2AV4A

Crystal structure of plasmodium yoelii thioredoxin-like protein 4a (dim1)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
135
Chain Sequence
HHMLQHLNSGWAVDQAIVNEDERLVCIRFGHDYDPDCMKMDELLYKVADDIKNFCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNKQEFIDIVETIFRGARKGRGLVISPKDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Thioredoxin-like protein 4A (DIM1)
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium yoelii
total genus 42
structure length 135
sequence length 150
ec nomenclature
pdb deposition date 2005-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02966 DIM1 Mitosis protein DIM1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2av4A00
5HFIA 1F37A 3ZMKA 1C72A 1XZOA 1G6YA 3HDCA 1GSSA 1TXXA 4XS6A 5D96A 3L4NA 2R6KA 3QOUA 4HQZA 1QK8A 4WXTA 1XWGA 3BJ5A 3EC3A 4I2UA 5KEJA 3UBLA 2DMMA 3DWVA 1A0RP 2HZEB 4AJ6A 4OO5A 2A4VA 5H5SA 4LL4B 1TOFA 2YNXA 5CRWA 4YH2A 1XPVA 2YJ7A 3LXTA 5AGYA 1GTIA 3ZTLA 1VF1A 1OVNA 2IMEA 1ML6A 1AUCA 1K0DA 2QSIA 2X8GA 2GZZA 2LQOA 5CRDA 2R3XA 4QL9A 5GZZB 5IQYA 2K9FA 2KP2A 1H75A 3DVXA 5IMVA 1GP1A 3VK9A 2VUPA 4RQXA 3HHVA 1SD8A 2H0HA 3KH7A 1Z7PA 1X5CA 3CSIA 2L5OA 4IKHA 2FCHA 4MJEA 3TKSC 1F3AA 1SK0A 22GSA 1J9BA 4NPBA 4ILFA 2B5YA 3PR8A 4F2IA 5IPGA 2RUEA 3OR5A 3EWLA 4L0UA 4QQ7A 2C0DA 3KMNA 3APSA 3RPNA 1U6TA 2C1YA 2B1LA 4PGTA 4KB3A 4WF5A 1G0TA 1FG4A 1K3LA 3LYPA 1MDIA 3KP9A 3Q6OA 4I6XA 1R26A 2MZCA 3FR6A 2AAWA 2CVDA 2E7PA 2V6KA 3UMAA 2P31A 3CYNA 4X1UA 5DJLA 2CVKA 1X9WB 3GNJA 2WULA 2H8LA 4O92A 2R37A 2JL4A 3F6FA 4G19A 2WRTA 1JLVA 4ZB6A 2NPBA 2I1UA 7GSSA 1TRWA 3MDKA 3HYPA 2XBQA 4LLRA 1W4VA 2DJ2A 3TKQA 1WWJA 1XW6A 4V2MA 2B5XA 2HT9A 3GA4A 3IK7A 4EL1A 1GL8A 3HA9A 1Z3EA 4BPYA 2B7KA 1PL1A 2I81A 1Z9HA 4AGSA 4G9HA 1XCCA 1TI1A 3AY8A 2WJUA 4FH8A 4MA9A 2MBSA 2LRNA 1K0BA 1GSQA 2MYGA 3TKPA 4ZXGA 2FLSA 1FOVA 2OKAA 5J5NA 2VOCA 2R4VA 5F06A 3PGTA 2ON5A 4DSQA 1HNAA 2GZPA 2IMKA 5F0GA 1K0NA 2XPEA 1ILOA 1PN9A 2GDRA 2O8VB 4HEA2 5G5FA 4MH2A 4D73B 3GYKA 2VLVA 1URMA 2WDUA 1F6MC 3EU3A 3UVTA 4XCSA 2LNTA 3F0IA 4KDXA 3KXOA 1Y25A 1CQGA 1HNBA 5J41A 3H8QA 2C3NA 2P0GA 2OA7A 2CX4A 3D4MA 5KN1A 1QUWA 1GLPA 5INYA 1AQXA 1VF4A 3HCZA 1B8XA 2IFQB 4OFTA 3W8JA 2PN8A 1LU4A 2O87A 3WGXA 1KEBA 4Q5QA 3CSHA 1PMTA 6GSUA 1WE0A 2RUFA 1TU7A 4OO4A 2L6CA 3TRQA 2HRFA 1XWCA 3MSZA 2F51A 4NAXA 2WGRA 1M0UA 1O73A 2YZUA 3H93A 1ZGNA 3GV1A 5L71A 1NHOA 1OKDA 5G31A 1SD9A 5H5QA 2JADA 4PNFA 4WBJA 3Q19A 1ERUA 2EIOA 2ES7A 4GSNA 1OC9B 2JSZA 2PMTA 1SL2B 2AB6A 1GSFA 1N8JA 5IMFA 1EOGA 4OFNA 4NV5A 1TRUA 2H74A 4FYCA 2D2ZA 5F8BA 1YZXA 3IAM2 4TVEA 5HQPA 4K7OA 2P5QA 3DD3A 2DIYA 3ZRDA 5HR1A 1AQWA 1PKWA 3HJPA 3QR6A 5JCGA 4Q5RA 6GSVA 3SWLA 2H0IA 2DJJA 4TW5A 2K6VA 4KCEA 4KH7A 3FKFA 1EGRA 1EV4A 3I69A 3GTUA 4O5RA 2L4CA 4TXOA 1BQ7A 5ECLB 3M3MA 3M9KA 3UL3A 2CV4A 3ZVJA 5B6MA 3EURA 4EDZA 13GSA 2GGTA 2GS3A 3L9SA 5DALA 2X64A 4EVMA 3UJ1A 1WOUA 1M99A 4Q5NA 3GN3A 4X0XA 2JSYA 1I9DA 4KX4A 2AYTA 2YWMA 2H0GA 4NWYA 1XOBA 4IHUA 4GSSA 5B6NA 3NZNA 1MD4A 5AIVA 4K7NA 5AIXA 2H30A 1U87A 2HI7A 2YPMA 4IGJA 4ZBAA 4OFMA 4MCUA 1IYIA 4I8BA 1O6JA 2ZCTA 1SU9A 5E59A 2HNLA 3HZ8A 4MPFA 4GQCA 1OKTA 5JWRB 2V1MA 4MZCA 1HYUA 2G2QA 1MDJA 4DVCA 1SYRA 1K0MA 4EC0A 3J7Yk 1JZDA 3R2QA 2H6ZA 1A2LA 1DE1A 4F82A 6GSWA 1T7PB 2YWNA 5DVBA 1M9BA 2WFCA 4TOPA 1M2DA 2DMLA 3RBTA 3CRUA 2R5GA 4K9ZA 2PERA 2H72A 1BX9A 3F3QA 1S3DA 1GNEA 3GURA 1RW1A 3KGKA 3LORA 4JE1A 1K0CA 3ZL5A 2PVOC 5IM9A 1FVJA 2H73A 2O89A 4EF0A 2MMNA 2IPAA 2VCQA 1EP7A 1QFNA 2XBIA 4OMVA 2LS5A 2O7KA 2GSRA 2KP1A 20GSA 1XWBA 1TP9A 3VURA 2YV9A 1YKCA 3D0ZA 3FZ5A 2EIQA 4XS4A 1B48A 5ID2B 1VGLA 4POMA 3A2XA 4ACSA 5KN0A 4FIWA 1S3CA 2L6DA 3TJJA 3HY2A 1JLWA 1XIYA 2NDOA 2FD3A 5FT3A 5JCUA 5ECQB 3ZREA 2OE0A 1FVKA 1O8XA 5ECSA 2I4AA 4HJ2A 4ID0A 3CMIA 4ZB8A 1T8EB 2TRCP 1DE2A 1USBA 4I5QA 5JWOB 1WPIA 3VPTA 1GTUA 1S3AA 4LA1A 3G7YA 4EDYA 5A4WA 1X9SB 3F3RA 2CA8A 3CSJA 4MLYA 1H4OA 4KE3A 3A2VA 2FWEA 5D9VA 2GT6A 1GRXA 2GVPA 3C7MA 3LYKA 4GRFA 1Z6NA 2L4QA 2OBIA 3VPQA 3RHCA 4OCEA 2JZTA 5D9TA 3F4TA 5ELGA 4MH3A 1GULA 2C3TA 3LFLA 2LRCA 5CP1A 3FK8A 2C80A 2N5BA 4MMMA 2PVQA 3D5JA 3Q18A 3TRPA 2YWOA 3C73A 3E0UA 5E4WA 5ECHB 2H01A 3GRXA 4V1Ap 5AN1A 1QQ2A 2DJ1A 1YJ6A 3TOTA 2LQQA 2OBKA 1A2JA 2LUSA 4ZB9A 4MK3A 5IMZA 2KHPA 2FHEA 19GSA 3LG6A 3V1WA 4WR5A 1BEDA 4GWRA 1X5EA 3QPMA 1PKZA 1V9WA 2IL3A 3H1NA 6GSSA 2VL9A 3DGQA 4Z7XA 2VD0A 5HFGA 3W8SA 2G0FA 3BCKA 2HLSA 4MPGA 4GSTA 5COHA 4F0CA 3TRXA 3EMXA 4TRXA 5G30A 2A2RA 1SJZA 2AV4A 2J9HA 5DDLA 4WEYA 3TCOA 5ID2A 2JACA 4O32A 1XOAA 2QKEA 1EP8A 3IAS2 2XPDA 3C1SA 5ABRA 4HZ4A 1GWCA 4NV2A 5A5KA 2YJHA 1TK5B 1YF1A 1M2AA 4POKA 4EUYA 3TJBA 3LXZA 3W6GA 5IMAA 1BJXA 3FR9A 2P5RA 3IR4A 2OADA 1ZL9A 1F9MA 1O8WA 1XBSA 3PH9A 2H76A 4ECJA 1R7HA 1PX6A 2H70A 1K0AA 3F63A 5ECPB 4ZBBA 2R2JA 1YQ1A 1Q4JA 3HJMA 1OC3A 4HU9A 3UBKA 1X5DA 3KD0A 17GSA 2YOIA 2LRTA 4JR6A 4RQRA 4CDOA 2X99A 1IYHA 1ZCPA 4IS0A 4PNGA 1EOHA 5HR0A 5IOXA 2VCVA 4TR0A 6GSXA 3TGZA 5DQYA 1GSEA 2FWFA 2DJKA 2JZSA 5ECRB 3UAPA 1GTAA 2OE1A 2MMAA 3DVWA 4IP1A 4GXZA 1YDKA 1VF3A 5CNWA 4HZ2A 5LNKe 1ON4A 2YWIA 3E9JB 4HOJA 1WIKA 2C8UA 4OD7A 3LWAA 4HU7A 3RDWA 3M1GA 2Z9SA 1GH2A 4ML1A 3GTUB 1PD21 2YANA 1SKSB 4N30A 3IDVA 4TXOB 1ZYEA 1SJ6A 4TXVA 5J9BA 1A24A 2REMA 1THXA 4KA0A 3N5OA 1SENA 3QAWA 5ECMB 1TI3A 3N9JA 4ZIJA 1B4QA 5DALB 3RAZA 1FAAA 2YZHA 1ST9A 4RI7A 5DCGA 4YQVA 1OE7A 1THOA 2JZRA 3NOFA 3ZLPA 5CREA 2DBCA 5G2ZA 4N0VA 3SBCA 4N10A 3FY7A 3ZMLA 2MMOA 5IPHA 2DJ0A 3GSTA 4MZBA 1ZYQB 4KSMA 3D4TA 2HSYA 4V1Ag 4OWYA 3FW2A 1SKWB 1ZZYA 5DBQA 1R4WA 1WJKA 2N5FA 2RM5A 2K8SA 3APQA 3DKSA 3WGEA 1SL0B 3WD6A 2MBTA 4J57E 5EVOA 3VWWA 5D9XA 4DSSA 2GSSA 10GSA 2GQMA 2IIYA 2VL2A 1WRYA 1B4PA 3GKKA 1LBKA 3K8NA 4RUVA 2VM1A 3G7IA 5D8IA 3TB2A 3HKRA 3WYWA 3HJOA 3KTLA 2HFDA 3KCMA 3C71A 1W89A 3TJGA 1V98A 1KBNA 5ELAA 3ZIVA 4GF0A 5IO2A 5DJMA 1ERWA 4TR1A 1NW2A 2QC7A 3WT1A 5ECIB 1AXDA 5B8AA 1Y6EA 2TRXA 9GSSA 2PUKC 4LMVA 1TK0B 4NMUA 2WB9A 1SKRB 5G1LA 3GIXA 2I9HA 1AQVA 1V58A 4MJBA 3L9UA 3A2WA 4JBBA 16GSA 3F4RA 2C3QA 4L0WA 4XS4B 2AUVA 1HNCA 1EZKA 5HR3A 3EE2A 2H6XA 2E2MA 1E2YA 3ZFLA 2VO4A 1QMVA 2F9SA 3GSSA 3DIEA 4YQMA 4XTSA 4POLA 2C4JA 1QXHA 3VWXA 4DSRA 2YP6A 4L5OA 2H19A 1ERTA 1M2BA 2ZNMA 3ERGA 3BOAA 1YEXA 1YEPA 1TU8A 2VL2C 2F8AA 1TTZA 3VWUA 4BVXA 2VL3A 4LL1B 2AHEA 3EINA 5JWQB 2YV7A 4ZL7A 1FW1A 4MF6A 2KLXA 3H4KA 3IRAA 3G7JA 3LQ7A 3P90A 4PQHA 2L57A 1TDIA 3G9BA 1O7UA 5DAKB 4RI6A 1JZOA 5GAND 4TR3A 1VRSD 1KNGA 2VIMA 2CVBA 2K8VA 3UEMA 2VCXA 3FZ4A 4MJCA 1Z7RA 3MAKA 4E8EA 2H66A 3UOMA 4KAEA 1TRSA 3HZ4A 1ABAA 3F4SA 3IBHA 4F0BA 2VCTA 1R5PA 1PL2A 3M8NA 1GUKA 1I5GA 2H71A 3VFIA 3GKXA 2OJLA 3TKSE 4GQFA 5B7CA 3KMOA 2LKUA 5D93A 4CHSA 1HD2A 1YY7A 1T1VA 2CX3A 4L8EA 1RQMA 4HJMA 2IMFA 5G1KA 1OE8A 1Z5YE 5DCHA 5EPFA 1TRVA 2HSHA 3IXRA 4OCFA 3KM6A 1MD3A 4MF7A 2FWGA 2ALBA 2IMIA 2NVLA 4FYBA 2KOKA 1ERVA 1BAYA 2MMZA 2CZ3A 4K7IA 3FR3A 4K0GA 4I97A 4E8HA 3HVVA 2V6OA 4HI7A 2BMXA 5D73A 3M0FA 3P8WA 3ME8A 5G5EA 4ECCA 1MTCA 3F6DA 4AJ8A 4I2TA 1X0RA 4G10A 1SYXA 4EXJA 1N2AA 2HYXA 2RM6A 1UA5A 1SL1B 3KP8A 4IQAA 4PXOA 1GSDA 2M80A 1T3BA 4FYUA 2PGTA 2VCZA 1AIUA 2KUCA 2O85A 2B3SA 3EYTA 3TKRA 1WP0A 4ZILA 2FNOA 2OACA 3CTGA 5J9CA 4F03A 1Z6MA 4YAPA 4XRDA 2DIZA 2H1DA 2LV3A 4ECIA 1DBYA 4MDCA 5IMDA 4BVYA 1T4ZA 3CTFA 5DAKA 4ECBA 2IJYA 3VI5A 1UVZA 1FHEA 3CBUA 2CT6A 1ZOFA 4BL7A 1EV9A 1UC7A 5KN3A 1NHYA 3O76A 4O7HA 1F2EA 2XC2A 5EY6A 4KGIA 5F07A 1XXUA 3ME7A 3S9FA 2IN3A 3GHAA 4GTUA 2H6YA 3DXBA 3J7Yb 4HS1A 3FYGA 2DC5A 2M46A 3UIWA 3TJKA 4J56E 1EEJA 3ZITA 3D6IA 4KW6A 1V40A 3WGDA 4N11A 1RK4A 3IC4A 1OYJA 2WCIA 2IMDA 4XHMA 1U88A 1FB0A 2GT5A 3QAGA 5GSTA 3BD2A 3ERFA 3L0HA 3PINA 4N0ZA 4XRAA 2ON7A 3KJYA 2DSAA 3IPZA 4KUNA 5LCZA 5CYYA 2BTOT 2PBJA 3Q74A 2CZ2A 3I9V2 3FZ9A 11GSA 5EL8A 2LJRA 2QGVA 1PRXA 4IP6A 1G6WA 4K0NA 1PQNA 3ZVJD 5JCWA 3QDNA 1G7OA 3FZAA 1T4YA 2B1KA 3TOUA 5C00A 3ED3A 3L78A 6GSTA 3EMPA 4F9ZA 2HRNA 2V41A 5IOWA 5H5RA 3BCIA 3GH9A 3D22A 3IV4A 5IIZA 3UVHA 3HD5A 4DEJA 2AJQB 3VI7A 4KDUA 2TIRA 1JFUA 2GTUA 2YCDA 4DSSB 1PX7A 3TJFA 2LEGA 2EIRA 2HXKA 4IQ1A 4POBA 2HE3A 5ENUA 4AF2A 3D21A 3ISOA 2DLXA 5ECNB 5HR2A 1GSUA 4EE0A 2FUG2 3U6VA 4ZL9A 1SK2A 4GLTA 4TR1B 2NTOA 5C04A 3A3TA 1EGOA 2LSTA 3FRCA 4JR4A 4WETA 1B9YC 4KCAA 2HZEA 1JZRA 5CAXA 3GFKA 2E2GA 3EU4A 3MWHA 3MNGA 4KSOA 5GSSA 4K6XA 4HDEA 5KN2A 5A4VA 3GKNA 1QGVA 2VLTA 2PWJA 3CXGA 3GX0A 1J0FA 5CO3A 4PX1A 2I3YA 3F8UA 2ZUPA 3IA1A 4PUAA 1NM3A 2VM2A 4YAVA 5A4UA 2LNSA 3HVSA 3U5RE 1KTEA 1YKAA 4J2FA 3H79A 3E3EA 5ECKB 1UN2A 1T00A 2L5LA 4K1FA 1SK1A 3KIJA 3BBYA 2GQLA 1CQHA 4PUFC 1WMJA 2V32A 3JCML 3LEFA 2YN1A 3GKMA 4XS1A 3RPPA 4G2EA 1X9MB 1V57A 1TKDB 3DEXA 4V2LA 2LJKA 2V2GA 1XWAA 4BWSA 1DUGA 2F8FA 3L9VA 12GSA 3ZFBA 1XW5A 3VWVA 5CRHA 3DMLA 2FWHA 4MJAA 1ZMAA 3P7XA 4Q5FA 1A2MA 1GUHA 2RIIA 1DSBA 3GX8A 1EWXA 5GAPD 5J3RA 3CRTA 2H1GA 1AAZA 2LTKA 1O81A 1JZWA 3KZQA 5ECOB 4X43A 4EKZA 4BA7A 1Q98A 3QMXA 4KDYA 4MZWA 4K2DA 3APOA 1AW9A 4KNDA 3ZYWA 2H75A 4IELA 2C0GA 3IHQA 3ZIJA 3VLNA 3IOSA 1XW9A 2WZ9A 1G7EA 4BWQA 4LMWA 2VAFA 2HZFA 4XIHA 3HXSA 3M9JA 1A8LA 1PA3A 3QCPA 4PQ1A 3NIVA 1OC8A 2OE3A 2FA8A 4IW9A 4JZQA 2GZYA 3I43A 2N5AA 2WS2A 4GCIA 1TK8B 3I6AA 14GSA 3LSZA 4QL7A 3O6TA 1O85A 2E0QA 3ZZXA 2VCWA 4PURA 2B7JA 2XHFA 4JU5A 2BJXA 3GL5A 2PPTA 4NHZA 3O3TA 2GSTA 2X8HA 5HFKA 1U3IA 4TN8A 4P3YB 1PSQA 1BYEA 4JEDA 1XVWA 1J08A 1MDKA 4IBPA 4WKWA 4WF4A 1YF0A 1ACVA 1B9XC 3QFBC 4PQIA 4WBRD 3F9UA 2FA4A 4HUAA 4D73A 3QAVA 3C8EA 3GL3A 3ERWA 1R5AA 3UARA 4NHWA 3GH6A 4FO5A 3KTBA 4CW9A 3HVXA 4IVFA 4L5LA 2H1BA 1VF2A 1GTBA 3US3A 3TDGA 2VLUA 3GUSA 3GMFA 2B5EA 5F05A 2IFQA 5FHIA 1M9AA 4JRRA 1MEKA 3KH9A 4ISDA 1E6BA 2EC4A 2GQKA 4MF5A 5J4UA 4NXIA 1GUMA 1FO5A 3EVIA 4EO3A 1TJDA 2C0EA 1BG5A 1A23A 1NSWA 3LJRA 2NBSA 5IO0A 4IN0A 2GSQA 4WR4A 1PGTA 3TUEA 4TKYA 3QFAC 4ZL8A 2L59A 1A8YA 1LJRA 1F3BA 5D9WA 1XFLA 5FWGA 1SJIA 2H1AA 2X8CA 1M7TA 2LJAA 1K3OA 6GSYA 2CAIA 4YQUA 3DRNA 2RLIA 2K18A 2IWTA 3FEUA 4MABA 2A2SA 1V2AA 4ML6A 5AISA 1OC9A 2B6MA 1K3YA 1JHBA 1EEMA 1GSYA 1GNWA 1FB6A 3IE3A 2GLRA 1HQOA 5LD0A 4HQSA 4V2NA 1AC1A 3FHKA 2J23A 4IJ3A 4K8MA 3RHBA 1OAZA 5IMCA 2FY6A 4TR4A 5CRGA 4AJ7A 18GSA 2CQ9A 2CAQA 2JU5A 3LGCA 2PU9C 2FGXA 2F3MA 4IJIA 1TW9A 4H86A 3P2AA 4ZBDA 3QD9A 3A5WA 3KEBA 1K0OA 3TKSA 1XWKA 2DJ3A 1XVQA 3IK9A 5B8BA 1A0FA 2C0FA 1GLQA 1U3AA 3C1RA 5DQSA 3DYRA 8GSSA 3WT2A 2VD1A 4ULXA 2M72A 4MP4A
chains in the Genus database with same CATH superfamily
5HFIA 1F37A 3ZMKA 1C72A 1XZOA 1G6YA 3HDCA 1GSSA 1TXXA 4XS6A 5D96A 3L4NA 4HSCX 2R6KA 3QOUA 4HQZA 1QK8A 4WXTA 1XWGA 3BJ5A 3EC3A 4I2UA 5KEJA 3UBLA 2DMMA 3DWVA 1A0RP 2HZEB 4AJ6A 4OO5A 2A4VA 5H5SA 4LL4B 1TOFA 2YNXA 5CRWA 4YH2A 1XPVA 2YJ7A 3LXTA 5AGYA 1GTIA 3ZTLA 1VF1A 1OVNA 2IMEA 1ML6A 1AUCA 1K0DA 2QSIA 2X8GA 2GZZA 2LQOA 5CRDA 2R3XA 4QL9A 5GZZB 5IQYA 2K9FA 2KP2A 1H75A 3DVXA 5IMVA 1GP1A 3VK9A 2VUPA 4RQXA 3HHVA 4G0IA 1SD8A 2H0HA 4G0LA 3KH7A 1Z7PA 5KOWA 1X5CA 3CSIA 4Z2TA 2L5OA 4IKHA 2FCHA 4MJEA 3TKSC 1F3AA 1SK0A 3EPTA 22GSA 1J9BA 4NPBA 4ILFA 2B5YA 3PR8A 4CY6A 4F2IA 5IPGA 2RUEA 3OR5A 3EWLA 4L0UA 4QQ7A 2C0DA 3KMNA 3APSA 3RPNA 1U6TA 2C1YA 2B1LA 4PGTA 4KB3A 4WF5A 4K5RA 1G0TA 1FG4A 1K3LA 3LYPA 1MDIA 3KP9A 3Q6OA 4I6XA 1R26A 2MZCA 3FR6A 1M3IA 2AAWA 2CVDA 2E7PA 2V6KA 3UMAA 2P31A 3CYNA 4X1UA 5DJLA 2CVKA 1X9WB 3GNJA 2WULA 2H8LA 4O92A 2R37A 2JL4A 3F6FA 4G19A 2WRTA 1JLVA 4ZB6A 2NPBA 2I1UA 7GSSA 1TRWA 3MDKA 3HYPA 2XBQA 4LLRA 1W4VA 2DJ2A 3TKQA 1WWJA 1XW6A 4V2MA 2B5XA 2HT9A 3GA4A 3IK7A 4EL1A 1GL8A 3HA9A 1Z3EA 4BPYA 2B7KA 1PL1A 2I81A 1Z9HA 4AGSA 4G9HA 1XCCA 1TI1A 3AY8A 2WJUA 4FH8A 4MA9A 2MBSA 2LRNA 1K0BA 1GSQA 2MYGA 3TKPA 2R0CA 4ZXGA 2FLSA 1FOVA 2OKAA 5J5NA 2VOCA 2R4VA 5F06A 3PGTA 2ON5A 4DSQA 1HNAA 2HRKA 2GZPA 2IMKA 5F0GA 1K0NA 2XPEA 1ILOA 1PN9A 2GDRA 2O8VB 4HEA2 5G5FA 4MH2A 4D73B 3GYKA 2VLVA 1URMA 2WDUA 1F6MC 3EU3A 3UVTA 4XCSA 2LNTA 3F0IA 4KDXA 3KXOA 1Y25A 1CQGA 1HNBA 5J41A 3H8QA 2C3NA 2P0GA 2OA7A 2CX4A 3D4MA 5KN1A 1QUWA 1GLPA 5INYA 1AQXA 1VF4A 4K5SA 3HCZA 1B8XA 2IFQB 4OFTA 3W8JA 2PN8A 1LU4A 2O87A 3WGXA 1KEBA 4Q5QA 3CSHA 1PMTA 6GSUA 1WE0A 2RUFA 1TU7A 4OO4A 2L6CA 3TRQA 3FMWA 2HRFA 1XWCA 3MSZA 2F51A 4NAXA 2WGRA 1M0UA 1O73A 3HVNA 2YZUA 3H93A 1ZGNA 3GV1A 5L71A 1NHOA 1OKDA 5G31A 1SD9A 5H5QA 2JADA 4PNFA 4WBJA 3Q19A 1ERUA 2EIOA 2ES7A 4GSNA 4O5QA 1OC9B 2JSZA 2PMTA 1SL2B 2AB6A 1GSFA 1N8JA 5IMFA 1EOGA 2A4HA 4OFNA 4NV5A 1TRUA 2H74A 4FYCA 2D2ZA 4ICYA 5F8BA 1YZXA 3IAM2 4TVEA 5HQPA 4K7OA 2P5QA 3DD3A 2DIYA 3ZRDA 5HR1A 1AQWA 1PKWA 3HJPA 3QR6A 5JCGA 4Q5RA 6GSVA 3SWLA 2H0IA 2DJJA 4TW5A 2K6VA 4KCEA 4KH7A 3FKFA 1EGRA 1EV4A 3I69A 3GTUA 4O5RA 2L4CA 3R3EA 4TXOA 1BQ7A 3CQFA 5ECLB 3M3MA 3M9KA 3UL3A 2CV4A 3ZVJA 5B6MA 3EURA 4EDZA 3MIXA 13GSA 2GGTA 2GS3A 3L9SA 5DALA 2X64A 4EVMA 3UJ1A 1WOUA 1M99A 4Q5NA 3GN3A 4X0XA 2JSYA 1I9DA 4KX4A 2AYTA 2YWMA 2H0GA 4NWYA 1XOBA 4IHUA 4GSSA 5B6NA 3NZNA 1MD4A 5AIVA 4K7NA 5AIXA 2H30A 1U87A 2HI7A 2YPMA 4MNNA 4IGJA 4ZBAA 4OFMA 4MCUA 1IYIA 4I8BA 1O6JA 2ZCTA 1SU9A 5E59A 2HNLA 3HZ8A 4MPFA 4GQCA 1OKTA 5JWRB 2V1MA 4MZCA 1HYUA 2G2QA 1MDJA 4DVCA 1SYRA 1K0MA 4EC0A 3J7Yk 1JZDA 3R2QA 2H6ZA 1A2LA 1DE1A 4F82A 6GSWA 1T7PB 2YWNA 5DVBA 1M9BA 2WFCA 4TOPA 1M2DA 2DMLA 3RBTA 3CRUA 2R5GA 4K9ZA 2PERA 2H72A 1BX9A 3F3QA 1S3DA 1GNEA 3GURA 1RW1A 3KGKA 1PN0A 3LORA 4JE1A 1K0CA 3ZL5A 2PVOC 5IM9A 1FVJA 2H73A 2O89A 4EF0A 2MMNA 2IPAA 2VCQA 1EP7A 1QFNA 2XBIA 4OMVA 2LS5A 4K2XA 2O7KA 2GSRA 2KP1A 20GSA 1XWBA 1TP9A 3VURA 2YV9A 3MYDA 1YKCA 3D0ZA 3FZ5A 2EIQA 4XS4A 1B48A 5ID2B 1VGLA 4POMA 3A2XA 4ACSA 5KN0A 4FIWA 1S3CA 2L6DA 3TJJA 3HY2A 1JLWA 1XIYA 2NDOA 2FD3A 5FT3A 5JCUA 5ECQB 3ZREA 2OE0A 1FVKA 1O8XA 5ECSA 2I4AA 4HJ2A 4ID0A 3CMIA 4ZB8A 1T8EB 2TRCP 1DE2A 1USBA 4I5QA 5JWOB 1WPIA 3VPTA 1GTUA 1S3AA 4LA1A 3G7YA 4EDYA 5A4WA 1X9SB 3F3RA 2CA8A 3CSJA 4MLYA 1H4OA 4KE3A 3A2VA 2FWEA 5D9VA 2GT6A 1GRXA 2GVPA 2HSMA 3C7MA 3LYKA 4GRFA 1Z6NA 2L4QA 2OBIA 3VPQA 3RHCA 4OCEA 2JZTA 5D9TA 3F4TA 5ELGA 4MH3A 1GULA 2C3TA 3LFLA 2LRCA 5CP1A 3FK8A 2C80A 2N5BA 4MMMA 4FQUA 2PVQA 3D5JA 3Q18A 3TRPA 2YWOA 3C73A 3E0UA 5E4WA 5ECHB 2H01A 3GRXA 4V1Ap 5AN1A 1QQ2A 2DJ1A 1YJ6A 3TOTA 2LQQA 2OBKA 1A2JA 2LUSA 4ZB9A 4MK3A 5IMZA 2KHPA 2FHEA 19GSA 3LG6A 3V1WA 4WR5A 1BEDA 4GWRA 1X5EA 3QPMA 1PKZA 1V9WA 2IL3A 3H1NA 4O5UA 6GSSA 2VL9A 3DGQA 4Z7XA 2VD0A 5HFGA 4PTSA 3W8SA 2G0FA 3BCKA 2HLSA 4MPGA 4GSTA 5COHA 4F0CA 3TRXA 3EMXA 4TRXA 5G30A 2A2RA 1SJZA 2AV4A 2J9HA 5DDLA 4WEYA 3TCOA 5ID2A 2JACA 4O32A 1XOAA 2QKEA 1EP8A 3IAS2 2XPDA 3C1SA 5ABRA 4HZ4A 1GWCA 4NV2A 5A5KA 2YJHA 1TK5B 1YF1A 1M2AA 4POKA 4EUYA 3TJBA 3LXZA 3W6GA 5IMAA 1BJXA 3FR9A 2P5RA 3IR4A 2OADA 1ZL9A 1F9MA 1O8WA 1XBSA 3PH9A 2H76A 4ECJA 1R7HA 1PX6A 2H70A 1K0AA 3F63A 4YKGA 5ECPB 4ZBBA 2R2JA 1YQ1A 1Q4JA 3HJMA 1OC3A 4HU9A 3UBKA 1X5DA 3KD0A 17GSA 1PFOA 2YOIA 2LRTA 4JR6A 4RQRA 4CDOA 2X99A 1IYHA 1ZCPA 4IS0A 4PNGA 1EOHA 5HR0A 5IOXA 2VCVA 4TR0A 6GSXA 3TGZA 5DQYA 1GSEA 2FWFA 2DJKA 1FOHA 2JZSA 5ECRB 3UAPA 1GTAA 2OE1A 2MMAA 3DVWA 4IP1A 4GXZA 1YDKA 1VF3A 1ZYPA 5CNWA 4HZ2A 5LNKe 1ON4A 2YWIA 3E9JB 4HOJA 1WIKA 2C8UA 4OD7A 3LWAA 4HU7A 3RDWA 3M1GA 2Z9SA 1GH2A 4ML1A 3GTUB 1PD21 2YANA 1SKSB 4N30A 3IDVA 4TXOB 1ZYEA 1SJ6A 4TXVA 5J9BA 1A24A 2REMA 1THXA 4KA0A 3N5OA 1SENA 3QAWA 5ECMB 1TI3A 3N9JA 4ZIJA 4YKFA 1B4QA 5DALB 3RAZA 1FAAA 3IC8A 2YZHA 1ST9A 4RI7A 5DCGA 4YQVA 1OE7A 1THOA 2JZRA 3NOFA 3ZLPA 5CREA 2DBCA 5G2ZA 4N0VA 3SBCA 4N10A 3FY7A 3ZMLA 2MMOA 5IPHA 2DJ0A 3GSTA 4MZBA 1ZYQB 4KSMA 3D4TA 2HSYA 4V1Ag 2R0GA 4OWYA 3FW2A 1SKWB 1ZZYA 5DBQA 1R4WA 1WJKA 2N5FA 2RM5A 2K8SA 3APQA 3DKSA 3WGEA 1SL0B 3WD6A 2MBTA 4J57E 5EVOA 3VWWA 5D9XA 4DSSA 2GSSA 2X4AA 10GSA 2GQMA 2IIYA 2VL2A 1WRYA 1B4PA 4CY8A 1S3RA 3GKKA 1LBKA 3K8NA 4RUVA 2VM1A 3G7IA 5D8IA 3TB2A 3HKRA 3WYWA 3HJOA 3KTLA 2HFDA 3KCMA 3C71A 1W89A 3TJGA 1V98A 1KBNA 5ELAA 3ZIVA 4GF0A 5IO2A 5DJMA 1ERWA 4TR1A 1NW2A 2QC7A 3WT1A 5ECIB 1AXDA 5B8AA 1Y6EA 4EIQA 2TRXA 9GSSA 2PUKC 4LMVA 4USSA 1TK0B 4NMUA 2WB9A 1SKRB 5G1LA 3GIXA 2I9HA 1AQVA 1V58A 4MJBA 3L9UA 3A2WA 4JBBA 16GSA 3F4RA 2C3QA 4L0WA 4XS4B 2AUVA 1HNCA 1EZKA 5HR3A 2DKIA 3EE2A 2H6XA 2E2MA 1E2YA 3ZFLA 2VO4A 1QMVA 2F9SA 3GSSA 3DIEA 4YQMA 4XTSA 4POLA 2DKHA 2C4JA 1QXHA 3VWXA 4DSRA 2YP6A 4L5OA 2H19A 1ERTA 1M2BA 2ZNMA 4A5PA 1XG8A 3ERGA 3BOAA 1YEXA 1YEPA 1TU8A 2VL2C 2F8AA 1TTZA 3VWUA 4BVXA 2VL3A 4LL1B 2AHEA 3EINA 5JWQB 2YV7A 4ZL7A 1FW1A 4MF6A 2KLXA 3H4KA 3IRAA 3LW9A 3G7JA 3LQ7A 3P90A 4PQHA 2L57A 1TDIA 3G9BA 1O7UA 5DAKB 4RI6A 1JZOA 5GAND 4TR3A 1VRSD 1KNGA 4Z2RA 2VIMA 2CVBA 2K8VA 3UEMA 2VCXA 3FZ4A 4MJCA 1Z7RA 3MAKA 4E8EA 2H66A 3UOMA 4KAEA 1TRSA 3HZ4A 1ABAA 3F4SA 3IBHA 4F0BA 2VCTA 1R5PA 1PL2A 3M8NA 1GUKA 1I5GA 2H71A 3VFIA 3GKXA 2OJLA 3TKSE 4GQFA 5B7CA 3KMOA 2LKUA 5D93A 4CHSA 1HD2A 1YY7A 1T1VA 2CX3A 4L8EA 1RQMA 4HJMA 2IMFA 5G1KA 1OE8A 1Z5YE 5DCHA 5EPFA 1TRVA 2HSHA 3IXRA 4OCFA 3KM6A 1MD3A 4MF7A 2FWGA 2ALBA 2IMIA 2NVLA 4FYBA 2KOKA 1ERVA 1BAYA 2MMZA 2CZ3A 4K7IA 3FR3A 4K0GA 4I97A 4E8HA 3HVVA 2V6OA 4HI7A 2BMXA 5D73A 3M0FA 3P8WA 3ME8A 5G5EA 4ECCA 1MTCA 3F6DA 4AJ8A 4I2TA 1X0RA 4G10A 1SYXA 4EXJA 1N2AA 2HYXA 2RM6A 1UA5A 1SL1B 3KP8A 4IQAA 4PXOA 1GSDA 2M80A 1T3BA 4FYUA 2PGTA 2VCZA 1AIUA 2UZ8A 2KUCA 2O85A 2B3SA 3EYTA 3TKRA 1WP0A 4ZILA 2FNOA 2OACA 3CTGA 5J9CA 4F03A 1Z6MA 4YAPA 4XRDA 2DIZA 2H1DA 2LV3A 4ECIA 1DBYA 4MDCA 5IMDA 4BVYA 1T4ZA 3CTFA 5DAKA 4ECBA 2IJYA 3VI5A 1UVZA 1FHEA 3CBUA 2CT6A 1ZOFA 4BL7A 1EV9A 1UC7A 5KN3A 1NHYA 3O76A 4O7HA 1F2EA 2XC2A 5EY6A 1ZYNA 4KGIA 5F07A 1XXUA 3ME7A 3S9FA 2IN3A 3GHAA 4GTUA 2H6YA 3DXBA 3J7Yb 4HS1A 3FYGA 2DC5A 2M46A 4G0KA 3TJKA 4J56E 3UIWA 1EEJA 3ZITA 3D6IA 4KW6A 1V40A 4EIPA 3WGDA 4N11A 1RK4A 3IC4A 1OYJA 2WCIA 2IMDA 4XHMA 1U88A 1FB0A 2GT5A 3QAGA 5GSTA 3BD2A 3ERFA 3L0HA 3PINA 4N0ZA 4XRAA 2ON7A 3KJYA 2DSAA 3IPZA 4KUNA 5LCZA 5CYYA 2BTOT 2PBJA 3Q74A 2CZ2A 3I9V2 3FZ9A 11GSA 5EL8A 2LJRA 2QGVA 1PRXA 4IP6A 1G6WA 4K0NA 1PQNA 3ZVJD 5JCWA 3QDNA 1G7OA 3FZAA 1T4YA 2B1KA 3TOUA 5C00A 3ED3A 3L78A 6GSTA 3EMPA 4F9ZA 2HRNA 2V41A 5IOWA 5H5RA 3BCIA 2A2PA 3GH9A 3D22A 3IV4A 5IIZA 3UVHA 3HD5A 4DEJA 2AJQB 3VI7A 3PPUA 4KDUA 2TIRA 1JFUA 2GTUA 2YCDA 4DSSB 1PX7A 3TJFA 2LEGA 2EIRA 2HXKA 4IQ1A 4POBA 2HE3A 5ENUA 4AF2A 3D21A 3ISOA 2DLXA 5ECNB 5HR2A 5BRTA 1GSUA 4EE0A 2FUG2 3U6VA 4ZL9A 1SK2A 4GLTA 4TR1B 2NTOA 5C04A 3A3TA 1EGOA 2LSTA 3FRCA 4JR4A 4WETA 1B9YC 4KCAA 2HZEA 1JZRA 5CAXA 3GFKA 2E2GA 3EU4A 3MWHA 3MNGA 4KSOA 5GSSA 4K6XA 4HDEA 5KN2A 5A4VA 3GKNA 1QGVA 2VLTA 2PWJA 3CXGA 3GX0A 1J0FA 5CO3A 4PX1A 2I3YA 3F8UA 2ZUPA 3IA1A 4PUAA 1NM3A 2VM2A 4YAVA 5A4UA 2LNSA 3HVSA 4X4JA 3U5RE 1KTEA 1YKAA 4J2FA 3H79A 3E3EA 5ECKB 1UN2A 1T00A 2L5LA 4K1FA 1SK1A 3KIJA 3BBYA 2GQLA 1CQHA 4PUFC 1WMJA 3A5IA 2V32A 3JCML 3LEFA 2YN1A 3GKMA 4XS1A 3RPPA 4G2EA 1X9MB 1V57A 1TKDB 3DEXA 4V2LA 2LJKA 2V2GA 1XWAA 4BWSA 1DUGA 2F8FA 3L9VA 12GSA 3ZFBA 1XW5A 3VWVA 5CRHA 3DMLA 2FWHA 4MJAA 1ZMAA 4BVXB 3P7XA 4Q5FA 1A2MA 1GUHA 2RIIA 4KF9A 1DSBA 3GX8A 1EWXA 5GAPD 5J3RA 3CRTA 5KOXA 2H1GA 1AAZA 2LTKA 1O81A 1JZWA 3KZQA 5ECOB 4X43A 4EKZA 4BA7A 1Q98A 3QMXA 4KDYA 4MZWA 4K2DA 3APOA 1AW9A 4KNDA 3ZYWA 2H75A 4IELA 2C0GA 3IHQA 3ZIJA 3VLNA 3IOSA 1XW9A 2WZ9A 1G7EA 4BWQA 4LMWA 2VAFA 2HZFA 4XIHA 3HXSA 3M9JA 1A8LA 1PA3A 3QCPA 4PQ1A 3NIVA 1OC8A 2OE3A 2FA8A 4IW9A 4JZQA 2GZYA 3I43A 2N5AA 2WS2A 2HRAA 4GCIA 1TK8B 3I6AA 14GSA 3LSZA 4QL7A 3O6TA 1O85A 2E0QA 5BMUA 3ZZXA 2VCWA 4PURA 2B7JA 2XHFA 4JU5A 2BJXA 3GL5A 2PPTA 4NHZA 3O3TA 2GSTA 2X8HA 5HFKA 1U3IA 4TN8A 4P3YB 1PSQA 1BYEA 4JEDA 1XVWA 1J08A 1MDKA 4IBPA 4WKWA 4WF4A 1YF0A 1ACVA 1B9XC 3QFBC 4PQIA 4WBRD 3F9UA 2FA4A 4HUAA 4D73A 3QAVA 3C8EA 3GL3A 3ERWA 1R5AA 3UARA 4NHWA 3GH6A 4FO5A 3KTBA 4CW9A 3HVXA 4IVFA 4L5LA 2H1BA 1VF2A 1GTBA 2R0PA 3US3A 3TDGA 2VLUA 3GUSA 3GMFA 2B5EA 5F05A 2IFQA 5FHIA 1M9AA 4JRRA 1MEKA 3KH9A 4ISDA 1E6BA 4Z2UA 4BVYB 2EC4A 2GQKA 4MF5A 5J4UA 4NXIA 1GUMA 1FO5A 3EVIA 4EO3A 1TJDA 2C0EA 1BG5A 1A23A 1NSWA 3LJRA 2NBSA 5IO0A 4IN0A 2GSQA 4BL7B 2QA2A 1M3JA 4WR4A 1PGTA 3TUEA 4TKYA 3QFAC 4ZL8A 2L59A 1A8YA 1LJRA 1F3BA 5D9WA 1XFLA 5FWGA 2X49A 1SJIA 2H1AA 2X8CA 1M7TA 2LJAA 1K3OA 6GSYA 2CAIA 4YQUA 3DRNA 2RLIA 2K18A 2IWTA 3FEUA 4MABA 2A2SA 1V2AA 2QA1A 4ML6A 5AISA 1OC9A 2B6MA 3IHGA 1K3YA 1JHBA 1EEMA 1GSYA 1GNWA 1FB6A 3IE3A 2GLRA 1HQOA 5LD0A 4HQSA 4V2NA 1AC1A 3FHKA 2J23A 4IJ3A 4K8MA 3RHBA 1OAZA 5IMCA 2FY6A 4TR4A 5CRGA 4AJ7A 18GSA 2CQ9A 2CAQA 2JU5A 3LGCA 2PU9C 2FGXA 2F3MA 4IJIA 1TW9A 4H86A 3P2AA 4ZBDA 3QD9A 3A5WA 3KEBA 1K0OA 3TKSA 1XWKA 2DJ3A 1XVQA 3IK9A 5B8BA 1A0FA 2C0FA 1GLQA 1U3AA 4BIKA 3C1RA 5DQSA 3DYRA 8GSSA 3WT2A 2VD1A 4ULXA 2M72A 4MP4A
chains in the Genus database with same CATH topology
5HFIA 1F37A 3ZMKA 1C72A 1XZOA 1G6YA 3HDCA 1GSSA 1TXXA 4XS6A 5D96A 3L4NA 2R6KA 3QOUA 4HQZA 1QK8A 4WXTA 1XWGA 3BJ5A 3EC3A 4I2UA 5KEJA 3UBLA 2DMMA 3DWVA 1A0RP 2HZEB 4AJ6A 4OO5A 2A4VA 5H5SA 4LL4B 1TOFA 2YNXA 5CRWA 4YH2A 1XPVA 2YJ7A 3LXTA 5AGYA 1GTIA 3ZTLA 1VF1A 1OVNA 2IMEA 1ML6A 1AUCA 1K0DA 2QSIA 2X8GA 2GZZA 2LQOA 5CRDA 2R3XA 4QL9A 5GZZB 5IQYA 2K9FA 2KP2A 1H75A 3DVXA 5IMVA 1GP1A 3VK9A 2VUPA 4RQXA 3HHVA 4G0IA 1SD8A 2H0HA 4G0LA 3KH7A 1Z7PA 5KOWA 1X5CA 3CSIA 4Z2TA 2L5OA 4IKHA 2FCHA 4MJEA 3TKSC 1F3AA 1SK0A 3EPTA 22GSA 1J9BA 4NPBA 4ILFA 2B5YA 3PR8A 4CY6A 4F2IA 5IPGA 2RUEA 3OR5A 3EWLA 4L0UA 4QQ7A 2C0DA 3KMNA 3APSA 3RPNA 1U6TA 2C1YA 2B1LA 4PGTA 4KB3A 4WF5A 4K5RA 1G0TA 1FG4A 1K3LA 3LYPA 1MDIA 3KP9A 3Q6OA 4I6XA 1R26A 2MZCA 3FR6A 2AAWA 2CVDA 2E7PA 2V6KA 3UMAA 2P31A 3CYNA 4X1UA 5DJLA 2CVKA 1X9WB 3GNJA 2WULA 2H8LA 4O92A 2R37A 2JL4A 3F6FA 4G19A 2WRTA 1JLVA 4ZB6A 2NPBA 2I1UA 7GSSA 1TRWA 3MDKA 3HYPA 2XBQA 4LLRA 1W4VA 2DJ2A 3TKQA 1WWJA 1XW6A 4V2MA 2B5XA 2HT9A 3GA4A 3IK7A 4EL1A 1GL8A 3HA9A 1Z3EA 4BPYA 2B7KA 1PL1A 2I81A 1Z9HA 4AGSA 4G9HA 1XCCA 1TI1A 3AY8A 2WJUA 4FH8A 4MA9A 2MBSA 2LRNA 1K0BA 1GSQA 2MYGA 3TKPA 2R0CA 4ZXGA 2FLSA 1FOVA 2OKAA 5J5NA 2VOCA 2R4VA 5F06A 3PGTA 2ON5A 4DSQA 1HNAA 2HRKA 2GZPA 2IMKA 5F0GA 1K0NA 2XPEA 1ILOA 1PN9A 2GDRA 2O8VB 4HEA2 5G5FA 4MH2A 4D73B 3GYKA 2VLVA 1URMA 2WDUA 1F6MC 3EU3A 3UVTA 4XCSA 2LNTA 3F0IA 4KDXA 3KXOA 1Y25A 1CQGA 1HNBA 5J41A 3H8QA 2C3NA 2P0GA 2OA7A 2CX4A 3D4MA 5KN1A 1QUWA 1GLPA 5INYA 1AQXA 1VF4A 4K5SA 3HCZA 1B8XA 2IFQB 4OFTA 3W8JA 2PN8A 1LU4A 2O87A 3WGXA 1KEBA 4Q5QA 3CSHA 1PMTA 6GSUA 1WE0A 2RUFA 1TU7A 4OO4A 2L6CA 3TRQA 3FMWA 2HRFA 1XWCA 3MSZA 2F51A 4NAXA 2WGRA 1M0UA 1O73A 2YZUA 3H93A 1ZGNA 3GV1A 5L71A 1NHOA 1OKDA 5G31A 1SD9A 5H5QA 2JADA 4PNFA 4WBJA 3Q19A 1ERUA 2EIOA 2ES7A 4GSNA 4O5QA 1OC9B 2JSZA 2PMTA 1SL2B 2AB6A 1GSFA 1N8JA 5IMFA 1EOGA 2A4HA 4OFNA 4NV5A 1TRUA 2H74A 4FYCA 2D2ZA 4ICYA 5F8BA 1YZXA 3IAM2 4TVEA 5HQPA 4K7OA 2P5QA 3DD3A 2DIYA 3ZRDA 5HR1A 1AQWA 1PKWA 3HJPA 3QR6A 5JCGA 4Q5RA 6GSVA 3SWLA 2H0IA 2DJJA 4TW5A 2K6VA 4KCEA 4KH7A 3FKFA 1EGRA 1EV4A 3I69A 3GTUA 4O5RA 2L4CA 3R3EA 4TXOA 1BQ7A 5ECLB 3M3MA 3M9KA 3UL3A 2CV4A 3ZVJA 5B6MA 3EURA 4EDZA 3MIXA 13GSA 2GGTA 2GS3A 3L9SA 5DALA 2X64A 4EVMA 3UJ1A 1WOUA 1M99A 4Q5NA 3GN3A 4X0XA 2JSYA 1I9DA 4KX4A 2AYTA 2YWMA 2H0GA 4NWYA 1XOBA 4IHUA 4GSSA 5B6NA 3NZNA 1MD4A 5AIVA 4K7NA 5AIXA 2H30A 1U87A 2HI7A 2YPMA 4MNNA 4IGJA 4ZBAA 4OFMA 4MCUA 1IYIA 4I8BA 1O6JA 2ZCTA 1SU9A 5E59A 2HNLA 3HZ8A 4MPFA 4GQCA 1OKTA 5JWRB 2V1MA 4MZCA 1HYUA 2G2QA 1MDJA 4DVCA 1SYRA 1K0MA 4EC0A 3J7Yk 1JZDA 3R2QA 2H6ZA 1A2LA 1DE1A 4F82A 6GSWA 1T7PB 2YWNA 5DVBA 1M9BA 2WFCA 4TOPA 1M2DA 2DMLA 3RBTA 3CRUA 2R5GA 4K9ZA 2PERA 2H72A 1BX9A 3F3QA 1S3DA 1GNEA 3GURA 1RW1A 3KGKA 1PN0A 3LORA 4JE1A 1K0CA 3ZL5A 2PVOC 5IM9A 1FVJA 2H73A 2O89A 4EF0A 2MMNA 2IPAA 2VCQA 1EP7A 1QFNA 2XBIA 4OMVA 2LS5A 4K2XA 2O7KA 2GSRA 2KP1A 20GSA 1XWBA 1TP9A 3VURA 2YV9A 3MYDA 1YKCA 3D0ZA 3FZ5A 2EIQA 4XS4A 1B48A 5ID2B 1VGLA 4POMA 3A2XA 4ACSA 5KN0A 4FIWA 1S3CA 2L6DA 3TJJA 3HY2A 1JLWA 1XIYA 2NDOA 2FD3A 5FT3A 5JCUA 5ECQB 3ZREA 2OE0A 1FVKA 1O8XA 5ECSA 2I4AA 4HJ2A 4ID0A 3CMIA 4ZB8A 1T8EB 2TRCP 1DE2A 1USBA 4I5QA 5JWOB 1WPIA 3VPTA 1GTUA 1S3AA 4LA1A 3G7YA 4EDYA 5A4WA 1X9SB 3F3RA 2CA8A 3CSJA 4MLYA 1H4OA 4KE3A 3A2VA 2FWEA 5D9VA 2GT6A 1GRXA 2GVPA 2HSMA 3C7MA 3LYKA 4GRFA 1Z6NA 2L4QA 2OBIA 3VPQA 3RHCA 4OCEA 2JZTA 5D9TA 3F4TA 5ELGA 4MH3A 1GULA 2C3TA 3LFLA 2LRCA 5CP1A 3FK8A 2C80A 2N5BA 4MMMA 4FQUA 2PVQA 3D5JA 3Q18A 3TRPA 2YWOA 3C73A 3E0UA 5E4WA 5ECHB 2H01A 3GRXA 4V1Ap 5AN1A 1QQ2A 2DJ1A 1YJ6A 3TOTA 2LQQA 2OBKA 1A2JA 2LUSA 4ZB9A 4MK3A 5IMZA 2KHPA 2FHEA 19GSA 3LG6A 3V1WA 4WR5A 1BEDA 4GWRA 1X5EA 3QPMA 1PKZA 1V9WA 2IL3A 3H1NA 4O5UA 6GSSA 2VL9A 3DGQA 4Z7XA 2VD0A 5HFGA 4PTSA 3W8SA 2G0FA 3BCKA 2HLSA 4MPGA 4GSTA 5COHA 4F0CA 3TRXA 3EMXA 4TRXA 5G30A 2A2RA 1SJZA 2AV4A 2J9HA 5DDLA 4WEYA 3TCOA 5ID2A 2JACA 4O32A 1XOAA 2QKEA 1EP8A 3IAS2 2XPDA 3C1SA 5ABRA 4HZ4A 1GWCA 4NV2A 5A5KA 2YJHA 1TK5B 1YF1A 1M2AA 4POKA 4EUYA 3TJBA 3LXZA 3W6GA 5IMAA 1BJXA 3FR9A 2P5RA 3IR4A 2OADA 1ZL9A 1F9MA 1O8WA 1XBSA 3PH9A 2H76A 4ECJA 1R7HA 1PX6A 2H70A 1K0AA 3F63A 4YKGA 5ECPB 4ZBBA 2R2JA 1YQ1A 1Q4JA 3HJMA 1OC3A 4HU9A 3UBKA 1X5DA 3KD0A 17GSA 2YOIA 2LRTA 4JR6A 4RQRA 4CDOA 2X99A 1IYHA 1ZCPA 4IS0A 4PNGA 1EOHA 5HR0A 5IOXA 2VCVA 4TR0A 6GSXA 3TGZA 5DQYA 1GSEA 2FWFA 2DJKA 1FOHA 2JZSA 5ECRB 3UAPA 1GTAA 2OE1A 2MMAA 3DVWA 4IP1A 4GXZA 1YDKA 1VF3A 1ZYPA 5CNWA 4HZ2A 5LNKe 1ON4A 2YWIA 3E9JB 4HOJA 1WIKA 2C8UA 4OD7A 3LWAA 4HU7A 3RDWA 3M1GA 2Z9SA 1GH2A 4ML1A 3GTUB 1PD21 2YANA 1SKSB 4N30A 3IDVA 4TXOB 1ZYEA 1SJ6A 4TXVA 5J9BA 1A24A 2REMA 1THXA 4KA0A 3N5OA 1SENA 3QAWA 5ECMB 1TI3A 3N9JA 4ZIJA 4YKFA 1B4QA 5DALB 3RAZA 1FAAA 3IC8A 2YZHA 1ST9A 4RI7A 5DCGA 4YQVA 1OE7A 1THOA 2JZRA 3NOFA 3ZLPA 5CREA 2DBCA 5G2ZA 4N0VA 3SBCA 4N10A 3FY7A 3ZMLA 2MMOA 5IPHA 2DJ0A 3GSTA 4MZBA 1ZYQB 4KSMA 3D4TA 2HSYA 4V1Ag 2R0GA 4OWYA 3FW2A 1SKWB 1ZZYA 5DBQA 1R4WA 1WJKA 2N5FA 2RM5A 2K8SA 3APQA 3DKSA 3WGEA 1SL0B 3WD6A 2MBTA 4J57E 5EVOA 3VWWA 5D9XA 4DSSA 2GSSA 2X4AA 10GSA 2GQMA 2IIYA 2VL2A 1WRYA 1B4PA 4CY8A 3GKKA 1LBKA 3K8NA 4RUVA 2VM1A 3G7IA 5D8IA 3TB2A 3HKRA 3WYWA 3HJOA 3KTLA 2HFDA 3KCMA 3C71A 1W89A 3TJGA 1V98A 1KBNA 5ELAA 3ZIVA 4GF0A 5IO2A 5DJMA 1ERWA 4TR1A 1NW2A 2QC7A 3WT1A 5ECIB 1AXDA 5B8AA 1Y6EA 4EIQA 2TRXA 9GSSA 2PUKC 4LMVA 4USSA 1TK0B 4NMUA 2WB9A 1SKRB 5G1LA 3GIXA 2I9HA 1AQVA 1V58A 4MJBA 3L9UA 3A2WA 4JBBA 16GSA 3F4RA 2C3QA 4L0WA 4XS4B 2AUVA 1HNCA 1EZKA 5HR3A 2DKIA 3EE2A 2H6XA 2E2MA 1E2YA 3ZFLA 2VO4A 1QMVA 2F9SA 3GSSA 3DIEA 4YQMA 4XTSA 4POLA 2DKHA 2C4JA 1QXHA 3VWXA 4DSRA 2YP6A 4L5OA 2H19A 1ERTA 1M2BA 2ZNMA 4A5PA 3ERGA 3BOAA 1YEXA 1YEPA 1TU8A 2VL2C 2F8AA 1TTZA 3VWUA 4BVXA 2VL3A 4LL1B 2AHEA 3EINA 5JWQB 2YV7A 4ZL7A 1FW1A 4MF6A 2KLXA 3H4KA 3IRAA 3LW9A 3G7JA 3LQ7A 3P90A 4PQHA 2L57A 1TDIA 3G9BA 1O7UA 5DAKB 4RI6A 1JZOA 5GAND 4TR3A 1VRSD 1KNGA 4Z2RA 2VIMA 2CVBA 2K8VA 3UEMA 2VCXA 3FZ4A 4MJCA 1Z7RA 3MAKA 4E8EA 2H66A 3UOMA 4KAEA 1TRSA 3HZ4A 1ABAA 3F4SA 3IBHA 4F0BA 2VCTA 1R5PA 1PL2A 3M8NA 1GUKA 1I5GA 2H71A 3VFIA 3GKXA 2OJLA 3TKSE 4GQFA 5B7CA 3KMOA 2LKUA 5D93A 4CHSA 1HD2A 1YY7A 1T1VA 2CX3A 4L8EA 1RQMA 4HJMA 2IMFA 5G1KA 1OE8A 1Z5YE 5DCHA 5EPFA 1TRVA 2HSHA 3IXRA 4OCFA 3KM6A 1MD3A 4MF7A 2FWGA 2ALBA 2IMIA 2NVLA 4FYBA 2KOKA 1ERVA 1BAYA 2MMZA 2CZ3A 4K7IA 3FR3A 4K0GA 4I97A 4E8HA 3HVVA 2V6OA 4HI7A 2BMXA 5D73A 3M0FA 3P8WA 3ME8A 5G5EA 4ECCA 1MTCA 3F6DA 4AJ8A 4I2TA 1X0RA 4G10A 1SYXA 4EXJA 1N2AA 2HYXA 2RM6A 1UA5A 1SL1B 3KP8A 4IQAA 4PXOA 1GSDA 2M80A 1T3BA 4FYUA 2PGTA 2VCZA 1AIUA 2UZ8A 2KUCA 2O85A 2B3SA 3EYTA 3TKRA 1WP0A 4ZILA 2FNOA 2OACA 3CTGA 5J9CA 4F03A 1Z6MA 4YAPA 4XRDA 2DIZA 2H1DA 2LV3A 4ECIA 1DBYA 4MDCA 5IMDA 4BVYA 1T4ZA 3CTFA 5DAKA 4ECBA 2IJYA 3VI5A 1UVZA 1FHEA 3CBUA 2CT6A 1ZOFA 4BL7A 1EV9A 1UC7A 5KN3A 1NHYA 3O76A 4O7HA 1F2EA 2XC2A 5EY6A 1ZYNA 4KGIA 5F07A 1XXUA 3ME7A 3S9FA 2IN3A 3GHAA 4GTUA 2H6YA 3DXBA 3J7Yb 4HS1A 3FYGA 2DC5A 2M46A 4G0KA 3TJKA 4J56E 3UIWA 1EEJA 3ZITA 3D6IA 4KW6A 1V40A 4EIPA 3WGDA 4N11A 1RK4A 3IC4A 1OYJA 2WCIA 2IMDA 4XHMA 1U88A 1FB0A 2GT5A 3QAGA 5GSTA 3BD2A 3ERFA 3L0HA 3PINA 4N0ZA 4XRAA 2ON7A 3KJYA 2DSAA 3IPZA 4KUNA 5LCZA 5CYYA 2BTOT 2PBJA 3Q74A 2CZ2A 3I9V2 3FZ9A 11GSA 5EL8A 2LJRA 2QGVA 1PRXA 4IP6A 1G6WA 4K0NA 1PQNA 3ZVJD 5JCWA 3QDNA 1G7OA 3FZAA 1T4YA 2B1KA 3TOUA 5C00A 3ED3A 3L78A 6GSTA 3EMPA 4F9ZA 2HRNA 2V41A 5IOWA 5H5RA 3BCIA 2A2PA 3GH9A 3D22A 3IV4A 5IIZA 3UVHA 3HD5A 4DEJA 2AJQB 3VI7A 3PPUA 4KDUA 2TIRA 1JFUA 2GTUA 2YCDA 4DSSB 1PX7A 3TJFA 2LEGA 2EIRA 2HXKA 4IQ1A 4POBA 2HE3A 5ENUA 4AF2A 3D21A 3ISOA 2DLXA 5ECNB 5HR2A 5BRTA 1GSUA 4EE0A 2FUG2 3U6VA 4ZL9A 1SK2A 4GLTA 4TR1B 2NTOA 5C04A 3A3TA 1EGOA 2LSTA 3FRCA 4JR4A 4WETA 1B9YC 4KCAA 2HZEA 1JZRA 5CAXA 3GFKA 2E2GA 3EU4A 3MWHA 3MNGA 4KSOA 5GSSA 4K6XA 4HDEA 5KN2A 5A4VA 3GKNA 1QGVA 2VLTA 2PWJA 3CXGA 3GX0A 1J0FA 5CO3A 4PX1A 2I3YA 3F8UA 2ZUPA 3IA1A 4PUAA 1NM3A 2VM2A 4YAVA 5A4UA 2LNSA 3HVSA 4X4JA 3U5RE 1KTEA 1YKAA 4J2FA 3H79A 3E3EA 5ECKB 1UN2A 1T00A 2L5LA 4K1FA 1SK1A 3KIJA 3BBYA 2GQLA 1CQHA 4PUFC 1WMJA 3A5IA 2V32A 3JCML 3LEFA 2YN1A 3GKMA 4XS1A 3RPPA 4G2EA 1X9MB 1V57A 1TKDB 3DEXA 4V2LA 2LJKA 2V2GA 1XWAA 4BWSA 1DUGA 2F8FA 3L9VA 12GSA 3ZFBA 1XW5A 3VWVA 5CRHA 3DMLA 2FWHA 4MJAA 1ZMAA 4BVXB 3P7XA 4Q5FA 1A2MA 1GUHA 2RIIA 4KF9A 1DSBA 3GX8A 1EWXA 5GAPD 5J3RA 3CRTA 5KOXA 2H1GA 1AAZA 2LTKA 1O81A 1JZWA 3KZQA 5ECOB 4X43A 4EKZA 4BA7A 1Q98A 3QMXA 4KDYA 4MZWA 4K2DA 3APOA 1AW9A 4KNDA 3ZYWA 2H75A 4IELA 2C0GA 3IHQA 3ZIJA 3VLNA 3IOSA 1XW9A 2WZ9A 1G7EA 4BWQA 4LMWA 2VAFA 2HZFA 4XIHA 3HXSA 3M9JA 1A8LA 1PA3A 3QCPA 4PQ1A 3NIVA 1OC8A 2OE3A 2FA8A 4IW9A 4JZQA 2GZYA 3I43A 2N5AA 2WS2A 2HRAA 4GCIA 1TK8B 3I6AA 14GSA 3LSZA 4QL7A 3O6TA 1O85A 2E0QA 5BMUA 3ZZXA 2VCWA 4PURA 2B7JA 2XHFA 4JU5A 2BJXA 3GL5A 2PPTA 4NHZA 3O3TA 2GSTA 2X8HA 5HFKA 1U3IA 4TN8A 4P3YB 1PSQA 1BYEA 4JEDA 1XVWA 1J08A 1MDKA 4IBPA 4WKWA 4WF4A 1YF0A 1ACVA 1B9XC 3QFBC 4PQIA 4WBRD 3F9UA 2FA4A 4HUAA 4D73A 3QAVA 3C8EA 3GL3A 3ERWA 1R5AA 3UARA 4NHWA 3GH6A 4FO5A 3KTBA 4CW9A 3HVXA 4IVFA 4L5LA 2H1BA 1VF2A 1GTBA 2R0PA 3US3A 3TDGA 2VLUA 3GUSA 3GMFA 2B5EA 5F05A 2IFQA 5FHIA 1M9AA 4JRRA 1MEKA 3KH9A 4ISDA 1E6BA 4Z2UA 4BVYB 2EC4A 2GQKA 4MF5A 5J4UA 4NXIA 1GUMA 1FO5A 3EVIA 4EO3A 1TJDA 2C0EA 1BG5A 1A23A 1NSWA 3LJRA 2NBSA 5IO0A 4IN0A 2GSQA 4BL7B 2QA2A 4WR4A 1PGTA 3TUEA 4TKYA 3QFAC 4ZL8A 2L59A 1A8YA 1LJRA 1F3BA 5D9WA 1XFLA 5FWGA 2X49A 1SJIA 2H1AA 2X8CA 1M7TA 2LJAA 1K3OA 6GSYA 2CAIA 4YQUA 3DRNA 2RLIA 2K18A 2IWTA 3FEUA 4MABA 2A2SA 1V2AA 2QA1A 4ML6A 5AISA 1OC9A 2B6MA 3IHGA 1K3YA 1JHBA 1EEMA 1GSYA 1GNWA 1FB6A 3IE3A 2GLRA 1HQOA 5LD0A 4HQSA 4V2NA 1AC1A 3FHKA 2J23A 4IJ3A 4K8MA 3RHBA 1OAZA 5IMCA 2FY6A 4TR4A 5CRGA 4AJ7A 18GSA 2CQ9A 2CAQA 2JU5A 3LGCA 2PU9C 2FGXA 2F3MA 4IJIA 1TW9A 4H86A 3P2AA 4ZBDA 3QD9A 3A5WA 3KEBA 1K0OA 3TKSA 1XWKA 2DJ3A 1XVQA 3IK9A 5B8BA 1A0FA 2C0FA 1GLQA 1U3AA 3C1RA 5DQSA 3DYRA 8GSSA 3WT2A 2VD1A 4ULXA 2M72A 4MP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFI A;  1F37 A;  3ZMK A;  1C72 A;  1XZO A;  1G6Y A;  3HDC A;  1GSS A;  1TXX A;  4XS6 A;  5D96 A;  3L4N A;  2R6K A;  3QOU A;  4HQZ A;  1QK8 A;  4WXT A;  1XWG A;  3BJ5 A;  3EC3 A;  4I2U A;  5KEJ A;  3UBL A;  2DMM A;  3DWV A;  1A0R P;  2HZE B;  4AJ6 A;  4OO5 A;  2A4V A;  5H5S A;  4LL4 B;  1TOF A;  2YNX A;  5CRW A;  4YH2 A;  1XPV A;  2YJ7 A;  3LXT A;  5AGY A;  1GTI A;  3ZTL A;  1VF1 A;  1OVN A;  2IME A;  1ML6 A;  1AUC A;  1K0D A;  2QSI A;  2X8G A;  2GZZ A;  2LQO A;  5CRD A;  2R3X A;  4QL9 A;  5GZZ B;  5IQY A;  2K9F A;  2KP2 A;  1H75 A;  3DVX A;  5IMV A;  1GP1 A;  3VK9 A;  2VUP A;  4RQX A;  3HHV A;  1SD8 A;  2H0H A;  3KH7 A;  1Z7P A;  1X5C A;  3CSI A;  2L5O A;  4IKH A;  2FCH A;  4MJE A;  3TKS C;  1F3A A;  1SK0 A;  22GS A;  1J9B A;  4NPB A;  4ILF A;  2B5Y A;  3PR8 A;  4F2I A;  5IPG A;  2RUE A;  3OR5 A;  3EWL A;  4L0U A;  4QQ7 A;  2C0D A;  3KMN A;  3APS A;  3RPN A;  1U6T A;  2C1Y A;  2B1L A;  4PGT A;  4KB3 A;  4WF5 A;  1G0T A;  1FG4 A;  1K3L A;  3LYP A;  1MDI A;  3KP9 A;  3Q6O A;  4I6X A;  1R26 A;  2MZC A;  3FR6 A;  2AAW A;  2CVD A;  2E7P A;  2V6K A;  3UMA A;  2P31 A;  3CYN A;  4X1U A;  5DJL A;  2CVK A;  1X9W B;  3GNJ A;  2WUL A;  2H8L A;  4O92 A;  2R37 A;  2JL4 A;  3F6F A;  4G19 A;  2WRT A;  1JLV A;  4ZB6 A;  2NPB A;  2I1U A;  7GSS A;  1TRW A;  3MDK A;  3HYP A;  2XBQ A;  4LLR A;  1W4V A;  2DJ2 A;  3TKQ A;  1WWJ A;  1XW6 A;  4V2M A;  2B5X A;  2HT9 A;  3GA4 A;  3IK7 A;  4EL1 A;  1GL8 A;  3HA9 A;  1Z3E A;  4BPY A;  2B7K A;  1PL1 A;  2I81 A;  1Z9H A;  4AGS A;  4G9H A;  1XCC A;  1TI1 A;  3AY8 A;  2WJU A;  4FH8 A;  4MA9 A;  2MBS A;  2LRN A;  1K0B A;  1GSQ A;  2MYG A;  3TKP A;  4ZXG A;  2FLS A;  1FOV A;  2OKA A;  5J5N A;  2VOC A;  2R4V A;  5F06 A;  3PGT A;  2ON5 A;  4DSQ A;  1HNA A;  2GZP A;  2IMK A;  5F0G A;  1K0N A;  2XPE A;  1ILO A;  1PN9 A;  2GDR A;  2O8V B;  4HEA 2;  5G5F A;  4MH2 A;  4D73 B;  3GYK A;  2VLV A;  1URM A;  2WDU A;  1F6M C;  3EU3 A;  3UVT A;  4XCS A;  2LNT A;  3F0I A;  4KDX A;  3KXO A;  1Y25 A;  1CQG A;  1HNB A;  5J41 A;  3H8Q A;  2C3N A;  2P0G A;  2OA7 A;  2CX4 A;  3D4M A;  5KN1 A;  1QUW A;  1GLP A;  5INY A;  1AQX A;  1VF4 A;  3HCZ A;  1B8X A;  2IFQ B;  4OFT A;  3W8J A;  2PN8 A;  1LU4 A;  2O87 A;  3WGX A;  1KEB A;  4Q5Q A;  3CSH A;  1PMT A;  6GSU A;  1WE0 A;  2RUF A;  1TU7 A;  4OO4 A;  2L6C A;  3TRQ A;  2HRF A;  1XWC A;  3MSZ A;  2F51 A;  4NAX A;  2WGR A;  1M0U A;  1O73 A;  2YZU A;  3H93 A;  1ZGN A;  3GV1 A;  5L71 A;  1NHO A;  1OKD A;  5G31 A;  1SD9 A;  5H5Q A;  2JAD A;  4PNF A;  4WBJ A;  3Q19 A;  1ERU A;  2EIO A;  2ES7 A;  4GSN A;  1OC9 B;  2JSZ A;  2PMT A;  1SL2 B;  2AB6 A;  1GSF A;  1N8J A;  5IMF A;  1EOG A;  4OFN A;  4NV5 A;  1TRU A;  2H74 A;  4FYC A;  2D2Z A;  5F8B A;  1YZX A;  3IAM 2;  4TVE A;  5HQP A;  4K7O A;  2P5Q A;  3DD3 A;  2DIY A;  3ZRD A;  5HR1 A;  1AQW A;  1PKW A;  3HJP A;  3QR6 A;  5JCG A;  4Q5R A;  6GSV A;  3SWL A;  2H0I A;  2DJJ A;  4TW5 A;  2K6V A;  4KCE A;  4KH7 A;  3FKF A;  1EGR A;  1EV4 A;  3I69 A;  3GTU A;  4O5R A;  2L4C A;  4TXO A;  1BQ7 A;  5ECL B;  3M3M A;  3M9K A;  3UL3 A;  2CV4 A;  3ZVJ A;  5B6M A;  3EUR A;  4EDZ A;  13GS A;  2GGT A;  2GS3 A;  3L9S A;  5DAL A;  2X64 A;  4EVM A;  3UJ1 A;  1WOU A;  1M99 A;  4Q5N A;  3GN3 A;  4X0X A;  2JSY A;  1I9D A;  4KX4 A;  2AYT A;  2YWM A;  2H0G A;  4NWY A;  1XOB A;  4IHU A;  4GSS A;  5B6N A;  3NZN A;  1MD4 A;  5AIV A;  4K7N A;  5AIX A;  2H30 A;  1U87 A;  2HI7 A;  2YPM A;  4IGJ A;  4ZBA A;  4OFM A;  4MCU A;  1IYI A;  4I8B A;  1O6J A;  2ZCT A;  1SU9 A;  5E59 A;  2HNL A;  3HZ8 A;  4MPF A;  4GQC A;  1OKT A;  5JWR B;  2V1M A;  4MZC A;  1HYU A;  2G2Q A;  1MDJ A;  4DVC A;  1SYR A;  1K0M A;  4EC0 A;  3J7Y k;  1JZD A;  3R2Q A;  2H6Z A;  1A2L A;  1DE1 A;  4F82 A;  6GSW A;  1T7P B;  2YWN A;  5DVB A;  1M9B A;  2WFC A;  4TOP A;  1M2D A;  2DML A;  3RBT A;  3CRU A;  2R5G A;  4K9Z A;  2PER A;  2H72 A;  1BX9 A;  3F3Q A;  1S3D A;  1GNE A;  3GUR A;  1RW1 A;  3KGK A;  3LOR A;  4JE1 A;  1K0C A;  3ZL5 A;  2PVO C;  5IM9 A;  1FVJ A;  2H73 A;  2O89 A;  4EF0 A;  2MMN A;  2IPA A;  2VCQ A;  1EP7 A;  1QFN A;  2XBI A;  4OMV A;  2LS5 A;  2O7K A;  2GSR A;  2KP1 A;  20GS A;  1XWB A;  1TP9 A;  3VUR A;  2YV9 A;  1YKC A;  3D0Z A;  3FZ5 A;  2EIQ A;  4XS4 A;  1B48 A;  5ID2 B;  1VGL A;  4POM A;  3A2X A;  4ACS A;  5KN0 A;  4FIW A;  1S3C A;  2L6D A;  3TJJ A;  3HY2 A;  1JLW A;  1XIY A;  2NDO A;  2FD3 A;  5FT3 A;  5JCU A;  5ECQ B;  3ZRE A;  2OE0 A;  1FVK A;  1O8X A;  5ECS A;  2I4A A;  4HJ2 A;  4ID0 A;  3CMI A;  4ZB8 A;  1T8E B;  2TRC P;  1DE2 A;  1USB A;  4I5Q A;  5JWO B;  1WPI A;  3VPT A;  1GTU A;  1S3A A;  4LA1 A;  3G7Y A;  4EDY A;  5A4W A;  1X9S B;  3F3R A;  2CA8 A;  3CSJ A;  4MLY A;  1H4O A;  4KE3 A;  3A2V A;  2FWE A;  5D9V A;  2GT6 A;  1GRX A;  2GVP A;  3C7M A;  3LYK A;  4GRF A;  1Z6N A;  2L4Q A;  2OBI A;  3VPQ A;  3RHC A;  4OCE A;  2JZT A;  5D9T A;  3F4T A;  5ELG A;  4MH3 A;  1GUL A;  2C3T A;  3LFL A;  2LRC A;  5CP1 A;  3FK8 A;  2C80 A;  2N5B A;  4MMM A;  2PVQ A;  3D5J A;  3Q18 A;  3TRP A;  2YWO A;  3C73 A;  3E0U A;  5E4W A;  5ECH B;  2H01 A;  3GRX A;  4V1A p;  5AN1 A;  1QQ2 A;  2DJ1 A;  1YJ6 A;  3TOT A;  2LQQ A;  2OBK A;  1A2J A;  2LUS A;  4ZB9 A;  4MK3 A;  5IMZ A;  2KHP A;  2FHE A;  19GS A;  3LG6 A;  3V1W A;  4WR5 A;  1BED A;  4GWR A;  1X5E A;  3QPM A;  1PKZ A;  1V9W A;  2IL3 A;  3H1N A;  6GSS A;  2VL9 A;  3DGQ A;  4Z7X A;  2VD0 A;  5HFG A;  3W8S A;  2G0F A;  3BCK A;  2HLS A;  4MPG A;  4GST A;  5COH A;  4F0C A;  3TRX A;  3EMX A;  4TRX A;  5G30 A;  2A2R A;  1SJZ A;  2AV4 A;  2J9H A;  5DDL A;  4WEY A;  3TCO A;  5ID2 A;  2JAC A;  4O32 A;  1XOA A;  2QKE A;  1EP8 A;  3IAS 2;  2XPD A;  3C1S A;  5ABR A;  4HZ4 A;  1GWC A;  4NV2 A;  5A5K A;  2YJH A;  1TK5 B;  1YF1 A;  1M2A A;  4POK A;  4EUY A;  3TJB A;  3LXZ A;  3W6G A;  5IMA A;  1BJX A;  3FR9 A;  2P5R A;  3IR4 A;  2OAD A;  1ZL9 A;  1F9M A;  1O8W A;  1XBS A;  3PH9 A;  2H76 A;  4ECJ A;  1R7H A;  1PX6 A;  2H70 A;  1K0A A;  3F63 A;  5ECP B;  4ZBB A;  2R2J A;  1YQ1 A;  1Q4J A;  3HJM A;  1OC3 A;  4HU9 A;  3UBK A;  1X5D A;  3KD0 A;  17GS A;  2YOI A;  2LRT A;  4JR6 A;  4RQR A;  4CDO A;  2X99 A;  1IYH A;  1ZCP A;  4IS0 A;  4PNG A;  1EOH A;  5HR0 A;  5IOX A;  2VCV A;  4TR0 A;  6GSX A;  3TGZ A;  5DQY A;  1GSE A;  2FWF A;  2DJK A;  2JZS A;  5ECR B;  3UAP A;  1GTA A;  2OE1 A;  2MMA A;  3DVW A;  4IP1 A;  4GXZ A;  1YDK A;  1VF3 A;  5CNW A;  4HZ2 A;  5LNK e;  1ON4 A;  2YWI A;  3E9J B;  4HOJ A;  1WIK A;  2C8U A;  4OD7 A;  3LWA A;  4HU7 A;  3RDW A;  3M1G A;  2Z9S A;  1GH2 A;  4ML1 A;  3GTU B;  1PD2 1;  2YAN A;  1SKS B;  4N30 A;  3IDV A;  4TXO B;  1ZYE A;  1SJ6 A;  4TXV A;  5J9B A;  1A24 A;  2REM A;  1THX A;  4KA0 A;  3N5O A;  1SEN A;  3QAW A;  5ECM B;  1TI3 A;  3N9J A;  4ZIJ A;  1B4Q A;  5DAL B;  3RAZ A;  1FAA A;  2YZH A;  1ST9 A;  4RI7 A;  5DCG A;  4YQV A;  1OE7 A;  1THO A;  2JZR A;  3NOF A;  3ZLP A;  5CRE A;  2DBC A;  5G2Z A;  4N0V A;  3SBC A;  4N10 A;  3FY7 A;  3ZML A;  2MMO A;  5IPH A;  2DJ0 A;  3GST A;  4MZB A;  1ZYQ B;  4KSM A;  3D4T A;  2HSY A;  4V1A g;  4OWY A;  3FW2 A;  1SKW B;  1ZZY A;  5DBQ A;  1R4W A;  1WJK A;  2N5F A;  2RM5 A;  2K8S A;  3APQ A;  3DKS A;  3WGE A;  1SL0 B;  3WD6 A;  2MBT A;  4J57 E;  5EVO A;  3VWW A;  5D9X A;  4DSS A;  2GSS A;  10GS A;  2GQM A;  2IIY A;  2VL2 A;  1WRY A;  1B4P A;  3GKK A;  1LBK A;  3K8N A;  4RUV A;  2VM1 A;  3G7I A;  5D8I A;  3TB2 A;  3HKR A;  3WYW A;  3HJO A;  3KTL A;  2HFD A;  3KCM A;  3C71 A;  1W89 A;  3TJG A;  1V98 A;  1KBN A;  5ELA A;  3ZIV A;  4GF0 A;  5IO2 A;  5DJM A;  1ERW A;  4TR1 A;  1NW2 A;  2QC7 A;  3WT1 A;  5ECI B;  1AXD A;  5B8A A;  1Y6E A;  2TRX A;  9GSS A;  2PUK C;  4LMV A;  1TK0 B;  4NMU A;  2WB9 A;  1SKR B;  5G1L A;  3GIX A;  2I9H A;  1AQV A;  1V58 A;  4MJB A;  3L9U A;  3A2W A;  4JBB A;  16GS A;  3F4R A;  2C3Q A;  4L0W A;  4XS4 B;  2AUV A;  1HNC A;  1EZK A;  5HR3 A;  3EE2 A;  2H6X A;  2E2M A;  1E2Y A;  3ZFL A;  2VO4 A;  1QMV A;  2F9S A;  3GSS A;  3DIE A;  4YQM A;  4XTS A;  4POL A;  2C4J A;  1QXH A;  3VWX A;  4DSR A;  2YP6 A;  4L5O A;  2H19 A;  1ERT A;  1M2B A;  2ZNM A;  3ERG A;  3BOA A;  1YEX A;  1YEP A;  1TU8 A;  2VL2 C;  2F8A A;  1TTZ A;  3VWU A;  4BVX A;  2VL3 A;  4LL1 B;  2AHE A;  3EIN A;  5JWQ B;  2YV7 A;  4ZL7 A;  1FW1 A;  4MF6 A;  2KLX A;  3H4K A;  3IRA A;  3G7J A;  3LQ7 A;  3P90 A;  4PQH A;  2L57 A;  1TDI A;  3G9B A;  1O7U A;  5DAK B;  4RI6 A;  1JZO A;  5GAN D;  4TR3 A;  1VRS D;  1KNG A;  2VIM A;  2CVB A;  2K8V A;  3UEM A;  2VCX A;  3FZ4 A;  4MJC A;  1Z7R A;  3MAK A;  4E8E A;  2H66 A;  3UOM A;  4KAE A;  1TRS A;  3HZ4 A;  1ABA A;  3F4S A;  3IBH A;  4F0B A;  2VCT A;  1R5P A;  1PL2 A;  3M8N A;  1GUK A;  1I5G A;  2H71 A;  3VFI A;  3GKX A;  2OJL A;  3TKS E;  4GQF A;  5B7C A;  3KMO A;  2LKU A;  5D93 A;  4CHS A;  1HD2 A;  1YY7 A;  1T1V A;  2CX3 A;  4L8E A;  1RQM A;  4HJM A;  2IMF A;  5G1K A;  1OE8 A;  1Z5Y E;  5DCH A;  5EPF A;  1TRV A;  2HSH A;  3IXR A;  4OCF A;  3KM6 A;  1MD3 A;  4MF7 A;  2FWG A;  2ALB A;  2IMI A;  2NVL A;  4FYB A;  2KOK A;  1ERV A;  1BAY A;  2MMZ A;  2CZ3 A;  4K7I A;  3FR3 A;  4K0G A;  4I97 A;  4E8H A;  3HVV A;  2V6O A;  4HI7 A;  2BMX A;  5D73 A;  3M0F A;  3P8W A;  3ME8 A;  5G5E A;  4ECC A;  1MTC A;  3F6D A;  4AJ8 A;  4I2T A;  1X0R A;  4G10 A;  1SYX A;  4EXJ A;  1N2A A;  2HYX A;  2RM6 A;  1UA5 A;  1SL1 B;  3KP8 A;  4IQA A;  4PXO A;  1GSD A;  2M80 A;  1T3B A;  4FYU A;  2PGT A;  2VCZ A;  1AIU A;  2KUC A;  2O85 A;  2B3S A;  3EYT A;  3TKR A;  1WP0 A;  4ZIL A;  2FNO A;  2OAC A;  3CTG A;  5J9C A;  4F03 A;  1Z6M A;  4YAP A;  4XRD A;  2DIZ A;  2H1D A;  2LV3 A;  4ECI A;  1DBY A;  4MDC A;  5IMD A;  4BVY A;  1T4Z A;  3CTF A;  5DAK A;  4ECB A;  2IJY A;  3VI5 A;  1UVZ A;  1FHE A;  3CBU A;  2CT6 A;  1ZOF A;  4BL7 A;  1EV9 A;  1UC7 A;  5KN3 A;  1NHY A;  3O76 A;  4O7H A;  1F2E A;  2XC2 A;  5EY6 A;  4KGI A;  5F07 A;  1XXU A;  3ME7 A;  3S9F A;  2IN3 A;  3GHA A;  4GTU A;  2H6Y A;  3DXB A;  3J7Y b;  4HS1 A;  3FYG A;  2DC5 A;  2M46 A;  3UIW A;  3TJK A;  4J56 E;  1EEJ A;  3ZIT A;  3D6I A;  4KW6 A;  1V40 A;  3WGD A;  4N11 A;  1RK4 A;  3IC4 A;  1OYJ A;  2WCI A;  2IMD A;  4XHM A;  1U88 A;  1FB0 A;  2GT5 A;  3QAG A;  5GST A;  3BD2 A;  3ERF A;  3L0H A;  3PIN A;  4N0Z A;  4XRA A;  2ON7 A;  3KJY A;  2DSA A;  3IPZ A;  4KUN A;  5LCZ A;  5CYY A;  2BTO T;  2PBJ A;  3Q74 A;  2CZ2 A;  3I9V 2;  3FZ9 A;  11GS A;  5EL8 A;  2LJR A;  2QGV A;  1PRX A;  4IP6 A;  1G6W A;  4K0N A;  1PQN A;  3ZVJ D;  5JCW A;  3QDN A;  1G7O A;  3FZA A;  1T4Y A;  2B1K A;  3TOU A;  5C00 A;  3ED3 A;  3L78 A;  6GST A;  3EMP A;  4F9Z A;  2HRN A;  2V41 A;  5IOW A;  5H5R A;  3BCI A;  3GH9 A;  3D22 A;  3IV4 A;  5IIZ A;  3UVH A;  3HD5 A;  4DEJ A;  2AJQ B;  3VI7 A;  4KDU A;  2TIR A;  1JFU A;  2GTU A;  2YCD A;  4DSS B;  1PX7 A;  3TJF A;  2LEG A;  2EIR A;  2HXK A;  4IQ1 A;  4POB A;  2HE3 A;  5ENU A;  4AF2 A;  3D21 A;  3ISO A;  2DLX A;  5ECN B;  5HR2 A;  1GSU A;  4EE0 A;  2FUG 2;  3U6V A;  4ZL9 A;  1SK2 A;  4GLT A;  4TR1 B;  2NTO A;  5C04 A;  3A3T A;  1EGO A;  2LST A;  3FRC A;  4JR4 A;  4WET A;  1B9Y C;  4KCA A;  2HZE A;  1JZR A;  5CAX A;  3GFK A;  2E2G A;  3EU4 A;  3MWH A;  3MNG A;  4KSO A;  5GSS A;  4K6X A;  4HDE A;  5KN2 A;  5A4V A;  3GKN A;  1QGV A;  2VLT A;  2PWJ A;  3CXG A;  3GX0 A;  1J0F A;  5CO3 A;  4PX1 A;  2I3Y A;  3F8U A;  2ZUP A;  3IA1 A;  4PUA A;  1NM3 A;  2VM2 A;  4YAV A;  5A4U A;  2LNS A;  3HVS A;  3U5R E;  1KTE A;  1YKA A;  4J2F A;  3H79 A;  3E3E A;  5ECK B;  1UN2 A;  1T00 A;  2L5L A;  4K1F A;  1SK1 A;  3KIJ A;  3BBY A;  2GQL A;  1CQH A;  4PUF C;  1WMJ A;  2V32 A;  3JCM L;  3LEF A;  2YN1 A;  3GKM A;  4XS1 A;  3RPP A;  4G2E A;  1X9M B;  1V57 A;  1TKD B;  3DEX A;  4V2L A;  2LJK A;  2V2G A;  1XWA A;  4BWS A;  1DUG A;  2F8F A;  3L9V A;  12GS A;  3ZFB A;  1XW5 A;  3VWV A;  5CRH A;  3DML A;  2FWH A;  4MJA A;  1ZMA A;  3P7X A;  4Q5F A;  1A2M A;  1GUH A;  2RII A;  1DSB A;  3GX8 A;  1EWX A;  5GAP D;  5J3R A;  3CRT A;  2H1G A;  1AAZ A;  2LTK A;  1O81 A;  1JZW A;  3KZQ A;  5ECO B;  4X43 A;  4EKZ A;  4BA7 A;  1Q98 A;  3QMX A;  4KDY A;  4MZW A;  4K2D A;  3APO A;  1AW9 A;  4KND A;  3ZYW A;  2H75 A;  4IEL A;  2C0G A;  3IHQ A;  3ZIJ A;  3VLN A;  3IOS A;  1XW9 A;  2WZ9 A;  1G7E A;  4BWQ A;  4LMW A;  2VAF A;  2HZF A;  4XIH A;  3HXS A;  3M9J A;  1A8L A;  1PA3 A;  3QCP A;  4PQ1 A;  3NIV A;  1OC8 A;  2OE3 A;  2FA8 A;  4IW9 A;  4JZQ A;  2GZY A;  3I43 A;  2N5A A;  2WS2 A;  4GCI A;  1TK8 B;  3I6A A;  14GS A;  3LSZ A;  4QL7 A;  3O6T A;  1O85 A;  2E0Q A;  3ZZX A;  2VCW A;  4PUR A;  2B7J A;  2XHF A;  4JU5 A;  2BJX A;  3GL5 A;  2PPT A;  4NHZ A;  3O3T A;  2GST A;  2X8H A;  5HFK A;  1U3I A;  4TN8 A;  4P3Y B;  1PSQ A;  1BYE A;  4JED A;  1XVW A;  1J08 A;  1MDK A;  4IBP A;  4WKW A;  4WF4 A;  1YF0 A;  1ACV A;  1B9X C;  3QFB C;  4PQI A;  4WBR D;  3F9U A;  2FA4 A;  4HUA A;  4D73 A;  3QAV A;  3C8E A;  3GL3 A;  3ERW A;  1R5A A;  3UAR A;  4NHW A;  3GH6 A;  4FO5 A;  3KTB A;  4CW9 A;  3HVX A;  4IVF A;  4L5L A;  2H1B A;  1VF2 A;  1GTB A;  3US3 A;  3TDG A;  2VLU A;  3GUS A;  3GMF A;  2B5E A;  5F05 A;  2IFQ A;  5FHI A;  1M9A A;  4JRR A;  1MEK A;  3KH9 A;  4ISD A;  1E6B A;  2EC4 A;  2GQK A;  4MF5 A;  5J4U A;  4NXI A;  1GUM A;  1FO5 A;  3EVI A;  4EO3 A;  1TJD A;  2C0E A;  1BG5 A;  1A23 A;  1NSW A;  3LJR A;  2NBS A;  5IO0 A;  4IN0 A;  2GSQ A;  4WR4 A;  1PGT A;  3TUE A;  4TKY A;  3QFA C;  4ZL8 A;  2L59 A;  1A8Y A;  1LJR A;  1F3B A;  5D9W A;  1XFL A;  5FWG A;  1SJI A;  2H1A A;  2X8C A;  1M7T A;  2LJA A;  1K3O A;  6GSY A;  2CAI A;  4YQU A;  3DRN A;  2RLI A;  2K18 A;  2IWT A;  3FEU A;  4MAB A;  2A2S A;  1V2A A;  4ML6 A;  5AIS A;  1OC9 A;  2B6M A;  1K3Y A;  1JHB A;  1EEM A;  1GSY A;  1GNW A;  1FB6 A;  3IE3 A;  2GLR A;  1HQO A;  5LD0 A;  4HQS A;  4V2N A;  1AC1 A;  3FHK A;  2J23 A;  4IJ3 A;  4K8M A;  3RHB A;  1OAZ A;  5IMC A;  2FY6 A;  4TR4 A;  5CRG A;  4AJ7 A;  18GS A;  2CQ9 A;  2CAQ A;  2JU5 A;  3LGC A;  2PU9 C;  2FGX A;  2F3M A;  4IJI A;  1TW9 A;  4H86 A;  3P2A A;  4ZBD A;  3QD9 A;  3A5W A;  3KEB A;  1K0O A;  3TKS A;  1XWK A;  2DJ3 A;  1XVQ A;  3IK9 A;  5B8B A;  1A0F A;  2C0F A;  1GLQ A;  1U3A A;  3C1R A;  5DQS A;  3DYR A;  8GSS A;  3WT2 A;  2VD1 A;  4ULX A;  2M72 A;  4MP4 A; 
#chains in the Genus database with same CATH topology
 5HFI A;  1F37 A;  3ZMK A;  1C72 A;  1XZO A;  1G6Y A;  3HDC A;  1GSS A;  1TXX A;  4XS6 A;  5D96 A;  3L4N A;  4HSC X;  2R6K A;  3QOU A;  4HQZ A;  1QK8 A;  4WXT A;  1XWG A;  3BJ5 A;  3EC3 A;  4I2U A;  5KEJ A;  3UBL A;  2DMM A;  3DWV A;  1A0R P;  2HZE B;  4AJ6 A;  4OO5 A;  2A4V A;  5H5S A;  4LL4 B;  1TOF A;  2YNX A;  5CRW A;  4YH2 A;  1XPV A;  2YJ7 A;  3LXT A;  5AGY A;  1GTI A;  3ZTL A;  1VF1 A;  1OVN A;  2IME A;  1ML6 A;  1AUC A;  1K0D A;  2QSI A;  2X8G A;  2GZZ A;  2LQO A;  5CRD A;  2R3X A;  4QL9 A;  5GZZ B;  5IQY A;  2K9F A;  2KP2 A;  1H75 A;  3DVX A;  5IMV A;  1GP1 A;  3VK9 A;  2VUP A;  4RQX A;  3HHV A;  4G0I A;  1SD8 A;  2H0H A;  4G0L A;  3KH7 A;  1Z7P A;  5KOW A;  1X5C A;  3CSI A;  4Z2T A;  2L5O A;  4IKH A;  2FCH A;  4MJE A;  3TKS C;  1F3A A;  1SK0 A;  3EPT A;  22GS A;  1J9B A;  4NPB A;  4ILF A;  2B5Y A;  3PR8 A;  4CY6 A;  4F2I A;  5IPG A;  2RUE A;  3OR5 A;  3EWL A;  4L0U A;  4QQ7 A;  2C0D A;  3KMN A;  3APS A;  3RPN A;  1U6T A;  2C1Y A;  2B1L A;  4PGT A;  4KB3 A;  4WF5 A;  4K5R A;  1G0T A;  1FG4 A;  1K3L A;  3LYP A;  1MDI A;  3KP9 A;  3Q6O A;  4I6X A;  1R26 A;  2MZC A;  3FR6 A;  1M3I A;  2AAW A;  2CVD A;  2E7P A;  2V6K A;  3UMA A;  2P31 A;  3CYN A;  4X1U A;  5DJL A;  2CVK A;  1X9W B;  3GNJ A;  2WUL A;  2H8L A;  4O92 A;  2R37 A;  2JL4 A;  3F6F A;  4G19 A;  2WRT A;  1JLV A;  4ZB6 A;  2NPB A;  2I1U A;  7GSS A;  1TRW A;  3MDK A;  3HYP A;  2XBQ A;  4LLR A;  1W4V A;  2DJ2 A;  3TKQ A;  1WWJ A;  1XW6 A;  4V2M A;  2B5X A;  2HT9 A;  3GA4 A;  3IK7 A;  4EL1 A;  1GL8 A;  3HA9 A;  1Z3E A;  4BPY A;  2B7K A;  1PL1 A;  2I81 A;  1Z9H A;  4AGS A;  4G9H A;  1XCC A;  1TI1 A;  3AY8 A;  2WJU A;  4FH8 A;  4MA9 A;  2MBS A;  2LRN A;  1K0B A;  1GSQ A;  2MYG A;  3TKP A;  2R0C A;  4ZXG A;  2FLS A;  1FOV A;  2OKA A;  5J5N A;  2VOC A;  2R4V A;  5F06 A;  3PGT A;  2ON5 A;  4DSQ A;  1HNA A;  2HRK A;  2GZP A;  2IMK A;  5F0G A;  1K0N A;  2XPE A;  1ILO A;  1PN9 A;  2GDR A;  2O8V B;  4HEA 2;  5G5F A;  4MH2 A;  4D73 B;  3GYK A;  2VLV A;  1URM A;  2WDU A;  1F6M C;  3EU3 A;  3UVT A;  4XCS A;  2LNT A;  3F0I A;  4KDX A;  3KXO A;  1Y25 A;  1CQG A;  1HNB A;  5J41 A;  3H8Q A;  2C3N A;  2P0G A;  2OA7 A;  2CX4 A;  3D4M A;  5KN1 A;  1QUW A;  1GLP A;  5INY A;  1AQX A;  1VF4 A;  4K5S A;  3HCZ A;  1B8X A;  2IFQ B;  4OFT A;  3W8J A;  2PN8 A;  1LU4 A;  2O87 A;  3WGX A;  1KEB A;  4Q5Q A;  3CSH A;  1PMT A;  6GSU A;  1WE0 A;  2RUF A;  1TU7 A;  4OO4 A;  2L6C A;  3TRQ A;  3FMW A;  2HRF A;  1XWC A;  3MSZ A;  2F51 A;  4NAX A;  2WGR A;  1M0U A;  1O73 A;  3HVN A;  2YZU A;  3H93 A;  1ZGN A;  3GV1 A;  5L71 A;  1NHO A;  1OKD A;  5G31 A;  1SD9 A;  5H5Q A;  2JAD A;  4PNF A;  4WBJ A;  3Q19 A;  1ERU A;  2EIO A;  2ES7 A;  4GSN A;  4O5Q A;  1OC9 B;  2JSZ A;  2PMT A;  1SL2 B;  2AB6 A;  1GSF A;  1N8J A;  5IMF A;  1EOG A;  2A4H A;  4OFN A;  4NV5 A;  1TRU A;  2H74 A;  4FYC A;  2D2Z A;  4ICY A;  5F8B A;  1YZX A;  3IAM 2;  4TVE A;  5HQP A;  4K7O A;  2P5Q A;  3DD3 A;  2DIY A;  3ZRD A;  5HR1 A;  1AQW A;  1PKW A;  3HJP A;  3QR6 A;  5JCG A;  4Q5R A;  6GSV A;  3SWL A;  2H0I A;  2DJJ A;  4TW5 A;  2K6V A;  4KCE A;  4KH7 A;  3FKF A;  1EGR A;  1EV4 A;  3I69 A;  3GTU A;  4O5R A;  2L4C A;  3R3E A;  4TXO A;  1BQ7 A;  3CQF A;  5ECL B;  3M3M A;  3M9K A;  3UL3 A;  2CV4 A;  3ZVJ A;  5B6M A;  3EUR A;  4EDZ A;  3MIX A;  13GS A;  2GGT A;  2GS3 A;  3L9S A;  5DAL A;  2X64 A;  4EVM A;  3UJ1 A;  1WOU A;  1M99 A;  4Q5N A;  3GN3 A;  4X0X A;  2JSY A;  1I9D A;  4KX4 A;  2AYT A;  2YWM A;  2H0G A;  4NWY A;  1XOB A;  4IHU A;  4GSS A;  5B6N A;  3NZN A;  1MD4 A;  5AIV A;  4K7N A;  5AIX A;  2H30 A;  1U87 A;  2HI7 A;  2YPM A;  4MNN A;  4IGJ A;  4ZBA A;  4OFM A;  4MCU A;  1IYI A;  4I8B A;  1O6J A;  2ZCT A;  1SU9 A;  5E59 A;  2HNL A;  3HZ8 A;  4MPF A;  4GQC A;  1OKT A;  5JWR B;  2V1M A;  4MZC A;  1HYU A;  2G2Q A;  1MDJ A;  4DVC A;  1SYR A;  1K0M A;  4EC0 A;  3J7Y k;  1JZD A;  3R2Q A;  2H6Z A;  1A2L A;  1DE1 A;  4F82 A;  6GSW A;  1T7P B;  2YWN A;  5DVB A;  1M9B A;  2WFC A;  4TOP A;  1M2D A;  2DML A;  3RBT A;  3CRU A;  2R5G A;  4K9Z A;  2PER A;  2H72 A;  1BX9 A;  3F3Q A;  1S3D A;  1GNE A;  3GUR A;  1RW1 A;  3KGK A;  1PN0 A;  3LOR A;  4JE1 A;  1K0C A;  3ZL5 A;  2PVO C;  5IM9 A;  1FVJ A;  2H73 A;  2O89 A;  4EF0 A;  2MMN A;  2IPA A;  2VCQ A;  1EP7 A;  1QFN A;  2XBI A;  4OMV A;  2LS5 A;  4K2X A;  2O7K A;  2GSR A;  2KP1 A;  20GS A;  1XWB A;  1TP9 A;  3VUR A;  2YV9 A;  3MYD A;  1YKC A;  3D0Z A;  3FZ5 A;  2EIQ A;  4XS4 A;  1B48 A;  5ID2 B;  1VGL A;  4POM A;  3A2X A;  4ACS A;  5KN0 A;  4FIW A;  1S3C A;  2L6D A;  3TJJ A;  3HY2 A;  1JLW A;  1XIY A;  2NDO A;  2FD3 A;  5FT3 A;  5JCU A;  5ECQ B;  3ZRE A;  2OE0 A;  1FVK A;  1O8X A;  5ECS A;  2I4A A;  4HJ2 A;  4ID0 A;  3CMI A;  4ZB8 A;  1T8E B;  2TRC P;  1DE2 A;  1USB A;  4I5Q A;  5JWO B;  1WPI A;  3VPT A;  1GTU A;  1S3A A;  4LA1 A;  3G7Y A;  4EDY A;  5A4W A;  1X9S B;  3F3R A;  2CA8 A;  3CSJ A;  4MLY A;  1H4O A;  4KE3 A;  3A2V A;  2FWE A;  5D9V A;  2GT6 A;  1GRX A;  2GVP A;  2HSM A;  3C7M A;  3LYK A;  4GRF A;  1Z6N A;  2L4Q A;  2OBI A;  3VPQ A;  3RHC A;  4OCE A;  2JZT A;  5D9T A;  3F4T A;  5ELG A;  4MH3 A;  1GUL A;  2C3T A;  3LFL A;  2LRC A;  5CP1 A;  3FK8 A;  2C80 A;  2N5B A;  4MMM A;  4FQU A;  2PVQ A;  3D5J A;  3Q18 A;  3TRP A;  2YWO A;  3C73 A;  3E0U A;  5E4W A;  5ECH B;  2H01 A;  3GRX A;  4V1A p;  5AN1 A;  1QQ2 A;  2DJ1 A;  1YJ6 A;  3TOT A;  2LQQ A;  2OBK A;  1A2J A;  2LUS A;  4ZB9 A;  4MK3 A;  5IMZ A;  2KHP A;  2FHE A;  19GS A;  3LG6 A;  3V1W A;  4WR5 A;  1BED A;  4GWR A;  1X5E A;  3QPM A;  1PKZ A;  1V9W A;  2IL3 A;  3H1N A;  4O5U A;  6GSS A;  2VL9 A;  3DGQ A;  4Z7X A;  2VD0 A;  5HFG A;  4PTS A;  3W8S A;  2G0F A;  3BCK A;  2HLS A;  4MPG A;  4GST A;  5COH A;  4F0C A;  3TRX A;  3EMX A;  4TRX A;  5G30 A;  2A2R A;  1SJZ A;  2AV4 A;  2J9H A;  5DDL A;  4WEY A;  3TCO A;  5ID2 A;  2JAC A;  4O32 A;  1XOA A;  2QKE A;  1EP8 A;  3IAS 2;  2XPD A;  3C1S A;  5ABR A;  4HZ4 A;  1GWC A;  4NV2 A;  5A5K A;  2YJH A;  1TK5 B;  1YF1 A;  1M2A A;  4POK A;  4EUY A;  3TJB A;  3LXZ A;  3W6G A;  5IMA A;  1BJX A;  3FR9 A;  2P5R A;  3IR4 A;  2OAD A;  1ZL9 A;  1F9M A;  1O8W A;  1XBS A;  3PH9 A;  2H76 A;  4ECJ A;  1R7H A;  1PX6 A;  2H70 A;  1K0A A;  3F63 A;  4YKG A;  5ECP B;  4ZBB A;  2R2J A;  1YQ1 A;  1Q4J A;  3HJM A;  1OC3 A;  4HU9 A;  3UBK A;  1X5D A;  3KD0 A;  17GS A;  1PFO A;  2YOI A;  2LRT A;  4JR6 A;  4RQR A;  4CDO A;  2X99 A;  1IYH A;  1ZCP A;  4IS0 A;  4PNG A;  1EOH A;  5HR0 A;  5IOX A;  2VCV A;  4TR0 A;  6GSX A;  3TGZ A;  5DQY A;  1GSE A;  2FWF A;  2DJK A;  1FOH A;  2JZS A;  5ECR B;  3UAP A;  1GTA A;  2OE1 A;  2MMA A;  3DVW A;  4IP1 A;  4GXZ A;  1YDK A;  1VF3 A;  1ZYP A;  5CNW A;  4HZ2 A;  5LNK e;  1ON4 A;  2YWI A;  3E9J B;  4HOJ A;  1WIK A;  2C8U A;  4OD7 A;  3LWA A;  4HU7 A;  3RDW A;  3M1G A;  2Z9S A;  1GH2 A;  4ML1 A;  3GTU B;  1PD2 1;  2YAN A;  1SKS B;  4N30 A;  3IDV A;  4TXO B;  1ZYE A;  1SJ6 A;  4TXV A;  5J9B A;  1A24 A;  2REM A;  1THX A;  4KA0 A;  3N5O A;  1SEN A;  3QAW A;  5ECM B;  1TI3 A;  3N9J A;  4ZIJ A;  4YKF A;  1B4Q A;  5DAL B;  3RAZ A;  1FAA A;  3IC8 A;  2YZH A;  1ST9 A;  4RI7 A;  5DCG A;  4YQV A;  1OE7 A;  1THO A;  2JZR A;  3NOF A;  3ZLP A;  5CRE A;  2DBC A;  5G2Z A;  4N0V A;  3SBC A;  4N10 A;  3FY7 A;  3ZML A;  2MMO A;  5IPH A;  2DJ0 A;  3GST A;  4MZB A;  1ZYQ B;  4KSM A;  3D4T A;  2HSY A;  4V1A g;  2R0G A;  4OWY A;  3FW2 A;  1SKW B;  1ZZY A;  5DBQ A;  1R4W A;  1WJK A;  2N5F A;  2RM5 A;  2K8S A;  3APQ A;  3DKS A;  3WGE A;  1SL0 B;  3WD6 A;  2MBT A;  4J57 E;  5EVO A;  3VWW A;  5D9X A;  4DSS A;  2GSS A;  2X4A A;  10GS A;  2GQM A;  2IIY A;  2VL2 A;  1WRY A;  1B4P A;  4CY8 A;  1S3R A;  3GKK A;  1LBK A;  3K8N A;  4RUV A;  2VM1 A;  3G7I A;  5D8I A;  3TB2 A;  3HKR A;  3WYW A;  3HJO A;  3KTL A;  2HFD A;  3KCM A;  3C71 A;  1W89 A;  3TJG A;  1V98 A;  1KBN A;  5ELA A;  3ZIV A;  4GF0 A;  5IO2 A;  5DJM A;  1ERW A;  4TR1 A;  1NW2 A;  2QC7 A;  3WT1 A;  5ECI B;  1AXD A;  5B8A A;  1Y6E A;  4EIQ A;  2TRX A;  9GSS A;  2PUK C;  4LMV A;  4USS A;  1TK0 B;  4NMU A;  2WB9 A;  1SKR B;  5G1L A;  3GIX A;  2I9H A;  1AQV A;  1V58 A;  4MJB A;  3L9U A;  3A2W A;  4JBB A;  16GS A;  3F4R A;  2C3Q A;  4L0W A;  4XS4 B;  2AUV A;  1HNC A;  1EZK A;  5HR3 A;  2DKI A;  3EE2 A;  2H6X A;  2E2M A;  1E2Y A;  3ZFL A;  2VO4 A;  1QMV A;  2F9S A;  3GSS A;  3DIE A;  4YQM A;  4XTS A;  4POL A;  2DKH A;  2C4J A;  1QXH A;  3VWX A;  4DSR A;  2YP6 A;  4L5O A;  2H19 A;  1ERT A;  1M2B A;  2ZNM A;  4A5P A;  1XG8 A;  3ERG A;  3BOA A;  1YEX A;  1YEP A;  1TU8 A;  2VL2 C;  2F8A A;  1TTZ A;  3VWU A;  4BVX A;  2VL3 A;  4LL1 B;  2AHE A;  3EIN A;  5JWQ B;  2YV7 A;  4ZL7 A;  1FW1 A;  4MF6 A;  2KLX A;  3H4K A;  3IRA A;  3LW9 A;  3G7J A;  3LQ7 A;  3P90 A;  4PQH A;  2L57 A;  1TDI A;  3G9B A;  1O7U A;  5DAK B;  4RI6 A;  1JZO A;  5GAN D;  4TR3 A;  1VRS D;  1KNG A;  4Z2R A;  2VIM A;  2CVB A;  2K8V A;  3UEM A;  2VCX A;  3FZ4 A;  4MJC A;  1Z7R A;  3MAK A;  4E8E A;  2H66 A;  3UOM A;  4KAE A;  1TRS A;  3HZ4 A;  1ABA A;  3F4S A;  3IBH A;  4F0B A;  2VCT A;  1R5P A;  1PL2 A;  3M8N A;  1GUK A;  1I5G A;  2H71 A;  3VFI A;  3GKX A;  2OJL A;  3TKS E;  4GQF A;  5B7C A;  3KMO A;  2LKU A;  5D93 A;  4CHS A;  1HD2 A;  1YY7 A;  1T1V A;  2CX3 A;  4L8E A;  1RQM A;  4HJM A;  2IMF A;  5G1K A;  1OE8 A;  1Z5Y E;  5DCH A;  5EPF A;  1TRV A;  2HSH A;  3IXR A;  4OCF A;  3KM6 A;  1MD3 A;  4MF7 A;  2FWG A;  2ALB A;  2IMI A;  2NVL A;  4FYB A;  2KOK A;  1ERV A;  1BAY A;  2MMZ A;  2CZ3 A;  4K7I A;  3FR3 A;  4K0G A;  4I97 A;  4E8H A;  3HVV A;  2V6O A;  4HI7 A;  2BMX A;  5D73 A;  3M0F A;  3P8W A;  3ME8 A;  5G5E A;  4ECC A;  1MTC A;  3F6D A;  4AJ8 A;  4I2T A;  1X0R A;  4G10 A;  1SYX A;  4EXJ A;  1N2A A;  2HYX A;  2RM6 A;  1UA5 A;  1SL1 B;  3KP8 A;  4IQA A;  4PXO A;  1GSD A;  2M80 A;  1T3B A;  4FYU A;  2PGT A;  2VCZ A;  1AIU A;  2UZ8 A;  2KUC A;  2O85 A;  2B3S A;  3EYT A;  3TKR A;  1WP0 A;  4ZIL A;  2FNO A;  2OAC A;  3CTG A;  5J9C A;  4F03 A;  1Z6M A;  4YAP A;  4XRD A;  2DIZ A;  2H1D A;  2LV3 A;  4ECI A;  1DBY A;  4MDC A;  5IMD A;  4BVY A;  1T4Z A;  3CTF A;  5DAK A;  4ECB A;  2IJY A;  3VI5 A;  1UVZ A;  1FHE A;  3CBU A;  2CT6 A;  1ZOF A;  4BL7 A;  1EV9 A;  1UC7 A;  5KN3 A;  1NHY A;  3O76 A;  4O7H A;  1F2E A;  2XC2 A;  5EY6 A;  1ZYN A;  4KGI A;  5F07 A;  1XXU A;  3ME7 A;  3S9F A;  2IN3 A;  3GHA A;  4GTU A;  2H6Y A;  3DXB A;  3J7Y b;  4HS1 A;  3FYG A;  2DC5 A;  2M46 A;  4G0K A;  3TJK A;  4J56 E;  3UIW A;  1EEJ A;  3ZIT A;  3D6I A;  4KW6 A;  1V40 A;  4EIP A;  3WGD A;  4N11 A;  1RK4 A;  3IC4 A;  1OYJ A;  2WCI A;  2IMD A;  4XHM A;  1U88 A;  1FB0 A;  2GT5 A;  3QAG A;  5GST A;  3BD2 A;  3ERF A;  3L0H A;  3PIN A;  4N0Z A;  4XRA A;  2ON7 A;  3KJY A;  2DSA A;  3IPZ A;  4KUN A;  5LCZ A;  5CYY A;  2BTO T;  2PBJ A;  3Q74 A;  2CZ2 A;  3I9V 2;  3FZ9 A;  11GS A;  5EL8 A;  2LJR A;  2QGV A;  1PRX A;  4IP6 A;  1G6W A;  4K0N A;  1PQN A;  3ZVJ D;  5JCW A;  3QDN A;  1G7O A;  3FZA A;  1T4Y A;  2B1K A;  3TOU A;  5C00 A;  3ED3 A;  3L78 A;  6GST A;  3EMP A;  4F9Z A;  2HRN A;  2V41 A;  5IOW A;  5H5R A;  3BCI A;  2A2P A;  3GH9 A;  3D22 A;  3IV4 A;  5IIZ A;  3UVH A;  3HD5 A;  4DEJ A;  2AJQ B;  3VI7 A;  3PPU A;  4KDU A;  2TIR A;  1JFU A;  2GTU A;  2YCD A;  4DSS B;  1PX7 A;  3TJF A;  2LEG A;  2EIR A;  2HXK A;  4IQ1 A;  4POB A;  2HE3 A;  5ENU A;  4AF2 A;  3D21 A;  3ISO A;  2DLX A;  5ECN B;  5HR2 A;  5BRT A;  1GSU A;  4EE0 A;  2FUG 2;  3U6V A;  4ZL9 A;  1SK2 A;  4GLT A;  4TR1 B;  2NTO A;  5C04 A;  3A3T A;  1EGO A;  2LST A;  3FRC A;  4JR4 A;  4WET A;  1B9Y C;  4KCA A;  2HZE A;  1JZR A;  5CAX A;  3GFK A;  2E2G A;  3EU4 A;  3MWH A;  3MNG A;  4KSO A;  5GSS A;  4K6X A;  4HDE A;  5KN2 A;  5A4V A;  3GKN A;  1QGV A;  2VLT A;  2PWJ A;  3CXG A;  3GX0 A;  1J0F A;  5CO3 A;  4PX1 A;  2I3Y A;  3F8U A;  2ZUP A;  3IA1 A;  4PUA A;  1NM3 A;  2VM2 A;  4YAV A;  5A4U A;  2LNS A;  3HVS A;  4X4J A;  3U5R E;  1KTE A;  1YKA A;  4J2F A;  3H79 A;  3E3E A;  5ECK B;  1UN2 A;  1T00 A;  2L5L A;  4K1F A;  1SK1 A;  3KIJ A;  3BBY A;  2GQL A;  1CQH A;  4PUF C;  1WMJ A;  3A5I A;  2V32 A;  3JCM L;  3LEF A;  2YN1 A;  3GKM A;  4XS1 A;  3RPP A;  4G2E A;  1X9M B;  1V57 A;  1TKD B;  3DEX A;  4V2L A;  2LJK A;  2V2G A;  1XWA A;  4BWS A;  1DUG A;  2F8F A;  3L9V A;  12GS A;  3ZFB A;  1XW5 A;  3VWV A;  5CRH A;  3DML A;  2FWH A;  4MJA A;  1ZMA A;  4BVX B;  3P7X A;  4Q5F A;  1A2M A;  1GUH A;  2RII A;  4KF9 A;  1DSB A;  3GX8 A;  1EWX A;  5GAP D;  5J3R A;  3CRT A;  5KOX A;  2H1G A;  1AAZ A;  2LTK A;  1O81 A;  1JZW A;  3KZQ A;  5ECO B;  4X43 A;  4EKZ A;  4BA7 A;  1Q98 A;  3QMX A;  4KDY A;  4MZW A;  4K2D A;  3APO A;  1AW9 A;  4KND A;  3ZYW A;  2H75 A;  4IEL A;  2C0G A;  3IHQ A;  3ZIJ A;  3VLN A;  3IOS A;  1XW9 A;  2WZ9 A;  1G7E A;  4BWQ A;  4LMW A;  2VAF A;  2HZF A;  4XIH A;  3HXS A;  3M9J A;  1A8L A;  1PA3 A;  3QCP A;  4PQ1 A;  3NIV A;  1OC8 A;  2OE3 A;  2FA8 A;  4IW9 A;  4JZQ A;  2GZY A;  3I43 A;  2N5A A;  2WS2 A;  2HRA A;  4GCI A;  1TK8 B;  3I6A A;  14GS A;  3LSZ A;  4QL7 A;  3O6T A;  1O85 A;  2E0Q A;  5BMU A;  3ZZX A;  2VCW A;  4PUR A;  2B7J A;  2XHF A;  4JU5 A;  2BJX A;  3GL5 A;  2PPT A;  4NHZ A;  3O3T A;  2GST A;  2X8H A;  5HFK A;  1U3I A;  4TN8 A;  4P3Y B;  1PSQ A;  1BYE A;  4JED A;  1XVW A;  1J08 A;  1MDK A;  4IBP A;  4WKW A;  4WF4 A;  1YF0 A;  1ACV A;  1B9X C;  3QFB C;  4PQI A;  4WBR D;  3F9U A;  2FA4 A;  4HUA A;  4D73 A;  3QAV A;  3C8E A;  3GL3 A;  3ERW A;  1R5A A;  3UAR A;  4NHW A;  3GH6 A;  4FO5 A;  3KTB A;  4CW9 A;  3HVX A;  4IVF A;  4L5L A;  2H1B A;  1VF2 A;  1GTB A;  2R0P A;  3US3 A;  3TDG A;  2VLU A;  3GUS A;  3GMF A;  2B5E A;  5F05 A;  2IFQ A;  5FHI A;  1M9A A;  4JRR A;  1MEK A;  3KH9 A;  4ISD A;  1E6B A;  4Z2U A;  4BVY B;  2EC4 A;  2GQK A;  4MF5 A;  5J4U A;  4NXI A;  1GUM A;  1FO5 A;  3EVI A;  4EO3 A;  1TJD A;  2C0E A;  1BG5 A;  1A23 A;  1NSW A;  3LJR A;  2NBS A;  5IO0 A;  4IN0 A;  2GSQ A;  4BL7 B;  2QA2 A;  1M3J A;  4WR4 A;  1PGT A;  3TUE A;  4TKY A;  3QFA C;  4ZL8 A;  2L59 A;  1A8Y A;  1LJR A;  1F3B A;  5D9W A;  1XFL A;  5FWG A;  2X49 A;  1SJI A;  2H1A A;  2X8C A;  1M7T A;  2LJA A;  1K3O A;  6GSY A;  2CAI A;  4YQU A;  3DRN A;  2RLI A;  2K18 A;  2IWT A;  3FEU A;  4MAB A;  2A2S A;  1V2A A;  2QA1 A;  4ML6 A;  5AIS A;  1OC9 A;  2B6M A;  3IHG A;  1K3Y A;  1JHB A;  1EEM A;  1GSY A;  1GNW A;  1FB6 A;  3IE3 A;  2GLR A;  1HQO A;  5LD0 A;  4HQS A;  4V2N A;  1AC1 A;  3FHK A;  2J23 A;  4IJ3 A;  4K8M A;  3RHB A;  1OAZ A;  5IMC A;  2FY6 A;  4TR4 A;  5CRG A;  4AJ7 A;  18GS A;  2CQ9 A;  2CAQ A;  2JU5 A;  3LGC A;  2PU9 C;  2FGX A;  2F3M A;  4IJI A;  1TW9 A;  4H86 A;  3P2A A;  4ZBD A;  3QD9 A;  3A5W A;  3KEB A;  1K0O A;  3TKS A;  1XWK A;  2DJ3 A;  1XVQ A;  3IK9 A;  5B8B A;  1A0F A;  2C0F A;  1GLQ A;  1U3A A;  4BIK A;  3C1R A;  5DQS A;  3DYR A;  8GSS A;  3WT2 A;  2VD1 A;  4ULX A;  2M72 A;  4MP4 A; 
#chains in the Genus database with same CATH homology
 5HFI A;  1F37 A;  3ZMK A;  1C72 A;  1XZO A;  1G6Y A;  3HDC A;  1GSS A;  1TXX A;  4XS6 A;  5D96 A;  3L4N A;  2R6K A;  3QOU A;  4HQZ A;  1QK8 A;  4WXT A;  1XWG A;  3BJ5 A;  3EC3 A;  4I2U A;  5KEJ A;  3UBL A;  2DMM A;  3DWV A;  1A0R P;  2HZE B;  4AJ6 A;  4OO5 A;  2A4V A;  5H5S A;  4LL4 B;  1TOF A;  2YNX A;  5CRW A;  4YH2 A;  1XPV A;  2YJ7 A;  3LXT A;  5AGY A;  1GTI A;  3ZTL A;  1VF1 A;  1OVN A;  2IME A;  1ML6 A;  1AUC A;  1K0D A;  2QSI A;  2X8G A;  2GZZ A;  2LQO A;  5CRD A;  2R3X A;  4QL9 A;  5GZZ B;  5IQY A;  2K9F A;  2KP2 A;  1H75 A;  3DVX A;  5IMV A;  1GP1 A;  3VK9 A;  2VUP A;  4RQX A;  3HHV A;  4G0I A;  1SD8 A;  2H0H A;  4G0L A;  3KH7 A;  1Z7P A;  5KOW A;  1X5C A;  3CSI A;  4Z2T A;  2L5O A;  4IKH A;  2FCH A;  4MJE A;  3TKS C;  1F3A A;  1SK0 A;  3EPT A;  22GS A;  1J9B A;  4NPB A;  4ILF A;  2B5Y A;  3PR8 A;  4CY6 A;  4F2I A;  5IPG A;  2RUE A;  3OR5 A;  3EWL A;  4L0U A;  4QQ7 A;  2C0D A;  3KMN A;  3APS A;  3RPN A;  1U6T A;  2C1Y A;  2B1L A;  4PGT A;  4KB3 A;  4WF5 A;  4K5R A;  1G0T A;  1FG4 A;  1K3L A;  3LYP A;  1MDI A;  3KP9 A;  3Q6O A;  4I6X A;  1R26 A;  2MZC A;  3FR6 A;  2AAW A;  2CVD A;  2E7P A;  2V6K A;  3UMA A;  2P31 A;  3CYN A;  4X1U A;  5DJL A;  2CVK A;  1X9W B;  3GNJ A;  2WUL A;  2H8L A;  4O92 A;  2R37 A;  2JL4 A;  3F6F A;  4G19 A;  2WRT A;  1JLV A;  4ZB6 A;  2NPB A;  2I1U A;  7GSS A;  1TRW A;  3MDK A;  3HYP A;  2XBQ A;  4LLR A;  1W4V A;  2DJ2 A;  3TKQ A;  1WWJ A;  1XW6 A;  4V2M A;  2B5X A;  2HT9 A;  3GA4 A;  3IK7 A;  4EL1 A;  1GL8 A;  3HA9 A;  1Z3E A;  4BPY A;  2B7K A;  1PL1 A;  2I81 A;  1Z9H A;  4AGS A;  4G9H A;  1XCC A;  1TI1 A;  3AY8 A;  2WJU A;  4FH8 A;  4MA9 A;  2MBS A;  2LRN A;  1K0B A;  1GSQ A;  2MYG A;  3TKP A;  2R0C A;  4ZXG A;  2FLS A;  1FOV A;  2OKA A;  5J5N A;  2VOC A;  2R4V A;  5F06 A;  3PGT A;  2ON5 A;  4DSQ A;  1HNA A;  2HRK A;  2GZP A;  2IMK A;  5F0G A;  1K0N A;  2XPE A;  1ILO A;  1PN9 A;  2GDR A;  2O8V B;  4HEA 2;  5G5F A;  4MH2 A;  4D73 B;  3GYK A;  2VLV A;  1URM A;  2WDU A;  1F6M C;  3EU3 A;  3UVT A;  4XCS A;  2LNT A;  3F0I A;  4KDX A;  3KXO A;  1Y25 A;  1CQG A;  1HNB A;  5J41 A;  3H8Q A;  2C3N A;  2P0G A;  2OA7 A;  2CX4 A;  3D4M A;  5KN1 A;  1QUW A;  1GLP A;  5INY A;  1AQX A;  1VF4 A;  4K5S A;  3HCZ A;  1B8X A;  2IFQ B;  4OFT A;  3W8J A;  2PN8 A;  1LU4 A;  2O87 A;  3WGX A;  1KEB A;  4Q5Q A;  3CSH A;  1PMT A;  6GSU A;  1WE0 A;  2RUF A;  1TU7 A;  4OO4 A;  2L6C A;  3TRQ A;  3FMW A;  2HRF A;  1XWC A;  3MSZ A;  2F51 A;  4NAX A;  2WGR A;  1M0U A;  1O73 A;  2YZU A;  3H93 A;  1ZGN A;  3GV1 A;  5L71 A;  1NHO A;  1OKD A;  5G31 A;  1SD9 A;  5H5Q A;  2JAD A;  4PNF A;  4WBJ A;  3Q19 A;  1ERU A;  2EIO A;  2ES7 A;  4GSN A;  4O5Q A;  1OC9 B;  2JSZ A;  2PMT A;  1SL2 B;  2AB6 A;  1GSF A;  1N8J A;  5IMF A;  1EOG A;  2A4H A;  4OFN A;  4NV5 A;  1TRU A;  2H74 A;  4FYC A;  2D2Z A;  4ICY A;  5F8B A;  1YZX A;  3IAM 2;  4TVE A;  5HQP A;  4K7O A;  2P5Q A;  3DD3 A;  2DIY A;  3ZRD A;  5HR1 A;  1AQW A;  1PKW A;  3HJP A;  3QR6 A;  5JCG A;  4Q5R A;  6GSV A;  3SWL A;  2H0I A;  2DJJ A;  4TW5 A;  2K6V A;  4KCE A;  4KH7 A;  3FKF A;  1EGR A;  1EV4 A;  3I69 A;  3GTU A;  4O5R A;  2L4C A;  3R3E A;  4TXO A;  1BQ7 A;  5ECL B;  3M3M A;  3M9K A;  3UL3 A;  2CV4 A;  3ZVJ A;  5B6M A;  3EUR A;  4EDZ A;  3MIX A;  13GS A;  2GGT A;  2GS3 A;  3L9S A;  5DAL A;  2X64 A;  4EVM A;  3UJ1 A;  1WOU A;  1M99 A;  4Q5N A;  3GN3 A;  4X0X A;  2JSY A;  1I9D A;  4KX4 A;  2AYT A;  2YWM A;  2H0G A;  4NWY A;  1XOB A;  4IHU A;  4GSS A;  5B6N A;  3NZN A;  1MD4 A;  5AIV A;  4K7N A;  5AIX A;  2H30 A;  1U87 A;  2HI7 A;  2YPM A;  4MNN A;  4IGJ A;  4ZBA A;  4OFM A;  4MCU A;  1IYI A;  4I8B A;  1O6J A;  2ZCT A;  1SU9 A;  5E59 A;  2HNL A;  3HZ8 A;  4MPF A;  4GQC A;  1OKT A;  5JWR B;  2V1M A;  4MZC A;  1HYU A;  2G2Q A;  1MDJ A;  4DVC A;  1SYR A;  1K0M A;  4EC0 A;  3J7Y k;  1JZD A;  3R2Q A;  2H6Z A;  1A2L A;  1DE1 A;  4F82 A;  6GSW A;  1T7P B;  2YWN A;  5DVB A;  1M9B A;  2WFC A;  4TOP A;  1M2D A;  2DML A;  3RBT A;  3CRU A;  2R5G A;  4K9Z A;  2PER A;  2H72 A;  1BX9 A;  3F3Q A;  1S3D A;  1GNE A;  3GUR A;  1RW1 A;  3KGK A;  1PN0 A;  3LOR A;  4JE1 A;  1K0C A;  3ZL5 A;  2PVO C;  5IM9 A;  1FVJ A;  2H73 A;  2O89 A;  4EF0 A;  2MMN A;  2IPA A;  2VCQ A;  1EP7 A;  1QFN A;  2XBI A;  4OMV A;  2LS5 A;  4K2X A;  2O7K A;  2GSR A;  2KP1 A;  20GS A;  1XWB A;  1TP9 A;  3VUR A;  2YV9 A;  3MYD A;  1YKC A;  3D0Z A;  3FZ5 A;  2EIQ A;  4XS4 A;  1B48 A;  5ID2 B;  1VGL A;  4POM A;  3A2X A;  4ACS A;  5KN0 A;  4FIW A;  1S3C A;  2L6D A;  3TJJ A;  3HY2 A;  1JLW A;  1XIY A;  2NDO A;  2FD3 A;  5FT3 A;  5JCU A;  5ECQ B;  3ZRE A;  2OE0 A;  1FVK A;  1O8X A;  5ECS A;  2I4A A;  4HJ2 A;  4ID0 A;  3CMI A;  4ZB8 A;  1T8E B;  2TRC P;  1DE2 A;  1USB A;  4I5Q A;  5JWO B;  1WPI A;  3VPT A;  1GTU A;  1S3A A;  4LA1 A;  3G7Y A;  4EDY A;  5A4W A;  1X9S B;  3F3R A;  2CA8 A;  3CSJ A;  4MLY A;  1H4O A;  4KE3 A;  3A2V A;  2FWE A;  5D9V A;  2GT6 A;  1GRX A;  2GVP A;  2HSM A;  3C7M A;  3LYK A;  4GRF A;  1Z6N A;  2L4Q A;  2OBI A;  3VPQ A;  3RHC A;  4OCE A;  2JZT A;  5D9T A;  3F4T A;  5ELG A;  4MH3 A;  1GUL A;  2C3T A;  3LFL A;  2LRC A;  5CP1 A;  3FK8 A;  2C80 A;  2N5B A;  4MMM A;  4FQU A;  2PVQ A;  3D5J A;  3Q18 A;  3TRP A;  2YWO A;  3C73 A;  3E0U A;  5E4W A;  5ECH B;  2H01 A;  3GRX A;  4V1A p;  5AN1 A;  1QQ2 A;  2DJ1 A;  1YJ6 A;  3TOT A;  2LQQ A;  2OBK A;  1A2J A;  2LUS A;  4ZB9 A;  4MK3 A;  5IMZ A;  2KHP A;  2FHE A;  19GS A;  3LG6 A;  3V1W A;  4WR5 A;  1BED A;  4GWR A;  1X5E A;  3QPM A;  1PKZ A;  1V9W A;  2IL3 A;  3H1N A;  4O5U A;  6GSS A;  2VL9 A;  3DGQ A;  4Z7X A;  2VD0 A;  5HFG A;  4PTS A;  3W8S A;  2G0F A;  3BCK A;  2HLS A;  4MPG A;  4GST A;  5COH A;  4F0C A;  3TRX A;  3EMX A;  4TRX A;  5G30 A;  2A2R A;  1SJZ A;  2AV4 A;  2J9H A;  5DDL A;  4WEY A;  3TCO A;  5ID2 A;  2JAC A;  4O32 A;  1XOA A;  2QKE A;  1EP8 A;  3IAS 2;  2XPD A;  3C1S A;  5ABR A;  4HZ4 A;  1GWC A;  4NV2 A;  5A5K A;  2YJH A;  1TK5 B;  1YF1 A;  1M2A A;  4POK A;  4EUY A;  3TJB A;  3LXZ A;  3W6G A;  5IMA A;  1BJX A;  3FR9 A;  2P5R A;  3IR4 A;  2OAD A;  1ZL9 A;  1F9M A;  1O8W A;  1XBS A;  3PH9 A;  2H76 A;  4ECJ A;  1R7H A;  1PX6 A;  2H70 A;  1K0A A;  3F63 A;  4YKG A;  5ECP B;  4ZBB A;  2R2J A;  1YQ1 A;  1Q4J A;  3HJM A;  1OC3 A;  4HU9 A;  3UBK A;  1X5D A;  3KD0 A;  17GS A;  2YOI A;  2LRT A;  4JR6 A;  4RQR A;  4CDO A;  2X99 A;  1IYH A;  1ZCP A;  4IS0 A;  4PNG A;  1EOH A;  5HR0 A;  5IOX A;  2VCV A;  4TR0 A;  6GSX A;  3TGZ A;  5DQY A;  1GSE A;  2FWF A;  2DJK A;  1FOH A;  2JZS A;  5ECR B;  3UAP A;  1GTA A;  2OE1 A;  2MMA A;  3DVW A;  4IP1 A;  4GXZ A;  1YDK A;  1VF3 A;  1ZYP A;  5CNW A;  4HZ2 A;  5LNK e;  1ON4 A;  2YWI A;  3E9J B;  4HOJ A;  1WIK A;  2C8U A;  4OD7 A;  3LWA A;  4HU7 A;  3RDW A;  3M1G A;  2Z9S A;  1GH2 A;  4ML1 A;  3GTU B;  1PD2 1;  2YAN A;  1SKS B;  4N30 A;  3IDV A;  4TXO B;  1ZYE A;  1SJ6 A;  4TXV A;  5J9B A;  1A24 A;  2REM A;  1THX A;  4KA0 A;  3N5O A;  1SEN A;  3QAW A;  5ECM B;  1TI3 A;  3N9J A;  4ZIJ A;  4YKF A;  1B4Q A;  5DAL B;  3RAZ A;  1FAA A;  3IC8 A;  2YZH A;  1ST9 A;  4RI7 A;  5DCG A;  4YQV A;  1OE7 A;  1THO A;  2JZR A;  3NOF A;  3ZLP A;  5CRE A;  2DBC A;  5G2Z A;  4N0V A;  3SBC A;  4N10 A;  3FY7 A;  3ZML A;  2MMO A;  5IPH A;  2DJ0 A;  3GST A;  4MZB A;  1ZYQ B;  4KSM A;  3D4T A;  2HSY A;  4V1A g;  2R0G A;  4OWY A;  3FW2 A;  1SKW B;  1ZZY A;  5DBQ A;  1R4W A;  1WJK A;  2N5F A;  2RM5 A;  2K8S A;  3APQ A;  3DKS A;  3WGE A;  1SL0 B;  3WD6 A;  2MBT A;  4J57 E;  5EVO A;  3VWW A;  5D9X A;  4DSS A;  2GSS A;  2X4A A;  10GS A;  2GQM A;  2IIY A;  2VL2 A;  1WRY A;  1B4P A;  4CY8 A;  3GKK A;  1LBK A;  3K8N A;  4RUV A;  2VM1 A;  3G7I A;  5D8I A;  3TB2 A;  3HKR A;  3WYW A;  3HJO A;  3KTL A;  2HFD A;  3KCM A;  3C71 A;  1W89 A;  3TJG A;  1V98 A;  1KBN A;  5ELA A;  3ZIV A;  4GF0 A;  5IO2 A;  5DJM A;  1ERW A;  4TR1 A;  1NW2 A;  2QC7 A;  3WT1 A;  5ECI B;  1AXD A;  5B8A A;  1Y6E A;  4EIQ A;  2TRX A;  9GSS A;  2PUK C;  4LMV A;  4USS A;  1TK0 B;  4NMU A;  2WB9 A;  1SKR B;  5G1L A;  3GIX A;  2I9H A;  1AQV A;  1V58 A;  4MJB A;  3L9U A;  3A2W A;  4JBB A;  16GS A;  3F4R A;  2C3Q A;  4L0W A;  4XS4 B;  2AUV A;  1HNC A;  1EZK A;  5HR3 A;  2DKI A;  3EE2 A;  2H6X A;  2E2M A;  1E2Y A;  3ZFL A;  2VO4 A;  1QMV A;  2F9S A;  3GSS A;  3DIE A;  4YQM A;  4XTS A;  4POL A;  2DKH A;  2C4J A;  1QXH A;  3VWX A;  4DSR A;  2YP6 A;  4L5O A;  2H19 A;  1ERT A;  1M2B A;  2ZNM A;  4A5P A;  3ERG A;  3BOA A;  1YEX A;  1YEP A;  1TU8 A;  2VL2 C;  2F8A A;  1TTZ A;  3VWU A;  4BVX A;  2VL3 A;  4LL1 B;  2AHE A;  3EIN A;  5JWQ B;  2YV7 A;  4ZL7 A;  1FW1 A;  4MF6 A;  2KLX A;  3H4K A;  3IRA A;  3LW9 A;  3G7J A;  3LQ7 A;  3P90 A;  4PQH A;  2L57 A;  1TDI A;  3G9B A;  1O7U A;  5DAK B;  4RI6 A;  1JZO A;  5GAN D;  4TR3 A;  1VRS D;  1KNG A;  4Z2R A;  2VIM A;  2CVB A;  2K8V A;  3UEM A;  2VCX A;  3FZ4 A;  4MJC A;  1Z7R A;  3MAK A;  4E8E A;  2H66 A;  3UOM A;  4KAE A;  1TRS A;  3HZ4 A;  1ABA A;  3F4S A;  3IBH A;  4F0B A;  2VCT A;  1R5P A;  1PL2 A;  3M8N A;  1GUK A;  1I5G A;  2H71 A;  3VFI A;  3GKX A;  2OJL A;  3TKS E;  4GQF A;  5B7C A;  3KMO A;  2LKU A;  5D93 A;  4CHS A;  1HD2 A;  1YY7 A;  1T1V A;  2CX3 A;  4L8E A;  1RQM A;  4HJM A;  2IMF A;  5G1K A;  1OE8 A;  1Z5Y E;  5DCH A;  5EPF A;  1TRV A;  2HSH A;  3IXR A;  4OCF A;  3KM6 A;  1MD3 A;  4MF7 A;  2FWG A;  2ALB A;  2IMI A;  2NVL A;  4FYB A;  2KOK A;  1ERV A;  1BAY A;  2MMZ A;  2CZ3 A;  4K7I A;  3FR3 A;  4K0G A;  4I97 A;  4E8H A;  3HVV A;  2V6O A;  4HI7 A;  2BMX A;  5D73 A;  3M0F A;  3P8W A;  3ME8 A;  5G5E A;  4ECC A;  1MTC A;  3F6D A;  4AJ8 A;  4I2T A;  1X0R A;  4G10 A;  1SYX A;  4EXJ A;  1N2A A;  2HYX A;  2RM6 A;  1UA5 A;  1SL1 B;  3KP8 A;  4IQA A;  4PXO A;  1GSD A;  2M80 A;  1T3B A;  4FYU A;  2PGT A;  2VCZ A;  1AIU A;  2UZ8 A;  2KUC A;  2O85 A;  2B3S A;  3EYT A;  3TKR A;  1WP0 A;  4ZIL A;  2FNO A;  2OAC A;  3CTG A;  5J9C A;  4F03 A;  1Z6M A;  4YAP A;  4XRD A;  2DIZ A;  2H1D A;  2LV3 A;  4ECI A;  1DBY A;  4MDC A;  5IMD A;  4BVY A;  1T4Z A;  3CTF A;  5DAK A;  4ECB A;  2IJY A;  3VI5 A;  1UVZ A;  1FHE A;  3CBU A;  2CT6 A;  1ZOF A;  4BL7 A;  1EV9 A;  1UC7 A;  5KN3 A;  1NHY A;  3O76 A;  4O7H A;  1F2E A;  2XC2 A;  5EY6 A;  1ZYN A;  4KGI A;  5F07 A;  1XXU A;  3ME7 A;  3S9F A;  2IN3 A;  3GHA A;  4GTU A;  2H6Y A;  3DXB A;  3J7Y b;  4HS1 A;  3FYG A;  2DC5 A;  2M46 A;  4G0K A;  3TJK A;  4J56 E;  3UIW A;  1EEJ A;  3ZIT A;  3D6I A;  4KW6 A;  1V40 A;  4EIP A;  3WGD A;  4N11 A;  1RK4 A;  3IC4 A;  1OYJ A;  2WCI A;  2IMD A;  4XHM A;  1U88 A;  1FB0 A;  2GT5 A;  3QAG A;  5GST A;  3BD2 A;  3ERF A;  3L0H A;  3PIN A;  4N0Z A;  4XRA A;  2ON7 A;  3KJY A;  2DSA A;  3IPZ A;  4KUN A;  5LCZ A;  5CYY A;  2BTO T;  2PBJ A;  3Q74 A;  2CZ2 A;  3I9V 2;  3FZ9 A;  11GS A;  5EL8 A;  2LJR A;  2QGV A;  1PRX A;  4IP6 A;  1G6W A;  4K0N A;  1PQN A;  3ZVJ D;  5JCW A;  3QDN A;  1G7O A;  3FZA A;  1T4Y A;  2B1K A;  3TOU A;  5C00 A;  3ED3 A;  3L78 A;  6GST A;  3EMP A;  4F9Z A;  2HRN A;  2V41 A;  5IOW A;  5H5R A;  3BCI A;  2A2P A;  3GH9 A;  3D22 A;  3IV4 A;  5IIZ A;  3UVH A;  3HD5 A;  4DEJ A;  2AJQ B;  3VI7 A;  3PPU A;  4KDU A;  2TIR A;  1JFU A;  2GTU A;  2YCD A;  4DSS B;  1PX7 A;  3TJF A;  2LEG A;  2EIR A;  2HXK A;  4IQ1 A;  4POB A;  2HE3 A;  5ENU A;  4AF2 A;  3D21 A;  3ISO A;  2DLX A;  5ECN B;  5HR2 A;  5BRT A;  1GSU A;  4EE0 A;  2FUG 2;  3U6V A;  4ZL9 A;  1SK2 A;  4GLT A;  4TR1 B;  2NTO A;  5C04 A;  3A3T A;  1EGO A;  2LST A;  3FRC A;  4JR4 A;  4WET A;  1B9Y C;  4KCA A;  2HZE A;  1JZR A;  5CAX A;  3GFK A;  2E2G A;  3EU4 A;  3MWH A;  3MNG A;  4KSO A;  5GSS A;  4K6X A;  4HDE A;  5KN2 A;  5A4V A;  3GKN A;  1QGV A;  2VLT A;  2PWJ A;  3CXG A;  3GX0 A;  1J0F A;  5CO3 A;  4PX1 A;  2I3Y A;  3F8U A;  2ZUP A;  3IA1 A;  4PUA A;  1NM3 A;  2VM2 A;  4YAV A;  5A4U A;  2LNS A;  3HVS A;  4X4J A;  3U5R E;  1KTE A;  1YKA A;  4J2F A;  3H79 A;  3E3E A;  5ECK B;  1UN2 A;  1T00 A;  2L5L A;  4K1F A;  1SK1 A;  3KIJ A;  3BBY A;  2GQL A;  1CQH A;  4PUF C;  1WMJ A;  3A5I A;  2V32 A;  3JCM L;  3LEF A;  2YN1 A;  3GKM A;  4XS1 A;  3RPP A;  4G2E A;  1X9M B;  1V57 A;  1TKD B;  3DEX A;  4V2L A;  2LJK A;  2V2G A;  1XWA A;  4BWS A;  1DUG A;  2F8F A;  3L9V A;  12GS A;  3ZFB A;  1XW5 A;  3VWV A;  5CRH A;  3DML A;  2FWH A;  4MJA A;  1ZMA A;  4BVX B;  3P7X A;  4Q5F A;  1A2M A;  1GUH A;  2RII A;  4KF9 A;  1DSB A;  3GX8 A;  1EWX A;  5GAP D;  5J3R A;  3CRT A;  5KOX A;  2H1G A;  1AAZ A;  2LTK A;  1O81 A;  1JZW A;  3KZQ A;  5ECO B;  4X43 A;  4EKZ A;  4BA7 A;  1Q98 A;  3QMX A;  4KDY A;  4MZW A;  4K2D A;  3APO A;  1AW9 A;  4KND A;  3ZYW A;  2H75 A;  4IEL A;  2C0G A;  3IHQ A;  3ZIJ A;  3VLN A;  3IOS A;  1XW9 A;  2WZ9 A;  1G7E A;  4BWQ A;  4LMW A;  2VAF A;  2HZF A;  4XIH A;  3HXS A;  3M9J A;  1A8L A;  1PA3 A;  3QCP A;  4PQ1 A;  3NIV A;  1OC8 A;  2OE3 A;  2FA8 A;  4IW9 A;  4JZQ A;  2GZY A;  3I43 A;  2N5A A;  2WS2 A;  2HRA A;  4GCI A;  1TK8 B;  3I6A A;  14GS A;  3LSZ A;  4QL7 A;  3O6T A;  1O85 A;  2E0Q A;  5BMU A;  3ZZX A;  2VCW A;  4PUR A;  2B7J A;  2XHF A;  4JU5 A;  2BJX A;  3GL5 A;  2PPT A;  4NHZ A;  3O3T A;  2GST A;  2X8H A;  5HFK A;  1U3I A;  4TN8 A;  4P3Y B;  1PSQ A;  1BYE A;  4JED A;  1XVW A;  1J08 A;  1MDK A;  4IBP A;  4WKW A;  4WF4 A;  1YF0 A;  1ACV A;  1B9X C;  3QFB C;  4PQI A;  4WBR D;  3F9U A;  2FA4 A;  4HUA A;  4D73 A;  3QAV A;  3C8E A;  3GL3 A;  3ERW A;  1R5A A;  3UAR A;  4NHW A;  3GH6 A;  4FO5 A;  3KTB A;  4CW9 A;  3HVX A;  4IVF A;  4L5L A;  2H1B A;  1VF2 A;  1GTB A;  2R0P A;  3US3 A;  3TDG A;  2VLU A;  3GUS A;  3GMF A;  2B5E A;  5F05 A;  2IFQ A;  5FHI A;  1M9A A;  4JRR A;  1MEK A;  3KH9 A;  4ISD A;  1E6B A;  4Z2U A;  4BVY B;  2EC4 A;  2GQK A;  4MF5 A;  5J4U A;  4NXI A;  1GUM A;  1FO5 A;  3EVI A;  4EO3 A;  1TJD A;  2C0E A;  1BG5 A;  1A23 A;  1NSW A;  3LJR A;  2NBS A;  5IO0 A;  4IN0 A;  2GSQ A;  4BL7 B;  2QA2 A;  4WR4 A;  1PGT A;  3TUE A;  4TKY A;  3QFA C;  4ZL8 A;  2L59 A;  1A8Y A;  1LJR A;  1F3B A;  5D9W A;  1XFL A;  5FWG A;  2X49 A;  1SJI A;  2H1A A;  2X8C A;  1M7T A;  2LJA A;  1K3O A;  6GSY A;  2CAI A;  4YQU A;  3DRN A;  2RLI A;  2K18 A;  2IWT A;  3FEU A;  4MAB A;  2A2S A;  1V2A A;  2QA1 A;  4ML6 A;  5AIS A;  1OC9 A;  2B6M A;  3IHG A;  1K3Y A;  1JHB A;  1EEM A;  1GSY A;  1GNW A;  1FB6 A;  3IE3 A;  2GLR A;  1HQO A;  5LD0 A;  4HQS A;  4V2N A;  1AC1 A;  3FHK A;  2J23 A;  4IJ3 A;  4K8M A;  3RHB A;  1OAZ A;  5IMC A;  2FY6 A;  4TR4 A;  5CRG A;  4AJ7 A;  18GS A;  2CQ9 A;  2CAQ A;  2JU5 A;  3LGC A;  2PU9 C;  2FGX A;  2F3M A;  4IJI A;  1TW9 A;  4H86 A;  3P2A A;  4ZBD A;  3QD9 A;  3A5W A;  3KEB A;  1K0O A;  3TKS A;  1XWK A;  2DJ3 A;  1XVQ A;  3IK9 A;  5B8B A;  1A0F A;  2C0F A;  1GLQ A;  1U3A A;  3C1R A;  5DQS A;  3DYR A;  8GSS A;  3WT2 A;  2VD1 A;  4ULX A;  2M72 A;  4MP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...