2E0QA

Crystal structure of k53e thioredoxin from sulfolobus tokodaii strain7
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
VIHLDSKNFDSFLASHEIAVVDFWAEWCAPCLILAPIIEELAEDYPQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAVPREEIEIRIKNLLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thioredoxin
publication title Crystal structure of thioredoxin domain of ST2123 from thermophilic archaea Sulfolobus tokodaii strain7
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Electron transport
total genus 26
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2e0qA00
20GSA 2FWGA 2EIRA 2GZYA 2H6ZA 1AW9A 3ED3A 1EOGA 1E2YA 1U88A 4CDOA 3F3QA 4IQ1A 3HVVA 3EINA 2VAFA 2VL2A 4N0ZA 4GF0A 1GSFA 2B1LA 3WYWA 1YF1A 1PRXA 2JSZA 2MMAA 1XWGA 2GDRA 1J0FA 1WIKA 2HRNA 1EGOA 3APSA 2YWMA 2O7KA 3QR6A 3DKSA 3U5RE 4HZ2A 5AIXA 4MABA 5IOXA 4ECIA 5DQYA 1A0FA 1KEBA 3LFLA 3Q74A 4I5QA 5F0GA 1LU4A 3GURA 1S3CA 1A2JA 5AN1A 5GSSA 4BVYA 1TI3A 1K3LA 1ZMAA 3HHVA 2TRXA 3R2QA 4BWQA 3EURA 2PN8A 4FYUA 2H1DA 4TR1B 4OO4A 2IL3A 2VUPA 2YV9A 3TOTA 1CQHA 3GKXA 2L5LA 1XCCA 4FO5A 4NMUA 1GSDA 2X64A 2DBCA 4CHSA 3TJFA 1PN9A 2OACA 4GSSA 3D4MA 5A4VA 2C0EA 4GRFA 3WT1A 3UMAA 4GTUA 2B5YA 1A23A 2GT5A 1K0BA 5EY6A 4RI7A 3IE3A 4Q5FA 1WOUA 3TUEA 1TRWA 3IRAA 2DJ3A 2GSRA 1FB6A 1V57A 3UEMA 1AQWA 2DC5A 1YY7A 1GLPA 2TIRA 1G7EA 3EE2A 5ECNB 1BYEA 3PH9A 3UBKA 3F6DA 3TKSC 1HNAA 5GAPD 4NWYA 4LLRA 2LTKA 2LEGA 4BVXA 3CSJA 3UIWA 3P8WA 3A3TA 2HNLA 4NV5A 1AIUA 3DMLA 5A5KA 1SYRA 2GZZA 4TR3A 3FW2A 1FAAA 2V32A 3DXBA 1R5AA 3IK9A 1B48A 2AHEA 3D0ZA 3GV1A 2C4JA 4MPFA 1X0RA 1R26A 2A2RA 5DCGA 2H30A 3L4NA 2GSTA 1XOAA 5KN1A 2K6VA 4ECCA 5KN3A 2PMTA 5INYA 5J41A 2H73A 5CAXA 4F03A 2V6OA 4G10A 4F0BA 5DQSA 5DVBA 5CO3A 3D21A 1FG4A 3HXSA 5LCZA 2FHEA 3P7XA 1GULA 5ABRA 3IK7A 3M1GA 5D9VA 3CSIA 5B6MA 3APQA 2YANA 1TTZA 1AC1A 4WBRD 1SJIA 2NDOA 6GSYA 2FA8A 2H19A 1EEJA 2H0IA 3F4RA 2AB6A 2I4AA 3LORA 1W4VA 3P90A 3HJPA 1GTAA 2KHPA 2ZCTA 2VCXA 2OKAA 3KH9A 1EOHA 1TU8A 2VL2C 1O7UA 1XFLA 2AYTA 1S3AA 2WRTA 3QD9A 1TDIA 3BD2A 4ACSA 1SU9A 1MDKA 3F0IA 1I9DA 2C1YA 2N5FA 1ERWA 1THOA 5IMVA 4EDZA 2PVOC 1DE1A 4L5LA 2B3SA 1SKSB 1WJKA 3ISOA 1TXXA 1XPVA 1U3AA 1Q4JA 3BBYA 1YF0A 16GSA 3W8JA 3MNGA 2VL9A 3CRTA 1BG5A 3J7Yb 3ERWA 1R4WA 2H72A 3UL3A 4XS4A 1Z9HA 1JZDA 1UC7A 1GNEA 5L71A 4IQAA 2H1BA 3FR9A 2GVPA 2QSIA 1EWXA 2HXKA 1T1VA 2B5XA 1GLQA 1VF3A 4ZBBA 4BWSA 1U87A 5D9XA 1R5PA 1SJ6A 2ALBA 1K0MA 1M2AA 2LRCA 12GSA 3VK9A 2YZHA 2H74A 1NW2A 3HZ8A 2E2GA 2L57A 2PVQA 4OCFA 3KP8A 2VO4A 1GH2A 2EIQA 3N9JA 3HY2A 4YAVA 3GL3A 3QAWA 3VURA 4AGSA 4F9ZA 3IHQA 2YV7A 3CMIA 4RQRA 2IIYA 3EC3A 4IHUA 1Z7PA 2X8CA 5CRHA 4TRXA 4HJ2A 6GSUA 5ECLB 4PXOA 1LJRA 3VWUA 3N5OA 4TR1A 6GSVA 1OKTA 3ZTLA 2P31A 3A2VA 3KM6A 3QDNA 2R5GA 1LBKA 1XWKA 2V6KA 2RM5A 1O85A 5CRWA 1FOVA 2M72A 3IPZA 3BOAA 3TKRA 4JEDA 1A8YA 3KMOA 2PGTA 3RHCA 3LXTA 1MDJA 2GT6A 5ECMB 2DIZA 4LMWA 4XS6A 4WF4A 1WP0A 1SL0B 2MMOA 2H75A 2HLSA 2M46A 9GSSA 4JBBA 4O92A 1F3BA 1X5DA 4HEA2 5ID2A 4MJAA 2X99A 5B6NA 2R3XA 2R6KA 2JZRA 4OO5A 4ZB9A 3ZITA 2NTOA 1V2AA 2N5AA 3MSZA 2LRTA 2VCWA 3I6AA 2GZPA 3M9JA 1W89A 2RLIA 1TU7A 1N2AA 3EU4A 1OC8A 3O3TA 3D6IA 5IPHA 4KCAA 1GSEA 1HD2A 1A8LA 4K6XA 1RK4A 5J4UA 1XWAA 3M3MA 3DEXA 2HI7A 2IMEA 1YEPA 3SBCA 1QMVA 2B7KA 2PUKC 1K0DA 4HQSA 4P3YB 3DRNA 3F63A 4N30A 1PKZA 2LJRA 3CTGA 3KEBA 4L0UA 4TVEA 1TRSA 1SYXA 1PX6A 1WWJA 5G5FA 3H93A 1QK8A 4XIHA 2FA4A 5F05A 2M80A 3IA1A 1GSQA 3LQ7A 4MA9A 4WKWA 3IC4A 3IOSA 3W6GA 4PQ1A 5DDLA 1V40A 2GS3A 2L5OA 4MJBA 1PX7A 1F9MA 1V58A 2HT9A 3KGKA 2IMDA 2VCZA 1B4QA 2R4VA 4DSSB 5HR0A 4GWRA 1T00A 1EV4A 2AV4A 4PQIA 2LQOA 3ZRDA 5COHA 4X43A 1H75A 2WGRA 2BTOT 4EKZA 3A5WA 2CVBA 1CQGA 3ZIJA 3RBTA 3M9KA 4TXVA 2CT6A 2ON5A 2REMA 1SL1B 4X0XA 4EVMA 1SL2B 3F9UA 1OC3A 1KBNA 3TKQA 1Z6MA 2YJ7A 4K7IA 3HCZA 3NOFA 2B6MA 4L8EA 5C00A 3F4TA 5FHIA 1F2EA 4IW9A 2L6DA 5HFKA 3ME7A 5ECOB 2B5EA 1U6TA 2JZTA 2LQQA 3GNJA 3IV4A 5A4UA 1T8EB 5KN0A 2I9HA 4ULXA 6GSXA 2YWNA 4GSNA 4OCEA 3TCOA 1BAYA 2F8FA 2DJ0A 1X5EA 2H0HA 2CZ2A 3FZ9A 2KOKA 4ID0A 3DWVA 3QPMA 2L4CA 1O73A 4DEJA 4EL1A 2LRNA 2YWIA 1O8XA 1F3AA 2Z9SA 2PU9C 4WXTA 1EP7A 4IJ3A 5IO2A 1X9WB 3VWWA 1K0CA 1SKRB 2JACA 5LD0A 2J23A 3OR5A 2FWHA 4O7HA 2PERA 1PD21 1R7HA 4BL7A 1JZRA 1X9MB 1YKCA 1TK8B 3QOUA 4K2DA 6GSSA 2LUSA 4N10A 1YZXA 3FRCA 4KGIA 3FZAA 5DALB 5D9TA 4MH2A 2WJUA 5CRGA 5IQYA 2YP6A 5H5QA 4HS1A 1A2LA 2QGVA 1M9BA 2H71A 3D4TA 2VIMA 4IKHA 2CZ3A 3L9SA 1HNBA 3K8NA 1XVQA 1AAZA 4NV2A 2OE0A 4GLTA 1XW6A 3M8NA 4WETA 2H0GA 3VI7A 2LJAA 2LKUA 3GL5A 4ZL8A 1GL8A 1XOBA 1FVKA 5DCHA 4XTSA 3I43A 4XRDA 3M0FA 3FR6A 5HR2A 2KUCA 2IMFA 4NXIA 1DE2A 1EZKA 5IMZA 1V9WA 3RPNA 1ZOFA 1XIYA 3H1NA 4KW6A 1E6BA 1HQOA 2BMXA 1AUCA 2JZSA 1K0NA 2HSHA 4KE3A 7GSSA 1SK1A 4QL7A 1WRYA 2P5RA 4N0VA 2FD3A 4MPGA 1JFUA 5D96A 1GSYA 2GSQA 3HJOA 3L9VA 4POLA 1JZOA 4MF6A 4ZB8A 4ZL9A 19GSA 3FKFA 3KP9A 1YJ6A 4EXJA 3UARA 3TB2A 4KSOA 1ZZYA 3ZYWA 2HZFA 4V2MA 4OFMA 4L0WA 2C0DA 4J2FA 3LYPA 5IO0A 5JWRB 2YZUA 1QUWA 3MDKA 3RDWA 2L59A 1PGTA 4ML1A 3TJGA 1F37A 1TJDA 2RM6A 5IMCA 2DJ2A 1XWBA 3HYPA 2YN1A 4LL1B 4IVFA 1QGVA 4POBA 4IP1A 3CYNA 3NZNA 3G7IA 1ILOA 1B9XC 5G1LA 2E0QA 4EE0A 1QXHA 3LEFA 1IYHA 5DAKA 2A2SA 5DJMA 3WT2A 2I3YA 3I9V2 2CQ9A 4PGTA 5IMDA 5IM9A 4LL4B 4TXOB 2VM2A 3ZVJD 3FEUA 1BX9A 4KSMA 3L9UA 3FZ4A 2R2JA 1Z5YE 1JLVA 3LXZA 2XPDA 2KLXA 1TI1A 3WGXA 1ML6A 2AAWA 4YQMA 1BQ7A 1MD4A 4ML6A 2WS2A 3CBUA 3F3RA 2LNSA 1F6MC 2C0FA 5G5EA 2OJLA 4JZQA 3WGDA 3BCKA 2IMKA 1FB0A 4OFTA 2HZEB 1MTCA 2LV3A 2K8SA 3CTFA 2YOIA 2FNOA 2EIOA 4IS0A 2D2ZA 3S9FA 1ON4A 2P0GA 4IP6A 5IPGA 1M0UA 2DMMA 4DSSA 4ZBDA 3DVXA 3QAGA 1WE0A 1XW5A 1N8JA 3VWXA 1X5CA 2VCQA 2MBSA 3Q18A 4HU9A 2P5QA 3EMPA 5J5NA 1Y25A 5ENUA 5IOWA 1VRSD 4DVCA 1THXA 4DSRA 3C73A 3FHKA 2N5BA 2WULA 4Q5NA 4MLYA 1XZOA 2WZ9A 3ZVJA 3LJRA 3F8UA 1B4PA 1B8XA 1SJZA 2K9FA 1T3BA 2OE3A 2HYXA 3HZ4A 1SK2A 3G7YA 17GSA 1RQMA 1PMTA 5ECPB 1XWCA 5CNWA 2IWTA 4AF2A 3W8SA 4ECBA 4EO3A 1MD3A 4ISDA 1GSSA 2H01A 13GSA 5AIVA 2NPBA 5C04A 4IBPA 4Q5QA 4HZ4A 3VWVA 4E8HA 1UA5A 3ZIVA 5FT3A 5GAND 1PKWA 1TW9A 4GSTA 1NHYA 1SKWB 4MH3A 4WR4A 2CX4A 3QAVA 3UOMA 2OE1A 4IGJA 1BEDA 2DIYA 4KB3A 1XW9A 1T4YA 1WMJA 1JZWA 1TP9A 2OBIA 2KP1A 2L6CA 5F07A 2E2MA 4YQUA 3G9BA 1K0OA 4CW9A 3QCPA 3TRPA 4XHMA 2K8VA 2V2GA 3KJYA 1DUGA 1PL1A 3QFAC 4G2EA 2MMZA 3PGTA 3A2XA 1YKAA 3UVTA 2J9HA 3ZMLA 1K3YA 4K0NA 4FH8A 2H8LA 2IMIA 2KP2A 4I2TA 1YEXA 5J9BA 1G6WA 4OD7A 2ZUPA 3GIXA 1NM3A 1ERTA 2V1MA 3LGCA 1OKDA 2DJKA 4KH7A 3QFBC 1HYUA 4L5OA 1ZL9A 3O6TA 1G0TA 1ZGNA 3FR3A 3DGQA 1GTBA 1OC9B 3CSHA 3E9JB 2WCIA 3GKKA 5FWGA 2LS5A 3ZL5A 4PX1A 3E0UA 2O87A 2MYGA 3GH6A 4MMMA 5HR3A 4KDYA 1QQ2A 2MBTA 2F51A 3KZQA 5JWOB 2IN3A 2CVDA 4XCSA 3MAKA 3GMFA 2F3MA 1AXDA 1PA3A 1H4OA 2IPAA 5A4WA 3ZFLA 1KNGA 1PL2A 3APOA 4HI7A 4GQFA 4MZBA 4AJ6A 2HFDA 3CXGA 6GSWA 3GX0A 2X8HA 2VLUA 3HJMA 1Y6EA 4J56E 2V41A 2FLSA 4TKYA 5F8BA 2PWJA 3GRXA 1M2BA 2QKEA 2VOCA 2L4QA 1USBA 2X8GA 1OE7A 4OMVA 3EVIA 3C71A 4ZB6A 1G7OA 4D73B 2JL4A 1QFNA 4ZBAA 3KD0A 3UVHA 1AQVA 2YWOA 3DVWA 3ZLPA 3J7Yk 4TXOA 1FVJA 3LYKA 18GSA 2AUVA 5EPFA 5CP1A 2H6YA 3D22A 1A0RP 4K7NA 3TRXA 2FGXA 4XS4B 2QC7A 4MK3A 3UJ1A 3LWAA 4AJ7A 4LA1A 3IR4A 5KN2A 1K0AA 2XBIA 2HE3A 4DSQA 3GSTA 5GSTA 1B9YC 4BPYA 4V1Ag 4NHZA 3HVXA 5EVOA 4KDUA 1M99A 3O76A 2HZEA 5ELGA 4KAEA 2I1UA 1Z7RA 4NHWA 4PNGA 3MWHA 3GTUB 3P2AA 1GRXA 2CAQA 4KNDA 3ZZXA 2YJHA 4IELA 3G7JA 2G2QA 1FHEA 5HFGA 4V2LA 5ECIB 5ECSA 1M9AA 5IIZA 4AJ8A 1Q98A 1G6YA 4ILFA 2ON7A 2YCDA 3GKMA 2VD1A 2GLRA 1GP1A 4KCEA 4J57E 3RAZA 3IAS2 4I97A 5J3RA 5B8AA 4KX4A 4GXZA 5JCWA 2CVKA 4OWYA 3BJ5A 3ERGA 3EYTA 5D9WA 3KMNA 4N11A 4WF5A 10GSA 4FYCA 1IYIA 3SWLA 2YNXA 3QMXA 3NIVA 2F9SA 3WD6A 2R37A 5ECQB 1HNCA 6GSTA 5IMFA 5JCGA 4JR4A 3TJJA 2GSSA 2IJYA 2BJXA 4HQZA 2LNTA 5B7CA 4EUYA 2YPMA 1EV9A 5B8BA 4QL9A 2LJKA 3GX8A 2TRCP 3IXRA 1XXUA 1UVZA 5ID2B 4MZWA 5G30A 2RIIA 11GSA 5D73A 5J9CA 3KXOA 1ACVA 1S3DA 2H76A 5H5RA 3KTLA 3TJBA 2VCTA 3DYRA 1SENA 2HRFA 4MP4A 4MJEA 2C3QA 1J9BA 1FW1A 1A24A 1TKDB 2XPEA 5JWQB 1BJXA 3HKRA 1T4ZA 1ST9A 1TRUA 1VF4A 5H5SA 4JRRA 3V1WA 4POKA 1GSUA 3ZFBA 2DMLA 2FWEA 2DLXA 3US3A 3GYKA 1UN2A 3VI5A 2DSAA 2HSYA 4EF0A 2GQKA 1SD9A 1OVNA 2B7JA 4EDYA 2C8UA 5ELAA 1XVWA 1TK5B 1V98A 3KTBA 2VLTA 3UBLA 3EWLA 3CRUA 1FO5A 2CV4A 5ECRB 1M2DA 5DJLA 2JADA 4HDEA 4NPBA 5EL8A 3IDVA 4O32A 2RUFA 3FYGA 4ZL7A 1OC9A 3GA4A 3FY7A 2IFQB 4ZILA 4TW5A 4I6XA 3WGEA 2C0GA 1AQXA 3H4KA 2VCVA 4IJIA 2H66A 5JCUA 4FIWA 4MDCA 4IN0A 3D5JA 2DJJA 3HA9A 4RI6A 5AGYA 3VFIA 2WFCA 2ES7A 4MZCA 2O8VB 1DSBA 3C8EA 3TJKA 1VF1A 3PR8A 4XS1A 1JLWA 4K0GA 1MDIA 3GSSA 1TOFA 4HJMA 2NBSA 4MF7A 3TKSE 1X9SB 2WB9A 2RUEA 5G1KA 2E7PA 2H6XA 4PUFC 1ABAA 4XRAA 3HVSA 1DBYA 2MZCA 3FZ5A 3TOUA 2FY6A 4KA0A 3TKPA 1ERVA 5HFIA 4WBJA 1GWCA 5F06A 3BCIA 4D73A 3PINA 5G2ZA 5ECKB 4TN8A 3VPTA 4F2IA 2OBKA 1EP8A 4NAXA 2GGTA 1J08A 3L78A 4Q5RA 5E59A 2O89A 2AJQB 3AY8A 1M7TA 1O6JA 1ERUA 3IAM2 4WEYA 14GSA 4I2UA 4YH2A 4WR5A 4K9ZA 3Q6OA 4I8BA 1URMA 1XBSA 2NVLA 4MJCA 3DD3A 3HD5A 4TR4A 2H1AA 4KUNA 4BA7A 4F82A 3GN3A 4LMVA 3RPPA 3GTUA 2XC2A 3GH9A 5GZZB 4X1UA 3E3EA 3GFKA 2CX3A 3UAPA 4HU7A 2JSYA 2FCHA 4K7OA 1VF2A 3GUSA 5CRDA 1O8WA 2CA8A 4PUAA 2B1KA 3RHBA 3TDGA 4HOJA 4GCIA 4RUVA 4RQXA 4PURA 5DALA 2I81A 4KDXA 4POMA 1NSWA 3ERFA 1RW1A 4H86A 3U6VA 2JU5A 2OA7A 5ECHB 4JE1A 1KTEA 2MMNA 3H8QA 4TOPA 3EMXA 3GHAA 3ME8A 1ZYEA 3FK8A 4ZXGA 1GUKA 5IMAA 4QQ7A 4F0CA 4Z7XA 5HQPA 4OFNA 3F6FA 3Q19A 2PPTA 1MEKA 2DJ1A 5CYYA 4ECJA 5KEJA 4GQCA 1JHBA 2H1GA 1YDKA 2VL3A 3LG6A 1GTIA 1VGLA 2XBQA 2VD0A 3IBHA 1GTUA 1ZYQB 1SD8A 3VPQA 2GTUA 4K8MA 4PQHA 22GSA 4HUAA 3JCML 1SK0A 5D93A 1WPIA 1PSQA 1Z6NA 4V1Ap 4YAPA 4O5RA 3TKSA 1TRVA 2EC4A 2C80A 2XHFA 2VLVA 2H70A 1OYJA 2K18A 1NHOA 2CAIA 5CREA 5D8IA 4K1FA 5DAKB 2O85A 3KCMA 2VM1A 1O81A 1C72A 1TK0B 2GQLA 5AISA 3ZMKA 2FWFA 3C1RA 3I69A 3KIJA 1OAZA 4ZIJA 3C7MA 1GUHA 3L0HA 2F8AA 4G9HA 4FYBA 3ZREA 3LSZA 4PNFA 1EEMA 3C1SA 1EGRA 2G0FA 1T7PB 4YQVA 4EC0A 1Z3EA 3KH7A 1A2MA 4V2NA 3EU3A 1YQ1A 1ZCPA 1GUMA 4E8EA 2FUG2 5E4WA 5LNKe 4MCUA 2WDUA 4JR6A 3H79A 4MF5A 3A2WA 1GNWA 2GQMA 3GKNA 1I5GA 5G31A 3F4SA 1OE8A 2OADA 2C3TA 2C3NA 2LSTA 5HR1A 2A4VA 3TGZA 2IFQA 1U3IA 4JU5A 1PQNA 3DIEA 2PBJA 3TRQA 8GSSA 2ZNMA 1K3OA 4G19A 5DBQA 3VLNA 3HDCA 4TR0A
chains in the Genus database with same CATH superfamily
20GSA 2FWGA 2EIRA 2GZYA 2H6ZA 1AW9A 3ED3A 1EOGA 1E2YA 1U88A 4CDOA 3F3QA 4IQ1A 3HVVA 3EINA 2VAFA 2VL2A 4N0ZA 4GF0A 1GSFA 2B1LA 3WYWA 5BRTA 1YF1A 1PRXA 2JSZA 2MMAA 1XWGA 2GDRA 1J0FA 1WIKA 2HRNA 1EGOA 3APSA 2YWMA 2O7KA 3QR6A 3DKSA 3U5RE 4HZ2A 5AIXA 4MABA 5IOXA 4ECIA 5DQYA 1A0FA 1KEBA 3LFLA 3Q74A 4I5QA 5F0GA 1LU4A 3GURA 1S3CA 1A2JA 5AN1A 5GSSA 4BVYA 1TI3A 1K3LA 1ZMAA 3HHVA 2TRXA 3R2QA 4BWQA 3EURA 2DKIA 2PN8A 4FYUA 2H1DA 4TR1B 4OO4A 2IL3A 2VUPA 2YV9A 3TOTA 1CQHA 3GKXA 2L5LA 1XCCA 4FO5A 4NMUA 1GSDA 2X64A 2DBCA 4CHSA 3TJFA 1PN9A 2OACA 4GSSA 3D4MA 5A4VA 2C0EA 4GRFA 3WT1A 3UMAA 4GTUA 2B5YA 1A23A 2HRKA 2GT5A 1K0BA 5EY6A 4RI7A 3IE3A 4Q5FA 1WOUA 3TUEA 1TRWA 3IRAA 2DJ3A 2GSRA 1FB6A 1V57A 3UEMA 1AQWA 2DC5A 1YY7A 1GLPA 2TIRA 1G7EA 3EE2A 5ECNB 1BYEA 3PH9A 3UBKA 3LW9A 3F6DA 3TKSC 1HNAA 5GAPD 4NWYA 4LLRA 3FMWA 2LTKA 2LEGA 4BVXA 3CSJA 3UIWA 3P8WA 3A3TA 2HNLA 4NV5A 1AIUA 3DMLA 5A5KA 1SYRA 2GZZA 4TR3A 3FW2A 1FAAA 2V32A 3DXBA 1R5AA 3IK9A 1B48A 2AHEA 3D0ZA 3GV1A 2C4JA 4MPFA 1X0RA 1R26A 2A2RA 5DCGA 2H30A 3L4NA 2GSTA 1M3IA 1XOAA 5KN1A 2K6VA 4ECCA 5KN3A 2PMTA 5INYA 5J41A 2H73A 5CAXA 4F03A 2V6OA 4G10A 4F0BA 5DQSA 5DVBA 5CO3A 3A5IA 3D21A 1FG4A 3HXSA 5LCZA 2FHEA 3P7XA 1GULA 5ABRA 3IK7A 3M1GA 5D9VA 3CSIA 5B6MA 3APQA 2YANA 1TTZA 1AC1A 4WBRD 1SJIA 2NDOA 6GSYA 2FA8A 2H19A 1EEJA 2H0IA 3F4RA 2AB6A 2I4AA 3LORA 3CQFA 1W4VA 3P90A 3HJPA 1GTAA 2KHPA 2ZCTA 2VCXA 2OKAA 3KH9A 1EOHA 3PPUA 1TU8A 2VL2C 1O7UA 1XFLA 2AYTA 1S3AA 2WRTA 3QD9A 1TDIA 3BD2A 4ACSA 1SU9A 1MDKA 3F0IA 1I9DA 2C1YA 2N5FA 1ERWA 1THOA 5IMVA 4EDZA 2PVOC 1DE1A 4L5LA 2B3SA 1SKSB 1WJKA 3ISOA 1TXXA 1XPVA 1U3AA 1Q4JA 3BBYA 1YF0A 16GSA 3W8JA 3MNGA 2VL9A 3CRTA 1BG5A 3J7Yb 3ERWA 1R4WA 2H72A 3UL3A 4XS4A 4BL7B 1Z9HA 1JZDA 1UC7A 1GNEA 5L71A 4IQAA 2H1BA 3FR9A 2GVPA 2QSIA 1EWXA 2HXKA 1T1VA 2B5XA 1GLQA 1VF3A 4ZBBA 1PFOA 4BWSA 1U87A 5D9XA 1R5PA 1SJ6A 2ALBA 1K0MA 1M2AA 2LRCA 12GSA 3VK9A 2YZHA 2H74A 1NW2A 3HZ8A 2E2GA 2L57A 2PVQA 4OCFA 3KP8A 2VO4A 1GH2A 2EIQA 3N9JA 3HY2A 4YAVA 3GL3A 3QAWA 3VURA 4AGSA 4F9ZA 3IHQA 2YV7A 3CMIA 4RQRA 1M3JA 2IIYA 3EC3A 4IHUA 1Z7PA 2X8CA 5CRHA 4TRXA 4HJ2A 6GSUA 5ECLB 4PXOA 1LJRA 3VWUA 3N5OA 4TR1A 6GSVA 1OKTA 3ZTLA 2P31A 3A2VA 2X4AA 3KM6A 3QDNA 2R5GA 1LBKA 1XWKA 2V6KA 2RM5A 1O85A 5CRWA 1FOVA 2M72A 3IPZA 3BOAA 3TKRA 4JEDA 1A8YA 3KMOA 2PGTA 3RHCA 3LXTA 1MDJA 2GT6A 5ECMB 2DIZA 4LMWA 4XS6A 4WF4A 1WP0A 1SL0B 2MMOA 2H75A 2HLSA 1PN0A 2M46A 2R0GA 4JBBA 4O92A 9GSSA 1F3BA 1X5DA 4HEA2 5ID2A 4MJAA 2X99A 5B6NA 2R3XA 2R6KA 2JZRA 4OO5A 4ZB9A 3ZITA 2NTOA 1V2AA 2N5AA 3MSZA 2LRTA 2VCWA 4G0LA 3I6AA 2GZPA 3M9JA 1W89A 2HRAA 2RLIA 1TU7A 1N2AA 3EU4A 1OC8A 3O3TA 3D6IA 4Z2TA 5IPHA 4MNNA 4KCAA 1GSEA 1HD2A 1A8LA 4K6XA 1RK4A 5J4UA 1FOHA 1XWAA 3M3MA 3DEXA 2HI7A 2IMEA 1YEPA 3SBCA 1QMVA 2B7KA 2PUKC 1K0DA 4HQSA 4X4JA 4P3YB 3DRNA 3F63A 4N30A 1PKZA 2LJRA 3CTGA 3KEBA 4L0UA 4TVEA 1TRSA 3MYDA 1SYXA 1PX6A 1WWJA 5G5FA 3H93A 1QK8A 4XIHA 2FA4A 5F05A 2M80A 3IA1A 1GSQA 3LQ7A 4MA9A 4WKWA 3IC4A 3IOSA 3W6GA 4PQ1A 5DDLA 1V40A 2GS3A 2L5OA 4MJBA 1PX7A 1F9MA 1V58A 2HT9A 3KGKA 2IMDA 2VCZA 1B4QA 2R4VA 4DSSB 5HR0A 4GWRA 1T00A 1EV4A 2AV4A 4PQIA 2LQOA 3ZRDA 5COHA 4X43A 1H75A 2WGRA 2BTOT 4EKZA 3A5WA 2CVBA 1CQGA 3ZIJA 5KOXA 3RBTA 3M9KA 4CY6A 4TXVA 2CT6A 2ON5A 2REMA 1SL1B 4X0XA 4EVMA 1SL2B 3F9UA 1OC3A 1KBNA 3TKQA 1Z6MA 2YJ7A 4K7IA 3HCZA 3NOFA 2B6MA 4L8EA 5C00A 3F4TA 5FHIA 1F2EA 4IW9A 2L6DA 5HFKA 3ME7A 5ECOB 2B5EA 1U6TA 2JZTA 2LQQA 3GNJA 3IV4A 5A4UA 1T8EB 5KN0A 2I9HA 4ULXA 6GSXA 2YWNA 4GSNA 4OCEA 3TCOA 1BAYA 2F8FA 2DJ0A 1X5EA 2H0HA 2CZ2A 3FZ9A 2KOKA 4ID0A 3DWVA 3QPMA 2L4CA 1O73A 4DEJA 4EL1A 2LRNA 2YWIA 3MIXA 1O8XA 1F3AA 2Z9SA 2PU9C 4WXTA 1EP7A 4IJ3A 5IO2A 1X9WB 3VWWA 1K0CA 1SKRB 2JACA 5LD0A 2J23A 3OR5A 2FWHA 4O7HA 2PERA 1PD21 1ZYNA 1R7HA 4BL7A 1JZRA 1X9MB 1YKCA 1TK8B 3QOUA 4K2DA 6GSSA 2LUSA 4N10A 1YZXA 3FRCA 4K5SA 4KGIA 3FZAA 5DALB 5D9TA 4MH2A 2WJUA 5CRGA 5IQYA 2YP6A 5H5QA 4HS1A 1A2LA 2QGVA 1M9BA 2H71A 3D4TA 2VIMA 4IKHA 2CZ3A 3IHGA 3L9SA 1HNBA 3K8NA 1XVQA 1AAZA 4NV2A 2OE0A 4GLTA 1XW6A 3M8NA 4WETA 2H0GA 3VI7A 2LJAA 2LKUA 3GL5A 4ZL8A 1GL8A 1XOBA 1FVKA 5DCHA 4XTSA 3I43A 4XRDA 3M0FA 3FR6A 5HR2A 2KUCA 2IMFA 4NXIA 1DE2A 1EZKA 5IMZA 4O5QA 1V9WA 3RPNA 1ZOFA 1XIYA 3H1NA 4KW6A 1E6BA 1HQOA 2BMXA 4ICYA 1AUCA 2JZSA 1K0NA 2HSHA 4KE3A 7GSSA 1SK1A 4QL7A 1WRYA 2P5RA 4N0VA 2FD3A 4MPGA 1JFUA 5D96A 1GSYA 2GSQA 3HJOA 3L9VA 4POLA 1JZOA 4MF6A 4ZB8A 4ZL9A 19GSA 3FKFA 3KP9A 1YJ6A 4EXJA 3UARA 3TB2A 4KSOA 1ZZYA 3ZYWA 2HZFA 4V2MA 4OFMA 4L0WA 4YKGA 2C0DA 4J2FA 3LYPA 5IO0A 5JWRB 2YZUA 1QUWA 3MDKA 3RDWA 2L59A 1PGTA 4ML1A 3TJGA 1F37A 1TJDA 2RM6A 5IMCA 2DJ2A 1XWBA 3HYPA 4EIQA 2YN1A 4LL1B 4IVFA 1QGVA 4POBA 4IP1A 3CYNA 3NZNA 3G7IA 1ILOA 1B9XC 5G1LA 2E0QA 4EE0A 1QXHA 3LEFA 1IYHA 5DAKA 2A2SA 5DJMA 3WT2A 2I3YA 3I9V2 2CQ9A 4PGTA 5IMDA 5IM9A 4LL4B 4TXOB 2VM2A 3ZVJD 3FEUA 1BX9A 4KSMA 3L9UA 3FZ4A 2R2JA 1Z5YE 1JLVA 3LXZA 2XPDA 2KLXA 1TI1A 3WGXA 1ML6A 2AAWA 4YQMA 1BQ7A 1MD4A 4ML6A 2WS2A 3CBUA 3F3RA 2LNSA 1F6MC 2C0FA 5G5EA 2OJLA 4JZQA 3WGDA 3BCKA 2IMKA 1FB0A 4OFTA 4O5UA 2HZEB 1MTCA 2LV3A 2K8SA 3CTFA 2YOIA 2FNOA 2EIOA 4IS0A 2D2ZA 3S9FA 1ON4A 2P0GA 4IP6A 5IPGA 1M0UA 2DMMA 2R0PA 4DSSA 4ZBDA 3DVXA 3QAGA 1WE0A 1XW5A 1N8JA 3VWXA 1X5CA 2VCQA 2MBSA 3Q18A 4HU9A 2P5QA 3EMPA 5J5NA 1Y25A 5ENUA 5IOWA 4BIKA 1VRSD 4DVCA 1THXA 4DSRA 3C73A 3FHKA 2N5BA 2WULA 4Q5NA 4MLYA 1XZOA 2A4HA 2WZ9A 3ZVJA 4Z2UA 3LJRA 3F8UA 1B4PA 1B8XA 1SJZA 2K9FA 1T3BA 2OE3A 2HYXA 3HZ4A 1SK2A 3G7YA 17GSA 1RQMA 1PMTA 5ECPB 1XWCA 5CNWA 2IWTA 4AF2A 3W8SA 4ECBA 4EO3A 1MD3A 4ISDA 1GSSA 2H01A 13GSA 5AIVA 2NPBA 5C04A 4IBPA 4Q5QA 4HZ4A 3VWVA 4E8HA 1UA5A 3ZIVA 5FT3A 5GAND 1PKWA 1TW9A 4GSTA 1NHYA 1SKWB 4MH3A 4WR4A 2CX4A 3QAVA 3UOMA 2OE1A 4IGJA 1BEDA 2DIYA 4KB3A 1XW9A 1T4YA 1WMJA 1JZWA 1TP9A 2OBIA 2KP1A 2L6CA 5F07A 2E2MA 4YQUA 3G9BA 1K0OA 4CW9A 3QCPA 3TRPA 4XHMA 2K8VA 2V2GA 3KJYA 1DUGA 1PL1A 3QFAC 4G2EA 2MMZA 3PGTA 3A2XA 1YKAA 3UVTA 2J9HA 3ZMLA 1K3YA 4K0NA 4FH8A 2H8LA 2IMIA 2KP2A 4I2TA 1YEXA 5J9BA 1G6WA 4OD7A 2ZUPA 3GIXA 1NM3A 1ERTA 2V1MA 3LGCA 1OKDA 2DJKA 4KH7A 3QFBC 1HYUA 4L5OA 1ZL9A 4Z2RA 3O6TA 1G0TA 1ZGNA 3FR3A 3DGQA 1GTBA 1OC9B 3CSHA 3E9JB 2WCIA 3GKKA 5FWGA 2LS5A 3ZL5A 4PX1A 3E0UA 2O87A 2MYGA 3GH6A 4MMMA 5HR3A 4KDYA 1QQ2A 2MBTA 2F51A 3KZQA 5JWOB 2IN3A 2CVDA 4XCSA 3MAKA 3GMFA 2F3MA 1AXDA 1PA3A 1H4OA 2IPAA 5A4WA 3ZFLA 1KNGA 1PL2A 3APOA 4HI7A 4GQFA 4MZBA 4AJ6A 2HFDA 3CXGA 6GSWA 3GX0A 2X8HA 2VLUA 3HJMA 1Y6EA 4J56E 2V41A 2FLSA 4TKYA 2HSMA 5F8BA 2PWJA 3GRXA 1M2BA 2QKEA 2VOCA 2L4QA 1USBA 2X8GA 1OE7A 4OMVA 3EVIA 3C71A 4ZB6A 1G7OA 4D73B 2JL4A 1QFNA 4ZBAA 3KD0A 3UVHA 1AQVA 2YWOA 3DVWA 3ZLPA 3J7Yk 4TXOA 1FVJA 3LYKA 18GSA 2AUVA 5EPFA 5CP1A 2H6YA 3D22A 1ZYPA 4EIPA 1A0RP 2A2PA 4K7NA 3TRXA 2FGXA 4XS4B 2QC7A 4MK3A 3UJ1A 3LWAA 4AJ7A 4LA1A 3IR4A 5KN2A 5BMUA 1K0AA 2XBIA 2HE3A 4DSQA 3GSTA 5GSTA 1B9YC 4BPYA 4V1Ag 4NHZA 3HVXA 5EVOA 4KDUA 1M99A 3O76A 2HZEA 5ELGA 4KAEA 2I1UA 1Z7RA 4NHWA 4PNGA 3MWHA 3GTUB 3P2AA 1GRXA 2UZ8A 2CAQA 4KNDA 3ZZXA 2YJHA 4IELA 4USSA 3G7JA 2G2QA 1FHEA 5HFGA 4V2LA 5ECIB 5ECSA 1M9AA 5IIZA 4AJ8A 1Q98A 1G6YA 4ILFA 2ON7A 2YCDA 3GKMA 2VD1A 2GLRA 1GP1A 4KCEA 4J57E 3RAZA 3IAS2 4I97A 2QA2A 5J3RA 5B8AA 4KX4A 4GXZA 5JCWA 2CVKA 4OWYA 3BJ5A 3ERGA 3EYTA 5D9WA 3KMNA 4N11A 3R3EA 4WF5A 10GSA 4FYCA 1IYIA 3SWLA 2YNXA 3QMXA 3NIVA 3HVNA 4G0KA 2F9SA 3WD6A 2R37A 5ECQB 1HNCA 6GSTA 5IMFA 5JCGA 4JR4A 3TJJA 2GSSA 2IJYA 2BJXA 4HQZA 2LNTA 5B7CA 4EUYA 2YPMA 1EV9A 5B8BA 4QL9A 2LJKA 3GX8A 2TRCP 3IXRA 1XXUA 1UVZA 5ID2B 4MZWA 5G30A 2RIIA 11GSA 5D73A 5J9CA 3KXOA 1ACVA 1S3DA 2H76A 5H5RA 3KTLA 3TJBA 2VCTA 3DYRA 1SENA 2HRFA 4MP4A 4MJEA 2C3QA 1J9BA 1FW1A 1A24A 1TKDB 2XPEA 5JWQB 1BJXA 2DKHA 3HKRA 1T4ZA 1ST9A 1TRUA 1VF4A 5H5SA 4JRRA 3V1WA 4K2XA 4POKA 1GSUA 3ZFBA 2DMLA 2FWEA 2DLXA 3US3A 3GYKA 1UN2A 3VI5A 2DSAA 2HSYA 4EF0A 2GQKA 1SD9A 1OVNA 2B7JA 4EDYA 2C8UA 5ELAA 1XVWA 1TK5B 1V98A 3KTBA 2VLTA 3UBLA 3EWLA 3CRUA 4KF9A 1FO5A 2CV4A 5ECRB 1M2DA 5DJLA 2JADA 4HDEA 4NPBA 4K5RA 5EL8A 3IDVA 4O32A 2RUFA 3FYGA 4ZL7A 1OC9A 3GA4A 3FY7A 2IFQB 4ZILA 4TW5A 4I6XA 3WGEA 2C0GA 1AQXA 3H4KA 2VCVA 4IJIA 2H66A 5JCUA 4FIWA 4MDCA 4IN0A 3D5JA 2DJJA 3HA9A 4RI6A 5AGYA 3VFIA 2WFCA 2ES7A 4MZCA 2O8VB 1DSBA 3C8EA 3TJKA 1VF1A 3PR8A 4XS1A 1JLWA 4K0GA 1MDIA 3GSSA 4CY8A 1TOFA 4HJMA 2NBSA 4MF7A 3TKSE 1X9SB 2WB9A 2RUEA 5G1KA 3IC8A 2X49A 3EPTA 2E7PA 2H6XA 4PUFC 1ABAA 4HSCX 4XRAA 3HVSA 1DBYA 2MZCA 3FZ5A 3TOUA 2FY6A 4A5PA 4KA0A 3TKPA 1ERVA 5HFIA 4WBJA 4G0IA 1GWCA 5F06A 3BCIA 4D73A 3PINA 2QA1A 5G2ZA 5ECKB 4TN8A 3VPTA 4F2IA 4BVYB 2OBKA 1EP8A 4NAXA 2GGTA 1J08A 3L78A 4Q5RA 5E59A 2O89A 2AJQB 3AY8A 1M7TA 1O6JA 1ERUA 3IAM2 4WEYA 14GSA 4I2UA 4YH2A 4WR5A 4K9ZA 3Q6OA 4I8BA 1URMA 1XBSA 2NVLA 4MJCA 3DD3A 3HD5A 4TR4A 2H1AA 4KUNA 4BA7A 4F82A 3GN3A 4LMVA 3RPPA 3GTUA 2XC2A 3GH9A 5GZZB 4X1UA 3E3EA 3GFKA 2CX3A 4FQUA 3UAPA 4HU7A 2JSYA 2FCHA 4K7OA 1VF2A 3GUSA 5CRDA 1O8WA 2CA8A 4PUAA 2B1KA 3RHBA 3TDGA 4HOJA 4GCIA 4RUVA 4RQXA 4PURA 5DALA 2I81A 4KDXA 4POMA 1NSWA 3ERFA 1RW1A 4H86A 3U6VA 2JU5A 4PTSA 2OA7A 5ECHB 4BVXB 4JE1A 1KTEA 2MMNA 3H8QA 4TOPA 3EMXA 3GHAA 3ME8A 1ZYEA 3FK8A 4ZXGA 1GUKA 5IMAA 4QQ7A 4F0CA 4Z7XA 5HQPA 4OFNA 3F6FA 3Q19A 2PPTA 1MEKA 2DJ1A 5CYYA 4ECJA 5KEJA 4GQCA 1JHBA 2H1GA 1YDKA 2VL3A 3LG6A 1GTIA 1VGLA 2XBQA 2VD0A 3IBHA 1S3RA 1GTUA 1ZYQB 1SD8A 3VPQA 2GTUA 4K8MA 4PQHA 22GSA 4HUAA 3JCML 1SK0A 5D93A 1WPIA 1PSQA 1Z6NA 4V1Ap 4YAPA 4O5RA 3TKSA 1TRVA 2EC4A 5KOWA 2C80A 2XHFA 2VLVA 2H70A 1OYJA 2K18A 1NHOA 2CAIA 5CREA 5D8IA 4K1FA 5DAKB 2O85A 1XG8A 3KCMA 2VM1A 1O81A 1C72A 1TK0B 2GQLA 5AISA 3ZMKA 2FWFA 3C1RA 3I69A 4YKFA 3KIJA 1OAZA 4ZIJA 3C7MA 1GUHA 3L0HA 2F8AA 4G9HA 4FYBA 3ZREA 3LSZA 4PNFA 1EEMA 3C1SA 1EGRA 2G0FA 1T7PB 4YQVA 4EC0A 1Z3EA 3KH7A 1A2MA 4V2NA 2R0CA 3EU3A 1YQ1A 1ZCPA 1GUMA 4E8EA 2FUG2 5E4WA 5LNKe 4MCUA 2WDUA 4JR6A 3H79A 4MF5A 3A2WA 1GNWA 2GQMA 3GKNA 1I5GA 5G31A 3F4SA 1OE8A 2OADA 2C3TA 2C3NA 2LSTA 5HR1A 2A4VA 3TGZA 2IFQA 1U3IA 4JU5A 1PQNA 3DIEA 2PBJA 3TRQA 8GSSA 2ZNMA 1K3OA 4G19A 5DBQA 3VLNA 3HDCA 4TR0A
chains in the Genus database with same CATH topology
20GSA 2FWGA 2EIRA 2GZYA 2H6ZA 1AW9A 3ED3A 1EOGA 1E2YA 1U88A 4CDOA 3F3QA 4IQ1A 3HVVA 3EINA 2VAFA 2VL2A 4N0ZA 4GF0A 1GSFA 2B1LA 3WYWA 5BRTA 1YF1A 1PRXA 2JSZA 2MMAA 1XWGA 2GDRA 1J0FA 1WIKA 2HRNA 1EGOA 3APSA 2YWMA 2O7KA 3QR6A 3DKSA 3U5RE 4HZ2A 5AIXA 4MABA 5IOXA 4ECIA 5DQYA 1A0FA 1KEBA 3LFLA 3Q74A 4I5QA 5F0GA 1LU4A 3GURA 1S3CA 1A2JA 5AN1A 5GSSA 4BVYA 1TI3A 1K3LA 1ZMAA 3HHVA 2TRXA 3R2QA 4BWQA 3EURA 2DKIA 2PN8A 4FYUA 2H1DA 4TR1B 4OO4A 2IL3A 2VUPA 2YV9A 3TOTA 1CQHA 3GKXA 2L5LA 1XCCA 4FO5A 4NMUA 1GSDA 2X64A 2DBCA 4CHSA 3TJFA 1PN9A 2OACA 4GSSA 3D4MA 5A4VA 2C0EA 4GRFA 3WT1A 3UMAA 4GTUA 2B5YA 1A23A 2HRKA 2GT5A 1K0BA 5EY6A 4RI7A 3IE3A 4Q5FA 1WOUA 3TUEA 1TRWA 3IRAA 2DJ3A 2GSRA 1FB6A 1V57A 3UEMA 1AQWA 2DC5A 1YY7A 1GLPA 2TIRA 1G7EA 3EE2A 5ECNB 1BYEA 3PH9A 3UBKA 3LW9A 3F6DA 3TKSC 1HNAA 5GAPD 4NWYA 4LLRA 3FMWA 2LTKA 2LEGA 4BVXA 3CSJA 3UIWA 3P8WA 3A3TA 2HNLA 4NV5A 1AIUA 3DMLA 5A5KA 1SYRA 2GZZA 4TR3A 3FW2A 1FAAA 2V32A 3DXBA 1R5AA 3IK9A 1B48A 2AHEA 3D0ZA 3GV1A 2C4JA 4MPFA 1X0RA 1R26A 2A2RA 5DCGA 2H30A 3L4NA 2GSTA 1XOAA 5KN1A 2K6VA 4ECCA 5KN3A 2PMTA 5INYA 5J41A 2H73A 5CAXA 4F03A 2V6OA 4G10A 4F0BA 5DQSA 5DVBA 5CO3A 3A5IA 3D21A 1FG4A 3HXSA 5LCZA 2FHEA 3P7XA 1GULA 5ABRA 3IK7A 3M1GA 5D9VA 3CSIA 5B6MA 3APQA 2YANA 1TTZA 1AC1A 4WBRD 1SJIA 2NDOA 6GSYA 2FA8A 2H19A 1EEJA 2H0IA 3F4RA 2AB6A 2I4AA 3LORA 1W4VA 3P90A 3HJPA 1GTAA 2KHPA 2ZCTA 2VCXA 2OKAA 3KH9A 1EOHA 3PPUA 1TU8A 2VL2C 1O7UA 1XFLA 2AYTA 1S3AA 2WRTA 3QD9A 1TDIA 3BD2A 4ACSA 1SU9A 1MDKA 3F0IA 1I9DA 2C1YA 2N5FA 1ERWA 1THOA 5IMVA 4EDZA 2PVOC 1DE1A 4L5LA 2B3SA 1SKSB 1WJKA 3ISOA 1TXXA 1XPVA 1U3AA 1Q4JA 3BBYA 1YF0A 16GSA 3W8JA 3MNGA 2VL9A 3CRTA 1BG5A 3J7Yb 3ERWA 1R4WA 2H72A 3UL3A 4XS4A 4BL7B 1Z9HA 1JZDA 1UC7A 1GNEA 5L71A 4IQAA 2H1BA 3FR9A 2GVPA 2QSIA 1EWXA 2HXKA 1T1VA 2B5XA 1GLQA 1VF3A 4ZBBA 4BWSA 1U87A 5D9XA 1R5PA 1SJ6A 2ALBA 1K0MA 1M2AA 2LRCA 12GSA 3VK9A 2YZHA 2H74A 1NW2A 3HZ8A 2E2GA 2L57A 2PVQA 4OCFA 3KP8A 2VO4A 1GH2A 2EIQA 3N9JA 3HY2A 4YAVA 3GL3A 3QAWA 3VURA 4AGSA 4F9ZA 3IHQA 2YV7A 3CMIA 4RQRA 2IIYA 3EC3A 4IHUA 1Z7PA 2X8CA 5CRHA 4TRXA 4HJ2A 6GSUA 5ECLB 4PXOA 1LJRA 3VWUA 3N5OA 4TR1A 6GSVA 1OKTA 3ZTLA 2P31A 3A2VA 2X4AA 3KM6A 3QDNA 2R5GA 1LBKA 1XWKA 2V6KA 2RM5A 1O85A 5CRWA 1FOVA 2M72A 3IPZA 3BOAA 3TKRA 4JEDA 1A8YA 3KMOA 2PGTA 3RHCA 3LXTA 1MDJA 2GT6A 5ECMB 2DIZA 4LMWA 4XS6A 4WF4A 1WP0A 1SL0B 2MMOA 2H75A 2HLSA 1PN0A 2M46A 2R0GA 4JBBA 4O92A 9GSSA 1F3BA 1X5DA 4HEA2 5ID2A 4MJAA 2X99A 5B6NA 2R3XA 2R6KA 2JZRA 4OO5A 4ZB9A 3ZITA 2NTOA 1V2AA 2N5AA 3MSZA 2LRTA 2VCWA 4G0LA 3I6AA 2GZPA 3M9JA 1W89A 2HRAA 2RLIA 1TU7A 1N2AA 3EU4A 1OC8A 3O3TA 3D6IA 4Z2TA 5IPHA 4MNNA 4KCAA 1GSEA 1HD2A 1A8LA 4K6XA 1RK4A 5J4UA 1FOHA 1XWAA 3M3MA 3DEXA 2HI7A 2IMEA 1YEPA 3SBCA 1QMVA 2B7KA 2PUKC 1K0DA 4HQSA 4X4JA 4P3YB 3DRNA 3F63A 4N30A 1PKZA 2LJRA 3CTGA 3KEBA 4L0UA 4TVEA 1TRSA 3MYDA 1SYXA 1PX6A 1WWJA 5G5FA 3H93A 1QK8A 4XIHA 2FA4A 5F05A 2M80A 3IA1A 1GSQA 3LQ7A 4MA9A 4WKWA 3IC4A 3IOSA 3W6GA 4PQ1A 5DDLA 1V40A 2GS3A 2L5OA 4MJBA 1PX7A 1F9MA 1V58A 2HT9A 3KGKA 2IMDA 2VCZA 1B4QA 2R4VA 4DSSB 5HR0A 4GWRA 1T00A 1EV4A 2AV4A 4PQIA 2LQOA 3ZRDA 5COHA 4X43A 1H75A 2WGRA 2BTOT 4EKZA 3A5WA 2CVBA 1CQGA 3ZIJA 5KOXA 3RBTA 3M9KA 4CY6A 4TXVA 2CT6A 2ON5A 2REMA 1SL1B 4X0XA 4EVMA 1SL2B 3F9UA 1OC3A 1KBNA 3TKQA 1Z6MA 2YJ7A 4K7IA 3HCZA 3NOFA 2B6MA 4L8EA 5C00A 3F4TA 5FHIA 1F2EA 4IW9A 2L6DA 5HFKA 3ME7A 5ECOB 2B5EA 1U6TA 2JZTA 2LQQA 3GNJA 3IV4A 5A4UA 1T8EB 5KN0A 2I9HA 4ULXA 6GSXA 2YWNA 4GSNA 4OCEA 3TCOA 1BAYA 2F8FA 2DJ0A 1X5EA 2H0HA 2CZ2A 3FZ9A 2KOKA 4ID0A 3DWVA 3QPMA 2L4CA 1O73A 4DEJA 4EL1A 2LRNA 2YWIA 3MIXA 1O8XA 1F3AA 2Z9SA 2PU9C 4WXTA 1EP7A 4IJ3A 5IO2A 1X9WB 3VWWA 1K0CA 1SKRB 2JACA 5LD0A 2J23A 3OR5A 2FWHA 4O7HA 2PERA 1PD21 1ZYNA 1R7HA 4BL7A 1JZRA 1X9MB 1YKCA 1TK8B 3QOUA 4K2DA 6GSSA 2LUSA 4N10A 1YZXA 3FRCA 4K5SA 4KGIA 3FZAA 5DALB 5D9TA 4MH2A 2WJUA 5CRGA 5IQYA 2YP6A 5H5QA 4HS1A 1A2LA 2QGVA 1M9BA 2H71A 3D4TA 2VIMA 4IKHA 2CZ3A 3IHGA 3L9SA 1HNBA 3K8NA 1XVQA 1AAZA 4NV2A 2OE0A 4GLTA 1XW6A 3M8NA 4WETA 2H0GA 3VI7A 2LJAA 2LKUA 3GL5A 4ZL8A 1GL8A 1XOBA 1FVKA 5DCHA 4XTSA 3I43A 4XRDA 3M0FA 3FR6A 5HR2A 2KUCA 2IMFA 4NXIA 1DE2A 1EZKA 5IMZA 4O5QA 1V9WA 3RPNA 1ZOFA 1XIYA 3H1NA 4KW6A 1E6BA 1HQOA 2BMXA 4ICYA 1AUCA 2JZSA 1K0NA 2HSHA 4KE3A 7GSSA 1SK1A 4QL7A 1WRYA 2P5RA 4N0VA 2FD3A 4MPGA 1JFUA 5D96A 1GSYA 2GSQA 3HJOA 3L9VA 4POLA 1JZOA 4MF6A 4ZB8A 4ZL9A 19GSA 3FKFA 3KP9A 1YJ6A 4EXJA 3UARA 3TB2A 4KSOA 1ZZYA 3ZYWA 2HZFA 4V2MA 4OFMA 4L0WA 4YKGA 2C0DA 4J2FA 3LYPA 5IO0A 5JWRB 2YZUA 1QUWA 3MDKA 3RDWA 2L59A 1PGTA 4ML1A 3TJGA 1F37A 1TJDA 2RM6A 5IMCA 2DJ2A 1XWBA 3HYPA 4EIQA 2YN1A 4LL1B 4IVFA 1QGVA 4POBA 4IP1A 3CYNA 3NZNA 3G7IA 1ILOA 1B9XC 5G1LA 2E0QA 4EE0A 1QXHA 3LEFA 1IYHA 5DAKA 2A2SA 5DJMA 3WT2A 2I3YA 3I9V2 2CQ9A 4PGTA 5IMDA 5IM9A 4LL4B 4TXOB 2VM2A 3ZVJD 3FEUA 1BX9A 4KSMA 3L9UA 3FZ4A 2R2JA 1Z5YE 1JLVA 3LXZA 2XPDA 2KLXA 1TI1A 3WGXA 1ML6A 2AAWA 4YQMA 1BQ7A 1MD4A 4ML6A 2WS2A 3CBUA 3F3RA 2LNSA 1F6MC 2C0FA 5G5EA 2OJLA 4JZQA 3WGDA 3BCKA 2IMKA 1FB0A 4OFTA 4O5UA 2HZEB 1MTCA 2LV3A 2K8SA 3CTFA 2YOIA 2FNOA 2EIOA 4IS0A 2D2ZA 3S9FA 1ON4A 2P0GA 4IP6A 5IPGA 1M0UA 2DMMA 2R0PA 4DSSA 4ZBDA 3DVXA 3QAGA 1WE0A 1XW5A 1N8JA 3VWXA 1X5CA 2VCQA 2MBSA 3Q18A 4HU9A 2P5QA 3EMPA 5J5NA 1Y25A 5ENUA 5IOWA 1VRSD 4DVCA 1THXA 4DSRA 3C73A 3FHKA 2N5BA 2WULA 4Q5NA 4MLYA 1XZOA 2A4HA 2WZ9A 3ZVJA 4Z2UA 3LJRA 3F8UA 1B4PA 1B8XA 1SJZA 2K9FA 1T3BA 2OE3A 2HYXA 3HZ4A 1SK2A 3G7YA 17GSA 1RQMA 1PMTA 5ECPB 1XWCA 5CNWA 2IWTA 4AF2A 3W8SA 4ECBA 4EO3A 1MD3A 4ISDA 1GSSA 2H01A 13GSA 5AIVA 2NPBA 5C04A 4IBPA 4Q5QA 4HZ4A 3VWVA 4E8HA 1UA5A 3ZIVA 5FT3A 5GAND 1PKWA 1TW9A 4GSTA 1NHYA 1SKWB 4MH3A 4WR4A 2CX4A 3QAVA 3UOMA 2OE1A 4IGJA 1BEDA 2DIYA 4KB3A 1XW9A 1T4YA 1WMJA 1JZWA 1TP9A 2OBIA 2KP1A 2L6CA 5F07A 2E2MA 4YQUA 3G9BA 1K0OA 4CW9A 3QCPA 3TRPA 4XHMA 2K8VA 2V2GA 3KJYA 1DUGA 1PL1A 3QFAC 4G2EA 2MMZA 3PGTA 3A2XA 1YKAA 3UVTA 2J9HA 3ZMLA 1K3YA 4K0NA 4FH8A 2H8LA 2IMIA 2KP2A 4I2TA 1YEXA 5J9BA 1G6WA 4OD7A 2ZUPA 3GIXA 1NM3A 1ERTA 2V1MA 3LGCA 1OKDA 2DJKA 4KH7A 3QFBC 1HYUA 4L5OA 1ZL9A 4Z2RA 3O6TA 1G0TA 1ZGNA 3FR3A 3DGQA 1GTBA 1OC9B 3CSHA 3E9JB 2WCIA 3GKKA 5FWGA 2LS5A 3ZL5A 4PX1A 3E0UA 2O87A 2MYGA 3GH6A 4MMMA 5HR3A 4KDYA 1QQ2A 2MBTA 2F51A 3KZQA 5JWOB 2IN3A 2CVDA 4XCSA 3MAKA 3GMFA 2F3MA 1AXDA 1PA3A 1H4OA 2IPAA 5A4WA 3ZFLA 1KNGA 1PL2A 3APOA 4HI7A 4GQFA 4MZBA 4AJ6A 2HFDA 3CXGA 6GSWA 3GX0A 2X8HA 2VLUA 3HJMA 1Y6EA 4J56E 2V41A 2FLSA 4TKYA 2HSMA 5F8BA 2PWJA 3GRXA 1M2BA 2QKEA 2VOCA 2L4QA 1USBA 2X8GA 1OE7A 4OMVA 3EVIA 3C71A 4ZB6A 1G7OA 4D73B 2JL4A 1QFNA 4ZBAA 3KD0A 3UVHA 1AQVA 2YWOA 3DVWA 3ZLPA 3J7Yk 4TXOA 1FVJA 3LYKA 18GSA 2AUVA 5EPFA 5CP1A 2H6YA 3D22A 1ZYPA 4EIPA 1A0RP 2A2PA 4K7NA 3TRXA 2FGXA 4XS4B 2QC7A 4MK3A 3UJ1A 3LWAA 4AJ7A 4LA1A 3IR4A 5KN2A 5BMUA 1K0AA 2XBIA 2HE3A 4DSQA 3GSTA 5GSTA 1B9YC 4BPYA 4V1Ag 4NHZA 3HVXA 5EVOA 4KDUA 1M99A 3O76A 2HZEA 5ELGA 4KAEA 2I1UA 1Z7RA 4NHWA 4PNGA 3MWHA 3GTUB 3P2AA 1GRXA 2UZ8A 2CAQA 4KNDA 3ZZXA 2YJHA 4IELA 4USSA 3G7JA 2G2QA 1FHEA 5HFGA 4V2LA 5ECIB 5ECSA 1M9AA 5IIZA 4AJ8A 1Q98A 1G6YA 4ILFA 2ON7A 2YCDA 3GKMA 2VD1A 2GLRA 1GP1A 4KCEA 4J57E 3RAZA 3IAS2 4I97A 2QA2A 5J3RA 5B8AA 4KX4A 4GXZA 5JCWA 2CVKA 4OWYA 3BJ5A 3ERGA 3EYTA 5D9WA 3KMNA 4N11A 3R3EA 4WF5A 10GSA 4FYCA 1IYIA 3SWLA 2YNXA 3QMXA 3NIVA 4G0KA 2F9SA 3WD6A 2R37A 5ECQB 1HNCA 6GSTA 5IMFA 5JCGA 4JR4A 3TJJA 2GSSA 2IJYA 2BJXA 4HQZA 2LNTA 5B7CA 4EUYA 2YPMA 1EV9A 5B8BA 4QL9A 2LJKA 3GX8A 2TRCP 3IXRA 1XXUA 1UVZA 5ID2B 4MZWA 5G30A 2RIIA 11GSA 5D73A 5J9CA 3KXOA 1ACVA 1S3DA 2H76A 5H5RA 3KTLA 3TJBA 2VCTA 3DYRA 1SENA 2HRFA 4MP4A 4MJEA 2C3QA 1J9BA 1FW1A 1A24A 1TKDB 2XPEA 5JWQB 1BJXA 2DKHA 3HKRA 1T4ZA 1ST9A 1TRUA 1VF4A 5H5SA 4JRRA 3V1WA 4K2XA 4POKA 1GSUA 3ZFBA 2DMLA 2FWEA 2DLXA 3US3A 3GYKA 1UN2A 3VI5A 2DSAA 2HSYA 4EF0A 2GQKA 1SD9A 1OVNA 2B7JA 4EDYA 2C8UA 5ELAA 1XVWA 1TK5B 1V98A 3KTBA 2VLTA 3UBLA 3EWLA 3CRUA 4KF9A 1FO5A 2CV4A 5ECRB 1M2DA 5DJLA 2JADA 4HDEA 4NPBA 4K5RA 5EL8A 3IDVA 4O32A 2RUFA 3FYGA 4ZL7A 1OC9A 3GA4A 3FY7A 2IFQB 4ZILA 4TW5A 4I6XA 3WGEA 2C0GA 1AQXA 3H4KA 2VCVA 4IJIA 2H66A 5JCUA 4FIWA 4MDCA 4IN0A 3D5JA 2DJJA 3HA9A 4RI6A 5AGYA 3VFIA 2WFCA 2ES7A 4MZCA 2O8VB 1DSBA 3C8EA 3TJKA 1VF1A 3PR8A 4XS1A 1JLWA 4K0GA 1MDIA 3GSSA 4CY8A 1TOFA 4HJMA 2NBSA 4MF7A 3TKSE 1X9SB 2WB9A 2RUEA 5G1KA 3IC8A 2X49A 3EPTA 2E7PA 2H6XA 4PUFC 1ABAA 4XRAA 3HVSA 1DBYA 2MZCA 3FZ5A 3TOUA 2FY6A 4A5PA 4KA0A 3TKPA 1ERVA 5HFIA 4WBJA 4G0IA 1GWCA 5F06A 3BCIA 4D73A 3PINA 2QA1A 5G2ZA 5ECKB 4TN8A 3VPTA 4F2IA 4BVYB 2OBKA 1EP8A 4NAXA 2GGTA 1J08A 3L78A 4Q5RA 5E59A 2O89A 2AJQB 3AY8A 1M7TA 1O6JA 1ERUA 3IAM2 4WEYA 14GSA 4I2UA 4YH2A 4WR5A 4K9ZA 3Q6OA 4I8BA 1URMA 1XBSA 2NVLA 4MJCA 3DD3A 3HD5A 4TR4A 2H1AA 4KUNA 4BA7A 4F82A 3GN3A 4LMVA 3RPPA 3GTUA 2XC2A 3GH9A 5GZZB 4X1UA 3E3EA 3GFKA 2CX3A 4FQUA 3UAPA 4HU7A 2JSYA 2FCHA 4K7OA 1VF2A 3GUSA 5CRDA 1O8WA 2CA8A 4PUAA 2B1KA 3RHBA 3TDGA 4HOJA 4GCIA 4RUVA 4RQXA 4PURA 5DALA 2I81A 4KDXA 4POMA 1NSWA 3ERFA 1RW1A 4H86A 3U6VA 2JU5A 4PTSA 2OA7A 5ECHB 4BVXB 4JE1A 1KTEA 2MMNA 3H8QA 4TOPA 3EMXA 3GHAA 3ME8A 1ZYEA 3FK8A 4ZXGA 1GUKA 5IMAA 4QQ7A 4F0CA 4Z7XA 5HQPA 4OFNA 3F6FA 3Q19A 2PPTA 1MEKA 2DJ1A 5CYYA 4ECJA 5KEJA 4GQCA 1JHBA 2H1GA 1YDKA 2VL3A 3LG6A 1GTIA 1VGLA 2XBQA 2VD0A 3IBHA 1GTUA 1ZYQB 1SD8A 3VPQA 2GTUA 4K8MA 4PQHA 22GSA 4HUAA 3JCML 1SK0A 5D93A 1WPIA 1PSQA 1Z6NA 4V1Ap 4YAPA 4O5RA 3TKSA 1TRVA 2EC4A 5KOWA 2C80A 2XHFA 2VLVA 2H70A 1OYJA 2K18A 1NHOA 2CAIA 5CREA 5D8IA 4K1FA 5DAKB 2O85A 3KCMA 2VM1A 1O81A 1C72A 1TK0B 2GQLA 5AISA 3ZMKA 2FWFA 3C1RA 3I69A 4YKFA 3KIJA 1OAZA 4ZIJA 3C7MA 1GUHA 3L0HA 2F8AA 4G9HA 4FYBA 3ZREA 3LSZA 4PNFA 1EEMA 3C1SA 1EGRA 2G0FA 1T7PB 4YQVA 4EC0A 1Z3EA 3KH7A 1A2MA 4V2NA 2R0CA 3EU3A 1YQ1A 1ZCPA 1GUMA 4E8EA 2FUG2 5E4WA 5LNKe 4MCUA 2WDUA 4JR6A 3H79A 4MF5A 3A2WA 1GNWA 2GQMA 3GKNA 1I5GA 5G31A 3F4SA 1OE8A 2OADA 2C3TA 2C3NA 2LSTA 5HR1A 2A4VA 3TGZA 2IFQA 1U3IA 4JU5A 1PQNA 3DIEA 2PBJA 3TRQA 8GSSA 2ZNMA 1K3OA 4G19A 5DBQA 3VLNA 3HDCA 4TR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 20GS A;  2FWG A;  2EIR A;  2GZY A;  2H6Z A;  1AW9 A;  3ED3 A;  1EOG A;  1E2Y A;  1U88 A;  4CDO A;  3F3Q A;  4IQ1 A;  3HVV A;  3EIN A;  2VAF A;  2VL2 A;  4N0Z A;  4GF0 A;  1GSF A;  2B1L A;  3WYW A;  1YF1 A;  1PRX A;  2JSZ A;  2MMA A;  1XWG A;  2GDR A;  1J0F A;  1WIK A;  2HRN A;  1EGO A;  3APS A;  2YWM A;  2O7K A;  3QR6 A;  3DKS A;  3U5R E;  4HZ2 A;  5AIX A;  4MAB A;  5IOX A;  4ECI A;  5DQY A;  1A0F A;  1KEB A;  3LFL A;  3Q74 A;  4I5Q A;  5F0G A;  1LU4 A;  3GUR A;  1S3C A;  1A2J A;  5AN1 A;  5GSS A;  4BVY A;  1TI3 A;  1K3L A;  1ZMA A;  3HHV A;  2TRX A;  3R2Q A;  4BWQ A;  3EUR A;  2PN8 A;  4FYU A;  2H1D A;  4TR1 B;  4OO4 A;  2IL3 A;  2VUP A;  2YV9 A;  3TOT A;  1CQH A;  3GKX A;  2L5L A;  1XCC A;  4FO5 A;  4NMU A;  1GSD A;  2X64 A;  2DBC A;  4CHS A;  3TJF A;  1PN9 A;  2OAC A;  4GSS A;  3D4M A;  5A4V A;  2C0E A;  4GRF A;  3WT1 A;  3UMA A;  4GTU A;  2B5Y A;  1A23 A;  2GT5 A;  1K0B A;  5EY6 A;  4RI7 A;  3IE3 A;  4Q5F A;  1WOU A;  3TUE A;  1TRW A;  3IRA A;  2DJ3 A;  2GSR A;  1FB6 A;  1V57 A;  3UEM A;  1AQW A;  2DC5 A;  1YY7 A;  1GLP A;  2TIR A;  1G7E A;  3EE2 A;  5ECN B;  1BYE A;  3PH9 A;  3UBK A;  3F6D A;  3TKS C;  1HNA A;  5GAP D;  4NWY A;  4LLR A;  2LTK A;  2LEG A;  4BVX A;  3CSJ A;  3UIW A;  3P8W A;  3A3T A;  2HNL A;  4NV5 A;  1AIU A;  3DML A;  5A5K A;  1SYR A;  2GZZ A;  4TR3 A;  3FW2 A;  1FAA A;  2V32 A;  3DXB A;  1R5A A;  3IK9 A;  1B48 A;  2AHE A;  3D0Z A;  3GV1 A;  2C4J A;  4MPF A;  1X0R A;  1R26 A;  2A2R A;  5DCG A;  2H30 A;  3L4N A;  2GST A;  1XOA A;  5KN1 A;  2K6V A;  4ECC A;  5KN3 A;  2PMT A;  5INY A;  5J41 A;  2H73 A;  5CAX A;  4F03 A;  2V6O A;  4G10 A;  4F0B A;  5DQS A;  5DVB A;  5CO3 A;  3D21 A;  1FG4 A;  3HXS A;  5LCZ A;  2FHE A;  3P7X A;  1GUL A;  5ABR A;  3IK7 A;  3M1G A;  5D9V A;  3CSI A;  5B6M A;  3APQ A;  2YAN A;  1TTZ A;  1AC1 A;  4WBR D;  1SJI A;  2NDO A;  6GSY A;  2FA8 A;  2H19 A;  1EEJ A;  2H0I A;  3F4R A;  2AB6 A;  2I4A A;  3LOR A;  1W4V A;  3P90 A;  3HJP A;  1GTA A;  2KHP A;  2ZCT A;  2VCX A;  2OKA A;  3KH9 A;  1EOH A;  1TU8 A;  2VL2 C;  1O7U A;  1XFL A;  2AYT A;  1S3A A;  2WRT A;  3QD9 A;  1TDI A;  3BD2 A;  4ACS A;  1SU9 A;  1MDK A;  3F0I A;  1I9D A;  2C1Y A;  2N5F A;  1ERW A;  1THO A;  5IMV A;  4EDZ A;  2PVO C;  1DE1 A;  4L5L A;  2B3S A;  1SKS B;  1WJK A;  3ISO A;  1TXX A;  1XPV A;  1U3A A;  1Q4J A;  3BBY A;  1YF0 A;  16GS A;  3W8J A;  3MNG A;  2VL9 A;  3CRT A;  1BG5 A;  3J7Y b;  3ERW A;  1R4W A;  2H72 A;  3UL3 A;  4XS4 A;  1Z9H A;  1JZD A;  1UC7 A;  1GNE A;  5L71 A;  4IQA A;  2H1B A;  3FR9 A;  2GVP A;  2QSI A;  1EWX A;  2HXK A;  1T1V A;  2B5X A;  1GLQ A;  1VF3 A;  4ZBB A;  4BWS A;  1U87 A;  5D9X A;  1R5P A;  1SJ6 A;  2ALB A;  1K0M A;  1M2A A;  2LRC A;  12GS A;  3VK9 A;  2YZH A;  2H74 A;  1NW2 A;  3HZ8 A;  2E2G A;  2L57 A;  2PVQ A;  4OCF A;  3KP8 A;  2VO4 A;  1GH2 A;  2EIQ A;  3N9J A;  3HY2 A;  4YAV A;  3GL3 A;  3QAW A;  3VUR A;  4AGS A;  4F9Z A;  3IHQ A;  2YV7 A;  3CMI A;  4RQR A;  2IIY A;  3EC3 A;  4IHU A;  1Z7P A;  2X8C A;  5CRH A;  4TRX A;  4HJ2 A;  6GSU A;  5ECL B;  4PXO A;  1LJR A;  3VWU A;  3N5O A;  4TR1 A;  6GSV A;  1OKT A;  3ZTL A;  2P31 A;  3A2V A;  3KM6 A;  3QDN A;  2R5G A;  1LBK A;  1XWK A;  2V6K A;  2RM5 A;  1O85 A;  5CRW A;  1FOV A;  2M72 A;  3IPZ A;  3BOA A;  3TKR A;  4JED A;  1A8Y A;  3KMO A;  2PGT A;  3RHC A;  3LXT A;  1MDJ A;  2GT6 A;  5ECM B;  2DIZ A;  4LMW A;  4XS6 A;  4WF4 A;  1WP0 A;  1SL0 B;  2MMO A;  2H75 A;  2HLS A;  2M46 A;  9GSS A;  4JBB A;  4O92 A;  1F3B A;  1X5D A;  4HEA 2;  5ID2 A;  4MJA A;  2X99 A;  5B6N A;  2R3X A;  2R6K A;  2JZR A;  4OO5 A;  4ZB9 A;  3ZIT A;  2NTO A;  1V2A A;  2N5A A;  3MSZ A;  2LRT A;  2VCW A;  3I6A A;  2GZP A;  3M9J A;  1W89 A;  2RLI A;  1TU7 A;  1N2A A;  3EU4 A;  1OC8 A;  3O3T A;  3D6I A;  5IPH A;  4KCA A;  1GSE A;  1HD2 A;  1A8L A;  4K6X A;  1RK4 A;  5J4U A;  1XWA A;  3M3M A;  3DEX A;  2HI7 A;  2IME A;  1YEP A;  3SBC A;  1QMV A;  2B7K A;  2PUK C;  1K0D A;  4HQS A;  4P3Y B;  3DRN A;  3F63 A;  4N30 A;  1PKZ A;  2LJR A;  3CTG A;  3KEB A;  4L0U A;  4TVE A;  1TRS A;  1SYX A;  1PX6 A;  1WWJ A;  5G5F A;  3H93 A;  1QK8 A;  4XIH A;  2FA4 A;  5F05 A;  2M80 A;  3IA1 A;  1GSQ A;  3LQ7 A;  4MA9 A;  4WKW A;  3IC4 A;  3IOS A;  3W6G A;  4PQ1 A;  5DDL A;  1V40 A;  2GS3 A;  2L5O A;  4MJB A;  1PX7 A;  1F9M A;  1V58 A;  2HT9 A;  3KGK A;  2IMD A;  2VCZ A;  1B4Q A;  2R4V A;  4DSS B;  5HR0 A;  4GWR A;  1T00 A;  1EV4 A;  2AV4 A;  4PQI A;  2LQO A;  3ZRD A;  5COH A;  4X43 A;  1H75 A;  2WGR A;  2BTO T;  4EKZ A;  3A5W A;  2CVB A;  1CQG A;  3ZIJ A;  3RBT A;  3M9K A;  4TXV A;  2CT6 A;  2ON5 A;  2REM A;  1SL1 B;  4X0X A;  4EVM A;  1SL2 B;  3F9U A;  1OC3 A;  1KBN A;  3TKQ A;  1Z6M A;  2YJ7 A;  4K7I A;  3HCZ A;  3NOF A;  2B6M A;  4L8E A;  5C00 A;  3F4T A;  5FHI A;  1F2E A;  4IW9 A;  2L6D A;  5HFK A;  3ME7 A;  5ECO B;  2B5E A;  1U6T A;  2JZT A;  2LQQ A;  3GNJ A;  3IV4 A;  5A4U A;  1T8E B;  5KN0 A;  2I9H A;  4ULX A;  6GSX A;  2YWN A;  4GSN A;  4OCE A;  3TCO A;  1BAY A;  2F8F A;  2DJ0 A;  1X5E A;  2H0H A;  2CZ2 A;  3FZ9 A;  2KOK A;  4ID0 A;  3DWV A;  3QPM A;  2L4C A;  1O73 A;  4DEJ A;  4EL1 A;  2LRN A;  2YWI A;  1O8X A;  1F3A A;  2Z9S A;  2PU9 C;  4WXT A;  1EP7 A;  4IJ3 A;  5IO2 A;  1X9W B;  3VWW A;  1K0C A;  1SKR B;  2JAC A;  5LD0 A;  2J23 A;  3OR5 A;  2FWH A;  4O7H A;  2PER A;  1PD2 1;  1R7H A;  4BL7 A;  1JZR A;  1X9M B;  1YKC A;  1TK8 B;  3QOU A;  4K2D A;  6GSS A;  2LUS A;  4N10 A;  1YZX A;  3FRC A;  4KGI A;  3FZA A;  5DAL B;  5D9T A;  4MH2 A;  2WJU A;  5CRG A;  5IQY A;  2YP6 A;  5H5Q A;  4HS1 A;  1A2L A;  2QGV A;  1M9B A;  2H71 A;  3D4T A;  2VIM A;  4IKH A;  2CZ3 A;  3L9S A;  1HNB A;  3K8N A;  1XVQ A;  1AAZ A;  4NV2 A;  2OE0 A;  4GLT A;  1XW6 A;  3M8N A;  4WET A;  2H0G A;  3VI7 A;  2LJA A;  2LKU A;  3GL5 A;  4ZL8 A;  1GL8 A;  1XOB A;  1FVK A;  5DCH A;  4XTS A;  3I43 A;  4XRD A;  3M0F A;  3FR6 A;  5HR2 A;  2KUC A;  2IMF A;  4NXI A;  1DE2 A;  1EZK A;  5IMZ A;  1V9W A;  3RPN A;  1ZOF A;  1XIY A;  3H1N A;  4KW6 A;  1E6B A;  1HQO A;  2BMX A;  1AUC A;  2JZS A;  1K0N A;  2HSH A;  4KE3 A;  7GSS A;  1SK1 A;  4QL7 A;  1WRY A;  2P5R A;  4N0V A;  2FD3 A;  4MPG A;  1JFU A;  5D96 A;  1GSY A;  2GSQ A;  3HJO A;  3L9V A;  4POL A;  1JZO A;  4MF6 A;  4ZB8 A;  4ZL9 A;  19GS A;  3FKF A;  3KP9 A;  1YJ6 A;  4EXJ A;  3UAR A;  3TB2 A;  4KSO A;  1ZZY A;  3ZYW A;  2HZF A;  4V2M A;  4OFM A;  4L0W A;  2C0D A;  4J2F A;  3LYP A;  5IO0 A;  5JWR B;  2YZU A;  1QUW A;  3MDK A;  3RDW A;  2L59 A;  1PGT A;  4ML1 A;  3TJG A;  1F37 A;  1TJD A;  2RM6 A;  5IMC A;  2DJ2 A;  1XWB A;  3HYP A;  2YN1 A;  4LL1 B;  4IVF A;  1QGV A;  4POB A;  4IP1 A;  3CYN A;  3NZN A;  3G7I A;  1ILO A;  1B9X C;  5G1L A;  2E0Q A;  4EE0 A;  1QXH A;  3LEF A;  1IYH A;  5DAK A;  2A2S A;  5DJM A;  3WT2 A;  2I3Y A;  3I9V 2;  2CQ9 A;  4PGT A;  5IMD A;  5IM9 A;  4LL4 B;  4TXO B;  2VM2 A;  3ZVJ D;  3FEU A;  1BX9 A;  4KSM A;  3L9U A;  3FZ4 A;  2R2J A;  1Z5Y E;  1JLV A;  3LXZ A;  2XPD A;  2KLX A;  1TI1 A;  3WGX A;  1ML6 A;  2AAW A;  4YQM A;  1BQ7 A;  1MD4 A;  4ML6 A;  2WS2 A;  3CBU A;  3F3R A;  2LNS A;  1F6M C;  2C0F A;  5G5E A;  2OJL A;  4JZQ A;  3WGD A;  3BCK A;  2IMK A;  1FB0 A;  4OFT A;  2HZE B;  1MTC A;  2LV3 A;  2K8S A;  3CTF A;  2YOI A;  2FNO A;  2EIO A;  4IS0 A;  2D2Z A;  3S9F A;  1ON4 A;  2P0G A;  4IP6 A;  5IPG A;  1M0U A;  2DMM A;  4DSS A;  4ZBD A;  3DVX A;  3QAG A;  1WE0 A;  1XW5 A;  1N8J A;  3VWX A;  1X5C A;  2VCQ A;  2MBS A;  3Q18 A;  4HU9 A;  2P5Q A;  3EMP A;  5J5N A;  1Y25 A;  5ENU A;  5IOW A;  1VRS D;  4DVC A;  1THX A;  4DSR A;  3C73 A;  3FHK A;  2N5B A;  2WUL A;  4Q5N A;  4MLY A;  1XZO A;  2WZ9 A;  3ZVJ A;  3LJR A;  3F8U A;  1B4P A;  1B8X A;  1SJZ A;  2K9F A;  1T3B A;  2OE3 A;  2HYX A;  3HZ4 A;  1SK2 A;  3G7Y A;  17GS A;  1RQM A;  1PMT A;  5ECP B;  1XWC A;  5CNW A;  2IWT A;  4AF2 A;  3W8S A;  4ECB A;  4EO3 A;  1MD3 A;  4ISD A;  1GSS A;  2H01 A;  13GS A;  5AIV A;  2NPB A;  5C04 A;  4IBP A;  4Q5Q A;  4HZ4 A;  3VWV A;  4E8H A;  1UA5 A;  3ZIV A;  5FT3 A;  5GAN D;  1PKW A;  1TW9 A;  4GST A;  1NHY A;  1SKW B;  4MH3 A;  4WR4 A;  2CX4 A;  3QAV A;  3UOM A;  2OE1 A;  4IGJ A;  1BED A;  2DIY A;  4KB3 A;  1XW9 A;  1T4Y A;  1WMJ A;  1JZW A;  1TP9 A;  2OBI A;  2KP1 A;  2L6C A;  5F07 A;  2E2M A;  4YQU A;  3G9B A;  1K0O A;  4CW9 A;  3QCP A;  3TRP A;  4XHM A;  2K8V A;  2V2G A;  3KJY A;  1DUG A;  1PL1 A;  3QFA C;  4G2E A;  2MMZ A;  3PGT A;  3A2X A;  1YKA A;  3UVT A;  2J9H A;  3ZML A;  1K3Y A;  4K0N A;  4FH8 A;  2H8L A;  2IMI A;  2KP2 A;  4I2T A;  1YEX A;  5J9B A;  1G6W A;  4OD7 A;  2ZUP A;  3GIX A;  1NM3 A;  1ERT A;  2V1M A;  3LGC A;  1OKD A;  2DJK A;  4KH7 A;  3QFB C;  1HYU A;  4L5O A;  1ZL9 A;  3O6T A;  1G0T A;  1ZGN A;  3FR3 A;  3DGQ A;  1GTB A;  1OC9 B;  3CSH A;  3E9J B;  2WCI A;  3GKK A;  5FWG A;  2LS5 A;  3ZL5 A;  4PX1 A;  3E0U A;  2O87 A;  2MYG A;  3GH6 A;  4MMM A;  5HR3 A;  4KDY A;  1QQ2 A;  2MBT A;  2F51 A;  3KZQ A;  5JWO B;  2IN3 A;  2CVD A;  4XCS A;  3MAK A;  3GMF A;  2F3M A;  1AXD A;  1PA3 A;  1H4O A;  2IPA A;  5A4W A;  3ZFL A;  1KNG A;  1PL2 A;  3APO A;  4HI7 A;  4GQF A;  4MZB A;  4AJ6 A;  2HFD A;  3CXG A;  6GSW A;  3GX0 A;  2X8H A;  2VLU A;  3HJM A;  1Y6E A;  4J56 E;  2V41 A;  2FLS A;  4TKY A;  5F8B A;  2PWJ A;  3GRX A;  1M2B A;  2QKE A;  2VOC A;  2L4Q A;  1USB A;  2X8G A;  1OE7 A;  4OMV A;  3EVI A;  3C71 A;  4ZB6 A;  1G7O A;  4D73 B;  2JL4 A;  1QFN A;  4ZBA A;  3KD0 A;  3UVH A;  1AQV A;  2YWO A;  3DVW A;  3ZLP A;  3J7Y k;  4TXO A;  1FVJ A;  3LYK A;  18GS A;  2AUV A;  5EPF A;  5CP1 A;  2H6Y A;  3D22 A;  1A0R P;  4K7N A;  3TRX A;  2FGX A;  4XS4 B;  2QC7 A;  4MK3 A;  3UJ1 A;  3LWA A;  4AJ7 A;  4LA1 A;  3IR4 A;  5KN2 A;  1K0A A;  2XBI A;  2HE3 A;  4DSQ A;  3GST A;  5GST A;  1B9Y C;  4BPY A;  4V1A g;  4NHZ A;  3HVX A;  5EVO A;  4KDU A;  1M99 A;  3O76 A;  2HZE A;  5ELG A;  4KAE A;  2I1U A;  1Z7R A;  4NHW A;  4PNG A;  3MWH A;  3GTU B;  3P2A A;  1GRX A;  2CAQ A;  4KND A;  3ZZX A;  2YJH A;  4IEL A;  3G7J A;  2G2Q A;  1FHE A;  5HFG A;  4V2L A;  5ECI B;  5ECS A;  1M9A A;  5IIZ A;  4AJ8 A;  1Q98 A;  1G6Y A;  4ILF A;  2ON7 A;  2YCD A;  3GKM A;  2VD1 A;  2GLR A;  1GP1 A;  4KCE A;  4J57 E;  3RAZ A;  3IAS 2;  4I97 A;  5J3R A;  5B8A A;  4KX4 A;  4GXZ A;  5JCW A;  2CVK A;  4OWY A;  3BJ5 A;  3ERG A;  3EYT A;  5D9W A;  3KMN A;  4N11 A;  4WF5 A;  10GS A;  4FYC A;  1IYI A;  3SWL A;  2YNX A;  3QMX A;  3NIV A;  2F9S A;  3WD6 A;  2R37 A;  5ECQ B;  1HNC A;  6GST A;  5IMF A;  5JCG A;  4JR4 A;  3TJJ A;  2GSS A;  2IJY A;  2BJX A;  4HQZ A;  2LNT A;  5B7C A;  4EUY A;  2YPM A;  1EV9 A;  5B8B A;  4QL9 A;  2LJK A;  3GX8 A;  2TRC P;  3IXR A;  1XXU A;  1UVZ A;  5ID2 B;  4MZW A;  5G30 A;  2RII A;  11GS A;  5D73 A;  5J9C A;  3KXO A;  1ACV A;  1S3D A;  2H76 A;  5H5R A;  3KTL A;  3TJB A;  2VCT A;  3DYR A;  1SEN A;  2HRF A;  4MP4 A;  4MJE A;  2C3Q A;  1J9B A;  1FW1 A;  1A24 A;  1TKD B;  2XPE A;  5JWQ B;  1BJX A;  3HKR A;  1T4Z A;  1ST9 A;  1TRU A;  1VF4 A;  5H5S A;  4JRR A;  3V1W A;  4POK A;  1GSU A;  3ZFB A;  2DML A;  2FWE A;  2DLX A;  3US3 A;  3GYK A;  1UN2 A;  3VI5 A;  2DSA A;  2HSY A;  4EF0 A;  2GQK A;  1SD9 A;  1OVN A;  2B7J A;  4EDY A;  2C8U A;  5ELA A;  1XVW A;  1TK5 B;  1V98 A;  3KTB A;  2VLT A;  3UBL A;  3EWL A;  3CRU A;  1FO5 A;  2CV4 A;  5ECR B;  1M2D A;  5DJL A;  2JAD A;  4HDE A;  4NPB A;  5EL8 A;  3IDV A;  4O32 A;  2RUF A;  3FYG A;  4ZL7 A;  1OC9 A;  3GA4 A;  3FY7 A;  2IFQ B;  4ZIL A;  4TW5 A;  4I6X A;  3WGE A;  2C0G A;  1AQX A;  3H4K A;  2VCV A;  4IJI A;  2H66 A;  5JCU A;  4FIW A;  4MDC A;  4IN0 A;  3D5J A;  2DJJ A;  3HA9 A;  4RI6 A;  5AGY A;  3VFI A;  2WFC A;  2ES7 A;  4MZC A;  2O8V B;  1DSB A;  3C8E A;  3TJK A;  1VF1 A;  3PR8 A;  4XS1 A;  1JLW A;  4K0G A;  1MDI A;  3GSS A;  1TOF A;  4HJM A;  2NBS A;  4MF7 A;  3TKS E;  1X9S B;  2WB9 A;  2RUE A;  5G1K A;  2E7P A;  2H6X A;  4PUF C;  1ABA A;  4XRA A;  3HVS A;  1DBY A;  2MZC A;  3FZ5 A;  3TOU A;  2FY6 A;  4KA0 A;  3TKP A;  1ERV A;  5HFI A;  4WBJ A;  1GWC A;  5F06 A;  3BCI A;  4D73 A;  3PIN A;  5G2Z A;  5ECK B;  4TN8 A;  3VPT A;  4F2I A;  2OBK A;  1EP8 A;  4NAX A;  2GGT A;  1J08 A;  3L78 A;  4Q5R A;  5E59 A;  2O89 A;  2AJQ B;  3AY8 A;  1M7T A;  1O6J A;  1ERU A;  3IAM 2;  4WEY A;  14GS A;  4I2U A;  4YH2 A;  4WR5 A;  4K9Z A;  3Q6O A;  4I8B A;  1URM A;  1XBS A;  2NVL A;  4MJC A;  3DD3 A;  3HD5 A;  4TR4 A;  2H1A A;  4KUN A;  4BA7 A;  4F82 A;  3GN3 A;  4LMV A;  3RPP A;  3GTU A;  2XC2 A;  3GH9 A;  5GZZ B;  4X1U A;  3E3E A;  3GFK A;  2CX3 A;  3UAP A;  4HU7 A;  2JSY A;  2FCH A;  4K7O A;  1VF2 A;  3GUS A;  5CRD A;  1O8W A;  2CA8 A;  4PUA A;  2B1K A;  3RHB A;  3TDG A;  4HOJ A;  4GCI A;  4RUV A;  4RQX A;  4PUR A;  5DAL A;  2I81 A;  4KDX A;  4POM A;  1NSW A;  3ERF A;  1RW1 A;  4H86 A;  3U6V A;  2JU5 A;  2OA7 A;  5ECH B;  4JE1 A;  1KTE A;  2MMN A;  3H8Q A;  4TOP A;  3EMX A;  3GHA A;  3ME8 A;  1ZYE A;  3FK8 A;  4ZXG A;  1GUK A;  5IMA A;  4QQ7 A;  4F0C A;  4Z7X A;  5HQP A;  4OFN A;  3F6F A;  3Q19 A;  2PPT A;  1MEK A;  2DJ1 A;  5CYY A;  4ECJ A;  5KEJ A;  4GQC A;  1JHB A;  2H1G A;  1YDK A;  2VL3 A;  3LG6 A;  1GTI A;  1VGL A;  2XBQ A;  2VD0 A;  3IBH A;  1GTU A;  1ZYQ B;  1SD8 A;  3VPQ A;  2GTU A;  4K8M A;  4PQH A;  22GS A;  4HUA A;  3JCM L;  1SK0 A;  5D93 A;  1WPI A;  1PSQ A;  1Z6N A;  4V1A p;  4YAP A;  4O5R A;  3TKS A;  1TRV A;  2EC4 A;  2C80 A;  2XHF A;  2VLV A;  2H70 A;  1OYJ A;  2K18 A;  1NHO A;  2CAI A;  5CRE A;  5D8I A;  4K1F A;  5DAK B;  2O85 A;  3KCM A;  2VM1 A;  1O81 A;  1C72 A;  1TK0 B;  2GQL A;  5AIS A;  3ZMK A;  2FWF A;  3C1R A;  3I69 A;  3KIJ A;  1OAZ A;  4ZIJ A;  3C7M A;  1GUH A;  3L0H A;  2F8A A;  4G9H A;  4FYB A;  3ZRE A;  3LSZ A;  4PNF A;  1EEM A;  3C1S A;  1EGR A;  2G0F A;  1T7P B;  4YQV A;  4EC0 A;  1Z3E A;  3KH7 A;  1A2M A;  4V2N A;  3EU3 A;  1YQ1 A;  1ZCP A;  1GUM A;  4E8E A;  2FUG 2;  5E4W A;  5LNK e;  4MCU A;  2WDU A;  4JR6 A;  3H79 A;  4MF5 A;  3A2W A;  1GNW A;  2GQM A;  3GKN A;  1I5G A;  5G31 A;  3F4S A;  1OE8 A;  2OAD A;  2C3T A;  2C3N A;  2LST A;  5HR1 A;  2A4V A;  3TGZ A;  2IFQ A;  1U3I A;  4JU5 A;  1PQN A;  3DIE A;  2PBJ A;  3TRQ A;  8GSS A;  2ZNM A;  1K3O A;  4G19 A;  5DBQ A;  3VLN A;  3HDC A;  4TR0 A; 
#chains in the Genus database with same CATH topology
 20GS A;  2FWG A;  2EIR A;  2GZY A;  2H6Z A;  1AW9 A;  3ED3 A;  1EOG A;  1E2Y A;  1U88 A;  4CDO A;  3F3Q A;  4IQ1 A;  3HVV A;  3EIN A;  2VAF A;  2VL2 A;  4N0Z A;  4GF0 A;  1GSF A;  2B1L A;  3WYW A;  5BRT A;  1YF1 A;  1PRX A;  2JSZ A;  2MMA A;  1XWG A;  2GDR A;  1J0F A;  1WIK A;  2HRN A;  1EGO A;  3APS A;  2YWM A;  2O7K A;  3QR6 A;  3DKS A;  3U5R E;  4HZ2 A;  5AIX A;  4MAB A;  5IOX A;  4ECI A;  5DQY A;  1A0F A;  1KEB A;  3LFL A;  3Q74 A;  4I5Q A;  5F0G A;  1LU4 A;  3GUR A;  1S3C A;  1A2J A;  5AN1 A;  5GSS A;  4BVY A;  1TI3 A;  1K3L A;  1ZMA A;  3HHV A;  2TRX A;  3R2Q A;  4BWQ A;  3EUR A;  2DKI A;  2PN8 A;  4FYU A;  2H1D A;  4TR1 B;  4OO4 A;  2IL3 A;  2VUP A;  2YV9 A;  3TOT A;  1CQH A;  3GKX A;  2L5L A;  1XCC A;  4FO5 A;  4NMU A;  1GSD A;  2X64 A;  2DBC A;  4CHS A;  3TJF A;  1PN9 A;  2OAC A;  4GSS A;  3D4M A;  5A4V A;  2C0E A;  4GRF A;  3WT1 A;  3UMA A;  4GTU A;  2B5Y A;  1A23 A;  2HRK A;  2GT5 A;  1K0B A;  5EY6 A;  4RI7 A;  3IE3 A;  4Q5F A;  1WOU A;  3TUE A;  1TRW A;  3IRA A;  2DJ3 A;  2GSR A;  1FB6 A;  1V57 A;  3UEM A;  1AQW A;  2DC5 A;  1YY7 A;  1GLP A;  2TIR A;  1G7E A;  3EE2 A;  5ECN B;  1BYE A;  3PH9 A;  3UBK A;  3LW9 A;  3F6D A;  3TKS C;  1HNA A;  5GAP D;  4NWY A;  4LLR A;  3FMW A;  2LTK A;  2LEG A;  4BVX A;  3CSJ A;  3UIW A;  3P8W A;  3A3T A;  2HNL A;  4NV5 A;  1AIU A;  3DML A;  5A5K A;  1SYR A;  2GZZ A;  4TR3 A;  3FW2 A;  1FAA A;  2V32 A;  3DXB A;  1R5A A;  3IK9 A;  1B48 A;  2AHE A;  3D0Z A;  3GV1 A;  2C4J A;  4MPF A;  1X0R A;  1R26 A;  2A2R A;  5DCG A;  2H30 A;  3L4N A;  2GST A;  1M3I A;  1XOA A;  5KN1 A;  2K6V A;  4ECC A;  5KN3 A;  2PMT A;  5INY A;  5J41 A;  2H73 A;  5CAX A;  4F03 A;  2V6O A;  4G10 A;  4F0B A;  5DQS A;  5DVB A;  5CO3 A;  3A5I A;  3D21 A;  1FG4 A;  3HXS A;  5LCZ A;  2FHE A;  3P7X A;  1GUL A;  5ABR A;  3IK7 A;  3M1G A;  5D9V A;  3CSI A;  5B6M A;  3APQ A;  2YAN A;  1TTZ A;  1AC1 A;  4WBR D;  1SJI A;  2NDO A;  6GSY A;  2FA8 A;  2H19 A;  1EEJ A;  2H0I A;  3F4R A;  2AB6 A;  2I4A A;  3LOR A;  3CQF A;  1W4V A;  3P90 A;  3HJP A;  1GTA A;  2KHP A;  2ZCT A;  2VCX A;  2OKA A;  3KH9 A;  1EOH A;  3PPU A;  1TU8 A;  2VL2 C;  1O7U A;  1XFL A;  2AYT A;  1S3A A;  2WRT A;  3QD9 A;  1TDI A;  3BD2 A;  4ACS A;  1SU9 A;  1MDK A;  3F0I A;  1I9D A;  2C1Y A;  2N5F A;  1ERW A;  1THO A;  5IMV A;  4EDZ A;  2PVO C;  1DE1 A;  4L5L A;  2B3S A;  1SKS B;  1WJK A;  3ISO A;  1TXX A;  1XPV A;  1U3A A;  1Q4J A;  3BBY A;  1YF0 A;  16GS A;  3W8J A;  3MNG A;  2VL9 A;  3CRT A;  1BG5 A;  3J7Y b;  3ERW A;  1R4W A;  2H72 A;  3UL3 A;  4XS4 A;  4BL7 B;  1Z9H A;  1JZD A;  1UC7 A;  1GNE A;  5L71 A;  4IQA A;  2H1B A;  3FR9 A;  2GVP A;  2QSI A;  1EWX A;  2HXK A;  1T1V A;  2B5X A;  1GLQ A;  1VF3 A;  4ZBB A;  1PFO A;  4BWS A;  1U87 A;  5D9X A;  1R5P A;  1SJ6 A;  2ALB A;  1K0M A;  1M2A A;  2LRC A;  12GS A;  3VK9 A;  2YZH A;  2H74 A;  1NW2 A;  3HZ8 A;  2E2G A;  2L57 A;  2PVQ A;  4OCF A;  3KP8 A;  2VO4 A;  1GH2 A;  2EIQ A;  3N9J A;  3HY2 A;  4YAV A;  3GL3 A;  3QAW A;  3VUR A;  4AGS A;  4F9Z A;  3IHQ A;  2YV7 A;  3CMI A;  4RQR A;  1M3J A;  2IIY A;  3EC3 A;  4IHU A;  1Z7P A;  2X8C A;  5CRH A;  4TRX A;  4HJ2 A;  6GSU A;  5ECL B;  4PXO A;  1LJR A;  3VWU A;  3N5O A;  4TR1 A;  6GSV A;  1OKT A;  3ZTL A;  2P31 A;  3A2V A;  2X4A A;  3KM6 A;  3QDN A;  2R5G A;  1LBK A;  1XWK A;  2V6K A;  2RM5 A;  1O85 A;  5CRW A;  1FOV A;  2M72 A;  3IPZ A;  3BOA A;  3TKR A;  4JED A;  1A8Y A;  3KMO A;  2PGT A;  3RHC A;  3LXT A;  1MDJ A;  2GT6 A;  5ECM B;  2DIZ A;  4LMW A;  4XS6 A;  4WF4 A;  1WP0 A;  1SL0 B;  2MMO A;  2H75 A;  2HLS A;  1PN0 A;  2M46 A;  2R0G A;  4JBB A;  4O92 A;  9GSS A;  1F3B A;  1X5D A;  4HEA 2;  5ID2 A;  4MJA A;  2X99 A;  5B6N A;  2R3X A;  2R6K A;  2JZR A;  4OO5 A;  4ZB9 A;  3ZIT A;  2NTO A;  1V2A A;  2N5A A;  3MSZ A;  2LRT A;  2VCW A;  4G0L A;  3I6A A;  2GZP A;  3M9J A;  1W89 A;  2HRA A;  2RLI A;  1TU7 A;  1N2A A;  3EU4 A;  1OC8 A;  3O3T A;  3D6I A;  4Z2T A;  5IPH A;  4MNN A;  4KCA A;  1GSE A;  1HD2 A;  1A8L A;  4K6X A;  1RK4 A;  5J4U A;  1FOH A;  1XWA A;  3M3M A;  3DEX A;  2HI7 A;  2IME A;  1YEP A;  3SBC A;  1QMV A;  2B7K A;  2PUK C;  1K0D A;  4HQS A;  4X4J A;  4P3Y B;  3DRN A;  3F63 A;  4N30 A;  1PKZ A;  2LJR A;  3CTG A;  3KEB A;  4L0U A;  4TVE A;  1TRS A;  3MYD A;  1SYX A;  1PX6 A;  1WWJ A;  5G5F A;  3H93 A;  1QK8 A;  4XIH A;  2FA4 A;  5F05 A;  2M80 A;  3IA1 A;  1GSQ A;  3LQ7 A;  4MA9 A;  4WKW A;  3IC4 A;  3IOS A;  3W6G A;  4PQ1 A;  5DDL A;  1V40 A;  2GS3 A;  2L5O A;  4MJB A;  1PX7 A;  1F9M A;  1V58 A;  2HT9 A;  3KGK A;  2IMD A;  2VCZ A;  1B4Q A;  2R4V A;  4DSS B;  5HR0 A;  4GWR A;  1T00 A;  1EV4 A;  2AV4 A;  4PQI A;  2LQO A;  3ZRD A;  5COH A;  4X43 A;  1H75 A;  2WGR A;  2BTO T;  4EKZ A;  3A5W A;  2CVB A;  1CQG A;  3ZIJ A;  5KOX A;  3RBT A;  3M9K A;  4CY6 A;  4TXV A;  2CT6 A;  2ON5 A;  2REM A;  1SL1 B;  4X0X A;  4EVM A;  1SL2 B;  3F9U A;  1OC3 A;  1KBN A;  3TKQ A;  1Z6M A;  2YJ7 A;  4K7I A;  3HCZ A;  3NOF A;  2B6M A;  4L8E A;  5C00 A;  3F4T A;  5FHI A;  1F2E A;  4IW9 A;  2L6D A;  5HFK A;  3ME7 A;  5ECO B;  2B5E A;  1U6T A;  2JZT A;  2LQQ A;  3GNJ A;  3IV4 A;  5A4U A;  1T8E B;  5KN0 A;  2I9H A;  4ULX A;  6GSX A;  2YWN A;  4GSN A;  4OCE A;  3TCO A;  1BAY A;  2F8F A;  2DJ0 A;  1X5E A;  2H0H A;  2CZ2 A;  3FZ9 A;  2KOK A;  4ID0 A;  3DWV A;  3QPM A;  2L4C A;  1O73 A;  4DEJ A;  4EL1 A;  2LRN A;  2YWI A;  3MIX A;  1O8X A;  1F3A A;  2Z9S A;  2PU9 C;  4WXT A;  1EP7 A;  4IJ3 A;  5IO2 A;  1X9W B;  3VWW A;  1K0C A;  1SKR B;  2JAC A;  5LD0 A;  2J23 A;  3OR5 A;  2FWH A;  4O7H A;  2PER A;  1PD2 1;  1ZYN A;  1R7H A;  4BL7 A;  1JZR A;  1X9M B;  1YKC A;  1TK8 B;  3QOU A;  4K2D A;  6GSS A;  2LUS A;  4N10 A;  1YZX A;  3FRC A;  4K5S A;  4KGI A;  3FZA A;  5DAL B;  5D9T A;  4MH2 A;  2WJU A;  5CRG A;  5IQY A;  2YP6 A;  5H5Q A;  4HS1 A;  1A2L A;  2QGV A;  1M9B A;  2H71 A;  3D4T A;  2VIM A;  4IKH A;  2CZ3 A;  3IHG A;  3L9S A;  1HNB A;  3K8N A;  1XVQ A;  1AAZ A;  4NV2 A;  2OE0 A;  4GLT A;  1XW6 A;  3M8N A;  4WET A;  2H0G A;  3VI7 A;  2LJA A;  2LKU A;  3GL5 A;  4ZL8 A;  1GL8 A;  1XOB A;  1FVK A;  5DCH A;  4XTS A;  3I43 A;  4XRD A;  3M0F A;  3FR6 A;  5HR2 A;  2KUC A;  2IMF A;  4NXI A;  1DE2 A;  1EZK A;  5IMZ A;  4O5Q A;  1V9W A;  3RPN A;  1ZOF A;  1XIY A;  3H1N A;  4KW6 A;  1E6B A;  1HQO A;  2BMX A;  4ICY A;  1AUC A;  2JZS A;  1K0N A;  2HSH A;  4KE3 A;  7GSS A;  1SK1 A;  4QL7 A;  1WRY A;  2P5R A;  4N0V A;  2FD3 A;  4MPG A;  1JFU A;  5D96 A;  1GSY A;  2GSQ A;  3HJO A;  3L9V A;  4POL A;  1JZO A;  4MF6 A;  4ZB8 A;  4ZL9 A;  19GS A;  3FKF A;  3KP9 A;  1YJ6 A;  4EXJ A;  3UAR A;  3TB2 A;  4KSO A;  1ZZY A;  3ZYW A;  2HZF A;  4V2M A;  4OFM A;  4L0W A;  4YKG A;  2C0D A;  4J2F A;  3LYP A;  5IO0 A;  5JWR B;  2YZU A;  1QUW A;  3MDK A;  3RDW A;  2L59 A;  1PGT A;  4ML1 A;  3TJG A;  1F37 A;  1TJD A;  2RM6 A;  5IMC A;  2DJ2 A;  1XWB A;  3HYP A;  4EIQ A;  2YN1 A;  4LL1 B;  4IVF A;  1QGV A;  4POB A;  4IP1 A;  3CYN A;  3NZN A;  3G7I A;  1ILO A;  1B9X C;  5G1L A;  2E0Q A;  4EE0 A;  1QXH A;  3LEF A;  1IYH A;  5DAK A;  2A2S A;  5DJM A;  3WT2 A;  2I3Y A;  3I9V 2;  2CQ9 A;  4PGT A;  5IMD A;  5IM9 A;  4LL4 B;  4TXO B;  2VM2 A;  3ZVJ D;  3FEU A;  1BX9 A;  4KSM A;  3L9U A;  3FZ4 A;  2R2J A;  1Z5Y E;  1JLV A;  3LXZ A;  2XPD A;  2KLX A;  1TI1 A;  3WGX A;  1ML6 A;  2AAW A;  4YQM A;  1BQ7 A;  1MD4 A;  4ML6 A;  2WS2 A;  3CBU A;  3F3R A;  2LNS A;  1F6M C;  2C0F A;  5G5E A;  2OJL A;  4JZQ A;  3WGD A;  3BCK A;  2IMK A;  1FB0 A;  4OFT A;  4O5U A;  2HZE B;  1MTC A;  2LV3 A;  2K8S A;  3CTF A;  2YOI A;  2FNO A;  2EIO A;  4IS0 A;  2D2Z A;  3S9F A;  1ON4 A;  2P0G A;  4IP6 A;  5IPG A;  1M0U A;  2DMM A;  2R0P A;  4DSS A;  4ZBD A;  3DVX A;  3QAG A;  1WE0 A;  1XW5 A;  1N8J A;  3VWX A;  1X5C A;  2VCQ A;  2MBS A;  3Q18 A;  4HU9 A;  2P5Q A;  3EMP A;  5J5N A;  1Y25 A;  5ENU A;  5IOW A;  4BIK A;  1VRS D;  4DVC A;  1THX A;  4DSR A;  3C73 A;  3FHK A;  2N5B A;  2WUL A;  4Q5N A;  4MLY A;  1XZO A;  2A4H A;  2WZ9 A;  3ZVJ A;  4Z2U A;  3LJR A;  3F8U A;  1B4P A;  1B8X A;  1SJZ A;  2K9F A;  1T3B A;  2OE3 A;  2HYX A;  3HZ4 A;  1SK2 A;  3G7Y A;  17GS A;  1RQM A;  1PMT A;  5ECP B;  1XWC A;  5CNW A;  2IWT A;  4AF2 A;  3W8S A;  4ECB A;  4EO3 A;  1MD3 A;  4ISD A;  1GSS A;  2H01 A;  13GS A;  5AIV A;  2NPB A;  5C04 A;  4IBP A;  4Q5Q A;  4HZ4 A;  3VWV A;  4E8H A;  1UA5 A;  3ZIV A;  5FT3 A;  5GAN D;  1PKW A;  1TW9 A;  4GST A;  1NHY A;  1SKW B;  4MH3 A;  4WR4 A;  2CX4 A;  3QAV A;  3UOM A;  2OE1 A;  4IGJ A;  1BED A;  2DIY A;  4KB3 A;  1XW9 A;  1T4Y A;  1WMJ A;  1JZW A;  1TP9 A;  2OBI A;  2KP1 A;  2L6C A;  5F07 A;  2E2M A;  4YQU A;  3G9B A;  1K0O A;  4CW9 A;  3QCP A;  3TRP A;  4XHM A;  2K8V A;  2V2G A;  3KJY A;  1DUG A;  1PL1 A;  3QFA C;  4G2E A;  2MMZ A;  3PGT A;  3A2X A;  1YKA A;  3UVT A;  2J9H A;  3ZML A;  1K3Y A;  4K0N A;  4FH8 A;  2H8L A;  2IMI A;  2KP2 A;  4I2T A;  1YEX A;  5J9B A;  1G6W A;  4OD7 A;  2ZUP A;  3GIX A;  1NM3 A;  1ERT A;  2V1M A;  3LGC A;  1OKD A;  2DJK A;  4KH7 A;  3QFB C;  1HYU A;  4L5O A;  1ZL9 A;  4Z2R A;  3O6T A;  1G0T A;  1ZGN A;  3FR3 A;  3DGQ A;  1GTB A;  1OC9 B;  3CSH A;  3E9J B;  2WCI A;  3GKK A;  5FWG A;  2LS5 A;  3ZL5 A;  4PX1 A;  3E0U A;  2O87 A;  2MYG A;  3GH6 A;  4MMM A;  5HR3 A;  4KDY A;  1QQ2 A;  2MBT A;  2F51 A;  3KZQ A;  5JWO B;  2IN3 A;  2CVD A;  4XCS A;  3MAK A;  3GMF A;  2F3M A;  1AXD A;  1PA3 A;  1H4O A;  2IPA A;  5A4W A;  3ZFL A;  1KNG A;  1PL2 A;  3APO A;  4HI7 A;  4GQF A;  4MZB A;  4AJ6 A;  2HFD A;  3CXG A;  6GSW A;  3GX0 A;  2X8H A;  2VLU A;  3HJM A;  1Y6E A;  4J56 E;  2V41 A;  2FLS A;  4TKY A;  2HSM A;  5F8B A;  2PWJ A;  3GRX A;  1M2B A;  2QKE A;  2VOC A;  2L4Q A;  1USB A;  2X8G A;  1OE7 A;  4OMV A;  3EVI A;  3C71 A;  4ZB6 A;  1G7O A;  4D73 B;  2JL4 A;  1QFN A;  4ZBA A;  3KD0 A;  3UVH A;  1AQV A;  2YWO A;  3DVW A;  3ZLP A;  3J7Y k;  4TXO A;  1FVJ A;  3LYK A;  18GS A;  2AUV A;  5EPF A;  5CP1 A;  2H6Y A;  3D22 A;  1ZYP A;  4EIP A;  1A0R P;  2A2P A;  4K7N A;  3TRX A;  2FGX A;  4XS4 B;  2QC7 A;  4MK3 A;  3UJ1 A;  3LWA A;  4AJ7 A;  4LA1 A;  3IR4 A;  5KN2 A;  5BMU A;  1K0A A;  2XBI A;  2HE3 A;  4DSQ A;  3GST A;  5GST A;  1B9Y C;  4BPY A;  4V1A g;  4NHZ A;  3HVX A;  5EVO A;  4KDU A;  1M99 A;  3O76 A;  2HZE A;  5ELG A;  4KAE A;  2I1U A;  1Z7R A;  4NHW A;  4PNG A;  3MWH A;  3GTU B;  3P2A A;  1GRX A;  2UZ8 A;  2CAQ A;  4KND A;  3ZZX A;  2YJH A;  4IEL A;  4USS A;  3G7J A;  2G2Q A;  1FHE A;  5HFG A;  4V2L A;  5ECI B;  5ECS A;  1M9A A;  5IIZ A;  4AJ8 A;  1Q98 A;  1G6Y A;  4ILF A;  2ON7 A;  2YCD A;  3GKM A;  2VD1 A;  2GLR A;  1GP1 A;  4KCE A;  4J57 E;  3RAZ A;  3IAS 2;  4I97 A;  2QA2 A;  5J3R A;  5B8A A;  4KX4 A;  4GXZ A;  5JCW A;  2CVK A;  4OWY A;  3BJ5 A;  3ERG A;  3EYT A;  5D9W A;  3KMN A;  4N11 A;  3R3E A;  4WF5 A;  10GS A;  4FYC A;  1IYI A;  3SWL A;  2YNX A;  3QMX A;  3NIV A;  3HVN A;  4G0K A;  2F9S A;  3WD6 A;  2R37 A;  5ECQ B;  1HNC A;  6GST A;  5IMF A;  5JCG A;  4JR4 A;  3TJJ A;  2GSS A;  2IJY A;  2BJX A;  4HQZ A;  2LNT A;  5B7C A;  4EUY A;  2YPM A;  1EV9 A;  5B8B A;  4QL9 A;  2LJK A;  3GX8 A;  2TRC P;  3IXR A;  1XXU A;  1UVZ A;  5ID2 B;  4MZW A;  5G30 A;  2RII A;  11GS A;  5D73 A;  5J9C A;  3KXO A;  1ACV A;  1S3D A;  2H76 A;  5H5R A;  3KTL A;  3TJB A;  2VCT A;  3DYR A;  1SEN A;  2HRF A;  4MP4 A;  4MJE A;  2C3Q A;  1J9B A;  1FW1 A;  1A24 A;  1TKD B;  2XPE A;  5JWQ B;  1BJX A;  2DKH A;  3HKR A;  1T4Z A;  1ST9 A;  1TRU A;  1VF4 A;  5H5S A;  4JRR A;  3V1W A;  4K2X A;  4POK A;  1GSU A;  3ZFB A;  2DML A;  2FWE A;  2DLX A;  3US3 A;  3GYK A;  1UN2 A;  3VI5 A;  2DSA A;  2HSY A;  4EF0 A;  2GQK A;  1SD9 A;  1OVN A;  2B7J A;  4EDY A;  2C8U A;  5ELA A;  1XVW A;  1TK5 B;  1V98 A;  3KTB A;  2VLT A;  3UBL A;  3EWL A;  3CRU A;  4KF9 A;  1FO5 A;  2CV4 A;  5ECR B;  1M2D A;  5DJL A;  2JAD A;  4HDE A;  4NPB A;  4K5R A;  5EL8 A;  3IDV A;  4O32 A;  2RUF A;  3FYG A;  4ZL7 A;  1OC9 A;  3GA4 A;  3FY7 A;  2IFQ B;  4ZIL A;  4TW5 A;  4I6X A;  3WGE A;  2C0G A;  1AQX A;  3H4K A;  2VCV A;  4IJI A;  2H66 A;  5JCU A;  4FIW A;  4MDC A;  4IN0 A;  3D5J A;  2DJJ A;  3HA9 A;  4RI6 A;  5AGY A;  3VFI A;  2WFC A;  2ES7 A;  4MZC A;  2O8V B;  1DSB A;  3C8E A;  3TJK A;  1VF1 A;  3PR8 A;  4XS1 A;  1JLW A;  4K0G A;  1MDI A;  3GSS A;  4CY8 A;  1TOF A;  4HJM A;  2NBS A;  4MF7 A;  3TKS E;  1X9S B;  2WB9 A;  2RUE A;  5G1K A;  3IC8 A;  2X49 A;  3EPT A;  2E7P A;  2H6X A;  4PUF C;  1ABA A;  4HSC X;  4XRA A;  3HVS A;  1DBY A;  2MZC A;  3FZ5 A;  3TOU A;  2FY6 A;  4A5P A;  4KA0 A;  3TKP A;  1ERV A;  5HFI A;  4WBJ A;  4G0I A;  1GWC A;  5F06 A;  3BCI A;  4D73 A;  3PIN A;  2QA1 A;  5G2Z A;  5ECK B;  4TN8 A;  3VPT A;  4F2I A;  4BVY B;  2OBK A;  1EP8 A;  4NAX A;  2GGT A;  1J08 A;  3L78 A;  4Q5R A;  5E59 A;  2O89 A;  2AJQ B;  3AY8 A;  1M7T A;  1O6J A;  1ERU A;  3IAM 2;  4WEY A;  14GS A;  4I2U A;  4YH2 A;  4WR5 A;  4K9Z A;  3Q6O A;  4I8B A;  1URM A;  1XBS A;  2NVL A;  4MJC A;  3DD3 A;  3HD5 A;  4TR4 A;  2H1A A;  4KUN A;  4BA7 A;  4F82 A;  3GN3 A;  4LMV A;  3RPP A;  3GTU A;  2XC2 A;  3GH9 A;  5GZZ B;  4X1U A;  3E3E A;  3GFK A;  2CX3 A;  4FQU A;  3UAP A;  4HU7 A;  2JSY A;  2FCH A;  4K7O A;  1VF2 A;  3GUS A;  5CRD A;  1O8W A;  2CA8 A;  4PUA A;  2B1K A;  3RHB A;  3TDG A;  4HOJ A;  4GCI A;  4RUV A;  4RQX A;  4PUR A;  5DAL A;  2I81 A;  4KDX A;  4POM A;  1NSW A;  3ERF A;  1RW1 A;  4H86 A;  3U6V A;  2JU5 A;  4PTS A;  2OA7 A;  5ECH B;  4BVX B;  4JE1 A;  1KTE A;  2MMN A;  3H8Q A;  4TOP A;  3EMX A;  3GHA A;  3ME8 A;  1ZYE A;  3FK8 A;  4ZXG A;  1GUK A;  5IMA A;  4QQ7 A;  4F0C A;  4Z7X A;  5HQP A;  4OFN A;  3F6F A;  3Q19 A;  2PPT A;  1MEK A;  2DJ1 A;  5CYY A;  4ECJ A;  5KEJ A;  4GQC A;  1JHB A;  2H1G A;  1YDK A;  2VL3 A;  3LG6 A;  1GTI A;  1VGL A;  2XBQ A;  2VD0 A;  3IBH A;  1S3R A;  1GTU A;  1ZYQ B;  1SD8 A;  3VPQ A;  2GTU A;  4K8M A;  4PQH A;  22GS A;  4HUA A;  3JCM L;  1SK0 A;  5D93 A;  1WPI A;  1PSQ A;  1Z6N A;  4V1A p;  4YAP A;  4O5R A;  3TKS A;  1TRV A;  2EC4 A;  5KOW A;  2C80 A;  2XHF A;  2VLV A;  2H70 A;  1OYJ A;  2K18 A;  1NHO A;  2CAI A;  5CRE A;  5D8I A;  4K1F A;  5DAK B;  2O85 A;  1XG8 A;  3KCM A;  2VM1 A;  1O81 A;  1C72 A;  1TK0 B;  2GQL A;  5AIS A;  3ZMK A;  2FWF A;  3C1R A;  3I69 A;  4YKF A;  3KIJ A;  1OAZ A;  4ZIJ A;  3C7M A;  1GUH A;  3L0H A;  2F8A A;  4G9H A;  4FYB A;  3ZRE A;  3LSZ A;  4PNF A;  1EEM A;  3C1S A;  1EGR A;  2G0F A;  1T7P B;  4YQV A;  4EC0 A;  1Z3E A;  3KH7 A;  1A2M A;  4V2N A;  2R0C A;  3EU3 A;  1YQ1 A;  1ZCP A;  1GUM A;  4E8E A;  2FUG 2;  5E4W A;  5LNK e;  4MCU A;  2WDU A;  4JR6 A;  3H79 A;  4MF5 A;  3A2W A;  1GNW A;  2GQM A;  3GKN A;  1I5G A;  5G31 A;  3F4S A;  1OE8 A;  2OAD A;  2C3T A;  2C3N A;  2LST A;  5HR1 A;  2A4V A;  3TGZ A;  2IFQ A;  1U3I A;  4JU5 A;  1PQN A;  3DIE A;  2PBJ A;  3TRQ A;  8GSS A;  2ZNM A;  1K3O A;  4G19 A;  5DBQ A;  3VLN A;  3HDC A;  4TR0 A; 
#chains in the Genus database with same CATH homology
 20GS A;  2FWG A;  2EIR A;  2GZY A;  2H6Z A;  1AW9 A;  3ED3 A;  1EOG A;  1E2Y A;  1U88 A;  4CDO A;  3F3Q A;  4IQ1 A;  3HVV A;  3EIN A;  2VAF A;  2VL2 A;  4N0Z A;  4GF0 A;  1GSF A;  2B1L A;  3WYW A;  5BRT A;  1YF1 A;  1PRX A;  2JSZ A;  2MMA A;  1XWG A;  2GDR A;  1J0F A;  1WIK A;  2HRN A;  1EGO A;  3APS A;  2YWM A;  2O7K A;  3QR6 A;  3DKS A;  3U5R E;  4HZ2 A;  5AIX A;  4MAB A;  5IOX A;  4ECI A;  5DQY A;  1A0F A;  1KEB A;  3LFL A;  3Q74 A;  4I5Q A;  5F0G A;  1LU4 A;  3GUR A;  1S3C A;  1A2J A;  5AN1 A;  5GSS A;  4BVY A;  1TI3 A;  1K3L A;  1ZMA A;  3HHV A;  2TRX A;  3R2Q A;  4BWQ A;  3EUR A;  2DKI A;  2PN8 A;  4FYU A;  2H1D A;  4TR1 B;  4OO4 A;  2IL3 A;  2VUP A;  2YV9 A;  3TOT A;  1CQH A;  3GKX A;  2L5L A;  1XCC A;  4FO5 A;  4NMU A;  1GSD A;  2X64 A;  2DBC A;  4CHS A;  3TJF A;  1PN9 A;  2OAC A;  4GSS A;  3D4M A;  5A4V A;  2C0E A;  4GRF A;  3WT1 A;  3UMA A;  4GTU A;  2B5Y A;  1A23 A;  2HRK A;  2GT5 A;  1K0B A;  5EY6 A;  4RI7 A;  3IE3 A;  4Q5F A;  1WOU A;  3TUE A;  1TRW A;  3IRA A;  2DJ3 A;  2GSR A;  1FB6 A;  1V57 A;  3UEM A;  1AQW A;  2DC5 A;  1YY7 A;  1GLP A;  2TIR A;  1G7E A;  3EE2 A;  5ECN B;  1BYE A;  3PH9 A;  3UBK A;  3LW9 A;  3F6D A;  3TKS C;  1HNA A;  5GAP D;  4NWY A;  4LLR A;  3FMW A;  2LTK A;  2LEG A;  4BVX A;  3CSJ A;  3UIW A;  3P8W A;  3A3T A;  2HNL A;  4NV5 A;  1AIU A;  3DML A;  5A5K A;  1SYR A;  2GZZ A;  4TR3 A;  3FW2 A;  1FAA A;  2V32 A;  3DXB A;  1R5A A;  3IK9 A;  1B48 A;  2AHE A;  3D0Z A;  3GV1 A;  2C4J A;  4MPF A;  1X0R A;  1R26 A;  2A2R A;  5DCG A;  2H30 A;  3L4N A;  2GST A;  1XOA A;  5KN1 A;  2K6V A;  4ECC A;  5KN3 A;  2PMT A;  5INY A;  5J41 A;  2H73 A;  5CAX A;  4F03 A;  2V6O A;  4G10 A;  4F0B A;  5DQS A;  5DVB A;  5CO3 A;  3A5I A;  3D21 A;  1FG4 A;  3HXS A;  5LCZ A;  2FHE A;  3P7X A;  1GUL A;  5ABR A;  3IK7 A;  3M1G A;  5D9V A;  3CSI A;  5B6M A;  3APQ A;  2YAN A;  1TTZ A;  1AC1 A;  4WBR D;  1SJI A;  2NDO A;  6GSY A;  2FA8 A;  2H19 A;  1EEJ A;  2H0I A;  3F4R A;  2AB6 A;  2I4A A;  3LOR A;  1W4V A;  3P90 A;  3HJP A;  1GTA A;  2KHP A;  2ZCT A;  2VCX A;  2OKA A;  3KH9 A;  1EOH A;  3PPU A;  1TU8 A;  2VL2 C;  1O7U A;  1XFL A;  2AYT A;  1S3A A;  2WRT A;  3QD9 A;  1TDI A;  3BD2 A;  4ACS A;  1SU9 A;  1MDK A;  3F0I A;  1I9D A;  2C1Y A;  2N5F A;  1ERW A;  1THO A;  5IMV A;  4EDZ A;  2PVO C;  1DE1 A;  4L5L A;  2B3S A;  1SKS B;  1WJK A;  3ISO A;  1TXX A;  1XPV A;  1U3A A;  1Q4J A;  3BBY A;  1YF0 A;  16GS A;  3W8J A;  3MNG A;  2VL9 A;  3CRT A;  1BG5 A;  3J7Y b;  3ERW A;  1R4W A;  2H72 A;  3UL3 A;  4XS4 A;  4BL7 B;  1Z9H A;  1JZD A;  1UC7 A;  1GNE A;  5L71 A;  4IQA A;  2H1B A;  3FR9 A;  2GVP A;  2QSI A;  1EWX A;  2HXK A;  1T1V A;  2B5X A;  1GLQ A;  1VF3 A;  4ZBB A;  4BWS A;  1U87 A;  5D9X A;  1R5P A;  1SJ6 A;  2ALB A;  1K0M A;  1M2A A;  2LRC A;  12GS A;  3VK9 A;  2YZH A;  2H74 A;  1NW2 A;  3HZ8 A;  2E2G A;  2L57 A;  2PVQ A;  4OCF A;  3KP8 A;  2VO4 A;  1GH2 A;  2EIQ A;  3N9J A;  3HY2 A;  4YAV A;  3GL3 A;  3QAW A;  3VUR A;  4AGS A;  4F9Z A;  3IHQ A;  2YV7 A;  3CMI A;  4RQR A;  2IIY A;  3EC3 A;  4IHU A;  1Z7P A;  2X8C A;  5CRH A;  4TRX A;  4HJ2 A;  6GSU A;  5ECL B;  4PXO A;  1LJR A;  3VWU A;  3N5O A;  4TR1 A;  6GSV A;  1OKT A;  3ZTL A;  2P31 A;  3A2V A;  2X4A A;  3KM6 A;  3QDN A;  2R5G A;  1LBK A;  1XWK A;  2V6K A;  2RM5 A;  1O85 A;  5CRW A;  1FOV A;  2M72 A;  3IPZ A;  3BOA A;  3TKR A;  4JED A;  1A8Y A;  3KMO A;  2PGT A;  3RHC A;  3LXT A;  1MDJ A;  2GT6 A;  5ECM B;  2DIZ A;  4LMW A;  4XS6 A;  4WF4 A;  1WP0 A;  1SL0 B;  2MMO A;  2H75 A;  2HLS A;  1PN0 A;  2M46 A;  2R0G A;  4JBB A;  4O92 A;  9GSS A;  1F3B A;  1X5D A;  4HEA 2;  5ID2 A;  4MJA A;  2X99 A;  5B6N A;  2R3X A;  2R6K A;  2JZR A;  4OO5 A;  4ZB9 A;  3ZIT A;  2NTO A;  1V2A A;  2N5A A;  3MSZ A;  2LRT A;  2VCW A;  4G0L A;  3I6A A;  2GZP A;  3M9J A;  1W89 A;  2HRA A;  2RLI A;  1TU7 A;  1N2A A;  3EU4 A;  1OC8 A;  3O3T A;  3D6I A;  4Z2T A;  5IPH A;  4MNN A;  4KCA A;  1GSE A;  1HD2 A;  1A8L A;  4K6X A;  1RK4 A;  5J4U A;  1FOH A;  1XWA A;  3M3M A;  3DEX A;  2HI7 A;  2IME A;  1YEP A;  3SBC A;  1QMV A;  2B7K A;  2PUK C;  1K0D A;  4HQS A;  4X4J A;  4P3Y B;  3DRN A;  3F63 A;  4N30 A;  1PKZ A;  2LJR A;  3CTG A;  3KEB A;  4L0U A;  4TVE A;  1TRS A;  3MYD A;  1SYX A;  1PX6 A;  1WWJ A;  5G5F A;  3H93 A;  1QK8 A;  4XIH A;  2FA4 A;  5F05 A;  2M80 A;  3IA1 A;  1GSQ A;  3LQ7 A;  4MA9 A;  4WKW A;  3IC4 A;  3IOS A;  3W6G A;  4PQ1 A;  5DDL A;  1V40 A;  2GS3 A;  2L5O A;  4MJB A;  1PX7 A;  1F9M A;  1V58 A;  2HT9 A;  3KGK A;  2IMD A;  2VCZ A;  1B4Q A;  2R4V A;  4DSS B;  5HR0 A;  4GWR A;  1T00 A;  1EV4 A;  2AV4 A;  4PQI A;  2LQO A;  3ZRD A;  5COH A;  4X43 A;  1H75 A;  2WGR A;  2BTO T;  4EKZ A;  3A5W A;  2CVB A;  1CQG A;  3ZIJ A;  5KOX A;  3RBT A;  3M9K A;  4CY6 A;  4TXV A;  2CT6 A;  2ON5 A;  2REM A;  1SL1 B;  4X0X A;  4EVM A;  1SL2 B;  3F9U A;  1OC3 A;  1KBN A;  3TKQ A;  1Z6M A;  2YJ7 A;  4K7I A;  3HCZ A;  3NOF A;  2B6M A;  4L8E A;  5C00 A;  3F4T A;  5FHI A;  1F2E A;  4IW9 A;  2L6D A;  5HFK A;  3ME7 A;  5ECO B;  2B5E A;  1U6T A;  2JZT A;  2LQQ A;  3GNJ A;  3IV4 A;  5A4U A;  1T8E B;  5KN0 A;  2I9H A;  4ULX A;  6GSX A;  2YWN A;  4GSN A;  4OCE A;  3TCO A;  1BAY A;  2F8F A;  2DJ0 A;  1X5E A;  2H0H A;  2CZ2 A;  3FZ9 A;  2KOK A;  4ID0 A;  3DWV A;  3QPM A;  2L4C A;  1O73 A;  4DEJ A;  4EL1 A;  2LRN A;  2YWI A;  3MIX A;  1O8X A;  1F3A A;  2Z9S A;  2PU9 C;  4WXT A;  1EP7 A;  4IJ3 A;  5IO2 A;  1X9W B;  3VWW A;  1K0C A;  1SKR B;  2JAC A;  5LD0 A;  2J23 A;  3OR5 A;  2FWH A;  4O7H A;  2PER A;  1PD2 1;  1ZYN A;  1R7H A;  4BL7 A;  1JZR A;  1X9M B;  1YKC A;  1TK8 B;  3QOU A;  4K2D A;  6GSS A;  2LUS A;  4N10 A;  1YZX A;  3FRC A;  4K5S A;  4KGI A;  3FZA A;  5DAL B;  5D9T A;  4MH2 A;  2WJU A;  5CRG A;  5IQY A;  2YP6 A;  5H5Q A;  4HS1 A;  1A2L A;  2QGV A;  1M9B A;  2H71 A;  3D4T A;  2VIM A;  4IKH A;  2CZ3 A;  3IHG A;  3L9S A;  1HNB A;  3K8N A;  1XVQ A;  1AAZ A;  4NV2 A;  2OE0 A;  4GLT A;  1XW6 A;  3M8N A;  4WET A;  2H0G A;  3VI7 A;  2LJA A;  2LKU A;  3GL5 A;  4ZL8 A;  1GL8 A;  1XOB A;  1FVK A;  5DCH A;  4XTS A;  3I43 A;  4XRD A;  3M0F A;  3FR6 A;  5HR2 A;  2KUC A;  2IMF A;  4NXI A;  1DE2 A;  1EZK A;  5IMZ A;  4O5Q A;  1V9W A;  3RPN A;  1ZOF A;  1XIY A;  3H1N A;  4KW6 A;  1E6B A;  1HQO A;  2BMX A;  4ICY A;  1AUC A;  2JZS A;  1K0N A;  2HSH A;  4KE3 A;  7GSS A;  1SK1 A;  4QL7 A;  1WRY A;  2P5R A;  4N0V A;  2FD3 A;  4MPG A;  1JFU A;  5D96 A;  1GSY A;  2GSQ A;  3HJO A;  3L9V A;  4POL A;  1JZO A;  4MF6 A;  4ZB8 A;  4ZL9 A;  19GS A;  3FKF A;  3KP9 A;  1YJ6 A;  4EXJ A;  3UAR A;  3TB2 A;  4KSO A;  1ZZY A;  3ZYW A;  2HZF A;  4V2M A;  4OFM A;  4L0W A;  4YKG A;  2C0D A;  4J2F A;  3LYP A;  5IO0 A;  5JWR B;  2YZU A;  1QUW A;  3MDK A;  3RDW A;  2L59 A;  1PGT A;  4ML1 A;  3TJG A;  1F37 A;  1TJD A;  2RM6 A;  5IMC A;  2DJ2 A;  1XWB A;  3HYP A;  4EIQ A;  2YN1 A;  4LL1 B;  4IVF A;  1QGV A;  4POB A;  4IP1 A;  3CYN A;  3NZN A;  3G7I A;  1ILO A;  1B9X C;  5G1L A;  2E0Q A;  4EE0 A;  1QXH A;  3LEF A;  1IYH A;  5DAK A;  2A2S A;  5DJM A;  3WT2 A;  2I3Y A;  3I9V 2;  2CQ9 A;  4PGT A;  5IMD A;  5IM9 A;  4LL4 B;  4TXO B;  2VM2 A;  3ZVJ D;  3FEU A;  1BX9 A;  4KSM A;  3L9U A;  3FZ4 A;  2R2J A;  1Z5Y E;  1JLV A;  3LXZ A;  2XPD A;  2KLX A;  1TI1 A;  3WGX A;  1ML6 A;  2AAW A;  4YQM A;  1BQ7 A;  1MD4 A;  4ML6 A;  2WS2 A;  3CBU A;  3F3R A;  2LNS A;  1F6M C;  2C0F A;  5G5E A;  2OJL A;  4JZQ A;  3WGD A;  3BCK A;  2IMK A;  1FB0 A;  4OFT A;  4O5U A;  2HZE B;  1MTC A;  2LV3 A;  2K8S A;  3CTF A;  2YOI A;  2FNO A;  2EIO A;  4IS0 A;  2D2Z A;  3S9F A;  1ON4 A;  2P0G A;  4IP6 A;  5IPG A;  1M0U A;  2DMM A;  2R0P A;  4DSS A;  4ZBD A;  3DVX A;  3QAG A;  1WE0 A;  1XW5 A;  1N8J A;  3VWX A;  1X5C A;  2VCQ A;  2MBS A;  3Q18 A;  4HU9 A;  2P5Q A;  3EMP A;  5J5N A;  1Y25 A;  5ENU A;  5IOW A;  1VRS D;  4DVC A;  1THX A;  4DSR A;  3C73 A;  3FHK A;  2N5B A;  2WUL A;  4Q5N A;  4MLY A;  1XZO A;  2A4H A;  2WZ9 A;  3ZVJ A;  4Z2U A;  3LJR A;  3F8U A;  1B4P A;  1B8X A;  1SJZ A;  2K9F A;  1T3B A;  2OE3 A;  2HYX A;  3HZ4 A;  1SK2 A;  3G7Y A;  17GS A;  1RQM A;  1PMT A;  5ECP B;  1XWC A;  5CNW A;  2IWT A;  4AF2 A;  3W8S A;  4ECB A;  4EO3 A;  1MD3 A;  4ISD A;  1GSS A;  2H01 A;  13GS A;  5AIV A;  2NPB A;  5C04 A;  4IBP A;  4Q5Q A;  4HZ4 A;  3VWV A;  4E8H A;  1UA5 A;  3ZIV A;  5FT3 A;  5GAN D;  1PKW A;  1TW9 A;  4GST A;  1NHY A;  1SKW B;  4MH3 A;  4WR4 A;  2CX4 A;  3QAV A;  3UOM A;  2OE1 A;  4IGJ A;  1BED A;  2DIY A;  4KB3 A;  1XW9 A;  1T4Y A;  1WMJ A;  1JZW A;  1TP9 A;  2OBI A;  2KP1 A;  2L6C A;  5F07 A;  2E2M A;  4YQU A;  3G9B A;  1K0O A;  4CW9 A;  3QCP A;  3TRP A;  4XHM A;  2K8V A;  2V2G A;  3KJY A;  1DUG A;  1PL1 A;  3QFA C;  4G2E A;  2MMZ A;  3PGT A;  3A2X A;  1YKA A;  3UVT A;  2J9H A;  3ZML A;  1K3Y A;  4K0N A;  4FH8 A;  2H8L A;  2IMI A;  2KP2 A;  4I2T A;  1YEX A;  5J9B A;  1G6W A;  4OD7 A;  2ZUP A;  3GIX A;  1NM3 A;  1ERT A;  2V1M A;  3LGC A;  1OKD A;  2DJK A;  4KH7 A;  3QFB C;  1HYU A;  4L5O A;  1ZL9 A;  4Z2R A;  3O6T A;  1G0T A;  1ZGN A;  3FR3 A;  3DGQ A;  1GTB A;  1OC9 B;  3CSH A;  3E9J B;  2WCI A;  3GKK A;  5FWG A;  2LS5 A;  3ZL5 A;  4PX1 A;  3E0U A;  2O87 A;  2MYG A;  3GH6 A;  4MMM A;  5HR3 A;  4KDY A;  1QQ2 A;  2MBT A;  2F51 A;  3KZQ A;  5JWO B;  2IN3 A;  2CVD A;  4XCS A;  3MAK A;  3GMF A;  2F3M A;  1AXD A;  1PA3 A;  1H4O A;  2IPA A;  5A4W A;  3ZFL A;  1KNG A;  1PL2 A;  3APO A;  4HI7 A;  4GQF A;  4MZB A;  4AJ6 A;  2HFD A;  3CXG A;  6GSW A;  3GX0 A;  2X8H A;  2VLU A;  3HJM A;  1Y6E A;  4J56 E;  2V41 A;  2FLS A;  4TKY A;  2HSM A;  5F8B A;  2PWJ A;  3GRX A;  1M2B A;  2QKE A;  2VOC A;  2L4Q A;  1USB A;  2X8G A;  1OE7 A;  4OMV A;  3EVI A;  3C71 A;  4ZB6 A;  1G7O A;  4D73 B;  2JL4 A;  1QFN A;  4ZBA A;  3KD0 A;  3UVH A;  1AQV A;  2YWO A;  3DVW A;  3ZLP A;  3J7Y k;  4TXO A;  1FVJ A;  3LYK A;  18GS A;  2AUV A;  5EPF A;  5CP1 A;  2H6Y A;  3D22 A;  1ZYP A;  4EIP A;  1A0R P;  2A2P A;  4K7N A;  3TRX A;  2FGX A;  4XS4 B;  2QC7 A;  4MK3 A;  3UJ1 A;  3LWA A;  4AJ7 A;  4LA1 A;  3IR4 A;  5KN2 A;  5BMU A;  1K0A A;  2XBI A;  2HE3 A;  4DSQ A;  3GST A;  5GST A;  1B9Y C;  4BPY A;  4V1A g;  4NHZ A;  3HVX A;  5EVO A;  4KDU A;  1M99 A;  3O76 A;  2HZE A;  5ELG A;  4KAE A;  2I1U A;  1Z7R A;  4NHW A;  4PNG A;  3MWH A;  3GTU B;  3P2A A;  1GRX A;  2UZ8 A;  2CAQ A;  4KND A;  3ZZX A;  2YJH A;  4IEL A;  4USS A;  3G7J A;  2G2Q A;  1FHE A;  5HFG A;  4V2L A;  5ECI B;  5ECS A;  1M9A A;  5IIZ A;  4AJ8 A;  1Q98 A;  1G6Y A;  4ILF A;  2ON7 A;  2YCD A;  3GKM A;  2VD1 A;  2GLR A;  1GP1 A;  4KCE A;  4J57 E;  3RAZ A;  3IAS 2;  4I97 A;  2QA2 A;  5J3R A;  5B8A A;  4KX4 A;  4GXZ A;  5JCW A;  2CVK A;  4OWY A;  3BJ5 A;  3ERG A;  3EYT A;  5D9W A;  3KMN A;  4N11 A;  3R3E A;  4WF5 A;  10GS A;  4FYC A;  1IYI A;  3SWL A;  2YNX A;  3QMX A;  3NIV A;  4G0K A;  2F9S A;  3WD6 A;  2R37 A;  5ECQ B;  1HNC A;  6GST A;  5IMF A;  5JCG A;  4JR4 A;  3TJJ A;  2GSS A;  2IJY A;  2BJX A;  4HQZ A;  2LNT A;  5B7C A;  4EUY A;  2YPM A;  1EV9 A;  5B8B A;  4QL9 A;  2LJK A;  3GX8 A;  2TRC P;  3IXR A;  1XXU A;  1UVZ A;  5ID2 B;  4MZW A;  5G30 A;  2RII A;  11GS A;  5D73 A;  5J9C A;  3KXO A;  1ACV A;  1S3D A;  2H76 A;  5H5R A;  3KTL A;  3TJB A;  2VCT A;  3DYR A;  1SEN A;  2HRF A;  4MP4 A;  4MJE A;  2C3Q A;  1J9B A;  1FW1 A;  1A24 A;  1TKD B;  2XPE A;  5JWQ B;  1BJX A;  2DKH A;  3HKR A;  1T4Z A;  1ST9 A;  1TRU A;  1VF4 A;  5H5S A;  4JRR A;  3V1W A;  4K2X A;  4POK A;  1GSU A;  3ZFB A;  2DML A;  2FWE A;  2DLX A;  3US3 A;  3GYK A;  1UN2 A;  3VI5 A;  2DSA A;  2HSY A;  4EF0 A;  2GQK A;  1SD9 A;  1OVN A;  2B7J A;  4EDY A;  2C8U A;  5ELA A;  1XVW A;  1TK5 B;  1V98 A;  3KTB A;  2VLT A;  3UBL A;  3EWL A;  3CRU A;  4KF9 A;  1FO5 A;  2CV4 A;  5ECR B;  1M2D A;  5DJL A;  2JAD A;  4HDE A;  4NPB A;  4K5R A;  5EL8 A;  3IDV A;  4O32 A;  2RUF A;  3FYG A;  4ZL7 A;  1OC9 A;  3GA4 A;  3FY7 A;  2IFQ B;  4ZIL A;  4TW5 A;  4I6X A;  3WGE A;  2C0G A;  1AQX A;  3H4K A;  2VCV A;  4IJI A;  2H66 A;  5JCU A;  4FIW A;  4MDC A;  4IN0 A;  3D5J A;  2DJJ A;  3HA9 A;  4RI6 A;  5AGY A;  3VFI A;  2WFC A;  2ES7 A;  4MZC A;  2O8V B;  1DSB A;  3C8E A;  3TJK A;  1VF1 A;  3PR8 A;  4XS1 A;  1JLW A;  4K0G A;  1MDI A;  3GSS A;  4CY8 A;  1TOF A;  4HJM A;  2NBS A;  4MF7 A;  3TKS E;  1X9S B;  2WB9 A;  2RUE A;  5G1K A;  3IC8 A;  2X49 A;  3EPT A;  2E7P A;  2H6X A;  4PUF C;  1ABA A;  4XRA A;  3HVS A;  1DBY A;  2MZC A;  3FZ5 A;  3TOU A;  2FY6 A;  4A5P A;  4KA0 A;  3TKP A;  1ERV A;  5HFI A;  4WBJ A;  4G0I A;  1GWC A;  5F06 A;  3BCI A;  4D73 A;  3PIN A;  2QA1 A;  5G2Z A;  5ECK B;  4TN8 A;  3VPT A;  4F2I A;  4BVY B;  2OBK A;  1EP8 A;  4NAX A;  2GGT A;  1J08 A;  3L78 A;  4Q5R A;  5E59 A;  2O89 A;  2AJQ B;  3AY8 A;  1M7T A;  1O6J A;  1ERU A;  3IAM 2;  4WEY A;  14GS A;  4I2U A;  4YH2 A;  4WR5 A;  4K9Z A;  3Q6O A;  4I8B A;  1URM A;  1XBS A;  2NVL A;  4MJC A;  3DD3 A;  3HD5 A;  4TR4 A;  2H1A A;  4KUN A;  4BA7 A;  4F82 A;  3GN3 A;  4LMV A;  3RPP A;  3GTU A;  2XC2 A;  3GH9 A;  5GZZ B;  4X1U A;  3E3E A;  3GFK A;  2CX3 A;  4FQU A;  3UAP A;  4HU7 A;  2JSY A;  2FCH A;  4K7O A;  1VF2 A;  3GUS A;  5CRD A;  1O8W A;  2CA8 A;  4PUA A;  2B1K A;  3RHB A;  3TDG A;  4HOJ A;  4GCI A;  4RUV A;  4RQX A;  4PUR A;  5DAL A;  2I81 A;  4KDX A;  4POM A;  1NSW A;  3ERF A;  1RW1 A;  4H86 A;  3U6V A;  2JU5 A;  4PTS A;  2OA7 A;  5ECH B;  4BVX B;  4JE1 A;  1KTE A;  2MMN A;  3H8Q A;  4TOP A;  3EMX A;  3GHA A;  3ME8 A;  1ZYE A;  3FK8 A;  4ZXG A;  1GUK A;  5IMA A;  4QQ7 A;  4F0C A;  4Z7X A;  5HQP A;  4OFN A;  3F6F A;  3Q19 A;  2PPT A;  1MEK A;  2DJ1 A;  5CYY A;  4ECJ A;  5KEJ A;  4GQC A;  1JHB A;  2H1G A;  1YDK A;  2VL3 A;  3LG6 A;  1GTI A;  1VGL A;  2XBQ A;  2VD0 A;  3IBH A;  1GTU A;  1ZYQ B;  1SD8 A;  3VPQ A;  2GTU A;  4K8M A;  4PQH A;  22GS A;  4HUA A;  3JCM L;  1SK0 A;  5D93 A;  1WPI A;  1PSQ A;  1Z6N A;  4V1A p;  4YAP A;  4O5R A;  3TKS A;  1TRV A;  2EC4 A;  5KOW A;  2C80 A;  2XHF A;  2VLV A;  2H70 A;  1OYJ A;  2K18 A;  1NHO A;  2CAI A;  5CRE A;  5D8I A;  4K1F A;  5DAK B;  2O85 A;  3KCM A;  2VM1 A;  1O81 A;  1C72 A;  1TK0 B;  2GQL A;  5AIS A;  3ZMK A;  2FWF A;  3C1R A;  3I69 A;  4YKF A;  3KIJ A;  1OAZ A;  4ZIJ A;  3C7M A;  1GUH A;  3L0H A;  2F8A A;  4G9H A;  4FYB A;  3ZRE A;  3LSZ A;  4PNF A;  1EEM A;  3C1S A;  1EGR A;  2G0F A;  1T7P B;  4YQV A;  4EC0 A;  1Z3E A;  3KH7 A;  1A2M A;  4V2N A;  2R0C A;  3EU3 A;  1YQ1 A;  1ZCP A;  1GUM A;  4E8E A;  2FUG 2;  5E4W A;  5LNK e;  4MCU A;  2WDU A;  4JR6 A;  3H79 A;  4MF5 A;  3A2W A;  1GNW A;  2GQM A;  3GKN A;  1I5G A;  5G31 A;  3F4S A;  1OE8 A;  2OAD A;  2C3T A;  2C3N A;  2LST A;  5HR1 A;  2A4V A;  3TGZ A;  2IFQ A;  1U3I A;  4JU5 A;  1PQN A;  3DIE A;  2PBJ A;  3TRQ A;  8GSS A;  2ZNM A;  1K3O A;  4G19 A;  5DBQ A;  3VLN A;  3HDC A;  4TR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...