFA 3M3MA 4RQXA 4MZCA 4Q5QA 2GT5A 2FUG2 2O8VB 3TRPA 3O76A 4EDZA 4ID0A 5H5QA 5EL8A 4MH3A 3TKRA 3C1SA 2GQKA 5IOWA 2C3NA 3GSSA 1AXDA 2ES7A 1K0MA 1QQ2A 5BRTA 2DIZA 3VI5A 1W89A 5ABRA 2DJ0A 4I97A 1EOGA 1OVNA 2HT9A 5G31A 1ZMAA 1PKZA 2C0GA 1XPVA 2CAQA 1YQ1A 3S9FA 1G7EA 3J7Yk 4FH8A 3D22A 4LL4B 1J0FA 1U6TA 3FZAA 4DSSA 3TKPA 2MMOA 3FMWA 1S3CA 2WDUA 3WGDA 4IBPA 4WBJA 1Z6MA 4GWRA 5HR3A 3E3EA 5D96A 4J57E 1NM3A 4PQIA 5GZZB 5J5NA 3LYKA 2H73A 2L5LA 5F06A 4GQFA 5D9VA 4KSMA 1ILOA 4WBRD 1O8WA 4V2NA 4EUYA 2V32A 2X99A 2L4CA 1GNWA 2YJHA 3GNJA 2H0GA 2HZFA 1ON4A 2XBQA 2BTOT 2O89A 4Z7XA 2WJUA 4P3YB 1EEMA 3TRXA 1K0OA 3TOUA 1OYJA 2FD3A 3HZ4A 4TOPA 1AAZA 4XS6A 19GSA 3DVXA 2C0FA 3Q6OA 1FW1A 2H0HA 4I2UA 1Z5YE 1XWCA 1PSQA 3UMAA 4ZB6A 3F9UA 4KF9A 5H5RA 4BL7A 3QDNA 4BVYA 4OD7A 2C0DA 1TRUA 2VM1A 2XBIA 3ZZXA 5LCZA 1AIUA 1XW5A 3HJOA 3NIVA 4TXVA 4KDXA 3EURA 4HUAA 3WT2A 3W8SA 1PA3A 1TRWA 2FHEA 5D9XA 3VWVA 3F6FA 1PL2A 1ZCPA 1EZKA 1BEDA 1O73A 2NDOA 5J41A 5CRDA 3RBTA 2JACA 2GLRA 3VURA 3GTUB 3GKMA 2PUKC 1TW9A 5G1LA 4X4JA 6GSUA 1VRSD 2GDRA 3JCML 1G0TA 1QXHA 1F6MC 2R0GA 1GNEA 3HXSA 4KW6A 4TXOB 1UC7A 3CSHA 5ELGA 1FOVA 4K0GA 3L0HA 4HDEA 3ZREA 4POLA 4JZQA 2F9SA 1TU8A 1V2AA 5ECKB 4KH7A 3LXZA 2VL2A 3C8EA 2RM6A 5ID2B 1XOBA 3GFKA 1ZYEA 1R5PA 1G7OA 1TI3A 3QAWA 2HZEA 1SKWB 1GSYA 2QSIA 2DC5A 2CZ3A 2VL3A 4WR4A 2VO4A 1EEJA 17GSA 4KB3A 3KZQA 1XWKA 3CSJA 5LNKe 4ML1A 1B8XA 1ZZYA 1U3AA 2F8FA 4ZBBA 2HSYA 4TR3A 5HFGA 2P31A 2PVQA 2Z9SA 1HYUA 5DVBA 3QOUA 3VLNA 3KGKA 1QK8A 2A2PA 2R5GA 2IPAA 4TN8A 2DJJA 4G10A 2KOKA 2H74A 3ISOA 2XHFA 1X0RA 5KN2A 5JWRB 5AN1A 5LD0A 4N11A 3MYDA 1AC1A 2C3QA 4DSRA 4EVMA 1BYEA 2XC2A 3L4NA 5ELAA 2P0GA 2B6MA 4NV5A 1WPIA 4Q5NA 3GYKA 2I9HA 2YWMA 5IMDA 4G0KA 3HY2A 4E8HA 1EV9A 3BD2A 1ACVA 1O85A 3RPPA 4FQUA 1S3DA 2DJ1A 2DJ3A 3H8QA 3Q18A 20GSA 2B5YA 4O7HA 3FW2A 1T3BA 5INYA 3DXBA 2B1KA 4OFNA 1CQGA 1GTAA 3LGCA 2HNLA 1XVQA 1UVZA 3H79A 1K3YA 5D9WA 3Q19A 4MPFA 2L4QA 13GSA 2LSTA 5BMUA 4DSQA 1FB6A 5HQPA 2OE3A 5IMZA 3LW9A 1XXUA 3ZLPA 4K6XA 3ERWA 3CBUA 2PVOC 4ISDA 4HEA2 2IMFA 4Z2RA 5AIXA 1DBYA 2QKEA 2LUSA 3DEXA 2LS5A 5GSTA 5GSSA 2FCHA 1OC9A 5KOXA 2V6OA 4EF0A 4USSA 3FZ9A 2B5EA 4F03A 3TKSC 4MK3A 5CRHA 1PRXA 4OFMA 5KOWA 2H71A 3VPQA 2IJYA 4HJMA 1K0DA 4OO4A 2CT6A 1O8XA 3UARA 3WGXA 5DALB 3P7XA 4YKFA 5ECLB 3GX8A 3IRAA 2DMMA 2XPEA 3WD6A 1GUKA 3W6GA 3P8WA 2DBCA 5B7CA 4POKA 4YQMA 3UIWA 4GSSA 2R4VA 2FWHA 3QFBC 2YJ7A 4KX4A 1BG5A 4MF5A 1SL2B 1K0AA 1X5DA 1K0CA 4TVEA 4KCEA 1X9MB 9GSSA 3A2WA 2LJAA 2FWFA 4YAPA 2M72A 1W4VA 2K8VA 3UAPA 4LMWA 1PL1A 2QA2A 4X0XA 5A4VA 1OC8A 3E9JB 2GSTA 1R4WA 5DAKA 1Z7RA 4PURA 3FR3A 3O3TA 4MF7A 2CAIA 5CYYA 4ZL7A 2OBIA 2AJQB 4OCEA 1MDIA 4MABA 1ERVA 1XW6A 4FYUA 4PNGA 2RIIA 4XTSA 3A2XA 4WF5A 4K7NA 5IPGA 4L5OA 4LL1B 1V40A 4TRXA 1ZOFA 1RQMA 1SK2A 3KCMA 1YY7A 1T00A 2VLVA 1NHYA 4LA1A 1FO5A 1Q98A 1A2LA 3M0FA 1LU4A 3GH6A 2LRNA 3LQ7A 4F9ZA 5IIZA 3HCZA 5CNWA 4GSNA 2LNTA 2PERA 1GUMA 3VPTA 5ECPB 4MLYA 1J08A 4XS1A 3A3TA 3UEMA 1X5EA 2K9FA 1TRVA 2HRNA 4J56E 4ZILA 2VIMA 2C8UA 3EE2A 1M2DA 1URMA 3LWAA 1A8YA 3ZITA 3LEFA 4CY6A 4HQSA 4IP6A 4ZB8A 5A4WA 1GL8A 4BVXA 4KE3A 2AB6A 2FA8A 2CX4A 2TIRA 2JSYA 3UJ1A 3IBHA 2C80A 2MMAA 2GZZA 2E7PA 4PTSA 4ZB9A 1PD21 2JZTA 4AGSA 4POBA 4ZBAA 3RHBA 4I8BA 4HQZA 1TKDB 3PPUA 4HOJA 1BAYA 2OJLA 4G0IA 2YV9A 4G19A 1IYIA 3TOTA 2O7KA 4GRFA 4RI6A 4K5RA 5KN0A 5FWGA 6GSVA 2DKHA 3R2QA 2HZEB 4F2IA 1PKWA 3WGEA 1KBNA 3C71A 4OMVA 5DQYA 1OE8A 4AJ7A 1Z9HA 2MMZA 4MJEA 2WULA 4KDYA 2DLXA 4RUVA 4N0VA 2JADA 3MAKA 1EOHA 2OKAA 1M0UA 3IOSA 4ULXA 3W8JA 2K18A 4JR6A 16GSA 4JE1A 1K3LA 2FWGA 1PN9A 1ZGNA 2L6CA 2IMEA 3FRCA 2FGXA 1JZRA 1EGOA 4MF6A 2HI7A 3QAVA 3TCOA 4HZ4A 3Q74A 5DQSA 4K2DA 3H93A 4TR4A 4MP4A 4ZL9A 4Z2UA 3LYPA 1BJXA 2V6KA 1HQOA 2HYXA 2R0CA 1UA5A 4FYBA 4ECCA 3FZ4A 1K3OA 2GQMA 2JU5A 1ST9A 2NTOA 3AY8A 1GSQA 2R37A 4NPBA 2IWTA 4N30A 5IM9A 3FYGA 2YPMA 1B9YC 2CV4A 4HU9A 4IGJA 2MZCA 1RW1A 4TKYA 2VAFA 3DVWA 2H70A 4IW9A 2RM5A 4L0WA 1XOAA 1GP1A 1SKSB 5ECSA 2RUFA 1ERUA 3VWUA 5J3RA 5J9CA 2ALBA 4TR1B 3ZFLA 1X5CA 3BBYA 4D73A 1TXXA 1QMVA 1U87A 3L78A 4V2MA 1Y25A 3APQA 3QAGA 2B7KA 2LNSA 1WMJA 3SBCA 3GN3A 3DIEA 4ZIJA 1GRXA 1F37A 4K7IA 5IO0A 2X8CA 3KTLA 5J4UA 2LTKA 4O5UA 2A4VA 2VCXA 1ERTA 2WRTA 1O6JA 4A5PA 1OC9B 1LJRA 1ZL9A 2E0QA 2PWJA 3GX0A 1Z6NA 5KN3A 2FNOA 3PH9A 4EL1A 1TP9A 2DKIA 4FYCA 1R26A 3QMXA 1Y6EA 5CRGA 5DCGA 2YZHA 2FA4A 1SYRA 2OE1A 4ECBA 3IC4A 3TDGA 4ILFA 2HE3A 3H4KA 1MDJA 5H5SA 2QGVA 2H01A 1AUCA 2PMTA 3IV4A 1MDKA 2HRAA 4MNNA 1KNGA 3SWLA 1YKAA 2NBSA 1WP0A 5A4UA 3TJJA 3L9VA 2V2GA 4ACSA 1T8EB 3GHAA 1YF1A 5G5FA 5B6NA 2MBTA 3KEBA 2OA7A 4WXTA 5KEJA 5CO3A 2H1BA 4K8MA 3L9SA 4ICYA 1OE7A 1F3BA 3ZVJA 4PX1A 4BA7A 2R2JA 4F0BA 4IVFA 3EU3A 1ZYNA 2GVPA 2IFQB 2GT6A 3VFIA 1VF4A 2KHPA 2AHEA 2PN8A 4IN0A 1WRYA 2PBJA 1A2MA 4CY8A 11GSA 2P5QA 1GSFA 3C73A 3HZ8A 3IC8A 3RDWA 1QFNA 3I6AA 5G30A 5J9BA 12GSA 2GSRA 3F3RA 3F3QA 3M9JA 2CQ9A 1H75A 2VCVA 4V1Ap 4YAVA 1QUWA 2H75A 2VCWA 2GSSA 1FG4A 2C0EA 3FEUA 1TDIA 4KDUA 1R7HA 3ERFA 3HKRA 3UVTA 3M9KA 2E2MA 1THOA 2V41A 1FHEA 3KH7A 2DSAA 2LKUA 1S3AA 2X64A 4CHSA 3ZFBA 2H1DA 3BCKA 4NHWA 1T1VA 3CXGA 1TK8B 1T4ZA 2H19A 5ECRB 1A0RP 3IE3A 5IMVA 1SK0A 1GSSA 5JWOB 3KTBA 3GRXA 4QL9A 5IPHA 4XS4B 1PX7A 5B6MA 1C72A 3TGZA 1I9DA 3PR8A 5L71A 4OCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L59 A;  1Z3E A;  5IMA A;  1NSW A;  4AF2 A;  1FVJ A;  1GSU A;  2C1Y A;  3GKN A;  5ECO B;  4I2T A;  3GTU A;  1A2J A;  1XWA A;  2IMK A;  4JBB A;  3EU4 A;  4IQ1 A;  2MYG A;  3F0I A;  4ECI A;  3EMX A;  2WB9 A;  3GUR A;  1R5A A;  2KUC A;  5DJM A;  4BWS A;  4FIW A;  3N5O A;  4TW5 A;  2PGT A;  3CMI A;  1SL0 B;  3U5R E;  3F4R A;  4PUA A;  5DJL A;  1XW9 A;  2H0I A;  2WS2 A;  4LMV A;  3HHV A;  4EXJ A;  5HFI A;  1FB0 A;  2LRT A;  3F6D A;  2F3M A;  3EMP A;  3EC3 A;  5DCH A;  5E4W A;  5ID2 A;  1SD9 A;  1WOU A;  4J2F A;  4MCU A;  4F0C A;  3DML A;  4WR5 A;  1GH2 A;  4MA9 A;  5D73 A;  5D93 A;  2TRX A;  3GIX A;  3G7Y A;  2CVB A;  1EGR A;  1BX9 A;  5IQY A;  4DSS B;  4O32 A;  3HA9 A;  1X9W B;  1XFL A;  4OWY A;  4HU7 A;  1LBK A;  3DGQ A;  1V98 A;  2LJK A;  4ML6 A;  4PGT A;  4K1F A;  3LSZ A;  3VWW A;  1FAA A;  2AV4 A;  10GS A;  2WCI A;  1VF1 A;  4IS0 A;  3BJ5 A;  4QQ7 A;  4KAE A;  1OC3 A;  2VUP A;  3CSI A;  3IAS 2;  2H76 A;  4O5R A;  4POM A;  4IP1 A;  2LV3 A;  1JZW A;  1A0F A;  3L9U A;  4RI7 A;  1O81 A;  1TJD A;  2YCD A;  5AIV A;  4KSO A;  4V1A g;  2H6X A;  4PQ1 A;  1AQV A;  2VL9 A;  4EE0 A;  3G7I A;  4K0N A;  2VL2 C;  3D4T A;  5FHI A;  3F4S A;  1GUH A;  1USB A;  2IMD A;  4XRA A;  4E8E A;  4ZBD A;  3IK9 A;  1ZYQ B;  1NHO A;  2H30 A;  3ZVJ D;  3KH9 A;  4O92 A;  1SL1 B;  4DVC A;  4MZW A;  1AQX A;  2A2R A;  2X8G A;  1YJ6 A;  4F82 A;  4MZB A;  2LQQ A;  2NPB A;  3ME7 A;  3G7J A;  2VM2 A;  4EO3 A;  2JSZ A;  3MNG A;  4JRR A;  1Q4J A;  4OO5 A;  3IK7 A;  4Q5F A;  3KJY A;  1WWJ A;  1A8L A;  4H86 A;  1NW2 A;  3N9J A;  2O87 A;  1THX A;  1MD3 A;  1O7U A;  3NOF A;  3BCI A;  1VF2 A;  1KTE A;  4HI7 A;  5ECQ B;  3HJP A;  3HYP A;  2EC4 A;  3ED3 A;  5G2Z A;  1XVW A;  4MMM A;  1WE0 A;  5COH A;  3UBL A;  5ECM B;  5ECH B;  1Z7P A;  1GTB A;  2TRC P;  5EPF A;  2N5B A;  3FKF A;  5KN1 A;  2VCZ A;  1SJ6 A;  2GSQ A;  3UVH A;  1GLP A;  1DSB A;  2HRF A;  1YKC A;  3ME8 A;  2HXK A;  3FR9 A;  2EIR A;  2I81 A;  6GSX A;  3C7M A;  2CVK A;  4JED A;  1OKD A;  4XCS A;  5CP1 A;  3LXT A;  4N0Z A;  1PGT A;  3ZIV A;  3O6T A;  1F9M A;  3TKS E;  3EIN A;  5ENU A;  3VWX A;  3RHC A;  2EIQ A;  3OR5 A;  1IYH A;  3M8N A;  1H4O A;  5FT3 A;  2VCQ A;  2CVD A;  4EC0 A;  1TOF A;  4N10 A;  5DAL A;  1KEB A;  3FK8 A;  2LEG A;  2J23 A;  4YH2 A;  2VOC A;  3VI7 A;  2BJX A;  2NVL A;  2H8L A;  1JFU A;  2I1U A;  2YWN A;  1CQH A;  1X9S B;  1E2Y A;  4GST A;  3IXR A;  5EVO A;  2WFC A;  5C04 A;  4L0U A;  4HJ2 A;  4ZXG A;  5EY6 A;  2GGT A;  2LRC A;  3DYR A;  2VD1 A;  2HLS A;  3IDV A;  1XIY A;  3QFA C;  2OE0 A;  1K0B A;  2KP2 A;  4YQV A;  2D2Z A;  1TRS A;  2C3T A;  5GAN D;  4IQA A;  3TKQ A;  3HVV A;  1SKR B;  4MPG A;  3D0Z A;  2YWI A;  1XZO A;  3F4T A;  1PQN A;  1B4Q A;  2K6V A;  1EP7 A;  5ECN B;  5D9T A;  5HR0 A;  4TR0 A;  1PX6 A;  3TJG A;  6GST A;  2H66 A;  3QCP A;  2OBK A;  1EV4 A;  1U88 A;  2I4A A;  4XHM A;  3H1N A;  3LG6 A;  4IEL A;  3CRT A;  3F8U A;  4RQR A;  2AUV A;  3QD9 A;  3HVS A;  1XWG A;  5CRE A;  2M80 A;  3FY7 A;  4WF4 A;  5IMF A;  3TKS A;  4I6X A;  4IJ3 A;  4WET A;  4EKZ A;  2F51 A;  3G9B A;  3U6V A;  5CAX A;  1TTZ A;  3M1G A;  4NXI A;  1B4P A;  5JCW A;  3I9V 2;  7GSS A;  5IOX A;  1I5G A;  2GZY A;  3GUS A;  1XCC A;  4AJ6 A;  4V2L A;  4K7O A;  2AYT A;  3ZMK A;  3J7Y b;  1JHB A;  3EYT A;  4EDY A;  4YQU A;  1UN2 A;  4BWQ A;  1MEK A;  5CRW A;  3IR4 A;  1VF3 A;  4CW9 A;  1K0N A;  1YF0 A;  3CTF A;  1N8J A;  3E0U A;  4OFT A;  1SYX A;  3FHK A;  3BOA A;  4MH2 A;  2FWE A;  3GV1 A;  2YOI A;  3HD5 A;  4WKW A;  3NZN A;  1GTU A;  3I69 A;  5F07 A;  2B1L A;  1A23 A;  2H1A A;  1JLV A;  3KIJ A;  2WZ9 A;  2RLI A;  5B8B A;  4MDC A;  2FY6 A;  2FLS A;  4X1U A;  3ZYW A;  1M2B A;  2RUE A;  3PIN A;  3A2V A;  5F0G A;  1QGV A;  1JZO A;  2OAD A;  4IJI A;  3IAM 2;  1V58 A;  5B8A A;  3C1R A;  1AW9 A;  2YWO A;  5JCU A;  8GSS A;  3D21 A;  2GTU A;  2IL3 A;  1M99 A;  3MWH A;  3TB2 A;  4ZL8 A;  2ON7 A;  2E2G A;  1U3I A;  4CDO A;  1DE2 A;  1GSE A;  4GLT A;  2H6Z A;  3GKK A;  2KP1 A;  2JZR A;  1SD8 A;  4PUF C;  3TJK A;  2K8S A;  3FR6 A;  4JR4 A;  3LOR A;  1ABA A;  4MJB A;  1M2A A;  3ERG A;  1J9B A;  2B3S A;  4IKH A;  2GQL A;  2IN3 A;  1OKT A;  5JWQ B;  3TJB A;  1XWB A;  2L57 A;  3KM6 A;  1YDK A;  1FVK A;  3TUE A;  3TJF A;  2XPD A;  2ZCT A;  3V1W A;  1TK0 B;  5JCG A;  3HJM A;  4PNF A;  3ZML A;  2P5R A;  6GSY A;  4NV2 A;  2LQO A;  5DAK B;  4QL7 A;  2H1G A;  3D5J A;  1SU9 A;  1B9X C;  1N2A A;  3QR6 A;  4PXO A;  1DE1 A;  3GKX A;  3ZTL A;  1GWC A;  1HNA A;  3TRQ A;  4FO5 A;  2G2Q A;  5DBQ A;  4NWY A;  1G6Y A;  3KMN A;  4L5L A;  2GZP A;  1M9B A;  2L6D A;  4KUN A;  5HR1 A;  4MJC A;  4KCA A;  1HD2 A;  2DML A;  2YV7 A;  3ZL5 A;  3WYW A;  3KP8 A;  2F8A A;  5HFK A;  2G0F A;  1OAZ A;  3DD3 A;  22GS A;  3CRU A;  3RAZ A;  3APO A;  1T4Y A;  1F3A A;  4K9Z A;  3DRN A;  3LJR A;  2IIY A;  2PPT A;  5G1K A;  2AAW A;  4HZ2 A;  3UBK A;  2YAN A;  2OAC A;  5G5E A;  4TR1 A;  1V9W A;  1BQ7 A;  5AGY A;  3GL5 A;  2YN1 A;  4AJ8 A;  1M7T A;  3PGT A;  1YZX A;  2O85 A;  1A24 A;  1GLQ A;  3US3 A;  3RPN A;  3IHQ A;  1WJK A;  2KLX A;  4LLR A;  3QPM A;  1TI1 A;  2R6K A;  2JZS A;  1GSD A;  1RK4 A;  2M46 A;  3EVI A;  4X43 A;  2B7J A;  1JLW A;  3K8N A;  5HR2 A;  2N5A A;  2ZNM A;  1EWX A;  4I5Q A;  4TXO A;  2V1M A;  1GUL A;  1YEX A;  2JL4 A;  1V57 A;  3DKS A;  5F05 A;  2R3X A;  3IA1 A;  3A5W A;  5C00 A;  2C4J A;  3KXO A;  1T7P B;  2H6Y A;  2WGR A;  2I3Y A;  3KP9 A;  4KGI A;  2MMN A;  4G9H A;  2J9H A;  1F2E A;  1TU7 A;  4WEY A;  2B5X A;  1ERW A;  4NAX A;  2CX3 A;  3KD0 A;  4XIH A;  1XBS A;  2HFD A;  2N5F A;  1SJI A;  2L5O A;  3UL3 A;  1PMT A;  2IMI A;  3CTG A;  4KA0 A;  4G2E A;  4L8E A;  3APS A;  1YEP A;  5E59 A;  5A5K A;  1MD4 A;  3P90 A;  5DDL A;  5ECI B;  3D6I A;  4GCI A;  5D8I A;  3GL3 A;  4MJA A;  2VD0 A;  3DWV A;  1E6B A;  4GXZ A;  4NMU A;  3EWL A;  1VGL A;  4ECJ A;  4XRD A;  3GA4 A;  3D4M A;  2A2S A;  2IFQ A;  3P2A A;  2REM A;  6GSW A;  2YZU A;  1B48 A;  1WIK A;  1MTC A;  2YNX A;  2YP6 A;  2ZUP A;  3CYN A;  4NHZ A;  2LJR A;  5F8B A;  3UOM A;  1ML6 A;  1TK5 B;  3MSZ A;  2DIY A;  1GTI A;  2X8H A;  4GF0 A;  2BMX A;  1HNB A;  5IMC A;  3WT1 A;  3MDK A;  3GST A;  1JZD A;  1G6W A;  2DJK A;  2QC7 A;  2H72 A;  4KND A;  4PQH A;  2MBS A;  2VLT A;  3HVX A;  1SEN A;  2GS3 A;  18GS A;  6GSS A;  1HNC A;  4Q5R A;  14GS A;  1M9A A;  3F63 A;  1SK1 A;  4JU5 A;  2HSH A;  2PU9 C;  4GQC A;  2CZ2 A;  4D73 B;  3GH9 A;  1EP8 A;  2DJ2 A;  3FZ5 A;  3IPZ A;  5IO2 A;  2CA8 A;  3ZIJ A;  5GAP D;  4HS1 A;  2VCT A;  3LFL A;  4BPY A;  3ZRD A;  4XS4 A;  3HDC A;  3I43 A;  5AIS A;  4GTU A;  1SJZ A;  1DUG A;  3KMO A;  1AQW A;  3VK9 A;  2VLU A;  2ON5 A;  2EIO A;  4IHU A;  4DEJ A;  3GMF A;  3M3M A;  4RQX A;  4MZC A;  4Q5Q A;  2GT5 A;  2FUG 2;  2O8V B;  3TRP A;  3O76 A;  4EDZ A;  4ID0 A;  5H5Q A;  5EL8 A;  4MH3 A;  3TKR A;  3C1S A;  2GQK A;  5IOW A;  2C3N A;  3GSS A;  1AXD A;  2ES7 A;  1K0M A;  1QQ2 A;  2DIZ A;  3VI5 A;  1W89 A;  5ABR A;  2DJ0 A;  4I97 A;  1EOG A;  1OVN A;  2HT9 A;  5G31 A;  1ZMA A;  1PKZ A;  2C0G A;  1XPV A;  2CAQ A;  1YQ1 A;  3S9F A;  1G7E A;  3J7Y k;  4FH8 A;  3D22 A;  4LL4 B;  1J0F A;  1U6T A;  3FZA A;  4DSS A;  3TKP A;  2MMO A;  1S3C A;  2WDU A;  3WGD A;  4IBP A;  4WBJ A;  1Z6M A;  4GWR A;  5HR3 A;  3E3E A;  5D96 A;  4J57 E;  1NM3 A;  4PQI A;  5GZZ B;  5J5N A;  3LYK A;  2H73 A;  2L5L A;  5F06 A;  4GQF A;  5D9V A;  4KSM A;  1ILO A;  4WBR D;  1O8W A;  4V2N A;  4EUY A;  2V32 A;  2X99 A;  2L4C A;  1GNW A;  2YJH A;  3GNJ A;  2H0G A;  2HZF A;  1ON4 A;  2XBQ A;  2BTO T;  2O89 A;  4Z7X A;  2WJU A;  4P3Y B;  1EEM A;  3TRX A;  1K0O A;  3TOU A;  1OYJ A;  2FD3 A;  3HZ4 A;  4TOP A;  1AAZ A;  4XS6 A;  19GS A;  3DVX A;  2C0F A;  3Q6O A;  1FW1 A;  2H0H A;  4I2U A;  1Z5Y E;  1XWC A;  1PSQ A;  3UMA A;  4ZB6 A;  3F9U A;  5H5R A;  4BL7 A;  3QDN A;  4BVY A;  4OD7 A;  2C0D A;  1TRU A;  2VM1 A;  2XBI A;  3ZZX A;  5LCZ A;  1AIU A;  1XW5 A;  3HJO A;  3NIV A;  4TXV A;  4KDX A;  3EUR A;  4HUA A;  3WT2 A;  3W8S A;  1PA3 A;  1TRW A;  2FHE A;  5D9X A;  3VWV A;  3F6F A;  1PL2 A;  1ZCP A;  1EZK A;  1BED A;  1O73 A;  2NDO A;  5J41 A;  5CRD A;  3RBT A;  2JAC A;  2GLR A;  3VUR A;  3GTU B;  3GKM A;  2PUK C;  1TW9 A;  5G1L A;  6GSU A;  1VRS D;  2GDR A;  3JCM L;  1G0T A;  1QXH A;  1F6M C;  1GNE A;  3HXS A;  4KW6 A;  4TXO B;  1UC7 A;  3CSH A;  5ELG A;  1FOV A;  4K0G A;  3L0H A;  4HDE A;  3ZRE A;  4POL A;  4JZQ A;  2F9S A;  1TU8 A;  1V2A A;  5ECK B;  4KH7 A;  3LXZ A;  2VL2 A;  3C8E A;  2RM6 A;  5ID2 B;  1XOB A;  3GFK A;  1ZYE A;  1R5P A;  1G7O A;  1TI3 A;  3QAW A;  2HZE A;  1SKW B;  1GSY A;  2QSI A;  2DC5 A;  2CZ3 A;  2VL3 A;  4WR4 A;  2VO4 A;  1EEJ A;  17GS A;  4KB3 A;  3KZQ A;  1XWK A;  3CSJ A;  5LNK e;  4ML1 A;  1B8X A;  1ZZY A;  1U3A A;  2F8F A;  4ZBB A;  2HSY A;  4TR3 A;  5HFG A;  2P31 A;  2PVQ A;  2Z9S A;  1HYU A;  5DVB A;  3QOU A;  3VLN A;  3KGK A;  1QK8 A;  2R5G A;  2IPA A;  4TN8 A;  2DJJ A;  4G10 A;  2KOK A;  2H74 A;  3ISO A;  2XHF A;  1X0R A;  5KN2 A;  5JWR B;  5AN1 A;  5LD0 A;  4N11 A;  1AC1 A;  2C3Q A;  4DSR A;  4EVM A;  1BYE A;  2XC2 A;  3L4N A;  5ELA A;  2P0G A;  2B6M A;  4NV5 A;  1WPI A;  4Q5N A;  3GYK A;  2I9H A;  2YWM A;  5IMD A;  3HY2 A;  4E8H A;  1EV9 A;  3BD2 A;  1ACV A;  1O85 A;  3RPP A;  1S3D A;  2DJ1 A;  2DJ3 A;  3H8Q A;  3Q18 A;  20GS A;  2B5Y A;  4O7H A;  3FW2 A;  1T3B A;  5INY A;  3DXB A;  2B1K A;  4OFN A;  1CQG A;  1GTA A;  3LGC A;  2HNL A;  1XVQ A;  1UVZ A;  3H79 A;  1K3Y A;  5D9W A;  3Q19 A;  4MPF A;  2L4Q A;  13GS A;  2LST A;  4DSQ A;  1FB6 A;  5HQP A;  2OE3 A;  5IMZ A;  1XXU A;  3ZLP A;  4K6X A;  3ERW A;  3CBU A;  2PVO C;  4ISD A;  4HEA 2;  2IMF A;  5AIX A;  1DBY A;  2QKE A;  2LUS A;  3DEX A;  2LS5 A;  5GST A;  5GSS A;  2FCH A;  1OC9 A;  2V6O A;  4EF0 A;  3FZ9 A;  2B5E A;  4F03 A;  3TKS C;  4MK3 A;  5CRH A;  1PRX A;  4OFM A;  2H71 A;  3VPQ A;  2IJY A;  4HJM A;  1K0D A;  4OO4 A;  2CT6 A;  1O8X A;  3UAR A;  3WGX A;  5DAL B;  3P7X A;  5ECL B;  3GX8 A;  3IRA A;  2DMM A;  2XPE A;  3WD6 A;  1GUK A;  3W6G A;  3P8W A;  2DBC A;  5B7C A;  4POK A;  4YQM A;  3UIW A;  4GSS A;  2R4V A;  2FWH A;  3QFB C;  2YJ7 A;  4KX4 A;  1BG5 A;  4MF5 A;  1SL2 B;  1K0A A;  1X5D A;  1K0C A;  4TVE A;  4KCE A;  1X9M B;  9GSS A;  3A2W A;  2LJA A;  2FWF A;  4YAP A;  2M72 A;  1W4V A;  2K8V A;  3UAP A;  4LMW A;  1PL1 A;  4X0X A;  5A4V A;  1OC8 A;  3E9J B;  2GST A;  1R4W A;  5DAK A;  1Z7R A;  4PUR A;  3FR3 A;  3O3T A;  4MF7 A;  2CAI A;  5CYY A;  4ZL7 A;  2OBI A;  2AJQ B;  4OCE A;  1MDI A;  4MAB A;  1ERV A;  1XW6 A;  4FYU A;  4PNG A;  2RII A;  4XTS A;  3A2X A;  4WF5 A;  4K7N A;  5IPG A;  4L5O A;  4LL1 B;  1V40 A;  4TRX A;  1ZOF A;  1RQM A;  1SK2 A;  3KCM A;  1YY7 A;  1T00 A;  2VLV A;  1NHY A;  4LA1 A;  1FO5 A;  1Q98 A;  1A2L A;  3M0F A;  1LU4 A;  3GH6 A;  2LRN A;  3LQ7 A;  4F9Z A;  5IIZ A;  3HCZ A;  5CNW A;  4GSN A;  2LNT A;  2PER A;  1GUM A;  3VPT A;  5ECP B;  4MLY A;  1J08 A;  4XS1 A;  3A3T A;  3UEM A;  1X5E A;  2K9F A;  1TRV A;  2HRN A;  4J56 E;  4ZIL A;  2VIM A;  2C8U A;  3EE2 A;  1M2D A;  1URM A;  3LWA A;  1A8Y A;  3ZIT A;  3LEF A;  4HQS A;  4IP6 A;  4ZB8 A;  5A4W A;  1GL8 A;  4BVX A;  4KE3 A;  2AB6 A;  2FA8 A;  2CX4 A;  2TIR A;  2JSY A;  3UJ1 A;  3IBH A;  2C80 A;  2MMA A;  2GZZ A;  2E7P A;  4ZB9 A;  1PD2 1;  2JZT A;  4AGS A;  4POB A;  4ZBA A;  3RHB A;  4I8B A;  4HQZ A;  1TKD B;  4HOJ A;  1BAY A;  2OJL A;  2YV9 A;  4G19 A;  1IYI A;  3TOT A;  2O7K A;  4GRF A;  4RI6 A;  5KN0 A;  5FWG A;  6GSV A;  3R2Q A;  2HZE B;  4F2I A;  1PKW A;  3WGE A;  1KBN A;  3C71 A;  4OMV A;  5DQY A;  1OE8 A;  4AJ7 A;  1Z9H A;  2MMZ A;  4MJE A;  2WUL A;  4KDY A;  2DLX A;  4RUV A;  4N0V A;  2JAD A;  3MAK A;  1EOH A;  2OKA A;  1M0U A;  3IOS A;  4ULX A;  3W8J A;  2K18 A;  4JR6 A;  16GS A;  4JE1 A;  1K3L A;  2FWG A;  1PN9 A;  1ZGN A;  2L6C A;  2IME A;  3FRC A;  2FGX A;  1JZR A;  1EGO A;  4MF6 A;  2HI7 A;  3QAV A;  3TCO A;  4HZ4 A;  3Q74 A;  5DQS A;  4K2D A;  3H93 A;  4TR4 A;  4MP4 A;  4ZL9 A;  1BJX A;  3LYP A;  2V6K A;  1HQO A;  2HYX A;  1UA5 A;  4FYB A;  4ECC A;  3FZ4 A;  1K3O A;  2GQM A;  2JU5 A;  1ST9 A;  2NTO A;  3AY8 A;  1GSQ A;  2R37 A;  4NPB A;  2IWT A;  4N30 A;  5IM9 A;  3FYG A;  2YPM A;  1B9Y C;  2CV4 A;  4HU9 A;  4IGJ A;  2MZC A;  1RW1 A;  4TKY A;  2VAF A;  3DVW A;  2H70 A;  4IW9 A;  2RM5 A;  4L0W A;  1XOA A;  1GP1 A;  1SKS B;  5ECS A;  2RUF A;  1ERU A;  3VWU A;  5J3R A;  5J9C A;  2ALB A;  4TR1 B;  3ZFL A;  1X5C A;  3BBY A;  4D73 A;  1TXX A;  1QMV A;  1U87 A;  3L78 A;  4V2M A;  1Y25 A;  3APQ A;  3QAG A;  2B7K A;  2LNS A;  1WMJ A;  3SBC A;  3GN3 A;  3DIE A;  4ZIJ A;  1GRX A;  1F37 A;  4K7I A;  5IO0 A;  2X8C A;  3KTL A;  5J4U A;  2LTK A;  2A4V A;  2VCX A;  1ERT A;  2WRT A;  1O6J A;  1OC9 B;  1LJR A;  1ZL9 A;  2E0Q A;  2PWJ A;  3GX0 A;  1Z6N A;  5KN3 A;  2FNO A;  3PH9 A;  4EL1 A;  1TP9 A;  4FYC A;  1R26 A;  3QMX A;  1Y6E A;  5CRG A;  5DCG A;  2YZH A;  2FA4 A;  1SYR A;  2OE1 A;  4ECB A;  3IC4 A;  3TDG A;  4ILF A;  2HE3 A;  3H4K A;  1MDJ A;  5H5S A;  2QGV A;  2H01 A;  1AUC A;  2PMT A;  3IV4 A;  1MDK A;  1KNG A;  3SWL A;  1YKA A;  2NBS A;  1WP0 A;  5A4U A;  3TJJ A;  3L9V A;  2V2G A;  4ACS A;  1T8E B;  3GHA A;  1YF1 A;  5G5F A;  5B6N A;  2MBT A;  3KEB A;  2OA7 A;  4WXT A;  5KEJ A;  5CO3 A;  2H1B A;  4K8M A;  3L9S A;  1OE7 A;  1F3B A;  3ZVJ A;  4PX1 A;  4BA7 A;  2R2J A;  4F0B A;  4IVF A;  3EU3 A;  2GVP A;  2IFQ B;  2GT6 A;  3VFI A;  1VF4 A;  2KHP A;  2AHE A;  2PN8 A;  4IN0 A;  1WRY A;  2PBJ A;  1A2M A;  11GS A;  2P5Q A;  1GSF A;  3C73 A;  3HZ8 A;  3RDW A;  1QFN A;  3I6A A;  5G30 A;  5J9B A;  12GS A;  2GSR A;  3F3R A;  3F3Q A;  3M9J A;  2CQ9 A;  1H75 A;  2VCV A;  4V1A p;  4YAV A;  1QUW A;  2H75 A;  2VCW A;  2GSS A;  1FG4 A;  2C0E A;  3FEU A;  1TDI A;  4KDU A;  1R7H A;  3ERF A;  3HKR A;  3UVT A;  3M9K A;  2E2M A;  1THO A;  2V41 A;  1FHE A;  3KH7 A;  2DSA A;  2LKU A;  1S3A A;  2X64 A;  4CHS A;  3ZFB A;  2H1D A;  3BCK A;  4NHW A;  1T1V A;  3CXG A;  1TK8 B;  1T4Z A;  2H19 A;  5ECR B;  1A0R P;  3IE3 A;  5IMV A;  1SK0 A;  1GSS A;  5JWO B;  3KTB A;  3GRX A;  4QL9 A;  5IPH A;  4XS4 B;  1PX7 A;  5B6M A;  1C72 A;  3TGZ A;  1I9D A;  3PR8 A;  5L71 A;  4OCF A; 
#chains in the Genus database with same CATH topology
 2L59 A;  1Z3E A;  5IMA A;  3A5I A;  1NSW A;  4AF2 A;  1FVJ A;  1GSU A;  2C1Y A;  3GKN A;  5ECO B;  4I2T A;  3GTU A;  1A2J A;  1XWA A;  2IMK A;  4JBB A;  3EU4 A;  4IQ1 A;  2MYG A;  3F0I A;  4ECI A;  3EMX A;  2WB9 A;  3GUR A;  1R5A A;  2KUC A;  5DJM A;  4BWS A;  4FIW A;  3N5O A;  4TW5 A;  2PGT A;  3CMI A;  1M3I A;  1SL0 B;  3U5R E;  3F4R A;  4PUA A;  5DJL A;  1XW9 A;  2H0I A;  2WS2 A;  4LMV A;  3HHV A;  4EXJ A;  5HFI A;  1FB0 A;  2LRT A;  3F6D A;  2F3M A;  3EMP A;  3EC3 A;  5DCH A;  5E4W A;  5ID2 A;  1SD9 A;  1WOU A;  4J2F A;  4MCU A;  4F0C A;  3DML A;  4WR5 A;  1GH2 A;  4MA9 A;  5D73 A;  5D93 A;  2TRX A;  3GIX A;  3G7Y A;  2CVB A;  1EGR A;  1BX9 A;  5IQY A;  4DSS B;  4O32 A;  3HA9 A;  1X9W B;  1XFL A;  4OWY A;  4HU7 A;  1LBK A;  3DGQ A;  1V98 A;  2LJK A;  4ML6 A;  4PGT A;  4K1F A;  3LSZ A;  3VWW A;  1FAA A;  2AV4 A;  10GS A;  2WCI A;  1VF1 A;  4IS0 A;  3BJ5 A;  4QQ7 A;  4KAE A;  1OC3 A;  2VUP A;  3CSI A;  3IAS 2;  2H76 A;  4O5R A;  4POM A;  4IP1 A;  2LV3 A;  1JZW A;  1A0F A;  3L9U A;  4RI7 A;  1O81 A;  1TJD A;  2YCD A;  5AIV A;  4KSO A;  4V1A g;  2H6X A;  4PQ1 A;  1AQV A;  2VL9 A;  4EE0 A;  3G7I A;  1FOH A;  4K0N A;  2VL2 C;  3D4T A;  5FHI A;  3F4S A;  1GUH A;  1USB A;  2IMD A;  4XRA A;  4E8E A;  4ZBD A;  3IK9 A;  1ZYQ B;  1NHO A;  2H30 A;  3ZVJ D;  3KH9 A;  2A4H A;  4O92 A;  1SL1 B;  4DVC A;  4BL7 B;  4MZW A;  4BVY B;  1AQX A;  2A2R A;  2X8G A;  1YJ6 A;  4F82 A;  4MZB A;  2LQQ A;  2NPB A;  3ME7 A;  3G7J A;  2VM2 A;  4EO3 A;  2JSZ A;  3MNG A;  4JRR A;  1Q4J A;  4OO5 A;  3IK7 A;  4Q5F A;  3KJY A;  1WWJ A;  1A8L A;  4H86 A;  1NW2 A;  3N9J A;  2O87 A;  1THX A;  1MD3 A;  1O7U A;  3NOF A;  3BCI A;  1VF2 A;  1KTE A;  4HI7 A;  5ECQ B;  3HJP A;  3HYP A;  2EC4 A;  3ED3 A;  5G2Z A;  1XVW A;  4MMM A;  1WE0 A;  5COH A;  3UBL A;  5ECM B;  5ECH B;  1Z7P A;  1GTB A;  2TRC P;  5EPF A;  2N5B A;  3FKF A;  5KN1 A;  2VCZ A;  1SJ6 A;  2GSQ A;  3UVH A;  1GLP A;  1DSB A;  2HRF A;  1YKC A;  3ME8 A;  2HXK A;  3FR9 A;  2EIR A;  2I81 A;  1PN0 A;  6GSX A;  3C7M A;  2CVK A;  2HRK A;  4JED A;  1OKD A;  4XCS A;  5CP1 A;  3LXT A;  4N0Z A;  1PGT A;  3ZIV A;  3O6T A;  1F9M A;  3TKS E;  3EIN A;  5ENU A;  3VWX A;  3RHC A;  2EIQ A;  3OR5 A;  1IYH A;  3M8N A;  1H4O A;  5FT3 A;  2VCQ A;  2CVD A;  4EC0 A;  1TOF A;  4N10 A;  5DAL A;  1KEB A;  3FK8 A;  2LEG A;  2J23 A;  4YH2 A;  2VOC A;  3VI7 A;  2BJX A;  2NVL A;  2H8L A;  1JFU A;  2I1U A;  2YWN A;  1CQH A;  1X9S B;  1E2Y A;  4GST A;  3IXR A;  5EVO A;  2WFC A;  5C04 A;  4L0U A;  2R0P A;  4HJ2 A;  4ZXG A;  5EY6 A;  2GGT A;  2LRC A;  3DYR A;  2VD1 A;  2HLS A;  3IDV A;  1XIY A;  3QFA C;  2OE0 A;  1K0B A;  2KP2 A;  4YQV A;  2D2Z A;  1TRS A;  2C3T A;  5GAN D;  4IQA A;  3TKQ A;  3HVV A;  1SKR B;  4MPG A;  3D0Z A;  2YWI A;  1XZO A;  3F4T A;  1PQN A;  1B4Q A;  2K6V A;  1EP7 A;  5ECN B;  5D9T A;  5HR0 A;  4TR0 A;  1PX6 A;  3TJG A;  6GST A;  2H66 A;  3QCP A;  2OBK A;  1EV4 A;  1U88 A;  2I4A A;  4XHM A;  4K5S A;  3H1N A;  3LG6 A;  4IEL A;  3CRT A;  3F8U A;  4RQR A;  2AUV A;  3QD9 A;  4EIP A;  3HVS A;  1XWG A;  5CRE A;  2M80 A;  3FY7 A;  4WF4 A;  5IMF A;  3TKS A;  4I6X A;  4IJ3 A;  4WET A;  4EKZ A;  4Z2T A;  2F51 A;  3G9B A;  3U6V A;  5CAX A;  1TTZ A;  3M1G A;  4NXI A;  1B4P A;  5JCW A;  3I9V 2;  7GSS A;  5IOX A;  1I5G A;  2GZY A;  3GUS A;  1XCC A;  4AJ6 A;  4V2L A;  4K7O A;  2AYT A;  3ZMK A;  3J7Y b;  1JHB A;  3EYT A;  4EDY A;  4YQU A;  1UN2 A;  4BWQ A;  1MEK A;  5CRW A;  3IR4 A;  1VF3 A;  4CW9 A;  1K0N A;  1YF0 A;  3CTF A;  1N8J A;  3E0U A;  4OFT A;  1SYX A;  3FHK A;  3BOA A;  4MH2 A;  2FWE A;  3GV1 A;  2YOI A;  3HD5 A;  4WKW A;  3NZN A;  1GTU A;  3I69 A;  5F07 A;  2B1L A;  1A23 A;  2H1A A;  1JLV A;  3KIJ A;  2WZ9 A;  2RLI A;  5B8B A;  4MDC A;  2FY6 A;  2FLS A;  4X1U A;  3ZYW A;  1M2B A;  2RUE A;  3PIN A;  3A2V A;  5F0G A;  1QGV A;  1JZO A;  2OAD A;  4IJI A;  3IAM 2;  1V58 A;  5B8A A;  3C1R A;  1AW9 A;  2YWO A;  5JCU A;  8GSS A;  3MWH A;  3D21 A;  2GTU A;  2IL3 A;  1M99 A;  3TB2 A;  4ZL8 A;  2ON7 A;  2E2G A;  1U3I A;  4CDO A;  2X4A A;  1GSE A;  1DE2 A;  4GLT A;  2H6Z A;  3GKK A;  2KP1 A;  2JZR A;  1SD8 A;  4PUF C;  4G0L A;  3TJK A;  2K8S A;  3FR6 A;  4JR4 A;  3LOR A;  1ABA A;  4MJB A;  1M2A A;  3ERG A;  1J9B A;  2B3S A;  4IKH A;  2GQL A;  2IN3 A;  1OKT A;  5JWQ B;  3TJB A;  1XWB A;  2L57 A;  3KM6 A;  1YDK A;  1FVK A;  3TUE A;  3TJF A;  2XPD A;  2ZCT A;  3V1W A;  1TK0 B;  5JCG A;  3HJM A;  4PNF A;  3ZML A;  2P5R A;  6GSY A;  4NV2 A;  2LQO A;  5DAK B;  4QL7 A;  2H1G A;  3D5J A;  4YKG A;  1SU9 A;  1B9X C;  1N2A A;  3QR6 A;  4PXO A;  1DE1 A;  3GKX A;  3ZTL A;  1GWC A;  1HNA A;  3TRQ A;  4FO5 A;  2G2Q A;  5DBQ A;  4NWY A;  1G6Y A;  3KMN A;  4L5L A;  4EIQ A;  2GZP A;  1M9B A;  2L6D A;  4KUN A;  5HR1 A;  4MJC A;  4KCA A;  1HD2 A;  2DML A;  2YV7 A;  3ZL5 A;  2X49 A;  3WYW A;  3KP8 A;  2F8A A;  5HFK A;  2G0F A;  1OAZ A;  3DD3 A;  22GS A;  3CRU A;  3RAZ A;  3APO A;  1T4Y A;  1F3A A;  4K9Z A;  3DRN A;  3LJR A;  2IIY A;  2PPT A;  5G1K A;  2AAW A;  4HZ2 A;  3UBK A;  2YAN A;  2OAC A;  5G5E A;  4TR1 A;  1V9W A;  1BQ7 A;  5AGY A;  3GL5 A;  2YN1 A;  3MIX A;  4AJ8 A;  1M7T A;  3PGT A;  1YZX A;  2O85 A;  1A24 A;  1GLQ A;  4BVX B;  3US3 A;  3RPN A;  3IHQ A;  1WJK A;  2KLX A;  4LLR A;  3QPM A;  1TI1 A;  2R6K A;  2JZS A;  1GSD A;  1RK4 A;  2M46 A;  3EVI A;  4X43 A;  2B7J A;  1JLW A;  3K8N A;  5HR2 A;  1XG8 A;  2N5A A;  2ZNM A;  1EWX A;  4I5Q A;  4TXO A;  2QA1 A;  2V1M A;  1GUL A;  1YEX A;  2JL4 A;  1V57 A;  3EPT A;  3DKS A;  5F05 A;  2R3X A;  3IA1 A;  3A5W A;  5C00 A;  2C4J A;  3KXO A;  1T7P B;  2H6Y A;  2WGR A;  2I3Y A;  3KP9 A;  4KGI A;  2MMN A;  1ZYP A;  4G9H A;  2J9H A;  1F2E A;  1TU7 A;  4WEY A;  2B5X A;  1ERW A;  4NAX A;  2CX3 A;  3KD0 A;  4XIH A;  1XBS A;  2HFD A;  2N5F A;  1SJI A;  2L5O A;  3UL3 A;  1PMT A;  2IMI A;  3CTG A;  4KA0 A;  4G2E A;  4L8E A;  3APS A;  1YEP A;  5E59 A;  5A5K A;  1MD4 A;  3P90 A;  5DDL A;  5ECI B;  3D6I A;  4GCI A;  5D8I A;  3GL3 A;  4MJA A;  2VD0 A;  3DWV A;  1E6B A;  4GXZ A;  4NMU A;  3EWL A;  1VGL A;  4ECJ A;  4XRD A;  3GA4 A;  3D4M A;  2A2S A;  2IFQ A;  3P2A A;  2REM A;  6GSW A;  2YZU A;  1B48 A;  1WIK A;  1MTC A;  2YNX A;  2YP6 A;  2ZUP A;  3CYN A;  4NHZ A;  2LJR A;  5F8B A;  3UOM A;  1ML6 A;  1TK5 B;  4O5Q A;  3MSZ A;  2DIY A;  1GTI A;  2X8H A;  4GF0 A;  2BMX A;  1HNB A;  5IMC A;  3WT1 A;  3MDK A;  3GST A;  1JZD A;  1G6W A;  4K2X A;  2HSM A;  2DJK A;  2QC7 A;  2H72 A;  4KND A;  4PQH A;  2MBS A;  2VLT A;  3HVX A;  1SEN A;  2GS3 A;  3CQF A;  18GS A;  6GSS A;  1HNC A;  4Q5R A;  14GS A;  1M9A A;  3F63 A;  1SK1 A;  4JU5 A;  2HSH A;  2PU9 C;  4GQC A;  2CZ2 A;  4D73 B;  3GH9 A;  1EP8 A;  2DJ2 A;  3FZ5 A;  3IPZ A;  5IO2 A;  2UZ8 A;  2CA8 A;  3ZIJ A;  5GAP D;  4HS1 A;  2VCT A;  3LFL A;  4BPY A;  3ZRD A;  4XS4 A;  3HDC A;  3R3E A;  3I43 A;  5AIS A;  4GTU A;  1SJZ A;  1DUG A;  3KMO A;  1AQW A;  3VK9 A;  2VLU A;  2ON5 A;  3IHG A;  2EIO A;  4IHU A;  4DEJ A;  3GMF A;  3M3M A;  4RQX A;  4MZC A;  4Q5Q A;  2GT5 A;  2FUG 2;  2O8V B;  3TRP A;  3O76 A;  4EDZ A;  4ID0 A;  5H5Q A;  5EL8 A;  4MH3 A;  3TKR A;  3C1S A;  2GQK A;  5IOW A;  2C3N A;  3GSS A;  1AXD A;  2ES7 A;  1K0M A;  1QQ2 A;  5BRT A;  2DIZ A;  3VI5 A;  1W89 A;  5ABR A;  2DJ0 A;  4I97 A;  1EOG A;  1OVN A;  2HT9 A;  5G31 A;  1ZMA A;  1PKZ A;  2C0G A;  1XPV A;  2CAQ A;  1YQ1 A;  3S9F A;  1G7E A;  3J7Y k;  4FH8 A;  3D22 A;  4LL4 B;  1J0F A;  1U6T A;  1M3J A;  3FZA A;  4DSS A;  3TKP A;  2MMO A;  1S3R A;  3FMW A;  1S3C A;  2WDU A;  3WGD A;  4IBP A;  4WBJ A;  1Z6M A;  4GWR A;  5HR3 A;  3E3E A;  5D96 A;  4J57 E;  1NM3 A;  4PQI A;  5GZZ B;  5J5N A;  3LYK A;  2H73 A;  2L5L A;  5F06 A;  4GQF A;  5D9V A;  4KSM A;  1ILO A;  4WBR D;  1O8W A;  4V2N A;  4EUY A;  2V32 A;  2X99 A;  2L4C A;  1GNW A;  2YJH A;  3GNJ A;  2H0G A;  2HZF A;  1ON4 A;  2XBQ A;  2BTO T;  2O89 A;  4Z7X A;  2WJU A;  4P3Y B;  1EEM A;  3TRX A;  1K0O A;  3TOU A;  1OYJ A;  2FD3 A;  3HZ4 A;  4TOP A;  1AAZ A;  4XS6 A;  19GS A;  3DVX A;  2C0F A;  3Q6O A;  1FW1 A;  2H0H A;  4I2U A;  1Z5Y E;  1XWC A;  1PSQ A;  3UMA A;  4ZB6 A;  3F9U A;  4KF9 A;  5H5R A;  4BL7 A;  3QDN A;  4BVY A;  4OD7 A;  2C0D A;  1TRU A;  2VM1 A;  2XBI A;  3ZZX A;  5LCZ A;  1AIU A;  1XW5 A;  3HJO A;  3NIV A;  4TXV A;  4KDX A;  3EUR A;  4HUA A;  3WT2 A;  3W8S A;  1PA3 A;  1TRW A;  2FHE A;  5D9X A;  3VWV A;  3F6F A;  1PL2 A;  1ZCP A;  1EZK A;  1BED A;  1O73 A;  2NDO A;  5J41 A;  5CRD A;  3RBT A;  2JAC A;  2GLR A;  3VUR A;  3GTU B;  3GKM A;  2PUK C;  1TW9 A;  5G1L A;  4X4J A;  6GSU A;  1VRS D;  2GDR A;  3JCM L;  1G0T A;  1QXH A;  1F6M C;  2R0G A;  1GNE A;  3HXS A;  4KW6 A;  4TXO B;  1UC7 A;  3CSH A;  5ELG A;  1FOV A;  4K0G A;  3L0H A;  4HDE A;  3ZRE A;  4POL A;  4JZQ A;  2F9S A;  1TU8 A;  1V2A A;  5ECK B;  4KH7 A;  3LXZ A;  2VL2 A;  3C8E A;  2RM6 A;  5ID2 B;  1XOB A;  3GFK A;  1ZYE A;  1R5P A;  1G7O A;  1TI3 A;  3QAW A;  2HZE A;  1SKW B;  1GSY A;  2QSI A;  2DC5 A;  2CZ3 A;  2VL3 A;  4WR4 A;  2VO4 A;  1EEJ A;  17GS A;  4KB3 A;  3KZQ A;  1XWK A;  3CSJ A;  5LNK e;  4ML1 A;  1B8X A;  1ZZY A;  1U3A A;  2F8F A;  4ZBB A;  2HSY A;  4TR3 A;  5HFG A;  2P31 A;  2PVQ A;  2Z9S A;  1HYU A;  5DVB A;  3QOU A;  3HVN A;  3VLN A;  3KGK A;  1QK8 A;  2A2P A;  2R5G A;  2IPA A;  4TN8 A;  2DJJ A;  4G10 A;  2KOK A;  2H74 A;  3ISO A;  2XHF A;  1X0R A;  5KN2 A;  5JWR B;  5AN1 A;  5LD0 A;  4N11 A;  3MYD A;  1AC1 A;  2C3Q A;  4DSR A;  4EVM A;  1BYE A;  2XC2 A;  3L4N A;  5ELA A;  2P0G A;  2B6M A;  4NV5 A;  1WPI A;  4Q5N A;  3GYK A;  2I9H A;  2YWM A;  5IMD A;  4G0K A;  3HY2 A;  4E8H A;  1EV9 A;  3BD2 A;  1ACV A;  1O85 A;  3RPP A;  4FQU A;  1S3D A;  2DJ1 A;  2DJ3 A;  3H8Q A;  3Q18 A;  20GS A;  2B5Y A;  4O7H A;  3FW2 A;  1T3B A;  5INY A;  3DXB A;  2B1K A;  4OFN A;  1CQG A;  1GTA A;  3LGC A;  2HNL A;  1XVQ A;  1UVZ A;  3H79 A;  1K3Y A;  5D9W A;  3Q19 A;  4MPF A;  2L4Q A;  13GS A;  2LST A;  5BMU A;  4DSQ A;  1FB6 A;  5HQP A;  2OE3 A;  5IMZ A;  3LW9 A;  1XXU A;  3ZLP A;  4K6X A;  3ERW A;  3CBU A;  2PVO C;  4ISD A;  4HEA 2;  2IMF A;  4Z2R A;  5AIX A;  1DBY A;  2QKE A;  2LUS A;  3DEX A;  2LS5 A;  5GST A;  5GSS A;  1PFO A;  2FCH A;  1OC9 A;  5KOX A;  2V6O A;  4EF0 A;  4USS A;  3FZ9 A;  2B5E A;  4F03 A;  3TKS C;  4MK3 A;  5CRH A;  1PRX A;  4OFM A;  5KOW A;  2H71 A;  3VPQ A;  2IJY A;  4HJM A;  1K0D A;  4OO4 A;  2CT6 A;  1O8X A;  3UAR A;  3WGX A;  5DAL B;  3P7X A;  4YKF A;  5ECL B;  3GX8 A;  3IRA A;  2DMM A;  2XPE A;  3WD6 A;  1GUK A;  3W6G A;  3P8W A;  2DBC A;  5B7C A;  4POK A;  4YQM A;  3UIW A;  4GSS A;  2R4V A;  2FWH A;  3QFB C;  2YJ7 A;  4KX4 A;  1BG5 A;  4MF5 A;  1SL2 B;  1K0A A;  1X5D A;  1K0C A;  4TVE A;  4KCE A;  1X9M B;  9GSS A;  3A2W A;  2LJA A;  2FWF A;  4YAP A;  2M72 A;  1W4V A;  2K8V A;  3UAP A;  4LMW A;  1PL1 A;  2QA2 A;  4X0X A;  5A4V A;  1OC8 A;  3E9J B;  2GST A;  1R4W A;  5DAK A;  1Z7R A;  4PUR A;  3FR3 A;  3O3T A;  4MF7 A;  2CAI A;  5CYY A;  4ZL7 A;  2OBI A;  2AJQ B;  4OCE A;  1MDI A;  4MAB A;  1ERV A;  1XW6 A;  4FYU A;  4PNG A;  2RII A;  4XTS A;  3A2X A;  4WF5 A;  4K7N A;  5IPG A;  4L5O A;  4LL1 B;  1V40 A;  4TRX A;  1ZOF A;  1RQM A;  1SK2 A;  3KCM A;  1YY7 A;  1T00 A;  2VLV A;  1NHY A;  4LA1 A;  1FO5 A;  1Q98 A;  1A2L A;  3M0F A;  1LU4 A;  3GH6 A;  2LRN A;  3LQ7 A;  4F9Z A;  5IIZ A;  3HCZ A;  5CNW A;  4GSN A;  2LNT A;  2PER A;  1GUM A;  3VPT A;  5ECP B;  4MLY A;  1J08 A;  4XS1 A;  3A3T A;  3UEM A;  1X5E A;  2K9F A;  1TRV A;  2HRN A;  4J56 E;  4ZIL A;  2VIM A;  2C8U A;  3EE2 A;  1M2D A;  1URM A;  3LWA A;  1A8Y A;  3ZIT A;  3LEF A;  4CY6 A;  4HQS A;  4IP6 A;  4ZB8 A;  5A4W A;  1GL8 A;  4BVX A;  4KE3 A;  2AB6 A;  2FA8 A;  2CX4 A;  2TIR A;  2JSY A;  3UJ1 A;  3IBH A;  2C80 A;  2MMA A;  2GZZ A;  2E7P A;  4PTS A;  4ZB9 A;  1PD2 1;  2JZT A;  4AGS A;  4POB A;  4ZBA A;  3RHB A;  4I8B A;  4HQZ A;  1TKD B;  3PPU A;  4HOJ A;  1BAY A;  2OJL A;  4G0I A;  2YV9 A;  4G19 A;  1IYI A;  3TOT A;  2O7K A;  4GRF A;  4RI6 A;  4K5R A;  5KN0 A;  5FWG A;  6GSV A;  2DKH A;  3R2Q A;  2HZE B;  4F2I A;  1PKW A;  3WGE A;  1KBN A;  3C71 A;  4OMV A;  5DQY A;  1OE8 A;  4AJ7 A;  1Z9H A;  2MMZ A;  4MJE A;  2WUL A;  4KDY A;  2DLX A;  4RUV A;  4N0V A;  2JAD A;  3MAK A;  1EOH A;  2OKA A;  1M0U A;  3IOS A;  4ULX A;  3W8J A;  2K18 A;  4JR6 A;  16GS A;  4JE1 A;  1K3L A;  2FWG A;  1PN9 A;  1ZGN A;  2L6C A;  2IME A;  3FRC A;  2FGX A;  1JZR A;  1EGO A;  4MF6 A;  2HI7 A;  3QAV A;  3TCO A;  4HZ4 A;  3Q74 A;  5DQS A;  4K2D A;  3H93 A;  4TR4 A;  4MP4 A;  4ZL9 A;  4Z2U A;  3LYP A;  1BJX A;  2V6K A;  1HQO A;  2HYX A;  2R0C A;  1UA5 A;  4FYB A;  4ECC A;  3FZ4 A;  1K3O A;  2GQM A;  2JU5 A;  1ST9 A;  2NTO A;  3AY8 A;  1GSQ A;  2R37 A;  4NPB A;  2IWT A;  4N30 A;  5IM9 A;  4BIK A;  3FYG A;  2YPM A;  1B9Y C;  2CV4 A;  4HU9 A;  4IGJ A;  2MZC A;  1RW1 A;  4TKY A;  2VAF A;  3DVW A;  2H70 A;  4IW9 A;  2RM5 A;  4L0W A;  1XOA A;  1GP1 A;  1SKS B;  5ECS A;  2RUF A;  1ERU A;  3VWU A;  5J3R A;  5J9C A;  2ALB A;  4TR1 B;  3ZFL A;  1X5C A;  3BBY A;  4D73 A;  1TXX A;  1QMV A;  1U87 A;  3L78 A;  4V2M A;  1Y25 A;  3APQ A;  3QAG A;  2B7K A;  2LNS A;  1WMJ A;  3SBC A;  3GN3 A;  3DIE A;  4ZIJ A;  1GRX A;  1F37 A;  4K7I A;  5IO0 A;  2X8C A;  3KTL A;  5J4U A;  2LTK A;  4O5U A;  2A4V A;  2VCX A;  1ERT A;  2WRT A;  1O6J A;  4A5P A;  1OC9 B;  1LJR A;  1ZL9 A;  2E0Q A;  2PWJ A;  3GX0 A;  1Z6N A;  5KN3 A;  2FNO A;  3PH9 A;  4EL1 A;  1TP9 A;  2DKI A;  4FYC A;  1R26 A;  3QMX A;  1Y6E A;  5CRG A;  5DCG A;  2YZH A;  2FA4 A;  1SYR A;  2OE1 A;  4ECB A;  3IC4 A;  3TDG A;  4ILF A;  2HE3 A;  3H4K A;  1MDJ A;  5H5S A;  2QGV A;  2H01 A;  1AUC A;  2PMT A;  3IV4 A;  1MDK A;  2HRA A;  4MNN A;  1KNG A;  3SWL A;  1YKA A;  2NBS A;  1WP0 A;  5A4U A;  3TJJ A;  3L9V A;  2V2G A;  4ACS A;  1T8E B;  3GHA A;  4HSC X;  1YF1 A;  5G5F A;  5B6N A;  2MBT A;  3KEB A;  2OA7 A;  4WXT A;  5KEJ A;  5CO3 A;  2H1B A;  4K8M A;  3L9S A;  4ICY A;  1OE7 A;  1F3B A;  3ZVJ A;  4PX1 A;  4BA7 A;  2R2J A;  4F0B A;  4IVF A;  3EU3 A;  1ZYN A;  2GVP A;  2IFQ B;  2GT6 A;  3VFI A;  1VF4 A;  2KHP A;  2AHE A;  2PN8 A;  4IN0 A;  1WRY A;  2PBJ A;  1A2M A;  4CY8 A;  11GS A;  2P5Q A;  1GSF A;  3C73 A;  3HZ8 A;  3IC8 A;  3RDW A;  1QFN A;  3I6A A;  5G30 A;  5J9B A;  12GS A;  2GSR A;  3F3R A;  3F3Q A;  3M9J A;  2CQ9 A;  1H75 A;  2VCV A;  4V1A p;  4YAV A;  1QUW A;  2H75 A;  2VCW A;  2GSS A;  1FG4 A;  2C0E A;  3FEU A;  1TDI A;  4KDU A;  1R7H A;  3ERF A;  3HKR A;  3UVT A;  3M9K A;  2E2M A;  1THO A;  2V41 A;  1FHE A;  3KH7 A;  2DSA A;  2LKU A;  1S3A A;  2X64 A;  4CHS A;  3ZFB A;  2H1D A;  3BCK A;  4NHW A;  1T1V A;  3CXG A;  1TK8 B;  1T4Z A;  2H19 A;  5ECR B;  1A0R P;  3IE3 A;  5IMV A;  1SK0 A;  1GSS A;  5JWO B;  3KTB A;  3GRX A;  4QL9 A;  5IPH A;  4XS4 B;  1PX7 A;  5B6M A;  1C72 A;  3TGZ A;  1I9D A;  3PR8 A;  5L71 A;  4OCF A; 
#chains in the Genus database with same CATH homology
 2L59 A;  1Z3E A;  5IMA A;  3A5I A;  1NSW A;  4AF2 A;  1FVJ A;  1GSU A;  2C1Y A;  3GKN A;  5ECO B;  4I2T A;  3GTU A;  1A2J A;  1XWA A;  2IMK A;  4JBB A;  3EU4 A;  4IQ1 A;  2MYG A;  3F0I A;  4ECI A;  3EMX A;  2WB9 A;  3GUR A;  1R5A A;  2KUC A;  5DJM A;  4BWS A;  4FIW A;  3N5O A;  4TW5 A;  2PGT A;  3CMI A;  1SL0 B;  3U5R E;  3F4R A;  4PUA A;  5DJL A;  1XW9 A;  2H0I A;  2WS2 A;  4LMV A;  3HHV A;  4EXJ A;  5HFI A;  1FB0 A;  2LRT A;  3F6D A;  2F3M A;  3EMP A;  3EC3 A;  5DCH A;  5E4W A;  5ID2 A;  1SD9 A;  1WOU A;  4J2F A;  4MCU A;  4F0C A;  3DML A;  4WR5 A;  1GH2 A;  4MA9 A;  5D73 A;  5D93 A;  2TRX A;  3GIX A;  3G7Y A;  2CVB A;  1EGR A;  1BX9 A;  5IQY A;  4DSS B;  4O32 A;  3HA9 A;  1X9W B;  1XFL A;  4OWY A;  4HU7 A;  1LBK A;  3DGQ A;  1V98 A;  2LJK A;  4ML6 A;  4PGT A;  4K1F A;  3LSZ A;  3VWW A;  1FAA A;  2AV4 A;  10GS A;  2WCI A;  1VF1 A;  4IS0 A;  3BJ5 A;  4QQ7 A;  4KAE A;  1OC3 A;  2VUP A;  3CSI A;  3IAS 2;  2H76 A;  4O5R A;  4POM A;  4IP1 A;  2LV3 A;  1JZW A;  1A0F A;  3L9U A;  4RI7 A;  1O81 A;  1TJD A;  2YCD A;  5AIV A;  4KSO A;  4V1A g;  2H6X A;  4PQ1 A;  1AQV A;  2VL9 A;  4EE0 A;  3G7I A;  1FOH A;  4K0N A;  2VL2 C;  3D4T A;  5FHI A;  3F4S A;  1GUH A;  1USB A;  2IMD A;  4XRA A;  4E8E A;  4ZBD A;  3IK9 A;  1ZYQ B;  1NHO A;  2H30 A;  3ZVJ D;  3KH9 A;  2A4H A;  4O92 A;  1SL1 B;  4DVC A;  4BL7 B;  4MZW A;  4BVY B;  1AQX A;  2A2R A;  2X8G A;  1YJ6 A;  4F82 A;  4MZB A;  2LQQ A;  2NPB A;  3ME7 A;  3G7J A;  2VM2 A;  4EO3 A;  2JSZ A;  3MNG A;  4JRR A;  1Q4J A;  4OO5 A;  3IK7 A;  4Q5F A;  3KJY A;  1WWJ A;  1A8L A;  4H86 A;  1NW2 A;  3N9J A;  2O87 A;  1THX A;  1MD3 A;  1O7U A;  3NOF A;  3BCI A;  1VF2 A;  1KTE A;  4HI7 A;  5ECQ B;  3HJP A;  3HYP A;  2EC4 A;  3ED3 A;  5G2Z A;  1XVW A;  4MMM A;  1WE0 A;  5COH A;  3UBL A;  5ECM B;  5ECH B;  1Z7P A;  1GTB A;  2TRC P;  5EPF A;  2N5B A;  3FKF A;  5KN1 A;  2VCZ A;  1SJ6 A;  2GSQ A;  3UVH A;  1GLP A;  1DSB A;  2HRF A;  1YKC A;  3ME8 A;  2HXK A;  3FR9 A;  2EIR A;  2I81 A;  1PN0 A;  6GSX A;  3C7M A;  2CVK A;  2HRK A;  4JED A;  1OKD A;  4XCS A;  5CP1 A;  3LXT A;  4N0Z A;  1PGT A;  3ZIV A;  3O6T A;  1F9M A;  3TKS E;  3EIN A;  5ENU A;  3VWX A;  3RHC A;  2EIQ A;  3OR5 A;  1IYH A;  3M8N A;  1H4O A;  5FT3 A;  2VCQ A;  2CVD A;  4EC0 A;  1TOF A;  4N10 A;  5DAL A;  1KEB A;  3FK8 A;  2LEG A;  2J23 A;  4YH2 A;  2VOC A;  3VI7 A;  2BJX A;  2NVL A;  2H8L A;  1JFU A;  2I1U A;  2YWN A;  1CQH A;  1X9S B;  1E2Y A;  4GST A;  3IXR A;  5EVO A;  2WFC A;  5C04 A;  4L0U A;  2R0P A;  4HJ2 A;  4ZXG A;  5EY6 A;  2GGT A;  2LRC A;  3DYR A;  2VD1 A;  2HLS A;  3IDV A;  1XIY A;  3QFA C;  2OE0 A;  1K0B A;  2KP2 A;  4YQV A;  2D2Z A;  1TRS A;  2C3T A;  5GAN D;  4IQA A;  3TKQ A;  3HVV A;  1SKR B;  4MPG A;  3D0Z A;  2YWI A;  1XZO A;  3F4T A;  1PQN A;  1B4Q A;  2K6V A;  1EP7 A;  5ECN B;  5D9T A;  5HR0 A;  4TR0 A;  1PX6 A;  3TJG A;  6GST A;  2H66 A;  3QCP A;  2OBK A;  1EV4 A;  1U88 A;  2I4A A;  4XHM A;  4K5S A;  3H1N A;  3LG6 A;  4IEL A;  3CRT A;  3F8U A;  4RQR A;  2AUV A;  3QD9 A;  4EIP A;  3HVS A;  1XWG A;  5CRE A;  2M80 A;  3FY7 A;  4WF4 A;  5IMF A;  3TKS A;  4I6X A;  4IJ3 A;  4WET A;  4EKZ A;  4Z2T A;  2F51 A;  3G9B A;  3U6V A;  5CAX A;  1TTZ A;  3M1G A;  4NXI A;  1B4P A;  5JCW A;  3I9V 2;  7GSS A;  5IOX A;  1I5G A;  2GZY A;  3GUS A;  1XCC A;  4AJ6 A;  4V2L A;  4K7O A;  2AYT A;  3ZMK A;  3J7Y b;  1JHB A;  3EYT A;  4EDY A;  4YQU A;  1UN2 A;  4BWQ A;  1MEK A;  5CRW A;  3IR4 A;  1VF3 A;  4CW9 A;  1K0N A;  1YF0 A;  3CTF A;  1N8J A;  3E0U A;  4OFT A;  1SYX A;  3FHK A;  3BOA A;  4MH2 A;  2FWE A;  3GV1 A;  2YOI A;  3HD5 A;  4WKW A;  3NZN A;  1GTU A;  3I69 A;  5F07 A;  2B1L A;  1A23 A;  2H1A A;  1JLV A;  3KIJ A;  2WZ9 A;  2RLI A;  5B8B A;  4MDC A;  2FY6 A;  2FLS A;  4X1U A;  3ZYW A;  1M2B A;  2RUE A;  3PIN A;  3A2V A;  5F0G A;  1QGV A;  1JZO A;  2OAD A;  4IJI A;  3IAM 2;  1V58 A;  5B8A A;  3C1R A;  1AW9 A;  2YWO A;  5JCU A;  8GSS A;  3MWH A;  3D21 A;  2GTU A;  2IL3 A;  1M99 A;  3TB2 A;  4ZL8 A;  2ON7 A;  2E2G A;  1U3I A;  4CDO A;  2X4A A;  1GSE A;  1DE2 A;  4GLT A;  2H6Z A;  3GKK A;  2KP1 A;  2JZR A;  1SD8 A;  4PUF C;  4G0L A;  3TJK A;  2K8S A;  3FR6 A;  4JR4 A;  3LOR A;  1ABA A;  4MJB A;  1M2A A;  3ERG A;  1J9B A;  2B3S A;  4IKH A;  2GQL A;  2IN3 A;  1OKT A;  5JWQ B;  3TJB A;  1XWB A;  2L57 A;  3KM6 A;  1YDK A;  1FVK A;  3TUE A;  3TJF A;  2XPD A;  2ZCT A;  3V1W A;  1TK0 B;  5JCG A;  3HJM A;  4PNF A;  3ZML A;  2P5R A;  6GSY A;  4NV2 A;  2LQO A;  5DAK B;  4QL7 A;  2H1G A;  3D5J A;  4YKG A;  1SU9 A;  1B9X C;  1N2A A;  3QR6 A;  4PXO A;  1DE1 A;  3GKX A;  3ZTL A;  1GWC A;  1HNA A;  3TRQ A;  4FO5 A;  2G2Q A;  5DBQ A;  4NWY A;  1G6Y A;  3KMN A;  4L5L A;  4EIQ A;  2GZP A;  1M9B A;  2L6D A;  4KUN A;  5HR1 A;  4MJC A;  4KCA A;  1HD2 A;  2DML A;  2YV7 A;  3ZL5 A;  2X49 A;  3WYW A;  3KP8 A;  2F8A A;  5HFK A;  2G0F A;  1OAZ A;  3DD3 A;  22GS A;  3CRU A;  3RAZ A;  3APO A;  1T4Y A;  1F3A A;  4K9Z A;  3DRN A;  3LJR A;  2IIY A;  2PPT A;  5G1K A;  2AAW A;  4HZ2 A;  3UBK A;  2YAN A;  2OAC A;  5G5E A;  4TR1 A;  1V9W A;  1BQ7 A;  5AGY A;  3GL5 A;  2YN1 A;  3MIX A;  4AJ8 A;  1M7T A;  3PGT A;  1YZX A;  2O85 A;  1A24 A;  1GLQ A;  4BVX B;  3US3 A;  3RPN A;  3IHQ A;  1WJK A;  2KLX A;  4LLR A;  3QPM A;  1TI1 A;  2R6K A;  2JZS A;  1GSD A;  1RK4 A;  2M46 A;  3EVI A;  4X43 A;  2B7J A;  1JLW A;  3K8N A;  5HR2 A;  2N5A A;  2ZNM A;  1EWX A;  4I5Q A;  4TXO A;  2QA1 A;  2V1M A;  1GUL A;  1YEX A;  2JL4 A;  1V57 A;  3EPT A;  3DKS A;  5F05 A;  2R3X A;  3IA1 A;  3A5W A;  5C00 A;  2C4J A;  3KXO A;  1T7P B;  2H6Y A;  2WGR A;  2I3Y A;  3KP9 A;  4KGI A;  2MMN A;  1ZYP A;  4G9H A;  2J9H A;  1F2E A;  1TU7 A;  4WEY A;  2B5X A;  1ERW A;  4NAX A;  2CX3 A;  3KD0 A;  4XIH A;  1XBS A;  2HFD A;  2N5F A;  1SJI A;  2L5O A;  3UL3 A;  1PMT A;  2IMI A;  3CTG A;  4KA0 A;  4G2E A;  4L8E A;  3APS A;  1YEP A;  5E59 A;  5A5K A;  1MD4 A;  3P90 A;  5DDL A;  5ECI B;  3D6I A;  4GCI A;  5D8I A;  3GL3 A;  4MJA A;  2VD0 A;  3DWV A;  1E6B A;  4GXZ A;  4NMU A;  3EWL A;  1VGL A;  4ECJ A;  4XRD A;  3GA4 A;  3D4M A;  2A2S A;  2IFQ A;  3P2A A;  2REM A;  6GSW A;  2YZU A;  1B48 A;  1WIK A;  1MTC A;  2YNX A;  2YP6 A;  2ZUP A;  3CYN A;  4NHZ A;  2LJR A;  5F8B A;  3UOM A;  1ML6 A;  1TK5 B;  4O5Q A;  3MSZ A;  2DIY A;  1GTI A;  2X8H A;  4GF0 A;  2BMX A;  1HNB A;  5IMC A;  3WT1 A;  3MDK A;  3GST A;  1JZD A;  1G6W A;  4K2X A;  2HSM A;  2DJK A;  2QC7 A;  2H72 A;  4KND A;  4PQH A;  2MBS A;  2VLT A;  3HVX A;  1SEN A;  2GS3 A;  18GS A;  6GSS A;  1HNC A;  4Q5R A;  14GS A;  1M9A A;  3F63 A;  1SK1 A;  4JU5 A;  2HSH A;  2PU9 C;  4GQC A;  2CZ2 A;  4D73 B;  3GH9 A;  1EP8 A;  2DJ2 A;  3FZ5 A;  3IPZ A;  5IO2 A;  2UZ8 A;  2CA8 A;  3ZIJ A;  5GAP D;  4HS1 A;  2VCT A;  3LFL A;  4BPY A;  3ZRD A;  4XS4 A;  3HDC A;  3R3E A;  3I43 A;  5AIS A;  4GTU A;  1SJZ A;  1DUG A;  3KMO A;  1AQW A;  3VK9 A;  2VLU A;  2ON5 A;  3IHG A;  2EIO A;  4IHU A;  4DEJ A;  3GMF A;  3M3M A;  4RQX A;  4MZC A;  4Q5Q A;  2GT5 A;  2FUG 2;  2O8V B;  3TRP A;  3O76 A;  4EDZ A;  4ID0 A;  5H5Q A;  5EL8 A;  4MH3 A;  3TKR A;  3C1S A;  2GQK A;  5IOW A;  2C3N A;  3GSS A;  1AXD A;  2ES7 A;  1K0M A;  1QQ2 A;  5BRT A;  2DIZ A;  3VI5 A;  1W89 A;  5ABR A;  2DJ0 A;  4I97 A;  1EOG A;  1OVN A;  2HT9 A;  5G31 A;  1ZMA A;  1PKZ A;  2C0G A;  1XPV A;  2CAQ A;  1YQ1 A;  3S9F A;  1G7E A;  3J7Y k;  4FH8 A;  3D22 A;  4LL4 B;  1J0F A;  1U6T A;  3FZA A;  4DSS A;  3TKP A;  2MMO A;  3FMW A;  1S3C A;  2WDU A;  3WGD A;  4IBP A;  4WBJ A;  1Z6M A;  4GWR A;  5HR3 A;  3E3E A;  5D96 A;  4J57 E;  1NM3 A;  4PQI A;  5GZZ B;  5J5N A;  3LYK A;  2H73 A;  2L5L A;  5F06 A;  4GQF A;  5D9V A;  4KSM A;  1ILO A;  4WBR D;  1O8W A;  4V2N A;  4EUY A;  2V32 A;  2X99 A;  2L4C A;  1GNW A;  2YJH A;  3GNJ A;  2H0G A;  2HZF A;  1ON4 A;  2XBQ A;  2BTO T;  2O89 A;  4Z7X A;  2WJU A;  4P3Y B;  1EEM A;  3TRX A;  1K0O A;  3TOU A;  1OYJ A;  2FD3 A;  3HZ4 A;  4TOP A;  1AAZ A;  4XS6 A;  19GS A;  3DVX A;  2C0F A;  3Q6O A;  1FW1 A;  2H0H A;  4I2U A;  1Z5Y E;  1XWC A;  1PSQ A;  3UMA A;  4ZB6 A;  3F9U A;  4KF9 A;  5H5R A;  4BL7 A;  3QDN A;  4BVY A;  4OD7 A;  2C0D A;  1TRU A;  2VM1 A;  2XBI A;  3ZZX A;  5LCZ A;  1AIU A;  1XW5 A;  3HJO A;  3NIV A;  4TXV A;  4KDX A;  3EUR A;  4HUA A;  3WT2 A;  3W8S A;  1PA3 A;  1TRW A;  2FHE A;  5D9X A;  3VWV A;  3F6F A;  1PL2 A;  1ZCP A;  1EZK A;  1BED A;  1O73 A;  2NDO A;  5J41 A;  5CRD A;  3RBT A;  2JAC A;  2GLR A;  3VUR A;  3GTU B;  3GKM A;  2PUK C;  1TW9 A;  5G1L A;  4X4J A;  6GSU A;  1VRS D;  2GDR A;  3JCM L;  1G0T A;  1QXH A;  1F6M C;  2R0G A;  1GNE A;  3HXS A;  4KW6 A;  4TXO B;  1UC7 A;  3CSH A;  5ELG A;  1FOV A;  4K0G A;  3L0H A;  4HDE A;  3ZRE A;  4POL A;  4JZQ A;  2F9S A;  1TU8 A;  1V2A A;  5ECK B;  4KH7 A;  3LXZ A;  2VL2 A;  3C8E A;  2RM6 A;  5ID2 B;  1XOB A;  3GFK A;  1ZYE A;  1R5P A;  1G7O A;  1TI3 A;  3QAW A;  2HZE A;  1SKW B;  1GSY A;  2QSI A;  2DC5 A;  2CZ3 A;  2VL3 A;  4WR4 A;  2VO4 A;  1EEJ A;  17GS A;  4KB3 A;  3KZQ A;  1XWK A;  3CSJ A;  5LNK e;  4ML1 A;  1B8X A;  1ZZY A;  1U3A A;  2F8F A;  4ZBB A;  2HSY A;  4TR3 A;  5HFG A;  2P31 A;  2PVQ A;  2Z9S A;  1HYU A;  5DVB A;  3QOU A;  3VLN A;  3KGK A;  1QK8 A;  2A2P A;  2R5G A;  2IPA A;  4TN8 A;  2DJJ A;  4G10 A;  2KOK A;  2H74 A;  3ISO A;  2XHF A;  1X0R A;  5KN2 A;  5JWR B;  5AN1 A;  5LD0 A;  4N11 A;  3MYD A;  1AC1 A;  2C3Q A;  4DSR A;  4EVM A;  1BYE A;  2XC2 A;  3L4N A;  5ELA A;  2P0G A;  2B6M A;  4NV5 A;  1WPI A;  4Q5N A;  3GYK A;  2I9H A;  2YWM A;  5IMD A;  4G0K A;  3HY2 A;  4E8H A;  1EV9 A;  3BD2 A;  1ACV A;  1O85 A;  3RPP A;  4FQU A;  1S3D A;  2DJ1 A;  2DJ3 A;  3H8Q A;  3Q18 A;  20GS A;  2B5Y A;  4O7H A;  3FW2 A;  1T3B A;  5INY A;  3DXB A;  2B1K A;  4OFN A;  1CQG A;  1GTA A;  3LGC A;  2HNL A;  1XVQ A;  1UVZ A;  3H79 A;  1K3Y A;  5D9W A;  3Q19 A;  4MPF A;  2L4Q A;  13GS A;  2LST A;  5BMU A;  4DSQ A;  1FB6 A;  5HQP A;  2OE3 A;  5IMZ A;  3LW9 A;  1XXU A;  3ZLP A;  4K6X A;  3ERW A;  3CBU A;  2PVO C;  4ISD A;  4HEA 2;  2IMF A;  4Z2R A;  5AIX A;  1DBY A;  2QKE A;  2LUS A;  3DEX A;  2LS5 A;  5GST A;  5GSS A;  2FCH A;  1OC9 A;  5KOX A;  2V6O A;  4EF0 A;  4USS A;  3FZ9 A;  2B5E A;  4F03 A;  3TKS C;  4MK3 A;  5CRH A;  1PRX A;  4OFM A;  5KOW A;  2H71 A;  3VPQ A;  2IJY A;  4HJM A;  1K0D A;  4OO4 A;  2CT6 A;  1O8X A;  3UAR A;  3WGX A;  5DAL B;  3P7X A;  4YKF A;  5ECL B;  3GX8 A;  3IRA A;  2DMM A;  2XPE A;  3WD6 A;  1GUK A;  3W6G A;  3P8W A;  2DBC A;  5B7C A;  4POK A;  4YQM A;  3UIW A;  4GSS A;  2R4V A;  2FWH A;  3QFB C;  2YJ7 A;  4KX4 A;  1BG5 A;  4MF5 A;  1SL2 B;  1K0A A;  1X5D A;  1K0C A;  4TVE A;  4KCE A;  1X9M B;  9GSS A;  3A2W A;  2LJA A;  2FWF A;  4YAP A;  2M72 A;  1W4V A;  2K8V A;  3UAP A;  4LMW A;  1PL1 A;  2QA2 A;  4X0X A;  5A4V A;  1OC8 A;  3E9J B;  2GST A;  1R4W A;  5DAK A;  1Z7R A;  4PUR A;  3FR3 A;  3O3T A;  4MF7 A;  2CAI A;  5CYY A;  4ZL7 A;  2OBI A;  2AJQ B;  4OCE A;  1MDI A;  4MAB A;  1ERV A;  1XW6 A;  4FYU A;  4PNG A;  2RII A;  4XTS A;  3A2X A;  4WF5 A;  4K7N A;  5IPG A;  4L5O A;  4LL1 B;  1V40 A;  4TRX A;  1ZOF A;  1RQM A;  1SK2 A;  3KCM A;  1YY7 A;  1T00 A;  2VLV A;  1NHY A;  4LA1 A;  1FO5 A;  1Q98 A;  1A2L A;  3M0F A;  1LU4 A;  3GH6 A;  2LRN A;  3LQ7 A;  4F9Z A;  5IIZ A;  3HCZ A;  5CNW A;  4GSN A;  2LNT A;  2PER A;  1GUM A;  3VPT A;  5ECP B;  4MLY A;  1J08 A;  4XS1 A;  3A3T A;  3UEM A;  1X5E A;  2K9F A;  1TRV A;  2HRN A;  4J56 E;  4ZIL A;  2VIM A;  2C8U A;  3EE2 A;  1M2D A;  1URM A;  3LWA A;  1A8Y A;  3ZIT A;  3LEF A;  4CY6 A;  4HQS A;  4IP6 A;  4ZB8 A;  5A4W A;  1GL8 A;  4BVX A;  4KE3 A;  2AB6 A;  2FA8 A;  2CX4 A;  2TIR A;  2JSY A;  3UJ1 A;  3IBH A;  2C80 A;  2MMA A;  2GZZ A;  2E7P A;  4PTS A;  4ZB9 A;  1PD2 1;  2JZT A;  4AGS A;  4POB A;  4ZBA A;  3RHB A;  4I8B A;  4HQZ A;  1TKD B;  3PPU A;  4HOJ A;  1BAY A;  2OJL A;  4G0I A;  2YV9 A;  4G19 A;  1IYI A;  3TOT A;  2O7K A;  4GRF A;  4RI6 A;  4K5R A;  5KN0 A;  5FWG A;  6GSV A;  2DKH A;  3R2Q A;  2HZE B;  4F2I A;  1PKW A;  3WGE A;  1KBN A;  3C71 A;  4OMV A;  5DQY A;  1OE8 A;  4AJ7 A;  1Z9H A;  2MMZ A;  4MJE A;  2WUL A;  4KDY A;  2DLX A;  4RUV A;  4N0V A;  2JAD A;  3MAK A;  1EOH A;  2OKA A;  1M0U A;  3IOS A;  4ULX A;  3W8J A;  2K18 A;  4JR6 A;  16GS A;  4JE1 A;  1K3L A;  2FWG A;  1PN9 A;  1ZGN A;  2L6C A;  2IME A;  3FRC A;  2FGX A;  1JZR A;  1EGO A;  4MF6 A;  2HI7 A;  3QAV A;  3TCO A;  4HZ4 A;  3Q74 A;  5DQS A;  4K2D A;  3H93 A;  4TR4 A;  4MP4 A;  4ZL9 A;  4Z2U A;  3LYP A;  1BJX A;  2V6K A;  1HQO A;  2HYX A;  2R0C A;  1UA5 A;  4FYB A;  4ECC A;  3FZ4 A;  1K3O A;  2GQM A;  2JU5 A;  1ST9 A;  2NTO A;  3AY8 A;  1GSQ A;  2R37 A;  4NPB A;  2IWT A;  4N30 A;  5IM9 A;  3FYG A;  2YPM A;  1B9Y C;  2CV4 A;  4HU9 A;  4IGJ A;  2MZC A;  1RW1 A;  4TKY A;  2VAF A;  3DVW A;  2H70 A;  4IW9 A;  2RM5 A;  4L0W A;  1XOA A;  1GP1 A;  1SKS B;  5ECS A;  2RUF A;  1ERU A;  3VWU A;  5J3R A;  5J9C A;  2ALB A;  4TR1 B;  3ZFL A;  1X5C A;  3BBY A;  4D73 A;  1TXX A;  1QMV A;  1U87 A;  3L78 A;  4V2M A;  1Y25 A;  3APQ A;  3QAG A;  2B7K A;  2LNS A;  1WMJ A;  3SBC A;  3GN3 A;  3DIE A;  4ZIJ A;  1GRX A;  1F37 A;  4K7I A;  5IO0 A;  2X8C A;  3KTL A;  5J4U A;  2LTK A;  4O5U A;  2A4V A;  2VCX A;  1ERT A;  2WRT A;  1O6J A;  4A5P A;  1OC9 B;  1LJR A;  1ZL9 A;  2E0Q A;  2PWJ A;  3GX0 A;  1Z6N A;  5KN3 A;  2FNO A;  3PH9 A;  4EL1 A;  1TP9 A;  2DKI A;  4FYC A;  1R26 A;  3QMX A;  1Y6E A;  5CRG A;  5DCG A;  2YZH A;  2FA4 A;  1SYR A;  2OE1 A;  4ECB A;  3IC4 A;  3TDG A;  4ILF A;  2HE3 A;  3H4K A;  1MDJ A;  5H5S A;  2QGV A;  2H01 A;  1AUC A;  2PMT A;  3IV4 A;  1MDK A;  2HRA A;  4MNN A;  1KNG A;  3SWL A;  1YKA A;  2NBS A;  1WP0 A;  5A4U A;  3TJJ A;  3L9V A;  2V2G A;  4ACS A;  1T8E B;  3GHA A;  1YF1 A;  5G5F A;  5B6N A;  2MBT A;  3KEB A;  2OA7 A;  4WXT A;  5KEJ A;  5CO3 A;  2H1B A;  4K8M A;  3L9S A;  4ICY A;  1OE7 A;  1F3B A;  3ZVJ A;  4PX1 A;  4BA7 A;  2R2J A;  4F0B A;  4IVF A;  3EU3 A;  1ZYN A;  2GVP A;  2IFQ B;  2GT6 A;  3VFI A;  1VF4 A;  2KHP A;  2AHE A;  2PN8 A;  4IN0 A;  1WRY A;  2PBJ A;  1A2M A;  4CY8 A;  11GS A;  2P5Q A;  1GSF A;  3C73 A;  3HZ8 A;  3IC8 A;  3RDW A;  1QFN A;  3I6A A;  5G30 A;  5J9B A;  12GS A;  2GSR A;  3F3R A;  3F3Q A;  3M9J A;  2CQ9 A;  1H75 A;  2VCV A;  4V1A p;  4YAV A;  1QUW A;  2H75 A;  2VCW A;  2GSS A;  1FG4 A;  2C0E A;  3FEU A;  1TDI A;  4KDU A;  1R7H A;  3ERF A;  3HKR A;  3UVT A;  3M9K A;  2E2M A;  1THO A;  2V41 A;  1FHE A;  3KH7 A;  2DSA A;  2LKU A;  1S3A A;  2X64 A;  4CHS A;  3ZFB A;  2H1D A;  3BCK A;  4NHW A;  1T1V A;  3CXG A;  1TK8 B;  1T4Z A;  2H19 A;  5ECR B;  1A0R P;  3IE3 A;  5IMV A;  1SK0 A;  1GSS A;  5JWO B;  3KTB A;  3GRX A;  4QL9 A;  5IPH A;  4XS4 B;  1PX7 A;  5B6M A;  1C72 A;  3TGZ A;  1I9D A;  3PR8 A;  5L71 A;  4OCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...