2H66A

The crystal structure of plasmodium vivax 2-cys peroxiredoxin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
167
structure length
167
Chain Sequence
PTYVGKEAPFFKAEAVFGDNSFGEVNLTQFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFHERNVELLGCSVDSKYTHLAWKKTPLAKGGIGNIKHTLLSDITKSISKDYNVLFDDSVSLRAFVLIDMNGIVQHLLVNNLAIGRSVDEILRIIDAIQHHEKYGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics/oxidoreductase
molecule keywords PV-PF14_0368
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 49
structure length 167
sequence length 167
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h66A00
1R26A 1ZCPA 3VURA 2KP1A 1V2AA 3F9UA 1NW2A 3KP8A 2H6YA 2LJRA 3GMFA 5ECPB 1C72A 4GTUA 2WCIA 3IK7A 5ECQB 4POKA 3I6AA 2HZEB 2RUEA 1ZYQB 1CQGA 4YQUA 3M9KA 2JSZA 1SKRB 1A2MA 1OKDA 3L9SA 1J0FA 2LEGA 2L59A 4EL1A 1EWXA 2IN3A 2C8UA 3A2XA 1GTAA 4O7HA 4KUNA 2RM5A 1T4YA 1WIKA 3RHCA 5D9VA 2VL3A 5JWRB 3US3A 3UVHA 1ERWA 4JR6A 3HXSA 2LNTA 4MZWA 2CVDA 4HQSA 4V2MA 2AB6A 5F06A 4WBJA 3J7Yb 4EE0A 1WOUA 3EINA 5DALB 1FB6A 3CSIA 4HEA2 1AXDA 3CTGA 1WPIA 1EEMA 3RPPA 4QQ7A 2L6CA 2OJLA 3C71A 2H76A 4PNGA 2CX3A 3TKSA 3WD6A 1T1VA 3IK9A 3KP9A 4PUAA 4FYCA 5H5RA 1KEBA 1JZRA 1K0NA 1T3BA 2IWTA 1WMJA 4Q5FA 5HFKA 5CRGA 4IP6A 3CTFA 4MPFA 2H6ZA 4X0XA 1QQ2A 3LGCA 2X64A 2H01A 2GQLA 1WE0A 1BG5A 1OAZA 1GTBA 2YV7A 2C3QA 3QDNA 2VM1A 5CREA 3EMXA 2VCQA 1M9AA 4L0UA 5IO0A 5C00A 3VK9A 4NV2A 2JU5A 4EKZA 3QFBC 1XOAA 2H19A 4K7OA 3E9JB 3M0FA 2G0FA 2K6VA 3BOAA 3FR6A 2IPAA 2VD0A 4LL4B 1WJKA 2YWNA 2CV4A 1DE2A 2FD3A 3TKPA 4KB3A 1Y25A 1SKSB 2A2SA 2NDOA 1GP1A 2I1UA 5A5KA 1O8WA 4IKHA 1XFLA 2G2QA 5AN1A 2V41A 4L5LA 5D9TA 3D4MA 4PGTA 3GYKA 2I4AA 3HHVA 2EIRA 4CHSA 3E0UA 1R5PA 3H79A 1WWJA 4WKWA 5EPFA 3LXTA 3I9V2 3DRNA 1R4WA 3QPMA 2CZ2A 4EUYA 4EDZA 2B6MA 3F3RA 3GKKA 2DIZA 4EXJA 2H72A 5IMCA 1TP9A 2PVQA 4IVFA 2ON5A 4EDYA 2QC7A 5IPGA 1K0BA 2YWOA 1USBA 1YF1A 5G5EA 2KOKA 2K18A 2GQMA 2VL2A 2WGRA 1B4PA 2X8GA 4F0CA 22GSA 2RM6A 1X9SB 1SL2B 1Q98A 4PXOA 4XIHA 5IMZA 4X1UA 3QFAC 1ST9A 2FA8A 1K3YA 3CXGA 2V1MA 2GGTA 3A2VA 4KNDA 1UA5A 3GURA 1S3AA 3TCOA 4EC0A 2FWGA 1G7EA 17GSA 3FW2A 1TI1A 2QGVA 2C0FA 1EOHA 2YJHA 1XW9A 4TXVA 4MF5A 2JACA 4KGIA 1A0RP 3D4TA 1WRYA 5DBQA 3IHQA 1YKCA 2IMIA 2HXKA 2EC4A 3W8SA 3VWVA 1S3CA 1J9BA 1FOVA 2RUFA 4MZCA 3HKRA 2H74A 2YZUA 2DC5A 3BJ5A 5AIVA 4KAEA 2FCHA 2FUG2 1QXHA 2L6DA 3VWUA 1EV4A 5AIXA 5CRDA 3PH9A 4N10A 3RAZA 4MMMA 1DUGA 2JZSA 5EY6A 4CDOA 16GSA 3TKSC 3KD0A 3ZZXA 2HSHA 1THXA 5IOWA 2C0DA 2QKEA 2MYGA 4LLRA 1K0AA 4MF6A 5IQYA 2JZTA 1K0DA 4L5OA 2FWEA 2GQKA 1I5GA 2LUSA 6GSWA 2MBSA 4TOPA 1GLQA 2GZYA 1U88A 1G0TA 3C1RA 2QSIA 4TN8A 1MDKA 3L9VA 3QD9A 3A5WA 4QL7A 1K0CA 4F82A 1YDKA 4ZIJA 1BQ7A 2YN1A 2YANA 4ZB8A 3HJPA 5IMFA 2BTOT 1ERUA 1R7HA 3ZRDA 2NPBA 1ACVA 1AIUA 5DDLA 3I43A 1KBNA 3IRAA 1MD3A 3EE2A 1J08A 4JE1A 4PQ1A 2VLTA 4ML1A 1PL2A 3W6GA 5DQYA 1G6WA 3TUEA 5A4WA 1YKAA 2J9HA 3RBTA 5IO2A 2H73A 2LKUA 4ECJA 5F0GA 5J4UA 3LFLA 2B3SA 5G2ZA 1XVWA 1GLPA 2AHEA 4MK3A 4ISDA 1GSFA 3Q6OA 2VD1A 2KLXA 1LJRA 3EURA 5ECKB 2OA7A 1M99A 2N5BA 4GWRA 4MP4A 5L71A 4TRXA 1BJXA 4GQCA 2D2ZA 1JFUA 1GULA 2IMKA 1XW6A 4IQAA 1IYIA 2CT6A 5GAPD 1E2YA 1M2AA 5GZZB 1B8XA 3GA4A 3LJRA 3L9UA 4N0ZA 5JWOB 3BD2A 1SK0A 3ED3A 1G6YA 4K7NA 2H0GA 5IOXA 4PUFC 5C04A 3HDCA 5INYA 3ZLPA 4PQHA 4IQ1A 1ZZYA 3HD5A 4WF4A 1X5EA 2RLIA 1LBKA 1YJ6A 2L57A 3KIJA 1PKZA 3VWWA 3L0HA 1XCCA 5ENUA 2WZ9A 1ZYEA 2VL2C 2FLSA 2KHPA 5J41A 2B7KA 3FHKA 2C4JA 3V1WA 4TXOB 2FWFA 4IP1A 5D96A 4HU7A 3FKFA 3F63A 3IXRA 5H5SA 3VPQA 4MLYA 4ZBDA 5F05A 4KSMA 4N30A 5GSSA 2VM2A 4ZL9A 1FVKA 1X5CA 4V2LA 4PNFA 4E8EA 2VIMA 1VF2A 3TRPA 1UN2A 4BWQA 5CNWA 5JCGA 2PMTA 1EZKA 2J23A 2MMZA 3EMPA 1EP7A 2GSQA 3IDVA 1TTZA 2C80A 2O85A 2TRCP 18GSA 1VRSD 3BCKA 1XIYA 3GTUB 4TW5A 1Z7PA 1KTEA 3CYNA 1XBSA 4JRRA 2C0GA 1GSUA 3M3MA 4YQVA 1SJ6A 3WGEA 4Q5QA 1MD4A 2GVPA 4JZQA 2PGTA 1TK0B 2LRTA 3IBHA 3UIWA 4LA1A 1SU9A 3UOMA 4OFMA 1OVNA 4EF0A 4TXOA 2VAFA 2JSYA 1SJZA 3VFIA 4IN0A 4ZBBA 3TGZA 1X9WB 2OADA 3BBYA 3GSTA 4GXZA 4K6XA 4XHMA 2K9FA 2LJKA 3F0IA 4J56E 3ZIJA 5IIZA 1GSYA 3G9BA 3H1NA 3A3TA 3RPNA 2H70A 3APSA 2HRNA 3TKSE 4FYUA 4I97A 1Z5YE 4NV5A 3CSJA 10GSA 2F3MA 2YV9A 3SWLA 2WULA 2XHFA 3O76A 3FZAA 3O3TA 3UVTA 1GUHA 5J9BA 1TXXA 1XZOA 1WP0A 4NPBA 3C73A 1ZOFA 2LQOA 4IW9A 2NTOA 1ZGNA 2CVBA 3DD3A 3GTUA 4HS1A 3KH7A 3Q18A 1PN9A 3AY8A 1EOGA 1YY7A 2PU9C 6GSSA 2VCTA 1FB0A 4XTSA 1BAYA 4K2DA 5FT3A 2WS2A 3IC4A 3G7JA 3U5RE 4RQXA 7GSSA 1GNWA 3FY7A 3C8EA 4FIWA 2CAIA 2VO4A 3HA9A 1XOBA 1SD9A 4IELA 1F3BA 1KNGA 2DIYA 3D22A 1PQNA 1DE1A 4MA9A 4ECCA 3KXOA 5ECOB 3ZITA 2GTUA 1W89A 1PRXA 1AUCA 3IPZA 5DCHA 3DWVA 1YEPA 8GSSA 4ID0A 3U6VA 2KUCA 3KZQA 2P31A 1TU8A 4Q5NA 2O87A 4MJCA 2V2GA 3M9JA 2GLRA 1A24A 1GRXA 2NVLA 1GH2A 4MDCA 1O6JA 4EO3A 13GSA 5KN1A 1A2LA 3G7YA 4TR1A 2P5RA 4PURA 3ZTLA 1V58A 1PMTA 3TRXA 5IPHA 3GUSA 3P7XA 1IYHA 1BX9A 1JLWA 2PVOC 5CRWA 1QUWA 3VI7A 1Z3EA 3LWAA 3DGQA 4MJAA 2YOIA 4YAVA 2KP2A 2R2JA 3ME8A 4ECIA 6GSVA 2YNXA 3HY2A 2REMA 1NM3A 4IJIA 1F37A 1VGLA 3RHBA 1DBYA 4Z7XA 2K8SA 5IMAA 5G1LA 3FZ5A 3OR5A 3KTBA 1OKTA 2X99A 3M8NA 1HQOA 3NOFA 4POMA 1MDJA 3D5JA 4TR0A 4LL1B 2R37A 1FW1A 5DJLA 4NHZA 1QK8A 5ECNB 5AGYA 3DXBA 1Z6NA 4KA0A 1K3LA 3HJOA 5ECHB 3O6TA 3GX0A 4LMVA 2FGXA 4BA7A 4GLTA 4JR4A 3ZIVA 2MMNA 3P90A 2N5FA 4G19A 3TRQA 3R2QA 3ISOA 4OO5A 4K0NA 4RI6A 2HNLA 2Z9SA 4CW9A 3APOA 5ECSA 1O7UA 3C7MA 1K0OA 3PINA 3ZREA 6GSUA 3GIXA 4ULXA 4BWSA 2L5OA 2P0GA 4HQZA 5G31A 3ME7A 3ERGA 5DCGA 1ZL9A 1ERVA 3GRXA 3QOUA 3TB2A 5IMDA 1EEJA 1YZXA 3DYRA 2IIYA 2DSAA 3WT2A 4MF7A 1PX6A 4X43A 1K3OA 5FHIA 4JBBA 1O8XA 4JU5A 5AISA 2WDUA 4ZILA 1M2BA 5CO3A 4OFNA 1SYXA 2E0QA 3ZMKA 4D73B 4XS4B 2BMXA 2DBCA 5J9CA 3KGKA 4G9HA 2YP6A 1SD8A 2AJQB 5ECRB 4OFTA 5LCZA 1X0RA 1SL0B 1OC9B 1OC3A 1TOFA 3FK8A 4DVCA 4XRDA 1EGRA 4WEYA 2CA8A 4GCIA 2B5YA 2HE3A 3GKXA 4GRFA 1GUMA 2PERA 4XS6A 3TJGA 2B5EA 1AC1A 2PUKC 4POBA 1HYUA 4KW6A 1GUKA 3KM6A 4I6XA 1GTIA 2P5QA 2JADA 4HUAA 6GSYA 2VCXA 3FRCA 2ZUPA 1GSEA 2NBSA 3F6FA 3GX8A 4K8MA 2A2RA 4OWYA 4KCEA 3MAKA 9GSSA 3WGDA 3MDKA 2X8HA 3N5OA 3TDGA 3LQ7A 1NHOA 1U87A 2F8AA 4GSNA 3ERWA 5KN0A 3SBCA 5J5NA 1OC8A 3EU3A 3QAGA 4ZXGA 3WYWA 5KN2A 2B5XA 2VCZA 1TRSA 4D73A 3EC3A 4MJBA 4XS4A 1OYJA 3TJFA 3KTLA 2V32A 2I9HA 4KE3A 3VLNA 1HNBA 2FY6A 1GSQA 4DEJA 1OC9A 4AJ6A 2XBQA 5A4UA 4QL9A 3EYTA 3UBLA 3GKMA 1FAAA 4KDXA 4IJ3A 2ES7A 2M80A 3QMXA 5F8BA 1V40A 4OCFA 2R6KA 4I2UA 1XWGA 4OO4A 3EU4A 2B1LA 3CSHA 1Z7RA 3GKNA 5CAXA 2LJAA 1SJIA 5KEJA 1ERTA 1XWBA 3EVIA 1N8JA 3LG6A 2GT6A 1T00A 3ERFA 1Z6MA 1PX7A 2CAQA 3CMIA 1XWCA 2GSTA 11GSA 3ZFBA 1GL8A 1NHYA 1B9XC 4I8BA 2MMOA 1TKDB 1YEXA 3FZ4A 2OBIA 5HR1A 4V1Ap 3KCMA 4KX4A 2AUVA 1TDIA 2IFQB 3J7Yk 1M9BA 1GSSA 4F9ZA 2C0EA 4TVEA 4POLA 4MJEA 3QAVA 3C1SA 4PQIA 3F3QA 3GH9A 4IGJA 2V6OA 1H75A 1XW5A 1TRWA 4IHUA 1XWAA 1A8LA 5IM9A 1G7OA 2PPTA 5HFGA 1T7PB 3FR9A 4YQMA 1GWCA 4TR4A 2GS3A 2EIOA 5IMVA 4BVYA 2LQQA 3Q19A 1EP8A 4O32A 5CP1A 1PGTA 2HYXA 4ZB9A 2IMFA 5DAKB 4OD7A 1ILOA 1AQXA 1CQHA 2DJ3A 1OE8A 3KMNA 4N11A 4DSSA 3VPTA 2K8VA 2HLSA 3N9JA 2OE1A 1JZWA 4L0WA 2H66A 4ZL8A 3F6DA 1JLVA 4ECBA 4Q5RA 3D0ZA 3L78A 2JL4A 1U3IA 3TOUA 4KDYA 1E6BA 4WR4A 1EV9A 5ABRA 3TJBA 3HZ4A 2BJXA 5D9WA 5LD0A 3GN3A 3LSZA 3K8NA 1FHEA 1TU7A 3KMOA 4HZ4A 2IFQA 4MCUA 4KCAA 1B4QA 4I5QA 1PA3A 1AW9A 3S9FA 1V9WA 5J3RA 4F2IA 2ON7A 3GV1A 4DSQA 4RI7A 1SL1B 3TOTA 2R4VA 1FVJA 4XCSA 2WFCA 3UJ1A 3GH6A 1HNAA 2H75A 3LYKA 2PBJA 5JCUA 1PL1A 3QCPA 5HR3A 4P3YB 1MTCA 5DAKA 4F0BA 1FG4A 3WT1A 2XPDA 1Y6EA 4TR1B 3PGTA 3H8QA 5FWGA 2MMAA 4MZBA 1V57A 1RW1A 2VCWA 2OE0A 4GSTA 1W4VA 1GTUA 1I9DA 5D73A 2H1AA 2GZPA 3DKSA 2WJUA 4NXIA 2WB9A 1A2JA 1H4OA 2E7PA 4HJMA 2I81A 4MPGA 3FR3A 3CRUA 2H30A 3DMLA 1XWKA 1QGVA 1DSBA 3P8WA 3F4SA 5D8IA 1RQMA 2F8FA 2ZNMA 1F9MA 5CYYA 1TK5B 2H1DA 1X9MB 2H1GA 2HZFA 2B1KA 3ZL5A 4XS1A 1URMA 4K1FA 2YZHA 2B7JA 1YQ1A 2HZEA 2CZ3A 3GL5A 5ELGA 1SKWB 2H71A 4KSOA 5DQSA 2VOCA 4RQRA 14GSA 4O5RA 2DJKA 3IE3A 3BCIA 3HVXA 1A8YA 4AJ8A 2A4VA 1GSDA 1SYRA 2ZCTA 3MWHA 2LNSA 4MH3A 5JCWA 4FH8A 1BEDA 1N2AA 4WBRD 3KH9A 6GSXA 4O92A 4J2FA 1AQWA 3DVXA 2AV4A 4MH2A 1PKWA 5B8BA 2X8CA 2L5LA 1AAZA 2O8VB 2YJ7A 3Q74A 19GSA 5DALA 2DJJA 3M1GA 1M0UA 2XBIA 2PN8A 1QMVA 1PSQA 4HDEA 5GAND 3QAWA 4NAXA 2FHEA 5COHA 2HRFA 4AF2A 3ZVJA 2YWMA 2E2MA 3H93A 5GSTA 1JHBA 1OE7A 1PD21 5D93A 5E59A 1JZDA 1TI3A 4K9ZA 1ZMAA 3FZ9A 2GSRA 4LMWA 3KJYA 4PX1A 3TKQA 4BVXA 2IMDA 2H1BA 2PWJA 3DVWA 2M46A 20GSA 4NHWA 3D6IA 1U6TA 4N0VA 3UL3A 2H8LA 4ACSA 4F03A 3HVSA 2VL9A 2I3YA 4J57E 5G1KA 5JWQB 5B6NA 2GDRA 3APQA 5H5QA 1VF4A 4K0GA 1O73A 4GSSA 5EL8A 4HJ2A 2E2GA 1BYEA 6GSTA 3TJKA 2H0HA 3UAPA 4JEDA 4XRAA 5D9XA 1U3AA 1ML6A 3IR4A 3L4NA 5ECIB 5B8AA 2DJ2A 1RK4A 1HD2A 3NZNA 1B9YC 1O85A 3IA1A 4BPYA 1UC7A 5B7CA 2YWIA 4OMVA 4K7IA 1LU4A 1FO5A 4YAPA 1O81A 1ON4A 2CVKA 1T8EB 1YF0A 2H6XA 5G5FA 1SENA 1VF1A 5HR2A 3FYGA 4ZL7A 5HFIA 5KN3A 2EIQA 4ZB6A 2M72A 2GSSA 4WF5A 2GT5A 3LEFA 2OKAA 2AAWA 2HFDA 2F51A 3IAM2 3CRTA 1S3DA 2YPMA 1Z9HA 1R5AA 2HSYA 2VLUA 1JZOA 1T4ZA 1THOA 2OE3A 4L8EA 4ZBAA 2LRNA 3FEUA 5E4WA 3UARA 1XPVA 3I69A 3LYPA 4FYBA 3HCZA 1AQVA 1M2DA 2WRTA 3GHAA 4I2TA 1TRUA 3MNGA 2HT9A 4HU9A 4E8HA 3GSSA 3UBKA 3DIEA 4WR5A 4OCEA 4BL7A 3PR8A 2TRXA 2AYTA 1A23A 1SK2A 1B48A 3GFKA 3DEXA 3HJMA 1MDIA 3LORA 1F2EA 2C3TA 2O7KA 3GNJA 2OACA 1X5DA 5F07A 3UMAA 2DMMA 2MZCA 3HZ8A 3UEMA 3EWLA 2CX4A 1F3AA 3VI5A 4DSRA 2L4QA 3HVVA 2DJ0A 4GQFA 4ML6A 4RUVA 1UVZA 1MEKA 2R3XA 4NWYA 5ECLB 4AJ7A 3TJJA 4EVMA 5B6MA 1NSWA 3IOSA 1V98A 1A0FA 3H4KA 4TR3A 2H0IA 4H86A 3E3EA 3F4RA 1TW9A 1TJDA 3IV4A 2LS5A 4FO5A 4DSSB 2LRCA 3LXZA 5ID2B 5G30A 4GF0A 1K0MA 2CQ9A 2XC2A 4HI7A 2FWHA 1XXUA 5HR0A 2HI7A 5HQPA 4V2NA 2N5AA 2L4CA 3HYPA 12GSA 2DJ1A 2DLXA 1QFNA 4WXTA 5ELAA 1TK8B 2R5GA 5EVOA 2IL3A 4AGSA 3CBUA 5CRHA 5DJMA 1HNCA 2VLVA 3A2WA 3W8JA 2DMLA 2IMEA 1VF3A 2ALBA 2GZZA 5A4VA 3ZFLA 1Q4JA 3GL3A 3WGXA 2LTKA 2C3NA 1XVQA 2XPEA 3TKRA 4KDUA 4KH7A 2FNOA 3F4TA 2V6KA 5LNKe 3NIVA 4YH2A 2OBKA 2JZRA 2MBTA 3G7IA 4MABA 3RDWA 3JCML 1ABAA 2FA4A 4IBPA 1M7TA 4ILFA 3MSZA 3VWXA 2LV3A 2O89A 2IJYA 1SK1A 3ZVJD 1TRVA 2RIIA 4V1Ag 3P2AA 2TIRA 2F9SA 3D21A 3IAS2 4WETA 4G2EA 3KEBA 4TKYA 5ECMB 5ID2A 4G10A 2VCVA 4HZ2A 3ZYWA 2VUPA 5DVBA 2LSTA 2C1YA 3QR6A 4IS0A 1F6MC 3ZMLA 3F8UA 1GNEA 1EGOA 2YCDA 4HOJA 4NMUA
chains in the Genus database with same CATH superfamily
1R26A 1ZCPA 3VURA 2KP1A 1V2AA 3F9UA 1NW2A 3KP8A 2H6YA 2LJRA 3GMFA 5ECPB 1C72A 4GTUA 2WCIA 3IK7A 5ECQB 4POKA 3I6AA 2HZEB 2RUEA 1ZYQB 1CQGA 4YQUA 3M9KA 2JSZA 1SKRB 1A2MA 1OKDA 3L9SA 1J0FA 5KOWA 2LEGA 2L59A 4EL1A 1EWXA 2IN3A 2C8UA 3A2XA 1GTAA 4O7HA 4G0KA 4KUNA 2RM5A 3MIXA 1T4YA 1WIKA 5BRTA 3RHCA 5D9VA 2VL3A 5JWRB 3US3A 3UVHA 1ERWA 4JR6A 3HXSA 4MNNA 2LNTA 4MZWA 2CVDA 4HQSA 4V2MA 2AB6A 5F06A 4WBJA 3J7Yb 4EE0A 1WOUA 3EINA 5DALB 1FB6A 3CSIA 4HEA2 1AXDA 3CTGA 1WPIA 1EEMA 3RPPA 4QQ7A 2L6CA 2OJLA 3C71A 2H76A 4PNGA 2CX3A 3TKSA 3WD6A 1T1VA 3IK9A 3KP9A 4PUAA 4FYCA 5H5RA 1KEBA 1JZRA 1K0NA 1T3BA 4Z2RA 2IWTA 1WMJA 4Q5FA 5HFKA 5CRGA 4IP6A 3CTFA 4MPFA 2H6ZA 4BVXB 4X0XA 1QQ2A 3LGCA 2X64A 2H01A 2GQLA 1WE0A 1BG5A 4USSA 1OAZA 1GTBA 2YV7A 2C3QA 3QDNA 2VM1A 5CREA 3EMXA 2VCQA 1M9AA 4L0UA 5IO0A 5C00A 3VK9A 4NV2A 2JU5A 4EKZA 3QFBC 1XOAA 2H19A 4K7OA 3E9JB 3M0FA 2G0FA 2K6VA 3BOAA 3FR6A 4PTSA 2IPAA 2VD0A 4LL4B 1WJKA 2YWNA 2CV4A 1DE2A 2FD3A 3TKPA 4KB3A 1Y25A 1SKSB 2A2SA 2NDOA 1GP1A 2I1UA 5A5KA 4HSCX 1O8WA 4IKHA 1XFLA 2G2QA 2V41A 5AN1A 3MYDA 4L5LA 5D9TA 3D4MA 4PGTA 3GYKA 2I4AA 3HHVA 2EIRA 4CHSA 3E0UA 1R5PA 3H79A 1WWJA 4WKWA 5EPFA 3LXTA 3I9V2 3DRNA 2R0GA 1R4WA 3QPMA 2CZ2A 4EUYA 4EDZA 2B6MA 3F3RA 3GKKA 2DIZA 4EXJA 2H72A 5IMCA 1TP9A 2PVQA 4IVFA 4G0LA 2ON5A 4EDYA 2QC7A 5IPGA 1K0BA 2YWOA 1USBA 1YF1A 5G5EA 2KOKA 2K18A 2GQMA 2VL2A 2WGRA 1B4PA 2X8GA 4F0CA 22GSA 2RM6A 1X9SB 1SL2B 1Q98A 1S3RA 4PXOA 4XIHA 5IMZA 4X1UA 3QFAC 1ST9A 2FA8A 1K3YA 3CXGA 2V1MA 2GGTA 3A2VA 4KNDA 1UA5A 3GURA 1S3AA 3TCOA 4EC0A 2FWGA 1G7EA 17GSA 3FW2A 1TI1A 2QGVA 2C0FA 1EOHA 2YJHA 1XW9A 1PFOA 4TXVA 4MF5A 2JACA 4KGIA 1A0RP 3D4TA 1WRYA 5DBQA 3IHQA 1YKCA 2IMIA 2HXKA 2EC4A 3W8SA 3VWVA 1S3CA 1J9BA 1FOVA 2RUFA 4MZCA 3HKRA 2H74A 2YZUA 2X4AA 2DC5A 3BJ5A 4G0IA 5AIVA 4KAEA 2FCHA 2FUG2 1QXHA 3FMWA 2L6DA 3VWUA 1EV4A 5AIXA 5CRDA 3PH9A 4K5SA 4N10A 4MMMA 1DUGA 2JZSA 3RAZA 5EY6A 4CDOA 16GSA 3TKSC 3KD0A 3ZZXA 2HSHA 1THXA 5IOWA 2C0DA 2QKEA 2MYGA 4LLRA 1K0AA 4MF6A 5IQYA 2JZTA 1K0DA 4L5OA 2FWEA 3R3EA 2GQKA 1I5GA 2LUSA 6GSWA 2MBSA 4CY6A 4TOPA 1GLQA 2GZYA 1U88A 1G0TA 3C1RA 2QSIA 4TN8A 1MDKA 3L9VA 3QD9A 3A5WA 4QL7A 1K0CA 4F82A 1YDKA 4ZIJA 1BQ7A 2YN1A 2YANA 4ZB8A 3HJPA 5IMFA 2BTOT 1ERUA 1R7HA 3ZRDA 2NPBA 1ACVA 1AIUA 3I43A 5DDLA 1KBNA 3IRAA 1MD3A 3EE2A 1J08A 4JE1A 4PQ1A 2VLTA 4ML1A 1PL2A 3W6GA 5DQYA 1G6WA 3TUEA 5A4WA 1YKAA 2J9HA 3RBTA 5IO2A 2H73A 2LKUA 4ECJA 5F0GA 5J4UA 3LFLA 2B3SA 5G2ZA 1XVWA 1GLPA 2AHEA 4MK3A 4ISDA 1GSFA 3Q6OA 2VD1A 2KLXA 1LJRA 3EURA 5ECKB 2OA7A 1M99A 2N5BA 4GWRA 4MP4A 5L71A 4TRXA 1BJXA 4GQCA 2D2ZA 1JFUA 1GULA 2IMKA 1XW6A 4IQAA 1IYIA 2CT6A 5GAPD 1E2YA 1M2AA 5GZZB 1B8XA 3GA4A 3LJRA 3L9UA 4N0ZA 5JWOB 3BD2A 1SK0A 3ED3A 1G6YA 4K7NA 2H0GA 5IOXA 4PUFC 5C04A 3HDCA 5INYA 3ZLPA 4PQHA 4IQ1A 1ZZYA 3HD5A 4WF4A 1X5EA 2RLIA 1LBKA 4X4JA 1YJ6A 2L57A 3KIJA 1PKZA 3VWWA 3L0HA 1XCCA 5ENUA 2WZ9A 1ZYEA 2VL2C 2FLSA 2KHPA 5J41A 2B7KA 3FHKA 2C4JA 3V1WA 4TXOB 2A4HA 2FWFA 4IP1A 5D96A 4HU7A 3FKFA 3F63A 3IXRA 5H5SA 3VPQA 4MLYA 4ZBDA 5F05A 4KSMA 4N30A 5GSSA 2VM2A 4ZL9A 1FVKA 1X5CA 4V2LA 4PNFA 4E8EA 2VIMA 1VF2A 3TRPA 1UN2A 4BWQA 5CNWA 5JCGA 2PMTA 1EZKA 2J23A 2MMZA 3EMPA 1EP7A 2GSQA 3IDVA 1TTZA 2C80A 2O85A 2TRCP 18GSA 1VRSD 3BCKA 1XIYA 3GTUB 4TW5A 1Z7PA 1KTEA 3CYNA 1XBSA 4JRRA 2C0GA 1GSUA 2DKHA 3M3MA 4YQVA 1SJ6A 3WGEA 4Q5QA 1MD4A 2GVPA 4JZQA 3IC8A 2PGTA 1TK0B 2LRTA 3IBHA 3UIWA 4LA1A 1SU9A 3UOMA 4OFMA 1OVNA 4EF0A 4TXOA 2VAFA 2JSYA 3CQFA 1SJZA 3VFIA 4IN0A 4ZBBA 3TGZA 1X9WB 2OADA 3BBYA 3GSTA 4GXZA 4K6XA 4XHMA 2K9FA 2LJKA 3F0IA 4J56E 3ZIJA 5IIZA 1GSYA 3G9BA 3H1NA 3A3TA 3RPNA 4A5PA 2H70A 3APSA 2HRNA 3TKSE 3A5IA 4FYUA 4I97A 1Z5YE 4NV5A 3CSJA 10GSA 2F3MA 2YV9A 3SWLA 2WULA 2XHFA 3O76A 3FZAA 3O3TA 4KF9A 3UVTA 1GUHA 5J9BA 1TXXA 1XZOA 1WP0A 4NPBA 3C73A 1ZOFA 2LQOA 4IW9A 2NTOA 1ZGNA 2CVBA 3DD3A 3GTUA 4HS1A 3KH7A 3Q18A 1PN9A 3AY8A 1EOGA 1YY7A 2PU9C 6GSSA 2VCTA 1FB0A 4XTSA 1BAYA 4K2DA 5FT3A 2WS2A 3IC4A 3G7JA 3U5RE 4RQXA 7GSSA 1GNWA 3FY7A 3C8EA 4FIWA 2CAIA 2VO4A 3HA9A 1XOBA 1SD9A 4IELA 1F3BA 1KNGA 2DIYA 3D22A 1PQNA 1DE1A 4MA9A 4ECCA 3KXOA 5ECOB 3ZITA 2GTUA 1W89A 1PRXA 1AUCA 3IPZA 5DCHA 3DWVA 1YEPA 8GSSA 4ID0A 3U6VA 2KUCA 3KZQA 2P31A 1TU8A 4Q5NA 2O87A 4MJCA 2V2GA 3M9JA 2GLRA 1A24A 1GRXA 2NVLA 1GH2A 4MDCA 1O6JA 4EO3A 13GSA 4O5QA 5KN1A 1A2LA 3G7YA 4TR1A 2P5RA 4PURA 3ZTLA 3IHGA 1V58A 1PMTA 3TRXA 5IPHA 3GUSA 3P7XA 1IYHA 1BX9A 1JLWA 2PVOC 5CRWA 1QUWA 3VI7A 1Z3EA 3LWAA 3DGQA 4MJAA 2YOIA 4YAVA 2KP2A 2R2JA 3ME8A 4ECIA 6GSVA 2YNXA 3HY2A 2REMA 1NM3A 4IJIA 1F37A 1VGLA 3RHBA 4FQUA 1DBYA 4Z7XA 2K8SA 5IMAA 5G1LA 4O5UA 3FZ5A 3OR5A 3KTBA 1OKTA 2X99A 3M8NA 1HQOA 3NOFA 4POMA 1MDJA 3D5JA 4TR0A 4LL1B 2R37A 1FW1A 5DJLA 4NHZA 1QK8A 5ECNB 5AGYA 3DXBA 4EIQA 1Z6NA 4KA0A 1K3LA 3HJOA 1ZYNA 5ECHB 3O6TA 3GX0A 4LMVA 4YKFA 2FGXA 4BA7A 4GLTA 4JR4A 3ZIVA 2MMNA 3P90A 2N5FA 4G19A 3TRQA 3R2QA 3PPUA 3ISOA 4OO5A 4K0NA 4RI6A 2HNLA 1ZYPA 2Z9SA 4CW9A 3APOA 5ECSA 1O7UA 3C7MA 1K0OA 3PINA 3ZREA 6GSUA 3GIXA 4ULXA 4BWSA 2L5OA 2P0GA 4HQZA 5G31A 3ME7A 3ERGA 5DCGA 1ZL9A 1ERVA 3GRXA 3QOUA 3TB2A 5IMDA 1EEJA 1YZXA 3DYRA 2IIYA 2DSAA 3WT2A 4MF7A 1PX6A 4X43A 1K3OA 2A2PA 5FHIA 4JBBA 1O8XA 4JU5A 5AISA 2WDUA 4ZILA 1M2BA 4Z2TA 5CO3A 4OFNA 1SYXA 2E0QA 3ZMKA 4D73B 4XS4B 2BMXA 2DBCA 5J9CA 3KGKA 4G9HA 2YP6A 1SD8A 2AJQB 4K2XA 5ECRB 4OFTA 5LCZA 1X0RA 1SL0B 1OC9B 1OC3A 1TOFA 3FK8A 4DVCA 4XRDA 1EGRA 4WEYA 2CA8A 4GCIA 2B5YA 2HE3A 3GKXA 4GRFA 1GUMA 2PERA 4XS6A 3TJGA 2B5EA 1AC1A 2PUKC 4POBA 1HYUA 4KW6A 1GUKA 3KM6A 4I6XA 1GTIA 2P5QA 2JADA 4HUAA 6GSYA 2VCXA 3FRCA 2ZUPA 1GSEA 2NBSA 3F6FA 3GX8A 2HRKA 4K8MA 2A2RA 4OWYA 4KCEA 3MAKA 9GSSA 3WGDA 3MDKA 2X8HA 3N5OA 3TDGA 3LQ7A 1NHOA 1U87A 2F8AA 3LW9A 4GSNA 3ERWA 5KN0A 3SBCA 5J5NA 1OC8A 3EU3A 3QAGA 4ZXGA 3WYWA 5KN2A 2B5XA 2VCZA 1TRSA 4D73A 3EC3A 4MJBA 4XS4A 1OYJA 3TJFA 3KTLA 4BVYB 2V32A 2I9HA 4KE3A 3VLNA 1HNBA 2FY6A 1GSQA 4DEJA 1OC9A 4AJ6A 2XBQA 5A4UA 4QL9A 3EYTA 3UBLA 3GKMA 1FAAA 4KDXA 4IJ3A 2ES7A 2M80A 3QMXA 5F8BA 1V40A 4OCFA 2R6KA 4I2UA 1XWGA 4OO4A 3EU4A 2B1LA 3CSHA 1Z7RA 3GKNA 5CAXA 2LJAA 1SJIA 5KEJA 1ERTA 1XWBA 3EVIA 1N8JA 3LG6A 2GT6A 1T00A 3ERFA 1Z6MA 1PX7A 2CAQA 3CMIA 1XWCA 2GSTA 3HVNA 3ZFBA 11GSA 1GL8A 1NHYA 1B9XC 4I8BA 2MMOA 1TKDB 1YEXA 3FZ4A 2OBIA 5HR1A 4V1Ap 3KCMA 4KX4A 2AUVA 1TDIA 2IFQB 3J7Yk 1M9BA 1GSSA 4F9ZA 2C0EA 4TVEA 4POLA 4MJEA 3QAVA 3C1SA 4PQIA 3F3QA 3GH9A 4IGJA 2V6OA 1H75A 1XW5A 1TRWA 4IHUA 1XWAA 1A8LA 5IM9A 1G7OA 2PPTA 5HFGA 1T7PB 3FR9A 4YQMA 1GWCA 4TR4A 2GS3A 2EIOA 5IMVA 4BVYA 2LQQA 3Q19A 1EP8A 4O32A 5CP1A 1PGTA 2HYXA 4ZB9A 2IMFA 5DAKB 4OD7A 1ILOA 1AQXA 1CQHA 2DJ3A 1OE8A 3KMNA 4N11A 4DSSA 3VPTA 2K8VA 2HLSA 3N9JA 2OE1A 1JZWA 4L0WA 2H66A 2UZ8A 4ZL8A 3F6DA 1JLVA 4ECBA 4Q5RA 3D0ZA 3L78A 2JL4A 1U3IA 3TOUA 4KDYA 1E6BA 4WR4A 1EV9A 5ABRA 3TJBA 3HZ4A 2BJXA 5D9WA 5LD0A 3GN3A 3LSZA 3K8NA 1FHEA 1TU7A 1M3IA 3KMOA 4HZ4A 2IFQA 4MCUA 4KCAA 1B4QA 4I5QA 1PA3A 1AW9A 3S9FA 1V9WA 5J3RA 4F2IA 2ON7A 3GV1A 4DSQA 4RI7A 1SL1B 3TOTA 2R4VA 1FVJA 4XCSA 2WFCA 3UJ1A 3GH6A 1HNAA 2H75A 3LYKA 2PBJA 5JCUA 1PL1A 2HSMA 3QCPA 5HR3A 4P3YB 1MTCA 5DAKA 4F0BA 1FG4A 3WT1A 2XPDA 1Y6EA 4TR1B 3PGTA 3H8QA 5FWGA 2MMAA 4MZBA 1V57A 1RW1A 2VCWA 2OE0A 4GSTA 1W4VA 1GTUA 1I9DA 2H1AA 5D73A 2GZPA 3DKSA 2WJUA 4NXIA 2WB9A 1A2JA 1H4OA 2E7PA 4HJMA 2I81A 4MPGA 3FR3A 3CRUA 2H30A 3DMLA 1XWKA 1QGVA 1DSBA 3P8WA 3F4SA 5D8IA 1RQMA 2F8FA 2ZNMA 1F9MA 5CYYA 1TK5B 2H1DA 1X9MB 2H1GA 2HZFA 2QA1A 2B1KA 3ZL5A 4XS1A 1URMA 4K1FA 2YZHA 2B7JA 1YQ1A 2HZEA 2CZ3A 3GL5A 5ELGA 1SKWB 2H71A 4KSOA 5DQSA 2VOCA 4RQRA 14GSA 2R0PA 4O5RA 2DJKA 3IE3A 3BCIA 3HVXA 1A8YA 4AJ8A 2A4VA 1GSDA 2DKIA 1SYRA 2ZCTA 3MWHA 2LNSA 4MH3A 5JCWA 4FH8A 1BEDA 1N2AA 4WBRD 3KH9A 6GSXA 4O92A 4J2FA 1AQWA 3DVXA 2AV4A 4MH2A 1PKWA 5B8BA 2X8CA 2L5LA 1AAZA 2O8VB 2YJ7A 3Q74A 19GSA 5DALA 2DJJA 3M1GA 1M0UA 2HRAA 2XBIA 2PN8A 1QMVA 1PSQA 4HDEA 5GAND 3QAWA 4NAXA 2FHEA 5COHA 2HRFA 4AF2A 3ZVJA 2YWMA 2E2MA 3H93A 5GSTA 1JHBA 1OE7A 1PD21 5D93A 5E59A 1JZDA 1TI3A 4K9ZA 1ZMAA 3FZ9A 2GSRA 4LMWA 3KJYA 4PX1A 3TKQA 4BVXA 2IMDA 2H1BA 2PWJA 3DVWA 2M46A 20GSA 4NHWA 3D6IA 1U6TA 4N0VA 3UL3A 2H8LA 4ACSA 4F03A 3HVSA 2VL9A 2I3YA 4J57E 5G1KA 5JWQB 5B6NA 2GDRA 3APQA 5H5QA 1VF4A 4K0GA 1O73A 4GSSA 5EL8A 4HJ2A 2E2GA 4BIKA 1BYEA 6GSTA 3TJKA 2H0HA 3UAPA 4JEDA 4BL7B 4XRAA 5D9XA 1U3AA 1ML6A 3IR4A 3L4NA 1FOHA 5ECIB 5B8AA 2DJ2A 1RK4A 1HD2A 3NZNA 1B9YC 1O85A 3IA1A 4BPYA 1UC7A 5B7CA 2YWIA 4OMVA 4K7IA 1LU4A 1FO5A 4YAPA 1O81A 1ON4A 2CVKA 1PN0A 1T8EB 1YF0A 2H6XA 5G5FA 1SENA 1VF1A 5HR2A 3FYGA 4ZL7A 5HFIA 5KN3A 2EIQA 4ZB6A 2M72A 2GSSA 4WF5A 2GT5A 3LEFA 2OKAA 2AAWA 2HFDA 2F51A 3IAM2 3CRTA 1S3DA 2YPMA 1Z9HA 1R5AA 2HSYA 2VLUA 1JZOA 1T4ZA 1THOA 2OE3A 4L8EA 4ZBAA 2LRNA 3FEUA 5E4WA 3UARA 1XPVA 3I69A 3LYPA 4FYBA 4Z2UA 3HCZA 1AQVA 1M2DA 2WRTA 3GHAA 1XG8A 4I2TA 1TRUA 3MNGA 2HT9A 4HU9A 4E8HA 3GSSA 3UBKA 3DIEA 4WR5A 4OCEA 4BL7A 3PR8A 2TRXA 2AYTA 1A23A 1SK2A 1B48A 3GFKA 3EPTA 3DEXA 3HJMA 1MDIA 3LORA 1F2EA 2C3TA 2O7KA 3GNJA 2OACA 1X5DA 5F07A 3UMAA 2DMMA 2MZCA 3HZ8A 3UEMA 5KOXA 3EWLA 2CX4A 2R0CA 1F3AA 4EIPA 3VI5A 4DSRA 2L4QA 3HVVA 2DJ0A 4GQFA 4ML6A 4RUVA 1UVZA 1MEKA 2R3XA 4NWYA 5ECLB 4AJ7A 3TJJA 4EVMA 5B6MA 1NSWA 3IOSA 1V98A 1A0FA 3H4KA 4TR3A 2H0IA 4H86A 3E3EA 3F4RA 1TW9A 1TJDA 3IV4A 2LS5A 4FO5A 4DSSB 2LRCA 3LXZA 5ID2B 5G30A 2X49A 4GF0A 1K0MA 2CQ9A 2XC2A 4HI7A 2FWHA 1XXUA 4YKGA 5HR0A 2HI7A 5HQPA 4V2NA 2N5AA 2L4CA 3HYPA 12GSA 2DJ1A 2DLXA 1QFNA 4WXTA 5ELAA 1TK8B 2R5GA 5EVOA 2IL3A 4AGSA 3CBUA 5CRHA 5DJMA 1HNCA 2VLVA 3A2WA 3W8JA 2DMLA 2IMEA 1VF3A 2ALBA 2GZZA 5A4VA 3ZFLA 1Q4JA 3GL3A 3WGXA 2LTKA 2C3NA 1XVQA 2XPEA 3TKRA 4KDUA 4KH7A 2FNOA 3F4TA 1M3JA 2V6KA 4ICYA 5LNKe 3NIVA 4YH2A 2OBKA 2JZRA 2MBTA 3G7IA 4MABA 3RDWA 3JCML 1ABAA 2FA4A 4IBPA 1M7TA 4ILFA 3MSZA 3VWXA 2LV3A 2O89A 2IJYA 1SK1A 5BMUA 3ZVJD 1TRVA 2RIIA 4V1Ag 3P2AA 2TIRA 4K5RA 2QA2A 2F9SA 3D21A 3IAS2 4WETA 4G2EA 3KEBA 4TKYA 5ECMB 5ID2A 4G10A 2VCVA 4HZ2A 3ZYWA 2VUPA 5DVBA 2LSTA 2C1YA 3QR6A 4IS0A 4CY8A 1F6MC 3ZMLA 3F8UA 1GNEA 1EGOA 2YCDA 4HOJA 4NMUA
chains in the Genus database with same CATH topology
1R26A 1ZCPA 3VURA 2KP1A 1V2AA 3F9UA 1NW2A 3KP8A 2H6YA 2LJRA 3GMFA 5ECPB 1C72A 4GTUA 2WCIA 3IK7A 5ECQB 4POKA 3I6AA 2HZEB 2RUEA 1ZYQB 1CQGA 4YQUA 3M9KA 2JSZA 1SKRB 1A2MA 1OKDA 3L9SA 1J0FA 5KOWA 2LEGA 2L59A 4EL1A 1EWXA 2IN3A 2C8UA 3A2XA 1GTAA 4O7HA 4G0KA 4KUNA 2RM5A 3MIXA 1T4YA 1WIKA 5BRTA 3RHCA 5D9VA 2VL3A 5JWRB 3US3A 3UVHA 1ERWA 4JR6A 3HXSA 4MNNA 2LNTA 4MZWA 2CVDA 4HQSA 4V2MA 2AB6A 5F06A 4WBJA 3J7Yb 4EE0A 1WOUA 3EINA 5DALB 1FB6A 3CSIA 4HEA2 1AXDA 3CTGA 1WPIA 1EEMA 3RPPA 4QQ7A 2L6CA 2OJLA 3C71A 2H76A 4PNGA 2CX3A 3TKSA 3WD6A 1T1VA 3IK9A 3KP9A 4PUAA 4FYCA 5H5RA 1KEBA 1JZRA 1K0NA 1T3BA 4Z2RA 2IWTA 1WMJA 4Q5FA 5HFKA 5CRGA 4IP6A 3CTFA 4MPFA 2H6ZA 4BVXB 4X0XA 1QQ2A 3LGCA 2X64A 2H01A 2GQLA 1WE0A 1BG5A 4USSA 1OAZA 1GTBA 2YV7A 2C3QA 3QDNA 2VM1A 5CREA 3EMXA 2VCQA 1M9AA 4L0UA 5IO0A 5C00A 3VK9A 4NV2A 2JU5A 4EKZA 3QFBC 1XOAA 2H19A 4K7OA 3E9JB 3M0FA 2G0FA 2K6VA 3BOAA 3FR6A 4PTSA 2IPAA 2VD0A 4LL4B 1WJKA 2YWNA 2CV4A 1DE2A 2FD3A 3TKPA 4KB3A 1Y25A 1SKSB 2A2SA 2NDOA 1GP1A 2I1UA 5A5KA 1O8WA 4IKHA 1XFLA 2G2QA 2V41A 5AN1A 3MYDA 4L5LA 5D9TA 3D4MA 4PGTA 3GYKA 2I4AA 3HHVA 2EIRA 4CHSA 3E0UA 1R5PA 3H79A 1WWJA 4WKWA 5EPFA 3LXTA 3I9V2 3DRNA 2R0GA 1R4WA 3QPMA 2CZ2A 4EUYA 4EDZA 2B6MA 3F3RA 3GKKA 2DIZA 4EXJA 2H72A 5IMCA 1TP9A 2PVQA 4IVFA 4G0LA 2ON5A 4EDYA 2QC7A 5IPGA 1K0BA 2YWOA 1USBA 1YF1A 5G5EA 2KOKA 2K18A 2GQMA 2VL2A 2WGRA 1B4PA 2X8GA 4F0CA 22GSA 2RM6A 1X9SB 1SL2B 1Q98A 4PXOA 4XIHA 5IMZA 4X1UA 3QFAC 1ST9A 2FA8A 1K3YA 3CXGA 2V1MA 2GGTA 3A2VA 4KNDA 1UA5A 3GURA 1S3AA 3TCOA 4EC0A 2FWGA 1G7EA 17GSA 3FW2A 1TI1A 2QGVA 2C0FA 1EOHA 2YJHA 1XW9A 4TXVA 4MF5A 2JACA 4KGIA 1A0RP 3D4TA 1WRYA 5DBQA 3IHQA 1YKCA 2IMIA 2HXKA 2EC4A 3W8SA 3VWVA 1S3CA 1J9BA 1FOVA 2RUFA 4MZCA 3HKRA 2H74A 2YZUA 2X4AA 2DC5A 3BJ5A 4G0IA 5AIVA 4KAEA 2FCHA 2FUG2 1QXHA 3FMWA 2L6DA 3VWUA 1EV4A 5AIXA 5CRDA 3PH9A 4K5SA 4N10A 4MMMA 1DUGA 2JZSA 3RAZA 5EY6A 4CDOA 16GSA 3TKSC 3KD0A 3ZZXA 2HSHA 1THXA 5IOWA 2C0DA 2QKEA 2MYGA 4LLRA 1K0AA 4MF6A 5IQYA 2JZTA 1K0DA 4L5OA 2FWEA 3R3EA 2GQKA 1I5GA 2LUSA 6GSWA 2MBSA 4CY6A 4TOPA 1GLQA 2GZYA 1U88A 1G0TA 3C1RA 2QSIA 4TN8A 1MDKA 3L9VA 3QD9A 3A5WA 4QL7A 1K0CA 4F82A 1YDKA 4ZIJA 1BQ7A 2YN1A 2YANA 4ZB8A 3HJPA 5IMFA 2BTOT 1ERUA 1R7HA 3ZRDA 2NPBA 1ACVA 1AIUA 3I43A 5DDLA 1KBNA 3IRAA 1MD3A 3EE2A 1J08A 4JE1A 4PQ1A 2VLTA 4ML1A 1PL2A 3W6GA 5DQYA 1G6WA 3TUEA 5A4WA 1YKAA 2J9HA 3RBTA 5IO2A 2H73A 2LKUA 4ECJA 5F0GA 5J4UA 3LFLA 2B3SA 5G2ZA 1XVWA 1GLPA 2AHEA 4MK3A 4ISDA 1GSFA 3Q6OA 2VD1A 2KLXA 1LJRA 3EURA 5ECKB 2OA7A 1M99A 2N5BA 4GWRA 4MP4A 5L71A 4TRXA 1BJXA 4GQCA 2D2ZA 1JFUA 1GULA 2IMKA 1XW6A 4IQAA 1IYIA 2CT6A 5GAPD 1E2YA 1M2AA 5GZZB 1B8XA 3GA4A 3LJRA 3L9UA 4N0ZA 5JWOB 3BD2A 1SK0A 3ED3A 1G6YA 4K7NA 2H0GA 5IOXA 4PUFC 5C04A 3HDCA 5INYA 3ZLPA 4PQHA 4IQ1A 1ZZYA 3HD5A 4WF4A 1X5EA 2RLIA 1LBKA 4X4JA 1YJ6A 2L57A 3KIJA 1PKZA 3VWWA 3L0HA 1XCCA 5ENUA 2WZ9A 1ZYEA 2VL2C 2FLSA 2KHPA 5J41A 2B7KA 3FHKA 2C4JA 3V1WA 4TXOB 2A4HA 2FWFA 4IP1A 5D96A 4HU7A 3FKFA 3F63A 3IXRA 5H5SA 3VPQA 4MLYA 4ZBDA 5F05A 4KSMA 4N30A 5GSSA 2VM2A 4ZL9A 1FVKA 1X5CA 4V2LA 4PNFA 4E8EA 2VIMA 1VF2A 3TRPA 1UN2A 4BWQA 5CNWA 5JCGA 2PMTA 1EZKA 2J23A 2MMZA 3EMPA 1EP7A 2GSQA 3IDVA 1TTZA 2C80A 2O85A 2TRCP 18GSA 1VRSD 3BCKA 1XIYA 3GTUB 4TW5A 1Z7PA 1KTEA 3CYNA 1XBSA 4JRRA 2C0GA 1GSUA 2DKHA 3M3MA 4YQVA 1SJ6A 3WGEA 4Q5QA 1MD4A 2GVPA 4JZQA 3IC8A 2PGTA 1TK0B 2LRTA 3IBHA 3UIWA 4LA1A 1SU9A 3UOMA 4OFMA 1OVNA 4EF0A 4TXOA 2VAFA 2JSYA 1SJZA 3VFIA 4IN0A 4ZBBA 3TGZA 1X9WB 2OADA 3BBYA 3GSTA 4GXZA 4K6XA 4XHMA 2K9FA 2LJKA 3F0IA 4J56E 3ZIJA 5IIZA 1GSYA 3G9BA 3H1NA 3A3TA 3RPNA 4A5PA 2H70A 3APSA 2HRNA 3TKSE 3A5IA 4FYUA 4I97A 1Z5YE 4NV5A 3CSJA 10GSA 2F3MA 2YV9A 3SWLA 2WULA 2XHFA 3O76A 3FZAA 3O3TA 4KF9A 3UVTA 1GUHA 5J9BA 1TXXA 1XZOA 1WP0A 4NPBA 3C73A 1ZOFA 2LQOA 4IW9A 2NTOA 1ZGNA 2CVBA 3DD3A 3GTUA 4HS1A 3KH7A 3Q18A 1PN9A 3AY8A 1EOGA 1YY7A 2PU9C 6GSSA 2VCTA 1FB0A 4XTSA 1BAYA 4K2DA 5FT3A 2WS2A 3IC4A 3G7JA 3U5RE 4RQXA 7GSSA 1GNWA 3FY7A 3C8EA 4FIWA 2CAIA 2VO4A 3HA9A 1XOBA 1SD9A 4IELA 1F3BA 1KNGA 2DIYA 3D22A 1PQNA 1DE1A 4MA9A 4ECCA 3KXOA 5ECOB 3ZITA 2GTUA 1W89A 1PRXA 1AUCA 3IPZA 5DCHA 3DWVA 1YEPA 8GSSA 4ID0A 3U6VA 2KUCA 3KZQA 2P31A 1TU8A 4Q5NA 2O87A 4MJCA 2V2GA 3M9JA 2GLRA 1A24A 1GRXA 2NVLA 1GH2A 4MDCA 1O6JA 4EO3A 13GSA 4O5QA 5KN1A 1A2LA 3G7YA 4TR1A 2P5RA 4PURA 3ZTLA 3IHGA 1V58A 1PMTA 3TRXA 5IPHA 3GUSA 3P7XA 1IYHA 1BX9A 1JLWA 2PVOC 5CRWA 1QUWA 3VI7A 1Z3EA 3LWAA 3DGQA 4MJAA 2YOIA 4YAVA 2KP2A 2R2JA 3ME8A 4ECIA 6GSVA 2YNXA 3HY2A 2REMA 1NM3A 4IJIA 1F37A 1VGLA 3RHBA 4FQUA 1DBYA 4Z7XA 2K8SA 5IMAA 5G1LA 4O5UA 3FZ5A 3OR5A 3KTBA 1OKTA 2X99A 3M8NA 1HQOA 3NOFA 4POMA 1MDJA 3D5JA 4TR0A 4LL1B 2R37A 1FW1A 5DJLA 4NHZA 1QK8A 5ECNB 5AGYA 3DXBA 4EIQA 1Z6NA 4KA0A 1K3LA 3HJOA 1ZYNA 5ECHB 3O6TA 3GX0A 4LMVA 4YKFA 2FGXA 4BA7A 4GLTA 4JR4A 3ZIVA 2MMNA 3P90A 2N5FA 4G19A 3TRQA 3R2QA 3PPUA 3ISOA 4OO5A 4K0NA 4RI6A 2HNLA 1ZYPA 2Z9SA 4CW9A 3APOA 5ECSA 1O7UA 3C7MA 1K0OA 3PINA 3ZREA 6GSUA 3GIXA 4ULXA 4BWSA 2L5OA 2P0GA 4HQZA 5G31A 3ME7A 3ERGA 5DCGA 1ZL9A 1ERVA 3GRXA 3QOUA 3TB2A 5IMDA 1EEJA 1YZXA 3DYRA 2IIYA 2DSAA 3WT2A 4MF7A 1PX6A 4X43A 1K3OA 2A2PA 5FHIA 4JBBA 1O8XA 4JU5A 5AISA 2WDUA 4ZILA 1M2BA 4Z2TA 5CO3A 4OFNA 1SYXA 2E0QA 3ZMKA 4D73B 4XS4B 2BMXA 2DBCA 5J9CA 3KGKA 4G9HA 2YP6A 1SD8A 2AJQB 4K2XA 5ECRB 4OFTA 5LCZA 1X0RA 1SL0B 1OC9B 1OC3A 1TOFA 3FK8A 4DVCA 4XRDA 1EGRA 4WEYA 2CA8A 4GCIA 2B5YA 2HE3A 3GKXA 4GRFA 1GUMA 2PERA 4XS6A 3TJGA 2B5EA 1AC1A 2PUKC 4POBA 1HYUA 4KW6A 1GUKA 3KM6A 4I6XA 1GTIA 2P5QA 2JADA 4HUAA 6GSYA 2VCXA 3FRCA 2ZUPA 1GSEA 2NBSA 3F6FA 3GX8A 2HRKA 4K8MA 2A2RA 4OWYA 4KCEA 3MAKA 9GSSA 3WGDA 3MDKA 2X8HA 3N5OA 3TDGA 3LQ7A 1NHOA 1U87A 2F8AA 3LW9A 4GSNA 3ERWA 5KN0A 3SBCA 5J5NA 1OC8A 3EU3A 3QAGA 4ZXGA 3WYWA 5KN2A 2B5XA 2VCZA 1TRSA 4D73A 3EC3A 4MJBA 4XS4A 1OYJA 3TJFA 3KTLA 4BVYB 2V32A 2I9HA 4KE3A 3VLNA 1HNBA 2FY6A 1GSQA 4DEJA 1OC9A 4AJ6A 2XBQA 5A4UA 4QL9A 3EYTA 3UBLA 3GKMA 1FAAA 4KDXA 4IJ3A 2ES7A 2M80A 3QMXA 5F8BA 1V40A 4OCFA 2R6KA 4I2UA 1XWGA 4OO4A 3EU4A 2B1LA 3CSHA 1Z7RA 3GKNA 5CAXA 2LJAA 1SJIA 5KEJA 1ERTA 1XWBA 3EVIA 1N8JA 3LG6A 2GT6A 1T00A 3ERFA 1Z6MA 1PX7A 2CAQA 3CMIA 1XWCA 2GSTA 11GSA 3ZFBA 1GL8A 1NHYA 1B9XC 4I8BA 2MMOA 1TKDB 1YEXA 3FZ4A 2OBIA 5HR1A 4V1Ap 3KCMA 4KX4A 2AUVA 1TDIA 2IFQB 3J7Yk 1M9BA 1GSSA 4F9ZA 2C0EA 4TVEA 4POLA 4MJEA 3QAVA 3C1SA 4PQIA 3F3QA 3GH9A 4IGJA 2V6OA 1H75A 1XW5A 1TRWA 4IHUA 1XWAA 1A8LA 5IM9A 1G7OA 2PPTA 5HFGA 1T7PB 3FR9A 4YQMA 1GWCA 4TR4A 2GS3A 2EIOA 5IMVA 4BVYA 2LQQA 3Q19A 1EP8A 4O32A 5CP1A 1PGTA 2HYXA 4ZB9A 2IMFA 5DAKB 4OD7A 1ILOA 1AQXA 1CQHA 2DJ3A 1OE8A 3KMNA 4N11A 4DSSA 3VPTA 2K8VA 2HLSA 3N9JA 2OE1A 1JZWA 4L0WA 2H66A 2UZ8A 4ZL8A 3F6DA 1JLVA 4ECBA 4Q5RA 3D0ZA 3L78A 2JL4A 1U3IA 3TOUA 4KDYA 1E6BA 4WR4A 1EV9A 5ABRA 3TJBA 3HZ4A 2BJXA 5D9WA 5LD0A 3GN3A 3LSZA 3K8NA 1FHEA 1TU7A 3KMOA 4HZ4A 2IFQA 4MCUA 4KCAA 1B4QA 4I5QA 1PA3A 1AW9A 3S9FA 1V9WA 5J3RA 4F2IA 2ON7A 3GV1A 4DSQA 4RI7A 1SL1B 3TOTA 2R4VA 1FVJA 4XCSA 2WFCA 3UJ1A 3GH6A 1HNAA 2H75A 3LYKA 2PBJA 5JCUA 1PL1A 2HSMA 3QCPA 5HR3A 4P3YB 1MTCA 5DAKA 4F0BA 1FG4A 3WT1A 2XPDA 1Y6EA 4TR1B 3PGTA 3H8QA 5FWGA 2MMAA 4MZBA 1V57A 1RW1A 2VCWA 2OE0A 4GSTA 1W4VA 1GTUA 1I9DA 5D73A 2H1AA 2GZPA 3DKSA 2WJUA 4NXIA 2WB9A 1A2JA 1H4OA 2E7PA 4HJMA 2I81A 4MPGA 3FR3A 3CRUA 2H30A 3DMLA 1XWKA 1QGVA 1DSBA 3P8WA 3F4SA 5D8IA 1RQMA 2F8FA 2ZNMA 1F9MA 5CYYA 1TK5B 2H1DA 1X9MB 2H1GA 2HZFA 2QA1A 2B1KA 3ZL5A 4XS1A 1URMA 4K1FA 2YZHA 2B7JA 1YQ1A 2HZEA 2CZ3A 3GL5A 5ELGA 1SKWB 2H71A 4KSOA 5DQSA 2VOCA 4RQRA 14GSA 2R0PA 4O5RA 2DJKA 3IE3A 3BCIA 3HVXA 1A8YA 4AJ8A 2A4VA 1GSDA 2DKIA 1SYRA 2ZCTA 3MWHA 2LNSA 4MH3A 5JCWA 4FH8A 1BEDA 1N2AA 4WBRD 3KH9A 6GSXA 4O92A 4J2FA 1AQWA 3DVXA 2AV4A 4MH2A 1PKWA 5B8BA 2X8CA 2L5LA 1AAZA 2O8VB 2YJ7A 3Q74A 19GSA 5DALA 2DJJA 3M1GA 1M0UA 2HRAA 2XBIA 2PN8A 1QMVA 1PSQA 4HDEA 5GAND 3QAWA 4NAXA 2FHEA 5COHA 2HRFA 4AF2A 3ZVJA 2YWMA 2E2MA 3H93A 5GSTA 1JHBA 1OE7A 1PD21 5D93A 5E59A 1JZDA 1TI3A 4K9ZA 1ZMAA 3FZ9A 2GSRA 4LMWA 3KJYA 4PX1A 3TKQA 4BVXA 2IMDA 2H1BA 2PWJA 3DVWA 2M46A 20GSA 4NHWA 3D6IA 1U6TA 4N0VA 3UL3A 2H8LA 4ACSA 4F03A 3HVSA 2VL9A 2I3YA 4J57E 5G1KA 5JWQB 5B6NA 2GDRA 3APQA 5H5QA 1VF4A 4K0GA 1O73A 4GSSA 5EL8A 4HJ2A 2E2GA 1BYEA 6GSTA 3TJKA 2H0HA 3UAPA 4JEDA 4BL7B 4XRAA 5D9XA 1U3AA 1ML6A 3IR4A 3L4NA 1FOHA 5ECIB 5B8AA 2DJ2A 1RK4A 1HD2A 3NZNA 1B9YC 1O85A 3IA1A 4BPYA 1UC7A 5B7CA 2YWIA 4OMVA 4K7IA 1LU4A 1FO5A 4YAPA 1O81A 1ON4A 2CVKA 1PN0A 1T8EB 1YF0A 2H6XA 5G5FA 1SENA 1VF1A 5HR2A 3FYGA 4ZL7A 5HFIA 5KN3A 2EIQA 4ZB6A 2M72A 2GSSA 4WF5A 2GT5A 3LEFA 2OKAA 2AAWA 2HFDA 2F51A 3IAM2 3CRTA 1S3DA 2YPMA 1Z9HA 1R5AA 2HSYA 2VLUA 1JZOA 1T4ZA 1THOA 2OE3A 4L8EA 4ZBAA 2LRNA 3FEUA 5E4WA 3UARA 1XPVA 3I69A 3LYPA 4FYBA 4Z2UA 3HCZA 1AQVA 1M2DA 2WRTA 3GHAA 4I2TA 1TRUA 3MNGA 2HT9A 4HU9A 4E8HA 3GSSA 3UBKA 3DIEA 4WR5A 4OCEA 4BL7A 3PR8A 2TRXA 2AYTA 1A23A 1SK2A 1B48A 3GFKA 3EPTA 3DEXA 3HJMA 1MDIA 3LORA 1F2EA 2C3TA 2O7KA 3GNJA 2OACA 1X5DA 5F07A 3UMAA 2DMMA 2MZCA 3HZ8A 3UEMA 5KOXA 3EWLA 2CX4A 2R0CA 1F3AA 4EIPA 3VI5A 4DSRA 2L4QA 3HVVA 2DJ0A 4GQFA 4ML6A 4RUVA 1UVZA 1MEKA 2R3XA 4NWYA 5ECLB 4AJ7A 3TJJA 4EVMA 5B6MA 1NSWA 3IOSA 1V98A 1A0FA 3H4KA 4TR3A 2H0IA 4H86A 3E3EA 3F4RA 1TW9A 1TJDA 3IV4A 2LS5A 4FO5A 4DSSB 2LRCA 3LXZA 5ID2B 5G30A 2X49A 4GF0A 1K0MA 2CQ9A 2XC2A 4HI7A 2FWHA 1XXUA 4YKGA 5HR0A 2HI7A 5HQPA 4V2NA 2N5AA 2L4CA 3HYPA 12GSA 2DJ1A 2DLXA 1QFNA 4WXTA 5ELAA 1TK8B 2R5GA 5EVOA 2IL3A 4AGSA 3CBUA 5CRHA 5DJMA 1HNCA 2VLVA 3A2WA 3W8JA 2DMLA 2IMEA 1VF3A 2ALBA 2GZZA 5A4VA 3ZFLA 1Q4JA 3GL3A 3WGXA 2LTKA 2C3NA 1XVQA 2XPEA 3TKRA 4KDUA 4KH7A 2FNOA 3F4TA 2V6KA 4ICYA 5LNKe 3NIVA 4YH2A 2OBKA 2JZRA 2MBTA 3G7IA 4MABA 3RDWA 3JCML 1ABAA 2FA4A 4IBPA 1M7TA 4ILFA 3MSZA 3VWXA 2LV3A 2O89A 2IJYA 1SK1A 5BMUA 3ZVJD 1TRVA 2RIIA 4V1Ag 3P2AA 2TIRA 4K5RA 2QA2A 2F9SA 3D21A 3IAS2 4WETA 4G2EA 3KEBA 4TKYA 5ECMB 5ID2A 4G10A 2VCVA 4HZ2A 3ZYWA 2VUPA 5DVBA 2LSTA 2C1YA 3QR6A 4IS0A 4CY8A 1F6MC 3ZMLA 3F8UA 1GNEA 1EGOA 2YCDA 4HOJA 4NMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R26 A;  1ZCP A;  3VUR A;  2KP1 A;  1V2A A;  3F9U A;  1NW2 A;  3KP8 A;  2H6Y A;  2LJR A;  3GMF A;  5ECP B;  1C72 A;  4GTU A;  2WCI A;  3IK7 A;  5ECQ B;  4POK A;  3I6A A;  2HZE B;  2RUE A;  1ZYQ B;  1CQG A;  4YQU A;  3M9K A;  2JSZ A;  1SKR B;  1A2M A;  1OKD A;  3L9S A;  1J0F A;  2LEG A;  2L59 A;  4EL1 A;  1EWX A;  2IN3 A;  2C8U A;  3A2X A;  1GTA A;  4O7H A;  4KUN A;  2RM5 A;  1T4Y A;  1WIK A;  3RHC A;  5D9V A;  2VL3 A;  5JWR B;  3US3 A;  3UVH A;  1ERW A;  4JR6 A;  3HXS A;  2LNT A;  4MZW A;  2CVD A;  4HQS A;  4V2M A;  2AB6 A;  5F06 A;  4WBJ A;  3J7Y b;  4EE0 A;  1WOU A;  3EIN A;  5DAL B;  1FB6 A;  3CSI A;  4HEA 2;  1AXD A;  3CTG A;  1WPI A;  1EEM A;  3RPP A;  4QQ7 A;  2L6C A;  2OJL A;  3C71 A;  2H76 A;  4PNG A;  2CX3 A;  3TKS A;  3WD6 A;  1T1V A;  3IK9 A;  3KP9 A;  4PUA A;  4FYC A;  5H5R A;  1KEB A;  1JZR A;  1K0N A;  1T3B A;  2IWT A;  1WMJ A;  4Q5F A;  5HFK A;  5CRG A;  4IP6 A;  3CTF A;  4MPF A;  2H6Z A;  4X0X A;  1QQ2 A;  3LGC A;  2X64 A;  2H01 A;  2GQL A;  1WE0 A;  1BG5 A;  1OAZ A;  1GTB A;  2YV7 A;  2C3Q A;  3QDN A;  2VM1 A;  5CRE A;  3EMX A;  2VCQ A;  1M9A A;  4L0U A;  5IO0 A;  5C00 A;  3VK9 A;  4NV2 A;  2JU5 A;  4EKZ A;  3QFB C;  1XOA A;  2H19 A;  4K7O A;  3E9J B;  3M0F A;  2G0F A;  2K6V A;  3BOA A;  3FR6 A;  2IPA A;  2VD0 A;  4LL4 B;  1WJK A;  2YWN A;  2CV4 A;  1DE2 A;  2FD3 A;  3TKP A;  4KB3 A;  1Y25 A;  1SKS B;  2A2S A;  2NDO A;  1GP1 A;  2I1U A;  5A5K A;  1O8W A;  4IKH A;  1XFL A;  2G2Q A;  5AN1 A;  2V41 A;  4L5L A;  5D9T A;  3D4M A;  4PGT A;  3GYK A;  2I4A A;  3HHV A;  2EIR A;  4CHS A;  3E0U A;  1R5P A;  3H79 A;  1WWJ A;  4WKW A;  5EPF A;  3LXT A;  3I9V 2;  3DRN A;  1R4W A;  3QPM A;  2CZ2 A;  4EUY A;  4EDZ A;  2B6M A;  3F3R A;  3GKK A;  2DIZ A;  4EXJ A;  2H72 A;  5IMC A;  1TP9 A;  2PVQ A;  4IVF A;  2ON5 A;  4EDY A;  2QC7 A;  5IPG A;  1K0B A;  2YWO A;  1USB A;  1YF1 A;  5G5E A;  2KOK A;  2K18 A;  2GQM A;  2VL2 A;  2WGR A;  1B4P A;  2X8G A;  4F0C A;  22GS A;  2RM6 A;  1X9S B;  1SL2 B;  1Q98 A;  4PXO A;  4XIH A;  5IMZ A;  4X1U A;  3QFA C;  1ST9 A;  2FA8 A;  1K3Y A;  3CXG A;  2V1M A;  2GGT A;  3A2V A;  4KND A;  1UA5 A;  3GUR A;  1S3A A;  3TCO A;  4EC0 A;  2FWG A;  1G7E A;  17GS A;  3FW2 A;  1TI1 A;  2QGV A;  2C0F A;  1EOH A;  2YJH A;  1XW9 A;  4TXV A;  4MF5 A;  2JAC A;  4KGI A;  1A0R P;  3D4T A;  1WRY A;  5DBQ A;  3IHQ A;  1YKC A;  2IMI A;  2HXK A;  2EC4 A;  3W8S A;  3VWV A;  1S3C A;  1J9B A;  1FOV A;  2RUF A;  4MZC A;  3HKR A;  2H74 A;  2YZU A;  2DC5 A;  3BJ5 A;  5AIV A;  4KAE A;  2FCH A;  2FUG 2;  1QXH A;  2L6D A;  3VWU A;  1EV4 A;  5AIX A;  5CRD A;  3PH9 A;  4N10 A;  3RAZ A;  4MMM A;  1DUG A;  2JZS A;  5EY6 A;  4CDO A;  16GS A;  3TKS C;  3KD0 A;  3ZZX A;  2HSH A;  1THX A;  5IOW A;  2C0D A;  2QKE A;  2MYG A;  4LLR A;  1K0A A;  4MF6 A;  5IQY A;  2JZT A;  1K0D A;  4L5O A;  2FWE A;  2GQK A;  1I5G A;  2LUS A;  6GSW A;  2MBS A;  4TOP A;  1GLQ A;  2GZY A;  1U88 A;  1G0T A;  3C1R A;  2QSI A;  4TN8 A;  1MDK A;  3L9V A;  3QD9 A;  3A5W A;  4QL7 A;  1K0C A;  4F82 A;  1YDK A;  4ZIJ A;  1BQ7 A;  2YN1 A;  2YAN A;  4ZB8 A;  3HJP A;  5IMF A;  2BTO T;  1ERU A;  1R7H A;  3ZRD A;  2NPB A;  1ACV A;  1AIU A;  5DDL A;  3I43 A;  1KBN A;  3IRA A;  1MD3 A;  3EE2 A;  1J08 A;  4JE1 A;  4PQ1 A;  2VLT A;  4ML1 A;  1PL2 A;  3W6G A;  5DQY A;  1G6W A;  3TUE A;  5A4W A;  1YKA A;  2J9H A;  3RBT A;  5IO2 A;  2H73 A;  2LKU A;  4ECJ A;  5F0G A;  5J4U A;  3LFL A;  2B3S A;  5G2Z A;  1XVW A;  1GLP A;  2AHE A;  4MK3 A;  4ISD A;  1GSF A;  3Q6O A;  2VD1 A;  2KLX A;  1LJR A;  3EUR A;  5ECK B;  2OA7 A;  1M99 A;  2N5B A;  4GWR A;  4MP4 A;  5L71 A;  4TRX A;  1BJX A;  4GQC A;  2D2Z A;  1JFU A;  1GUL A;  2IMK A;  1XW6 A;  4IQA A;  1IYI A;  2CT6 A;  5GAP D;  1E2Y A;  1M2A A;  5GZZ B;  1B8X A;  3GA4 A;  3LJR A;  3L9U A;  4N0Z A;  5JWO B;  3BD2 A;  1SK0 A;  3ED3 A;  1G6Y A;  4K7N A;  2H0G A;  5IOX A;  4PUF C;  5C04 A;  3HDC A;  5INY A;  3ZLP A;  4PQH A;  4IQ1 A;  1ZZY A;  3HD5 A;  4WF4 A;  1X5E A;  2RLI A;  1LBK A;  1YJ6 A;  2L57 A;  3KIJ A;  1PKZ A;  3VWW A;  3L0H A;  1XCC A;  5ENU A;  2WZ9 A;  1ZYE A;  2VL2 C;  2FLS A;  2KHP A;  5J41 A;  2B7K A;  3FHK A;  2C4J A;  3V1W A;  4TXO B;  2FWF A;  4IP1 A;  5D96 A;  4HU7 A;  3FKF A;  3F63 A;  3IXR A;  5H5S A;  3VPQ A;  4MLY A;  4ZBD A;  5F05 A;  4KSM A;  4N30 A;  5GSS A;  2VM2 A;  4ZL9 A;  1FVK A;  1X5C A;  4V2L A;  4PNF A;  4E8E A;  2VIM A;  1VF2 A;  3TRP A;  1UN2 A;  4BWQ A;  5CNW A;  5JCG A;  2PMT A;  1EZK A;  2J23 A;  2MMZ A;  3EMP A;  1EP7 A;  2GSQ A;  3IDV A;  1TTZ A;  2C80 A;  2O85 A;  2TRC P;  18GS A;  1VRS D;  3BCK A;  1XIY A;  3GTU B;  4TW5 A;  1Z7P A;  1KTE A;  3CYN A;  1XBS A;  4JRR A;  2C0G A;  1GSU A;  3M3M A;  4YQV A;  1SJ6 A;  3WGE A;  4Q5Q A;  1MD4 A;  2GVP A;  4JZQ A;  2PGT A;  1TK0 B;  2LRT A;  3IBH A;  3UIW A;  4LA1 A;  1SU9 A;  3UOM A;  4OFM A;  1OVN A;  4EF0 A;  4TXO A;  2VAF A;  2JSY A;  1SJZ A;  3VFI A;  4IN0 A;  4ZBB A;  3TGZ A;  1X9W B;  2OAD A;  3BBY A;  3GST A;  4GXZ A;  4K6X A;  4XHM A;  2K9F A;  2LJK A;  3F0I A;  4J56 E;  3ZIJ A;  5IIZ A;  1GSY A;  3G9B A;  3H1N A;  3A3T A;  3RPN A;  2H70 A;  3APS A;  2HRN A;  3TKS E;  4FYU A;  4I97 A;  1Z5Y E;  4NV5 A;  3CSJ A;  10GS A;  2F3M A;  2YV9 A;  3SWL A;  2WUL A;  2XHF A;  3O76 A;  3FZA A;  3O3T A;  3UVT A;  1GUH A;  5J9B A;  1TXX A;  1XZO A;  1WP0 A;  4NPB A;  3C73 A;  1ZOF A;  2LQO A;  4IW9 A;  2NTO A;  1ZGN A;  2CVB A;  3DD3 A;  3GTU A;  4HS1 A;  3KH7 A;  3Q18 A;  1PN9 A;  3AY8 A;  1EOG A;  1YY7 A;  2PU9 C;  6GSS A;  2VCT A;  1FB0 A;  4XTS A;  1BAY A;  4K2D A;  5FT3 A;  2WS2 A;  3IC4 A;  3G7J A;  3U5R E;  4RQX A;  7GSS A;  1GNW A;  3FY7 A;  3C8E A;  4FIW A;  2CAI A;  2VO4 A;  3HA9 A;  1XOB A;  1SD9 A;  4IEL A;  1F3B A;  1KNG A;  2DIY A;  3D22 A;  1PQN A;  1DE1 A;  4MA9 A;  4ECC A;  3KXO A;  5ECO B;  3ZIT A;  2GTU A;  1W89 A;  1PRX A;  1AUC A;  3IPZ A;  5DCH A;  3DWV A;  1YEP A;  8GSS A;  4ID0 A;  3U6V A;  2KUC A;  3KZQ A;  2P31 A;  1TU8 A;  4Q5N A;  2O87 A;  4MJC A;  2V2G A;  3M9J A;  2GLR A;  1A24 A;  1GRX A;  2NVL A;  1GH2 A;  4MDC A;  1O6J A;  4EO3 A;  13GS A;  5KN1 A;  1A2L A;  3G7Y A;  4TR1 A;  2P5R A;  4PUR A;  3ZTL A;  1V58 A;  1PMT A;  3TRX A;  5IPH A;  3GUS A;  3P7X A;  1IYH A;  1BX9 A;  1JLW A;  2PVO C;  5CRW A;  1QUW A;  3VI7 A;  1Z3E A;  3LWA A;  3DGQ A;  4MJA A;  2YOI A;  4YAV A;  2KP2 A;  2R2J A;  3ME8 A;  4ECI A;  6GSV A;  2YNX A;  3HY2 A;  2REM A;  1NM3 A;  4IJI A;  1F37 A;  1VGL A;  3RHB A;  1DBY A;  4Z7X A;  2K8S A;  5IMA A;  5G1L A;  3FZ5 A;  3OR5 A;  3KTB A;  1OKT A;  2X99 A;  3M8N A;  1HQO A;  3NOF A;  4POM A;  1MDJ A;  3D5J A;  4TR0 A;  4LL1 B;  2R37 A;  1FW1 A;  5DJL A;  4NHZ A;  1QK8 A;  5ECN B;  5AGY A;  3DXB A;  1Z6N A;  4KA0 A;  1K3L A;  3HJO A;  5ECH B;  3O6T A;  3GX0 A;  4LMV A;  2FGX A;  4BA7 A;  4GLT A;  4JR4 A;  3ZIV A;  2MMN A;  3P90 A;  2N5F A;  4G19 A;  3TRQ A;  3R2Q A;  3ISO A;  4OO5 A;  4K0N A;  4RI6 A;  2HNL A;  2Z9S A;  4CW9 A;  3APO A;  5ECS A;  1O7U A;  3C7M A;  1K0O A;  3PIN A;  3ZRE A;  6GSU A;  3GIX A;  4ULX A;  4BWS A;  2L5O A;  2P0G A;  4HQZ A;  5G31 A;  3ME7 A;  3ERG A;  5DCG A;  1ZL9 A;  1ERV A;  3GRX A;  3QOU A;  3TB2 A;  5IMD A;  1EEJ A;  1YZX A;  3DYR A;  2IIY A;  2DSA A;  3WT2 A;  4MF7 A;  1PX6 A;  4X43 A;  1K3O A;  5FHI A;  4JBB A;  1O8X A;  4JU5 A;  5AIS A;  2WDU A;  4ZIL A;  1M2B A;  5CO3 A;  4OFN A;  1SYX A;  2E0Q A;  3ZMK A;  4D73 B;  4XS4 B;  2BMX A;  2DBC A;  5J9C A;  3KGK A;  4G9H A;  2YP6 A;  1SD8 A;  2AJQ B;  5ECR B;  4OFT A;  5LCZ A;  1X0R A;  1SL0 B;  1OC9 B;  1OC3 A;  1TOF A;  3FK8 A;  4DVC A;  4XRD A;  1EGR A;  4WEY A;  2CA8 A;  4GCI A;  2B5Y A;  2HE3 A;  3GKX A;  4GRF A;  1GUM A;  2PER A;  4XS6 A;  3TJG A;  2B5E A;  1AC1 A;  2PUK C;  4POB A;  1HYU A;  4KW6 A;  1GUK A;  3KM6 A;  4I6X A;  1GTI A;  2P5Q A;  2JAD A;  4HUA A;  6GSY A;  2VCX A;  3FRC A;  2ZUP A;  1GSE A;  2NBS A;  3F6F A;  3GX8 A;  4K8M A;  2A2R A;  4OWY A;  4KCE A;  3MAK A;  9GSS A;  3WGD A;  3MDK A;  2X8H A;  3N5O A;  3TDG A;  3LQ7 A;  1NHO A;  1U87 A;  2F8A A;  4GSN A;  3ERW A;  5KN0 A;  3SBC A;  5J5N A;  1OC8 A;  3EU3 A;  3QAG A;  4ZXG A;  3WYW A;  5KN2 A;  2B5X A;  2VCZ A;  1TRS A;  4D73 A;  3EC3 A;  4MJB A;  4XS4 A;  1OYJ A;  3TJF A;  3KTL A;  2V32 A;  2I9H A;  4KE3 A;  3VLN A;  1HNB A;  2FY6 A;  1GSQ A;  4DEJ A;  1OC9 A;  4AJ6 A;  2XBQ A;  5A4U A;  4QL9 A;  3EYT A;  3UBL A;  3GKM A;  1FAA A;  4KDX A;  4IJ3 A;  2ES7 A;  2M80 A;  3QMX A;  5F8B A;  1V40 A;  4OCF A;  2R6K A;  4I2U A;  1XWG A;  4OO4 A;  3EU4 A;  2B1L A;  3CSH A;  1Z7R A;  3GKN A;  5CAX A;  2LJA A;  1SJI A;  5KEJ A;  1ERT A;  1XWB A;  3EVI A;  1N8J A;  3LG6 A;  2GT6 A;  1T00 A;  3ERF A;  1Z6M A;  1PX7 A;  2CAQ A;  3CMI A;  1XWC A;  2GST A;  11GS A;  3ZFB A;  1GL8 A;  1NHY A;  1B9X C;  4I8B A;  2MMO A;  1TKD B;  1YEX A;  3FZ4 A;  2OBI A;  5HR1 A;  4V1A p;  3KCM A;  4KX4 A;  2AUV A;  1TDI A;  2IFQ B;  3J7Y k;  1M9B A;  1GSS A;  4F9Z A;  2C0E A;  4TVE A;  4POL A;  4MJE A;  3QAV A;  3C1S A;  4PQI A;  3F3Q A;  3GH9 A;  4IGJ A;  2V6O A;  1H75 A;  1XW5 A;  1TRW A;  4IHU A;  1XWA A;  1A8L A;  5IM9 A;  1G7O A;  2PPT A;  5HFG A;  1T7P B;  3FR9 A;  4YQM A;  1GWC A;  4TR4 A;  2GS3 A;  2EIO A;  5IMV A;  4BVY A;  2LQQ A;  3Q19 A;  1EP8 A;  4O32 A;  5CP1 A;  1PGT A;  2HYX A;  4ZB9 A;  2IMF A;  5DAK B;  4OD7 A;  1ILO A;  1AQX A;  1CQH A;  2DJ3 A;  1OE8 A;  3KMN A;  4N11 A;  4DSS A;  3VPT A;  2K8V A;  2HLS A;  3N9J A;  2OE1 A;  1JZW A;  4L0W A;  2H66 A;  4ZL8 A;  3F6D A;  1JLV A;  4ECB A;  4Q5R A;  3D0Z A;  3L78 A;  2JL4 A;  1U3I A;  3TOU A;  4KDY A;  1E6B A;  4WR4 A;  1EV9 A;  5ABR A;  3TJB A;  3HZ4 A;  2BJX A;  5D9W A;  5LD0 A;  3GN3 A;  3LSZ A;  3K8N A;  1FHE A;  1TU7 A;  3KMO A;  4HZ4 A;  2IFQ A;  4MCU A;  4KCA A;  1B4Q A;  4I5Q A;  1PA3 A;  1AW9 A;  3S9F A;  1V9W A;  5J3R A;  4F2I A;  2ON7 A;  3GV1 A;  4DSQ A;  4RI7 A;  1SL1 B;  3TOT A;  2R4V A;  1FVJ A;  4XCS A;  2WFC A;  3UJ1 A;  3GH6 A;  1HNA A;  2H75 A;  3LYK A;  2PBJ A;  5JCU A;  1PL1 A;  3QCP A;  5HR3 A;  4P3Y B;  1MTC A;  5DAK A;  4F0B A;  1FG4 A;  3WT1 A;  2XPD A;  1Y6E A;  4TR1 B;  3PGT A;  3H8Q A;  5FWG A;  2MMA A;  4MZB A;  1V57 A;  1RW1 A;  2VCW A;  2OE0 A;  4GST A;  1W4V A;  1GTU A;  1I9D A;  5D73 A;  2H1A A;  2GZP A;  3DKS A;  2WJU A;  4NXI A;  2WB9 A;  1A2J A;  1H4O A;  2E7P A;  4HJM A;  2I81 A;  4MPG A;  3FR3 A;  3CRU A;  2H30 A;  3DML A;  1XWK A;  1QGV A;  1DSB A;  3P8W A;  3F4S A;  5D8I A;  1RQM A;  2F8F A;  2ZNM A;  1F9M A;  5CYY A;  1TK5 B;  2H1D A;  1X9M B;  2H1G A;  2HZF A;  2B1K A;  3ZL5 A;  4XS1 A;  1URM A;  4K1F A;  2YZH A;  2B7J A;  1YQ1 A;  2HZE A;  2CZ3 A;  3GL5 A;  5ELG A;  1SKW B;  2H71 A;  4KSO A;  5DQS A;  2VOC A;  4RQR A;  14GS A;  4O5R A;  2DJK A;  3IE3 A;  3BCI A;  3HVX A;  1A8Y A;  4AJ8 A;  2A4V A;  1GSD A;  1SYR A;  2ZCT A;  3MWH A;  2LNS A;  4MH3 A;  5JCW A;  4FH8 A;  1BED A;  1N2A A;  4WBR D;  3KH9 A;  6GSX A;  4O92 A;  4J2F A;  1AQW A;  3DVX A;  2AV4 A;  4MH2 A;  1PKW A;  5B8B A;  2X8C A;  2L5L A;  1AAZ A;  2O8V B;  2YJ7 A;  3Q74 A;  19GS A;  5DAL A;  2DJJ A;  3M1G A;  1M0U A;  2XBI A;  2PN8 A;  1QMV A;  1PSQ A;  4HDE A;  5GAN D;  3QAW A;  4NAX A;  2FHE A;  5COH A;  2HRF A;  4AF2 A;  3ZVJ A;  2YWM A;  2E2M A;  3H93 A;  5GST A;  1JHB A;  1OE7 A;  1PD2 1;  5D93 A;  5E59 A;  1JZD A;  1TI3 A;  4K9Z A;  1ZMA A;  3FZ9 A;  2GSR A;  4LMW A;  3KJY A;  4PX1 A;  3TKQ A;  4BVX A;  2IMD A;  2H1B A;  2PWJ A;  3DVW A;  2M46 A;  20GS A;  4NHW A;  3D6I A;  1U6T A;  4N0V A;  3UL3 A;  2H8L A;  4ACS A;  4F03 A;  3HVS A;  2VL9 A;  2I3Y A;  4J57 E;  5G1K A;  5JWQ B;  5B6N A;  2GDR A;  3APQ A;  5H5Q A;  1VF4 A;  4K0G A;  1O73 A;  4GSS A;  5EL8 A;  4HJ2 A;  2E2G A;  1BYE A;  6GST A;  3TJK A;  2H0H A;  3UAP A;  4JED A;  4XRA A;  5D9X A;  1U3A A;  1ML6 A;  3IR4 A;  3L4N A;  5ECI B;  5B8A A;  2DJ2 A;  1RK4 A;  1HD2 A;  3NZN A;  1B9Y C;  1O85 A;  3IA1 A;  4BPY A;  1UC7 A;  5B7C A;  2YWI A;  4OMV A;  4K7I A;  1LU4 A;  1FO5 A;  4YAP A;  1O81 A;  1ON4 A;  2CVK A;  1T8E B;  1YF0 A;  2H6X A;  5G5F A;  1SEN A;  1VF1 A;  5HR2 A;  3FYG A;  4ZL7 A;  5HFI A;  5KN3 A;  2EIQ A;  4ZB6 A;  2M72 A;  2GSS A;  4WF5 A;  2GT5 A;  3LEF A;  2OKA A;  2AAW A;  2HFD A;  2F51 A;  3IAM 2;  3CRT A;  1S3D A;  2YPM A;  1Z9H A;  1R5A A;  2HSY A;  2VLU A;  1JZO A;  1T4Z A;  1THO A;  2OE3 A;  4L8E A;  4ZBA A;  2LRN A;  3FEU A;  5E4W A;  3UAR A;  1XPV A;  3I69 A;  3LYP A;  4FYB A;  3HCZ A;  1AQV A;  1M2D A;  2WRT A;  3GHA A;  4I2T A;  1TRU A;  3MNG A;  2HT9 A;  4HU9 A;  4E8H A;  3GSS A;  3UBK A;  3DIE A;  4WR5 A;  4OCE A;  4BL7 A;  3PR8 A;  2TRX A;  2AYT A;  1A23 A;  1SK2 A;  1B48 A;  3GFK A;  3DEX A;  3HJM A;  1MDI A;  3LOR A;  1F2E A;  2C3T A;  2O7K A;  3GNJ A;  2OAC A;  1X5D A;  5F07 A;  3UMA A;  2DMM A;  2MZC A;  3HZ8 A;  3UEM A;  3EWL A;  2CX4 A;  1F3A A;  3VI5 A;  4DSR A;  2L4Q A;  3HVV A;  2DJ0 A;  4GQF A;  4ML6 A;  4RUV A;  1UVZ A;  1MEK A;  2R3X A;  4NWY A;  5ECL B;  4AJ7 A;  3TJJ A;  4EVM A;  5B6M A;  1NSW A;  3IOS A;  1V98 A;  1A0F A;  3H4K A;  4TR3 A;  2H0I A;  4H86 A;  3E3E A;  3F4R A;  1TW9 A;  1TJD A;  3IV4 A;  2LS5 A;  4FO5 A;  4DSS B;  2LRC A;  3LXZ A;  5ID2 B;  5G30 A;  4GF0 A;  1K0M A;  2CQ9 A;  2XC2 A;  4HI7 A;  2FWH A;  1XXU A;  5HR0 A;  2HI7 A;  5HQP A;  4V2N A;  2N5A A;  2L4C A;  3HYP A;  12GS A;  2DJ1 A;  2DLX A;  1QFN A;  4WXT A;  5ELA A;  1TK8 B;  2R5G A;  5EVO A;  2IL3 A;  4AGS A;  3CBU A;  5CRH A;  5DJM A;  1HNC A;  2VLV A;  3A2W A;  3W8J A;  2DML A;  2IME A;  1VF3 A;  2ALB A;  2GZZ A;  5A4V A;  3ZFL A;  1Q4J A;  3GL3 A;  3WGX A;  2LTK A;  2C3N A;  1XVQ A;  2XPE A;  3TKR A;  4KDU A;  4KH7 A;  2FNO A;  3F4T A;  2V6K A;  5LNK e;  3NIV A;  4YH2 A;  2OBK A;  2JZR A;  2MBT A;  3G7I A;  4MAB A;  3RDW A;  3JCM L;  1ABA A;  2FA4 A;  4IBP A;  1M7T A;  4ILF A;  3MSZ A;  3VWX A;  2LV3 A;  2O89 A;  2IJY A;  1SK1 A;  3ZVJ D;  1TRV A;  2RII A;  4V1A g;  3P2A A;  2TIR A;  2F9S A;  3D21 A;  3IAS 2;  4WET A;  4G2E A;  3KEB A;  4TKY A;  5ECM B;  5ID2 A;  4G10 A;  2VCV A;  4HZ2 A;  3ZYW A;  2VUP A;  5DVB A;  2LST A;  2C1Y A;  3QR6 A;  4IS0 A;  1F6M C;  3ZML A;  3F8U A;  1GNE A;  1EGO A;  2YCD A;  4HOJ A;  4NMU A; 
#chains in the Genus database with same CATH topology
 1R26 A;  1ZCP A;  3VUR A;  2KP1 A;  1V2A A;  3F9U A;  1NW2 A;  3KP8 A;  2H6Y A;  2LJR A;  3GMF A;  5ECP B;  1C72 A;  4GTU A;  2WCI A;  3IK7 A;  5ECQ B;  4POK A;  3I6A A;  2HZE B;  2RUE A;  1ZYQ B;  1CQG A;  4YQU A;  3M9K A;  2JSZ A;  1SKR B;  1A2M A;  1OKD A;  3L9S A;  1J0F A;  5KOW A;  2LEG A;  2L59 A;  4EL1 A;  1EWX A;  2IN3 A;  2C8U A;  3A2X A;  1GTA A;  4O7H A;  4G0K A;  4KUN A;  2RM5 A;  3MIX A;  1T4Y A;  1WIK A;  5BRT A;  3RHC A;  5D9V A;  2VL3 A;  5JWR B;  3US3 A;  3UVH A;  1ERW A;  4JR6 A;  3HXS A;  4MNN A;  2LNT A;  4MZW A;  2CVD A;  4HQS A;  4V2M A;  2AB6 A;  5F06 A;  4WBJ A;  3J7Y b;  4EE0 A;  1WOU A;  3EIN A;  5DAL B;  1FB6 A;  3CSI A;  4HEA 2;  1AXD A;  3CTG A;  1WPI A;  1EEM A;  3RPP A;  4QQ7 A;  2L6C A;  2OJL A;  3C71 A;  2H76 A;  4PNG A;  2CX3 A;  3TKS A;  3WD6 A;  1T1V A;  3IK9 A;  3KP9 A;  4PUA A;  4FYC A;  5H5R A;  1KEB A;  1JZR A;  1K0N A;  1T3B A;  4Z2R A;  2IWT A;  1WMJ A;  4Q5F A;  5HFK A;  5CRG A;  4IP6 A;  3CTF A;  4MPF A;  2H6Z A;  4BVX B;  4X0X A;  1QQ2 A;  3LGC A;  2X64 A;  2H01 A;  2GQL A;  1WE0 A;  1BG5 A;  4USS A;  1OAZ A;  1GTB A;  2YV7 A;  2C3Q A;  3QDN A;  2VM1 A;  5CRE A;  3EMX A;  2VCQ A;  1M9A A;  4L0U A;  5IO0 A;  5C00 A;  3VK9 A;  4NV2 A;  2JU5 A;  4EKZ A;  3QFB C;  1XOA A;  2H19 A;  4K7O A;  3E9J B;  3M0F A;  2G0F A;  2K6V A;  3BOA A;  3FR6 A;  4PTS A;  2IPA A;  2VD0 A;  4LL4 B;  1WJK A;  2YWN A;  2CV4 A;  1DE2 A;  2FD3 A;  3TKP A;  4KB3 A;  1Y25 A;  1SKS B;  2A2S A;  2NDO A;  1GP1 A;  2I1U A;  5A5K A;  4HSC X;  1O8W A;  4IKH A;  1XFL A;  2G2Q A;  2V41 A;  5AN1 A;  3MYD A;  4L5L A;  5D9T A;  3D4M A;  4PGT A;  3GYK A;  2I4A A;  3HHV A;  2EIR A;  4CHS A;  3E0U A;  1R5P A;  3H79 A;  1WWJ A;  4WKW A;  5EPF A;  3LXT A;  3I9V 2;  3DRN A;  2R0G A;  1R4W A;  3QPM A;  2CZ2 A;  4EUY A;  4EDZ A;  2B6M A;  3F3R A;  3GKK A;  2DIZ A;  4EXJ A;  2H72 A;  5IMC A;  1TP9 A;  2PVQ A;  4IVF A;  4G0L A;  2ON5 A;  4EDY A;  2QC7 A;  5IPG A;  1K0B A;  2YWO A;  1USB A;  1YF1 A;  5G5E A;  2KOK A;  2K18 A;  2GQM A;  2VL2 A;  2WGR A;  1B4P A;  2X8G A;  4F0C A;  22GS A;  2RM6 A;  1X9S B;  1SL2 B;  1Q98 A;  1S3R A;  4PXO A;  4XIH A;  5IMZ A;  4X1U A;  3QFA C;  1ST9 A;  2FA8 A;  1K3Y A;  3CXG A;  2V1M A;  2GGT A;  3A2V A;  4KND A;  1UA5 A;  3GUR A;  1S3A A;  3TCO A;  4EC0 A;  2FWG A;  1G7E A;  17GS A;  3FW2 A;  1TI1 A;  2QGV A;  2C0F A;  1EOH A;  2YJH A;  1XW9 A;  1PFO A;  4TXV A;  4MF5 A;  2JAC A;  4KGI A;  1A0R P;  3D4T A;  1WRY A;  5DBQ A;  3IHQ A;  1YKC A;  2IMI A;  2HXK A;  2EC4 A;  3W8S A;  3VWV A;  1S3C A;  1J9B A;  1FOV A;  2RUF A;  4MZC A;  3HKR A;  2H74 A;  2YZU A;  2X4A A;  2DC5 A;  3BJ5 A;  4G0I A;  5AIV A;  4KAE A;  2FCH A;  2FUG 2;  1QXH A;  3FMW A;  2L6D A;  3VWU A;  1EV4 A;  5AIX A;  5CRD A;  3PH9 A;  4K5S A;  4N10 A;  4MMM A;  1DUG A;  2JZS A;  3RAZ A;  5EY6 A;  4CDO A;  16GS A;  3TKS C;  3KD0 A;  3ZZX A;  2HSH A;  1THX A;  5IOW A;  2C0D A;  2QKE A;  2MYG A;  4LLR A;  1K0A A;  4MF6 A;  5IQY A;  2JZT A;  1K0D A;  4L5O A;  2FWE A;  3R3E A;  2GQK A;  1I5G A;  2LUS A;  6GSW A;  2MBS A;  4CY6 A;  4TOP A;  1GLQ A;  2GZY A;  1U88 A;  1G0T A;  3C1R A;  2QSI A;  4TN8 A;  1MDK A;  3L9V A;  3QD9 A;  3A5W A;  4QL7 A;  1K0C A;  4F82 A;  1YDK A;  4ZIJ A;  1BQ7 A;  2YN1 A;  2YAN A;  4ZB8 A;  3HJP A;  5IMF A;  2BTO T;  1ERU A;  1R7H A;  3ZRD A;  2NPB A;  1ACV A;  1AIU A;  3I43 A;  5DDL A;  1KBN A;  3IRA A;  1MD3 A;  3EE2 A;  1J08 A;  4JE1 A;  4PQ1 A;  2VLT A;  4ML1 A;  1PL2 A;  3W6G A;  5DQY A;  1G6W A;  3TUE A;  5A4W A;  1YKA A;  2J9H A;  3RBT A;  5IO2 A;  2H73 A;  2LKU A;  4ECJ A;  5F0G A;  5J4U A;  3LFL A;  2B3S A;  5G2Z A;  1XVW A;  1GLP A;  2AHE A;  4MK3 A;  4ISD A;  1GSF A;  3Q6O A;  2VD1 A;  2KLX A;  1LJR A;  3EUR A;  5ECK B;  2OA7 A;  1M99 A;  2N5B A;  4GWR A;  4MP4 A;  5L71 A;  4TRX A;  1BJX A;  4GQC A;  2D2Z A;  1JFU A;  1GUL A;  2IMK A;  1XW6 A;  4IQA A;  1IYI A;  2CT6 A;  5GAP D;  1E2Y A;  1M2A A;  5GZZ B;  1B8X A;  3GA4 A;  3LJR A;  3L9U A;  4N0Z A;  5JWO B;  3BD2 A;  1SK0 A;  3ED3 A;  1G6Y A;  4K7N A;  2H0G A;  5IOX A;  4PUF C;  5C04 A;  3HDC A;  5INY A;  3ZLP A;  4PQH A;  4IQ1 A;  1ZZY A;  3HD5 A;  4WF4 A;  1X5E A;  2RLI A;  1LBK A;  4X4J A;  1YJ6 A;  2L57 A;  3KIJ A;  1PKZ A;  3VWW A;  3L0H A;  1XCC A;  5ENU A;  2WZ9 A;  1ZYE A;  2VL2 C;  2FLS A;  2KHP A;  5J41 A;  2B7K A;  3FHK A;  2C4J A;  3V1W A;  4TXO B;  2A4H A;  2FWF A;  4IP1 A;  5D96 A;  4HU7 A;  3FKF A;  3F63 A;  3IXR A;  5H5S A;  3VPQ A;  4MLY A;  4ZBD A;  5F05 A;  4KSM A;  4N30 A;  5GSS A;  2VM2 A;  4ZL9 A;  1FVK A;  1X5C A;  4V2L A;  4PNF A;  4E8E A;  2VIM A;  1VF2 A;  3TRP A;  1UN2 A;  4BWQ A;  5CNW A;  5JCG A;  2PMT A;  1EZK A;  2J23 A;  2MMZ A;  3EMP A;  1EP7 A;  2GSQ A;  3IDV A;  1TTZ A;  2C80 A;  2O85 A;  2TRC P;  18GS A;  1VRS D;  3BCK A;  1XIY A;  3GTU B;  4TW5 A;  1Z7P A;  1KTE A;  3CYN A;  1XBS A;  4JRR A;  2C0G A;  1GSU A;  2DKH A;  3M3M A;  4YQV A;  1SJ6 A;  3WGE A;  4Q5Q A;  1MD4 A;  2GVP A;  4JZQ A;  3IC8 A;  2PGT A;  1TK0 B;  2LRT A;  3IBH A;  3UIW A;  4LA1 A;  1SU9 A;  3UOM A;  4OFM A;  1OVN A;  4EF0 A;  4TXO A;  2VAF A;  2JSY A;  3CQF A;  1SJZ A;  3VFI A;  4IN0 A;  4ZBB A;  3TGZ A;  1X9W B;  2OAD A;  3BBY A;  3GST A;  4GXZ A;  4K6X A;  4XHM A;  2K9F A;  2LJK A;  3F0I A;  4J56 E;  3ZIJ A;  5IIZ A;  1GSY A;  3G9B A;  3H1N A;  3A3T A;  3RPN A;  4A5P A;  2H70 A;  3APS A;  2HRN A;  3TKS E;  3A5I A;  4FYU A;  4I97 A;  1Z5Y E;  4NV5 A;  3CSJ A;  10GS A;  2F3M A;  2YV9 A;  3SWL A;  2WUL A;  2XHF A;  3O76 A;  3FZA A;  3O3T A;  4KF9 A;  3UVT A;  1GUH A;  5J9B A;  1TXX A;  1XZO A;  1WP0 A;  4NPB A;  3C73 A;  1ZOF A;  2LQO A;  4IW9 A;  2NTO A;  1ZGN A;  2CVB A;  3DD3 A;  3GTU A;  4HS1 A;  3KH7 A;  3Q18 A;  1PN9 A;  3AY8 A;  1EOG A;  1YY7 A;  2PU9 C;  6GSS A;  2VCT A;  1FB0 A;  4XTS A;  1BAY A;  4K2D A;  5FT3 A;  2WS2 A;  3IC4 A;  3G7J A;  3U5R E;  4RQX A;  7GSS A;  1GNW A;  3FY7 A;  3C8E A;  4FIW A;  2CAI A;  2VO4 A;  3HA9 A;  1XOB A;  1SD9 A;  4IEL A;  1F3B A;  1KNG A;  2DIY A;  3D22 A;  1PQN A;  1DE1 A;  4MA9 A;  4ECC A;  3KXO A;  5ECO B;  3ZIT A;  2GTU A;  1W89 A;  1PRX A;  1AUC A;  3IPZ A;  5DCH A;  3DWV A;  1YEP A;  8GSS A;  4ID0 A;  3U6V A;  2KUC A;  3KZQ A;  2P31 A;  1TU8 A;  4Q5N A;  2O87 A;  4MJC A;  2V2G A;  3M9J A;  2GLR A;  1A24 A;  1GRX A;  2NVL A;  1GH2 A;  4MDC A;  1O6J A;  4EO3 A;  13GS A;  4O5Q A;  5KN1 A;  1A2L A;  3G7Y A;  4TR1 A;  2P5R A;  4PUR A;  3ZTL A;  3IHG A;  1V58 A;  1PMT A;  3TRX A;  5IPH A;  3GUS A;  3P7X A;  1IYH A;  1BX9 A;  1JLW A;  2PVO C;  5CRW A;  1QUW A;  3VI7 A;  1Z3E A;  3LWA A;  3DGQ A;  4MJA A;  2YOI A;  4YAV A;  2KP2 A;  2R2J A;  3ME8 A;  4ECI A;  6GSV A;  2YNX A;  3HY2 A;  2REM A;  1NM3 A;  4IJI A;  1F37 A;  1VGL A;  3RHB A;  4FQU A;  1DBY A;  4Z7X A;  2K8S A;  5IMA A;  5G1L A;  4O5U A;  3FZ5 A;  3OR5 A;  3KTB A;  1OKT A;  2X99 A;  3M8N A;  1HQO A;  3NOF A;  4POM A;  1MDJ A;  3D5J A;  4TR0 A;  4LL1 B;  2R37 A;  1FW1 A;  5DJL A;  4NHZ A;  1QK8 A;  5ECN B;  5AGY A;  3DXB A;  4EIQ A;  1Z6N A;  4KA0 A;  1K3L A;  3HJO A;  1ZYN A;  5ECH B;  3O6T A;  3GX0 A;  4LMV A;  4YKF A;  2FGX A;  4BA7 A;  4GLT A;  4JR4 A;  3ZIV A;  2MMN A;  3P90 A;  2N5F A;  4G19 A;  3TRQ A;  3R2Q A;  3PPU A;  3ISO A;  4OO5 A;  4K0N A;  4RI6 A;  2HNL A;  1ZYP A;  2Z9S A;  4CW9 A;  3APO A;  5ECS A;  1O7U A;  3C7M A;  1K0O A;  3PIN A;  3ZRE A;  6GSU A;  3GIX A;  4ULX A;  4BWS A;  2L5O A;  2P0G A;  4HQZ A;  5G31 A;  3ME7 A;  3ERG A;  5DCG A;  1ZL9 A;  1ERV A;  3GRX A;  3QOU A;  3TB2 A;  5IMD A;  1EEJ A;  1YZX A;  3DYR A;  2IIY A;  2DSA A;  3WT2 A;  4MF7 A;  1PX6 A;  4X43 A;  1K3O A;  2A2P A;  5FHI A;  4JBB A;  1O8X A;  4JU5 A;  5AIS A;  2WDU A;  4ZIL A;  1M2B A;  4Z2T A;  5CO3 A;  4OFN A;  1SYX A;  2E0Q A;  3ZMK A;  4D73 B;  4XS4 B;  2BMX A;  2DBC A;  5J9C A;  3KGK A;  4G9H A;  2YP6 A;  1SD8 A;  2AJQ B;  4K2X A;  5ECR B;  4OFT A;  5LCZ A;  1X0R A;  1SL0 B;  1OC9 B;  1OC3 A;  1TOF A;  3FK8 A;  4DVC A;  4XRD A;  1EGR A;  4WEY A;  2CA8 A;  4GCI A;  2B5Y A;  2HE3 A;  3GKX A;  4GRF A;  1GUM A;  2PER A;  4XS6 A;  3TJG A;  2B5E A;  1AC1 A;  2PUK C;  4POB A;  1HYU A;  4KW6 A;  1GUK A;  3KM6 A;  4I6X A;  1GTI A;  2P5Q A;  2JAD A;  4HUA A;  6GSY A;  2VCX A;  3FRC A;  2ZUP A;  1GSE A;  2NBS A;  3F6F A;  3GX8 A;  2HRK A;  4K8M A;  2A2R A;  4OWY A;  4KCE A;  3MAK A;  9GSS A;  3WGD A;  3MDK A;  2X8H A;  3N5O A;  3TDG A;  3LQ7 A;  1NHO A;  1U87 A;  2F8A A;  3LW9 A;  4GSN A;  3ERW A;  5KN0 A;  3SBC A;  5J5N A;  1OC8 A;  3EU3 A;  3QAG A;  4ZXG A;  3WYW A;  5KN2 A;  2B5X A;  2VCZ A;  1TRS A;  4D73 A;  3EC3 A;  4MJB A;  4XS4 A;  1OYJ A;  3TJF A;  3KTL A;  4BVY B;  2V32 A;  2I9H A;  4KE3 A;  3VLN A;  1HNB A;  2FY6 A;  1GSQ A;  4DEJ A;  1OC9 A;  4AJ6 A;  2XBQ A;  5A4U A;  4QL9 A;  3EYT A;  3UBL A;  3GKM A;  1FAA A;  4KDX A;  4IJ3 A;  2ES7 A;  2M80 A;  3QMX A;  5F8B A;  1V40 A;  4OCF A;  2R6K A;  4I2U A;  1XWG A;  4OO4 A;  3EU4 A;  2B1L A;  3CSH A;  1Z7R A;  3GKN A;  5CAX A;  2LJA A;  1SJI A;  5KEJ A;  1ERT A;  1XWB A;  3EVI A;  1N8J A;  3LG6 A;  2GT6 A;  1T00 A;  3ERF A;  1Z6M A;  1PX7 A;  2CAQ A;  3CMI A;  1XWC A;  2GST A;  3HVN A;  3ZFB A;  11GS A;  1GL8 A;  1NHY A;  1B9X C;  4I8B A;  2MMO A;  1TKD B;  1YEX A;  3FZ4 A;  2OBI A;  5HR1 A;  4V1A p;  3KCM A;  4KX4 A;  2AUV A;  1TDI A;  2IFQ B;  3J7Y k;  1M9B A;  1GSS A;  4F9Z A;  2C0E A;  4TVE A;  4POL A;  4MJE A;  3QAV A;  3C1S A;  4PQI A;  3F3Q A;  3GH9 A;  4IGJ A;  2V6O A;  1H75 A;  1XW5 A;  1TRW A;  4IHU A;  1XWA A;  1A8L A;  5IM9 A;  1G7O A;  2PPT A;  5HFG A;  1T7P B;  3FR9 A;  4YQM A;  1GWC A;  4TR4 A;  2GS3 A;  2EIO A;  5IMV A;  4BVY A;  2LQQ A;  3Q19 A;  1EP8 A;  4O32 A;  5CP1 A;  1PGT A;  2HYX A;  4ZB9 A;  2IMF A;  5DAK B;  4OD7 A;  1ILO A;  1AQX A;  1CQH A;  2DJ3 A;  1OE8 A;  3KMN A;  4N11 A;  4DSS A;  3VPT A;  2K8V A;  2HLS A;  3N9J A;  2OE1 A;  1JZW A;  4L0W A;  2H66 A;  2UZ8 A;  4ZL8 A;  3F6D A;  1JLV A;  4ECB A;  4Q5R A;  3D0Z A;  3L78 A;  2JL4 A;  1U3I A;  3TOU A;  4KDY A;  1E6B A;  4WR4 A;  1EV9 A;  5ABR A;  3TJB A;  3HZ4 A;  2BJX A;  5D9W A;  5LD0 A;  3GN3 A;  3LSZ A;  3K8N A;  1FHE A;  1TU7 A;  1M3I A;  3KMO A;  4HZ4 A;  2IFQ A;  4MCU A;  4KCA A;  1B4Q A;  4I5Q A;  1PA3 A;  1AW9 A;  3S9F A;  1V9W A;  5J3R A;  4F2I A;  2ON7 A;  3GV1 A;  4DSQ A;  4RI7 A;  1SL1 B;  3TOT A;  2R4V A;  1FVJ A;  4XCS A;  2WFC A;  3UJ1 A;  3GH6 A;  1HNA A;  2H75 A;  3LYK A;  2PBJ A;  5JCU A;  1PL1 A;  2HSM A;  3QCP A;  5HR3 A;  4P3Y B;  1MTC A;  5DAK A;  4F0B A;  1FG4 A;  3WT1 A;  2XPD A;  1Y6E A;  4TR1 B;  3PGT A;  3H8Q A;  5FWG A;  2MMA A;  4MZB A;  1V57 A;  1RW1 A;  2VCW A;  2OE0 A;  4GST A;  1W4V A;  1GTU A;  1I9D A;  2H1A A;  5D73 A;  2GZP A;  3DKS A;  2WJU A;  4NXI A;  2WB9 A;  1A2J A;  1H4O A;  2E7P A;  4HJM A;  2I81 A;  4MPG A;  3FR3 A;  3CRU A;  2H30 A;  3DML A;  1XWK A;  1QGV A;  1DSB A;  3P8W A;  3F4S A;  5D8I A;  1RQM A;  2F8F A;  2ZNM A;  1F9M A;  5CYY A;  1TK5 B;  2H1D A;  1X9M B;  2H1G A;  2HZF A;  2QA1 A;  2B1K A;  3ZL5 A;  4XS1 A;  1URM A;  4K1F A;  2YZH A;  2B7J A;  1YQ1 A;  2HZE A;  2CZ3 A;  3GL5 A;  5ELG A;  1SKW B;  2H71 A;  4KSO A;  5DQS A;  2VOC A;  4RQR A;  14GS A;  2R0P A;  4O5R A;  2DJK A;  3IE3 A;  3BCI A;  3HVX A;  1A8Y A;  4AJ8 A;  2A4V A;  1GSD A;  2DKI A;  1SYR A;  2ZCT A;  3MWH A;  2LNS A;  4MH3 A;  5JCW A;  4FH8 A;  1BED A;  1N2A A;  4WBR D;  3KH9 A;  6GSX A;  4O92 A;  4J2F A;  1AQW A;  3DVX A;  2AV4 A;  4MH2 A;  1PKW A;  5B8B A;  2X8C A;  2L5L A;  1AAZ A;  2O8V B;  2YJ7 A;  3Q74 A;  19GS A;  5DAL A;  2DJJ A;  3M1G A;  1M0U A;  2HRA A;  2XBI A;  2PN8 A;  1QMV A;  1PSQ A;  4HDE A;  5GAN D;  3QAW A;  4NAX A;  2FHE A;  5COH A;  2HRF A;  4AF2 A;  3ZVJ A;  2YWM A;  2E2M A;  3H93 A;  5GST A;  1JHB A;  1OE7 A;  1PD2 1;  5D93 A;  5E59 A;  1JZD A;  1TI3 A;  4K9Z A;  1ZMA A;  3FZ9 A;  2GSR A;  4LMW A;  3KJY A;  4PX1 A;  3TKQ A;  4BVX A;  2IMD A;  2H1B A;  2PWJ A;  3DVW A;  2M46 A;  20GS A;  4NHW A;  3D6I A;  1U6T A;  4N0V A;  3UL3 A;  2H8L A;  4ACS A;  4F03 A;  3HVS A;  2VL9 A;  2I3Y A;  4J57 E;  5G1K A;  5JWQ B;  5B6N A;  2GDR A;  3APQ A;  5H5Q A;  1VF4 A;  4K0G A;  1O73 A;  4GSS A;  5EL8 A;  4HJ2 A;  2E2G A;  4BIK A;  1BYE A;  6GST A;  3TJK A;  2H0H A;  3UAP A;  4JED A;  4BL7 B;  4XRA A;  5D9X A;  1U3A A;  1ML6 A;  3IR4 A;  3L4N A;  1FOH A;  5ECI B;  5B8A A;  2DJ2 A;  1RK4 A;  1HD2 A;  3NZN A;  1B9Y C;  1O85 A;  3IA1 A;  4BPY A;  1UC7 A;  5B7C A;  2YWI A;  4OMV A;  4K7I A;  1LU4 A;  1FO5 A;  4YAP A;  1O81 A;  1ON4 A;  2CVK A;  1PN0 A;  1T8E B;  1YF0 A;  2H6X A;  5G5F A;  1SEN A;  1VF1 A;  5HR2 A;  3FYG A;  4ZL7 A;  5HFI A;  5KN3 A;  2EIQ A;  4ZB6 A;  2M72 A;  2GSS A;  4WF5 A;  2GT5 A;  3LEF A;  2OKA A;  2AAW A;  2HFD A;  2F51 A;  3IAM 2;  3CRT A;  1S3D A;  2YPM A;  1Z9H A;  1R5A A;  2HSY A;  2VLU A;  1JZO A;  1T4Z A;  1THO A;  2OE3 A;  4L8E A;  4ZBA A;  2LRN A;  3FEU A;  5E4W A;  3UAR A;  1XPV A;  3I69 A;  3LYP A;  4FYB A;  4Z2U A;  3HCZ A;  1AQV A;  1M2D A;  2WRT A;  3GHA A;  1XG8 A;  4I2T A;  1TRU A;  3MNG A;  2HT9 A;  4HU9 A;  4E8H A;  3GSS A;  3UBK A;  3DIE A;  4WR5 A;  4OCE A;  4BL7 A;  3PR8 A;  2TRX A;  2AYT A;  1A23 A;  1SK2 A;  1B48 A;  3GFK A;  3EPT A;  3DEX A;  3HJM A;  1MDI A;  3LOR A;  1F2E A;  2C3T A;  2O7K A;  3GNJ A;  2OAC A;  1X5D A;  5F07 A;  3UMA A;  2DMM A;  2MZC A;  3HZ8 A;  3UEM A;  5KOX A;  3EWL A;  2CX4 A;  2R0C A;  1F3A A;  4EIP A;  3VI5 A;  4DSR A;  2L4Q A;  3HVV A;  2DJ0 A;  4GQF A;  4ML6 A;  4RUV A;  1UVZ A;  1MEK A;  2R3X A;  4NWY A;  5ECL B;  4AJ7 A;  3TJJ A;  4EVM A;  5B6M A;  1NSW A;  3IOS A;  1V98 A;  1A0F A;  3H4K A;  4TR3 A;  2H0I A;  4H86 A;  3E3E A;  3F4R A;  1TW9 A;  1TJD A;  3IV4 A;  2LS5 A;  4FO5 A;  4DSS B;  2LRC A;  3LXZ A;  5ID2 B;  5G30 A;  2X49 A;  4GF0 A;  1K0M A;  2CQ9 A;  2XC2 A;  4HI7 A;  2FWH A;  1XXU A;  4YKG A;  5HR0 A;  2HI7 A;  5HQP A;  4V2N A;  2N5A A;  2L4C A;  3HYP A;  12GS A;  2DJ1 A;  2DLX A;  1QFN A;  4WXT A;  5ELA A;  1TK8 B;  2R5G A;  5EVO A;  2IL3 A;  4AGS A;  3CBU A;  5CRH A;  5DJM A;  1HNC A;  2VLV A;  3A2W A;  3W8J A;  2DML A;  2IME A;  1VF3 A;  2ALB A;  2GZZ A;  5A4V A;  3ZFL A;  1Q4J A;  3GL3 A;  3WGX A;  2LTK A;  2C3N A;  1XVQ A;  2XPE A;  3TKR A;  4KDU A;  4KH7 A;  2FNO A;  3F4T A;  1M3J A;  2V6K A;  4ICY A;  5LNK e;  3NIV A;  4YH2 A;  2OBK A;  2JZR A;  2MBT A;  3G7I A;  4MAB A;  3RDW A;  3JCM L;  1ABA A;  2FA4 A;  4IBP A;  1M7T A;  4ILF A;  3MSZ A;  3VWX A;  2LV3 A;  2O89 A;  2IJY A;  1SK1 A;  5BMU A;  3ZVJ D;  1TRV A;  2RII A;  4V1A g;  3P2A A;  2TIR A;  4K5R A;  2QA2 A;  2F9S A;  3D21 A;  3IAS 2;  4WET A;  4G2E A;  3KEB A;  4TKY A;  5ECM B;  5ID2 A;  4G10 A;  2VCV A;  4HZ2 A;  3ZYW A;  2VUP A;  5DVB A;  2LST A;  2C1Y A;  3QR6 A;  4IS0 A;  4CY8 A;  1F6M C;  3ZML A;  3F8U A;  1GNE A;  1EGO A;  2YCD A;  4HOJ A;  4NMU A; 
#chains in the Genus database with same CATH homology
 1R26 A;  1ZCP A;  3VUR A;  2KP1 A;  1V2A A;  3F9U A;  1NW2 A;  3KP8 A;  2H6Y A;  2LJR A;  3GMF A;  5ECP B;  1C72 A;  4GTU A;  2WCI A;  3IK7 A;  5ECQ B;  4POK A;  3I6A A;  2HZE B;  2RUE A;  1ZYQ B;  1CQG A;  4YQU A;  3M9K A;  2JSZ A;  1SKR B;  1A2M A;  1OKD A;  3L9S A;  1J0F A;  5KOW A;  2LEG A;  2L59 A;  4EL1 A;  1EWX A;  2IN3 A;  2C8U A;  3A2X A;  1GTA A;  4O7H A;  4G0K A;  4KUN A;  2RM5 A;  3MIX A;  1T4Y A;  1WIK A;  5BRT A;  3RHC A;  5D9V A;  2VL3 A;  5JWR B;  3US3 A;  3UVH A;  1ERW A;  4JR6 A;  3HXS A;  4MNN A;  2LNT A;  4MZW A;  2CVD A;  4HQS A;  4V2M A;  2AB6 A;  5F06 A;  4WBJ A;  3J7Y b;  4EE0 A;  1WOU A;  3EIN A;  5DAL B;  1FB6 A;  3CSI A;  4HEA 2;  1AXD A;  3CTG A;  1WPI A;  1EEM A;  3RPP A;  4QQ7 A;  2L6C A;  2OJL A;  3C71 A;  2H76 A;  4PNG A;  2CX3 A;  3TKS A;  3WD6 A;  1T1V A;  3IK9 A;  3KP9 A;  4PUA A;  4FYC A;  5H5R A;  1KEB A;  1JZR A;  1K0N A;  1T3B A;  4Z2R A;  2IWT A;  1WMJ A;  4Q5F A;  5HFK A;  5CRG A;  4IP6 A;  3CTF A;  4MPF A;  2H6Z A;  4BVX B;  4X0X A;  1QQ2 A;  3LGC A;  2X64 A;  2H01 A;  2GQL A;  1WE0 A;  1BG5 A;  4USS A;  1OAZ A;  1GTB A;  2YV7 A;  2C3Q A;  3QDN A;  2VM1 A;  5CRE A;  3EMX A;  2VCQ A;  1M9A A;  4L0U A;  5IO0 A;  5C00 A;  3VK9 A;  4NV2 A;  2JU5 A;  4EKZ A;  3QFB C;  1XOA A;  2H19 A;  4K7O A;  3E9J B;  3M0F A;  2G0F A;  2K6V A;  3BOA A;  3FR6 A;  4PTS A;  2IPA A;  2VD0 A;  4LL4 B;  1WJK A;  2YWN A;  2CV4 A;  1DE2 A;  2FD3 A;  3TKP A;  4KB3 A;  1Y25 A;  1SKS B;  2A2S A;  2NDO A;  1GP1 A;  2I1U A;  5A5K A;  1O8W A;  4IKH A;  1XFL A;  2G2Q A;  2V41 A;  5AN1 A;  3MYD A;  4L5L A;  5D9T A;  3D4M A;  4PGT A;  3GYK A;  2I4A A;  3HHV A;  2EIR A;  4CHS A;  3E0U A;  1R5P A;  3H79 A;  1WWJ A;  4WKW A;  5EPF A;  3LXT A;  3I9V 2;  3DRN A;  2R0G A;  1R4W A;  3QPM A;  2CZ2 A;  4EUY A;  4EDZ A;  2B6M A;  3F3R A;  3GKK A;  2DIZ A;  4EXJ A;  2H72 A;  5IMC A;  1TP9 A;  2PVQ A;  4IVF A;  4G0L A;  2ON5 A;  4EDY A;  2QC7 A;  5IPG A;  1K0B A;  2YWO A;  1USB A;  1YF1 A;  5G5E A;  2KOK A;  2K18 A;  2GQM A;  2VL2 A;  2WGR A;  1B4P A;  2X8G A;  4F0C A;  22GS A;  2RM6 A;  1X9S B;  1SL2 B;  1Q98 A;  4PXO A;  4XIH A;  5IMZ A;  4X1U A;  3QFA C;  1ST9 A;  2FA8 A;  1K3Y A;  3CXG A;  2V1M A;  2GGT A;  3A2V A;  4KND A;  1UA5 A;  3GUR A;  1S3A A;  3TCO A;  4EC0 A;  2FWG A;  1G7E A;  17GS A;  3FW2 A;  1TI1 A;  2QGV A;  2C0F A;  1EOH A;  2YJH A;  1XW9 A;  4TXV A;  4MF5 A;  2JAC A;  4KGI A;  1A0R P;  3D4T A;  1WRY A;  5DBQ A;  3IHQ A;  1YKC A;  2IMI A;  2HXK A;  2EC4 A;  3W8S A;  3VWV A;  1S3C A;  1J9B A;  1FOV A;  2RUF A;  4MZC A;  3HKR A;  2H74 A;  2YZU A;  2X4A A;  2DC5 A;  3BJ5 A;  4G0I A;  5AIV A;  4KAE A;  2FCH A;  2FUG 2;  1QXH A;  3FMW A;  2L6D A;  3VWU A;  1EV4 A;  5AIX A;  5CRD A;  3PH9 A;  4K5S A;  4N10 A;  4MMM A;  1DUG A;  2JZS A;  3RAZ A;  5EY6 A;  4CDO A;  16GS A;  3TKS C;  3KD0 A;  3ZZX A;  2HSH A;  1THX A;  5IOW A;  2C0D A;  2QKE A;  2MYG A;  4LLR A;  1K0A A;  4MF6 A;  5IQY A;  2JZT A;  1K0D A;  4L5O A;  2FWE A;  3R3E A;  2GQK A;  1I5G A;  2LUS A;  6GSW A;  2MBS A;  4CY6 A;  4TOP A;  1GLQ A;  2GZY A;  1U88 A;  1G0T A;  3C1R A;  2QSI A;  4TN8 A;  1MDK A;  3L9V A;  3QD9 A;  3A5W A;  4QL7 A;  1K0C A;  4F82 A;  1YDK A;  4ZIJ A;  1BQ7 A;  2YN1 A;  2YAN A;  4ZB8 A;  3HJP A;  5IMF A;  2BTO T;  1ERU A;  1R7H A;  3ZRD A;  2NPB A;  1ACV A;  1AIU A;  3I43 A;  5DDL A;  1KBN A;  3IRA A;  1MD3 A;  3EE2 A;  1J08 A;  4JE1 A;  4PQ1 A;  2VLT A;  4ML1 A;  1PL2 A;  3W6G A;  5DQY A;  1G6W A;  3TUE A;  5A4W A;  1YKA A;  2J9H A;  3RBT A;  5IO2 A;  2H73 A;  2LKU A;  4ECJ A;  5F0G A;  5J4U A;  3LFL A;  2B3S A;  5G2Z A;  1XVW A;  1GLP A;  2AHE A;  4MK3 A;  4ISD A;  1GSF A;  3Q6O A;  2VD1 A;  2KLX A;  1LJR A;  3EUR A;  5ECK B;  2OA7 A;  1M99 A;  2N5B A;  4GWR A;  4MP4 A;  5L71 A;  4TRX A;  1BJX A;  4GQC A;  2D2Z A;  1JFU A;  1GUL A;  2IMK A;  1XW6 A;  4IQA A;  1IYI A;  2CT6 A;  5GAP D;  1E2Y A;  1M2A A;  5GZZ B;  1B8X A;  3GA4 A;  3LJR A;  3L9U A;  4N0Z A;  5JWO B;  3BD2 A;  1SK0 A;  3ED3 A;  1G6Y A;  4K7N A;  2H0G A;  5IOX A;  4PUF C;  5C04 A;  3HDC A;  5INY A;  3ZLP A;  4PQH A;  4IQ1 A;  1ZZY A;  3HD5 A;  4WF4 A;  1X5E A;  2RLI A;  1LBK A;  4X4J A;  1YJ6 A;  2L57 A;  3KIJ A;  1PKZ A;  3VWW A;  3L0H A;  1XCC A;  5ENU A;  2WZ9 A;  1ZYE A;  2VL2 C;  2FLS A;  2KHP A;  5J41 A;  2B7K A;  3FHK A;  2C4J A;  3V1W A;  4TXO B;  2A4H A;  2FWF A;  4IP1 A;  5D96 A;  4HU7 A;  3FKF A;  3F63 A;  3IXR A;  5H5S A;  3VPQ A;  4MLY A;  4ZBD A;  5F05 A;  4KSM A;  4N30 A;  5GSS A;  2VM2 A;  4ZL9 A;  1FVK A;  1X5C A;  4V2L A;  4PNF A;  4E8E A;  2VIM A;  1VF2 A;  3TRP A;  1UN2 A;  4BWQ A;  5CNW A;  5JCG A;  2PMT A;  1EZK A;  2J23 A;  2MMZ A;  3EMP A;  1EP7 A;  2GSQ A;  3IDV A;  1TTZ A;  2C80 A;  2O85 A;  2TRC P;  18GS A;  1VRS D;  3BCK A;  1XIY A;  3GTU B;  4TW5 A;  1Z7P A;  1KTE A;  3CYN A;  1XBS A;  4JRR A;  2C0G A;  1GSU A;  2DKH A;  3M3M A;  4YQV A;  1SJ6 A;  3WGE A;  4Q5Q A;  1MD4 A;  2GVP A;  4JZQ A;  3IC8 A;  2PGT A;  1TK0 B;  2LRT A;  3IBH A;  3UIW A;  4LA1 A;  1SU9 A;  3UOM A;  4OFM A;  1OVN A;  4EF0 A;  4TXO A;  2VAF A;  2JSY A;  1SJZ A;  3VFI A;  4IN0 A;  4ZBB A;  3TGZ A;  1X9W B;  2OAD A;  3BBY A;  3GST A;  4GXZ A;  4K6X A;  4XHM A;  2K9F A;  2LJK A;  3F0I A;  4J56 E;  3ZIJ A;  5IIZ A;  1GSY A;  3G9B A;  3H1N A;  3A3T A;  3RPN A;  4A5P A;  2H70 A;  3APS A;  2HRN A;  3TKS E;  3A5I A;  4FYU A;  4I97 A;  1Z5Y E;  4NV5 A;  3CSJ A;  10GS A;  2F3M A;  2YV9 A;  3SWL A;  2WUL A;  2XHF A;  3O76 A;  3FZA A;  3O3T A;  4KF9 A;  3UVT A;  1GUH A;  5J9B A;  1TXX A;  1XZO A;  1WP0 A;  4NPB A;  3C73 A;  1ZOF A;  2LQO A;  4IW9 A;  2NTO A;  1ZGN A;  2CVB A;  3DD3 A;  3GTU A;  4HS1 A;  3KH7 A;  3Q18 A;  1PN9 A;  3AY8 A;  1EOG A;  1YY7 A;  2PU9 C;  6GSS A;  2VCT A;  1FB0 A;  4XTS A;  1BAY A;  4K2D A;  5FT3 A;  2WS2 A;  3IC4 A;  3G7J A;  3U5R E;  4RQX A;  7GSS A;  1GNW A;  3FY7 A;  3C8E A;  4FIW A;  2CAI A;  2VO4 A;  3HA9 A;  1XOB A;  1SD9 A;  4IEL A;  1F3B A;  1KNG A;  2DIY A;  3D22 A;  1PQN A;  1DE1 A;  4MA9 A;  4ECC A;  3KXO A;  5ECO B;  3ZIT A;  2GTU A;  1W89 A;  1PRX A;  1AUC A;  3IPZ A;  5DCH A;  3DWV A;  1YEP A;  8GSS A;  4ID0 A;  3U6V A;  2KUC A;  3KZQ A;  2P31 A;  1TU8 A;  4Q5N A;  2O87 A;  4MJC A;  2V2G A;  3M9J A;  2GLR A;  1A24 A;  1GRX A;  2NVL A;  1GH2 A;  4MDC A;  1O6J A;  4EO3 A;  13GS A;  4O5Q A;  5KN1 A;  1A2L A;  3G7Y A;  4TR1 A;  2P5R A;  4PUR A;  3ZTL A;  3IHG A;  1V58 A;  1PMT A;  3TRX A;  5IPH A;  3GUS A;  3P7X A;  1IYH A;  1BX9 A;  1JLW A;  2PVO C;  5CRW A;  1QUW A;  3VI7 A;  1Z3E A;  3LWA A;  3DGQ A;  4MJA A;  2YOI A;  4YAV A;  2KP2 A;  2R2J A;  3ME8 A;  4ECI A;  6GSV A;  2YNX A;  3HY2 A;  2REM A;  1NM3 A;  4IJI A;  1F37 A;  1VGL A;  3RHB A;  4FQU A;  1DBY A;  4Z7X A;  2K8S A;  5IMA A;  5G1L A;  4O5U A;  3FZ5 A;  3OR5 A;  3KTB A;  1OKT A;  2X99 A;  3M8N A;  1HQO A;  3NOF A;  4POM A;  1MDJ A;  3D5J A;  4TR0 A;  4LL1 B;  2R37 A;  1FW1 A;  5DJL A;  4NHZ A;  1QK8 A;  5ECN B;  5AGY A;  3DXB A;  4EIQ A;  1Z6N A;  4KA0 A;  1K3L A;  3HJO A;  1ZYN A;  5ECH B;  3O6T A;  3GX0 A;  4LMV A;  4YKF A;  2FGX A;  4BA7 A;  4GLT A;  4JR4 A;  3ZIV A;  2MMN A;  3P90 A;  2N5F A;  4G19 A;  3TRQ A;  3R2Q A;  3PPU A;  3ISO A;  4OO5 A;  4K0N A;  4RI6 A;  2HNL A;  1ZYP A;  2Z9S A;  4CW9 A;  3APO A;  5ECS A;  1O7U A;  3C7M A;  1K0O A;  3PIN A;  3ZRE A;  6GSU A;  3GIX A;  4ULX A;  4BWS A;  2L5O A;  2P0G A;  4HQZ A;  5G31 A;  3ME7 A;  3ERG A;  5DCG A;  1ZL9 A;  1ERV A;  3GRX A;  3QOU A;  3TB2 A;  5IMD A;  1EEJ A;  1YZX A;  3DYR A;  2IIY A;  2DSA A;  3WT2 A;  4MF7 A;  1PX6 A;  4X43 A;  1K3O A;  2A2P A;  5FHI A;  4JBB A;  1O8X A;  4JU5 A;  5AIS A;  2WDU A;  4ZIL A;  1M2B A;  4Z2T A;  5CO3 A;  4OFN A;  1SYX A;  2E0Q A;  3ZMK A;  4D73 B;  4XS4 B;  2BMX A;  2DBC A;  5J9C A;  3KGK A;  4G9H A;  2YP6 A;  1SD8 A;  2AJQ B;  4K2X A;  5ECR B;  4OFT A;  5LCZ A;  1X0R A;  1SL0 B;  1OC9 B;  1OC3 A;  1TOF A;  3FK8 A;  4DVC A;  4XRD A;  1EGR A;  4WEY A;  2CA8 A;  4GCI A;  2B5Y A;  2HE3 A;  3GKX A;  4GRF A;  1GUM A;  2PER A;  4XS6 A;  3TJG A;  2B5E A;  1AC1 A;  2PUK C;  4POB A;  1HYU A;  4KW6 A;  1GUK A;  3KM6 A;  4I6X A;  1GTI A;  2P5Q A;  2JAD A;  4HUA A;  6GSY A;  2VCX A;  3FRC A;  2ZUP A;  1GSE A;  2NBS A;  3F6F A;  3GX8 A;  2HRK A;  4K8M A;  2A2R A;  4OWY A;  4KCE A;  3MAK A;  9GSS A;  3WGD A;  3MDK A;  2X8H A;  3N5O A;  3TDG A;  3LQ7 A;  1NHO A;  1U87 A;  2F8A A;  3LW9 A;  4GSN A;  3ERW A;  5KN0 A;  3SBC A;  5J5N A;  1OC8 A;  3EU3 A;  3QAG A;  4ZXG A;  3WYW A;  5KN2 A;  2B5X A;  2VCZ A;  1TRS A;  4D73 A;  3EC3 A;  4MJB A;  4XS4 A;  1OYJ A;  3TJF A;  3KTL A;  4BVY B;  2V32 A;  2I9H A;  4KE3 A;  3VLN A;  1HNB A;  2FY6 A;  1GSQ A;  4DEJ A;  1OC9 A;  4AJ6 A;  2XBQ A;  5A4U A;  4QL9 A;  3EYT A;  3UBL A;  3GKM A;  1FAA A;  4KDX A;  4IJ3 A;  2ES7 A;  2M80 A;  3QMX A;  5F8B A;  1V40 A;  4OCF A;  2R6K A;  4I2U A;  1XWG A;  4OO4 A;  3EU4 A;  2B1L A;  3CSH A;  1Z7R A;  3GKN A;  5CAX A;  2LJA A;  1SJI A;  5KEJ A;  1ERT A;  1XWB A;  3EVI A;  1N8J A;  3LG6 A;  2GT6 A;  1T00 A;  3ERF A;  1Z6M A;  1PX7 A;  2CAQ A;  3CMI A;  1XWC A;  2GST A;  11GS A;  3ZFB A;  1GL8 A;  1NHY A;  1B9X C;  4I8B A;  2MMO A;  1TKD B;  1YEX A;  3FZ4 A;  2OBI A;  5HR1 A;  4V1A p;  3KCM A;  4KX4 A;  2AUV A;  1TDI A;  2IFQ B;  3J7Y k;  1M9B A;  1GSS A;  4F9Z A;  2C0E A;  4TVE A;  4POL A;  4MJE A;  3QAV A;  3C1S A;  4PQI A;  3F3Q A;  3GH9 A;  4IGJ A;  2V6O A;  1H75 A;  1XW5 A;  1TRW A;  4IHU A;  1XWA A;  1A8L A;  5IM9 A;  1G7O A;  2PPT A;  5HFG A;  1T7P B;  3FR9 A;  4YQM A;  1GWC A;  4TR4 A;  2GS3 A;  2EIO A;  5IMV A;  4BVY A;  2LQQ A;  3Q19 A;  1EP8 A;  4O32 A;  5CP1 A;  1PGT A;  2HYX A;  4ZB9 A;  2IMF A;  5DAK B;  4OD7 A;  1ILO A;  1AQX A;  1CQH A;  2DJ3 A;  1OE8 A;  3KMN A;  4N11 A;  4DSS A;  3VPT A;  2K8V A;  2HLS A;  3N9J A;  2OE1 A;  1JZW A;  4L0W A;  2H66 A;  2UZ8 A;  4ZL8 A;  3F6D A;  1JLV A;  4ECB A;  4Q5R A;  3D0Z A;  3L78 A;  2JL4 A;  1U3I A;  3TOU A;  4KDY A;  1E6B A;  4WR4 A;  1EV9 A;  5ABR A;  3TJB A;  3HZ4 A;  2BJX A;  5D9W A;  5LD0 A;  3GN3 A;  3LSZ A;  3K8N A;  1FHE A;  1TU7 A;  3KMO A;  4HZ4 A;  2IFQ A;  4MCU A;  4KCA A;  1B4Q A;  4I5Q A;  1PA3 A;  1AW9 A;  3S9F A;  1V9W A;  5J3R A;  4F2I A;  2ON7 A;  3GV1 A;  4DSQ A;  4RI7 A;  1SL1 B;  3TOT A;  2R4V A;  1FVJ A;  4XCS A;  2WFC A;  3UJ1 A;  3GH6 A;  1HNA A;  2H75 A;  3LYK A;  2PBJ A;  5JCU A;  1PL1 A;  2HSM A;  3QCP A;  5HR3 A;  4P3Y B;  1MTC A;  5DAK A;  4F0B A;  1FG4 A;  3WT1 A;  2XPD A;  1Y6E A;  4TR1 B;  3PGT A;  3H8Q A;  5FWG A;  2MMA A;  4MZB A;  1V57 A;  1RW1 A;  2VCW A;  2OE0 A;  4GST A;  1W4V A;  1GTU A;  1I9D A;  5D73 A;  2H1A A;  2GZP A;  3DKS A;  2WJU A;  4NXI A;  2WB9 A;  1A2J A;  1H4O A;  2E7P A;  4HJM A;  2I81 A;  4MPG A;  3FR3 A;  3CRU A;  2H30 A;  3DML A;  1XWK A;  1QGV A;  1DSB A;  3P8W A;  3F4S A;  5D8I A;  1RQM A;  2F8F A;  2ZNM A;  1F9M A;  5CYY A;  1TK5 B;  2H1D A;  1X9M B;  2H1G A;  2HZF A;  2QA1 A;  2B1K A;  3ZL5 A;  4XS1 A;  1URM A;  4K1F A;  2YZH A;  2B7J A;  1YQ1 A;  2HZE A;  2CZ3 A;  3GL5 A;  5ELG A;  1SKW B;  2H71 A;  4KSO A;  5DQS A;  2VOC A;  4RQR A;  14GS A;  2R0P A;  4O5R A;  2DJK A;  3IE3 A;  3BCI A;  3HVX A;  1A8Y A;  4AJ8 A;  2A4V A;  1GSD A;  2DKI A;  1SYR A;  2ZCT A;  3MWH A;  2LNS A;  4MH3 A;  5JCW A;  4FH8 A;  1BED A;  1N2A A;  4WBR D;  3KH9 A;  6GSX A;  4O92 A;  4J2F A;  1AQW A;  3DVX A;  2AV4 A;  4MH2 A;  1PKW A;  5B8B A;  2X8C A;  2L5L A;  1AAZ A;  2O8V B;  2YJ7 A;  3Q74 A;  19GS A;  5DAL A;  2DJJ A;  3M1G A;  1M0U A;  2HRA A;  2XBI A;  2PN8 A;  1QMV A;  1PSQ A;  4HDE A;  5GAN D;  3QAW A;  4NAX A;  2FHE A;  5COH A;  2HRF A;  4AF2 A;  3ZVJ A;  2YWM A;  2E2M A;  3H93 A;  5GST A;  1JHB A;  1OE7 A;  1PD2 1;  5D93 A;  5E59 A;  1JZD A;  1TI3 A;  4K9Z A;  1ZMA A;  3FZ9 A;  2GSR A;  4LMW A;  3KJY A;  4PX1 A;  3TKQ A;  4BVX A;  2IMD A;  2H1B A;  2PWJ A;  3DVW A;  2M46 A;  20GS A;  4NHW A;  3D6I A;  1U6T A;  4N0V A;  3UL3 A;  2H8L A;  4ACS A;  4F03 A;  3HVS A;  2VL9 A;  2I3Y A;  4J57 E;  5G1K A;  5JWQ B;  5B6N A;  2GDR A;  3APQ A;  5H5Q A;  1VF4 A;  4K0G A;  1O73 A;  4GSS A;  5EL8 A;  4HJ2 A;  2E2G A;  1BYE A;  6GST A;  3TJK A;  2H0H A;  3UAP A;  4JED A;  4BL7 B;  4XRA A;  5D9X A;  1U3A A;  1ML6 A;  3IR4 A;  3L4N A;  1FOH A;  5ECI B;  5B8A A;  2DJ2 A;  1RK4 A;  1HD2 A;  3NZN A;  1B9Y C;  1O85 A;  3IA1 A;  4BPY A;  1UC7 A;  5B7C A;  2YWI A;  4OMV A;  4K7I A;  1LU4 A;  1FO5 A;  4YAP A;  1O81 A;  1ON4 A;  2CVK A;  1PN0 A;  1T8E B;  1YF0 A;  2H6X A;  5G5F A;  1SEN A;  1VF1 A;  5HR2 A;  3FYG A;  4ZL7 A;  5HFI A;  5KN3 A;  2EIQ A;  4ZB6 A;  2M72 A;  2GSS A;  4WF5 A;  2GT5 A;  3LEF A;  2OKA A;  2AAW A;  2HFD A;  2F51 A;  3IAM 2;  3CRT A;  1S3D A;  2YPM A;  1Z9H A;  1R5A A;  2HSY A;  2VLU A;  1JZO A;  1T4Z A;  1THO A;  2OE3 A;  4L8E A;  4ZBA A;  2LRN A;  3FEU A;  5E4W A;  3UAR A;  1XPV A;  3I69 A;  3LYP A;  4FYB A;  4Z2U A;  3HCZ A;  1AQV A;  1M2D A;  2WRT A;  3GHA A;  4I2T A;  1TRU A;  3MNG A;  2HT9 A;  4HU9 A;  4E8H A;  3GSS A;  3UBK A;  3DIE A;  4WR5 A;  4OCE A;  4BL7 A;  3PR8 A;  2TRX A;  2AYT A;  1A23 A;  1SK2 A;  1B48 A;  3GFK A;  3EPT A;  3DEX A;  3HJM A;  1MDI A;  3LOR A;  1F2E A;  2C3T A;  2O7K A;  3GNJ A;  2OAC A;  1X5D A;  5F07 A;  3UMA A;  2DMM A;  2MZC A;  3HZ8 A;  3UEM A;  5KOX A;  3EWL A;  2CX4 A;  2R0C A;  1F3A A;  4EIP A;  3VI5 A;  4DSR A;  2L4Q A;  3HVV A;  2DJ0 A;  4GQF A;  4ML6 A;  4RUV A;  1UVZ A;  1MEK A;  2R3X A;  4NWY A;  5ECL B;  4AJ7 A;  3TJJ A;  4EVM A;  5B6M A;  1NSW A;  3IOS A;  1V98 A;  1A0F A;  3H4K A;  4TR3 A;  2H0I A;  4H86 A;  3E3E A;  3F4R A;  1TW9 A;  1TJD A;  3IV4 A;  2LS5 A;  4FO5 A;  4DSS B;  2LRC A;  3LXZ A;  5ID2 B;  5G30 A;  2X49 A;  4GF0 A;  1K0M A;  2CQ9 A;  2XC2 A;  4HI7 A;  2FWH A;  1XXU A;  4YKG A;  5HR0 A;  2HI7 A;  5HQP A;  4V2N A;  2N5A A;  2L4C A;  3HYP A;  12GS A;  2DJ1 A;  2DLX A;  1QFN A;  4WXT A;  5ELA A;  1TK8 B;  2R5G A;  5EVO A;  2IL3 A;  4AGS A;  3CBU A;  5CRH A;  5DJM A;  1HNC A;  2VLV A;  3A2W A;  3W8J A;  2DML A;  2IME A;  1VF3 A;  2ALB A;  2GZZ A;  5A4V A;  3ZFL A;  1Q4J A;  3GL3 A;  3WGX A;  2LTK A;  2C3N A;  1XVQ A;  2XPE A;  3TKR A;  4KDU A;  4KH7 A;  2FNO A;  3F4T A;  2V6K A;  4ICY A;  5LNK e;  3NIV A;  4YH2 A;  2OBK A;  2JZR A;  2MBT A;  3G7I A;  4MAB A;  3RDW A;  3JCM L;  1ABA A;  2FA4 A;  4IBP A;  1M7T A;  4ILF A;  3MSZ A;  3VWX A;  2LV3 A;  2O89 A;  2IJY A;  1SK1 A;  5BMU A;  3ZVJ D;  1TRV A;  2RII A;  4V1A g;  3P2A A;  2TIR A;  4K5R A;  2QA2 A;  2F9S A;  3D21 A;  3IAS 2;  4WET A;  4G2E A;  3KEB A;  4TKY A;  5ECM B;  5ID2 A;  4G10 A;  2VCV A;  4HZ2 A;  3ZYW A;  2VUP A;  5DVB A;  2LST A;  2C1Y A;  3QR6 A;  4IS0 A;  4CY8 A;  1F6M C;  3ZML A;  3F8U A;  1GNE A;  1EGO A;  2YCD A;  4HOJ A;  4NMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...