2E0QA

Crystal structure of k53e thioredoxin from sulfolobus tokodaii strain7
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
VIHLDSKNFDSFLASHEIAVVDFWAEWCAPCLILAPIIEELAEDYPQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAVPREEIEIRIKNLLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords thioredoxin
publication title Crystal structure of thioredoxin domain of ST2123 from thermophilic archaea Sulfolobus tokodaii strain7
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 26
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2e0qA00
4MPGA 2ES7A 3L78A 5HR3A 4F9ZA 4I6XA 3IC4A 2QSIA 1XOBA 1GTIA 5ECOB 1SU9A 4K0GA 1UA5A 1O8WA 3GYKA 3KEBA 1X9MB 1KBNA 1TU7A 3FRCA 1RQMA 2X99A 4BL7A 1SL0B 4HJMA 1DSBA 3M8NA 3VPQA 1BQ7A 2VCTA 5IMDA 3TUEA 5IPGA 4DSRA 1WMJA 1EWXA 4IJ3A 4ML6A 1OE7A 6GSXA 4Z7XA 1MDJA 2DIYA 1M2AA 1SJ6A 4K8MA 5EPFA 1ZMAA 1AQXA 1VF2A 5EL8A 5J9BA 1B9XC 1TRVA 2HSYA 2N5AA 2IN3A 1GTAA 1Q98A 5ECNB 1A8YA 3ZTLA 3RPNA 1WOUA 5HR0A 4I2UA 2H75A 1TU8A 3OR5A 1Y25A 2NDOA 5ECLB 2J9HA 2PN8A 1A2MA 1V9WA 2OE3A 2LQQA 1TJDA 2PUKC 2X8HA 2M80A 1J0FA 4MF5A 3J7Yk 1OKTA 3E9JB 3D22A 2K9FA 2B5EA 19GSA 4POLA 2H6XA 2M72A 4V1Ap 3WGDA 2G0FA 2GQLA 4GSSA 3UIWA 3VWWA 6GSUA 3LG6A 2B7KA 2O85A 1GNEA 1PA3A 4KCAA 4P3YB 3IV4A 5FWGA 1AW9A 4MP4A 2LS5A 4KDUA 2NTOA 2X8CA 3DYRA 4TR1A 3KXOA 4MJBA 4JE1A 4F0CA 1YKCA 4KDYA 3TJFA 1XWCA 2DJKA 2C0EA 5D9WA 4KCEA 1C72A 5AISA 4HJ2A 2FY6A 4XS6A 1X9SB 5JWRB 1M2DA 2L57A 9GSSA 1W89A 3BD2A 4N0ZA 5J9CA 5ID2B 1UVZA 4YQUA 1CQHA 2K6VA 1EEJA 3GRXA 3QCPA 1NW2A 3DWVA 2KUCA 3CRTA 3UJ1A 3IK7A 2P5QA 1V57A 2AB6A 4EE0A 1K0MA 1R4WA 4WXTA 14GSA 1XVWA 2GZYA 3HKRA 4OWYA 5CNWA 3HVXA 3IOSA 1B4QA 2DMLA 3DVWA 3TKRA 2GS3A 3TDGA 4TR0A 1NHYA 4TW5A 3HZ4A 5GAND 4QQ7A 4QL9A 20GSA 3APQA 2JZRA 2VM1A 3H8QA 2DJ1A 1YF0A 1K0AA 3VK9A 4TVEA 1Y6EA 2L4QA 5H5QA 3EWLA 3FZAA 4JRRA 2GGTA 3A2VA 3MWHA 1GSSA 4XS1A 5HFKA 3ZZXA 6GSTA 4OFNA 4BPYA 2L6CA 2O8VB 1M0UA 2QKEA 4EVMA 3F4RA 3ZIVA 3FHKA 2H66A 2CVDA 1B9YC 2YWOA 1ERWA 2IFQA 5E4WA 4F0BA 2QC7A 3C71A 1Z3EA 3UBKA 5IQYA 3G7JA 3I43A 5DVBA 5IO2A 5DALA 3C8EA 4L5LA 1WP0A 3I69A 4X0XA 5D9VA 4MH3A 1EOGA 3VWXA 3WYWA 3TJKA 3PINA 4WBJA 4NAXA 4ISDA 1TK8B 1OVNA 4EL1A 2R37A 18GSA 3CTFA 2E2GA 4F2IA 2CZ3A 1QMVA 2CT6A 3F63A 2ON7A 3IXRA 1T4YA 5A4UA 2JSZA 5KN1A 3S9FA 1TI3A 3VI5A 4ACSA 4YH2A 1ACVA 2QGVA 3KP8A 4MMMA 4WBRD 10GSA 2HLSA 4JBBA 5G30A 3V1WA 5DQYA 4G9HA 3LGCA 3ZFLA 3APSA 1A2LA 2P0GA 3LYPA 4BVYA 2HRFA 4I2TA 2HSHA 3KTBA 4TOPA 3IDVA 4HQSA 1NSWA 2RM6A 1OC8A 4JU5A 1TK0B 2CZ2A 4MJAA 1I5GA 1OYJA 2FGXA 4MH2A 3W6GA 3VWUA 5G5EA 5F07A 1N8JA 1WPIA 1NHOA 3H1NA 2BTOT 1J9BA 3GX8A 3EE2A 3RHBA 3ZITA 5FT3A 2MMAA 1F3BA 3H93A 3MAKA 5KN2A 1G6YA 1SK0A 2RUEA 2VLUA 3C73A 2FWGA 2CAQA 2K8SA 3MSZA 3D0ZA 1SYRA 3U5RE 2AUVA 4ZL9A 2RIIA 4OMVA 2DC5A 1T1VA 2LJKA 3M1GA 5DAKB 2HI7A 4WF5A 2OBIA 1PL1A 2JU5A 3GMFA 3Q18A 2H0GA 4MF7A 4J2FA 1FB6A 2LRNA 2B1LA 2F51A 3RBTA 3GKMA 1PQNA 2CX4A 3ME8A 4KGIA 1GSDA 2TRCP 3ZREA 3BJ5A 2VL3A 1S3AA 1T7PB 1F9MA 1LJRA 2YANA 2VAFA 4L0WA 2GTUA 3UOMA 4EF0A 1IYIA 2YP6A 8GSSA 3UVTA 4CHSA 1EEMA 3BCKA 2VCZA 1EV4A 3TKQA 2WZ9A 1T8EB 1LBKA 3IK9A 12GSA 3GH6A 5ECKB 3HA9A 4NXIA 2DMMA 3CSJA 4FYUA 5KN0A 2VD1A 5ABRA 1XW9A 4I8BA 3TKSC 4HZ2A 5GSTA 3ZFBA 1A23A 3HJMA 4D73A 5J4UA 4WR5A 3G9BA 4POMA 5IMAA 3QAVA 4GCIA 3L4NA 2YCDA 3IA1A 3M9JA 1QXHA 2IMDA 1XBSA 3FZ4A 5CRWA 3F6DA 3WT2A 1ON4A 1DUGA 5F8BA 2FNOA 2YZUA 4ECJA 1KNGA 2HRNA 1M99A 1UC7A 3GIXA 3RPPA 2IFQB 4ML1A 3GTUA 3Q74A 1F2EA 1SD8A 4HOJA 3ZYWA 3GKXA 2DSAA 3GHAA 3CSHA 4HU7A 3TRXA 5IPHA 1I9DA 1ML6A 1M9AA 3F3QA 1PSQA 2P5RA 4FH8A 1GSFA 3HY2A 1N2AA 5DJLA 3IHQA 4NPBA 2CV4A 2R2JA 2H74A 4O5RA 3HVSA 1SD9A 5AIVA 3GV1A 1HNAA 5DJMA 1PGTA 4N30A 1TTZA 5C00A 2RUFA 3PGTA 5B6MA 3ERFA 1G7OA 5CP1A 2HZEB 3VURA 1BAYA 3L9UA 1UN2A 3UMAA 4MZBA 1TRUA 2JACA 1Z6NA 2JZSA 4ECIA 3TKSE 5HFIA 4RUVA 5IMFA 1OKDA 3I6AA 3IBHA 1GUHA 2WFCA 1ST9A 3BOAA 1ZCPA 2B5YA 1XWKA 5KEJA 2N5FA 2VO4A 2XC2A 4L8EA 3IRAA 3UARA 3CTGA 5J41A 2YZHA 5KN3A 4J57E 2HT9A 4I5QA 2I4AA 2GSRA 3M0FA 1U3IA 4F82A 2WB9A 4OO4A 5A4WA 3LYKA 3TKPA 2BJXA 1ZOFA 1XZOA 3W8JA 4BA7A 2H6YA 1V2AA 5B8BA 2H1GA 3KP9A 4EC0A 1GULA 3L9VA 1XVQA 2WS2A 2V6KA 2OBKA 3HYPA 5B7CA 2GDRA 3DVXA 1JZOA 2LJAA 3F0IA 1K0OA 2H30A 2HNLA 3A5WA 4K9ZA 4NHWA 1SJZA 5B6NA 1T00A 2H73A 1XIYA 1R5AA 5H5SA 1GWCA 4IELA 2RM5A 4DSSA 3CSIA 1BG5A 4ZL7A 4N0VA 4ECCA 3ZLPA 1RK4A 4LL1B 1DE2A 1BJXA 2LSTA 1SL1B 3G7IA 1HNBA 4OCFA 4TN8A 4WKWA 2D2ZA 4JR6A 5G2ZA 1XW6A 5ECQB 3KMOA 2MBTA 2E2MA 3EVIA 4IVFA 3FK8A 4ECBA 2VIMA 2YWNA 4YAPA 3EU4A 4K7OA 1XWAA 4KSMA 3ZVJD 3J7Yb 1YJ6A 3UVHA 1ILOA 3LWAA 4JZQA 2H70A 2YOIA 1CQGA 2I1UA 3BCIA 1Z6MA 4KB3A 4Q5FA 2DLXA 3AY8A 3F9UA 1H4OA 1M2BA 3E0UA 4NWYA 3FR3A 2KP2A 4V2NA 4WEYA 5FHIA 3KMNA 1K0DA 4TXOA 1OC9B 1SYXA 3EMPA 1WJKA 4LL4B 4KW6A 1S3CA 5LNKe 1T4ZA 3HCZA 1G0TA 2C3TA 1U88A 3HDCA 2YWIA 5F0GA 3KGKA 4YQVA 6GSVA 5HQPA 3HVVA 5DCGA 1WIKA 2IMFA 2H1BA 4ZIJA 4MDCA 3A2XA 2IMIA 3RDWA 2IIYA 1K0BA 4IP1A 4GQFA 3LJRA 2IMKA 3P7XA 3QPMA 3D4MA 1MDIA 4GF0A 4BVXA 4ZILA 4OFTA 4XRAA 1Q4JA 1KTEA 2F3MA 3MDKA 1H75A 2V1MA 1ZYQB 1BEDA 4X1UA 3NOFA 2VCXA 2VCVA 3PH9A 3QAGA 2RLIA 2NBSA 5EVOA 2H72A 4MABA 1GL8A 2PU9C 1FVJA 3WGEA 3O76A 1XPVA 1JLWA 1W4VA 1THOA 3GSSA 5CRHA 3WD6A 1XOAA 3A3TA 3EINA 4XS4A 1M9BA 2IWTA 3FZ9A 1EZKA 2CVKA 5IMZA 4HS1A 3HJPA 1QK8A 1ZGNA 2B6MA 2FCHA 2IL3A 3EURA 3CYNA 3P90A 3KIJA 5CREA 4QL7A 4PQHA 3IAM2 3QAWA 1ERVA 1SK1A 5D96A 2VLTA 5GAPD 2H01A 2YN1A 1GSEA 3TJGA 1O81A 1GSUA 4MCUA 1ABAA 4FYBA 4JR4A 4F03A 3TJJA 2C3NA 3D21A 4GRFA 3SWLA 1MD3A 4N11A 4LLRA 2CX3A 3CRUA 2I81A 2FD3A 1VF4A 3GUSA 1AUCA 1ZZYA 3TGZA 2REMA 2DBCA 4MA9A 5J3RA 1S3DA 1QQ2A 5F06A 4O32A 2R6KA 3RAZA 1QFNA 2H1AA 1A0RP 1PX6A 2VM2A 2VL2A 5ECIB 1F6MC 1SK2A 2H76A 1AC1A 3P8WA 4WETA 2E0QA 4Q5QA 5LD0A 22GSA 3KD0A 3TB2A 5J5NA 5HR2A 3GH9A 3TOTA 1XWBA 2C4JA 4O92A 2MBSA 3LXTA 2LUSA 4RQRA 1GLPA 4KUNA 2R5GA 2ZCTA 3GNJA 2FHEA 2H6ZA 4TR1B 3DRNA 1PMTA 2HFDA 3DEXA 1GUKA 4PXOA 3TCOA 1EOHA 5C04A 1A24A 1XXUA 3DKSA 5DDLA 2FA8A 1B48A 5IMCA 4TXVA 3QD9A 4POKA 4ZB6A 1O6JA 1IYHA 1TW9A 2GVPA 1YKAA 2YV7A 1OC3A 4GSNA 2WULA 1GTUA 1AIUA 4AJ8A 1TKDB 1Z7RA 2V2GA 4HEA2 4LMWA 3QOUA 4ZBBA 2IPAA 4G19A 2V41A 1B8XA 2BMXA 1XCCA 1SKSB 2OA7A 4IGJA 3K8NA 4NV5A 13GSA 1AAZA 4FIWA 2IMEA 3FKFA 2N5BA 2WRTA 1NM3A 5E59A 3ME7A 2Z9SA 4TKYA 3A2WA 4MJEA 3DMLA 3W8SA 2C8UA 2K18A 4JEDA 4V2LA 3ED3A 4IW9A 4BWSA 3UL3A 1BX9A 2LRCA 5F05A 3LSZA 2FWHA 4G10A 3D5JA 1HYUA 2J23A 4CW9A 2YJ7A 3EU3A 5L71A 2B1KA 4HZ4A 2VUPA 3DGQA 4MZWA 3APOA 2FWEA 7GSSA 2ZNMA 1HD2A 2X64A 3ZMKA 4MZCA 4K7NA 5CRDA 3US3A 2NPBA 4V2MA 4KDXA 4TR3A 4KA0A 4YQMA 5ID2A 1TOFA 1SENA 4ZB9A 2DJJA 1K0NA 4EO3A 1F37A 5DALB 5H5RA 1GH2A 2LNSA 4XTSA 1PD21 3ZL5A 2XBIA 3ZVJA 5ENUA 1TXXA 2B3SA 2L4CA 4HQZA 3QR6A 4ULXA 2KHPA 2E7PA 1EGOA 1PN9A 1EV9A 2DJ0A 2L59A 1R5PA 4RQXA 3VLNA 5LCZA 1R7HA 1SJIA 2KP1A 4KE3A 2PMTA 4K1FA 1QGVA 3TRPA 3UBLA 2XPEA 4EXJA 2LNTA 2R3XA 2OE0A 1XFLA 2MZCA 1O73A 4X43A 3QMXA 2XBQA 4PUAA 2O87A 4K0NA 4MPFA 5IMVA 3VFIA 1GP1A 1TDIA 2YJHA 2AJQB 3N5OA 1ERTA 1FB0A 2PERA 3GL3A 4YAVA 2LEGA 1JHBA 3KH7A 3UAPA 1FOVA 3SBCA 1JFUA 2VL9A 4POBA 2PBJA 3TOUA 5DBQA 4XCSA 4PQIA 4EDZA 3CMIA 2GT6A 4CDOA 4Q5NA 3LORA 1R26A 2L5LA 4OO5A 3P2AA 1X9WB 1B4PA 1PKWA 5ECHB 5A4VA 17GSA 5ECSA 4NMUA 1A0FA 1EGRA 2JSYA 2PPTA 5IO0A 1T3BA 4K2DA 2GQMA 2CQ9A 2GLRA 2WCIA 2P31A 2YNXA 5DQSA 2LRTA 3H79A 2OJLA 5G5FA 3BBYA 1K3YA 5AGYA 1YY7A 5HFGA 4NV2A 1A8LA 2C0FA 2B5XA 4RI7A 5INYA 5CYYA 1JLVA 3HZ8A 4GLTA 1X5CA 1MEKA 3F3RA 6GSYA 3GSTA 1X5DA 1TI1A 1MD4A 4DSQA 2GSSA 4ID0A 4L5OA 4OD7A 3VWVA 3FW2A 2VLVA 5D93A 1E2YA 4L0UA 4PUFC 1VF3A 2B7JA 6GSSA 3L9SA 2VCWA 5JCUA 1FAAA 3GFKA 1WE0A 4GTUA 4MLYA 1O7UA 3IAS2 3IR4A 3KCMA 3F4SA 1G7EA 4BWQA 2EIRA 3D4TA 3F8UA 4LA1A 2VD0A 2NVLA 2GT5A 1VRSD 2FA4A 2JL4A 2K8VA 2F8AA 1WWJA 2A2SA 4PGTA 2EIQA 2H0IA 4ILFA 2A4VA 3N9JA 4D73B 1GTBA 4V1Ag 4IQ1A 2MYGA 2YPMA 5D8IA 4IQAA 1DBYA 1XW5A 2KLXA 1VGLA 1FHEA 3C1SA 3CBUA 1SKWB 2PWJA 3HJOA 4EDYA 5JWOB 5DAKA 1MDKA 2WJUA 4IJIA 2GZPA 2WGRA 2LKUA 1PRXA 3FEUA 3GTUB 2PVQA 2MMOA 5JWQB 3JCML 2O7KA 3QDNA 4O7HA 1USBA 3R2QA 3WGXA 3C7MA 1Z9HA 2I3YA 4FO5A 4PX1A 1U6TA 3ERWA 3KZQA 4MJCA 4AJ6A 1THXA 4IN0A 4XHMA 1A2JA 1YDKA 4MK3A 2LTKA 1X5EA 5DCHA 3L0HA 2ZUPA 1Z7PA 1DE1A 3QFBC 3M9KA 4AGSA 1EP7A 3GN3A 3EMXA 3Q6OA 3DXBA 5ECMB 2G2QA 2HXKA 1E6BA 1X0RA 4OFMA 2VCQA 4E8EA 1FVKA 5D9TA 1RW1A 4FYCA 1QUWA 1K0CA 2C0DA 5G31A 3F6FA 2FWFA 2TRXA 2OE1A 3HD5A 1AQVA 5EY6A 1FO5A 2JZTA 4XRDA 1GLQA 1YEXA 3FZ5A 2LQOA 4PQ1A 1ZYEA 4GQCA 2LJRA 4EUYA 1KEBA 3LFLA 1V40A 3EYTA 4PNFA 1YEPA 4IP6A 1J08A 5GZZB 1ERUA 2GSTA 4NHZA 2YWMA 3F4TA 5AIXA 3O6TA 2AAWA 4GXZA 5B8AA 3Q19A 1GSQA 2M46A 4HI7A 1U87A 4KSOA 1URMA 1HNCA 5D9XA 1TK5B 3KJYA 2DJ2A 3ZRDA 3DD3A 5ELGA 3FYGA 1G6WA 4ZB8A 2X8GA 2PGTA 3RHCA 4HDEA 1TRSA 2ON5A 4N10A 1JZWA 1JZDA 4J56E 1AXDA 3TJBA 5GSSA 1EP8A 2EC4A 5JCGA 4DSSB 1AQWA 11GSA 2HZEA 4E8HA 2OACA 1O85A 2AV4A 5HR1A 3GX0A 2KOKA 4I97A 3TRQA 2L6DA 2GQKA 1PX7A 1Z5YE 3VI7A 2ALBA 2H0HA 2F8FA 3LEFA 3MNGA 4WF4A 5G1KA 3NIVA 2MMNA 3ERGA 3HXSA 2WDUA 1MTCA 2TIRA 2V32A 2EIOA 2JADA 4ZL8A 16GSA 5IOWA 3EC3A 4IHUA 4TR4A 3GKNA 4RI6A 5CO3A 2C3QA 4DVCA 1PL2A 5IM9A 1V58A 2C80A 1U3AA 2VL2C 2GZZA 3FR6A 3GKKA 1YZXA 3U6VA 4H86A 4TXOB 3TKSA 5D73A 5IIZA 2OKAA 4GSTA 3E3EA 6GSWA 2CVBA 2V6OA 3ISOA 3M3MA 2CA8A 2LV3A 3WT1A 4MF6A 4ZBAA 3FR9A 1FW1A 1GUMA 2AHEA 2XPDA 1V98A 2HZFA 3D6IA 3O3TA 3H4KA 4XIHA 2H8LA 4IS0A 1GNWA 2PVOC 5IOXA 2DIZA 2CAIA 2AYTA 5JCWA 3KH9A 3LQ7A 2O89A 1M7TA 1WRYA 5CRGA 4K6XA 4AF2A 2I9HA 3C1RA 4G2EA 3NZNA 3G7YA 4TRXA 1HQOA 2H71A 3UEMA 1SL2B 4KNDA 4PURA 3KM6A 4LMVA 3ZIJA 4HU9A 4WR4A 5AN1A 5A5KA 4IKHA 2F9SA 4EKZA 3IE3A 1K3LA 3IPZA 1TP9A 2XHFA 5CAXA 4XS4B 5G1LA 2MMZA 4AJ7A 1ZL9A 1GSYA 1FG4A 3QFAC 3CXGA 4GWRA 4ZBDA 2L5OA 2A2RA 1O8XA 1GRXA 3GL5A 5ELAA 2DJ3A 3HHVA 4IBPA 3GURA 4KH7A 4KAEA 1SKRB 1JZRA 2YV9A 1OC9A 2IJYA 4OCEA 2H1DA 2OADA 4K7IA 3LXZA 3ZMLA 3I9V2 4ZXGA 1VF1A 3KTLA 2C1YA 3GA4A 3VPTA 2HE3A 1LU4A 4HUAA 1F3AA 5COHA 1XWGA 4Q5RA 3FY7A 2HYXA 5ECPB 2H19A 1K3OA 2R4VA 3DIEA 1YQ1A 1BYEA 1TRWA 1PKZA 2GSQA 2FUG2 2VOCA 4DEJA 5ECRB 2FLSA 1YF1A 3PR8A 1OE8A 2C0GA 4KX4A 4PNGA 1OAZA
chains in the Genus database with same CATH superfamily
4MPGA 2ES7A 3L78A 5HR3A 4F9ZA 4I6XA 3IC4A 2QSIA 1XOBA 1GTIA 5ECOB 1SU9A 4K0GA 1UA5A 1O8WA 3GYKA 3KEBA 1X9MB 1KBNA 1TU7A 3FRCA 1RQMA 4FQUA 2X99A 4BL7A 1SL0B 4HJMA 1DSBA 3M8NA 3VPQA 1BQ7A 2VCTA 5IMDA 3TUEA 5IPGA 4DSRA 1WMJA 1EWXA 4IJ3A 4ML6A 1OE7A 6GSXA 4Z7XA 1MDJA 2DIYA 1M2AA 1SJ6A 4K8MA 5EPFA 1ZMAA 1AQXA 1VF2A 5EL8A 5J9BA 1B9XC 1TRVA 2HSYA 2N5AA 2IN3A 1GTAA 1Q98A 5ECNB 1A8YA 3ZTLA 3RPNA 1WOUA 5HR0A 4I2UA 2H75A 1TU8A 3OR5A 1Y25A 2NDOA 5ECLB 2J9HA 2PN8A 1A2MA 1V9WA 2OE3A 2LQQA 1TJDA 2PUKC 2X8HA 2M80A 1J0FA 4MF5A 3J7Yk 1OKTA 3E9JB 3D22A 2K9FA 2B5EA 19GSA 4POLA 2H6XA 2M72A 2HRAA 4V1Ap 3WGDA 2G0FA 2GQLA 4GSSA 3UIWA 3VWWA 6GSUA 3LG6A 2B7KA 2O85A 1GNEA 1PA3A 4KCAA 4P3YB 3IV4A 5FWGA 1AW9A 4MP4A 2LS5A 4KDUA 2NTOA 2X8CA 3DYRA 4TR1A 3KXOA 4MJBA 4JE1A 4F0CA 4BIKA 1YKCA 4KDYA 3TJFA 1XWCA 2DJKA 2C0EA 5D9WA 4KCEA 1C72A 5AISA 4HJ2A 2FY6A 4XS6A 1X9SB 5JWRB 1M2DA 2L57A 9GSSA 1W89A 3BD2A 4N0ZA 5J9CA 5ID2B 1UVZA 4YQUA 1CQHA 2K6VA 1EEJA 3GRXA 3QCPA 1NW2A 3DWVA 2KUCA 3CRTA 3UJ1A 3IK7A 2P5QA 1V57A 2AB6A 4EE0A 1K0MA 1R4WA 4WXTA 14GSA 1XVWA 2GZYA 3HKRA 4OWYA 5CNWA 3HVXA 3IOSA 1B4QA 2DMLA 3DVWA 3TKRA 2GS3A 3TDGA 4TR0A 1NHYA 4TW5A 3HZ4A 5GAND 4QQ7A 4QL9A 20GSA 3APQA 2JZRA 2VM1A 3H8QA 2DJ1A 1YF0A 1K0AA 3VK9A 4TVEA 1Y6EA 2DKHA 2L4QA 5H5QA 3EWLA 3FZAA 4JRRA 2GGTA 3A2VA 3MWHA 1GSSA 4XS1A 5HFKA 3ZZXA 6GSTA 3FMWA 2X4AA 4OFNA 4BPYA 2L6CA 2O8VB 1M0UA 2QKEA 4EVMA 3F4RA 3ZIVA 4BL7B 3FHKA 2H66A 2CVDA 1B9YC 2YWOA 4O5UA 1ERWA 2IFQA 5E4WA 4F0BA 2QC7A 3C71A 1Z3EA 3UBKA 5IQYA 3G7JA 3I43A 5DVBA 5IO2A 5DALA 3C8EA 4L5LA 1WP0A 3I69A 4X0XA 5D9VA 4MH3A 1EOGA 3VWXA 3WYWA 3TJKA 3PINA 4WBJA 4NAXA 4ISDA 1TK8B 1OVNA 4EL1A 2R37A 18GSA 3CTFA 2E2GA 4F2IA 2CZ3A 1QMVA 2CT6A 3F63A 2ON7A 3IXRA 1T4YA 5A4UA 2JSZA 5KN1A 3S9FA 1TI3A 3VI5A 4ACSA 4YH2A 1ACVA 2QGVA 3KP8A 4MMMA 4WBRD 10GSA 2HLSA 4JBBA 5G30A 3V1WA 5DQYA 4G9HA 3LGCA 3ZFLA 3APSA 1A2LA 1M3JA 2P0GA 3PPUA 3LYPA 4BVYA 2HRFA 4MNNA 4I2TA 2HSHA 3KTBA 4TOPA 3IDVA 4HQSA 1NSWA 2RM6A 1OC8A 4JU5A 3MYDA 1TK0B 2CZ2A 4MJAA 1I5GA 1OYJA 2FGXA 4MH2A 3W6GA 3VWUA 5G5EA 5F07A 1N8JA 1WPIA 1NHOA 3H1NA 2BTOT 1J9BA 3GX8A 3EE2A 3RHBA 3ZITA 5FT3A 2MMAA 1F3BA 3H93A 3MAKA 4G0LA 5KN2A 4K2XA 1G6YA 1SK0A 2RUEA 2VLUA 3C73A 2FWGA 2CAQA 2K8SA 3MSZA 3D0ZA 1SYRA 3U5RE 2AUVA 4ZL9A 2RIIA 4OMVA 2DC5A 1T1VA 2LJKA 3M1GA 5DAKB 2HI7A 4WF5A 2OBIA 1PL1A 2JU5A 3GMFA 3Q18A 2H0GA 4MF7A 4J2FA 1FB6A 2LRNA 2B1LA 2F51A 3RBTA 3GKMA 1PQNA 2CX4A 3ME8A 4KGIA 3A5IA 1GSDA 2TRCP 5BMUA 3ZREA 3BJ5A 2VL3A 1S3AA 1T7PB 1F9MA 1LJRA 2YANA 2VAFA 4L0WA 2GTUA 3UOMA 4EF0A 1IYIA 2YP6A 8GSSA 3UVTA 4CHSA 1EEMA 3BCKA 2VCZA 1EV4A 3TKQA 2WZ9A 1T8EB 1LBKA 3IK9A 12GSA 3GH6A 5ECKB 3HA9A 4NXIA 2DMMA 3CSJA 4FYUA 5KN0A 2VD1A 5ABRA 1XW9A 4I8BA 3TKSC 4HZ2A 5GSTA 3ZFBA 1A23A 3HJMA 4D73A 5J4UA 4WR5A 3G9BA 4POMA 5IMAA 3QAVA 4GCIA 3L4NA 2YCDA 3IA1A 3M9JA 1QXHA 2IMDA 1XBSA 3FZ4A 5CRWA 3F6DA 3WT2A 1ON4A 1DUGA 5F8BA 2FNOA 2YZUA 4ECJA 1KNGA 2HRNA 1M99A 1UC7A 3GIXA 3RPPA 2IFQB 4ML1A 3GTUA 3Q74A 1F2EA 1SD8A 3R3EA 4HOJA 2QA2A 3ZYWA 3GKXA 2DSAA 3GHAA 3CSHA 1FOHA 4HU7A 3TRXA 5IPHA 1I9DA 1ML6A 1M9AA 3F3QA 1PSQA 1S3RA 2P5RA 4FH8A 1GSFA 3HY2A 1N2AA 5DJLA 3IHQA 4NPBA 2CV4A 2R2JA 2H74A 4O5RA 3HVSA 1SD9A 5AIVA 3GV1A 1HNAA 5DJMA 1PGTA 4N30A 1TTZA 5C00A 2RUFA 4K5RA 3PGTA 5B6MA 3ERFA 2HSMA 1G7OA 5CP1A 2HZEB 3VURA 1BAYA 3L9UA 1UN2A 3UMAA 4MZBA 1TRUA 4YKGA 4KF9A 2JACA 1Z6NA 2JZSA 4ECIA 3TKSE 4Z2UA 5HFIA 4RUVA 5IMFA 1OKDA 3I6AA 3HVNA 3IBHA 1GUHA 2WFCA 1ST9A 3BOAA 1ZCPA 2B5YA 1ZYNA 1XWKA 5KEJA 2N5FA 2VO4A 2XC2A 4L8EA 3IRAA 3UARA 3CTGA 5J41A 2YZHA 5KN3A 4J57E 2HT9A 4I5QA 2I4AA 5BRTA 2GSRA 3M0FA 1U3IA 4F82A 2WB9A 4OO4A 5A4WA 3LYKA 3TKPA 2BJXA 1ZOFA 1XZOA 3W8JA 4BA7A 2H6YA 1V2AA 5B8BA 2H1GA 3KP9A 4EC0A 1GULA 3L9VA 1XVQA 2WS2A 2V6KA 2OBKA 3HYPA 5B7CA 2GDRA 3LW9A 3DVXA 1JZOA 2LJAA 2HRKA 3F0IA 1K0OA 2H30A 2HNLA 3A5WA 4K9ZA 4NHWA 1SJZA 5B6NA 1T00A 2H73A 1XIYA 1R5AA 5H5SA 1GWCA 4EIPA 4IELA 2RM5A 4DSSA 3CSIA 1BG5A 4ZL7A 4N0VA 4ECCA 3ZLPA 1RK4A 4LL1B 1DE2A 1BJXA 4G0IA 2LSTA 1SL1B 3G7IA 4CY8A 1HNBA 4OCFA 4TN8A 4WKWA 2D2ZA 4JR6A 5G2ZA 1XW6A 5ECQB 3KMOA 4USSA 2MBTA 2E2MA 3EVIA 4IVFA 3FK8A 4ECBA 2VIMA 2YWNA 4YAPA 3EU4A 4K7OA 1XWAA 4KSMA 3ZVJD 3J7Yb 1YJ6A 3UVHA 1ILOA 3LWAA 4JZQA 2H70A 2YOIA 1CQGA 2I1UA 3BCIA 1Z6MA 4KB3A 4Q5FA 2DLXA 3AY8A 3F9UA 1H4OA 1M2BA 3E0UA 4NWYA 3FR3A 2KP2A 4V2NA 4WEYA 5FHIA 3KMNA 1K0DA 4TXOA 1OC9B 1SYXA 3EMPA 1WJKA 4LL4B 4KW6A 1S3CA 5LNKe 1T4ZA 3HCZA 1G0TA 2C3TA 1U88A 3HDCA 2YWIA 5F0GA 3KGKA 4YQVA 6GSVA 5HQPA 3HVVA 5DCGA 1WIKA 2IMFA 2H1BA 4ZIJA 4MDCA 3A2XA 2IMIA 3RDWA 2IIYA 1K0BA 4IP1A 4GQFA 3LJRA 2IMKA 3P7XA 3QPMA 3D4MA 1MDIA 4GF0A 4BVXA 4ZILA 4OFTA 4XRAA 1Q4JA 1KTEA 1PFOA 2F3MA 3MDKA 1H75A 2V1MA 1ZYQB 1BEDA 4X1UA 3NOFA 2VCXA 2VCVA 3PH9A 3QAGA 2RLIA 2NBSA 5EVOA 2H72A 3MIXA 4PTSA 4MABA 1GL8A 2PU9C 1FVJA 3WGEA 3O76A 1XPVA 1JLWA 1W4VA 1THOA 3GSSA 2DKIA 5CRHA 3WD6A 1XOAA 3A3TA 3EINA 4XS4A 1M9BA 2IWTA 3FZ9A 1EZKA 2CVKA 5IMZA 4HS1A 3HJPA 1QK8A 1ZGNA 2B6MA 2FCHA 2IL3A 3EURA 3CYNA 3P90A 3KIJA 5CREA 4QL7A 1M3IA 4PQHA 3IAM2 3QAWA 1ERVA 1SK1A 5D96A 2VLTA 5GAPD 2H01A 2YN1A 1GSEA 3TJGA 1O81A 1GSUA 4MCUA 1ABAA 4FYBA 4JR4A 4YKFA 4F03A 3TJJA 2C3NA 3D21A 4GRFA 3SWLA 1MD3A 4N11A 4LLRA 2CX3A 3CRUA 2I81A 2FD3A 1VF4A 3GUSA 1AUCA 1ZZYA 3TGZA 4Z2TA 2REMA 2DBCA 4MA9A 5J3RA 1S3DA 1QQ2A 5F06A 4O32A 2R6KA 3RAZA 1QFNA 2H1AA 1A0RP 1PX6A 2VM2A 2VL2A 5ECIB 1F6MC 1SK2A 2H76A 1AC1A 3P8WA 4WETA 2E0QA 4Q5QA 5LD0A 22GSA 3KD0A 3TB2A 5J5NA 5HR2A 5KOWA 3GH9A 3TOTA 1XWBA 2C4JA 4O92A 2MBSA 3LXTA 2LUSA 4RQRA 1GLPA 4KUNA 2R5GA 2ZCTA 3GNJA 2FHEA 4X4JA 2H6ZA 4TR1B 3DRNA 1PMTA 2HFDA 3DEXA 1GUKA 4PXOA 3TCOA 1EOHA 5C04A 1A24A 1XXUA 4CY6A 3DKSA 5DDLA 2FA8A 2A2PA 1B48A 5IMCA 4TXVA 3QD9A 4POKA 4ZB6A 1O6JA 1IYHA 1TW9A 2GVPA 1YKAA 2YV7A 1OC3A 4GSNA 2WULA 1GTUA 1AIUA 4AJ8A 2R0GA 1TKDB 1Z7RA 2V2GA 4HEA2 4LMWA 3QOUA 4ZBBA 2IPAA 4G19A 4A5PA 2V41A 1B8XA 2BMXA 1XCCA 1SKSB 2OA7A 4IGJA 3K8NA 4NV5A 13GSA 1AAZA 4FIWA 2IMEA 3FKFA 2N5BA 2WRTA 1NM3A 5E59A 4O5QA 3ME7A 2Z9SA 4TKYA 3A2WA 4MJEA 3DMLA 3W8SA 2C8UA 2K18A 4JEDA 4V2LA 3ED3A 4IW9A 4BWSA 3UL3A 1BX9A 2LRCA 5F05A 3LSZA 2FWHA 4G10A 3D5JA 1HYUA 2J23A 4CW9A 2YJ7A 3EU3A 5L71A 2B1KA 4HZ4A 2VUPA 3DGQA 4MZWA 3APOA 2FWEA 7GSSA 2ZNMA 1HD2A 2QA1A 2X64A 3EPTA 3ZMKA 4MZCA 4K7NA 5CRDA 3US3A 2NPBA 4V2MA 4KDXA 4TR3A 4KA0A 4YQMA 5ID2A 1TOFA 1SENA 4ZB9A 2DJJA 1K0NA 4EO3A 1F37A 5DALB 5H5RA 1GH2A 2LNSA 4XTSA 1PD21 3ZL5A 2XBIA 3ZVJA 5ENUA 1TXXA 2B3SA 2L4CA 4HQZA 3QR6A 4ULXA 2KHPA 2E7PA 1EGOA 1PN9A 1EV9A 2DJ0A 2L59A 1R5PA 4RQXA 3VLNA 5LCZA 1R7HA 1SJIA 2KP1A 4KE3A 2PMTA 4K1FA 1QGVA 3TRPA 3UBLA 2XPEA 4EXJA 2LNTA 2R3XA 2OE0A 1XFLA 2MZCA 1O73A 4X43A 4BVYB 3QMXA 2XBQA 4PUAA 2O87A 4K0NA 4MPFA 5IMVA 4Z2RA 3VFIA 1GP1A 1TDIA 2YJHA 2AJQB 3N5OA 1ERTA 1FB0A 2PERA 3GL3A 4YAVA 2LEGA 1JHBA 3KH7A 3UAPA 1FOVA 3SBCA 1JFUA 2VL9A 4POBA 2PBJA 3TOUA 4XCSA 5DBQA 4PQIA 4EDZA 3CMIA 2GT6A 4CDOA 4Q5NA 3LORA 1R26A 2L5LA 5KOXA 3IC8A 4OO5A 3P2AA 1X9WB 1B4PA 1PKWA 5ECHB 5A4VA 17GSA 5ECSA 4NMUA 1A0FA 1EGRA 2JSYA 2PPTA 5IO0A 1T3BA 4K2DA 2GQMA 2CQ9A 2GLRA 2WCIA 2P31A 2YNXA 5DQSA 2LRTA 3H79A 2OJLA 5G5FA 3BBYA 1K3YA 5AGYA 1YY7A 5HFGA 4NV2A 1A8LA 2C0FA 2B5XA 4RI7A 5INYA 4EIQA 5CYYA 1JLVA 3HZ8A 4GLTA 1X5CA 1MEKA 3F3RA 6GSYA 3GSTA 1X5DA 1TI1A 1MD4A 4DSQA 2GSSA 4ID0A 4L5OA 4OD7A 3VWVA 3FW2A 2VLVA 5D93A 1E2YA 4L0UA 4PUFC 1VF3A 2B7JA 6GSSA 3L9SA 2VCWA 5JCUA 1FAAA 3GFKA 1WE0A 4GTUA 4MLYA 1O7UA 3IAS2 3IR4A 3KCMA 3F4SA 1G7EA 4BWQA 2EIRA 3D4TA 3F8UA 4LA1A 2VD0A 2NVLA 2GT5A 1VRSD 2FA4A 2JL4A 2K8VA 2F8AA 1WWJA 2A2SA 4PGTA 2EIQA 2H0IA 4ILFA 2A4VA 3N9JA 4D73B 1GTBA 4V1Ag 4IQ1A 2MYGA 2YPMA 5D8IA 4IQAA 1DBYA 1XW5A 2KLXA 1VGLA 1FHEA 3C1SA 3CBUA 1SKWB 2PWJA 3HJOA 4EDYA 5JWOB 5DAKA 1MDKA 2WJUA 4IJIA 2GZPA 2WGRA 2LKUA 1PRXA 3FEUA 3GTUB 2PVQA 2MMOA 5JWQB 3JCML 2O7KA 3QDNA 4O7HA 1USBA 3R2QA 3WGXA 3C7MA 2R0PA 1Z9HA 2I3YA 1PN0A 1XG8A 4FO5A 4PX1A 1U6TA 2UZ8A 3ERWA 3KZQA 4MJCA 4AJ6A 1THXA 4IN0A 4XHMA 1A2JA 1YDKA 4MK3A 2LTKA 3CQFA 1X5EA 5DCHA 3L0HA 2ZUPA 1Z7PA 1DE1A 1ZYPA 3QFBC 3M9KA 4AGSA 1EP7A 3GN3A 3EMXA 3Q6OA 3DXBA 5ECMB 2G2QA 2HXKA 1E6BA 1X0RA 4OFMA 2VCQA 4E8EA 1FVKA 5D9TA 1RW1A 4FYCA 1QUWA 1K0CA 2C0DA 4ICYA 3F6FA 2FWFA 5G31A 2TRXA 2OE1A 3HD5A 1AQVA 5EY6A 1FO5A 2JZTA 4XRDA 1GLQA 1YEXA 3FZ5A 2LQOA 4PQ1A 1ZYEA 4GQCA 2LJRA 4EUYA 1KEBA 3LFLA 1V40A 3EYTA 4PNFA 2A4HA 1YEPA 4IP6A 1J08A 5GZZB 1ERUA 2GSTA 4NHZA 2YWMA 3F4TA 5AIXA 3O6TA 2AAWA 4GXZA 5B8AA 3IHGA 3Q19A 1GSQA 2M46A 4HI7A 1U87A 4KSOA 1URMA 1HNCA 5D9XA 1TK5B 3KJYA 2DJ2A 3ZRDA 3DD3A 5ELGA 3FYGA 1G6WA 4ZB8A 2X8GA 2PGTA 3RHCA 4HDEA 1TRSA 2ON5A 4N10A 1JZWA 1JZDA 4J56E 1AXDA 3TJBA 5GSSA 1EP8A 2EC4A 5JCGA 4DSSB 1AQWA 11GSA 2HZEA 4E8HA 2OACA 1O85A 2AV4A 5HR1A 3GX0A 2KOKA 4I97A 3TRQA 2L6DA 2GQKA 1PX7A 1Z5YE 3VI7A 2ALBA 2H0HA 2F8FA 3LEFA 3MNGA 4WF4A 5G1KA 3NIVA 2MMNA 3ERGA 3HXSA 2WDUA 1MTCA 2X49A 2TIRA 2V32A 2EIOA 2JADA 4ZL8A 16GSA 5IOWA 3EC3A 4IHUA 4TR4A 3GKNA 4RI6A 5CO3A 2C3QA 4DVCA 1PL2A 5IM9A 1V58A 2C80A 1U3AA 2VL2C 2GZZA 3FR6A 3GKKA 1YZXA 3U6VA 4H86A 4TXOB 3TKSA 5D73A 5IIZA 2OKAA 4GSTA 3E3EA 6GSWA 2CVBA 2V6OA 4HSCX 3ISOA 3M3MA 2CA8A 2LV3A 3WT1A 4MF6A 4ZBAA 3FR9A 1FW1A 1GUMA 2AHEA 2XPDA 1V98A 2HZFA 3D6IA 3O3TA 3H4KA 4XIHA 2H8LA 4IS0A 1GNWA 2PVOC 4K5SA 5IOXA 4G0KA 2DIZA 2CAIA 2AYTA 5JCWA 3KH9A 3LQ7A 2O89A 1M7TA 1WRYA 5CRGA 4K6XA 4AF2A 2I9HA 3C1RA 4BVXB 4G2EA 3NZNA 3G7YA 4TRXA 1HQOA 2H71A 2R0CA 3UEMA 1SL2B 4KNDA 4PURA 3KM6A 4LMVA 3ZIJA 4HU9A 4WR4A 5AN1A 5A5KA 4IKHA 2F9SA 4EKZA 3IE3A 1K3LA 3IPZA 1TP9A 2XHFA 5CAXA 4XS4B 5G1LA 2MMZA 4AJ7A 1ZL9A 1GSYA 1FG4A 3QFAC 3CXGA 4GWRA 4ZBDA 2L5OA 2A2RA 1O8XA 1GRXA 3GL5A 5ELAA 2DJ3A 3HHVA 4IBPA 3GURA 4KH7A 4KAEA 1SKRB 1JZRA 2YV9A 1OC9A 2IJYA 4OCEA 2H1DA 2OADA 4K7IA 3LXZA 3ZMLA 3I9V2 4ZXGA 1VF1A 3KTLA 2C1YA 3GA4A 3VPTA 2HE3A 1LU4A 4HUAA 1F3AA 5COHA 1XWGA 4Q5RA 3FY7A 2HYXA 5ECPB 2H19A 1K3OA 2R4VA 3DIEA 1YQ1A 1BYEA 1TRWA 1PKZA 2GSQA 2FUG2 2VOCA 4DEJA 5ECRB 2FLSA 1YF1A 3PR8A 1OE8A 2C0GA 4KX4A 4PNGA 1OAZA
chains in the Genus database with same CATH topology
4MPGA 2ES7A 3L78A 5HR3A 4F9ZA 4I6XA 3IC4A 2QSIA 1XOBA 1GTIA 5ECOB 1SU9A 4K0GA 1UA5A 1O8WA 3GYKA 3KEBA 1X9MB 1KBNA 1TU7A 3FRCA 1RQMA 4FQUA 2X99A 4BL7A 1SL0B 4HJMA 1DSBA 3M8NA 3VPQA 1BQ7A 2VCTA 5IMDA 3TUEA 5IPGA 4DSRA 1WMJA 1EWXA 4IJ3A 4ML6A 1OE7A 6GSXA 4Z7XA 1MDJA 2DIYA 1M2AA 1SJ6A 4K8MA 5EPFA 1ZMAA 1AQXA 1VF2A 5EL8A 5J9BA 1B9XC 1TRVA 2HSYA 2N5AA 2IN3A 1GTAA 1Q98A 5ECNB 1A8YA 3ZTLA 3RPNA 1WOUA 5HR0A 4I2UA 2H75A 1TU8A 3OR5A 1Y25A 2NDOA 5ECLB 2J9HA 2PN8A 1A2MA 1V9WA 2OE3A 2LQQA 1TJDA 2PUKC 2X8HA 2M80A 1J0FA 4MF5A 3J7Yk 1OKTA 3E9JB 3D22A 2K9FA 2B5EA 19GSA 4POLA 2H6XA 2M72A 2HRAA 4V1Ap 3WGDA 2G0FA 2GQLA 4GSSA 3UIWA 3VWWA 6GSUA 3LG6A 2B7KA 2O85A 1GNEA 1PA3A 4KCAA 4P3YB 3IV4A 5FWGA 1AW9A 4MP4A 2LS5A 4KDUA 2NTOA 2X8CA 3DYRA 4TR1A 3KXOA 4MJBA 4JE1A 4F0CA 1YKCA 4KDYA 3TJFA 1XWCA 2DJKA 2C0EA 5D9WA 4KCEA 1C72A 5AISA 4HJ2A 2FY6A 4XS6A 1X9SB 5JWRB 1M2DA 2L57A 9GSSA 1W89A 3BD2A 4N0ZA 5J9CA 5ID2B 1UVZA 4YQUA 1CQHA 2K6VA 1EEJA 3GRXA 3QCPA 1NW2A 3DWVA 2KUCA 3CRTA 3UJ1A 3IK7A 2P5QA 1V57A 2AB6A 4EE0A 1K0MA 1R4WA 4WXTA 14GSA 1XVWA 2GZYA 3HKRA 4OWYA 5CNWA 3HVXA 3IOSA 1B4QA 2DMLA 3DVWA 3TKRA 2GS3A 3TDGA 4TR0A 1NHYA 4TW5A 3HZ4A 5GAND 4QQ7A 4QL9A 20GSA 3APQA 2JZRA 2VM1A 3H8QA 2DJ1A 1YF0A 1K0AA 3VK9A 4TVEA 1Y6EA 2DKHA 2L4QA 5H5QA 3EWLA 3FZAA 4JRRA 2GGTA 3A2VA 3MWHA 1GSSA 4XS1A 5HFKA 3ZZXA 6GSTA 3FMWA 2X4AA 4OFNA 4BPYA 2L6CA 2O8VB 1M0UA 2QKEA 4EVMA 3F4RA 3ZIVA 4BL7B 3FHKA 2H66A 2CVDA 1B9YC 2YWOA 4O5UA 1ERWA 2IFQA 5E4WA 4F0BA 2QC7A 3C71A 1Z3EA 3UBKA 5IQYA 3G7JA 3I43A 5DVBA 5IO2A 5DALA 3C8EA 4L5LA 1WP0A 3I69A 4X0XA 5D9VA 4MH3A 1EOGA 3VWXA 3WYWA 3TJKA 3PINA 4WBJA 4NAXA 4ISDA 1TK8B 1OVNA 4EL1A 2R37A 18GSA 3CTFA 2E2GA 4F2IA 2CZ3A 1QMVA 2CT6A 3F63A 2ON7A 3IXRA 1T4YA 5A4UA 2JSZA 5KN1A 3S9FA 1TI3A 3VI5A 4ACSA 4YH2A 1ACVA 2QGVA 3KP8A 4MMMA 4WBRD 10GSA 2HLSA 4JBBA 5G30A 3V1WA 5DQYA 4G9HA 3LGCA 3ZFLA 3APSA 1A2LA 2P0GA 3PPUA 3LYPA 4BVYA 2HRFA 4MNNA 4I2TA 2HSHA 3KTBA 4TOPA 3IDVA 4HQSA 1NSWA 2RM6A 1OC8A 4JU5A 3MYDA 1TK0B 2CZ2A 4MJAA 1I5GA 1OYJA 2FGXA 4MH2A 3W6GA 3VWUA 5G5EA 5F07A 1N8JA 1WPIA 1NHOA 3H1NA 2BTOT 1J9BA 3GX8A 3EE2A 3RHBA 3ZITA 5FT3A 2MMAA 1F3BA 3H93A 3MAKA 4G0LA 5KN2A 4K2XA 1G6YA 1SK0A 2RUEA 2VLUA 3C73A 2FWGA 2CAQA 2K8SA 3MSZA 3D0ZA 1SYRA 3U5RE 2AUVA 4ZL9A 2RIIA 4OMVA 2DC5A 1T1VA 2LJKA 3M1GA 5DAKB 2HI7A 4WF5A 2OBIA 1PL1A 2JU5A 3GMFA 3Q18A 2H0GA 4MF7A 4J2FA 1FB6A 2LRNA 2B1LA 2F51A 3RBTA 3GKMA 1PQNA 2CX4A 3ME8A 4KGIA 3A5IA 1GSDA 2TRCP 5BMUA 3ZREA 3BJ5A 2VL3A 1S3AA 1T7PB 1F9MA 1LJRA 2YANA 2VAFA 4L0WA 2GTUA 3UOMA 4EF0A 1IYIA 2YP6A 8GSSA 3UVTA 4CHSA 1EEMA 3BCKA 2VCZA 1EV4A 3TKQA 2WZ9A 1T8EB 1LBKA 3IK9A 12GSA 3GH6A 5ECKB 3HA9A 4NXIA 2DMMA 3CSJA 4FYUA 5KN0A 2VD1A 5ABRA 1XW9A 4I8BA 3TKSC 4HZ2A 5GSTA 3ZFBA 1A23A 3HJMA 4D73A 5J4UA 4WR5A 3G9BA 4POMA 5IMAA 3QAVA 4GCIA 3L4NA 2YCDA 3IA1A 3M9JA 1QXHA 2IMDA 1XBSA 3FZ4A 5CRWA 3F6DA 3WT2A 1ON4A 1DUGA 5F8BA 2FNOA 2YZUA 4ECJA 1KNGA 2HRNA 1M99A 1UC7A 3GIXA 3RPPA 2IFQB 4ML1A 3GTUA 3Q74A 1F2EA 1SD8A 3R3EA 4HOJA 2QA2A 3ZYWA 3GKXA 2DSAA 3GHAA 3CSHA 1FOHA 4HU7A 3TRXA 5IPHA 1I9DA 1ML6A 1M9AA 3F3QA 1PSQA 2P5RA 4FH8A 1GSFA 3HY2A 1N2AA 5DJLA 3IHQA 4NPBA 2CV4A 2R2JA 2H74A 4O5RA 3HVSA 1SD9A 5AIVA 3GV1A 1HNAA 5DJMA 1PGTA 4N30A 1TTZA 5C00A 2RUFA 4K5RA 3PGTA 5B6MA 3ERFA 2HSMA 1G7OA 5CP1A 2HZEB 3VURA 1BAYA 3L9UA 1UN2A 3UMAA 4MZBA 1TRUA 4YKGA 4KF9A 2JACA 1Z6NA 2JZSA 4ECIA 3TKSE 4Z2UA 5HFIA 4RUVA 5IMFA 1OKDA 3I6AA 3IBHA 1GUHA 2WFCA 1ST9A 3BOAA 1ZCPA 2B5YA 1ZYNA 1XWKA 5KEJA 2N5FA 2VO4A 2XC2A 4L8EA 3IRAA 3UARA 3CTGA 5J41A 2YZHA 5KN3A 4J57E 2HT9A 4I5QA 2I4AA 5BRTA 2GSRA 3M0FA 1U3IA 4F82A 2WB9A 4OO4A 5A4WA 3LYKA 3TKPA 2BJXA 1ZOFA 1XZOA 3W8JA 4BA7A 2H6YA 1V2AA 5B8BA 2H1GA 3KP9A 4EC0A 1GULA 3L9VA 1XVQA 2WS2A 2V6KA 2OBKA 3HYPA 5B7CA 2GDRA 3LW9A 3DVXA 1JZOA 2LJAA 2HRKA 3F0IA 1K0OA 2H30A 2HNLA 3A5WA 4K9ZA 4NHWA 1SJZA 5B6NA 1T00A 2H73A 1XIYA 1R5AA 5H5SA 1GWCA 4EIPA 4IELA 2RM5A 4DSSA 3CSIA 1BG5A 4ZL7A 4N0VA 4ECCA 3ZLPA 1RK4A 4LL1B 1DE2A 1BJXA 4G0IA 2LSTA 1SL1B 3G7IA 4CY8A 1HNBA 4OCFA 4TN8A 4WKWA 2D2ZA 4JR6A 5G2ZA 1XW6A 5ECQB 3KMOA 4USSA 2MBTA 2E2MA 3EVIA 4IVFA 3FK8A 4ECBA 2VIMA 2YWNA 4YAPA 3EU4A 4K7OA 1XWAA 4KSMA 3ZVJD 3J7Yb 1YJ6A 3UVHA 1ILOA 3LWAA 4JZQA 2H70A 2YOIA 1CQGA 2I1UA 3BCIA 1Z6MA 4KB3A 4Q5FA 2DLXA 3AY8A 3F9UA 1H4OA 1M2BA 3E0UA 4NWYA 3FR3A 2KP2A 4V2NA 4WEYA 5FHIA 3KMNA 1K0DA 4TXOA 1OC9B 1SYXA 3EMPA 1WJKA 4LL4B 4KW6A 1S3CA 5LNKe 1T4ZA 3HCZA 1G0TA 2C3TA 1U88A 3HDCA 2YWIA 5F0GA 3KGKA 4YQVA 6GSVA 5HQPA 3HVVA 5DCGA 1WIKA 2IMFA 2H1BA 4ZIJA 4MDCA 3A2XA 2IMIA 3RDWA 2IIYA 1K0BA 4IP1A 4GQFA 3LJRA 2IMKA 3P7XA 3QPMA 3D4MA 1MDIA 4GF0A 4BVXA 4ZILA 4OFTA 4XRAA 1Q4JA 1KTEA 2F3MA 3MDKA 1H75A 2V1MA 1ZYQB 1BEDA 4X1UA 3NOFA 2VCXA 2VCVA 3PH9A 3QAGA 2RLIA 2NBSA 5EVOA 2H72A 3MIXA 4PTSA 4MABA 1GL8A 2PU9C 1FVJA 3WGEA 3O76A 1XPVA 1JLWA 1W4VA 1THOA 3GSSA 2DKIA 5CRHA 3WD6A 1XOAA 3A3TA 3EINA 4XS4A 1M9BA 2IWTA 3FZ9A 1EZKA 2CVKA 5IMZA 4HS1A 3HJPA 1QK8A 1ZGNA 2B6MA 2FCHA 2IL3A 3EURA 3CYNA 3P90A 3KIJA 5CREA 4QL7A 4PQHA 3IAM2 3QAWA 1ERVA 1SK1A 5D96A 2VLTA 5GAPD 2H01A 2YN1A 1GSEA 3TJGA 1O81A 1GSUA 4MCUA 1ABAA 4FYBA 4JR4A 4YKFA 4F03A 3TJJA 2C3NA 3D21A 4GRFA 3SWLA 1MD3A 4N11A 4LLRA 2CX3A 3CRUA 2I81A 2FD3A 1VF4A 3GUSA 1AUCA 1ZZYA 3TGZA 4Z2TA 2REMA 2DBCA 4MA9A 5J3RA 1S3DA 1QQ2A 5F06A 4O32A 2R6KA 3RAZA 1QFNA 2H1AA 1A0RP 1PX6A 2VM2A 2VL2A 5ECIB 1F6MC 1SK2A 2H76A 1AC1A 3P8WA 4WETA 2E0QA 4Q5QA 5LD0A 22GSA 3KD0A 3TB2A 5J5NA 5HR2A 5KOWA 3GH9A 3TOTA 1XWBA 2C4JA 4O92A 2MBSA 3LXTA 2LUSA 4RQRA 1GLPA 4KUNA 2R5GA 2ZCTA 3GNJA 2FHEA 4X4JA 2H6ZA 4TR1B 3DRNA 1PMTA 2HFDA 3DEXA 1GUKA 4PXOA 3TCOA 1EOHA 5C04A 1A24A 1XXUA 4CY6A 3DKSA 5DDLA 2FA8A 2A2PA 1B48A 5IMCA 4TXVA 3QD9A 4POKA 4ZB6A 1O6JA 1IYHA 1TW9A 2GVPA 1YKAA 2YV7A 1OC3A 4GSNA 2WULA 1GTUA 1AIUA 4AJ8A 2R0GA 1TKDB 1Z7RA 2V2GA 4HEA2 4LMWA 3QOUA 4ZBBA 2IPAA 4G19A 4A5PA 2V41A 1B8XA 2BMXA 1XCCA 1SKSB 2OA7A 4IGJA 3K8NA 4NV5A 13GSA 1AAZA 4FIWA 2IMEA 3FKFA 2N5BA 2WRTA 1NM3A 5E59A 4O5QA 3ME7A 2Z9SA 4TKYA 3A2WA 4MJEA 3DMLA 3W8SA 2C8UA 2K18A 4JEDA 4V2LA 3ED3A 4IW9A 4BWSA 3UL3A 1BX9A 2LRCA 5F05A 3LSZA 2FWHA 4G10A 3D5JA 1HYUA 2J23A 4CW9A 2YJ7A 3EU3A 5L71A 2B1KA 4HZ4A 2VUPA 3DGQA 4MZWA 3APOA 2FWEA 7GSSA 2ZNMA 1HD2A 2QA1A 2X64A 3EPTA 3ZMKA 4MZCA 4K7NA 5CRDA 3US3A 2NPBA 4V2MA 4KDXA 4TR3A 4KA0A 4YQMA 5ID2A 1TOFA 1SENA 4ZB9A 2DJJA 1K0NA 4EO3A 1F37A 5DALB 5H5RA 1GH2A 2LNSA 4XTSA 1PD21 3ZL5A 2XBIA 3ZVJA 5ENUA 1TXXA 2B3SA 2L4CA 4HQZA 3QR6A 4ULXA 2KHPA 2E7PA 1EGOA 1PN9A 1EV9A 2DJ0A 2L59A 1R5PA 4RQXA 3VLNA 5LCZA 1R7HA 1SJIA 2KP1A 4KE3A 2PMTA 4K1FA 1QGVA 3TRPA 3UBLA 2XPEA 4EXJA 2LNTA 2R3XA 2OE0A 1XFLA 2MZCA 1O73A 4X43A 4BVYB 3QMXA 2XBQA 4PUAA 2O87A 4K0NA 4MPFA 5IMVA 4Z2RA 3VFIA 1GP1A 1TDIA 2YJHA 2AJQB 3N5OA 1ERTA 1FB0A 2PERA 3GL3A 4YAVA 2LEGA 1JHBA 3KH7A 3UAPA 1FOVA 3SBCA 1JFUA 2VL9A 4POBA 2PBJA 3TOUA 4XCSA 5DBQA 4PQIA 4EDZA 3CMIA 2GT6A 4CDOA 4Q5NA 3LORA 1R26A 2L5LA 5KOXA 3IC8A 4OO5A 3P2AA 1X9WB 1B4PA 1PKWA 5ECHB 5A4VA 17GSA 5ECSA 4NMUA 1A0FA 1EGRA 2JSYA 2PPTA 5IO0A 1T3BA 4K2DA 2GQMA 2CQ9A 2GLRA 2WCIA 2P31A 2YNXA 5DQSA 2LRTA 3H79A 2OJLA 5G5FA 3BBYA 1K3YA 5AGYA 1YY7A 5HFGA 4NV2A 1A8LA 2C0FA 2B5XA 4RI7A 5INYA 4EIQA 5CYYA 1JLVA 3HZ8A 4GLTA 1X5CA 1MEKA 3F3RA 6GSYA 3GSTA 1X5DA 1TI1A 1MD4A 4DSQA 2GSSA 4ID0A 4L5OA 4OD7A 3VWVA 3FW2A 2VLVA 5D93A 1E2YA 4L0UA 4PUFC 1VF3A 2B7JA 6GSSA 3L9SA 2VCWA 5JCUA 1FAAA 3GFKA 1WE0A 4GTUA 4MLYA 1O7UA 3IAS2 3IR4A 3KCMA 3F4SA 1G7EA 4BWQA 2EIRA 3D4TA 3F8UA 4LA1A 2VD0A 2NVLA 2GT5A 1VRSD 2FA4A 2JL4A 2K8VA 2F8AA 1WWJA 2A2SA 4PGTA 2EIQA 2H0IA 4ILFA 2A4VA 3N9JA 4D73B 1GTBA 4V1Ag 4IQ1A 2MYGA 2YPMA 5D8IA 4IQAA 1DBYA 1XW5A 2KLXA 1VGLA 1FHEA 3C1SA 3CBUA 1SKWB 2PWJA 3HJOA 4EDYA 5JWOB 5DAKA 1MDKA 2WJUA 4IJIA 2GZPA 2WGRA 2LKUA 1PRXA 3FEUA 3GTUB 2PVQA 2MMOA 5JWQB 3JCML 2O7KA 3QDNA 4O7HA 1USBA 3R2QA 3WGXA 3C7MA 2R0PA 1Z9HA 2I3YA 1PN0A 4FO5A 4PX1A 1U6TA 2UZ8A 3ERWA 3KZQA 4MJCA 4AJ6A 1THXA 4IN0A 4XHMA 1A2JA 1YDKA 4MK3A 2LTKA 1X5EA 5DCHA 3L0HA 2ZUPA 1Z7PA 1DE1A 1ZYPA 3QFBC 3M9KA 4AGSA 1EP7A 3GN3A 3EMXA 3Q6OA 3DXBA 5ECMB 2G2QA 2HXKA 1E6BA 1X0RA 4OFMA 2VCQA 4E8EA 1FVKA 5D9TA 1RW1A 4FYCA 1QUWA 1K0CA 2C0DA 4ICYA 3F6FA 2FWFA 5G31A 2TRXA 2OE1A 3HD5A 1AQVA 5EY6A 1FO5A 2JZTA 4XRDA 1GLQA 1YEXA 3FZ5A 2LQOA 4PQ1A 1ZYEA 4GQCA 2LJRA 4EUYA 1KEBA 3LFLA 1V40A 3EYTA 4PNFA 2A4HA 1YEPA 4IP6A 1J08A 5GZZB 1ERUA 2GSTA 4NHZA 2YWMA 3F4TA 5AIXA 3O6TA 2AAWA 4GXZA 5B8AA 3IHGA 3Q19A 1GSQA 2M46A 4HI7A 1U87A 4KSOA 1URMA 1HNCA 5D9XA 1TK5B 3KJYA 2DJ2A 3ZRDA 3DD3A 5ELGA 3FYGA 1G6WA 4ZB8A 2X8GA 2PGTA 3RHCA 4HDEA 1TRSA 2ON5A 4N10A 1JZWA 1JZDA 4J56E 1AXDA 3TJBA 5GSSA 1EP8A 2EC4A 5JCGA 4DSSB 1AQWA 11GSA 2HZEA 4E8HA 2OACA 1O85A 2AV4A 5HR1A 3GX0A 2KOKA 4I97A 3TRQA 2L6DA 2GQKA 1PX7A 1Z5YE 3VI7A 2ALBA 2H0HA 2F8FA 3LEFA 3MNGA 4WF4A 5G1KA 3NIVA 2MMNA 3ERGA 3HXSA 2WDUA 1MTCA 2X49A 2TIRA 2V32A 2EIOA 2JADA 4ZL8A 16GSA 5IOWA 3EC3A 4IHUA 4TR4A 3GKNA 4RI6A 5CO3A 2C3QA 4DVCA 1PL2A 5IM9A 1V58A 2C80A 1U3AA 2VL2C 2GZZA 3FR6A 3GKKA 1YZXA 3U6VA 4H86A 4TXOB 3TKSA 5D73A 5IIZA 2OKAA 4GSTA 3E3EA 6GSWA 2CVBA 2V6OA 3ISOA 3M3MA 2CA8A 2LV3A 3WT1A 4MF6A 4ZBAA 3FR9A 1FW1A 1GUMA 2AHEA 2XPDA 1V98A 2HZFA 3D6IA 3O3TA 3H4KA 4XIHA 2H8LA 4IS0A 1GNWA 2PVOC 4K5SA 5IOXA 4G0KA 2DIZA 2CAIA 2AYTA 5JCWA 3KH9A 3LQ7A 2O89A 1M7TA 1WRYA 5CRGA 4K6XA 4AF2A 2I9HA 3C1RA 4BVXB 4G2EA 3NZNA 3G7YA 4TRXA 1HQOA 2H71A 2R0CA 3UEMA 1SL2B 4KNDA 4PURA 3KM6A 4LMVA 3ZIJA 4HU9A 4WR4A 5AN1A 5A5KA 4IKHA 2F9SA 4EKZA 3IE3A 1K3LA 3IPZA 1TP9A 2XHFA 5CAXA 4XS4B 5G1LA 2MMZA 4AJ7A 1ZL9A 1GSYA 1FG4A 3QFAC 3CXGA 4GWRA 4ZBDA 2L5OA 2A2RA 1O8XA 1GRXA 3GL5A 5ELAA 2DJ3A 3HHVA 4IBPA 3GURA 4KH7A 4KAEA 1SKRB 1JZRA 2YV9A 1OC9A 2IJYA 4OCEA 2H1DA 2OADA 4K7IA 3LXZA 3ZMLA 3I9V2 4ZXGA 1VF1A 3KTLA 2C1YA 3GA4A 3VPTA 2HE3A 1LU4A 4HUAA 1F3AA 5COHA 1XWGA 4Q5RA 3FY7A 2HYXA 5ECPB 2H19A 1K3OA 2R4VA 3DIEA 1YQ1A 1BYEA 1TRWA 1PKZA 2GSQA 2FUG2 2VOCA 4DEJA 5ECRB 2FLSA 1YF1A 3PR8A 1OE8A 2C0GA 4KX4A 4PNGA 1OAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MPG A;  2ES7 A;  3L78 A;  5HR3 A;  4F9Z A;  4I6X A;  3IC4 A;  2QSI A;  1XOB A;  1GTI A;  5ECO B;  1SU9 A;  4K0G A;  1UA5 A;  1O8W A;  3GYK A;  3KEB A;  1X9M B;  1KBN A;  1TU7 A;  3FRC A;  1RQM A;  2X99 A;  4BL7 A;  1SL0 B;  4HJM A;  1DSB A;  3M8N A;  3VPQ A;  1BQ7 A;  2VCT A;  5IMD A;  3TUE A;  5IPG A;  4DSR A;  1WMJ A;  1EWX A;  4IJ3 A;  4ML6 A;  1OE7 A;  6GSX A;  4Z7X A;  1MDJ A;  2DIY A;  1M2A A;  1SJ6 A;  4K8M A;  5EPF A;  1ZMA A;  1AQX A;  1VF2 A;  5EL8 A;  5J9B A;  1B9X C;  1TRV A;  2HSY A;  2N5A A;  2IN3 A;  1GTA A;  1Q98 A;  5ECN B;  1A8Y A;  3ZTL A;  3RPN A;  1WOU A;  5HR0 A;  4I2U A;  2H75 A;  1TU8 A;  3OR5 A;  1Y25 A;  2NDO A;  5ECL B;  2J9H A;  2PN8 A;  1A2M A;  1V9W A;  2OE3 A;  2LQQ A;  1TJD A;  2PUK C;  2X8H A;  2M80 A;  1J0F A;  4MF5 A;  3J7Y k;  1OKT A;  3E9J B;  3D22 A;  2K9F A;  2B5E A;  19GS A;  4POL A;  2H6X A;  2M72 A;  4V1A p;  3WGD A;  2G0F A;  2GQL A;  4GSS A;  3UIW A;  3VWW A;  6GSU A;  3LG6 A;  2B7K A;  2O85 A;  1GNE A;  1PA3 A;  4KCA A;  4P3Y B;  3IV4 A;  5FWG A;  1AW9 A;  4MP4 A;  2LS5 A;  4KDU A;  2NTO A;  2X8C A;  3DYR A;  4TR1 A;  3KXO A;  4MJB A;  4JE1 A;  4F0C A;  1YKC A;  4KDY A;  3TJF A;  1XWC A;  2DJK A;  2C0E A;  5D9W A;  4KCE A;  1C72 A;  5AIS A;  4HJ2 A;  2FY6 A;  4XS6 A;  1X9S B;  5JWR B;  1M2D A;  2L57 A;  9GSS A;  1W89 A;  3BD2 A;  4N0Z A;  5J9C A;  5ID2 B;  1UVZ A;  4YQU A;  1CQH A;  2K6V A;  1EEJ A;  3GRX A;  3QCP A;  1NW2 A;  3DWV A;  2KUC A;  3CRT A;  3UJ1 A;  3IK7 A;  2P5Q A;  1V57 A;  2AB6 A;  4EE0 A;  1K0M A;  1R4W A;  4WXT A;  14GS A;  1XVW A;  2GZY A;  3HKR A;  4OWY A;  5CNW A;  3HVX A;  3IOS A;  1B4Q A;  2DML A;  3DVW A;  3TKR A;  2GS3 A;  3TDG A;  4TR0 A;  1NHY A;  4TW5 A;  3HZ4 A;  5GAN D;  4QQ7 A;  4QL9 A;  20GS A;  3APQ A;  2JZR A;  2VM1 A;  3H8Q A;  2DJ1 A;  1YF0 A;  1K0A A;  3VK9 A;  4TVE A;  1Y6E A;  2L4Q A;  5H5Q A;  3EWL A;  3FZA A;  4JRR A;  2GGT A;  3A2V A;  3MWH A;  1GSS A;  4XS1 A;  5HFK A;  3ZZX A;  6GST A;  4OFN A;  4BPY A;  2L6C A;  2O8V B;  1M0U A;  2QKE A;  4EVM A;  3F4R A;  3ZIV A;  3FHK A;  2H66 A;  2CVD A;  1B9Y C;  2YWO A;  1ERW A;  2IFQ A;  5E4W A;  4F0B A;  2QC7 A;  3C71 A;  1Z3E A;  3UBK A;  5IQY A;  3G7J A;  3I43 A;  5DVB A;  5IO2 A;  5DAL A;  3C8E A;  4L5L A;  1WP0 A;  3I69 A;  4X0X A;  5D9V A;  4MH3 A;  1EOG A;  3VWX A;  3WYW A;  3TJK A;  3PIN A;  4WBJ A;  4NAX A;  4ISD A;  1TK8 B;  1OVN A;  4EL1 A;  2R37 A;  18GS A;  3CTF A;  2E2G A;  4F2I A;  2CZ3 A;  1QMV A;  2CT6 A;  3F63 A;  2ON7 A;  3IXR A;  1T4Y A;  5A4U A;  2JSZ A;  5KN1 A;  3S9F A;  1TI3 A;  3VI5 A;  4ACS A;  4YH2 A;  1ACV A;  2QGV A;  3KP8 A;  4MMM A;  4WBR D;  10GS A;  2HLS A;  4JBB A;  5G30 A;  3V1W A;  5DQY A;  4G9H A;  3LGC A;  3ZFL A;  3APS A;  1A2L A;  2P0G A;  3LYP A;  4BVY A;  2HRF A;  4I2T A;  2HSH A;  3KTB A;  4TOP A;  3IDV A;  4HQS A;  1NSW A;  2RM6 A;  1OC8 A;  4JU5 A;  1TK0 B;  2CZ2 A;  4MJA A;  1I5G A;  1OYJ A;  2FGX A;  4MH2 A;  3W6G A;  3VWU A;  5G5E A;  5F07 A;  1N8J A;  1WPI A;  1NHO A;  3H1N A;  2BTO T;  1J9B A;  3GX8 A;  3EE2 A;  3RHB A;  3ZIT A;  5FT3 A;  2MMA A;  1F3B A;  3H93 A;  3MAK A;  5KN2 A;  1G6Y A;  1SK0 A;  2RUE A;  2VLU A;  3C73 A;  2FWG A;  2CAQ A;  2K8S A;  3MSZ A;  3D0Z A;  1SYR A;  3U5R E;  2AUV A;  4ZL9 A;  2RII A;  4OMV A;  2DC5 A;  1T1V A;  2LJK A;  3M1G A;  5DAK B;  2HI7 A;  4WF5 A;  2OBI A;  1PL1 A;  2JU5 A;  3GMF A;  3Q18 A;  2H0G A;  4MF7 A;  4J2F A;  1FB6 A;  2LRN A;  2B1L A;  2F51 A;  3RBT A;  3GKM A;  1PQN A;  2CX4 A;  3ME8 A;  4KGI A;  1GSD A;  2TRC P;  3ZRE A;  3BJ5 A;  2VL3 A;  1S3A A;  1T7P B;  1F9M A;  1LJR A;  2YAN A;  2VAF A;  4L0W A;  2GTU A;  3UOM A;  4EF0 A;  1IYI A;  2YP6 A;  8GSS A;  3UVT A;  4CHS A;  1EEM A;  3BCK A;  2VCZ A;  1EV4 A;  3TKQ A;  2WZ9 A;  1T8E B;  1LBK A;  3IK9 A;  12GS A;  3GH6 A;  5ECK B;  3HA9 A;  4NXI A;  2DMM A;  3CSJ A;  4FYU A;  5KN0 A;  2VD1 A;  5ABR A;  1XW9 A;  4I8B A;  3TKS C;  4HZ2 A;  5GST A;  3ZFB A;  1A23 A;  3HJM A;  4D73 A;  5J4U A;  4WR5 A;  3G9B A;  4POM A;  5IMA A;  3QAV A;  4GCI A;  3L4N A;  2YCD A;  3IA1 A;  3M9J A;  1QXH A;  2IMD A;  1XBS A;  3FZ4 A;  5CRW A;  3F6D A;  3WT2 A;  1ON4 A;  1DUG A;  5F8B A;  2FNO A;  2YZU A;  4ECJ A;  1KNG A;  2HRN A;  1M99 A;  1UC7 A;  3GIX A;  3RPP A;  2IFQ B;  4ML1 A;  3GTU A;  3Q74 A;  1F2E A;  1SD8 A;  4HOJ A;  3ZYW A;  3GKX A;  2DSA A;  3GHA A;  3CSH A;  4HU7 A;  3TRX A;  5IPH A;  1I9D A;  1ML6 A;  1M9A A;  3F3Q A;  1PSQ A;  2P5R A;  4FH8 A;  1GSF A;  3HY2 A;  1N2A A;  5DJL A;  3IHQ A;  4NPB A;  2CV4 A;  2R2J A;  2H74 A;  4O5R A;  3HVS A;  1SD9 A;  5AIV A;  3GV1 A;  1HNA A;  5DJM A;  1PGT A;  4N30 A;  1TTZ A;  5C00 A;  2RUF A;  3PGT A;  5B6M A;  3ERF A;  1G7O A;  5CP1 A;  2HZE B;  3VUR A;  1BAY A;  3L9U A;  1UN2 A;  3UMA A;  4MZB A;  1TRU A;  2JAC A;  1Z6N A;  2JZS A;  4ECI A;  3TKS E;  5HFI A;  4RUV A;  5IMF A;  1OKD A;  3I6A A;  3IBH A;  1GUH A;  2WFC A;  1ST9 A;  3BOA A;  1ZCP A;  2B5Y A;  1XWK A;  5KEJ A;  2N5F A;  2VO4 A;  2XC2 A;  4L8E A;  3IRA A;  3UAR A;  3CTG A;  5J41 A;  2YZH A;  5KN3 A;  4J57 E;  2HT9 A;  4I5Q A;  2I4A A;  2GSR A;  3M0F A;  1U3I A;  4F82 A;  2WB9 A;  4OO4 A;  5A4W A;  3LYK A;  3TKP A;  2BJX A;  1ZOF A;  1XZO A;  3W8J A;  4BA7 A;  2H6Y A;  1V2A A;  5B8B A;  2H1G A;  3KP9 A;  4EC0 A;  1GUL A;  3L9V A;  1XVQ A;  2WS2 A;  2V6K A;  2OBK A;  3HYP A;  5B7C A;  2GDR A;  3DVX A;  1JZO A;  2LJA A;  3F0I A;  1K0O A;  2H30 A;  2HNL A;  3A5W A;  4K9Z A;  4NHW A;  1SJZ A;  5B6N A;  1T00 A;  2H73 A;  1XIY A;  1R5A A;  5H5S A;  1GWC A;  4IEL A;  2RM5 A;  4DSS A;  3CSI A;  1BG5 A;  4ZL7 A;  4N0V A;  4ECC A;  3ZLP A;  1RK4 A;  4LL1 B;  1DE2 A;  1BJX A;  2LST A;  1SL1 B;  3G7I A;  1HNB A;  4OCF A;  4TN8 A;  4WKW A;  2D2Z A;  4JR6 A;  5G2Z A;  1XW6 A;  5ECQ B;  3KMO A;  2MBT A;  2E2M A;  3EVI A;  4IVF A;  3FK8 A;  4ECB A;  2VIM A;  2YWN A;  4YAP A;  3EU4 A;  4K7O A;  1XWA A;  4KSM A;  3ZVJ D;  3J7Y b;  1YJ6 A;  3UVH A;  1ILO A;  3LWA A;  4JZQ A;  2H70 A;  2YOI A;  1CQG A;  2I1U A;  3BCI A;  1Z6M A;  4KB3 A;  4Q5F A;  2DLX A;  3AY8 A;  3F9U A;  1H4O A;  1M2B A;  3E0U A;  4NWY A;  3FR3 A;  2KP2 A;  4V2N A;  4WEY A;  5FHI A;  3KMN A;  1K0D A;  4TXO A;  1OC9 B;  1SYX A;  3EMP A;  1WJK A;  4LL4 B;  4KW6 A;  1S3C A;  5LNK e;  1T4Z A;  3HCZ A;  1G0T A;  2C3T A;  1U88 A;  3HDC A;  2YWI A;  5F0G A;  3KGK A;  4YQV A;  6GSV A;  5HQP A;  3HVV A;  5DCG A;  1WIK A;  2IMF A;  2H1B A;  4ZIJ A;  4MDC A;  3A2X A;  2IMI A;  3RDW A;  2IIY A;  1K0B A;  4IP1 A;  4GQF A;  3LJR A;  2IMK A;  3P7X A;  3QPM A;  3D4M A;  1MDI A;  4GF0 A;  4BVX A;  4ZIL A;  4OFT A;  4XRA A;  1Q4J A;  1KTE A;  2F3M A;  3MDK A;  1H75 A;  2V1M A;  1ZYQ B;  1BED A;  4X1U A;  3NOF A;  2VCX A;  2VCV A;  3PH9 A;  3QAG A;  2RLI A;  2NBS A;  5EVO A;  2H72 A;  4MAB A;  1GL8 A;  2PU9 C;  1FVJ A;  3WGE A;  3O76 A;  1XPV A;  1JLW A;  1W4V A;  1THO A;  3GSS A;  5CRH A;  3WD6 A;  1XOA A;  3A3T A;  3EIN A;  4XS4 A;  1M9B A;  2IWT A;  3FZ9 A;  1EZK A;  2CVK A;  5IMZ A;  4HS1 A;  3HJP A;  1QK8 A;  1ZGN A;  2B6M A;  2FCH A;  2IL3 A;  3EUR A;  3CYN A;  3P90 A;  3KIJ A;  5CRE A;  4QL7 A;  4PQH A;  3IAM 2;  3QAW A;  1ERV A;  1SK1 A;  5D96 A;  2VLT A;  5GAP D;  2H01 A;  2YN1 A;  1GSE A;  3TJG A;  1O81 A;  1GSU A;  4MCU A;  1ABA A;  4FYB A;  4JR4 A;  4F03 A;  3TJJ A;  2C3N A;  3D21 A;  4GRF A;  3SWL A;  1MD3 A;  4N11 A;  4LLR A;  2CX3 A;  3CRU A;  2I81 A;  2FD3 A;  1VF4 A;  3GUS A;  1AUC A;  1ZZY A;  3TGZ A;  2REM A;  2DBC A;  4MA9 A;  5J3R A;  1S3D A;  1QQ2 A;  5F06 A;  4O32 A;  2R6K A;  3RAZ A;  1QFN A;  2H1A A;  1A0R P;  1PX6 A;  2VM2 A;  2VL2 A;  5ECI B;  1F6M C;  1SK2 A;  2H76 A;  1AC1 A;  3P8W A;  4WET A;  2E0Q A;  4Q5Q A;  5LD0 A;  22GS A;  3KD0 A;  3TB2 A;  5J5N A;  5HR2 A;  3GH9 A;  3TOT A;  1XWB A;  2C4J A;  4O92 A;  2MBS A;  3LXT A;  2LUS A;  4RQR A;  1GLP A;  4KUN A;  2R5G A;  2ZCT A;  3GNJ A;  2FHE A;  2H6Z A;  4TR1 B;  3DRN A;  1PMT A;  2HFD A;  3DEX A;  1GUK A;  4PXO A;  3TCO A;  1EOH A;  5C04 A;  1A24 A;  1XXU A;  3DKS A;  5DDL A;  2FA8 A;  1B48 A;  5IMC A;  4TXV A;  3QD9 A;  4POK A;  4ZB6 A;  1O6J A;  1IYH A;  1TW9 A;  2GVP A;  1YKA A;  2YV7 A;  1OC3 A;  4GSN A;  2WUL A;  1GTU A;  1AIU A;  4AJ8 A;  1TKD B;  1Z7R A;  2V2G A;  4HEA 2;  4LMW A;  3QOU A;  4ZBB A;  2IPA A;  4G19 A;  2V41 A;  1B8X A;  2BMX A;  1XCC A;  1SKS B;  2OA7 A;  4IGJ A;  3K8N A;  4NV5 A;  13GS A;  1AAZ A;  4FIW A;  2IME A;  3FKF A;  2N5B A;  2WRT A;  1NM3 A;  5E59 A;  3ME7 A;  2Z9S A;  4TKY A;  3A2W A;  4MJE A;  3DML A;  3W8S A;  2C8U A;  2K18 A;  4JED A;  4V2L A;  3ED3 A;  4IW9 A;  4BWS A;  3UL3 A;  1BX9 A;  2LRC A;  5F05 A;  3LSZ A;  2FWH A;  4G10 A;  3D5J A;  1HYU A;  2J23 A;  4CW9 A;  2YJ7 A;  3EU3 A;  5L71 A;  2B1K A;  4HZ4 A;  2VUP A;  3DGQ A;  4MZW A;  3APO A;  2FWE A;  7GSS A;  2ZNM A;  1HD2 A;  2X64 A;  3ZMK A;  4MZC A;  4K7N A;  5CRD A;  3US3 A;  2NPB A;  4V2M A;  4KDX A;  4TR3 A;  4KA0 A;  4YQM A;  5ID2 A;  1TOF A;  1SEN A;  4ZB9 A;  2DJJ A;  1K0N A;  4EO3 A;  1F37 A;  5DAL B;  5H5R A;  1GH2 A;  2LNS A;  4XTS A;  1PD2 1;  3ZL5 A;  2XBI A;  3ZVJ A;  5ENU A;  1TXX A;  2B3S A;  2L4C A;  4HQZ A;  3QR6 A;  4ULX A;  2KHP A;  2E7P A;  1EGO A;  1PN9 A;  1EV9 A;  2DJ0 A;  2L59 A;  1R5P A;  4RQX A;  3VLN A;  5LCZ A;  1R7H A;  1SJI A;  2KP1 A;  4KE3 A;  2PMT A;  4K1F A;  1QGV A;  3TRP A;  3UBL A;  2XPE A;  4EXJ A;  2LNT A;  2R3X A;  2OE0 A;  1XFL A;  2MZC A;  1O73 A;  4X43 A;  3QMX A;  2XBQ A;  4PUA A;  2O87 A;  4K0N A;  4MPF A;  5IMV A;  3VFI A;  1GP1 A;  1TDI A;  2YJH A;  2AJQ B;  3N5O A;  1ERT A;  1FB0 A;  2PER A;  3GL3 A;  4YAV A;  2LEG A;  1JHB A;  3KH7 A;  3UAP A;  1FOV A;  3SBC A;  1JFU A;  2VL9 A;  4POB A;  2PBJ A;  3TOU A;  5DBQ A;  4XCS A;  4PQI A;  4EDZ A;  3CMI A;  2GT6 A;  4CDO A;  4Q5N A;  3LOR A;  1R26 A;  2L5L A;  4OO5 A;  3P2A A;  1X9W B;  1B4P A;  1PKW A;  5ECH B;  5A4V A;  17GS A;  5ECS A;  4NMU A;  1A0F A;  1EGR A;  2JSY A;  2PPT A;  5IO0 A;  1T3B A;  4K2D A;  2GQM A;  2CQ9 A;  2GLR A;  2WCI A;  2P31 A;  2YNX A;  5DQS A;  2LRT A;  3H79 A;  2OJL A;  5G5F A;  3BBY A;  1K3Y A;  5AGY A;  1YY7 A;  5HFG A;  4NV2 A;  1A8L A;  2C0F A;  2B5X A;  4RI7 A;  5INY A;  5CYY A;  1JLV A;  3HZ8 A;  4GLT A;  1X5C A;  1MEK A;  3F3R A;  6GSY A;  3GST A;  1X5D A;  1TI1 A;  1MD4 A;  4DSQ A;  2GSS A;  4ID0 A;  4L5O A;  4OD7 A;  3VWV A;  3FW2 A;  2VLV A;  5D93 A;  1E2Y A;  4L0U A;  4PUF C;  1VF3 A;  2B7J A;  6GSS A;  3L9S A;  2VCW A;  5JCU A;  1FAA A;  3GFK A;  1WE0 A;  4GTU A;  4MLY A;  1O7U A;  3IAS 2;  3IR4 A;  3KCM A;  3F4S A;  1G7E A;  4BWQ A;  2EIR A;  3D4T A;  3F8U A;  4LA1 A;  2VD0 A;  2NVL A;  2GT5 A;  1VRS D;  2FA4 A;  2JL4 A;  2K8V A;  2F8A A;  1WWJ A;  2A2S A;  4PGT A;  2EIQ A;  2H0I A;  4ILF A;  2A4V A;  3N9J A;  4D73 B;  1GTB A;  4V1A g;  4IQ1 A;  2MYG A;  2YPM A;  5D8I A;  4IQA A;  1DBY A;  1XW5 A;  2KLX A;  1VGL A;  1FHE A;  3C1S A;  3CBU A;  1SKW B;  2PWJ A;  3HJO A;  4EDY A;  5JWO B;  5DAK A;  1MDK A;  2WJU A;  4IJI A;  2GZP A;  2WGR A;  2LKU A;  1PRX A;  3FEU A;  3GTU B;  2PVQ A;  2MMO A;  5JWQ B;  3JCM L;  2O7K A;  3QDN A;  4O7H A;  1USB A;  3R2Q A;  3WGX A;  3C7M A;  1Z9H A;  2I3Y A;  4FO5 A;  4PX1 A;  1U6T A;  3ERW A;  3KZQ A;  4MJC A;  4AJ6 A;  1THX A;  4IN0 A;  4XHM A;  1A2J A;  1YDK A;  4MK3 A;  2LTK A;  1X5E A;  5DCH A;  3L0H A;  2ZUP A;  1Z7P A;  1DE1 A;  3QFB C;  3M9K A;  4AGS A;  1EP7 A;  3GN3 A;  3EMX A;  3Q6O A;  3DXB A;  5ECM B;  2G2Q A;  2HXK A;  1E6B A;  1X0R A;  4OFM A;  2VCQ A;  4E8E A;  1FVK A;  5D9T A;  1RW1 A;  4FYC A;  1QUW A;  1K0C A;  2C0D A;  5G31 A;  3F6F A;  2FWF A;  2TRX A;  2OE1 A;  3HD5 A;  1AQV A;  5EY6 A;  1FO5 A;  2JZT A;  4XRD A;  1GLQ A;  1YEX A;  3FZ5 A;  2LQO A;  4PQ1 A;  1ZYE A;  4GQC A;  2LJR A;  4EUY A;  1KEB A;  3LFL A;  1V40 A;  3EYT A;  4PNF A;  1YEP A;  4IP6 A;  1J08 A;  5GZZ B;  1ERU A;  2GST A;  4NHZ A;  2YWM A;  3F4T A;  5AIX A;  3O6T A;  2AAW A;  4GXZ A;  5B8A A;  3Q19 A;  1GSQ A;  2M46 A;  4HI7 A;  1U87 A;  4KSO A;  1URM A;  1HNC A;  5D9X A;  1TK5 B;  3KJY A;  2DJ2 A;  3ZRD A;  3DD3 A;  5ELG A;  3FYG A;  1G6W A;  4ZB8 A;  2X8G A;  2PGT A;  3RHC A;  4HDE A;  1TRS A;  2ON5 A;  4N10 A;  1JZW A;  1JZD A;  4J56 E;  1AXD A;  3TJB A;  5GSS A;  1EP8 A;  2EC4 A;  5JCG A;  4DSS B;  1AQW A;  11GS A;  2HZE A;  4E8H A;  2OAC A;  1O85 A;  2AV4 A;  5HR1 A;  3GX0 A;  2KOK A;  4I97 A;  3TRQ A;  2L6D A;  2GQK A;  1PX7 A;  1Z5Y E;  3VI7 A;  2ALB A;  2H0H A;  2F8F A;  3LEF A;  3MNG A;  4WF4 A;  5G1K A;  3NIV A;  2MMN A;  3ERG A;  3HXS A;  2WDU A;  1MTC A;  2TIR A;  2V32 A;  2EIO A;  2JAD A;  4ZL8 A;  16GS A;  5IOW A;  3EC3 A;  4IHU A;  4TR4 A;  3GKN A;  4RI6 A;  5CO3 A;  2C3Q A;  4DVC A;  1PL2 A;  5IM9 A;  1V58 A;  2C80 A;  1U3A A;  2VL2 C;  2GZZ A;  3FR6 A;  3GKK A;  1YZX A;  3U6V A;  4H86 A;  4TXO B;  3TKS A;  5D73 A;  5IIZ A;  2OKA A;  4GST A;  3E3E A;  6GSW A;  2CVB A;  2V6O A;  3ISO A;  3M3M A;  2CA8 A;  2LV3 A;  3WT1 A;  4MF6 A;  4ZBA A;  3FR9 A;  1FW1 A;  1GUM A;  2AHE A;  2XPD A;  1V98 A;  2HZF A;  3D6I A;  3O3T A;  3H4K A;  4XIH A;  2H8L A;  4IS0 A;  1GNW A;  2PVO C;  5IOX A;  2DIZ A;  2CAI A;  2AYT A;  5JCW A;  3KH9 A;  3LQ7 A;  2O89 A;  1M7T A;  1WRY A;  5CRG A;  4K6X A;  4AF2 A;  2I9H A;  3C1R A;  4G2E A;  3NZN A;  3G7Y A;  4TRX A;  1HQO A;  2H71 A;  3UEM A;  1SL2 B;  4KND A;  4PUR A;  3KM6 A;  4LMV A;  3ZIJ A;  4HU9 A;  4WR4 A;  5AN1 A;  5A5K A;  4IKH A;  2F9S A;  4EKZ A;  3IE3 A;  1K3L A;  3IPZ A;  1TP9 A;  2XHF A;  5CAX A;  4XS4 B;  5G1L A;  2MMZ A;  4AJ7 A;  1ZL9 A;  1GSY A;  1FG4 A;  3QFA C;  3CXG A;  4GWR A;  4ZBD A;  2L5O A;  2A2R A;  1O8X A;  1GRX A;  3GL5 A;  5ELA A;  2DJ3 A;  3HHV A;  4IBP A;  3GUR A;  4KH7 A;  4KAE A;  1SKR B;  1JZR A;  2YV9 A;  1OC9 A;  2IJY A;  4OCE A;  2H1D A;  2OAD A;  4K7I A;  3LXZ A;  3ZML A;  3I9V 2;  4ZXG A;  1VF1 A;  3KTL A;  2C1Y A;  3GA4 A;  3VPT A;  2HE3 A;  1LU4 A;  4HUA A;  1F3A A;  5COH A;  1XWG A;  4Q5R A;  3FY7 A;  2HYX A;  5ECP B;  2H19 A;  1K3O A;  2R4V A;  3DIE A;  1YQ1 A;  1BYE A;  1TRW A;  1PKZ A;  2GSQ A;  2FUG 2;  2VOC A;  4DEJ A;  5ECR B;  2FLS A;  1YF1 A;  3PR8 A;  1OE8 A;  2C0G A;  4KX4 A;  4PNG A;  1OAZ A; 
#chains in the Genus database with same CATH topology
 4MPG A;  2ES7 A;  3L78 A;  5HR3 A;  4F9Z A;  4I6X A;  3IC4 A;  2QSI A;  1XOB A;  1GTI A;  5ECO B;  1SU9 A;  4K0G A;  1UA5 A;  1O8W A;  3GYK A;  3KEB A;  1X9M B;  1KBN A;  1TU7 A;  3FRC A;  1RQM A;  4FQU A;  2X99 A;  4BL7 A;  1SL0 B;  4HJM A;  1DSB A;  3M8N A;  3VPQ A;  1BQ7 A;  2VCT A;  5IMD A;  3TUE A;  5IPG A;  4DSR A;  1WMJ A;  1EWX A;  4IJ3 A;  4ML6 A;  1OE7 A;  6GSX A;  4Z7X A;  1MDJ A;  2DIY A;  1M2A A;  1SJ6 A;  4K8M A;  5EPF A;  1ZMA A;  1AQX A;  1VF2 A;  5EL8 A;  5J9B A;  1B9X C;  1TRV A;  2HSY A;  2N5A A;  2IN3 A;  1GTA A;  1Q98 A;  5ECN B;  1A8Y A;  3ZTL A;  3RPN A;  1WOU A;  5HR0 A;  4I2U A;  2H75 A;  1TU8 A;  3OR5 A;  1Y25 A;  2NDO A;  5ECL B;  2J9H A;  2PN8 A;  1A2M A;  1V9W A;  2OE3 A;  2LQQ A;  1TJD A;  2PUK C;  2X8H A;  2M80 A;  1J0F A;  4MF5 A;  3J7Y k;  1OKT A;  3E9J B;  3D22 A;  2K9F A;  2B5E A;  19GS A;  4POL A;  2H6X A;  2M72 A;  2HRA A;  4V1A p;  3WGD A;  2G0F A;  2GQL A;  4GSS A;  3UIW A;  3VWW A;  6GSU A;  3LG6 A;  2B7K A;  2O85 A;  1GNE A;  1PA3 A;  4KCA A;  4P3Y B;  3IV4 A;  5FWG A;  1AW9 A;  4MP4 A;  2LS5 A;  4KDU A;  2NTO A;  2X8C A;  3DYR A;  4TR1 A;  3KXO A;  4MJB A;  4JE1 A;  4F0C A;  4BIK A;  1YKC A;  4KDY A;  3TJF A;  1XWC A;  2DJK A;  2C0E A;  5D9W A;  4KCE A;  1C72 A;  5AIS A;  4HJ2 A;  2FY6 A;  4XS6 A;  1X9S B;  5JWR B;  1M2D A;  2L57 A;  9GSS A;  1W89 A;  3BD2 A;  4N0Z A;  5J9C A;  5ID2 B;  1UVZ A;  4YQU A;  1CQH A;  2K6V A;  1EEJ A;  3GRX A;  3QCP A;  1NW2 A;  3DWV A;  2KUC A;  3CRT A;  3UJ1 A;  3IK7 A;  2P5Q A;  1V57 A;  2AB6 A;  4EE0 A;  1K0M A;  1R4W A;  4WXT A;  14GS A;  1XVW A;  2GZY A;  3HKR A;  4OWY A;  5CNW A;  3HVX A;  3IOS A;  1B4Q A;  2DML A;  3DVW A;  3TKR A;  2GS3 A;  3TDG A;  4TR0 A;  1NHY A;  4TW5 A;  3HZ4 A;  5GAN D;  4QQ7 A;  4QL9 A;  20GS A;  3APQ A;  2JZR A;  2VM1 A;  3H8Q A;  2DJ1 A;  1YF0 A;  1K0A A;  3VK9 A;  4TVE A;  1Y6E A;  2DKH A;  2L4Q A;  5H5Q A;  3EWL A;  3FZA A;  4JRR A;  2GGT A;  3A2V A;  3MWH A;  1GSS A;  4XS1 A;  5HFK A;  3ZZX A;  6GST A;  3FMW A;  2X4A A;  4OFN A;  4BPY A;  2L6C A;  2O8V B;  1M0U A;  2QKE A;  4EVM A;  3F4R A;  3ZIV A;  4BL7 B;  3FHK A;  2H66 A;  2CVD A;  1B9Y C;  2YWO A;  4O5U A;  1ERW A;  2IFQ A;  5E4W A;  4F0B A;  2QC7 A;  3C71 A;  1Z3E A;  3UBK A;  5IQY A;  3G7J A;  3I43 A;  5DVB A;  5IO2 A;  5DAL A;  3C8E A;  4L5L A;  1WP0 A;  3I69 A;  4X0X A;  5D9V A;  4MH3 A;  1EOG A;  3VWX A;  3WYW A;  3TJK A;  3PIN A;  4WBJ A;  4NAX A;  4ISD A;  1TK8 B;  1OVN A;  4EL1 A;  2R37 A;  18GS A;  3CTF A;  2E2G A;  4F2I A;  2CZ3 A;  1QMV A;  2CT6 A;  3F63 A;  2ON7 A;  3IXR A;  1T4Y A;  5A4U A;  2JSZ A;  5KN1 A;  3S9F A;  1TI3 A;  3VI5 A;  4ACS A;  4YH2 A;  1ACV A;  2QGV A;  3KP8 A;  4MMM A;  4WBR D;  10GS A;  2HLS A;  4JBB A;  5G30 A;  3V1W A;  5DQY A;  4G9H A;  3LGC A;  3ZFL A;  3APS A;  1A2L A;  1M3J A;  2P0G A;  3PPU A;  3LYP A;  4BVY A;  2HRF A;  4MNN A;  4I2T A;  2HSH A;  3KTB A;  4TOP A;  3IDV A;  4HQS A;  1NSW A;  2RM6 A;  1OC8 A;  4JU5 A;  3MYD A;  1TK0 B;  2CZ2 A;  4MJA A;  1I5G A;  1OYJ A;  2FGX A;  4MH2 A;  3W6G A;  3VWU A;  5G5E A;  5F07 A;  1N8J A;  1WPI A;  1NHO A;  3H1N A;  2BTO T;  1J9B A;  3GX8 A;  3EE2 A;  3RHB A;  3ZIT A;  5FT3 A;  2MMA A;  1F3B A;  3H93 A;  3MAK A;  4G0L A;  5KN2 A;  4K2X A;  1G6Y A;  1SK0 A;  2RUE A;  2VLU A;  3C73 A;  2FWG A;  2CAQ A;  2K8S A;  3MSZ A;  3D0Z A;  1SYR A;  3U5R E;  2AUV A;  4ZL9 A;  2RII A;  4OMV A;  2DC5 A;  1T1V A;  2LJK A;  3M1G A;  5DAK B;  2HI7 A;  4WF5 A;  2OBI A;  1PL1 A;  2JU5 A;  3GMF A;  3Q18 A;  2H0G A;  4MF7 A;  4J2F A;  1FB6 A;  2LRN A;  2B1L A;  2F51 A;  3RBT A;  3GKM A;  1PQN A;  2CX4 A;  3ME8 A;  4KGI A;  3A5I A;  1GSD A;  2TRC P;  5BMU A;  3ZRE A;  3BJ5 A;  2VL3 A;  1S3A A;  1T7P B;  1F9M A;  1LJR A;  2YAN A;  2VAF A;  4L0W A;  2GTU A;  3UOM A;  4EF0 A;  1IYI A;  2YP6 A;  8GSS A;  3UVT A;  4CHS A;  1EEM A;  3BCK A;  2VCZ A;  1EV4 A;  3TKQ A;  2WZ9 A;  1T8E B;  1LBK A;  3IK9 A;  12GS A;  3GH6 A;  5ECK B;  3HA9 A;  4NXI A;  2DMM A;  3CSJ A;  4FYU A;  5KN0 A;  2VD1 A;  5ABR A;  1XW9 A;  4I8B A;  3TKS C;  4HZ2 A;  5GST A;  3ZFB A;  1A23 A;  3HJM A;  4D73 A;  5J4U A;  4WR5 A;  3G9B A;  4POM A;  5IMA A;  3QAV A;  4GCI A;  3L4N A;  2YCD A;  3IA1 A;  3M9J A;  1QXH A;  2IMD A;  1XBS A;  3FZ4 A;  5CRW A;  3F6D A;  3WT2 A;  1ON4 A;  1DUG A;  5F8B A;  2FNO A;  2YZU A;  4ECJ A;  1KNG A;  2HRN A;  1M99 A;  1UC7 A;  3GIX A;  3RPP A;  2IFQ B;  4ML1 A;  3GTU A;  3Q74 A;  1F2E A;  1SD8 A;  3R3E A;  4HOJ A;  2QA2 A;  3ZYW A;  3GKX A;  2DSA A;  3GHA A;  3CSH A;  1FOH A;  4HU7 A;  3TRX A;  5IPH A;  1I9D A;  1ML6 A;  1M9A A;  3F3Q A;  1PSQ A;  1S3R A;  2P5R A;  4FH8 A;  1GSF A;  3HY2 A;  1N2A A;  5DJL A;  3IHQ A;  4NPB A;  2CV4 A;  2R2J A;  2H74 A;  4O5R A;  3HVS A;  1SD9 A;  5AIV A;  3GV1 A;  1HNA A;  5DJM A;  1PGT A;  4N30 A;  1TTZ A;  5C00 A;  2RUF A;  4K5R A;  3PGT A;  5B6M A;  3ERF A;  2HSM A;  1G7O A;  5CP1 A;  2HZE B;  3VUR A;  1BAY A;  3L9U A;  1UN2 A;  3UMA A;  4MZB A;  1TRU A;  4YKG A;  4KF9 A;  2JAC A;  1Z6N A;  2JZS A;  4ECI A;  3TKS E;  4Z2U A;  5HFI A;  4RUV A;  5IMF A;  1OKD A;  3I6A A;  3HVN A;  3IBH A;  1GUH A;  2WFC A;  1ST9 A;  3BOA A;  1ZCP A;  2B5Y A;  1ZYN A;  1XWK A;  5KEJ A;  2N5F A;  2VO4 A;  2XC2 A;  4L8E A;  3IRA A;  3UAR A;  3CTG A;  5J41 A;  2YZH A;  5KN3 A;  4J57 E;  2HT9 A;  4I5Q A;  2I4A A;  5BRT A;  2GSR A;  3M0F A;  1U3I A;  4F82 A;  2WB9 A;  4OO4 A;  5A4W A;  3LYK A;  3TKP A;  2BJX A;  1ZOF A;  1XZO A;  3W8J A;  4BA7 A;  2H6Y A;  1V2A A;  5B8B A;  2H1G A;  3KP9 A;  4EC0 A;  1GUL A;  3L9V A;  1XVQ A;  2WS2 A;  2V6K A;  2OBK A;  3HYP A;  5B7C A;  2GDR A;  3LW9 A;  3DVX A;  1JZO A;  2LJA A;  2HRK A;  3F0I A;  1K0O A;  2H30 A;  2HNL A;  3A5W A;  4K9Z A;  4NHW A;  1SJZ A;  5B6N A;  1T00 A;  2H73 A;  1XIY A;  1R5A A;  5H5S A;  1GWC A;  4EIP A;  4IEL A;  2RM5 A;  4DSS A;  3CSI A;  1BG5 A;  4ZL7 A;  4N0V A;  4ECC A;  3ZLP A;  1RK4 A;  4LL1 B;  1DE2 A;  1BJX A;  4G0I A;  2LST A;  1SL1 B;  3G7I A;  4CY8 A;  1HNB A;  4OCF A;  4TN8 A;  4WKW A;  2D2Z A;  4JR6 A;  5G2Z A;  1XW6 A;  5ECQ B;  3KMO A;  4USS A;  2MBT A;  2E2M A;  3EVI A;  4IVF A;  3FK8 A;  4ECB A;  2VIM A;  2YWN A;  4YAP A;  3EU4 A;  4K7O A;  1XWA A;  4KSM A;  3ZVJ D;  3J7Y b;  1YJ6 A;  3UVH A;  1ILO A;  3LWA A;  4JZQ A;  2H70 A;  2YOI A;  1CQG A;  2I1U A;  3BCI A;  1Z6M A;  4KB3 A;  4Q5F A;  2DLX A;  3AY8 A;  3F9U A;  1H4O A;  1M2B A;  3E0U A;  4NWY A;  3FR3 A;  2KP2 A;  4V2N A;  4WEY A;  5FHI A;  3KMN A;  1K0D A;  4TXO A;  1OC9 B;  1SYX A;  3EMP A;  1WJK A;  4LL4 B;  4KW6 A;  1S3C A;  5LNK e;  1T4Z A;  3HCZ A;  1G0T A;  2C3T A;  1U88 A;  3HDC A;  2YWI A;  5F0G A;  3KGK A;  4YQV A;  6GSV A;  5HQP A;  3HVV A;  5DCG A;  1WIK A;  2IMF A;  2H1B A;  4ZIJ A;  4MDC A;  3A2X A;  2IMI A;  3RDW A;  2IIY A;  1K0B A;  4IP1 A;  4GQF A;  3LJR A;  2IMK A;  3P7X A;  3QPM A;  3D4M A;  1MDI A;  4GF0 A;  4BVX A;  4ZIL A;  4OFT A;  4XRA A;  1Q4J A;  1KTE A;  1PFO A;  2F3M A;  3MDK A;  1H75 A;  2V1M A;  1ZYQ B;  1BED A;  4X1U A;  3NOF A;  2VCX A;  2VCV A;  3PH9 A;  3QAG A;  2RLI A;  2NBS A;  5EVO A;  2H72 A;  3MIX A;  4PTS A;  4MAB A;  1GL8 A;  2PU9 C;  1FVJ A;  3WGE A;  3O76 A;  1XPV A;  1JLW A;  1W4V A;  1THO A;  3GSS A;  2DKI A;  5CRH A;  3WD6 A;  1XOA A;  3A3T A;  3EIN A;  4XS4 A;  1M9B A;  2IWT A;  3FZ9 A;  1EZK A;  2CVK A;  5IMZ A;  4HS1 A;  3HJP A;  1QK8 A;  1ZGN A;  2B6M A;  2FCH A;  2IL3 A;  3EUR A;  3CYN A;  3P90 A;  3KIJ A;  5CRE A;  4QL7 A;  1M3I A;  4PQH A;  3IAM 2;  3QAW A;  1ERV A;  1SK1 A;  5D96 A;  2VLT A;  5GAP D;  2H01 A;  2YN1 A;  1GSE A;  3TJG A;  1O81 A;  1GSU A;  4MCU A;  1ABA A;  4FYB A;  4JR4 A;  4YKF A;  4F03 A;  3TJJ A;  2C3N A;  3D21 A;  4GRF A;  3SWL A;  1MD3 A;  4N11 A;  4LLR A;  2CX3 A;  3CRU A;  2I81 A;  2FD3 A;  1VF4 A;  3GUS A;  1AUC A;  1ZZY A;  3TGZ A;  4Z2T A;  2REM A;  2DBC A;  4MA9 A;  5J3R A;  1S3D A;  1QQ2 A;  5F06 A;  4O32 A;  2R6K A;  3RAZ A;  1QFN A;  2H1A A;  1A0R P;  1PX6 A;  2VM2 A;  2VL2 A;  5ECI B;  1F6M C;  1SK2 A;  2H76 A;  1AC1 A;  3P8W A;  4WET A;  2E0Q A;  4Q5Q A;  5LD0 A;  22GS A;  3KD0 A;  3TB2 A;  5J5N A;  5HR2 A;  5KOW A;  3GH9 A;  3TOT A;  1XWB A;  2C4J A;  4O92 A;  2MBS A;  3LXT A;  2LUS A;  4RQR A;  1GLP A;  4KUN A;  2R5G A;  2ZCT A;  3GNJ A;  2FHE A;  4X4J A;  2H6Z A;  4TR1 B;  3DRN A;  1PMT A;  2HFD A;  3DEX A;  1GUK A;  4PXO A;  3TCO A;  1EOH A;  5C04 A;  1A24 A;  1XXU A;  4CY6 A;  3DKS A;  5DDL A;  2FA8 A;  2A2P A;  1B48 A;  5IMC A;  4TXV A;  3QD9 A;  4POK A;  4ZB6 A;  1O6J A;  1IYH A;  1TW9 A;  2GVP A;  1YKA A;  2YV7 A;  1OC3 A;  4GSN A;  2WUL A;  1GTU A;  1AIU A;  4AJ8 A;  2R0G A;  1TKD B;  1Z7R A;  2V2G A;  4HEA 2;  4LMW A;  3QOU A;  4ZBB A;  2IPA A;  4G19 A;  4A5P A;  2V41 A;  1B8X A;  2BMX A;  1XCC A;  1SKS B;  2OA7 A;  4IGJ A;  3K8N A;  4NV5 A;  13GS A;  1AAZ A;  4FIW A;  2IME A;  3FKF A;  2N5B A;  2WRT A;  1NM3 A;  5E59 A;  4O5Q A;  3ME7 A;  2Z9S A;  4TKY A;  3A2W A;  4MJE A;  3DML A;  3W8S A;  2C8U A;  2K18 A;  4JED A;  4V2L A;  3ED3 A;  4IW9 A;  4BWS A;  3UL3 A;  1BX9 A;  2LRC A;  5F05 A;  3LSZ A;  2FWH A;  4G10 A;  3D5J A;  1HYU A;  2J23 A;  4CW9 A;  2YJ7 A;  3EU3 A;  5L71 A;  2B1K A;  4HZ4 A;  2VUP A;  3DGQ A;  4MZW A;  3APO A;  2FWE A;  7GSS A;  2ZNM A;  1HD2 A;  2QA1 A;  2X64 A;  3EPT A;  3ZMK A;  4MZC A;  4K7N A;  5CRD A;  3US3 A;  2NPB A;  4V2M A;  4KDX A;  4TR3 A;  4KA0 A;  4YQM A;  5ID2 A;  1TOF A;  1SEN A;  4ZB9 A;  2DJJ A;  1K0N A;  4EO3 A;  1F37 A;  5DAL B;  5H5R A;  1GH2 A;  2LNS A;  4XTS A;  1PD2 1;  3ZL5 A;  2XBI A;  3ZVJ A;  5ENU A;  1TXX A;  2B3S A;  2L4C A;  4HQZ A;  3QR6 A;  4ULX A;  2KHP A;  2E7P A;  1EGO A;  1PN9 A;  1EV9 A;  2DJ0 A;  2L59 A;  1R5P A;  4RQX A;  3VLN A;  5LCZ A;  1R7H A;  1SJI A;  2KP1 A;  4KE3 A;  2PMT A;  4K1F A;  1QGV A;  3TRP A;  3UBL A;  2XPE A;  4EXJ A;  2LNT A;  2R3X A;  2OE0 A;  1XFL A;  2MZC A;  1O73 A;  4X43 A;  4BVY B;  3QMX A;  2XBQ A;  4PUA A;  2O87 A;  4K0N A;  4MPF A;  5IMV A;  4Z2R A;  3VFI A;  1GP1 A;  1TDI A;  2YJH A;  2AJQ B;  3N5O A;  1ERT A;  1FB0 A;  2PER A;  3GL3 A;  4YAV A;  2LEG A;  1JHB A;  3KH7 A;  3UAP A;  1FOV A;  3SBC A;  1JFU A;  2VL9 A;  4POB A;  2PBJ A;  3TOU A;  4XCS A;  5DBQ A;  4PQI A;  4EDZ A;  3CMI A;  2GT6 A;  4CDO A;  4Q5N A;  3LOR A;  1R26 A;  2L5L A;  5KOX A;  3IC8 A;  4OO5 A;  3P2A A;  1X9W B;  1B4P A;  1PKW A;  5ECH B;  5A4V A;  17GS A;  5ECS A;  4NMU A;  1A0F A;  1EGR A;  2JSY A;  2PPT A;  5IO0 A;  1T3B A;  4K2D A;  2GQM A;  2CQ9 A;  2GLR A;  2WCI A;  2P31 A;  2YNX A;  5DQS A;  2LRT A;  3H79 A;  2OJL A;  5G5F A;  3BBY A;  1K3Y A;  5AGY A;  1YY7 A;  5HFG A;  4NV2 A;  1A8L A;  2C0F A;  2B5X A;  4RI7 A;  5INY A;  4EIQ A;  5CYY A;  1JLV A;  3HZ8 A;  4GLT A;  1X5C A;  1MEK A;  3F3R A;  6GSY A;  3GST A;  1X5D A;  1TI1 A;  1MD4 A;  4DSQ A;  2GSS A;  4ID0 A;  4L5O A;  4OD7 A;  3VWV A;  3FW2 A;  2VLV A;  5D93 A;  1E2Y A;  4L0U A;  4PUF C;  1VF3 A;  2B7J A;  6GSS A;  3L9S A;  2VCW A;  5JCU A;  1FAA A;  3GFK A;  1WE0 A;  4GTU A;  4MLY A;  1O7U A;  3IAS 2;  3IR4 A;  3KCM A;  3F4S A;  1G7E A;  4BWQ A;  2EIR A;  3D4T A;  3F8U A;  4LA1 A;  2VD0 A;  2NVL A;  2GT5 A;  1VRS D;  2FA4 A;  2JL4 A;  2K8V A;  2F8A A;  1WWJ A;  2A2S A;  4PGT A;  2EIQ A;  2H0I A;  4ILF A;  2A4V A;  3N9J A;  4D73 B;  1GTB A;  4V1A g;  4IQ1 A;  2MYG A;  2YPM A;  5D8I A;  4IQA A;  1DBY A;  1XW5 A;  2KLX A;  1VGL A;  1FHE A;  3C1S A;  3CBU A;  1SKW B;  2PWJ A;  3HJO A;  4EDY A;  5JWO B;  5DAK A;  1MDK A;  2WJU A;  4IJI A;  2GZP A;  2WGR A;  2LKU A;  1PRX A;  3FEU A;  3GTU B;  2PVQ A;  2MMO A;  5JWQ B;  3JCM L;  2O7K A;  3QDN A;  4O7H A;  1USB A;  3R2Q A;  3WGX A;  3C7M A;  2R0P A;  1Z9H A;  2I3Y A;  1PN0 A;  1XG8 A;  4FO5 A;  4PX1 A;  1U6T A;  2UZ8 A;  3ERW A;  3KZQ A;  4MJC A;  4AJ6 A;  1THX A;  4IN0 A;  4XHM A;  1A2J A;  1YDK A;  4MK3 A;  2LTK A;  3CQF A;  1X5E A;  5DCH A;  3L0H A;  2ZUP A;  1Z7P A;  1DE1 A;  1ZYP A;  3QFB C;  3M9K A;  4AGS A;  1EP7 A;  3GN3 A;  3EMX A;  3Q6O A;  3DXB A;  5ECM B;  2G2Q A;  2HXK A;  1E6B A;  1X0R A;  4OFM A;  2VCQ A;  4E8E A;  1FVK A;  5D9T A;  1RW1 A;  4FYC A;  1QUW A;  1K0C A;  2C0D A;  4ICY A;  3F6F A;  2FWF A;  5G31 A;  2TRX A;  2OE1 A;  3HD5 A;  1AQV A;  5EY6 A;  1FO5 A;  2JZT A;  4XRD A;  1GLQ A;  1YEX A;  3FZ5 A;  2LQO A;  4PQ1 A;  1ZYE A;  4GQC A;  2LJR A;  4EUY A;  1KEB A;  3LFL A;  1V40 A;  3EYT A;  4PNF A;  2A4H A;  1YEP A;  4IP6 A;  1J08 A;  5GZZ B;  1ERU A;  2GST A;  4NHZ A;  2YWM A;  3F4T A;  5AIX A;  3O6T A;  2AAW A;  4GXZ A;  5B8A A;  3IHG A;  3Q19 A;  1GSQ A;  2M46 A;  4HI7 A;  1U87 A;  4KSO A;  1URM A;  1HNC A;  5D9X A;  1TK5 B;  3KJY A;  2DJ2 A;  3ZRD A;  3DD3 A;  5ELG A;  3FYG A;  1G6W A;  4ZB8 A;  2X8G A;  2PGT A;  3RHC A;  4HDE A;  1TRS A;  2ON5 A;  4N10 A;  1JZW A;  1JZD A;  4J56 E;  1AXD A;  3TJB A;  5GSS A;  1EP8 A;  2EC4 A;  5JCG A;  4DSS B;  1AQW A;  11GS A;  2HZE A;  4E8H A;  2OAC A;  1O85 A;  2AV4 A;  5HR1 A;  3GX0 A;  2KOK A;  4I97 A;  3TRQ A;  2L6D A;  2GQK A;  1PX7 A;  1Z5Y E;  3VI7 A;  2ALB A;  2H0H A;  2F8F A;  3LEF A;  3MNG A;  4WF4 A;  5G1K A;  3NIV A;  2MMN A;  3ERG A;  3HXS A;  2WDU A;  1MTC A;  2X49 A;  2TIR A;  2V32 A;  2EIO A;  2JAD A;  4ZL8 A;  16GS A;  5IOW A;  3EC3 A;  4IHU A;  4TR4 A;  3GKN A;  4RI6 A;  5CO3 A;  2C3Q A;  4DVC A;  1PL2 A;  5IM9 A;  1V58 A;  2C80 A;  1U3A A;  2VL2 C;  2GZZ A;  3FR6 A;  3GKK A;  1YZX A;  3U6V A;  4H86 A;  4TXO B;  3TKS A;  5D73 A;  5IIZ A;  2OKA A;  4GST A;  3E3E A;  6GSW A;  2CVB A;  2V6O A;  4HSC X;  3ISO A;  3M3M A;  2CA8 A;  2LV3 A;  3WT1 A;  4MF6 A;  4ZBA A;  3FR9 A;  1FW1 A;  1GUM A;  2AHE A;  2XPD A;  1V98 A;  2HZF A;  3D6I A;  3O3T A;  3H4K A;  4XIH A;  2H8L A;  4IS0 A;  1GNW A;  2PVO C;  4K5S A;  5IOX A;  4G0K A;  2DIZ A;  2CAI A;  2AYT A;  5JCW A;  3KH9 A;  3LQ7 A;  2O89 A;  1M7T A;  1WRY A;  5CRG A;  4K6X A;  4AF2 A;  2I9H A;  3C1R A;  4BVX B;  4G2E A;  3NZN A;  3G7Y A;  4TRX A;  1HQO A;  2H71 A;  2R0C A;  3UEM A;  1SL2 B;  4KND A;  4PUR A;  3KM6 A;  4LMV A;  3ZIJ A;  4HU9 A;  4WR4 A;  5AN1 A;  5A5K A;  4IKH A;  2F9S A;  4EKZ A;  3IE3 A;  1K3L A;  3IPZ A;  1TP9 A;  2XHF A;  5CAX A;  4XS4 B;  5G1L A;  2MMZ A;  4AJ7 A;  1ZL9 A;  1GSY A;  1FG4 A;  3QFA C;  3CXG A;  4GWR A;  4ZBD A;  2L5O A;  2A2R A;  1O8X A;  1GRX A;  3GL5 A;  5ELA A;  2DJ3 A;  3HHV A;  4IBP A;  3GUR A;  4KH7 A;  4KAE A;  1SKR B;  1JZR A;  2YV9 A;  1OC9 A;  2IJY A;  4OCE A;  2H1D A;  2OAD A;  4K7I A;  3LXZ A;  3ZML A;  3I9V 2;  4ZXG A;  1VF1 A;  3KTL A;  2C1Y A;  3GA4 A;  3VPT A;  2HE3 A;  1LU4 A;  4HUA A;  1F3A A;  5COH A;  1XWG A;  4Q5R A;  3FY7 A;  2HYX A;  5ECP B;  2H19 A;  1K3O A;  2R4V A;  3DIE A;  1YQ1 A;  1BYE A;  1TRW A;  1PKZ A;  2GSQ A;  2FUG 2;  2VOC A;  4DEJ A;  5ECR B;  2FLS A;  1YF1 A;  3PR8 A;  1OE8 A;  2C0G A;  4KX4 A;  4PNG A;  1OAZ A; 
#chains in the Genus database with same CATH homology
 4MPG A;  2ES7 A;  3L78 A;  5HR3 A;  4F9Z A;  4I6X A;  3IC4 A;  2QSI A;  1XOB A;  1GTI A;  5ECO B;  1SU9 A;  4K0G A;  1UA5 A;  1O8W A;  3GYK A;  3KEB A;  1X9M B;  1KBN A;  1TU7 A;  3FRC A;  1RQM A;  4FQU A;  2X99 A;  4BL7 A;  1SL0 B;  4HJM A;  1DSB A;  3M8N A;  3VPQ A;  1BQ7 A;  2VCT A;  5IMD A;  3TUE A;  5IPG A;  4DSR A;  1WMJ A;  1EWX A;  4IJ3 A;  4ML6 A;  1OE7 A;  6GSX A;  4Z7X A;  1MDJ A;  2DIY A;  1M2A A;  1SJ6 A;  4K8M A;  5EPF A;  1ZMA A;  1AQX A;  1VF2 A;  5EL8 A;  5J9B A;  1B9X C;  1TRV A;  2HSY A;  2N5A A;  2IN3 A;  1GTA A;  1Q98 A;  5ECN B;  1A8Y A;  3ZTL A;  3RPN A;  1WOU A;  5HR0 A;  4I2U A;  2H75 A;  1TU8 A;  3OR5 A;  1Y25 A;  2NDO A;  5ECL B;  2J9H A;  2PN8 A;  1A2M A;  1V9W A;  2OE3 A;  2LQQ A;  1TJD A;  2PUK C;  2X8H A;  2M80 A;  1J0F A;  4MF5 A;  3J7Y k;  1OKT A;  3E9J B;  3D22 A;  2K9F A;  2B5E A;  19GS A;  4POL A;  2H6X A;  2M72 A;  2HRA A;  4V1A p;  3WGD A;  2G0F A;  2GQL A;  4GSS A;  3UIW A;  3VWW A;  6GSU A;  3LG6 A;  2B7K A;  2O85 A;  1GNE A;  1PA3 A;  4KCA A;  4P3Y B;  3IV4 A;  5FWG A;  1AW9 A;  4MP4 A;  2LS5 A;  4KDU A;  2NTO A;  2X8C A;  3DYR A;  4TR1 A;  3KXO A;  4MJB A;  4JE1 A;  4F0C A;  1YKC A;  4KDY A;  3TJF A;  1XWC A;  2DJK A;  2C0E A;  5D9W A;  4KCE A;  1C72 A;  5AIS A;  4HJ2 A;  2FY6 A;  4XS6 A;  1X9S B;  5JWR B;  1M2D A;  2L57 A;  9GSS A;  1W89 A;  3BD2 A;  4N0Z A;  5J9C A;  5ID2 B;  1UVZ A;  4YQU A;  1CQH A;  2K6V A;  1EEJ A;  3GRX A;  3QCP A;  1NW2 A;  3DWV A;  2KUC A;  3CRT A;  3UJ1 A;  3IK7 A;  2P5Q A;  1V57 A;  2AB6 A;  4EE0 A;  1K0M A;  1R4W A;  4WXT A;  14GS A;  1XVW A;  2GZY A;  3HKR A;  4OWY A;  5CNW A;  3HVX A;  3IOS A;  1B4Q A;  2DML A;  3DVW A;  3TKR A;  2GS3 A;  3TDG A;  4TR0 A;  1NHY A;  4TW5 A;  3HZ4 A;  5GAN D;  4QQ7 A;  4QL9 A;  20GS A;  3APQ A;  2JZR A;  2VM1 A;  3H8Q A;  2DJ1 A;  1YF0 A;  1K0A A;  3VK9 A;  4TVE A;  1Y6E A;  2DKH A;  2L4Q A;  5H5Q A;  3EWL A;  3FZA A;  4JRR A;  2GGT A;  3A2V A;  3MWH A;  1GSS A;  4XS1 A;  5HFK A;  3ZZX A;  6GST A;  3FMW A;  2X4A A;  4OFN A;  4BPY A;  2L6C A;  2O8V B;  1M0U A;  2QKE A;  4EVM A;  3F4R A;  3ZIV A;  4BL7 B;  3FHK A;  2H66 A;  2CVD A;  1B9Y C;  2YWO A;  4O5U A;  1ERW A;  2IFQ A;  5E4W A;  4F0B A;  2QC7 A;  3C71 A;  1Z3E A;  3UBK A;  5IQY A;  3G7J A;  3I43 A;  5DVB A;  5IO2 A;  5DAL A;  3C8E A;  4L5L A;  1WP0 A;  3I69 A;  4X0X A;  5D9V A;  4MH3 A;  1EOG A;  3VWX A;  3WYW A;  3TJK A;  3PIN A;  4WBJ A;  4NAX A;  4ISD A;  1TK8 B;  1OVN A;  4EL1 A;  2R37 A;  18GS A;  3CTF A;  2E2G A;  4F2I A;  2CZ3 A;  1QMV A;  2CT6 A;  3F63 A;  2ON7 A;  3IXR A;  1T4Y A;  5A4U A;  2JSZ A;  5KN1 A;  3S9F A;  1TI3 A;  3VI5 A;  4ACS A;  4YH2 A;  1ACV A;  2QGV A;  3KP8 A;  4MMM A;  4WBR D;  10GS A;  2HLS A;  4JBB A;  5G30 A;  3V1W A;  5DQY A;  4G9H A;  3LGC A;  3ZFL A;  3APS A;  1A2L A;  2P0G A;  3PPU A;  3LYP A;  4BVY A;  2HRF A;  4MNN A;  4I2T A;  2HSH A;  3KTB A;  4TOP A;  3IDV A;  4HQS A;  1NSW A;  2RM6 A;  1OC8 A;  4JU5 A;  3MYD A;  1TK0 B;  2CZ2 A;  4MJA A;  1I5G A;  1OYJ A;  2FGX A;  4MH2 A;  3W6G A;  3VWU A;  5G5E A;  5F07 A;  1N8J A;  1WPI A;  1NHO A;  3H1N A;  2BTO T;  1J9B A;  3GX8 A;  3EE2 A;  3RHB A;  3ZIT A;  5FT3 A;  2MMA A;  1F3B A;  3H93 A;  3MAK A;  4G0L A;  5KN2 A;  4K2X A;  1G6Y A;  1SK0 A;  2RUE A;  2VLU A;  3C73 A;  2FWG A;  2CAQ A;  2K8S A;  3MSZ A;  3D0Z A;  1SYR A;  3U5R E;  2AUV A;  4ZL9 A;  2RII A;  4OMV A;  2DC5 A;  1T1V A;  2LJK A;  3M1G A;  5DAK B;  2HI7 A;  4WF5 A;  2OBI A;  1PL1 A;  2JU5 A;  3GMF A;  3Q18 A;  2H0G A;  4MF7 A;  4J2F A;  1FB6 A;  2LRN A;  2B1L A;  2F51 A;  3RBT A;  3GKM A;  1PQN A;  2CX4 A;  3ME8 A;  4KGI A;  3A5I A;  1GSD A;  2TRC P;  5BMU A;  3ZRE A;  3BJ5 A;  2VL3 A;  1S3A A;  1T7P B;  1F9M A;  1LJR A;  2YAN A;  2VAF A;  4L0W A;  2GTU A;  3UOM A;  4EF0 A;  1IYI A;  2YP6 A;  8GSS A;  3UVT A;  4CHS A;  1EEM A;  3BCK A;  2VCZ A;  1EV4 A;  3TKQ A;  2WZ9 A;  1T8E B;  1LBK A;  3IK9 A;  12GS A;  3GH6 A;  5ECK B;  3HA9 A;  4NXI A;  2DMM A;  3CSJ A;  4FYU A;  5KN0 A;  2VD1 A;  5ABR A;  1XW9 A;  4I8B A;  3TKS C;  4HZ2 A;  5GST A;  3ZFB A;  1A23 A;  3HJM A;  4D73 A;  5J4U A;  4WR5 A;  3G9B A;  4POM A;  5IMA A;  3QAV A;  4GCI A;  3L4N A;  2YCD A;  3IA1 A;  3M9J A;  1QXH A;  2IMD A;  1XBS A;  3FZ4 A;  5CRW A;  3F6D A;  3WT2 A;  1ON4 A;  1DUG A;  5F8B A;  2FNO A;  2YZU A;  4ECJ A;  1KNG A;  2HRN A;  1M99 A;  1UC7 A;  3GIX A;  3RPP A;  2IFQ B;  4ML1 A;  3GTU A;  3Q74 A;  1F2E A;  1SD8 A;  3R3E A;  4HOJ A;  2QA2 A;  3ZYW A;  3GKX A;  2DSA A;  3GHA A;  3CSH A;  1FOH A;  4HU7 A;  3TRX A;  5IPH A;  1I9D A;  1ML6 A;  1M9A A;  3F3Q A;  1PSQ A;  2P5R A;  4FH8 A;  1GSF A;  3HY2 A;  1N2A A;  5DJL A;  3IHQ A;  4NPB A;  2CV4 A;  2R2J A;  2H74 A;  4O5R A;  3HVS A;  1SD9 A;  5AIV A;  3GV1 A;  1HNA A;  5DJM A;  1PGT A;  4N30 A;  1TTZ A;  5C00 A;  2RUF A;  4K5R A;  3PGT A;  5B6M A;  3ERF A;  2HSM A;  1G7O A;  5CP1 A;  2HZE B;  3VUR A;  1BAY A;  3L9U A;  1UN2 A;  3UMA A;  4MZB A;  1TRU A;  4YKG A;  4KF9 A;  2JAC A;  1Z6N A;  2JZS A;  4ECI A;  3TKS E;  4Z2U A;  5HFI A;  4RUV A;  5IMF A;  1OKD A;  3I6A A;  3IBH A;  1GUH A;  2WFC A;  1ST9 A;  3BOA A;  1ZCP A;  2B5Y A;  1ZYN A;  1XWK A;  5KEJ A;  2N5F A;  2VO4 A;  2XC2 A;  4L8E A;  3IRA A;  3UAR A;  3CTG A;  5J41 A;  2YZH A;  5KN3 A;  4J57 E;  2HT9 A;  4I5Q A;  2I4A A;  5BRT A;  2GSR A;  3M0F A;  1U3I A;  4F82 A;  2WB9 A;  4OO4 A;  5A4W A;  3LYK A;  3TKP A;  2BJX A;  1ZOF A;  1XZO A;  3W8J A;  4BA7 A;  2H6Y A;  1V2A A;  5B8B A;  2H1G A;  3KP9 A;  4EC0 A;  1GUL A;  3L9V A;  1XVQ A;  2WS2 A;  2V6K A;  2OBK A;  3HYP A;  5B7C A;  2GDR A;  3LW9 A;  3DVX A;  1JZO A;  2LJA A;  2HRK A;  3F0I A;  1K0O A;  2H30 A;  2HNL A;  3A5W A;  4K9Z A;  4NHW A;  1SJZ A;  5B6N A;  1T00 A;  2H73 A;  1XIY A;  1R5A A;  5H5S A;  1GWC A;  4EIP A;  4IEL A;  2RM5 A;  4DSS A;  3CSI A;  1BG5 A;  4ZL7 A;  4N0V A;  4ECC A;  3ZLP A;  1RK4 A;  4LL1 B;  1DE2 A;  1BJX A;  4G0I A;  2LST A;  1SL1 B;  3G7I A;  4CY8 A;  1HNB A;  4OCF A;  4TN8 A;  4WKW A;  2D2Z A;  4JR6 A;  5G2Z A;  1XW6 A;  5ECQ B;  3KMO A;  4USS A;  2MBT A;  2E2M A;  3EVI A;  4IVF A;  3FK8 A;  4ECB A;  2VIM A;  2YWN A;  4YAP A;  3EU4 A;  4K7O A;  1XWA A;  4KSM A;  3ZVJ D;  3J7Y b;  1YJ6 A;  3UVH A;  1ILO A;  3LWA A;  4JZQ A;  2H70 A;  2YOI A;  1CQG A;  2I1U A;  3BCI A;  1Z6M A;  4KB3 A;  4Q5F A;  2DLX A;  3AY8 A;  3F9U A;  1H4O A;  1M2B A;  3E0U A;  4NWY A;  3FR3 A;  2KP2 A;  4V2N A;  4WEY A;  5FHI A;  3KMN A;  1K0D A;  4TXO A;  1OC9 B;  1SYX A;  3EMP A;  1WJK A;  4LL4 B;  4KW6 A;  1S3C A;  5LNK e;  1T4Z A;  3HCZ A;  1G0T A;  2C3T A;  1U88 A;  3HDC A;  2YWI A;  5F0G A;  3KGK A;  4YQV A;  6GSV A;  5HQP A;  3HVV A;  5DCG A;  1WIK A;  2IMF A;  2H1B A;  4ZIJ A;  4MDC A;  3A2X A;  2IMI A;  3RDW A;  2IIY A;  1K0B A;  4IP1 A;  4GQF A;  3LJR A;  2IMK A;  3P7X A;  3QPM A;  3D4M A;  1MDI A;  4GF0 A;  4BVX A;  4ZIL A;  4OFT A;  4XRA A;  1Q4J A;  1KTE A;  2F3M A;  3MDK A;  1H75 A;  2V1M A;  1ZYQ B;  1BED A;  4X1U A;  3NOF A;  2VCX A;  2VCV A;  3PH9 A;  3QAG A;  2RLI A;  2NBS A;  5EVO A;  2H72 A;  3MIX A;  4PTS A;  4MAB A;  1GL8 A;  2PU9 C;  1FVJ A;  3WGE A;  3O76 A;  1XPV A;  1JLW A;  1W4V A;  1THO A;  3GSS A;  2DKI A;  5CRH A;  3WD6 A;  1XOA A;  3A3T A;  3EIN A;  4XS4 A;  1M9B A;  2IWT A;  3FZ9 A;  1EZK A;  2CVK A;  5IMZ A;  4HS1 A;  3HJP A;  1QK8 A;  1ZGN A;  2B6M A;  2FCH A;  2IL3 A;  3EUR A;  3CYN A;  3P90 A;  3KIJ A;  5CRE A;  4QL7 A;  4PQH A;  3IAM 2;  3QAW A;  1ERV A;  1SK1 A;  5D96 A;  2VLT A;  5GAP D;  2H01 A;  2YN1 A;  1GSE A;  3TJG A;  1O81 A;  1GSU A;  4MCU A;  1ABA A;  4FYB A;  4JR4 A;  4YKF A;  4F03 A;  3TJJ A;  2C3N A;  3D21 A;  4GRF A;  3SWL A;  1MD3 A;  4N11 A;  4LLR A;  2CX3 A;  3CRU A;  2I81 A;  2FD3 A;  1VF4 A;  3GUS A;  1AUC A;  1ZZY A;  3TGZ A;  4Z2T A;  2REM A;  2DBC A;  4MA9 A;  5J3R A;  1S3D A;  1QQ2 A;  5F06 A;  4O32 A;  2R6K A;  3RAZ A;  1QFN A;  2H1A A;  1A0R P;  1PX6 A;  2VM2 A;  2VL2 A;  5ECI B;  1F6M C;  1SK2 A;  2H76 A;  1AC1 A;  3P8W A;  4WET A;  2E0Q A;  4Q5Q A;  5LD0 A;  22GS A;  3KD0 A;  3TB2 A;  5J5N A;  5HR2 A;  5KOW A;  3GH9 A;  3TOT A;  1XWB A;  2C4J A;  4O92 A;  2MBS A;  3LXT A;  2LUS A;  4RQR A;  1GLP A;  4KUN A;  2R5G A;  2ZCT A;  3GNJ A;  2FHE A;  4X4J A;  2H6Z A;  4TR1 B;  3DRN A;  1PMT A;  2HFD A;  3DEX A;  1GUK A;  4PXO A;  3TCO A;  1EOH A;  5C04 A;  1A24 A;  1XXU A;  4CY6 A;  3DKS A;  5DDL A;  2FA8 A;  2A2P A;  1B48 A;  5IMC A;  4TXV A;  3QD9 A;  4POK A;  4ZB6 A;  1O6J A;  1IYH A;  1TW9 A;  2GVP A;  1YKA A;  2YV7 A;  1OC3 A;  4GSN A;  2WUL A;  1GTU A;  1AIU A;  4AJ8 A;  2R0G A;  1TKD B;  1Z7R A;  2V2G A;  4HEA 2;  4LMW A;  3QOU A;  4ZBB A;  2IPA A;  4G19 A;  4A5P A;  2V41 A;  1B8X A;  2BMX A;  1XCC A;  1SKS B;  2OA7 A;  4IGJ A;  3K8N A;  4NV5 A;  13GS A;  1AAZ A;  4FIW A;  2IME A;  3FKF A;  2N5B A;  2WRT A;  1NM3 A;  5E59 A;  4O5Q A;  3ME7 A;  2Z9S A;  4TKY A;  3A2W A;  4MJE A;  3DML A;  3W8S A;  2C8U A;  2K18 A;  4JED A;  4V2L A;  3ED3 A;  4IW9 A;  4BWS A;  3UL3 A;  1BX9 A;  2LRC A;  5F05 A;  3LSZ A;  2FWH A;  4G10 A;  3D5J A;  1HYU A;  2J23 A;  4CW9 A;  2YJ7 A;  3EU3 A;  5L71 A;  2B1K A;  4HZ4 A;  2VUP A;  3DGQ A;  4MZW A;  3APO A;  2FWE A;  7GSS A;  2ZNM A;  1HD2 A;  2QA1 A;  2X64 A;  3EPT A;  3ZMK A;  4MZC A;  4K7N A;  5CRD A;  3US3 A;  2NPB A;  4V2M A;  4KDX A;  4TR3 A;  4KA0 A;  4YQM A;  5ID2 A;  1TOF A;  1SEN A;  4ZB9 A;  2DJJ A;  1K0N A;  4EO3 A;  1F37 A;  5DAL B;  5H5R A;  1GH2 A;  2LNS A;  4XTS A;  1PD2 1;  3ZL5 A;  2XBI A;  3ZVJ A;  5ENU A;  1TXX A;  2B3S A;  2L4C A;  4HQZ A;  3QR6 A;  4ULX A;  2KHP A;  2E7P A;  1EGO A;  1PN9 A;  1EV9 A;  2DJ0 A;  2L59 A;  1R5P A;  4RQX A;  3VLN A;  5LCZ A;  1R7H A;  1SJI A;  2KP1 A;  4KE3 A;  2PMT A;  4K1F A;  1QGV A;  3TRP A;  3UBL A;  2XPE A;  4EXJ A;  2LNT A;  2R3X A;  2OE0 A;  1XFL A;  2MZC A;  1O73 A;  4X43 A;  4BVY B;  3QMX A;  2XBQ A;  4PUA A;  2O87 A;  4K0N A;  4MPF A;  5IMV A;  4Z2R A;  3VFI A;  1GP1 A;  1TDI A;  2YJH A;  2AJQ B;  3N5O A;  1ERT A;  1FB0 A;  2PER A;  3GL3 A;  4YAV A;  2LEG A;  1JHB A;  3KH7 A;  3UAP A;  1FOV A;  3SBC A;  1JFU A;  2VL9 A;  4POB A;  2PBJ A;  3TOU A;  4XCS A;  5DBQ A;  4PQI A;  4EDZ A;  3CMI A;  2GT6 A;  4CDO A;  4Q5N A;  3LOR A;  1R26 A;  2L5L A;  5KOX A;  3IC8 A;  4OO5 A;  3P2A A;  1X9W B;  1B4P A;  1PKW A;  5ECH B;  5A4V A;  17GS A;  5ECS A;  4NMU A;  1A0F A;  1EGR A;  2JSY A;  2PPT A;  5IO0 A;  1T3B A;  4K2D A;  2GQM A;  2CQ9 A;  2GLR A;  2WCI A;  2P31 A;  2YNX A;  5DQS A;  2LRT A;  3H79 A;  2OJL A;  5G5F A;  3BBY A;  1K3Y A;  5AGY A;  1YY7 A;  5HFG A;  4NV2 A;  1A8L A;  2C0F A;  2B5X A;  4RI7 A;  5INY A;  4EIQ A;  5CYY A;  1JLV A;  3HZ8 A;  4GLT A;  1X5C A;  1MEK A;  3F3R A;  6GSY A;  3GST A;  1X5D A;  1TI1 A;  1MD4 A;  4DSQ A;  2GSS A;  4ID0 A;  4L5O A;  4OD7 A;  3VWV A;  3FW2 A;  2VLV A;  5D93 A;  1E2Y A;  4L0U A;  4PUF C;  1VF3 A;  2B7J A;  6GSS A;  3L9S A;  2VCW A;  5JCU A;  1FAA A;  3GFK A;  1WE0 A;  4GTU A;  4MLY A;  1O7U A;  3IAS 2;  3IR4 A;  3KCM A;  3F4S A;  1G7E A;  4BWQ A;  2EIR A;  3D4T A;  3F8U A;  4LA1 A;  2VD0 A;  2NVL A;  2GT5 A;  1VRS D;  2FA4 A;  2JL4 A;  2K8V A;  2F8A A;  1WWJ A;  2A2S A;  4PGT A;  2EIQ A;  2H0I A;  4ILF A;  2A4V A;  3N9J A;  4D73 B;  1GTB A;  4V1A g;  4IQ1 A;  2MYG A;  2YPM A;  5D8I A;  4IQA A;  1DBY A;  1XW5 A;  2KLX A;  1VGL A;  1FHE A;  3C1S A;  3CBU A;  1SKW B;  2PWJ A;  3HJO A;  4EDY A;  5JWO B;  5DAK A;  1MDK A;  2WJU A;  4IJI A;  2GZP A;  2WGR A;  2LKU A;  1PRX A;  3FEU A;  3GTU B;  2PVQ A;  2MMO A;  5JWQ B;  3JCM L;  2O7K A;  3QDN A;  4O7H A;  1USB A;  3R2Q A;  3WGX A;  3C7M A;  2R0P A;  1Z9H A;  2I3Y A;  1PN0 A;  4FO5 A;  4PX1 A;  1U6T A;  2UZ8 A;  3ERW A;  3KZQ A;  4MJC A;  4AJ6 A;  1THX A;  4IN0 A;  4XHM A;  1A2J A;  1YDK A;  4MK3 A;  2LTK A;  1X5E A;  5DCH A;  3L0H A;  2ZUP A;  1Z7P A;  1DE1 A;  1ZYP A;  3QFB C;  3M9K A;  4AGS A;  1EP7 A;  3GN3 A;  3EMX A;  3Q6O A;  3DXB A;  5ECM B;  2G2Q A;  2HXK A;  1E6B A;  1X0R A;  4OFM A;  2VCQ A;  4E8E A;  1FVK A;  5D9T A;  1RW1 A;  4FYC A;  1QUW A;  1K0C A;  2C0D A;  4ICY A;  3F6F A;  2FWF A;  5G31 A;  2TRX A;  2OE1 A;  3HD5 A;  1AQV A;  5EY6 A;  1FO5 A;  2JZT A;  4XRD A;  1GLQ A;  1YEX A;  3FZ5 A;  2LQO A;  4PQ1 A;  1ZYE A;  4GQC A;  2LJR A;  4EUY A;  1KEB A;  3LFL A;  1V40 A;  3EYT A;  4PNF A;  2A4H A;  1YEP A;  4IP6 A;  1J08 A;  5GZZ B;  1ERU A;  2GST A;  4NHZ A;  2YWM A;  3F4T A;  5AIX A;  3O6T A;  2AAW A;  4GXZ A;  5B8A A;  3IHG A;  3Q19 A;  1GSQ A;  2M46 A;  4HI7 A;  1U87 A;  4KSO A;  1URM A;  1HNC A;  5D9X A;  1TK5 B;  3KJY A;  2DJ2 A;  3ZRD A;  3DD3 A;  5ELG A;  3FYG A;  1G6W A;  4ZB8 A;  2X8G A;  2PGT A;  3RHC A;  4HDE A;  1TRS A;  2ON5 A;  4N10 A;  1JZW A;  1JZD A;  4J56 E;  1AXD A;  3TJB A;  5GSS A;  1EP8 A;  2EC4 A;  5JCG A;  4DSS B;  1AQW A;  11GS A;  2HZE A;  4E8H A;  2OAC A;  1O85 A;  2AV4 A;  5HR1 A;  3GX0 A;  2KOK A;  4I97 A;  3TRQ A;  2L6D A;  2GQK A;  1PX7 A;  1Z5Y E;  3VI7 A;  2ALB A;  2H0H A;  2F8F A;  3LEF A;  3MNG A;  4WF4 A;  5G1K A;  3NIV A;  2MMN A;  3ERG A;  3HXS A;  2WDU A;  1MTC A;  2X49 A;  2TIR A;  2V32 A;  2EIO A;  2JAD A;  4ZL8 A;  16GS A;  5IOW A;  3EC3 A;  4IHU A;  4TR4 A;  3GKN A;  4RI6 A;  5CO3 A;  2C3Q A;  4DVC A;  1PL2 A;  5IM9 A;  1V58 A;  2C80 A;  1U3A A;  2VL2 C;  2GZZ A;  3FR6 A;  3GKK A;  1YZX A;  3U6V A;  4H86 A;  4TXO B;  3TKS A;  5D73 A;  5IIZ A;  2OKA A;  4GST A;  3E3E A;  6GSW A;  2CVB A;  2V6O A;  3ISO A;  3M3M A;  2CA8 A;  2LV3 A;  3WT1 A;  4MF6 A;  4ZBA A;  3FR9 A;  1FW1 A;  1GUM A;  2AHE A;  2XPD A;  1V98 A;  2HZF A;  3D6I A;  3O3T A;  3H4K A;  4XIH A;  2H8L A;  4IS0 A;  1GNW A;  2PVO C;  4K5S A;  5IOX A;  4G0K A;  2DIZ A;  2CAI A;  2AYT A;  5JCW A;  3KH9 A;  3LQ7 A;  2O89 A;  1M7T A;  1WRY A;  5CRG A;  4K6X A;  4AF2 A;  2I9H A;  3C1R A;  4BVX B;  4G2E A;  3NZN A;  3G7Y A;  4TRX A;  1HQO A;  2H71 A;  2R0C A;  3UEM A;  1SL2 B;  4KND A;  4PUR A;  3KM6 A;  4LMV A;  3ZIJ A;  4HU9 A;  4WR4 A;  5AN1 A;  5A5K A;  4IKH A;  2F9S A;  4EKZ A;  3IE3 A;  1K3L A;  3IPZ A;  1TP9 A;  2XHF A;  5CAX A;  4XS4 B;  5G1L A;  2MMZ A;  4AJ7 A;  1ZL9 A;  1GSY A;  1FG4 A;  3QFA C;  3CXG A;  4GWR A;  4ZBD A;  2L5O A;  2A2R A;  1O8X A;  1GRX A;  3GL5 A;  5ELA A;  2DJ3 A;  3HHV A;  4IBP A;  3GUR A;  4KH7 A;  4KAE A;  1SKR B;  1JZR A;  2YV9 A;  1OC9 A;  2IJY A;  4OCE A;  2H1D A;  2OAD A;  4K7I A;  3LXZ A;  3ZML A;  3I9V 2;  4ZXG A;  1VF1 A;  3KTL A;  2C1Y A;  3GA4 A;  3VPT A;  2HE3 A;  1LU4 A;  4HUA A;  1F3A A;  5COH A;  1XWG A;  4Q5R A;  3FY7 A;  2HYX A;  5ECP B;  2H19 A;  1K3O A;  2R4V A;  3DIE A;  1YQ1 A;  1BYE A;  1TRW A;  1PKZ A;  2GSQ A;  2FUG 2;  2VOC A;  4DEJ A;  5ECR B;  2FLS A;  1YF1 A;  3PR8 A;  1OE8 A;  2C0G A;  4KX4 A;  4PNG A;  1OAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...