1TTZA

X-ray structure of northeast structural genomics target protein xcr50 from x. campestris
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
75
structure length
75
Chain Sequence
ALTLYQRDDCHLCDQAVEALAQARAGAFFSVFIDDDAALESAYGLRVPVLRDPMGRELDWPFDAPRLRAWLDAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
publication title X-ray structure of Northeast Structural Genomics target protein XcR50 from X. campestris
rcsb
source organism Xanthomonas campestris
total genus 25
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05768 DUF836 Glutaredoxin-like domain (DUF836)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ttzA00
2JSZA 3RPNA 2NTOA 2PGTA 1BG5A 4KCAA 1SU9A 1ML6A 1XW9A 3VWVA 5A4WA 3BD2A 3KGKA 3DD3A 1FOVA 3P7XA 1OC9B 2DJKA 5J9CA 4F0CA 3DKSA 5CRHA 2LQQA 4GQFA 3A5WA 3M9JA 3H79A 3RHCA 3UBLA 3OR5A 1K0BA 3CTGA 2YP6A 3C71A 5COHA 2E2MA 4O5RA 2C3TA 2OA7A 4AGSA 4LA1A 2AYTA 3F63A 3E9JB 3F8UA 5ECPB 3F3QA 2DIYA 4JRRA 4Q5NA 2XPDA 4TOPA 1JHBA 1JZDA 2HRNA 2VD0A 3L0HA 2TIRA 2WCIA 4EDZA 3AY8A 3CTFA 5DJMA 3TJKA 2GT6A 3L4NA 2WJUA 3EMXA 4TR0A 3U6VA 1R7HA 3KCMA 2XPEA 1J0FA 2WULA 2DJ0A 1C72A 4MA9A 2RIIA 1YF1A 5IM9A 1AXDA 5F06A 4ECBA 4ZXGA 4WBRD 1T7PB 1GLQA 5JCWA 5LD0A 2YWIA 5DQYA 4MZBA 2X8GA 5D9TA 2I4AA 3GA4A 5HFIA 1AQVA 3HJOA 4POKA 4NAXA 3HXSA 3ERGA 5GAPD 1ZZYA 3KMOA 3TDGA 1VGLA 1GULA 1G7OA 4EDYA 3VWXA 1X0RA 1MDJA 2WRTA 20GSA 3ZREA 2B6MA 3APSA 4GSNA 5DALB 1YEPA 3N5OA 4WF5A 4OCFA 1GUKA 2H1GA 5CAXA 3M8NA 2C80A 4YQVA 4K7IA 5IMCA 3F3RA 1U88A 1SD9A 5J4UA 4RQRA 2REMA 1F3BA 1S3CA 4PQIA 4I5QA 4F82A 3DMLA 2CX3A 1YKCA 3P2AA 2A2SA 2FNOA 4X0XA 1MDIA 2L5LA 4X43A 4F03A 1J08A 4IKHA 2L6CA 4KX4A 4FO5A 1ILOA 1XIYA 2N5BA 3NIVA 1U3IA 3VK9A 2H01A 1YKAA 2VL2A 4MH3A 5B8AA 4J57E 3M0FA 2YJHA 4HJMA 5D96A 5ECSA 5F0GA 1Z5YE 4OD7A 2XBIA 5HR2A 4OCEA 2IL3A 2H8LA 2JZTA 3QFAC 2E0QA 4HQSA 1SKWB 2BMXA 1GTUA 1OVNA 1VF4A 3VURA 1M2DA 3ISOA 1T1VA 4POMA 2GTUA 2DMMA 3C1SA 4NWYA 1V58A 4PXOA 5CRDA 5ID2A 2O87A 4I97A 3RDWA 2H70A 3GKKA 2KHPA 2R4VA 5IO2A 5HR3A 1F37A 2OE0A 1DUGA 3TJFA 4D73A 5EPFA 2LKUA 3RAZA 1XWGA 3LXZA 22GSA 1MEKA 1HNCA 1OE7A 3IDVA 1SL0B 4I2UA 3GKMA 2Z9SA 5IIZA 6GSWA 5IMAA 2N5FA 2WS2A 5G2ZA 4EVMA 3F4SA 2MBTA 1OC3A 1TJDA 1Z6MA 3N9JA 2EIRA 3G9BA 4IP1A 2FLSA 3IXRA 4OFTA 1SK1A 3GKXA 2ALBA 2VCVA 2PU9C 5ECMB 3IOSA 1PA3A 1XOBA 3GRXA 2VM2A 2PBJA 3CRUA 1K0NA 2O8VB 2R37A 3ZRDA 1A2JA 1MDKA 2GQLA 3QPMA 3GFKA 1TKDB 1TOFA 1XW5A 1EP7A 3O6TA 3VWWA 4MF7A 1E6BA 1X5DA 5G5FA 12GSA 2ZCTA 4K0GA 3RHBA 2QKEA 1XWAA 2H6XA 2AHEA 4EXJA 4WF4A 1CQHA 1K0AA 1PX6A 1H75A 3G7IA 3H4KA 2ON7A 3EE2A 1PN9A 4HJ2A 2O85A 2J23A 2OACA 2KLXA 1ERTA 1X5EA 2CQ9A 5CO3A 2LRNA 2DMLA 1M2AA 1TP9A 3HYPA 2FCHA 2VLTA 4GF0A 1LBKA 3U5RE 1F9MA 1B8XA 3O76A 2MYGA 2FUG2 1O7UA 3LORA 2KOKA 4DSSB 4RI7A 3HHVA 1QUWA 3QFBC 5IOXA 2HZFA 4EKZA 1UA5A 1YDKA 1EOGA 3DIEA 2FWFA 2FA8A 3GNJA 1X9MB 2HRFA 4K2DA 3PINA 2WDUA 3WT2A 1GWCA 3IBHA 4XS1A 5KEJA 2O89A 1A24A 2XBQA 1VF2A 2HFDA 3JCML 1V2AA 2EIOA 5JCUA 2CVDA 3ZMLA 3F4RA 3W8JA 4MJEA 5D9VA 1W4VA 2FWGA 1K3YA 2C3NA 3CRTA 5B6MA 3GUSA 4XS6A 3QAVA 2QGVA 1MD3A 4YQUA 2H30A 4KDXA 1VF1A 2N5AA 2LUSA 1HYUA 4E8HA 2A2RA 5G1LA 2L57A 4ZBDA 2VCQA 3FZ5A 2DJ1A 2M80A 3HVXA 3CMIA 2V6KA 3GN3A 3F6FA 2BTOT 1TU8A 4KDUA 4GLTA 2F51A 1NHOA 4PUAA 3LXTA 1M9AA 1PX7A 13GSA 2L6DA 4RUVA 2MMNA 1T00A 2LRTA 4LL4B 3VPQA 5G5EA 2EC4A 2RUEA 4Z7XA 4IQAA 4TR1B 3IV4A 4XRAA 2VCZA 4WXTA 3IAS2 1Z6NA 4IP6A 2B5EA 2DLXA 2LNTA 4HI7A 1TRVA 5FWGA 2H72A 3KH9A 5J41A 5DAKB 1ABAA 5LCZA 4HU7A 5EVOA 4OWYA 1TXXA 2YJ7A 3IPZA 4YH2A 6GSSA 4BPYA 4NMUA 4EF0A 1DSBA 1ERWA 1SJIA 3UARA 1B48A 1NM3A 2DC5A 4XRDA 3V1WA 3TRXA 3LQ7A 3UL3A 1A8YA 4ZBBA 4JZQA 1GNEA 3GMFA 3KD0A 3MWHA 3TKSE 11GSA 1O6JA 3ME8A 6GSVA 3UVHA 3LG6A 1OC9A 2NBSA 1U6TA 4KSMA 2I3YA 1GTIA 4MLYA 4PURA 2R3XA 2AJQB 2IFQB 2HSHA 5E4WA 2H76A 4MZCA 3MSZA 2WZ9A 2TRCP 4MP4A 4XIHA 1N2AA 2CA8A 2HSYA 4GTUA 3TKQA 4ZL8A 2GGTA 5AN1A 1FB0A 4OFMA 3D21A 2K8SA 1YQ1A 1OYJA 3KEBA 2GDRA 2YPMA 4DVCA 3D5JA 5DCHA 2RM6A 2A4VA 2C0DA 3RBTA 2IWTA 1BQ7A 4O32A 3D4TA 4EO3A 2VOCA 2VM1A 3FRCA 3FKFA 5H5RA 1EV9A 1ST9A 3ZVJA 3GIXA 2CVKA 4ID0A 4MPFA 1GUMA 3EVIA 3KJYA 4G2EA 3HVVA 4ISDA 1Q98A 4ZB8A 1O8WA 1FAAA 5ECOB 1PKZA 1K0DA 4KGIA 1W89A 5ENUA 1CQGA 2RM5A 5C04A 1FO5A 5B6NA 3HJMA 4OFNA 3WD6A 2LS5A 1V40A 4HZ2A 1K3LA 3GSTA 5INYA 1RQMA 3C73A 3ZL5A 5ECNB 2AV4A 4AJ8A 1GSYA 1SKSB 2OKAA 4Q5FA 2YZUA 2RUFA 1AAZA 1K0CA 2V32A 4ZB6A 1Z7RA 4K9ZA 2VAFA 5H5QA 2L4QA 2GZYA 3FEUA 1AW9A 3TRQA 1X9WB 1SENA 17GSA 2HNLA 1AC1A 3LYKA 2P5QA 5DALA 1Z3EA 4KDYA 1ZOFA 4AF2A 2B3SA 1FB6A 3EC3A 3I9V2 2LNSA 4G9HA 5HFKA 2XHFA 4GQCA 2PUKC 1IYIA 1AIUA 3Q74A 2GT5A 2C1YA 1GSQA 2VUPA 1XPVA 4MDCA 3FR9A 1DE1A 5ECIB 3ERWA 1DBYA 2M46A 1HNAA 1WOUA 3H8QA 3FZAA 3MAKA 5IPGA 2P5RA 3HY2A 5ECQB 2HZEB 2G2QA 3UEMA 5HQPA 1FHEA 18GSA 2VIMA 3K8NA 2VO4A 1Q4JA 1OKDA 1O85A 4DSRA 2LV3A 3GYKA 1N8JA 3GH9A 2NVLA 3GTUB 1JZWA 3TRPA 4ML6A 1XWKA 4PQ1A 5CREA 2VCXA 3IAM2 3J7Yb 4JE1A 4KW6A 4PUFC 3APOA 2FHEA 4XS4B 3ZTLA 5ELGA 5CRWA 2C0GA 3KZQA 1NSWA 2DBCA 1WPIA 5CP1A 3GL5A 3DEXA 3QOUA 2HE3A 1OE8A 3J7Yk 2GSTA 3GKNA 3WGEA 2GSQA 1PSQA 2LQOA 3BCIA 3HZ4A 1XFLA 3NZNA 3QDNA 4HS1A 2O7KA 2ES7A 1O81A 3D4MA 2OE1A 6GSYA 2DJ2A 4NHZA 4FYBA 3I6AA 3IRAA 3HD5A 2YANA 4YAPA 1QFNA 3ERFA 3HCZA 1JLVA 4HEA2 4XTSA 1EV4A 5EY6A 5GSTA 1KEBA 1R5PA 4RQXA 3KMNA 4V2MA 1T4ZA 3P90A 3RPPA 4O7HA 1FG4A 10GSA 3ZZXA 3M1GA 4MABA 1Y25A 1AQWA 3PH9A 3CBUA 4POLA 2ZUPA 2B5XA 1Z9HA 2JADA 3CSIA 1FVJA 3GSSA 3L9UA 4IHUA 4N30A 7GSSA 1LJRA 2EIQA 4QL7A 4MZWA 3DRNA 5ECLB 2DJ3A 4NHWA 1UN2A 5AIVA 5L71A 2B5YA 2I1UA 3EU4A 2KP1A 1I9DA 2IIYA 1UVZA 5CYYA 3IK7A 5D8IA 5GAND 3EU3A 1LU4A 4J56E 4N0VA 3E0UA 4V2LA 2WB9A 1DE2A 3SBCA 3UAPA 3QMXA 3S9FA 4IGJA 1YY7A 4LMVA 5AGYA 4PQHA 3H1NA 6GSUA 4BVYA 2VLUA 2CAIA 1K3OA 3PGTA 5DJLA 3VPTA 2OE3A 5KN1A 4EUYA 1JZRA 1PL2A 2HYXA 4OMVA 4DEJA 1JFUA 1R5AA 2VL9A 4ZL9A 3LJRA 2CV4A 3HDCA 4BWSA 2K9FA 3QD9A 1T4YA 4DSSA 2PVQA 5ABRA 2J9HA 2V6OA 1A23A 2C0EA 4NV5A 1GSUA 2YWNA 4O92A 4KUNA 1KTEA 4LMWA 2JU5A 2WGRA 2YWMA 4GWRA 1GSDA 4WETA 14GSA 2CZ3A 1HD2A 16GSA 3DVWA 4ECIA 4CHSA 2MBSA 3L78A 4GXZA 6GSXA 1UC7A 3MNGA 2X64A 2VCWA 4HQZA 4GRFA 3CSHA 3LSZA 4K7NA 2V2GA 3KIJA 4TW5A 3IE3A 1TW9A 3DVXA 5IMVA 2LTKA 1AUCA 1IYHA 2YNXA 1M7TA 2PERA 2B7JA 3UOMA 2V41A 3KTBA 5DVBA 3TKPA 1PRXA 1WWJA 3HZ8A 2H6YA 1VF3A 5D93A 1QK8A 3UMAA 1ZL9A 2FWHA 5JCGA 5KN0A 3TUEA 1XXUA 3HKRA 3QCPA 4MMMA 2X99A 5J3RA 4IS0A 4ZBAA 5B8BA 3TCOA 1I5GA 1YF0A 3ZITA 4TVEA 3A2XA 5E59A 4AJ7A 5HR0A 2FA4A 3QAWA 4ACSA 4EL1A 4ZL7A 2H1AA 2MMZA 5ECHB 2ON5A 5AISA 4N11A 4HUAA 2V1MA 3TKRA 2PVOC 2F8FA 4KB3A 3ZFBA 3D0ZA 2M72A 3MDKA 1PQNA 1GL8A 1EOHA 2LSTA 3KH7A 4ECCA 3G7JA 2CT6A 1PGTA 4IN0A 5A4UA 2CAQA 3BBYA 4F9ZA 3A2VA 5B7CA 4V1Ag 2K6VA 1EWXA 2GSSA 1PL1A 1F2EA 4H86A 3IA1A 1WJKA 3KM6A 4BL7A 3DGQA 1NW2A 1MTCA 4IBPA 4IELA 2YOIA 3F4TA 1M2BA 4MJBA 2IMDA 3TJGA 3VWUA 2IMIA 1E2YA 4BA7A 4TXOB 5ECRB 5A4VA 1KBNA 4HOJA 3VI5A 3DWVA 4ILFA 3ED3A 5DBQA 5A5KA 1F3AA 3WGDA 2AUVA 4Q5QA 2H1DA 2H0IA 3TOTA 2LJRA 3EINA 1XBSA 5KN3A 3WYWA 5G1KA 1GP1A 1V9WA 4IVFA 1T8EB 5EL8A 3NOFA 3CXGA 4AJ6A 3HJPA 4V1Ap 4IJIA 1EGOA 5H5SA 2H6ZA 1JZOA 1YEXA 3FZ4A 3O3TA 1NHYA 4KH7A 3ZLPA 4MPGA 1SJZA 2YV9A 2GVPA 4L0UA 5IQYA 5J5NA 4BWQA 3ME7A 1B4PA 3FZ9A 2GLRA 1M99A 1M0UA 19GSA 1Z7PA 3WT1A 1BYEA 2YN1A 2VL3A 2IMKA 4WKWA 1B4QA 1GSFA 4K8MA 2LRCA 2B1KA 3GX8A 2OADA 2LEGA 2MMAA 2IMEA 1ZCPA 2IMFA 3EWLA 2OBIA 3US3A 3EURA 5IMZA 3W8SA 2ZNMA 3GV1A 1A0FA 2B1LA 1RW1A 4E8EA 1XZOA 1GTAA 5CRGA 3HVSA 1A0RP 1BAYA 3GX0A 4YAVA 1ERVA 2F9SA 2I9HA 3D6IA 2LJAA 3BCKA 2JL4A 6GSTA 4KAEA 1B9YC 9GSSA 3EMPA 4MF5A 2R6KA 3VI7A 4YQMA 3F6DA 1HQOA 3Q6OA 4MJAA 4KNDA 4ML1A 1YJ6A 3TJBA 4GCIA 3UIWA 3ZVJD 4CW9A 4V2NA 2OJLA 1WIKA 1SK2A 2YZHA 1XW6A 2DSAA 3BOAA 3KTLA 1T3BA 2FGXA 4JBBA 2H75A 5F8BA 5F07A 2X8CA 4TR4A 2NPBA 4N0ZA 2VD1A 4ECJA 1BX9A 3FW2A 3E3EA 5KN2A 4HDEA 3UJ1A 4P3YB 1J9BA 5D73A 1SKRB 1M9BA 1THOA 4HU9A 4NV2A 5D9XA 3FK8A 3APQA 2VLVA 3L9VA 5AIXA 4QQ7A 3CSJA 5IPHA 3UVTA 1TK5B 3TKSA 1SYRA 4XHMA 5JWQB 1WRYA 2E2GA 1GSSA 3D22A 2HZEA 4LLRA 5FHIA 2BJXA 1SJ6A 4F2IA 2H73A 2YV7A 4KA0A 1R26A 2YCDA 1XVQA 2GS3A 1TK0B 5IMFA 3TKSC 1TK8B 1SL2B 1S3AA 3GTUA 5ECKB 1PMTA 2IJYA 2B7KA 1ERUA 2DIZA 3LGCA 1KNGA 2KP2A 4JU5A 5FT3A 4ZILA 2C3QA 4XS4A 1AQXA 2PWJA 2VCTA 5DDLA 5IOWA 4TXVA 2GZPA 3R2QA 4Q5RA 1ZYEA 4G19A 1K0OA 2I81A 3PR8A 3CYNA 4MCUA 1EEMA 2JZSA 2X8HA 2QSIA 1URMA 5G31A 5GZZB 4N10A 1Y6EA 1RK4A 3G7YA 3H93A 2P0GA 5HFGA 3DXBA 3A2WA 2CZ2A 3TJJA 3W6GA 4I6XA 1V57A 5DQSA 2TRXA 4NPBA 1TRSA 2AAWA 1BEDA 1SD8A 1EP8A 2HT9A 3FR6A 1U3AA 4L5OA 2VL2C 4FYUA 3VLNA 3LEFA 3FYGA 2K8VA 4X1UA 5CNWA 5ELAA 3GH6A 3LWAA 2PPTA 2JZRA 3EYTA 4I8BA 1MD4A 1K0MA 2E7PA 1SK0A 1XCCA 1ZMAA 1VRSD 2NDOA 2DJJA 5JWOB 2H0HA 3C8EA 2MZCA 3FHKA 2H74A 5ID2B 3KXOA 1GH2A 4KCEA 1GLPA 2R5GA 3SWLA 4D73B 2H71A 4OO5A 1XWCA 2PN8A 1XOAA 4PNFA 4WR4A 2D2ZA 2HLSA 4PX1A 2F8AA 3ZIJA 4G10A 4QL9A 5IMDA 2RLIA 4NXIA 3I43A 3ZYWA 1X9SB 3FY7A 1PKWA 1ZGNA 2GSRA 4MJCA 4TRXA 1ZYQB 1QQ2A 1TU7A 4MF6A 2L5OA 4MH2A 1EGRA 4PNGA 4WBJA 2KUCA 3ZMKA 4EE0A 3VFIA 4ZB9A 3KP9A 4OO4A 1GTBA 1TDIA 1QMVA 1XVWA 4L8EA 1WE0A 1TTZA 1A8LA 1A2LA 3IK9A 4GSSA 3GHAA 4K1FA 2L4CA 2WFCA 1A2MA 1ON4A 2C8UA 4PGTA 1THXA 4ULXA 1GNWA 2H66A 4KE3A 2OBKA 2H0GA 3LYPA 2LJKA 1BJXA 4WEYA 1FVKA 2QC7A 4MK3A 1WP0A 4LL1B 2C0FA 4K0NA 3TGZA 1OC8A 1O8XA 1OAZA 1YZXA 2GZZA 3GL3A 3Q18A 4RI6A 4L0WA 1TRUA 2JACA 1XWBA 1G0TA 2P31A 3P8WA 2CVBA 5G30A 1FW1A 3F0IA 3IR4A 3GURA 1HNBA 2HI7A 4ZIJA 4IQ1A 2FWEA 3A3TA 3F9UA 4WR5A 4DSQA 4L5LA 1QXHA 2L59A 3FR3A 2IN3A 4F0BA 1O73A 4K7OA 5LNKe 4FIWA 3HA9A 2JSYA 2FY6A 2XC2A 4I2TA 1H4OA 2MMOA 3KP8A 1G6YA 1X5CA 3TB2A 3L9SA 4JR4A 4TR1A 3M3MA 2PMTA 3BJ5A 4POBA 3WGXA 4IJ3A 4KSOA 5GSSA 3LFLA 3I69A 1OKTA 1U87A 2H19A 5HR1A 2R2JA 1B9XC 5J9BA 3M9KA 3C7MA 1F6MC 2F3MA 5DAKA 5IO0A 3C1RA 4XCSA 3TOUA 4FYCA 1EEJA 4GSTA 2G0FA 1G6WA 1TI1A 1USBA 4TKYA 1S3DA 2HXKA 2C4JA 1SYXA 4TXOA 4IW9A 1QGVA 4EC0A 1TRWA 3QAGA 4FH8A 3ZIVA 3Q19A 4HZ4A 3IHQA 1WMJA 3QR6A 2H1BA 1JLWA 3UBKA 4JR6A 5D9WA 5C00A 1EZKA 5DCGA 2CX4A 5JWRB 1V98A 1R4WA 4TR3A 1ACVA 4JEDA 2GQKA 1SL1B 1PD21 2IFQA 4TN8A 1TI3A 2IPAA 1GUHA 3DYRA 2GQMA 8GSSA 1G7EA 4K6XA 1GSEA 4BVXA 4CDOA 2K18A 5F05A 2AB6A 4J2FA 3ZFLA 2YWOA 3IC4A 1GRXA 2FD3A
chains in the Genus database with same CATH superfamily
2JSZA 3RPNA 2NTOA 2PGTA 1BG5A 4KCAA 1SU9A 1ML6A 1XW9A 3VWVA 5A4WA 3BD2A 3FMWA 3KGKA 3DD3A 1FOVA 3P7XA 1OC9B 2DJKA 5J9CA 4F0CA 3DKSA 5CRHA 2LQQA 4GQFA 3A5WA 3M9JA 3H79A 4K5SA 3RHCA 3UBLA 3OR5A 1K0BA 3CTGA 2YP6A 3PPUA 3C71A 5COHA 2E2MA 4O5RA 2C3TA 2OA7A 4AGSA 4LA1A 2AYTA 3F63A 3E9JB 3F8UA 5ECPB 3F3QA 2DIYA 2X4AA 4JRRA 4Q5NA 2XPDA 4TOPA 1JHBA 1JZDA 2HRNA 2VD0A 3L0HA 2TIRA 2WCIA 4EDZA 3AY8A 3CTFA 5DJMA 3TJKA 2GT6A 3L4NA 2WJUA 3EMXA 4TR0A 3EPTA 3U6VA 1R7HA 3KCMA 2XPEA 1J0FA 2WULA 2DJ0A 1C72A 4MA9A 2RIIA 1YF1A 5IM9A 1AXDA 5F06A 4HSCX 4ECBA 4ZXGA 4WBRD 1T7PB 1GLQA 5JCWA 5LD0A 2YWIA 5DQYA 4MZBA 2X8GA 5D9TA 2I4AA 3GA4A 3IHGA 5HFIA 1AQVA 3HJOA 4POKA 4NAXA 3HXSA 3ERGA 5GAPD 1ZZYA 3KMOA 3TDGA 1VGLA 1GULA 1G7OA 4EDYA 3VWXA 1X0RA 4CY6A 1MDJA 2WRTA 20GSA 3ZREA 4Z2UA 2B6MA 3APSA 4GSNA 5DALB 1YEPA 3N5OA 4WF5A 4OCFA 1GUKA 2H1GA 5CAXA 3M8NA 2C80A 4YQVA 4K7IA 5IMCA 3F3RA 1U88A 1SD9A 5J4UA 4RQRA 2REMA 1F3BA 1S3CA 4PQIA 4I5QA 4F82A 3DMLA 2CX3A 1YKCA 3P2AA 2A2SA 2FNOA 4X0XA 1MDIA 2L5LA 4X43A 4F03A 1J08A 4IKHA 2L6CA 4KX4A 4FO5A 1ILOA 1XIYA 2N5BA 3NIVA 1U3IA 3VK9A 2H01A 1YKAA 2VL2A 4MH3A 5B8AA 4J57E 3M0FA 2YJHA 4HJMA 5D96A 5ECSA 5F0GA 1Z5YE 4OD7A 2XBIA 5HR2A 4OCEA 2IL3A 2H8LA 2JZTA 3QFAC 2E0QA 4HQSA 1SKWB 2BMXA 1GTUA 1OVNA 1VF4A 3VURA 1M2DA 3ISOA 1T1VA 4POMA 2GTUA 2DMMA 3C1SA 4FQUA 4NWYA 1V58A 4PXOA 5CRDA 5ID2A 2O87A 4I97A 3RDWA 2H70A 3GKKA 2KHPA 2R4VA 5IO2A 5HR3A 1F37A 2OE0A 1DUGA 3TJFA 4D73A 5EPFA 2LKUA 3RAZA 1XWGA 3LXZA 22GSA 1MEKA 1HNCA 1OE7A 3IDVA 1SL0B 4I2UA 3GKMA 2Z9SA 3IC8A 5IIZA 6GSWA 5IMAA 2N5FA 2WS2A 5G2ZA 4EVMA 3F4SA 2MBTA 1OC3A 1TJDA 1Z6MA 3N9JA 2EIRA 3G9BA 4IP1A 2FLSA 3IXRA 4OFTA 1SK1A 3GKXA 2ALBA 2VCVA 2PU9C 5ECMB 3IOSA 1PA3A 1XOBA 3GRXA 2VM2A 2PBJA 3CRUA 1K0NA 2O8VB 2R37A 3ZRDA 1A2JA 1MDKA 2GQLA 3QPMA 3GFKA 1TKDB 1TOFA 1XW5A 1EP7A 3O6TA 3VWWA 4MF7A 1E6BA 1X5DA 5G5FA 12GSA 2ZCTA 4K0GA 3RHBA 2QKEA 1XWAA 2H6XA 2AHEA 4EXJA 4WF4A 1CQHA 1K0AA 1XG8A 1PX6A 1H75A 3G7IA 3H4KA 2ON7A 3EE2A 1PN9A 4HJ2A 2O85A 2J23A 2OACA 2KLXA 4BVYB 1ERTA 1X5EA 2CQ9A 5CO3A 2LRNA 2DMLA 1M2AA 1TP9A 3HYPA 2FCHA 2VLTA 4GF0A 1LBKA 3U5RE 1F9MA 1B8XA 3O76A 2MYGA 2FUG2 1O7UA 3LORA 2KOKA 4DSSB 4RI7A 3HHVA 1QUWA 3QFBC 5IOXA 2HZFA 4EKZA 1UA5A 1YDKA 1EOGA 3DIEA 2FWFA 2FA8A 3GNJA 1X9MB 2HRFA 4K2DA 3PINA 2WDUA 3WT2A 1GWCA 3IBHA 4XS1A 5KEJA 4Z2TA 2O89A 1A24A 2XBQA 1VF2A 2HFDA 3JCML 1V2AA 2EIOA 5JCUA 2CVDA 3ZMLA 3F4RA 3W8JA 4MJEA 5D9VA 1W4VA 2FWGA 1K3YA 2C3NA 3CRTA 5B6MA 3GUSA 4XS6A 4O5QA 3QAVA 2QGVA 4KF9A 1MD3A 4YQUA 2H30A 4KDXA 1VF1A 2N5AA 2LUSA 1HYUA 4E8HA 2A2RA 5G1LA 2L57A 4ZBDA 2VCQA 3FZ5A 2DJ1A 2M80A 3HVXA 3CMIA 2V6KA 4BIKA 3GN3A 3F6FA 2BTOT 1TU8A 4KDUA 4GLTA 4MNNA 2F51A 3CQFA 1NHOA 4PUAA 3LXTA 1M9AA 1PX7A 13GSA 2L6DA 4RUVA 2MMNA 1T00A 2LRTA 4LL4B 3VPQA 5G5EA 2EC4A 2RUEA 4Z7XA 4IQAA 4TR1B 3IV4A 4XRAA 2VCZA 4WXTA 3IAS2 1Z6NA 4IP6A 2B5EA 2DLXA 2LNTA 4HI7A 1TRVA 5FWGA 2H72A 3KH9A 5J41A 5DAKB 1ABAA 5LCZA 4HU7A 5EVOA 4OWYA 1TXXA 2YJ7A 3IPZA 2HRAA 4YH2A 6GSSA 4BPYA 4NMUA 4EF0A 4K5RA 1DSBA 1ERWA 1SJIA 3UARA 1B48A 1NM3A 2DC5A 4XRDA 3V1WA 3TRXA 3LQ7A 3UL3A 1A8YA 4ZBBA 4JZQA 1GNEA 3GMFA 3KD0A 3MWHA 3TKSE 11GSA 1O6JA 3ME8A 6GSVA 3UVHA 3LG6A 1OC9A 2NBSA 1U6TA 4KSMA 2I3YA 1GTIA 4MLYA 4PURA 2R3XA 2AJQB 2IFQB 2HSHA 5E4WA 2H76A 4MZCA 3MSZA 2WZ9A 3R3EA 2TRCP 4MP4A 4XIHA 1N2AA 4BVXB 2CA8A 2HSYA 4GTUA 3TKQA 4ZL8A 2GGTA 5AN1A 1FB0A 4OFMA 3D21A 2K8SA 4G0KA 1YQ1A 1OYJA 3KEBA 2GDRA 2YPMA 4DVCA 3D5JA 2X49A 5DCHA 2RM6A 2A4VA 2C0DA 3RBTA 2IWTA 1BQ7A 4O32A 3D4TA 4EO3A 2VOCA 2VM1A 3FRCA 3FKFA 5H5RA 1EV9A 1ST9A 3ZVJA 3GIXA 2CVKA 4ID0A 4MPFA 1GUMA 4G0LA 3EVIA 3KJYA 4G2EA 3HVVA 4ISDA 1Q98A 4ZB8A 1O8WA 1FAAA 5ECOB 1PKZA 1K0DA 4KGIA 1W89A 5ENUA 1CQGA 2RM5A 5C04A 1FO5A 5B6NA 3HJMA 4OFNA 3WD6A 2LS5A 1V40A 4HZ2A 1K3LA 3GSTA 5INYA 1RQMA 3C73A 3ZL5A 5ECNB 2AV4A 4YKFA 4AJ8A 1GSYA 1SKSB 2OKAA 4Q5FA 2YZUA 2RUFA 1AAZA 1K0CA 2V32A 3LW9A 4ZB6A 1Z7RA 4K9ZA 2VAFA 5H5QA 2L4QA 2GZYA 3FEUA 1AW9A 3TRQA 1X9WB 1SENA 17GSA 2HNLA 1AC1A 3LYKA 2P5QA 5DALA 1Z3EA 4KDYA 1ZOFA 4AF2A 2B3SA 1FB6A 3EC3A 3I9V2 2LNSA 4G9HA 5HFKA 2XHFA 4GQCA 2PUKC 1IYIA 1AIUA 3Q74A 2GT5A 2C1YA 1GSQA 2VUPA 1XPVA 4MDCA 3FR9A 1DE1A 5ECIB 3ERWA 1DBYA 2M46A 1HNAA 1WOUA 3H8QA 3FZAA 3MAKA 5IPGA 2P5RA 3HY2A 5ECQB 2HZEB 2G2QA 3UEMA 5HQPA 1FHEA 18GSA 2VIMA 3K8NA 2VO4A 1Q4JA 1OKDA 1O85A 4K2XA 4DSRA 2LV3A 3GYKA 1N8JA 3GH9A 2NVLA 3GTUB 1JZWA 3TRPA 4ML6A 1XWKA 4PQ1A 5CREA 2VCXA 3IAM2 3J7Yb 4JE1A 4KW6A 4PUFC 3APOA 2FHEA 4XS4B 3ZTLA 5ELGA 5CRWA 2C0GA 3KZQA 1NSWA 2DBCA 1WPIA 5CP1A 3GL5A 3DEXA 3QOUA 2HE3A 1OE8A 3J7Yk 2GSTA 3GKNA 3WGEA 2GSQA 1PSQA 2LQOA 3BCIA 3HZ4A 1XFLA 3NZNA 3QDNA 4HS1A 2O7KA 2ES7A 1O81A 3D4MA 2OE1A 6GSYA 2DJ2A 4NHZA 4FYBA 3I6AA 3IRAA 3HD5A 2YANA 4YAPA 1QFNA 3ERFA 3HCZA 1JLVA 4HEA2 4XTSA 1EV4A 5EY6A 5GSTA 1KEBA 1R5PA 4RQXA 3KMNA 4V2MA 1T4ZA 3P90A 3RPPA 4O7HA 1FG4A 10GSA 3ZZXA 3M1GA 4MABA 1Y25A 1AQWA 3PH9A 3CBUA 4POLA 2ZUPA 2B5XA 1Z9HA 2JADA 3CSIA 1FVJA 3GSSA 4YKGA 3L9UA 4IHUA 4N30A 7GSSA 1LJRA 2R0CA 2EIQA 4QL7A 4MZWA 3DRNA 5ECLB 4EIPA 2DJ3A 4NHWA 1UN2A 5AIVA 5L71A 2B5YA 2I1UA 3EU4A 2KP1A 1I9DA 2IIYA 1UVZA 5CYYA 3IK7A 5D8IA 5GAND 3EU3A 1LU4A 4J56E 4N0VA 3E0UA 4V2LA 2WB9A 1DE2A 3SBCA 3UAPA 3QMXA 3S9FA 4IGJA 1YY7A 4LMVA 5AGYA 4PQHA 3H1NA 6GSUA 4BVYA 2VLUA 2CAIA 1K3OA 3PGTA 5DJLA 3VPTA 2OE3A 5KN1A 4EUYA 5KOXA 1JZRA 1PL2A 2HYXA 4OMVA 4DEJA 1JFUA 2A2PA 1R5AA 4A5PA 2VL9A 4ZL9A 3LJRA 2CV4A 3HDCA 4BWSA 2K9FA 3QD9A 1T4YA 4DSSA 2PVQA 5ABRA 2J9HA 2V6OA 1A23A 2C0EA 4NV5A 1GSUA 2YWNA 4O92A 4KUNA 1KTEA 4LMWA 2HRKA 2JU5A 2WGRA 2YWMA 4GWRA 1M3JA 1GSDA 2DKHA 4WETA 14GSA 2CZ3A 1HD2A 16GSA 3DVWA 4ECIA 2R0GA 4CHSA 2MBSA 3L78A 4GXZA 6GSXA 1UC7A 3MNGA 2X64A 2VCWA 4HQZA 4GRFA 3CSHA 3LSZA 4K7NA 2V2GA 3KIJA 4TW5A 3IE3A 1TW9A 3DVXA 5IMVA 2LTKA 1AUCA 1IYHA 2YNXA 1M7TA 2PERA 2B7JA 3UOMA 2R0PA 2V41A 3KTBA 5DVBA 3TKPA 1PRXA 1WWJA 3HZ8A 2H6YA 1VF3A 5D93A 1QK8A 3UMAA 1ZL9A 2FWHA 5JCGA 5KN0A 3TUEA 1XXUA 3HKRA 3QCPA 4MMMA 2X99A 5J3RA 4IS0A 4ZBAA 5B8BA 3TCOA 1PFOA 1I5GA 1YF0A 3ZITA 4TVEA 3A2XA 5E59A 4AJ7A 5HR0A 2FA4A 3QAWA 4ACSA 4EL1A 4ZL7A 2H1AA 2MMZA 5ECHB 2ON5A 5AISA 4N11A 4HUAA 2V1MA 3TKRA 2PVOC 2F8FA 4KB3A 3ZFBA 3D0ZA 2M72A 3MDKA 1PQNA 1GL8A 1EOHA 2LSTA 3KH7A 4ECCA 3G7JA 2CT6A 1PGTA 4IN0A 5A4UA 2CAQA 3BBYA 4F9ZA 3A2VA 5B7CA 2QA2A 4V1Ag 2K6VA 1EWXA 2GSSA 1PL1A 1F2EA 4H86A 3MIXA 3IA1A 1WJKA 3KM6A 4BL7A 3HVNA 3DGQA 1NW2A 1MTCA 4IBPA 4IELA 2YOIA 3F4TA 1M2BA 4MJBA 2IMDA 3TJGA 3VWUA 2IMIA 1E2YA 4BA7A 4TXOB 5ECRB 5A4VA 1KBNA 4HOJA 3VI5A 2A4HA 3DWVA 4ILFA 3ED3A 5DBQA 5A5KA 1F3AA 3WGDA 2AUVA 4Q5QA 2H1DA 2H0IA 3TOTA 2LJRA 3EINA 1XBSA 5KN3A 3WYWA 5G1KA 1GP1A 1V9WA 4IVFA 1T8EB 5EL8A 3NOFA 3CXGA 4AJ6A 3HJPA 4V1Ap 4IJIA 1EGOA 5H5SA 2H6ZA 1JZOA 1YEXA 3FZ4A 3O3TA 1NHYA 4KH7A 3ZLPA 4MPGA 1SJZA 2YV9A 2GVPA 4L0UA 5IQYA 5J5NA 4BWQA 3ME7A 1B4PA 3FZ9A 2GLRA 1M99A 1M0UA 19GSA 1Z7PA 3WT1A 1BYEA 5BRTA 2YN1A 2VL3A 1FOHA 2IMKA 4WKWA 1B4QA 1GSFA 4K8MA 2LRCA 2B1KA 3GX8A 2OADA 2LEGA 2MMAA 2IMEA 1ZCPA 2IMFA 3EWLA 2OBIA 3US3A 3EURA 5IMZA 3W8SA 2ZNMA 3GV1A 1A0FA 2B1LA 1RW1A 4E8EA 1XZOA 4Z2RA 1GTAA 5CRGA 3HVSA 1A0RP 1BAYA 3GX0A 4YAVA 1ERVA 2F9SA 2I9HA 3D6IA 2LJAA 3BCKA 2JL4A 6GSTA 4KAEA 1B9YC 9GSSA 3EMPA 4MF5A 2R6KA 3VI7A 4YQMA 3F6DA 1HQOA 3Q6OA 4MJAA 4KNDA 4ML1A 1YJ6A 3TJBA 4GCIA 3UIWA 3ZVJD 4CW9A 4V2NA 2OJLA 1WIKA 1SK2A 2YZHA 1XW6A 2DSAA 1ZYNA 3BOAA 4ICYA 3KTLA 1T3BA 2FGXA 4JBBA 1PN0A 2H75A 5F8BA 2X8CA 4TR4A 5F07A 2NPBA 4N0ZA 2VD1A 4ECJA 1BX9A 5KOWA 3FW2A 3E3EA 5KN2A 4HDEA 3UJ1A 4P3YB 1J9BA 5D73A 1SKRB 1M9BA 1THOA 4HU9A 4NV2A 5D9XA 3FK8A 3APQA 2VLVA 3L9VA 5AIXA 4QQ7A 3CSJA 5IPHA 3UVTA 1TK5B 3TKSA 1SYRA 4XHMA 5JWQB 2UZ8A 1WRYA 2E2GA 1GSSA 3D22A 2HZEA 4LLRA 5FHIA 2BJXA 1SJ6A 4F2IA 2H73A 2YV7A 4KA0A 1R26A 2YCDA 1XVQA 2GS3A 1TK0B 5IMFA 3TKSC 1TK8B 1SL2B 1S3AA 3GTUA 4EIQA 5ECKB 1PMTA 2IJYA 2B7KA 1ERUA 2DIZA 3LGCA 1KNGA 2KP2A 4JU5A 5FT3A 4ZILA 2C3QA 4XS4A 1AQXA 2PWJA 2VCTA 5DDLA 5IOWA 4TXVA 2GZPA 3R2QA 4Q5RA 4CY8A 1ZYEA 4G19A 1K0OA 2I81A 3PR8A 3CYNA 4MCUA 1EEMA 2JZSA 2X8HA 2QSIA 1URMA 5G31A 5GZZB 4N10A 1Y6EA 1RK4A 3G7YA 3H93A 2P0GA 5HFGA 3DXBA 3A2WA 2QA1A 2CZ2A 3TJJA 3W6GA 4I6XA 1V57A 5DQSA 2TRXA 4NPBA 1TRSA 2AAWA 1BEDA 1SD8A 1EP8A 2HT9A 3FR6A 1U3AA 4L5OA 2VL2C 4FYUA 3VLNA 3LEFA 3FYGA 2K8VA 4X1UA 5CNWA 5ELAA 3GH6A 3LWAA 2PPTA 2JZRA 3EYTA 4I8BA 1MD4A 1K0MA 2E7PA 1SK0A 1XCCA 1ZMAA 1VRSD 2NDOA 2DJJA 5JWOB 2H0HA 3C8EA 2MZCA 3FHKA 2H74A 5ID2B 3KXOA 1GH2A 4KCEA 1GLPA 2R5GA 4PTSA 3SWLA 4D73B 2H71A 4OO5A 1XWCA 2PN8A 1XOAA 4PNFA 4WR4A 2D2ZA 2HLSA 4G0IA 4PX1A 2F8AA 3ZIJA 4G10A 4QL9A 5IMDA 2RLIA 4NXIA 3I43A 3ZYWA 1X9SB 3FY7A 1PKWA 1ZGNA 2GSRA 1S3RA 4MJCA 4TRXA 1ZYQB 1QQ2A 1TU7A 4MF6A 2L5OA 4MH2A 1EGRA 4PNGA 4WBJA 2KUCA 3ZMKA 4EE0A 3VFIA 4ZB9A 3KP9A 4OO4A 1GTBA 1TDIA 1QMVA 1XVWA 4L8EA 1WE0A 1TTZA 1A8LA 1A2LA 3IK9A 4GSSA 3GHAA 4K1FA 2L4CA 4USSA 2WFCA 1A2MA 1ON4A 2C8UA 4PGTA 2DKIA 1THXA 4ULXA 1GNWA 2H66A 4KE3A 2OBKA 2H0GA 3LYPA 2LJKA 1BJXA 4WEYA 1FVKA 2QC7A 4MK3A 1WP0A 4LL1B 2C0FA 4K0NA 3TGZA 3MYDA 5BMUA 1OC8A 1O8XA 1OAZA 1YZXA 2GZZA 3GL3A 3Q18A 1ZYPA 4RI6A 2HSMA 4L0WA 1TRUA 2JACA 1XWBA 1G0TA 2P31A 3P8WA 2CVBA 5G30A 1FW1A 3F0IA 3IR4A 3GURA 1HNBA 2HI7A 4ZIJA 4IQ1A 2FWEA 3A3TA 3F9UA 4WR5A 4DSQA 4L5LA 1QXHA 2L59A 3FR3A 2IN3A 4F0BA 1O73A 4K7OA 5LNKe 4FIWA 3HA9A 2JSYA 2FY6A 2XC2A 4I2TA 1H4OA 1M3IA 2MMOA 3KP8A 1G6YA 1X5CA 3TB2A 3L9SA 4JR4A 4TR1A 3M3MA 2PMTA 3BJ5A 4POBA 3WGXA 4IJ3A 4KSOA 5GSSA 3LFLA 3I69A 1OKTA 1U87A 2H19A 5HR1A 3A5IA 2R2JA 4X4JA 1B9XC 5J9BA 3M9KA 3C7MA 1F6MC 2F3MA 5DAKA 5IO0A 3C1RA 4XCSA 3TOUA 4FYCA 1EEJA 4GSTA 2G0FA 1G6WA 1TI1A 1USBA 4TKYA 1S3DA 2HXKA 2C4JA 1SYXA 4TXOA 4IW9A 1QGVA 4EC0A 1TRWA 3QAGA 4FH8A 3ZIVA 3Q19A 4HZ4A 3IHQA 1WMJA 3QR6A 2H1BA 1JLWA 3UBKA 4JR6A 5D9WA 5C00A 1EZKA 5DCGA 2CX4A 4BL7B 5JWRB 1V98A 1R4WA 4TR3A 1ACVA 4JEDA 2GQKA 1SL1B 1PD21 2IFQA 4TN8A 1TI3A 2IPAA 1GUHA 3DYRA 2GQMA 8GSSA 1G7EA 4K6XA 1GSEA 4BVXA 4CDOA 2K18A 5F05A 2AB6A 4J2FA 3ZFLA 2YWOA 3IC4A 4O5UA 1GRXA 2FD3A
chains in the Genus database with same CATH topology
2JSZA 3RPNA 2NTOA 2PGTA 1BG5A 4KCAA 1SU9A 1ML6A 1XW9A 3VWVA 5A4WA 3BD2A 3FMWA 3KGKA 3DD3A 1FOVA 3P7XA 1OC9B 2DJKA 5J9CA 4F0CA 3DKSA 5CRHA 2LQQA 4GQFA 3A5WA 3M9JA 3H79A 4K5SA 3RHCA 3UBLA 3OR5A 1K0BA 3CTGA 2YP6A 3PPUA 3C71A 5COHA 2E2MA 4O5RA 2C3TA 2OA7A 4AGSA 4LA1A 2AYTA 3F63A 3E9JB 3F8UA 5ECPB 3F3QA 2DIYA 2X4AA 4JRRA 4Q5NA 2XPDA 4TOPA 1JHBA 1JZDA 2HRNA 2VD0A 3L0HA 2TIRA 2WCIA 4EDZA 3AY8A 3CTFA 5DJMA 3TJKA 2GT6A 3L4NA 2WJUA 3EMXA 4TR0A 3EPTA 3U6VA 1R7HA 3KCMA 2XPEA 1J0FA 2WULA 2DJ0A 1C72A 4MA9A 2RIIA 1YF1A 5IM9A 1AXDA 5F06A 4ECBA 4ZXGA 4WBRD 1T7PB 1GLQA 5JCWA 5LD0A 2YWIA 5DQYA 4MZBA 2X8GA 5D9TA 2I4AA 3GA4A 3IHGA 5HFIA 1AQVA 3HJOA 4POKA 4NAXA 3HXSA 3ERGA 5GAPD 1ZZYA 3KMOA 3TDGA 1VGLA 1GULA 1G7OA 4EDYA 3VWXA 1X0RA 4CY6A 1MDJA 2WRTA 20GSA 3ZREA 4Z2UA 2B6MA 3APSA 4GSNA 5DALB 1YEPA 3N5OA 4WF5A 4OCFA 1GUKA 2H1GA 5CAXA 3M8NA 2C80A 4YQVA 4K7IA 5IMCA 3F3RA 1U88A 1SD9A 5J4UA 4RQRA 2REMA 1F3BA 1S3CA 4PQIA 4I5QA 4F82A 3DMLA 2CX3A 1YKCA 3P2AA 2A2SA 2FNOA 4X0XA 1MDIA 2L5LA 4X43A 4F03A 1J08A 4IKHA 2L6CA 4KX4A 4FO5A 1ILOA 1XIYA 2N5BA 3NIVA 1U3IA 3VK9A 2H01A 1YKAA 2VL2A 4MH3A 5B8AA 4J57E 3M0FA 2YJHA 4HJMA 5D96A 5ECSA 5F0GA 1Z5YE 4OD7A 2XBIA 5HR2A 4OCEA 2IL3A 2H8LA 2JZTA 3QFAC 2E0QA 4HQSA 1SKWB 2BMXA 1GTUA 1OVNA 1VF4A 3VURA 1M2DA 3ISOA 1T1VA 4POMA 2GTUA 2DMMA 3C1SA 4FQUA 4NWYA 1V58A 4PXOA 5CRDA 5ID2A 2O87A 4I97A 3RDWA 2H70A 3GKKA 2KHPA 2R4VA 5IO2A 5HR3A 1F37A 2OE0A 1DUGA 3TJFA 4D73A 5EPFA 2LKUA 3RAZA 1XWGA 3LXZA 22GSA 1MEKA 1HNCA 1OE7A 3IDVA 1SL0B 4I2UA 3GKMA 2Z9SA 3IC8A 5IIZA 6GSWA 5IMAA 2N5FA 2WS2A 5G2ZA 4EVMA 3F4SA 2MBTA 1OC3A 1TJDA 1Z6MA 3N9JA 2EIRA 3G9BA 4IP1A 2FLSA 3IXRA 4OFTA 1SK1A 3GKXA 2ALBA 2VCVA 2PU9C 5ECMB 3IOSA 1PA3A 1XOBA 3GRXA 2VM2A 2PBJA 3CRUA 1K0NA 2O8VB 2R37A 3ZRDA 1A2JA 1MDKA 2GQLA 3QPMA 3GFKA 1TKDB 1TOFA 1XW5A 1EP7A 3O6TA 3VWWA 4MF7A 1E6BA 1X5DA 5G5FA 12GSA 2ZCTA 4K0GA 3RHBA 2QKEA 1XWAA 2H6XA 2AHEA 4EXJA 4WF4A 1CQHA 1K0AA 1PX6A 1H75A 3G7IA 3H4KA 2ON7A 3EE2A 1PN9A 4HJ2A 2O85A 2J23A 2OACA 2KLXA 4BVYB 1ERTA 1X5EA 2CQ9A 5CO3A 2LRNA 2DMLA 1M2AA 1TP9A 3HYPA 2FCHA 2VLTA 4GF0A 1LBKA 3U5RE 1F9MA 1B8XA 3O76A 2MYGA 2FUG2 1O7UA 3LORA 2KOKA 4DSSB 4RI7A 3HHVA 1QUWA 3QFBC 5IOXA 2HZFA 4EKZA 1UA5A 1YDKA 1EOGA 3DIEA 2FWFA 2FA8A 3GNJA 1X9MB 2HRFA 4K2DA 3PINA 2WDUA 3WT2A 1GWCA 3IBHA 4XS1A 5KEJA 4Z2TA 2O89A 1A24A 2XBQA 1VF2A 2HFDA 3JCML 1V2AA 2EIOA 5JCUA 2CVDA 3ZMLA 3F4RA 3W8JA 4MJEA 5D9VA 1W4VA 2FWGA 1K3YA 2C3NA 3CRTA 5B6MA 3GUSA 4XS6A 4O5QA 3QAVA 2QGVA 4KF9A 1MD3A 4YQUA 2H30A 4KDXA 1VF1A 2N5AA 2LUSA 1HYUA 4E8HA 2A2RA 5G1LA 2L57A 4ZBDA 2VCQA 3FZ5A 2DJ1A 2M80A 3HVXA 3CMIA 2V6KA 3GN3A 3F6FA 2BTOT 1TU8A 4KDUA 4GLTA 4MNNA 2F51A 1NHOA 4PUAA 3LXTA 1M9AA 1PX7A 13GSA 2L6DA 4RUVA 2MMNA 1T00A 2LRTA 4LL4B 3VPQA 5G5EA 2EC4A 2RUEA 4Z7XA 4IQAA 4TR1B 3IV4A 4XRAA 2VCZA 4WXTA 3IAS2 1Z6NA 4IP6A 2B5EA 2DLXA 2LNTA 4HI7A 1TRVA 5FWGA 2H72A 3KH9A 5J41A 5DAKB 1ABAA 5LCZA 4HU7A 5EVOA 4OWYA 1TXXA 2YJ7A 3IPZA 2HRAA 4YH2A 6GSSA 4BPYA 4NMUA 4EF0A 4K5RA 1DSBA 1ERWA 1SJIA 3UARA 1B48A 1NM3A 2DC5A 4XRDA 3V1WA 3TRXA 3LQ7A 3UL3A 1A8YA 4ZBBA 4JZQA 1GNEA 3GMFA 3KD0A 3MWHA 3TKSE 11GSA 1O6JA 3ME8A 6GSVA 3UVHA 3LG6A 1OC9A 2NBSA 1U6TA 4KSMA 2I3YA 1GTIA 4MLYA 4PURA 2R3XA 2AJQB 2IFQB 2HSHA 5E4WA 2H76A 4MZCA 3MSZA 2WZ9A 3R3EA 2TRCP 4MP4A 4XIHA 1N2AA 4BVXB 2CA8A 2HSYA 4GTUA 3TKQA 4ZL8A 2GGTA 5AN1A 1FB0A 4OFMA 3D21A 2K8SA 4G0KA 1YQ1A 1OYJA 3KEBA 2GDRA 2YPMA 4DVCA 3D5JA 2X49A 5DCHA 2RM6A 2A4VA 2C0DA 3RBTA 2IWTA 1BQ7A 4O32A 3D4TA 4EO3A 2VOCA 2VM1A 3FRCA 3FKFA 5H5RA 1EV9A 1ST9A 3ZVJA 3GIXA 2CVKA 4ID0A 4MPFA 1GUMA 4G0LA 3EVIA 3KJYA 4G2EA 3HVVA 4ISDA 1Q98A 4ZB8A 1O8WA 1FAAA 5ECOB 1PKZA 1K0DA 4KGIA 1W89A 5ENUA 1CQGA 2RM5A 5C04A 1FO5A 5B6NA 3HJMA 4OFNA 3WD6A 2LS5A 1V40A 4HZ2A 1K3LA 3GSTA 5INYA 1RQMA 3C73A 3ZL5A 5ECNB 2AV4A 4YKFA 4AJ8A 1GSYA 1SKSB 2OKAA 4Q5FA 2YZUA 2RUFA 1AAZA 1K0CA 2V32A 3LW9A 4ZB6A 1Z7RA 4K9ZA 2VAFA 5H5QA 2L4QA 2GZYA 3FEUA 1AW9A 3TRQA 1X9WB 1SENA 17GSA 2HNLA 1AC1A 3LYKA 2P5QA 5DALA 1Z3EA 4KDYA 1ZOFA 4AF2A 2B3SA 1FB6A 3EC3A 3I9V2 2LNSA 4G9HA 5HFKA 2XHFA 4GQCA 2PUKC 1IYIA 1AIUA 3Q74A 2GT5A 2C1YA 1GSQA 2VUPA 1XPVA 4MDCA 3FR9A 1DE1A 5ECIB 3ERWA 1DBYA 2M46A 1HNAA 1WOUA 3H8QA 3FZAA 3MAKA 5IPGA 2P5RA 3HY2A 5ECQB 2HZEB 2G2QA 3UEMA 5HQPA 1FHEA 18GSA 2VIMA 3K8NA 2VO4A 1Q4JA 1OKDA 1O85A 4K2XA 4DSRA 2LV3A 3GYKA 1N8JA 3GH9A 2NVLA 3GTUB 1JZWA 3TRPA 4ML6A 1XWKA 4PQ1A 5CREA 2VCXA 3IAM2 3J7Yb 4JE1A 4KW6A 4PUFC 3APOA 2FHEA 4XS4B 3ZTLA 5ELGA 5CRWA 2C0GA 3KZQA 1NSWA 2DBCA 1WPIA 5CP1A 3GL5A 3DEXA 3QOUA 2HE3A 1OE8A 3J7Yk 2GSTA 3GKNA 3WGEA 2GSQA 1PSQA 2LQOA 3BCIA 3HZ4A 1XFLA 3NZNA 3QDNA 4HS1A 2O7KA 2ES7A 1O81A 3D4MA 2OE1A 6GSYA 2DJ2A 4NHZA 4FYBA 3I6AA 3IRAA 3HD5A 2YANA 4YAPA 1QFNA 3ERFA 3HCZA 1JLVA 4HEA2 4XTSA 1EV4A 5EY6A 5GSTA 1KEBA 1R5PA 4RQXA 3KMNA 4V2MA 1T4ZA 3P90A 3RPPA 4O7HA 1FG4A 10GSA 3ZZXA 3M1GA 4MABA 1Y25A 1AQWA 3PH9A 3CBUA 4POLA 2ZUPA 2B5XA 1Z9HA 2JADA 3CSIA 1FVJA 3GSSA 4YKGA 3L9UA 4IHUA 4N30A 7GSSA 1LJRA 2R0CA 2EIQA 4QL7A 4MZWA 3DRNA 5ECLB 4EIPA 2DJ3A 4NHWA 1UN2A 5AIVA 5L71A 2B5YA 2I1UA 3EU4A 2KP1A 1I9DA 2IIYA 1UVZA 5CYYA 3IK7A 5D8IA 5GAND 3EU3A 1LU4A 4J56E 4N0VA 3E0UA 4V2LA 2WB9A 1DE2A 3SBCA 3UAPA 3QMXA 3S9FA 4IGJA 1YY7A 4LMVA 5AGYA 4PQHA 3H1NA 6GSUA 4BVYA 2VLUA 2CAIA 1K3OA 3PGTA 5DJLA 3VPTA 2OE3A 5KN1A 4EUYA 5KOXA 1JZRA 1PL2A 2HYXA 4OMVA 4DEJA 1JFUA 2A2PA 1R5AA 4A5PA 2VL9A 4ZL9A 3LJRA 2CV4A 3HDCA 4BWSA 2K9FA 3QD9A 1T4YA 4DSSA 2PVQA 5ABRA 2J9HA 2V6OA 1A23A 2C0EA 4NV5A 1GSUA 2YWNA 4O92A 4KUNA 1KTEA 4LMWA 2HRKA 2JU5A 2WGRA 2YWMA 4GWRA 1GSDA 2DKHA 4WETA 14GSA 2CZ3A 1HD2A 16GSA 3DVWA 4ECIA 2R0GA 4CHSA 2MBSA 3L78A 4GXZA 6GSXA 1UC7A 3MNGA 2X64A 2VCWA 4HQZA 4GRFA 3CSHA 3LSZA 4K7NA 2V2GA 3KIJA 4TW5A 3IE3A 1TW9A 3DVXA 5IMVA 2LTKA 1AUCA 1IYHA 2YNXA 1M7TA 2PERA 2B7JA 3UOMA 2R0PA 2V41A 3KTBA 5DVBA 3TKPA 1PRXA 1WWJA 3HZ8A 2H6YA 1VF3A 5D93A 1QK8A 3UMAA 1ZL9A 2FWHA 5JCGA 5KN0A 3TUEA 1XXUA 3HKRA 3QCPA 4MMMA 2X99A 5J3RA 4IS0A 4ZBAA 5B8BA 3TCOA 1I5GA 1YF0A 3ZITA 4TVEA 3A2XA 5E59A 4AJ7A 5HR0A 2FA4A 3QAWA 4ACSA 4EL1A 4ZL7A 2H1AA 2MMZA 5ECHB 2ON5A 5AISA 4N11A 4HUAA 2V1MA 3TKRA 2PVOC 2F8FA 4KB3A 3ZFBA 3D0ZA 2M72A 3MDKA 1PQNA 1GL8A 1EOHA 2LSTA 3KH7A 4ECCA 3G7JA 2CT6A 1PGTA 4IN0A 5A4UA 2CAQA 3BBYA 4F9ZA 3A2VA 5B7CA 2QA2A 4V1Ag 2K6VA 1EWXA 2GSSA 1PL1A 1F2EA 4H86A 3MIXA 3IA1A 1WJKA 3KM6A 4BL7A 3DGQA 1NW2A 1MTCA 4IBPA 4IELA 2YOIA 3F4TA 1M2BA 4MJBA 2IMDA 3TJGA 3VWUA 2IMIA 1E2YA 4BA7A 4TXOB 5ECRB 5A4VA 1KBNA 4HOJA 3VI5A 2A4HA 3DWVA 4ILFA 3ED3A 5DBQA 5A5KA 1F3AA 3WGDA 2AUVA 4Q5QA 2H1DA 2H0IA 3TOTA 2LJRA 3EINA 1XBSA 5KN3A 3WYWA 5G1KA 1GP1A 1V9WA 4IVFA 1T8EB 5EL8A 3NOFA 3CXGA 4AJ6A 3HJPA 4V1Ap 4IJIA 1EGOA 5H5SA 2H6ZA 1JZOA 1YEXA 3FZ4A 3O3TA 1NHYA 4KH7A 3ZLPA 4MPGA 1SJZA 2YV9A 2GVPA 4L0UA 5IQYA 5J5NA 4BWQA 3ME7A 1B4PA 3FZ9A 2GLRA 1M99A 1M0UA 19GSA 1Z7PA 3WT1A 1BYEA 5BRTA 2YN1A 2VL3A 1FOHA 2IMKA 4WKWA 1B4QA 1GSFA 4K8MA 2LRCA 2B1KA 3GX8A 2OADA 2LEGA 2MMAA 2IMEA 1ZCPA 2IMFA 3EWLA 2OBIA 3US3A 3EURA 5IMZA 3W8SA 2ZNMA 3GV1A 1A0FA 2B1LA 1RW1A 4E8EA 1XZOA 4Z2RA 1GTAA 5CRGA 3HVSA 1A0RP 1BAYA 3GX0A 4YAVA 1ERVA 2F9SA 2I9HA 3D6IA 2LJAA 3BCKA 2JL4A 6GSTA 4KAEA 1B9YC 9GSSA 3EMPA 4MF5A 2R6KA 3VI7A 4YQMA 3F6DA 1HQOA 3Q6OA 4MJAA 4KNDA 4ML1A 1YJ6A 3TJBA 4GCIA 3UIWA 3ZVJD 4CW9A 4V2NA 2OJLA 1WIKA 1SK2A 2YZHA 1XW6A 2DSAA 1ZYNA 3BOAA 4ICYA 3KTLA 1T3BA 2FGXA 4JBBA 1PN0A 2H75A 5F8BA 2X8CA 4TR4A 5F07A 2NPBA 4N0ZA 2VD1A 4ECJA 1BX9A 5KOWA 3FW2A 3E3EA 5KN2A 4HDEA 3UJ1A 4P3YB 1J9BA 5D73A 1SKRB 1M9BA 1THOA 4HU9A 4NV2A 5D9XA 3FK8A 3APQA 2VLVA 3L9VA 5AIXA 4QQ7A 3CSJA 5IPHA 3UVTA 1TK5B 3TKSA 1SYRA 4XHMA 5JWQB 2UZ8A 1WRYA 2E2GA 1GSSA 3D22A 2HZEA 4LLRA 5FHIA 2BJXA 1SJ6A 4F2IA 2H73A 2YV7A 4KA0A 1R26A 2YCDA 1XVQA 2GS3A 1TK0B 5IMFA 3TKSC 1TK8B 1SL2B 1S3AA 3GTUA 4EIQA 5ECKB 1PMTA 2IJYA 2B7KA 1ERUA 2DIZA 3LGCA 1KNGA 2KP2A 4JU5A 5FT3A 4ZILA 2C3QA 4XS4A 1AQXA 2PWJA 2VCTA 5DDLA 5IOWA 4TXVA 2GZPA 3R2QA 4Q5RA 4CY8A 1ZYEA 4G19A 1K0OA 2I81A 3PR8A 3CYNA 4MCUA 1EEMA 2JZSA 2X8HA 2QSIA 1URMA 5G31A 5GZZB 4N10A 1Y6EA 1RK4A 3G7YA 3H93A 2P0GA 5HFGA 3DXBA 3A2WA 2QA1A 2CZ2A 3TJJA 3W6GA 4I6XA 1V57A 5DQSA 2TRXA 4NPBA 1TRSA 2AAWA 1BEDA 1SD8A 1EP8A 2HT9A 3FR6A 1U3AA 4L5OA 2VL2C 4FYUA 3VLNA 3LEFA 3FYGA 2K8VA 4X1UA 5CNWA 5ELAA 3GH6A 3LWAA 2PPTA 2JZRA 3EYTA 4I8BA 1MD4A 1K0MA 2E7PA 1SK0A 1XCCA 1ZMAA 1VRSD 2NDOA 2DJJA 5JWOB 2H0HA 3C8EA 2MZCA 3FHKA 2H74A 5ID2B 3KXOA 1GH2A 4KCEA 1GLPA 2R5GA 4PTSA 3SWLA 4D73B 2H71A 4OO5A 1XWCA 2PN8A 1XOAA 4PNFA 4WR4A 2D2ZA 2HLSA 4G0IA 4PX1A 2F8AA 3ZIJA 4G10A 4QL9A 5IMDA 2RLIA 4NXIA 3I43A 3ZYWA 1X9SB 3FY7A 1PKWA 1ZGNA 2GSRA 4MJCA 4TRXA 1ZYQB 1QQ2A 1TU7A 4MF6A 2L5OA 4MH2A 1EGRA 4PNGA 4WBJA 2KUCA 3ZMKA 4EE0A 3VFIA 4ZB9A 3KP9A 4OO4A 1GTBA 1TDIA 1QMVA 1XVWA 4L8EA 1WE0A 1TTZA 1A8LA 1A2LA 3IK9A 4GSSA 3GHAA 4K1FA 2L4CA 4USSA 2WFCA 1A2MA 1ON4A 2C8UA 4PGTA 2DKIA 1THXA 4ULXA 1GNWA 2H66A 4KE3A 2OBKA 2H0GA 3LYPA 2LJKA 1BJXA 4WEYA 1FVKA 2QC7A 4MK3A 1WP0A 4LL1B 2C0FA 4K0NA 3TGZA 3MYDA 5BMUA 1OC8A 1O8XA 1OAZA 1YZXA 2GZZA 3GL3A 3Q18A 1ZYPA 4RI6A 2HSMA 4L0WA 1TRUA 2JACA 1XWBA 1G0TA 2P31A 3P8WA 2CVBA 5G30A 1FW1A 3F0IA 3IR4A 3GURA 1HNBA 2HI7A 4ZIJA 4IQ1A 2FWEA 3A3TA 3F9UA 4WR5A 4DSQA 4L5LA 1QXHA 2L59A 3FR3A 2IN3A 4F0BA 1O73A 4K7OA 5LNKe 4FIWA 3HA9A 2JSYA 2FY6A 2XC2A 4I2TA 1H4OA 2MMOA 3KP8A 1G6YA 1X5CA 3TB2A 3L9SA 4JR4A 4TR1A 3M3MA 2PMTA 3BJ5A 4POBA 3WGXA 4IJ3A 4KSOA 5GSSA 3LFLA 3I69A 1OKTA 1U87A 2H19A 5HR1A 3A5IA 2R2JA 4X4JA 1B9XC 5J9BA 3M9KA 3C7MA 1F6MC 2F3MA 5DAKA 5IO0A 3C1RA 4XCSA 3TOUA 4FYCA 1EEJA 4GSTA 2G0FA 1G6WA 1TI1A 1USBA 4TKYA 1S3DA 2HXKA 2C4JA 1SYXA 4TXOA 4IW9A 1QGVA 4EC0A 1TRWA 3QAGA 4FH8A 3ZIVA 3Q19A 4HZ4A 3IHQA 1WMJA 3QR6A 2H1BA 1JLWA 3UBKA 4JR6A 5D9WA 5C00A 1EZKA 5DCGA 2CX4A 4BL7B 5JWRB 1V98A 1R4WA 4TR3A 1ACVA 4JEDA 2GQKA 1SL1B 1PD21 2IFQA 4TN8A 1TI3A 2IPAA 1GUHA 3DYRA 2GQMA 8GSSA 1G7EA 4K6XA 1GSEA 4BVXA 4CDOA 2K18A 5F05A 2AB6A 4J2FA 3ZFLA 2YWOA 3IC4A 4O5UA 1GRXA 2FD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSZ A;  3RPN A;  2NTO A;  2PGT A;  1BG5 A;  4KCA A;  1SU9 A;  1ML6 A;  1XW9 A;  3VWV A;  5A4W A;  3BD2 A;  3KGK A;  3DD3 A;  1FOV A;  3P7X A;  1OC9 B;  2DJK A;  5J9C A;  4F0C A;  3DKS A;  5CRH A;  2LQQ A;  4GQF A;  3A5W A;  3M9J A;  3H79 A;  3RHC A;  3UBL A;  3OR5 A;  1K0B A;  3CTG A;  2YP6 A;  3C71 A;  5COH A;  2E2M A;  4O5R A;  2C3T A;  2OA7 A;  4AGS A;  4LA1 A;  2AYT A;  3F63 A;  3E9J B;  3F8U A;  5ECP B;  3F3Q A;  2DIY A;  4JRR A;  4Q5N A;  2XPD A;  4TOP A;  1JHB A;  1JZD A;  2HRN A;  2VD0 A;  3L0H A;  2TIR A;  2WCI A;  4EDZ A;  3AY8 A;  3CTF A;  5DJM A;  3TJK A;  2GT6 A;  3L4N A;  2WJU A;  3EMX A;  4TR0 A;  3U6V A;  1R7H A;  3KCM A;  2XPE A;  1J0F A;  2WUL A;  2DJ0 A;  1C72 A;  4MA9 A;  2RII A;  1YF1 A;  5IM9 A;  1AXD A;  5F06 A;  4ECB A;  4ZXG A;  4WBR D;  1T7P B;  1GLQ A;  5JCW A;  5LD0 A;  2YWI A;  5DQY A;  4MZB A;  2X8G A;  5D9T A;  2I4A A;  3GA4 A;  5HFI A;  1AQV A;  3HJO A;  4POK A;  4NAX A;  3HXS A;  3ERG A;  5GAP D;  1ZZY A;  3KMO A;  3TDG A;  1VGL A;  1GUL A;  1G7O A;  4EDY A;  3VWX A;  1X0R A;  1MDJ A;  2WRT A;  20GS A;  3ZRE A;  2B6M A;  3APS A;  4GSN A;  5DAL B;  1YEP A;  3N5O A;  4WF5 A;  4OCF A;  1GUK A;  2H1G A;  5CAX A;  3M8N A;  2C80 A;  4YQV A;  4K7I A;  5IMC A;  3F3R A;  1U88 A;  1SD9 A;  5J4U A;  4RQR A;  2REM A;  1F3B A;  1S3C A;  4PQI A;  4I5Q A;  4F82 A;  3DML A;  2CX3 A;  1YKC A;  3P2A A;  2A2S A;  2FNO A;  4X0X A;  1MDI A;  2L5L A;  4X43 A;  4F03 A;  1J08 A;  4IKH A;  2L6C A;  4KX4 A;  4FO5 A;  1ILO A;  1XIY A;  2N5B A;  3NIV A;  1U3I A;  3VK9 A;  2H01 A;  1YKA A;  2VL2 A;  4MH3 A;  5B8A A;  4J57 E;  3M0F A;  2YJH A;  4HJM A;  5D96 A;  5ECS A;  5F0G A;  1Z5Y E;  4OD7 A;  2XBI A;  5HR2 A;  4OCE A;  2IL3 A;  2H8L A;  2JZT A;  3QFA C;  2E0Q A;  4HQS A;  1SKW B;  2BMX A;  1GTU A;  1OVN A;  1VF4 A;  3VUR A;  1M2D A;  3ISO A;  1T1V A;  4POM A;  2GTU A;  2DMM A;  3C1S A;  4NWY A;  1V58 A;  4PXO A;  5CRD A;  5ID2 A;  2O87 A;  4I97 A;  3RDW A;  2H70 A;  3GKK A;  2KHP A;  2R4V A;  5IO2 A;  5HR3 A;  1F37 A;  2OE0 A;  1DUG A;  3TJF A;  4D73 A;  5EPF A;  2LKU A;  3RAZ A;  1XWG A;  3LXZ A;  22GS A;  1MEK A;  1HNC A;  1OE7 A;  3IDV A;  1SL0 B;  4I2U A;  3GKM A;  2Z9S A;  5IIZ A;  6GSW A;  5IMA A;  2N5F A;  2WS2 A;  5G2Z A;  4EVM A;  3F4S A;  2MBT A;  1OC3 A;  1TJD A;  1Z6M A;  3N9J A;  2EIR A;  3G9B A;  4IP1 A;  2FLS A;  3IXR A;  4OFT A;  1SK1 A;  3GKX A;  2ALB A;  2VCV A;  2PU9 C;  5ECM B;  3IOS A;  1PA3 A;  1XOB A;  3GRX A;  2VM2 A;  2PBJ A;  3CRU A;  1K0N A;  2O8V B;  2R37 A;  3ZRD A;  1A2J A;  1MDK A;  2GQL A;  3QPM A;  3GFK A;  1TKD B;  1TOF A;  1XW5 A;  1EP7 A;  3O6T A;  3VWW A;  4MF7 A;  1E6B A;  1X5D A;  5G5F A;  12GS A;  2ZCT A;  4K0G A;  3RHB A;  2QKE A;  1XWA A;  2H6X A;  2AHE A;  4EXJ A;  4WF4 A;  1CQH A;  1K0A A;  1PX6 A;  1H75 A;  3G7I A;  3H4K A;  2ON7 A;  3EE2 A;  1PN9 A;  4HJ2 A;  2O85 A;  2J23 A;  2OAC A;  2KLX A;  1ERT A;  1X5E A;  2CQ9 A;  5CO3 A;  2LRN A;  2DML A;  1M2A A;  1TP9 A;  3HYP A;  2FCH A;  2VLT A;  4GF0 A;  1LBK A;  3U5R E;  1F9M A;  1B8X A;  3O76 A;  2MYG A;  2FUG 2;  1O7U A;  3LOR A;  2KOK A;  4DSS B;  4RI7 A;  3HHV A;  1QUW A;  3QFB C;  5IOX A;  2HZF A;  4EKZ A;  1UA5 A;  1YDK A;  1EOG A;  3DIE A;  2FWF A;  2FA8 A;  3GNJ A;  1X9M B;  2HRF A;  4K2D A;  3PIN A;  2WDU A;  3WT2 A;  1GWC A;  3IBH A;  4XS1 A;  5KEJ A;  2O89 A;  1A24 A;  2XBQ A;  1VF2 A;  2HFD A;  3JCM L;  1V2A A;  2EIO A;  5JCU A;  2CVD A;  3ZML A;  3F4R A;  3W8J A;  4MJE A;  5D9V A;  1W4V A;  2FWG A;  1K3Y A;  2C3N A;  3CRT A;  5B6M A;  3GUS A;  4XS6 A;  3QAV A;  2QGV A;  1MD3 A;  4YQU A;  2H30 A;  4KDX A;  1VF1 A;  2N5A A;  2LUS A;  1HYU A;  4E8H A;  2A2R A;  5G1L A;  2L57 A;  4ZBD A;  2VCQ A;  3FZ5 A;  2DJ1 A;  2M80 A;  3HVX A;  3CMI A;  2V6K A;  3GN3 A;  3F6F A;  2BTO T;  1TU8 A;  4KDU A;  4GLT A;  2F51 A;  1NHO A;  4PUA A;  3LXT A;  1M9A A;  1PX7 A;  13GS A;  2L6D A;  4RUV A;  2MMN A;  1T00 A;  2LRT A;  4LL4 B;  3VPQ A;  5G5E A;  2EC4 A;  2RUE A;  4Z7X A;  4IQA A;  4TR1 B;  3IV4 A;  4XRA A;  2VCZ A;  4WXT A;  3IAS 2;  1Z6N A;  4IP6 A;  2B5E A;  2DLX A;  2LNT A;  4HI7 A;  1TRV A;  5FWG A;  2H72 A;  3KH9 A;  5J41 A;  5DAK B;  1ABA A;  5LCZ A;  4HU7 A;  5EVO A;  4OWY A;  1TXX A;  2YJ7 A;  3IPZ A;  4YH2 A;  6GSS A;  4BPY A;  4NMU A;  4EF0 A;  1DSB A;  1ERW A;  1SJI A;  3UAR A;  1B48 A;  1NM3 A;  2DC5 A;  4XRD A;  3V1W A;  3TRX A;  3LQ7 A;  3UL3 A;  1A8Y A;  4ZBB A;  4JZQ A;  1GNE A;  3GMF A;  3KD0 A;  3MWH A;  3TKS E;  11GS A;  1O6J A;  3ME8 A;  6GSV A;  3UVH A;  3LG6 A;  1OC9 A;  2NBS A;  1U6T A;  4KSM A;  2I3Y A;  1GTI A;  4MLY A;  4PUR A;  2R3X A;  2AJQ B;  2IFQ B;  2HSH A;  5E4W A;  2H76 A;  4MZC A;  3MSZ A;  2WZ9 A;  2TRC P;  4MP4 A;  4XIH A;  1N2A A;  2CA8 A;  2HSY A;  4GTU A;  3TKQ A;  4ZL8 A;  2GGT A;  5AN1 A;  1FB0 A;  4OFM A;  3D21 A;  2K8S A;  1YQ1 A;  1OYJ A;  3KEB A;  2GDR A;  2YPM A;  4DVC A;  3D5J A;  5DCH A;  2RM6 A;  2A4V A;  2C0D A;  3RBT A;  2IWT A;  1BQ7 A;  4O32 A;  3D4T A;  4EO3 A;  2VOC A;  2VM1 A;  3FRC A;  3FKF A;  5H5R A;  1EV9 A;  1ST9 A;  3ZVJ A;  3GIX A;  2CVK A;  4ID0 A;  4MPF A;  1GUM A;  3EVI A;  3KJY A;  4G2E A;  3HVV A;  4ISD A;  1Q98 A;  4ZB8 A;  1O8W A;  1FAA A;  5ECO B;  1PKZ A;  1K0D A;  4KGI A;  1W89 A;  5ENU A;  1CQG A;  2RM5 A;  5C04 A;  1FO5 A;  5B6N A;  3HJM A;  4OFN A;  3WD6 A;  2LS5 A;  1V40 A;  4HZ2 A;  1K3L A;  3GST A;  5INY A;  1RQM A;  3C73 A;  3ZL5 A;  5ECN B;  2AV4 A;  4AJ8 A;  1GSY A;  1SKS B;  2OKA A;  4Q5F A;  2YZU A;  2RUF A;  1AAZ A;  1K0C A;  2V32 A;  4ZB6 A;  1Z7R A;  4K9Z A;  2VAF A;  5H5Q A;  2L4Q A;  2GZY A;  3FEU A;  1AW9 A;  3TRQ A;  1X9W B;  1SEN A;  17GS A;  2HNL A;  1AC1 A;  3LYK A;  2P5Q A;  5DAL A;  1Z3E A;  4KDY A;  1ZOF A;  4AF2 A;  2B3S A;  1FB6 A;  3EC3 A;  3I9V 2;  2LNS A;  4G9H A;  5HFK A;  2XHF A;  4GQC A;  2PUK C;  1IYI A;  1AIU A;  3Q74 A;  2GT5 A;  2C1Y A;  1GSQ A;  2VUP A;  1XPV A;  4MDC A;  3FR9 A;  1DE1 A;  5ECI B;  3ERW A;  1DBY A;  2M46 A;  1HNA A;  1WOU A;  3H8Q A;  3FZA A;  3MAK A;  5IPG A;  2P5R A;  3HY2 A;  5ECQ B;  2HZE B;  2G2Q A;  3UEM A;  5HQP A;  1FHE A;  18GS A;  2VIM A;  3K8N A;  2VO4 A;  1Q4J A;  1OKD A;  1O85 A;  4DSR A;  2LV3 A;  3GYK A;  1N8J A;  3GH9 A;  2NVL A;  3GTU B;  1JZW A;  3TRP A;  4ML6 A;  1XWK A;  4PQ1 A;  5CRE A;  2VCX A;  3IAM 2;  3J7Y b;  4JE1 A;  4KW6 A;  4PUF C;  3APO A;  2FHE A;  4XS4 B;  3ZTL A;  5ELG A;  5CRW A;  2C0G A;  3KZQ A;  1NSW A;  2DBC A;  1WPI A;  5CP1 A;  3GL5 A;  3DEX A;  3QOU A;  2HE3 A;  1OE8 A;  3J7Y k;  2GST A;  3GKN A;  3WGE A;  2GSQ A;  1PSQ A;  2LQO A;  3BCI A;  3HZ4 A;  1XFL A;  3NZN A;  3QDN A;  4HS1 A;  2O7K A;  2ES7 A;  1O81 A;  3D4M A;  2OE1 A;  6GSY A;  2DJ2 A;  4NHZ A;  4FYB A;  3I6A A;  3IRA A;  3HD5 A;  2YAN A;  4YAP A;  1QFN A;  3ERF A;  3HCZ A;  1JLV A;  4HEA 2;  4XTS A;  1EV4 A;  5EY6 A;  5GST A;  1KEB A;  1R5P A;  4RQX A;  3KMN A;  4V2M A;  1T4Z A;  3P90 A;  3RPP A;  4O7H A;  1FG4 A;  10GS A;  3ZZX A;  3M1G A;  4MAB A;  1Y25 A;  1AQW A;  3PH9 A;  3CBU A;  4POL A;  2ZUP A;  2B5X A;  1Z9H A;  2JAD A;  3CSI A;  1FVJ A;  3GSS A;  3L9U A;  4IHU A;  4N30 A;  7GSS A;  1LJR A;  2EIQ A;  4QL7 A;  4MZW A;  3DRN A;  5ECL B;  2DJ3 A;  4NHW A;  1UN2 A;  5AIV A;  5L71 A;  2B5Y A;  2I1U A;  3EU4 A;  2KP1 A;  1I9D A;  2IIY A;  1UVZ A;  5CYY A;  3IK7 A;  5D8I A;  5GAN D;  3EU3 A;  1LU4 A;  4J56 E;  4N0V A;  3E0U A;  4V2L A;  2WB9 A;  1DE2 A;  3SBC A;  3UAP A;  3QMX A;  3S9F A;  4IGJ A;  1YY7 A;  4LMV A;  5AGY A;  4PQH A;  3H1N A;  6GSU A;  4BVY A;  2VLU A;  2CAI A;  1K3O A;  3PGT A;  5DJL A;  3VPT A;  2OE3 A;  5KN1 A;  4EUY A;  1JZR A;  1PL2 A;  2HYX A;  4OMV A;  4DEJ A;  1JFU A;  1R5A A;  2VL9 A;  4ZL9 A;  3LJR A;  2CV4 A;  3HDC A;  4BWS A;  2K9F A;  3QD9 A;  1T4Y A;  4DSS A;  2PVQ A;  5ABR A;  2J9H A;  2V6O A;  1A23 A;  2C0E A;  4NV5 A;  1GSU A;  2YWN A;  4O92 A;  4KUN A;  1KTE A;  4LMW A;  2JU5 A;  2WGR A;  2YWM A;  4GWR A;  1GSD A;  4WET A;  14GS A;  2CZ3 A;  1HD2 A;  16GS A;  3DVW A;  4ECI A;  4CHS A;  2MBS A;  3L78 A;  4GXZ A;  6GSX A;  1UC7 A;  3MNG A;  2X64 A;  2VCW A;  4HQZ A;  4GRF A;  3CSH A;  3LSZ A;  4K7N A;  2V2G A;  3KIJ A;  4TW5 A;  3IE3 A;  1TW9 A;  3DVX A;  5IMV A;  2LTK A;  1AUC A;  1IYH A;  2YNX A;  1M7T A;  2PER A;  2B7J A;  3UOM A;  2V41 A;  3KTB A;  5DVB A;  3TKP A;  1PRX A;  1WWJ A;  3HZ8 A;  2H6Y A;  1VF3 A;  5D93 A;  1QK8 A;  3UMA A;  1ZL9 A;  2FWH A;  5JCG A;  5KN0 A;  3TUE A;  1XXU A;  3HKR A;  3QCP A;  4MMM A;  2X99 A;  5J3R A;  4IS0 A;  4ZBA A;  5B8B A;  3TCO A;  1I5G A;  1YF0 A;  3ZIT A;  4TVE A;  3A2X A;  5E59 A;  4AJ7 A;  5HR0 A;  2FA4 A;  3QAW A;  4ACS A;  4EL1 A;  4ZL7 A;  2H1A A;  2MMZ A;  5ECH B;  2ON5 A;  5AIS A;  4N11 A;  4HUA A;  2V1M A;  3TKR A;  2PVO C;  2F8F A;  4KB3 A;  3ZFB A;  3D0Z A;  2M72 A;  3MDK A;  1PQN A;  1GL8 A;  1EOH A;  2LST A;  3KH7 A;  4ECC A;  3G7J A;  2CT6 A;  1PGT A;  4IN0 A;  5A4U A;  2CAQ A;  3BBY A;  4F9Z A;  3A2V A;  5B7C A;  4V1A g;  2K6V A;  1EWX A;  2GSS A;  1PL1 A;  1F2E A;  4H86 A;  3IA1 A;  1WJK A;  3KM6 A;  4BL7 A;  3DGQ A;  1NW2 A;  1MTC A;  4IBP A;  4IEL A;  2YOI A;  3F4T A;  1M2B A;  4MJB A;  2IMD A;  3TJG A;  3VWU A;  2IMI A;  1E2Y A;  4BA7 A;  4TXO B;  5ECR B;  5A4V A;  1KBN A;  4HOJ A;  3VI5 A;  3DWV A;  4ILF A;  3ED3 A;  5DBQ A;  5A5K A;  1F3A A;  3WGD A;  2AUV A;  4Q5Q A;  2H1D A;  2H0I A;  3TOT A;  2LJR A;  3EIN A;  1XBS A;  5KN3 A;  3WYW A;  5G1K A;  1GP1 A;  1V9W A;  4IVF A;  1T8E B;  5EL8 A;  3NOF A;  3CXG A;  4AJ6 A;  3HJP A;  4V1A p;  4IJI A;  1EGO A;  5H5S A;  2H6Z A;  1JZO A;  1YEX A;  3FZ4 A;  3O3T A;  1NHY A;  4KH7 A;  3ZLP A;  4MPG A;  1SJZ A;  2YV9 A;  2GVP A;  4L0U A;  5IQY A;  5J5N A;  4BWQ A;  3ME7 A;  1B4P A;  3FZ9 A;  2GLR A;  1M99 A;  1M0U A;  19GS A;  1Z7P A;  3WT1 A;  1BYE A;  2YN1 A;  2VL3 A;  2IMK A;  4WKW A;  1B4Q A;  1GSF A;  4K8M A;  2LRC A;  2B1K A;  3GX8 A;  2OAD A;  2LEG A;  2MMA A;  2IME A;  1ZCP A;  2IMF A;  3EWL A;  2OBI A;  3US3 A;  3EUR A;  5IMZ A;  3W8S A;  2ZNM A;  3GV1 A;  1A0F A;  2B1L A;  1RW1 A;  4E8E A;  1XZO A;  1GTA A;  5CRG A;  3HVS A;  1A0R P;  1BAY A;  3GX0 A;  4YAV A;  1ERV A;  2F9S A;  2I9H A;  3D6I A;  2LJA A;  3BCK A;  2JL4 A;  6GST A;  4KAE A;  1B9Y C;  9GSS A;  3EMP A;  4MF5 A;  2R6K A;  3VI7 A;  4YQM A;  3F6D A;  1HQO A;  3Q6O A;  4MJA A;  4KND A;  4ML1 A;  1YJ6 A;  3TJB A;  4GCI A;  3UIW A;  3ZVJ D;  4CW9 A;  4V2N A;  2OJL A;  1WIK A;  1SK2 A;  2YZH A;  1XW6 A;  2DSA A;  3BOA A;  3KTL A;  1T3B A;  2FGX A;  4JBB A;  2H75 A;  5F8B A;  5F07 A;  2X8C A;  4TR4 A;  2NPB A;  4N0Z A;  2VD1 A;  4ECJ A;  1BX9 A;  3FW2 A;  3E3E A;  5KN2 A;  4HDE A;  3UJ1 A;  4P3Y B;  1J9B A;  5D73 A;  1SKR B;  1M9B A;  1THO A;  4HU9 A;  4NV2 A;  5D9X A;  3FK8 A;  3APQ A;  2VLV A;  3L9V A;  5AIX A;  4QQ7 A;  3CSJ A;  5IPH A;  3UVT A;  1TK5 B;  3TKS A;  1SYR A;  4XHM A;  5JWQ B;  1WRY A;  2E2G A;  1GSS A;  3D22 A;  2HZE A;  4LLR A;  5FHI A;  2BJX A;  1SJ6 A;  4F2I A;  2H73 A;  2YV7 A;  4KA0 A;  1R26 A;  2YCD A;  1XVQ A;  2GS3 A;  1TK0 B;  5IMF A;  3TKS C;  1TK8 B;  1SL2 B;  1S3A A;  3GTU A;  5ECK B;  1PMT A;  2IJY A;  2B7K A;  1ERU A;  2DIZ A;  3LGC A;  1KNG A;  2KP2 A;  4JU5 A;  5FT3 A;  4ZIL A;  2C3Q A;  4XS4 A;  1AQX A;  2PWJ A;  2VCT A;  5DDL A;  5IOW A;  4TXV A;  2GZP A;  3R2Q A;  4Q5R A;  1ZYE A;  4G19 A;  1K0O A;  2I81 A;  3PR8 A;  3CYN A;  4MCU A;  1EEM A;  2JZS A;  2X8H A;  2QSI A;  1URM A;  5G31 A;  5GZZ B;  4N10 A;  1Y6E A;  1RK4 A;  3G7Y A;  3H93 A;  2P0G A;  5HFG A;  3DXB A;  3A2W A;  2CZ2 A;  3TJJ A;  3W6G A;  4I6X A;  1V57 A;  5DQS A;  2TRX A;  4NPB A;  1TRS A;  2AAW A;  1BED A;  1SD8 A;  1EP8 A;  2HT9 A;  3FR6 A;  1U3A A;  4L5O A;  2VL2 C;  4FYU A;  3VLN A;  3LEF A;  3FYG A;  2K8V A;  4X1U A;  5CNW A;  5ELA A;  3GH6 A;  3LWA A;  2PPT A;  2JZR A;  3EYT A;  4I8B A;  1MD4 A;  1K0M A;  2E7P A;  1SK0 A;  1XCC A;  1ZMA A;  1VRS D;  2NDO A;  2DJJ A;  5JWO B;  2H0H A;  3C8E A;  2MZC A;  3FHK A;  2H74 A;  5ID2 B;  3KXO A;  1GH2 A;  4KCE A;  1GLP A;  2R5G A;  3SWL A;  4D73 B;  2H71 A;  4OO5 A;  1XWC A;  2PN8 A;  1XOA A;  4PNF A;  4WR4 A;  2D2Z A;  2HLS A;  4PX1 A;  2F8A A;  3ZIJ A;  4G10 A;  4QL9 A;  5IMD A;  2RLI A;  4NXI A;  3I43 A;  3ZYW A;  1X9S B;  3FY7 A;  1PKW A;  1ZGN A;  2GSR A;  4MJC A;  4TRX A;  1ZYQ B;  1QQ2 A;  1TU7 A;  4MF6 A;  2L5O A;  4MH2 A;  1EGR A;  4PNG A;  4WBJ A;  2KUC A;  3ZMK A;  4EE0 A;  3VFI A;  4ZB9 A;  3KP9 A;  4OO4 A;  1GTB A;  1TDI A;  1QMV A;  1XVW A;  4L8E A;  1WE0 A;  1TTZ A;  1A8L A;  1A2L A;  3IK9 A;  4GSS A;  3GHA A;  4K1F A;  2L4C A;  2WFC A;  1A2M A;  1ON4 A;  2C8U A;  4PGT A;  1THX A;  4ULX A;  1GNW A;  2H66 A;  4KE3 A;  2OBK A;  2H0G A;  3LYP A;  2LJK A;  1BJX A;  4WEY A;  1FVK A;  2QC7 A;  4MK3 A;  1WP0 A;  4LL1 B;  2C0F A;  4K0N A;  3TGZ A;  1OC8 A;  1O8X A;  1OAZ A;  1YZX A;  2GZZ A;  3GL3 A;  3Q18 A;  4RI6 A;  4L0W A;  1TRU A;  2JAC A;  1XWB A;  1G0T A;  2P31 A;  3P8W A;  2CVB A;  5G30 A;  1FW1 A;  3F0I A;  3IR4 A;  3GUR A;  1HNB A;  2HI7 A;  4ZIJ A;  4IQ1 A;  2FWE A;  3A3T A;  3F9U A;  4WR5 A;  4DSQ A;  4L5L A;  1QXH A;  2L59 A;  3FR3 A;  2IN3 A;  4F0B A;  1O73 A;  4K7O A;  5LNK e;  4FIW A;  3HA9 A;  2JSY A;  2FY6 A;  2XC2 A;  4I2T A;  1H4O A;  2MMO A;  3KP8 A;  1G6Y A;  1X5C A;  3TB2 A;  3L9S A;  4JR4 A;  4TR1 A;  3M3M A;  2PMT A;  3BJ5 A;  4POB A;  3WGX A;  4IJ3 A;  4KSO A;  5GSS A;  3LFL A;  3I69 A;  1OKT A;  1U87 A;  2H19 A;  5HR1 A;  2R2J A;  1B9X C;  5J9B A;  3M9K A;  3C7M A;  1F6M C;  2F3M A;  5DAK A;  5IO0 A;  3C1R A;  4XCS A;  3TOU A;  4FYC A;  1EEJ A;  4GST A;  2G0F A;  1G6W A;  1TI1 A;  1USB A;  4TKY A;  1S3D A;  2HXK A;  2C4J A;  1SYX A;  4TXO A;  4IW9 A;  1QGV A;  4EC0 A;  1TRW A;  3QAG A;  4FH8 A;  3ZIV A;  3Q19 A;  4HZ4 A;  3IHQ A;  1WMJ A;  3QR6 A;  2H1B A;  1JLW A;  3UBK A;  4JR6 A;  5D9W A;  5C00 A;  1EZK A;  5DCG A;  2CX4 A;  5JWR B;  1V98 A;  1R4W A;  4TR3 A;  1ACV A;  4JED A;  2GQK A;  1SL1 B;  1PD2 1;  2IFQ A;  4TN8 A;  1TI3 A;  2IPA A;  1GUH A;  3DYR A;  2GQM A;  8GSS A;  1G7E A;  4K6X A;  1GSE A;  4BVX A;  4CDO A;  2K18 A;  5F05 A;  2AB6 A;  4J2F A;  3ZFL A;  2YWO A;  3IC4 A;  1GRX A;  2FD3 A; 
#chains in the Genus database with same CATH topology
 2JSZ A;  3RPN A;  2NTO A;  2PGT A;  1BG5 A;  4KCA A;  1SU9 A;  1ML6 A;  1XW9 A;  3VWV A;  5A4W A;  3BD2 A;  3FMW A;  3KGK A;  3DD3 A;  1FOV A;  3P7X A;  1OC9 B;  2DJK A;  5J9C A;  4F0C A;  3DKS A;  5CRH A;  2LQQ A;  4GQF A;  3A5W A;  3M9J A;  3H79 A;  4K5S A;  3RHC A;  3UBL A;  3OR5 A;  1K0B A;  3CTG A;  2YP6 A;  3PPU A;  3C71 A;  5COH A;  2E2M A;  4O5R A;  2C3T A;  2OA7 A;  4AGS A;  4LA1 A;  2AYT A;  3F63 A;  3E9J B;  3F8U A;  5ECP B;  3F3Q A;  2DIY A;  2X4A A;  4JRR A;  4Q5N A;  2XPD A;  4TOP A;  1JHB A;  1JZD A;  2HRN A;  2VD0 A;  3L0H A;  2TIR A;  2WCI A;  4EDZ A;  3AY8 A;  3CTF A;  5DJM A;  3TJK A;  2GT6 A;  3L4N A;  2WJU A;  3EMX A;  4TR0 A;  3EPT A;  3U6V A;  1R7H A;  3KCM A;  2XPE A;  1J0F A;  2WUL A;  2DJ0 A;  1C72 A;  4MA9 A;  2RII A;  1YF1 A;  5IM9 A;  1AXD A;  5F06 A;  4HSC X;  4ECB A;  4ZXG A;  4WBR D;  1T7P B;  1GLQ A;  5JCW A;  5LD0 A;  2YWI A;  5DQY A;  4MZB A;  2X8G A;  5D9T A;  2I4A A;  3GA4 A;  3IHG A;  5HFI A;  1AQV A;  3HJO A;  4POK A;  4NAX A;  3HXS A;  3ERG A;  5GAP D;  1ZZY A;  3KMO A;  3TDG A;  1VGL A;  1GUL A;  1G7O A;  4EDY A;  3VWX A;  1X0R A;  4CY6 A;  1MDJ A;  2WRT A;  20GS A;  3ZRE A;  4Z2U A;  2B6M A;  3APS A;  4GSN A;  5DAL B;  1YEP A;  3N5O A;  4WF5 A;  4OCF A;  1GUK A;  2H1G A;  5CAX A;  3M8N A;  2C80 A;  4YQV A;  4K7I A;  5IMC A;  3F3R A;  1U88 A;  1SD9 A;  5J4U A;  4RQR A;  2REM A;  1F3B A;  1S3C A;  4PQI A;  4I5Q A;  4F82 A;  3DML A;  2CX3 A;  1YKC A;  3P2A A;  2A2S A;  2FNO A;  4X0X A;  1MDI A;  2L5L A;  4X43 A;  4F03 A;  1J08 A;  4IKH A;  2L6C A;  4KX4 A;  4FO5 A;  1ILO A;  1XIY A;  2N5B A;  3NIV A;  1U3I A;  3VK9 A;  2H01 A;  1YKA A;  2VL2 A;  4MH3 A;  5B8A A;  4J57 E;  3M0F A;  2YJH A;  4HJM A;  5D96 A;  5ECS A;  5F0G A;  1Z5Y E;  4OD7 A;  2XBI A;  5HR2 A;  4OCE A;  2IL3 A;  2H8L A;  2JZT A;  3QFA C;  2E0Q A;  4HQS A;  1SKW B;  2BMX A;  1GTU A;  1OVN A;  1VF4 A;  3VUR A;  1M2D A;  3ISO A;  1T1V A;  4POM A;  2GTU A;  2DMM A;  3C1S A;  4FQU A;  4NWY A;  1V58 A;  4PXO A;  5CRD A;  5ID2 A;  2O87 A;  4I97 A;  3RDW A;  2H70 A;  3GKK A;  2KHP A;  2R4V A;  5IO2 A;  5HR3 A;  1F37 A;  2OE0 A;  1DUG A;  3TJF A;  4D73 A;  5EPF A;  2LKU A;  3RAZ A;  1XWG A;  3LXZ A;  22GS A;  1MEK A;  1HNC A;  1OE7 A;  3IDV A;  1SL0 B;  4I2U A;  3GKM A;  2Z9S A;  3IC8 A;  5IIZ A;  6GSW A;  5IMA A;  2N5F A;  2WS2 A;  5G2Z A;  4EVM A;  3F4S A;  2MBT A;  1OC3 A;  1TJD A;  1Z6M A;  3N9J A;  2EIR A;  3G9B A;  4IP1 A;  2FLS A;  3IXR A;  4OFT A;  1SK1 A;  3GKX A;  2ALB A;  2VCV A;  2PU9 C;  5ECM B;  3IOS A;  1PA3 A;  1XOB A;  3GRX A;  2VM2 A;  2PBJ A;  3CRU A;  1K0N A;  2O8V B;  2R37 A;  3ZRD A;  1A2J A;  1MDK A;  2GQL A;  3QPM A;  3GFK A;  1TKD B;  1TOF A;  1XW5 A;  1EP7 A;  3O6T A;  3VWW A;  4MF7 A;  1E6B A;  1X5D A;  5G5F A;  12GS A;  2ZCT A;  4K0G A;  3RHB A;  2QKE A;  1XWA A;  2H6X A;  2AHE A;  4EXJ A;  4WF4 A;  1CQH A;  1K0A A;  1XG8 A;  1PX6 A;  1H75 A;  3G7I A;  3H4K A;  2ON7 A;  3EE2 A;  1PN9 A;  4HJ2 A;  2O85 A;  2J23 A;  2OAC A;  2KLX A;  4BVY B;  1ERT A;  1X5E A;  2CQ9 A;  5CO3 A;  2LRN A;  2DML A;  1M2A A;  1TP9 A;  3HYP A;  2FCH A;  2VLT A;  4GF0 A;  1LBK A;  3U5R E;  1F9M A;  1B8X A;  3O76 A;  2MYG A;  2FUG 2;  1O7U A;  3LOR A;  2KOK A;  4DSS B;  4RI7 A;  3HHV A;  1QUW A;  3QFB C;  5IOX A;  2HZF A;  4EKZ A;  1UA5 A;  1YDK A;  1EOG A;  3DIE A;  2FWF A;  2FA8 A;  3GNJ A;  1X9M B;  2HRF A;  4K2D A;  3PIN A;  2WDU A;  3WT2 A;  1GWC A;  3IBH A;  4XS1 A;  5KEJ A;  4Z2T A;  2O89 A;  1A24 A;  2XBQ A;  1VF2 A;  2HFD A;  3JCM L;  1V2A A;  2EIO A;  5JCU A;  2CVD A;  3ZML A;  3F4R A;  3W8J A;  4MJE A;  5D9V A;  1W4V A;  2FWG A;  1K3Y A;  2C3N A;  3CRT A;  5B6M A;  3GUS A;  4XS6 A;  4O5Q A;  3QAV A;  2QGV A;  4KF9 A;  1MD3 A;  4YQU A;  2H30 A;  4KDX A;  1VF1 A;  2N5A A;  2LUS A;  1HYU A;  4E8H A;  2A2R A;  5G1L A;  2L57 A;  4ZBD A;  2VCQ A;  3FZ5 A;  2DJ1 A;  2M80 A;  3HVX A;  3CMI A;  2V6K A;  4BIK A;  3GN3 A;  3F6F A;  2BTO T;  1TU8 A;  4KDU A;  4GLT A;  4MNN A;  2F51 A;  3CQF A;  1NHO A;  4PUA A;  3LXT A;  1M9A A;  1PX7 A;  13GS A;  2L6D A;  4RUV A;  2MMN A;  1T00 A;  2LRT A;  4LL4 B;  3VPQ A;  5G5E A;  2EC4 A;  2RUE A;  4Z7X A;  4IQA A;  4TR1 B;  3IV4 A;  4XRA A;  2VCZ A;  4WXT A;  3IAS 2;  1Z6N A;  4IP6 A;  2B5E A;  2DLX A;  2LNT A;  4HI7 A;  1TRV A;  5FWG A;  2H72 A;  3KH9 A;  5J41 A;  5DAK B;  1ABA A;  5LCZ A;  4HU7 A;  5EVO A;  4OWY A;  1TXX A;  2YJ7 A;  3IPZ A;  2HRA A;  4YH2 A;  6GSS A;  4BPY A;  4NMU A;  4EF0 A;  4K5R A;  1DSB A;  1ERW A;  1SJI A;  3UAR A;  1B48 A;  1NM3 A;  2DC5 A;  4XRD A;  3V1W A;  3TRX A;  3LQ7 A;  3UL3 A;  1A8Y A;  4ZBB A;  4JZQ A;  1GNE A;  3GMF A;  3KD0 A;  3MWH A;  3TKS E;  11GS A;  1O6J A;  3ME8 A;  6GSV A;  3UVH A;  3LG6 A;  1OC9 A;  2NBS A;  1U6T A;  4KSM A;  2I3Y A;  1GTI A;  4MLY A;  4PUR A;  2R3X A;  2AJQ B;  2IFQ B;  2HSH A;  5E4W A;  2H76 A;  4MZC A;  3MSZ A;  2WZ9 A;  3R3E A;  2TRC P;  4MP4 A;  4XIH A;  1N2A A;  4BVX B;  2CA8 A;  2HSY A;  4GTU A;  3TKQ A;  4ZL8 A;  2GGT A;  5AN1 A;  1FB0 A;  4OFM A;  3D21 A;  2K8S A;  4G0K A;  1YQ1 A;  1OYJ A;  3KEB A;  2GDR A;  2YPM A;  4DVC A;  3D5J A;  2X49 A;  5DCH A;  2RM6 A;  2A4V A;  2C0D A;  3RBT A;  2IWT A;  1BQ7 A;  4O32 A;  3D4T A;  4EO3 A;  2VOC A;  2VM1 A;  3FRC A;  3FKF A;  5H5R A;  1EV9 A;  1ST9 A;  3ZVJ A;  3GIX A;  2CVK A;  4ID0 A;  4MPF A;  1GUM A;  4G0L A;  3EVI A;  3KJY A;  4G2E A;  3HVV A;  4ISD A;  1Q98 A;  4ZB8 A;  1O8W A;  1FAA A;  5ECO B;  1PKZ A;  1K0D A;  4KGI A;  1W89 A;  5ENU A;  1CQG A;  2RM5 A;  5C04 A;  1FO5 A;  5B6N A;  3HJM A;  4OFN A;  3WD6 A;  2LS5 A;  1V40 A;  4HZ2 A;  1K3L A;  3GST A;  5INY A;  1RQM A;  3C73 A;  3ZL5 A;  5ECN B;  2AV4 A;  4YKF A;  4AJ8 A;  1GSY A;  1SKS B;  2OKA A;  4Q5F A;  2YZU A;  2RUF A;  1AAZ A;  1K0C A;  2V32 A;  3LW9 A;  4ZB6 A;  1Z7R A;  4K9Z A;  2VAF A;  5H5Q A;  2L4Q A;  2GZY A;  3FEU A;  1AW9 A;  3TRQ A;  1X9W B;  1SEN A;  17GS A;  2HNL A;  1AC1 A;  3LYK A;  2P5Q A;  5DAL A;  1Z3E A;  4KDY A;  1ZOF A;  4AF2 A;  2B3S A;  1FB6 A;  3EC3 A;  3I9V 2;  2LNS A;  4G9H A;  5HFK A;  2XHF A;  4GQC A;  2PUK C;  1IYI A;  1AIU A;  3Q74 A;  2GT5 A;  2C1Y A;  1GSQ A;  2VUP A;  1XPV A;  4MDC A;  3FR9 A;  1DE1 A;  5ECI B;  3ERW A;  1DBY A;  2M46 A;  1HNA A;  1WOU A;  3H8Q A;  3FZA A;  3MAK A;  5IPG A;  2P5R A;  3HY2 A;  5ECQ B;  2HZE B;  2G2Q A;  3UEM A;  5HQP A;  1FHE A;  18GS A;  2VIM A;  3K8N A;  2VO4 A;  1Q4J A;  1OKD A;  1O85 A;  4K2X A;  4DSR A;  2LV3 A;  3GYK A;  1N8J A;  3GH9 A;  2NVL A;  3GTU B;  1JZW A;  3TRP A;  4ML6 A;  1XWK A;  4PQ1 A;  5CRE A;  2VCX A;  3IAM 2;  3J7Y b;  4JE1 A;  4KW6 A;  4PUF C;  3APO A;  2FHE A;  4XS4 B;  3ZTL A;  5ELG A;  5CRW A;  2C0G A;  3KZQ A;  1NSW A;  2DBC A;  1WPI A;  5CP1 A;  3GL5 A;  3DEX A;  3QOU A;  2HE3 A;  1OE8 A;  3J7Y k;  2GST A;  3GKN A;  3WGE A;  2GSQ A;  1PSQ A;  2LQO A;  3BCI A;  3HZ4 A;  1XFL A;  3NZN A;  3QDN A;  4HS1 A;  2O7K A;  2ES7 A;  1O81 A;  3D4M A;  2OE1 A;  6GSY A;  2DJ2 A;  4NHZ A;  4FYB A;  3I6A A;  3IRA A;  3HD5 A;  2YAN A;  4YAP A;  1QFN A;  3ERF A;  3HCZ A;  1JLV A;  4HEA 2;  4XTS A;  1EV4 A;  5EY6 A;  5GST A;  1KEB A;  1R5P A;  4RQX A;  3KMN A;  4V2M A;  1T4Z A;  3P90 A;  3RPP A;  4O7H A;  1FG4 A;  10GS A;  3ZZX A;  3M1G A;  4MAB A;  1Y25 A;  1AQW A;  3PH9 A;  3CBU A;  4POL A;  2ZUP A;  2B5X A;  1Z9H A;  2JAD A;  3CSI A;  1FVJ A;  3GSS A;  4YKG A;  3L9U A;  4IHU A;  4N30 A;  7GSS A;  1LJR A;  2R0C A;  2EIQ A;  4QL7 A;  4MZW A;  3DRN A;  5ECL B;  4EIP A;  2DJ3 A;  4NHW A;  1UN2 A;  5AIV A;  5L71 A;  2B5Y A;  2I1U A;  3EU4 A;  2KP1 A;  1I9D A;  2IIY A;  1UVZ A;  5CYY A;  3IK7 A;  5D8I A;  5GAN D;  3EU3 A;  1LU4 A;  4J56 E;  4N0V A;  3E0U A;  4V2L A;  2WB9 A;  1DE2 A;  3SBC A;  3UAP A;  3QMX A;  3S9F A;  4IGJ A;  1YY7 A;  4LMV A;  5AGY A;  4PQH A;  3H1N A;  6GSU A;  4BVY A;  2VLU A;  2CAI A;  1K3O A;  3PGT A;  5DJL A;  3VPT A;  2OE3 A;  5KN1 A;  4EUY A;  5KOX A;  1JZR A;  1PL2 A;  2HYX A;  4OMV A;  4DEJ A;  1JFU A;  2A2P A;  1R5A A;  4A5P A;  2VL9 A;  4ZL9 A;  3LJR A;  2CV4 A;  3HDC A;  4BWS A;  2K9F A;  3QD9 A;  1T4Y A;  4DSS A;  2PVQ A;  5ABR A;  2J9H A;  2V6O A;  1A23 A;  2C0E A;  4NV5 A;  1GSU A;  2YWN A;  4O92 A;  4KUN A;  1KTE A;  4LMW A;  2HRK A;  2JU5 A;  2WGR A;  2YWM A;  4GWR A;  1M3J A;  1GSD A;  2DKH A;  4WET A;  14GS A;  2CZ3 A;  1HD2 A;  16GS A;  3DVW A;  4ECI A;  2R0G A;  4CHS A;  2MBS A;  3L78 A;  4GXZ A;  6GSX A;  1UC7 A;  3MNG A;  2X64 A;  2VCW A;  4HQZ A;  4GRF A;  3CSH A;  3LSZ A;  4K7N A;  2V2G A;  3KIJ A;  4TW5 A;  3IE3 A;  1TW9 A;  3DVX A;  5IMV A;  2LTK A;  1AUC A;  1IYH A;  2YNX A;  1M7T A;  2PER A;  2B7J A;  3UOM A;  2R0P A;  2V41 A;  3KTB A;  5DVB A;  3TKP A;  1PRX A;  1WWJ A;  3HZ8 A;  2H6Y A;  1VF3 A;  5D93 A;  1QK8 A;  3UMA A;  1ZL9 A;  2FWH A;  5JCG A;  5KN0 A;  3TUE A;  1XXU A;  3HKR A;  3QCP A;  4MMM A;  2X99 A;  5J3R A;  4IS0 A;  4ZBA A;  5B8B A;  3TCO A;  1PFO A;  1I5G A;  1YF0 A;  3ZIT A;  4TVE A;  3A2X A;  5E59 A;  4AJ7 A;  5HR0 A;  2FA4 A;  3QAW A;  4ACS A;  4EL1 A;  4ZL7 A;  2H1A A;  2MMZ A;  5ECH B;  2ON5 A;  5AIS A;  4N11 A;  4HUA A;  2V1M A;  3TKR A;  2PVO C;  2F8F A;  4KB3 A;  3ZFB A;  3D0Z A;  2M72 A;  3MDK A;  1PQN A;  1GL8 A;  1EOH A;  2LST A;  3KH7 A;  4ECC A;  3G7J A;  2CT6 A;  1PGT A;  4IN0 A;  5A4U A;  2CAQ A;  3BBY A;  4F9Z A;  3A2V A;  5B7C A;  2QA2 A;  4V1A g;  2K6V A;  1EWX A;  2GSS A;  1PL1 A;  1F2E A;  4H86 A;  3MIX A;  3IA1 A;  1WJK A;  3KM6 A;  4BL7 A;  3HVN A;  3DGQ A;  1NW2 A;  1MTC A;  4IBP A;  4IEL A;  2YOI A;  3F4T A;  1M2B A;  4MJB A;  2IMD A;  3TJG A;  3VWU A;  2IMI A;  1E2Y A;  4BA7 A;  4TXO B;  5ECR B;  5A4V A;  1KBN A;  4HOJ A;  3VI5 A;  2A4H A;  3DWV A;  4ILF A;  3ED3 A;  5DBQ A;  5A5K A;  1F3A A;  3WGD A;  2AUV A;  4Q5Q A;  2H1D A;  2H0I A;  3TOT A;  2LJR A;  3EIN A;  1XBS A;  5KN3 A;  3WYW A;  5G1K A;  1GP1 A;  1V9W A;  4IVF A;  1T8E B;  5EL8 A;  3NOF A;  3CXG A;  4AJ6 A;  3HJP A;  4V1A p;  4IJI A;  1EGO A;  5H5S A;  2H6Z A;  1JZO A;  1YEX A;  3FZ4 A;  3O3T A;  1NHY A;  4KH7 A;  3ZLP A;  4MPG A;  1SJZ A;  2YV9 A;  2GVP A;  4L0U A;  5IQY A;  5J5N A;  4BWQ A;  3ME7 A;  1B4P A;  3FZ9 A;  2GLR A;  1M99 A;  1M0U A;  19GS A;  1Z7P A;  3WT1 A;  1BYE A;  5BRT A;  2YN1 A;  2VL3 A;  1FOH A;  2IMK A;  4WKW A;  1B4Q A;  1GSF A;  4K8M A;  2LRC A;  2B1K A;  3GX8 A;  2OAD A;  2LEG A;  2MMA A;  2IME A;  1ZCP A;  2IMF A;  3EWL A;  2OBI A;  3US3 A;  3EUR A;  5IMZ A;  3W8S A;  2ZNM A;  3GV1 A;  1A0F A;  2B1L A;  1RW1 A;  4E8E A;  1XZO A;  4Z2R A;  1GTA A;  5CRG A;  3HVS A;  1A0R P;  1BAY A;  3GX0 A;  4YAV A;  1ERV A;  2F9S A;  2I9H A;  3D6I A;  2LJA A;  3BCK A;  2JL4 A;  6GST A;  4KAE A;  1B9Y C;  9GSS A;  3EMP A;  4MF5 A;  2R6K A;  3VI7 A;  4YQM A;  3F6D A;  1HQO A;  3Q6O A;  4MJA A;  4KND A;  4ML1 A;  1YJ6 A;  3TJB A;  4GCI A;  3UIW A;  3ZVJ D;  4CW9 A;  4V2N A;  2OJL A;  1WIK A;  1SK2 A;  2YZH A;  1XW6 A;  2DSA A;  1ZYN A;  3BOA A;  4ICY A;  3KTL A;  1T3B A;  2FGX A;  4JBB A;  1PN0 A;  2H75 A;  5F8B A;  2X8C A;  4TR4 A;  5F07 A;  2NPB A;  4N0Z A;  2VD1 A;  4ECJ A;  1BX9 A;  5KOW A;  3FW2 A;  3E3E A;  5KN2 A;  4HDE A;  3UJ1 A;  4P3Y B;  1J9B A;  5D73 A;  1SKR B;  1M9B A;  1THO A;  4HU9 A;  4NV2 A;  5D9X A;  3FK8 A;  3APQ A;  2VLV A;  3L9V A;  5AIX A;  4QQ7 A;  3CSJ A;  5IPH A;  3UVT A;  1TK5 B;  3TKS A;  1SYR A;  4XHM A;  5JWQ B;  2UZ8 A;  1WRY A;  2E2G A;  1GSS A;  3D22 A;  2HZE A;  4LLR A;  5FHI A;  2BJX A;  1SJ6 A;  4F2I A;  2H73 A;  2YV7 A;  4KA0 A;  1R26 A;  2YCD A;  1XVQ A;  2GS3 A;  1TK0 B;  5IMF A;  3TKS C;  1TK8 B;  1SL2 B;  1S3A A;  3GTU A;  4EIQ A;  5ECK B;  1PMT A;  2IJY A;  2B7K A;  1ERU A;  2DIZ A;  3LGC A;  1KNG A;  2KP2 A;  4JU5 A;  5FT3 A;  4ZIL A;  2C3Q A;  4XS4 A;  1AQX A;  2PWJ A;  2VCT A;  5DDL A;  5IOW A;  4TXV A;  2GZP A;  3R2Q A;  4Q5R A;  4CY8 A;  1ZYE A;  4G19 A;  1K0O A;  2I81 A;  3PR8 A;  3CYN A;  4MCU A;  1EEM A;  2JZS A;  2X8H A;  2QSI A;  1URM A;  5G31 A;  5GZZ B;  4N10 A;  1Y6E A;  1RK4 A;  3G7Y A;  3H93 A;  2P0G A;  5HFG A;  3DXB A;  3A2W A;  2QA1 A;  2CZ2 A;  3TJJ A;  3W6G A;  4I6X A;  1V57 A;  5DQS A;  2TRX A;  4NPB A;  1TRS A;  2AAW A;  1BED A;  1SD8 A;  1EP8 A;  2HT9 A;  3FR6 A;  1U3A A;  4L5O A;  2VL2 C;  4FYU A;  3VLN A;  3LEF A;  3FYG A;  2K8V A;  4X1U A;  5CNW A;  5ELA A;  3GH6 A;  3LWA A;  2PPT A;  2JZR A;  3EYT A;  4I8B A;  1MD4 A;  1K0M A;  2E7P A;  1SK0 A;  1XCC A;  1ZMA A;  1VRS D;  2NDO A;  2DJJ A;  5JWO B;  2H0H A;  3C8E A;  2MZC A;  3FHK A;  2H74 A;  5ID2 B;  3KXO A;  1GH2 A;  4KCE A;  1GLP A;  2R5G A;  4PTS A;  3SWL A;  4D73 B;  2H71 A;  4OO5 A;  1XWC A;  2PN8 A;  1XOA A;  4PNF A;  4WR4 A;  2D2Z A;  2HLS A;  4G0I A;  4PX1 A;  2F8A A;  3ZIJ A;  4G10 A;  4QL9 A;  5IMD A;  2RLI A;  4NXI A;  3I43 A;  3ZYW A;  1X9S B;  3FY7 A;  1PKW A;  1ZGN A;  2GSR A;  1S3R A;  4MJC A;  4TRX A;  1ZYQ B;  1QQ2 A;  1TU7 A;  4MF6 A;  2L5O A;  4MH2 A;  1EGR A;  4PNG A;  4WBJ A;  2KUC A;  3ZMK A;  4EE0 A;  3VFI A;  4ZB9 A;  3KP9 A;  4OO4 A;  1GTB A;  1TDI A;  1QMV A;  1XVW A;  4L8E A;  1WE0 A;  1TTZ A;  1A8L A;  1A2L A;  3IK9 A;  4GSS A;  3GHA A;  4K1F A;  2L4C A;  4USS A;  2WFC A;  1A2M A;  1ON4 A;  2C8U A;  4PGT A;  2DKI A;  1THX A;  4ULX A;  1GNW A;  2H66 A;  4KE3 A;  2OBK A;  2H0G A;  3LYP A;  2LJK A;  1BJX A;  4WEY A;  1FVK A;  2QC7 A;  4MK3 A;  1WP0 A;  4LL1 B;  2C0F A;  4K0N A;  3TGZ A;  3MYD A;  5BMU A;  1OC8 A;  1O8X A;  1OAZ A;  1YZX A;  2GZZ A;  3GL3 A;  3Q18 A;  1ZYP A;  4RI6 A;  2HSM A;  4L0W A;  1TRU A;  2JAC A;  1XWB A;  1G0T A;  2P31 A;  3P8W A;  2CVB A;  5G30 A;  1FW1 A;  3F0I A;  3IR4 A;  3GUR A;  1HNB A;  2HI7 A;  4ZIJ A;  4IQ1 A;  2FWE A;  3A3T A;  3F9U A;  4WR5 A;  4DSQ A;  4L5L A;  1QXH A;  2L59 A;  3FR3 A;  2IN3 A;  4F0B A;  1O73 A;  4K7O A;  5LNK e;  4FIW A;  3HA9 A;  2JSY A;  2FY6 A;  2XC2 A;  4I2T A;  1H4O A;  1M3I A;  2MMO A;  3KP8 A;  1G6Y A;  1X5C A;  3TB2 A;  3L9S A;  4JR4 A;  4TR1 A;  3M3M A;  2PMT A;  3BJ5 A;  4POB A;  3WGX A;  4IJ3 A;  4KSO A;  5GSS A;  3LFL A;  3I69 A;  1OKT A;  1U87 A;  2H19 A;  5HR1 A;  3A5I A;  2R2J A;  4X4J A;  1B9X C;  5J9B A;  3M9K A;  3C7M A;  1F6M C;  2F3M A;  5DAK A;  5IO0 A;  3C1R A;  4XCS A;  3TOU A;  4FYC A;  1EEJ A;  4GST A;  2G0F A;  1G6W A;  1TI1 A;  1USB A;  4TKY A;  1S3D A;  2HXK A;  2C4J A;  1SYX A;  4TXO A;  4IW9 A;  1QGV A;  4EC0 A;  1TRW A;  3QAG A;  4FH8 A;  3ZIV A;  3Q19 A;  4HZ4 A;  3IHQ A;  1WMJ A;  3QR6 A;  2H1B A;  1JLW A;  3UBK A;  4JR6 A;  5D9W A;  5C00 A;  1EZK A;  5DCG A;  2CX4 A;  4BL7 B;  5JWR B;  1V98 A;  1R4W A;  4TR3 A;  1ACV A;  4JED A;  2GQK A;  1SL1 B;  1PD2 1;  2IFQ A;  4TN8 A;  1TI3 A;  2IPA A;  1GUH A;  3DYR A;  2GQM A;  8GSS A;  1G7E A;  4K6X A;  1GSE A;  4BVX A;  4CDO A;  2K18 A;  5F05 A;  2AB6 A;  4J2F A;  3ZFL A;  2YWO A;  3IC4 A;  4O5U A;  1GRX A;  2FD3 A; 
#chains in the Genus database with same CATH homology
 2JSZ A;  3RPN A;  2NTO A;  2PGT A;  1BG5 A;  4KCA A;  1SU9 A;  1ML6 A;  1XW9 A;  3VWV A;  5A4W A;  3BD2 A;  3FMW A;  3KGK A;  3DD3 A;  1FOV A;  3P7X A;  1OC9 B;  2DJK A;  5J9C A;  4F0C A;  3DKS A;  5CRH A;  2LQQ A;  4GQF A;  3A5W A;  3M9J A;  3H79 A;  4K5S A;  3RHC A;  3UBL A;  3OR5 A;  1K0B A;  3CTG A;  2YP6 A;  3PPU A;  3C71 A;  5COH A;  2E2M A;  4O5R A;  2C3T A;  2OA7 A;  4AGS A;  4LA1 A;  2AYT A;  3F63 A;  3E9J B;  3F8U A;  5ECP B;  3F3Q A;  2DIY A;  2X4A A;  4JRR A;  4Q5N A;  2XPD A;  4TOP A;  1JHB A;  1JZD A;  2HRN A;  2VD0 A;  3L0H A;  2TIR A;  2WCI A;  4EDZ A;  3AY8 A;  3CTF A;  5DJM A;  3TJK A;  2GT6 A;  3L4N A;  2WJU A;  3EMX A;  4TR0 A;  3EPT A;  3U6V A;  1R7H A;  3KCM A;  2XPE A;  1J0F A;  2WUL A;  2DJ0 A;  1C72 A;  4MA9 A;  2RII A;  1YF1 A;  5IM9 A;  1AXD A;  5F06 A;  4ECB A;  4ZXG A;  4WBR D;  1T7P B;  1GLQ A;  5JCW A;  5LD0 A;  2YWI A;  5DQY A;  4MZB A;  2X8G A;  5D9T A;  2I4A A;  3GA4 A;  3IHG A;  5HFI A;  1AQV A;  3HJO A;  4POK A;  4NAX A;  3HXS A;  3ERG A;  5GAP D;  1ZZY A;  3KMO A;  3TDG A;  1VGL A;  1GUL A;  1G7O A;  4EDY A;  3VWX A;  1X0R A;  4CY6 A;  1MDJ A;  2WRT A;  20GS A;  3ZRE A;  4Z2U A;  2B6M A;  3APS A;  4GSN A;  5DAL B;  1YEP A;  3N5O A;  4WF5 A;  4OCF A;  1GUK A;  2H1G A;  5CAX A;  3M8N A;  2C80 A;  4YQV A;  4K7I A;  5IMC A;  3F3R A;  1U88 A;  1SD9 A;  5J4U A;  4RQR A;  2REM A;  1F3B A;  1S3C A;  4PQI A;  4I5Q A;  4F82 A;  3DML A;  2CX3 A;  1YKC A;  3P2A A;  2A2S A;  2FNO A;  4X0X A;  1MDI A;  2L5L A;  4X43 A;  4F03 A;  1J08 A;  4IKH A;  2L6C A;  4KX4 A;  4FO5 A;  1ILO A;  1XIY A;  2N5B A;  3NIV A;  1U3I A;  3VK9 A;  2H01 A;  1YKA A;  2VL2 A;  4MH3 A;  5B8A A;  4J57 E;  3M0F A;  2YJH A;  4HJM A;  5D96 A;  5ECS A;  5F0G A;  1Z5Y E;  4OD7 A;  2XBI A;  5HR2 A;  4OCE A;  2IL3 A;  2H8L A;  2JZT A;  3QFA C;  2E0Q A;  4HQS A;  1SKW B;  2BMX A;  1GTU A;  1OVN A;  1VF4 A;  3VUR A;  1M2D A;  3ISO A;  1T1V A;  4POM A;  2GTU A;  2DMM A;  3C1S A;  4FQU A;  4NWY A;  1V58 A;  4PXO A;  5CRD A;  5ID2 A;  2O87 A;  4I97 A;  3RDW A;  2H70 A;  3GKK A;  2KHP A;  2R4V A;  5IO2 A;  5HR3 A;  1F37 A;  2OE0 A;  1DUG A;  3TJF A;  4D73 A;  5EPF A;  2LKU A;  3RAZ A;  1XWG A;  3LXZ A;  22GS A;  1MEK A;  1HNC A;  1OE7 A;  3IDV A;  1SL0 B;  4I2U A;  3GKM A;  2Z9S A;  3IC8 A;  5IIZ A;  6GSW A;  5IMA A;  2N5F A;  2WS2 A;  5G2Z A;  4EVM A;  3F4S A;  2MBT A;  1OC3 A;  1TJD A;  1Z6M A;  3N9J A;  2EIR A;  3G9B A;  4IP1 A;  2FLS A;  3IXR A;  4OFT A;  1SK1 A;  3GKX A;  2ALB A;  2VCV A;  2PU9 C;  5ECM B;  3IOS A;  1PA3 A;  1XOB A;  3GRX A;  2VM2 A;  2PBJ A;  3CRU A;  1K0N A;  2O8V B;  2R37 A;  3ZRD A;  1A2J A;  1MDK A;  2GQL A;  3QPM A;  3GFK A;  1TKD B;  1TOF A;  1XW5 A;  1EP7 A;  3O6T A;  3VWW A;  4MF7 A;  1E6B A;  1X5D A;  5G5F A;  12GS A;  2ZCT A;  4K0G A;  3RHB A;  2QKE A;  1XWA A;  2H6X A;  2AHE A;  4EXJ A;  4WF4 A;  1CQH A;  1K0A A;  1PX6 A;  1H75 A;  3G7I A;  3H4K A;  2ON7 A;  3EE2 A;  1PN9 A;  4HJ2 A;  2O85 A;  2J23 A;  2OAC A;  2KLX A;  4BVY B;  1ERT A;  1X5E A;  2CQ9 A;  5CO3 A;  2LRN A;  2DML A;  1M2A A;  1TP9 A;  3HYP A;  2FCH A;  2VLT A;  4GF0 A;  1LBK A;  3U5R E;  1F9M A;  1B8X A;  3O76 A;  2MYG A;  2FUG 2;  1O7U A;  3LOR A;  2KOK A;  4DSS B;  4RI7 A;  3HHV A;  1QUW A;  3QFB C;  5IOX A;  2HZF A;  4EKZ A;  1UA5 A;  1YDK A;  1EOG A;  3DIE A;  2FWF A;  2FA8 A;  3GNJ A;  1X9M B;  2HRF A;  4K2D A;  3PIN A;  2WDU A;  3WT2 A;  1GWC A;  3IBH A;  4XS1 A;  5KEJ A;  4Z2T A;  2O89 A;  1A24 A;  2XBQ A;  1VF2 A;  2HFD A;  3JCM L;  1V2A A;  2EIO A;  5JCU A;  2CVD A;  3ZML A;  3F4R A;  3W8J A;  4MJE A;  5D9V A;  1W4V A;  2FWG A;  1K3Y A;  2C3N A;  3CRT A;  5B6M A;  3GUS A;  4XS6 A;  4O5Q A;  3QAV A;  2QGV A;  4KF9 A;  1MD3 A;  4YQU A;  2H30 A;  4KDX A;  1VF1 A;  2N5A A;  2LUS A;  1HYU A;  4E8H A;  2A2R A;  5G1L A;  2L57 A;  4ZBD A;  2VCQ A;  3FZ5 A;  2DJ1 A;  2M80 A;  3HVX A;  3CMI A;  2V6K A;  3GN3 A;  3F6F A;  2BTO T;  1TU8 A;  4KDU A;  4GLT A;  4MNN A;  2F51 A;  1NHO A;  4PUA A;  3LXT A;  1M9A A;  1PX7 A;  13GS A;  2L6D A;  4RUV A;  2MMN A;  1T00 A;  2LRT A;  4LL4 B;  3VPQ A;  5G5E A;  2EC4 A;  2RUE A;  4Z7X A;  4IQA A;  4TR1 B;  3IV4 A;  4XRA A;  2VCZ A;  4WXT A;  3IAS 2;  1Z6N A;  4IP6 A;  2B5E A;  2DLX A;  2LNT A;  4HI7 A;  1TRV A;  5FWG A;  2H72 A;  3KH9 A;  5J41 A;  5DAK B;  1ABA A;  5LCZ A;  4HU7 A;  5EVO A;  4OWY A;  1TXX A;  2YJ7 A;  3IPZ A;  2HRA A;  4YH2 A;  6GSS A;  4BPY A;  4NMU A;  4EF0 A;  4K5R A;  1DSB A;  1ERW A;  1SJI A;  3UAR A;  1B48 A;  1NM3 A;  2DC5 A;  4XRD A;  3V1W A;  3TRX A;  3LQ7 A;  3UL3 A;  1A8Y A;  4ZBB A;  4JZQ A;  1GNE A;  3GMF A;  3KD0 A;  3MWH A;  3TKS E;  11GS A;  1O6J A;  3ME8 A;  6GSV A;  3UVH A;  3LG6 A;  1OC9 A;  2NBS A;  1U6T A;  4KSM A;  2I3Y A;  1GTI A;  4MLY A;  4PUR A;  2R3X A;  2AJQ B;  2IFQ B;  2HSH A;  5E4W A;  2H76 A;  4MZC A;  3MSZ A;  2WZ9 A;  3R3E A;  2TRC P;  4MP4 A;  4XIH A;  1N2A A;  4BVX B;  2CA8 A;  2HSY A;  4GTU A;  3TKQ A;  4ZL8 A;  2GGT A;  5AN1 A;  1FB0 A;  4OFM A;  3D21 A;  2K8S A;  4G0K A;  1YQ1 A;  1OYJ A;  3KEB A;  2GDR A;  2YPM A;  4DVC A;  3D5J A;  2X49 A;  5DCH A;  2RM6 A;  2A4V A;  2C0D A;  3RBT A;  2IWT A;  1BQ7 A;  4O32 A;  3D4T A;  4EO3 A;  2VOC A;  2VM1 A;  3FRC A;  3FKF A;  5H5R A;  1EV9 A;  1ST9 A;  3ZVJ A;  3GIX A;  2CVK A;  4ID0 A;  4MPF A;  1GUM A;  4G0L A;  3EVI A;  3KJY A;  4G2E A;  3HVV A;  4ISD A;  1Q98 A;  4ZB8 A;  1O8W A;  1FAA A;  5ECO B;  1PKZ A;  1K0D A;  4KGI A;  1W89 A;  5ENU A;  1CQG A;  2RM5 A;  5C04 A;  1FO5 A;  5B6N A;  3HJM A;  4OFN A;  3WD6 A;  2LS5 A;  1V40 A;  4HZ2 A;  1K3L A;  3GST A;  5INY A;  1RQM A;  3C73 A;  3ZL5 A;  5ECN B;  2AV4 A;  4YKF A;  4AJ8 A;  1GSY A;  1SKS B;  2OKA A;  4Q5F A;  2YZU A;  2RUF A;  1AAZ A;  1K0C A;  2V32 A;  3LW9 A;  4ZB6 A;  1Z7R A;  4K9Z A;  2VAF A;  5H5Q A;  2L4Q A;  2GZY A;  3FEU A;  1AW9 A;  3TRQ A;  1X9W B;  1SEN A;  17GS A;  2HNL A;  1AC1 A;  3LYK A;  2P5Q A;  5DAL A;  1Z3E A;  4KDY A;  1ZOF A;  4AF2 A;  2B3S A;  1FB6 A;  3EC3 A;  3I9V 2;  2LNS A;  4G9H A;  5HFK A;  2XHF A;  4GQC A;  2PUK C;  1IYI A;  1AIU A;  3Q74 A;  2GT5 A;  2C1Y A;  1GSQ A;  2VUP A;  1XPV A;  4MDC A;  3FR9 A;  1DE1 A;  5ECI B;  3ERW A;  1DBY A;  2M46 A;  1HNA A;  1WOU A;  3H8Q A;  3FZA A;  3MAK A;  5IPG A;  2P5R A;  3HY2 A;  5ECQ B;  2HZE B;  2G2Q A;  3UEM A;  5HQP A;  1FHE A;  18GS A;  2VIM A;  3K8N A;  2VO4 A;  1Q4J A;  1OKD A;  1O85 A;  4K2X A;  4DSR A;  2LV3 A;  3GYK A;  1N8J A;  3GH9 A;  2NVL A;  3GTU B;  1JZW A;  3TRP A;  4ML6 A;  1XWK A;  4PQ1 A;  5CRE A;  2VCX A;  3IAM 2;  3J7Y b;  4JE1 A;  4KW6 A;  4PUF C;  3APO A;  2FHE A;  4XS4 B;  3ZTL A;  5ELG A;  5CRW A;  2C0G A;  3KZQ A;  1NSW A;  2DBC A;  1WPI A;  5CP1 A;  3GL5 A;  3DEX A;  3QOU A;  2HE3 A;  1OE8 A;  3J7Y k;  2GST A;  3GKN A;  3WGE A;  2GSQ A;  1PSQ A;  2LQO A;  3BCI A;  3HZ4 A;  1XFL A;  3NZN A;  3QDN A;  4HS1 A;  2O7K A;  2ES7 A;  1O81 A;  3D4M A;  2OE1 A;  6GSY A;  2DJ2 A;  4NHZ A;  4FYB A;  3I6A A;  3IRA A;  3HD5 A;  2YAN A;  4YAP A;  1QFN A;  3ERF A;  3HCZ A;  1JLV A;  4HEA 2;  4XTS A;  1EV4 A;  5EY6 A;  5GST A;  1KEB A;  1R5P A;  4RQX A;  3KMN A;  4V2M A;  1T4Z A;  3P90 A;  3RPP A;  4O7H A;  1FG4 A;  10GS A;  3ZZX A;  3M1G A;  4MAB A;  1Y25 A;  1AQW A;  3PH9 A;  3CBU A;  4POL A;  2ZUP A;  2B5X A;  1Z9H A;  2JAD A;  3CSI A;  1FVJ A;  3GSS A;  4YKG A;  3L9U A;  4IHU A;  4N30 A;  7GSS A;  1LJR A;  2R0C A;  2EIQ A;  4QL7 A;  4MZW A;  3DRN A;  5ECL B;  4EIP A;  2DJ3 A;  4NHW A;  1UN2 A;  5AIV A;  5L71 A;  2B5Y A;  2I1U A;  3EU4 A;  2KP1 A;  1I9D A;  2IIY A;  1UVZ A;  5CYY A;  3IK7 A;  5D8I A;  5GAN D;  3EU3 A;  1LU4 A;  4J56 E;  4N0V A;  3E0U A;  4V2L A;  2WB9 A;  1DE2 A;  3SBC A;  3UAP A;  3QMX A;  3S9F A;  4IGJ A;  1YY7 A;  4LMV A;  5AGY A;  4PQH A;  3H1N A;  6GSU A;  4BVY A;  2VLU A;  2CAI A;  1K3O A;  3PGT A;  5DJL A;  3VPT A;  2OE3 A;  5KN1 A;  4EUY A;  5KOX A;  1JZR A;  1PL2 A;  2HYX A;  4OMV A;  4DEJ A;  1JFU A;  2A2P A;  1R5A A;  4A5P A;  2VL9 A;  4ZL9 A;  3LJR A;  2CV4 A;  3HDC A;  4BWS A;  2K9F A;  3QD9 A;  1T4Y A;  4DSS A;  2PVQ A;  5ABR A;  2J9H A;  2V6O A;  1A23 A;  2C0E A;  4NV5 A;  1GSU A;  2YWN A;  4O92 A;  4KUN A;  1KTE A;  4LMW A;  2HRK A;  2JU5 A;  2WGR A;  2YWM A;  4GWR A;  1GSD A;  2DKH A;  4WET A;  14GS A;  2CZ3 A;  1HD2 A;  16GS A;  3DVW A;  4ECI A;  2R0G A;  4CHS A;  2MBS A;  3L78 A;  4GXZ A;  6GSX A;  1UC7 A;  3MNG A;  2X64 A;  2VCW A;  4HQZ A;  4GRF A;  3CSH A;  3LSZ A;  4K7N A;  2V2G A;  3KIJ A;  4TW5 A;  3IE3 A;  1TW9 A;  3DVX A;  5IMV A;  2LTK A;  1AUC A;  1IYH A;  2YNX A;  1M7T A;  2PER A;  2B7J A;  3UOM A;  2R0P A;  2V41 A;  3KTB A;  5DVB A;  3TKP A;  1PRX A;  1WWJ A;  3HZ8 A;  2H6Y A;  1VF3 A;  5D93 A;  1QK8 A;  3UMA A;  1ZL9 A;  2FWH A;  5JCG A;  5KN0 A;  3TUE A;  1XXU A;  3HKR A;  3QCP A;  4MMM A;  2X99 A;  5J3R A;  4IS0 A;  4ZBA A;  5B8B A;  3TCO A;  1I5G A;  1YF0 A;  3ZIT A;  4TVE A;  3A2X A;  5E59 A;  4AJ7 A;  5HR0 A;  2FA4 A;  3QAW A;  4ACS A;  4EL1 A;  4ZL7 A;  2H1A A;  2MMZ A;  5ECH B;  2ON5 A;  5AIS A;  4N11 A;  4HUA A;  2V1M A;  3TKR A;  2PVO C;  2F8F A;  4KB3 A;  3ZFB A;  3D0Z A;  2M72 A;  3MDK A;  1PQN A;  1GL8 A;  1EOH A;  2LST A;  3KH7 A;  4ECC A;  3G7J A;  2CT6 A;  1PGT A;  4IN0 A;  5A4U A;  2CAQ A;  3BBY A;  4F9Z A;  3A2V A;  5B7C A;  2QA2 A;  4V1A g;  2K6V A;  1EWX A;  2GSS A;  1PL1 A;  1F2E A;  4H86 A;  3MIX A;  3IA1 A;  1WJK A;  3KM6 A;  4BL7 A;  3DGQ A;  1NW2 A;  1MTC A;  4IBP A;  4IEL A;  2YOI A;  3F4T A;  1M2B A;  4MJB A;  2IMD A;  3TJG A;  3VWU A;  2IMI A;  1E2Y A;  4BA7 A;  4TXO B;  5ECR B;  5A4V A;  1KBN A;  4HOJ A;  3VI5 A;  2A4H A;  3DWV A;  4ILF A;  3ED3 A;  5DBQ A;  5A5K A;  1F3A A;  3WGD A;  2AUV A;  4Q5Q A;  2H1D A;  2H0I A;  3TOT A;  2LJR A;  3EIN A;  1XBS A;  5KN3 A;  3WYW A;  5G1K A;  1GP1 A;  1V9W A;  4IVF A;  1T8E B;  5EL8 A;  3NOF A;  3CXG A;  4AJ6 A;  3HJP A;  4V1A p;  4IJI A;  1EGO A;  5H5S A;  2H6Z A;  1JZO A;  1YEX A;  3FZ4 A;  3O3T A;  1NHY A;  4KH7 A;  3ZLP A;  4MPG A;  1SJZ A;  2YV9 A;  2GVP A;  4L0U A;  5IQY A;  5J5N A;  4BWQ A;  3ME7 A;  1B4P A;  3FZ9 A;  2GLR A;  1M99 A;  1M0U A;  19GS A;  1Z7P A;  3WT1 A;  1BYE A;  5BRT A;  2YN1 A;  2VL3 A;  1FOH A;  2IMK A;  4WKW A;  1B4Q A;  1GSF A;  4K8M A;  2LRC A;  2B1K A;  3GX8 A;  2OAD A;  2LEG A;  2MMA A;  2IME A;  1ZCP A;  2IMF A;  3EWL A;  2OBI A;  3US3 A;  3EUR A;  5IMZ A;  3W8S A;  2ZNM A;  3GV1 A;  1A0F A;  2B1L A;  1RW1 A;  4E8E A;  1XZO A;  4Z2R A;  1GTA A;  5CRG A;  3HVS A;  1A0R P;  1BAY A;  3GX0 A;  4YAV A;  1ERV A;  2F9S A;  2I9H A;  3D6I A;  2LJA A;  3BCK A;  2JL4 A;  6GST A;  4KAE A;  1B9Y C;  9GSS A;  3EMP A;  4MF5 A;  2R6K A;  3VI7 A;  4YQM A;  3F6D A;  1HQO A;  3Q6O A;  4MJA A;  4KND A;  4ML1 A;  1YJ6 A;  3TJB A;  4GCI A;  3UIW A;  3ZVJ D;  4CW9 A;  4V2N A;  2OJL A;  1WIK A;  1SK2 A;  2YZH A;  1XW6 A;  2DSA A;  1ZYN A;  3BOA A;  4ICY A;  3KTL A;  1T3B A;  2FGX A;  4JBB A;  1PN0 A;  2H75 A;  5F8B A;  2X8C A;  4TR4 A;  5F07 A;  2NPB A;  4N0Z A;  2VD1 A;  4ECJ A;  1BX9 A;  5KOW A;  3FW2 A;  3E3E A;  5KN2 A;  4HDE A;  3UJ1 A;  4P3Y B;  1J9B A;  5D73 A;  1SKR B;  1M9B A;  1THO A;  4HU9 A;  4NV2 A;  5D9X A;  3FK8 A;  3APQ A;  2VLV A;  3L9V A;  5AIX A;  4QQ7 A;  3CSJ A;  5IPH A;  3UVT A;  1TK5 B;  3TKS A;  1SYR A;  4XHM A;  5JWQ B;  2UZ8 A;  1WRY A;  2E2G A;  1GSS A;  3D22 A;  2HZE A;  4LLR A;  5FHI A;  2BJX A;  1SJ6 A;  4F2I A;  2H73 A;  2YV7 A;  4KA0 A;  1R26 A;  2YCD A;  1XVQ A;  2GS3 A;  1TK0 B;  5IMF A;  3TKS C;  1TK8 B;  1SL2 B;  1S3A A;  3GTU A;  4EIQ A;  5ECK B;  1PMT A;  2IJY A;  2B7K A;  1ERU A;  2DIZ A;  3LGC A;  1KNG A;  2KP2 A;  4JU5 A;  5FT3 A;  4ZIL A;  2C3Q A;  4XS4 A;  1AQX A;  2PWJ A;  2VCT A;  5DDL A;  5IOW A;  4TXV A;  2GZP A;  3R2Q A;  4Q5R A;  4CY8 A;  1ZYE A;  4G19 A;  1K0O A;  2I81 A;  3PR8 A;  3CYN A;  4MCU A;  1EEM A;  2JZS A;  2X8H A;  2QSI A;  1URM A;  5G31 A;  5GZZ B;  4N10 A;  1Y6E A;  1RK4 A;  3G7Y A;  3H93 A;  2P0G A;  5HFG A;  3DXB A;  3A2W A;  2QA1 A;  2CZ2 A;  3TJJ A;  3W6G A;  4I6X A;  1V57 A;  5DQS A;  2TRX A;  4NPB A;  1TRS A;  2AAW A;  1BED A;  1SD8 A;  1EP8 A;  2HT9 A;  3FR6 A;  1U3A A;  4L5O A;  2VL2 C;  4FYU A;  3VLN A;  3LEF A;  3FYG A;  2K8V A;  4X1U A;  5CNW A;  5ELA A;  3GH6 A;  3LWA A;  2PPT A;  2JZR A;  3EYT A;  4I8B A;  1MD4 A;  1K0M A;  2E7P A;  1SK0 A;  1XCC A;  1ZMA A;  1VRS D;  2NDO A;  2DJJ A;  5JWO B;  2H0H A;  3C8E A;  2MZC A;  3FHK A;  2H74 A;  5ID2 B;  3KXO A;  1GH2 A;  4KCE A;  1GLP A;  2R5G A;  4PTS A;  3SWL A;  4D73 B;  2H71 A;  4OO5 A;  1XWC A;  2PN8 A;  1XOA A;  4PNF A;  4WR4 A;  2D2Z A;  2HLS A;  4G0I A;  4PX1 A;  2F8A A;  3ZIJ A;  4G10 A;  4QL9 A;  5IMD A;  2RLI A;  4NXI A;  3I43 A;  3ZYW A;  1X9S B;  3FY7 A;  1PKW A;  1ZGN A;  2GSR A;  4MJC A;  4TRX A;  1ZYQ B;  1QQ2 A;  1TU7 A;  4MF6 A;  2L5O A;  4MH2 A;  1EGR A;  4PNG A;  4WBJ A;  2KUC A;  3ZMK A;  4EE0 A;  3VFI A;  4ZB9 A;  3KP9 A;  4OO4 A;  1GTB A;  1TDI A;  1QMV A;  1XVW A;  4L8E A;  1WE0 A;  1TTZ A;  1A8L A;  1A2L A;  3IK9 A;  4GSS A;  3GHA A;  4K1F A;  2L4C A;  4USS A;  2WFC A;  1A2M A;  1ON4 A;  2C8U A;  4PGT A;  2DKI A;  1THX A;  4ULX A;  1GNW A;  2H66 A;  4KE3 A;  2OBK A;  2H0G A;  3LYP A;  2LJK A;  1BJX A;  4WEY A;  1FVK A;  2QC7 A;  4MK3 A;  1WP0 A;  4LL1 B;  2C0F A;  4K0N A;  3TGZ A;  3MYD A;  5BMU A;  1OC8 A;  1O8X A;  1OAZ A;  1YZX A;  2GZZ A;  3GL3 A;  3Q18 A;  1ZYP A;  4RI6 A;  2HSM A;  4L0W A;  1TRU A;  2JAC A;  1XWB A;  1G0T A;  2P31 A;  3P8W A;  2CVB A;  5G30 A;  1FW1 A;  3F0I A;  3IR4 A;  3GUR A;  1HNB A;  2HI7 A;  4ZIJ A;  4IQ1 A;  2FWE A;  3A3T A;  3F9U A;  4WR5 A;  4DSQ A;  4L5L A;  1QXH A;  2L59 A;  3FR3 A;  2IN3 A;  4F0B A;  1O73 A;  4K7O A;  5LNK e;  4FIW A;  3HA9 A;  2JSY A;  2FY6 A;  2XC2 A;  4I2T A;  1H4O A;  2MMO A;  3KP8 A;  1G6Y A;  1X5C A;  3TB2 A;  3L9S A;  4JR4 A;  4TR1 A;  3M3M A;  2PMT A;  3BJ5 A;  4POB A;  3WGX A;  4IJ3 A;  4KSO A;  5GSS A;  3LFL A;  3I69 A;  1OKT A;  1U87 A;  2H19 A;  5HR1 A;  3A5I A;  2R2J A;  4X4J A;  1B9X C;  5J9B A;  3M9K A;  3C7M A;  1F6M C;  2F3M A;  5DAK A;  5IO0 A;  3C1R A;  4XCS A;  3TOU A;  4FYC A;  1EEJ A;  4GST A;  2G0F A;  1G6W A;  1TI1 A;  1USB A;  4TKY A;  1S3D A;  2HXK A;  2C4J A;  1SYX A;  4TXO A;  4IW9 A;  1QGV A;  4EC0 A;  1TRW A;  3QAG A;  4FH8 A;  3ZIV A;  3Q19 A;  4HZ4 A;  3IHQ A;  1WMJ A;  3QR6 A;  2H1B A;  1JLW A;  3UBK A;  4JR6 A;  5D9W A;  5C00 A;  1EZK A;  5DCG A;  2CX4 A;  4BL7 B;  5JWR B;  1V98 A;  1R4W A;  4TR3 A;  1ACV A;  4JED A;  2GQK A;  1SL1 B;  1PD2 1;  2IFQ A;  4TN8 A;  1TI3 A;  2IPA A;  1GUH A;  3DYR A;  2GQM A;  8GSS A;  1G7E A;  4K6X A;  1GSE A;  4BVX A;  4CDO A;  2K18 A;  5F05 A;  2AB6 A;  4J2F A;  3ZFL A;  2YWO A;  3IC4 A;  4O5U A;  1GRX A;  2FD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...