4N11A

Crystal structure of plasmodium falciparum reduced glutaredoxin 1 (pfgrx1) complexed with cisplatin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
108
structure length
108
Chain Sequence
b'TSEAVKKWVNKIIEENIIAVFAKTECPYCIKAISILKGYNLNSHMHVENIEKNPDMANIQAYLKELTGKSSVPRIFINKDVVGGCDDLVKENDEGKLKERLQKLGLVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin
publication title Interaction of Cisplatin with plasmodium falciparum Glutaredoxin 1
rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 39
structure length 108
sequence length 108
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4n11A00
3KXOA 4PUFC 4FIWA 1N2AA 2JACA 2FNOA 2J9HA 5F0GA 2E7PA 3HYPA 1SKWB 3ZZXA 1R4WA 3ERWA 4LMWA 5ECQB 3WGXA 1K0AA 2GZPA 2YV9A 3FR6A 3MAKA 3F4SA 3KP8A 4NPBA 2GS3A 4MCUA 1F6MC 3CYNA 5KN0A 3EWLA 4BA7A 6GSYA 4ZL9A 1YF1A 5CP1A 2VD1A 1GSSA 4O5RA 4IGJA 3GKMA 3VPTA 1PL2A 1GTUA 4JR4A 5JWOB 2TRXA 4TKYA 1VF3A 3OR5A 1C72A 1EP8A 4NHZA 3HXSA 3EC3A 1S3AA 1XWCA 2V6KA 2YJHA 3DXBA 1F3AA 4QL7A 2K18A 1R5PA 2RM5A 4N10A 4OCEA 2L5OA 4NV5A 1A8LA 4K7OA 3IC4A 4ECBA 3H1NA 5A4WA 4V1Ap 5GSTA 1TOFA 4RQXA 1BAYA 4K7IA 4TR0A 1SL1B 2YOIA 4EVMA 2B5XA 4NV2A 4KUNA 3DD3A 3FR9A 1PRXA 3IE3A 1OKTA 3TKSE 1KBNA 4IP1A 3ZMKA 2XPEA 2AAWA 1ZL9A 1R7HA 3CSHA 3HCZA 4WR5A 5ECNB 4NHWA 3TJBA 3BOAA 3GN3A 4LL4B 3D4TA 4AGSA 3LG6A 3GX8A 1O8XA 1EGRA 1GTBA 2LV3A 2P31A 2H0GA 2X64A 4JU5A 4JZQA 3TJJA 5CNWA 4XS6A 1KNGA 2G2QA 3PR8A 3DIEA 3BD2A 1YEXA 2ALBA 3HDCA 1PQNA 1BYEA 4IQ1A 4GSTA 1SJ6A 4V2MA 2REMA 1K0OA 2VL9A 2O8VB 2HZFA 3APQA 4GRFA 4BVXA 3UOMA 2B1LA 4EDZA 4GXZA 3TRXA 1ON4A 5G1LA 3GKKA 3FZAA 2AUVA 2I1UA 2JU5A 4GWRA 3FY7A 2C8UA 1A0FA 1X9SB 2LJAA 2WJUA 3D5JA 2AB6A 2FCHA 3ZYWA 4EDYA 5HFIA 2O89A 2YZUA 3Q19A 3APOA 3LGCA 1XFLA 2WDUA 3MWHA 3FYGA 1NSWA 1B48A 5C04A 19GSA 1ZCPA 4KX4A 5IMAA 3G7YA 1JZRA 1O81A 3W8SA 1PD21 3C1RA 3VI7A 5ECOB 1ABAA 1BG5A 1F9MA 3TRPA 1ZYEA 3VWXA 1OE8A 1O85A 2KP1A 3ZREA 1DSBA 1FB6A 2OJLA 3TJKA 2F8AA 1TI3A 3S9FA 4WKWA 3FZ5A 5B7CA 5EY6A 2N5FA 1GUHA 2RIIA 5B8BA 3SWLA 1XIYA 1TK8B 4MMMA 2VAFA 3O3TA 5ECRB 2R4VA 2EC4A 3UL3A 1BQ7A 2L4QA 5CRGA 4HZ2A 3HHVA 1YJ6A 4MF6A 2GSQA 4HQZA 2MMZA 4MP4A 2X8GA 1HD2A 1PKWA 5HFGA 2HLSA 3UIWA 3UVHA 4OO5A 2X99A 4IJ3A 3QPMA 4J2FA 1VGLA 2ES7A 2GZYA 5G2ZA 3FZ4A 4ZB8A 4WF5A 4DSRA 2DMLA 3L78A 4ZXGA 3DMLA 4RI7A 1TRWA 4BPYA 2KP2A 4ID0A 1B8XA 1XWBA 3KH9A 3W6GA 2H66A 1OC9B 1A0RP 1Z5YE 1M99A 3EURA 3TGZA 3CRUA 1JZWA 22GSA 1URMA 3HVVA 2LNSA 1Q98A 3EE2A 2CAQA 3C1SA 1K3YA 4H86A 1YY7A 1EEMA 1V9WA 3V1WA 2NPBA 3CMIA 3TUEA 2YWMA 3D22A 3FKFA 3E9JB 1JLWA 2H75A 3WD6A 1GULA 1ZOFA 4TN8A 4YAVA 1ACVA 1TK0B 5IO0A 4MH2A 2HSYA 4RUVA 2V1MA 1RW1A 4NMUA 4POKA 1A23A 4F03A 1ILOA 1SD9A 4PNFA 4IBPA 1SD8A 2A2RA 5EPFA 3WT2A 2J23A 5IPHA 2DBCA 2C0EA 2RUEA 4AJ6A 4K0GA 3US3A 1TKDB 1PMTA 1FW1A 5DJLA 1EEJA 4F82A 1UC7A 3GV1A 3F3RA 4BL7A 1GSDA 3QCPA 3LEFA 1M9AA 1NHYA 2BTOT 2FHEA 4OCFA 4KDUA 1GNEA 5ABRA 1SK1A 3GL3A 1SYRA 3TOTA 1V58A 4MABA 2QKEA 3L0HA 3TKSA 5HR2A 4D73B 5CRWA 3LSZA 3TB2A 1S3DA 2OA7A 4X0XA 4ECCA 3HKRA 4E8EA 4QQ7A 1O6JA 4KH7A 2IMFA 1WJKA 1XW5A 5IMDA 5C00A 2LRCA 3HD5A 1FHEA 2E0QA 3P7XA 1VF1A 2DMMA 5DCGA 2XC2A 1VF2A 1G0TA 4G9HA 1PGTA 5HR0A 4TVEA 2CQ9A 1FO5A 5D96A 3KGKA 4ML1A 1DE2A 4HZ4A 3KH7A 6GSTA 2GGTA 5JCGA 5D9VA 3TJGA 2GSRA 4CW9A 2H73A 1SJIA 1M2AA 3LWAA 4K9ZA 5F07A 1G6YA 2Z9SA 3GKXA 4ULXA 4K6XA 4DSSA 1J08A 4ACSA 2D2ZA 1UVZA 3ERFA 4EO3A 1DE1A 2OBKA 5CO3A 2GQMA 2XBIA 3TRQA 4KNDA 4QL9A 3CTGA 3H4KA 4FYCA 5AISA 4MZCA 2FUG2 5D9XA 4GTUA 2HNLA 3H79A 1O73A 2WFCA 2A4VA 2R37A 4TRXA 4DSSB 4F2IA 2YANA 4ZBDA 3M9KA 3KMOA 1XW6A 6GSUA 4NAXA 1T4YA 5AIVA 2H0IA 1I5GA 1K0CA 1N8JA 4DVCA 2L4CA 2CA8A 2X8HA 3QOUA 3IAM2 5IPGA 5CAXA 4XIHA 4L0WA 1PSQA 2P0GA 2L6DA 3F6FA 2NVLA 1SENA 5D9TA 2VL2C 2YWIA 3U5RE 1GUKA 3GA4A 2GSSA 4GQFA 3MNGA 1QK8A 4ZL8A 2LJKA 1MD3A 2IIYA 3D6IA 4XRDA 3KZQA 4F9ZA 4IP6A 5AN1A 4WBRD 5CRDA 1GP1A 4XTSA 2F8FA 3DVWA 3FK8A 4GCIA 2VCTA 4IVFA 1M2DA 2G0FA 1YF0A 4GSSA 5HQPA 2YWNA 2H19A 5KN2A 2XHFA 1V2AA 4JE1A 2LRTA 3QMXA 5G1KA 3F8UA 2P5RA 3FW2A 3GURA 1FOVA 6GSWA 1TRUA 4TOPA 1TU8A 3VPQA 4G2EA 4TR3A 1U88A 4TXVA 1X5EA 2OBIA 3UBKA 4NWYA 3A3TA 1SKSB 4XS4A 3CTFA 3AY8A 9GSSA 4L8EA 5H5QA 1LJRA 4POLA 2H74A 2IWTA 1MDJA 3SBCA 1XWGA 5A5KA 3GUSA 2BJXA 4Q5FA 2X8CA 4KGIA 1OC8A 5D8IA 2C80A 1WOUA 14GSA 4PNGA 2VOCA 5IM9A 2H6XA 2VLTA 1K0BA 3J7Yb 3KMNA 4FYUA 4XS4B 4PGTA 1QMVA 3A2VA 3R2QA 2KUCA 2MBSA 3IBHA 2FY6A 3CSJA 3KJYA 3DKSA 4KCEA 5LNKe 1AQWA 4MJCA 2JZSA 5J9CA 4MPFA 1UA5A 1OAZA 2GTUA 2LRNA 2PMTA 3EYTA 2H8LA 2PU9C 2V41A 2C3TA 2GSTA 16GSA 3N5OA 2VUPA 4LL1B 1K0DA 3IV4A 4ISDA 2VD0A 4HI7A 1M9BA 2KLXA 2CX4A 1MTCA 4MLYA 3Q74A 1WPIA 1E2YA 4MJEA 1XBSA 2CT6A 2ON5A 1Q4JA 2K8VA 1FVKA 2XPDA 1M7TA 4P3YB 3UAPA 1GSEA 2MMOA 4J56E 4IKHA 3QAWA 1OC3A 2HXKA 4X43A 3E0UA 2B6MA 3GKNA 2HT9A 4FYBA 4MZWA 2F9SA 1AIUA 4EE0A 3UJ1A 1OVNA 5GAND 3VLNA 1AW9A 4DSQA 2OE3A 4YQUA 3ME7A 2PUKC 1K3LA 4GSNA 3BCKA 4YH2A 2TRCP 2DJ2A 2MBTA 1ML6A 3IR4A 2QSIA 3KEBA 4I97A 1BJXA 4CDOA 5J5NA 2MMAA 1QXHA 3C8EA 2OADA 1CQGA 3HZ8A 3WGDA 1GH2A 3M3MA 1ERWA 2NTOA 2FWHA 1EOHA 3KIJA 4K0NA 4WR4A 2VM2A 1TTZA 2B1KA 1TP9A 2LS5A 1UN2A 1THXA 4OFTA 1ERTA 1TJDA 5J3RA 2RLIA 1OYJA 1A2JA 1OC9A 2V32A 2JSZA 5CYYA 1BEDA 1PKZA 3NIVA 1WE0A 5E4WA 1U87A 1A24A 2O85A 4JRRA 3PGTA 4OO4A 4ZL7A 3GL5A 3F4RA 5J4UA 1J9BA 3LXTA 4AF2A 1AAZA 1YZXA 2AHEA 2AYTA 2M80A 1A2LA 1F37A 1QFNA 4EKZA 2VL3A 4MZBA 5H5RA 1PX7A 3G9BA 2DJ0A 4V1Ag 18GSA 4ZIJA 4L5OA 4HQSA 4KDXA 1JHBA 1U3IA 4EL1A 5DDLA 1THOA 2WULA 2HZEA 2O87A 4TW5A 1Z6NA 1LBKA 4HJ2A 1K3OA 4LA1A 1GLPA 2H71A 4HDEA 4I5QA 2VCWA 2H76A 3I6AA 3GYKA 4ML6A 1TU7A 1NHOA 20GSA 4IS0A 4HS1A 3RDWA 2A2SA 3EINA 3EU4A 3LYKA 3ZLPA 1W4VA 4KCAA 1EV9A 5INYA 1JZOA 2R2JA 4MA9A 3FEUA 5HR3A 3F9UA 1Z6MA 5ECIB 2PBJA 4JR6A 3BCIA 2PGTA 1XCCA 2DC5A 2HZEB 4PXOA 2WCIA 4POMA 4ZB9A 2WRTA 13GSA 3F0IA 1XOAA 3U6VA 1A2MA 1MDIA 1T1VA 2C3NA 4D73A 4ZB6A 5B6NA 1U3AA 1SKRB 2GQKA 3ZFBA 1YQ1A 1VF4A 2JZRA 3IA1A 1QGVA 4JBBA 1WWJA 4EF0A 1A8YA 3O6TA 1ZZYA 1OE7A 2L5LA 4KDYA 5JCWA 3KTBA 2OKAA 2DSAA 2ON7A 2DIYA 5KEJA 3D0ZA 5AIXA 2LKUA 3HY2A 3QFAC 4WETA 3ZIVA 5IOXA 4GQCA 2IMEA 5E59A 2H01A 3DWVA 2B7KA 6GSVA 3G7IA 3KM6A 3KTLA 2YNXA 3BBYA 1FB0A 3M1GA 5IMZA 1X5CA 2FLSA 4LMVA 2LQOA 1ST9A 1TDIA 1BX9A 1AC1A 4POBA 1JZDA 3D4MA 3L9VA 2IFQA 5F06A 3GSTA 3PINA 2GVPA 5DVBA 5IOWA 2C0GA 1GSUA 8GSSA 5IMVA 2I3YA 7GSSA 3HA9A 2I9HA 2DJJA 4I2UA 1GSYA 3UEMA 2DLXA 3IDVA 3DYRA 5DQSA 5GSSA 3LYPA 2LUSA 2MYGA 3VK9A 1DUGA 1U6TA 2CVKA 5DBQA 1FG4A 5AGYA 4FH8A 3GHAA 4V2LA 2IFQB 2OE0A 1EZKA 2R3XA 4YQMA 2HRNA 4JEDA 1XVQA 4K7NA 3KD0A 4G19A 3NZNA 1H4OA 2H6ZA 2WB9A 3ZTLA 4F0BA 4PQ1A 1TRVA 4HEA2 2B7JA 5ECMB 5IIZA 1XW9A 4X1UA 1Z7PA 3M9JA 1TK5B 3UARA 5FT3A 1JFUA 2C4JA 5J41A 2YWOA 2MZCA 2R6KA 2LEGA 1RK4A 1HYUA 2EIQA 3C7MA 5GZZB 4PURA 1SK0A 5B8AA 1SL2B 1ERVA 2PERA 4BWQA 2M72A 2IMKA 1E6BA 2B3SA 2H30A 3CSIA 3I9V2 3O76A 4PX1A 3M0FA 2H1DA 1MD4A 1YKCA 4N0ZA 2IMIA 2WS2A 2HI7A 3GRXA 3EU3A 3EVIA 3A2WA 3IXRA 4ILFA 4O7HA 1S3CA 2C0DA 4KSMA 3BJ5A 5ELGA 1WRYA 1FAAA 2HFDA 2RM6A 3IK9A 5DJMA 1Y25A 10GSA 5HFKA 4WBJA 1Z7RA 3VFIA 2H6YA 3L9SA 2LSTA 4MJBA 5EVOA 1T00A 2LJRA 2MMNA 2PVQA 3ZMLA 3VI5A 3D21A 2N5BA 3FZ9A 3CBUA 4AJ8A 3CXGA 4HU7A 4N11A 5KN3A 5KN1A 3HZ4A 1GSFA 3GNJA 4IQAA 3I43A 1WP0A 2VCQA 5FWGA 1J0FA 2RUFA 1HNCA 2YP6A 1SU9A 2HE3A 1GRXA 3ISOA 1QQ2A 2GZZA 1Z3EA 1R5AA 4EC0A 2IJYA 2AV4A 4TR1A 2P5QA 1V40A 1GLQA 5G30A 1EGOA 2WZ9A 1SJZA 3H93A 2AJQB 5ECPB 5LCZA 2JL4A 3P2AA 1IYHA 5D73A 4N30A 2BMXA 4HUAA 4XCSA 11GSA 1ZYQB 3EMXA 1X9MB 1X9WB 2JZTA 2NDOA 3JCML 3IHQA 1HNAA 2ZNMA 2DJKA 3FHKA 4XS1A 3C73A 2C0FA 5ENUA 2DIZA 5A4UA 4TR1B 1B9XC 4HJMA 3LFLA 3WGEA 5IQYA 3PH9A 1DBYA 1R26A 2KOKA 2LNTA 6GSXA 2K6VA 12GSA 3L9UA 1GTIA 4ZBBA 2VCVA 2IMDA 3HJPA 1B9YC 1O8WA 1NM3A 2CAIA 3MDKA 5EL8A 1EP7A 3F3QA 2HYXA 5IO2A 5ECHB 1QUWA 2HRFA 2QGVA 4BVYA 2XBQA 1T3BA 4YQVA 1WIKA 5ID2A 3F6DA 4MH3A 1IYIA 3HVSA 3IAS2 2QC7A 5L71A 1V98A 4PQHA 3Q6OA 4WEYA 3QR6A 3LJRA 4G10A 4K2DA 2VL2A 2VLUA 2CZ2A 5A4VA 1EWXA 2GT5A 5DQYA 4WF4A 5DCHA 2H1GA 4FO5A 4EUYA 2CZ3A 5ID2B 2YN1A 4KSOA 5COHA 1JLVA 3CRTA 4XHMA 3RHBA 4OMVA 1M2BA 3EMPA 2V6OA 2YJ7A 2PPTA 5F8BA 5FHIA 4OFMA 3ED3A 2B5YA 1G7EA 1YKAA 2L57A 2LQQA 3P8WA 1K0NA 4ZBAA 1VRSD 2C1YA 3GSSA 5ELAA 1GL8A 3HJOA 3QAGA 1X0RA 5CRHA 1O7UA 1Z9HA 3KP9A 3I69A 4LLRA 2FGXA 3GH6A 4KE3A 4TR4A 3J7Yk 1MEKA 3LQ7A 3MSZA 2IN3A 4K8MA 4RQRA 2CV4A 1T4ZA 1SYXA 4CHSA 3HVXA 2GDRA 5DAKA 1XZOA 2H72A 2FD3A 3FRCA 4E8HA 4RI6A 2V2GA 1TXXA 2CVBA 3M8NA 3LORA 3TKSC 3TKRA 5DALA 2YPMA 2GLRA 4NXIA 2FWFA 1F3BA 4O92A 1GNWA 2OACA 1CQHA 2KHPA 1YDKA 3GTUA 2VIMA 2B5EA 3KCMA 1HQOA 4KW6A 2FWGA 2E2GA 1HNBA 2F51A 4ZILA 5DAKB 3HJMA 1SL0B 5JCUA 4KAEA 5F05A 3GH9A 5ECSA 2L59A 5DALB 3TDGA 1K0MA 4AJ7A 5D93A 2K8SA 2VM1A 1TI1A 3UBLA 1ZMAA 5H5SA 5CREA 6GSSA 3A5WA 3GTUB 3ZFLA 2OE1A 2PWJA 2CX3A 4HU9A 1LU4A 17GSA 1PN9A 5D9WA 2I4AA 4IHUA 3GFKA 2JSYA 2YV7A 3ZRDA 1AQXA 3VWVA 1H75A 3QFBC 3RAZA 1T8EB 4HOJA 4L5LA 4ECIA 4L0UA 4I2TA 4PUAA 4ECJA 2TIRA 2H0HA 1F2EA 1RQMA 1X5DA 1V57A 4IELA 3K8NA 5G5FA 2CVDA 4IN0A 2FA4A 3ZITA 4IW9A 3G7JA 4YAPA 2WGRA 3W8JA 4I6XA 3ZIJA 4OFNA 3RPPA 3RBTA 3TKPA 3E3EA 3P90A 3DEXA 5G31A 4MJAA 2NBSA 5LD0A 1PX6A 1AXDA 3APSA 2IPAA 4MF7A 1KEBA 3NOFA 2F3MA 3TKQA 3DVXA 3LXZA 4DEJA 3TOUA 4OD7A 2EIRA 2H70A 1GSQA 3C71A 3IK7A 2L6CA 3UVTA 4O32A 3TCOA 4BWSA 2GQLA 1YEPA 1FVJA 4IJIA 2PVOC 4MPGA 3IRAA 5IMCA 3F63A 2C3QA 2GT6A 5G5EA 3L4NA 1EOGA 3TJFA 1EV4A 4J57E 4MK3A 1I9DA 2M46A 1T7PB 1B4PA 3QAVA 1GWCA 2DJ1A 1GTAA 1OKDA 1USBA 1KTEA 5JWQB 4OWYA 1Y6EA 2H1AA 2JADA 1M0UA 4EXJA 1PL1A 2I81A 2IL3A 1ZGNA 3DGQA 3VWWA 3ZL5A 3GIXA 3WT1A 3ZVJD 5GAPD 4MDCA 5ECLB 1XPVA 1XWAA 4F0CA 5B6MA 2VO4A 4K1FA 4KB3A 4Q5NA 3IPZA 3VURA 4V2NA 3QD9A 3ZVJA 3IOSA 4MF5A 1MDKA 4N0VA 2N5AA 2LTKA 1W89A 3Q18A 4Q5QA 1WMJA 4GLTA 3QDNA 3RHCA 3UMAA 2FA8A 1XXUA 4I8BA 1GUMA 3GMFA 4WXTA 2VCZA 1AUCA 3H8QA 2ZCTA 3ME8A 2E2MA 3F4TA 3WYWA 3FR3A 2R5GA 5J9BA 1TRSA 1TW9A 1NW2A 1ERUA 2O7KA 5IMFA 5ECKB 4TXOA 3A2XA 2DJ3A 3ERGA 4PQIA 4KA0A 4GF0A 5JWRB 3GX0A 2VLVA 3RPNA 2YZHA 2EIOA 2ZUPA 2K9FA 2H1BA 2FWEA 4XRAA 1G7OA 1XVWA 4Z7XA 5HR1A 1G6WA 2VCXA 1XWKA 4Q5RA 2YCDA 2PN8A 3N9JA 3DRNA 1SK2A 2HSHA 1XOBA 3VWUA 1AQVA 1B4QA 1PA3A 4TXOB
chains in the Genus database with same CATH superfamily
3KXOA 4PUFC 4FIWA 1N2AA 2JACA 2FNOA 2J9HA 5F0GA 2E7PA 3HYPA 1M3IA 1SKWB 3ZZXA 1R4WA 3ERWA 4LMWA 5ECQB 3WGXA 1K0AA 2GZPA 2R0GA 2YV9A 3FR6A 3MAKA 3F4SA 3KP8A 4NPBA 2GS3A 4MCUA 1F6MC 3CYNA 5KN0A 3EWLA 4BA7A 6GSYA 4ZL9A 1YF1A 5CP1A 2VD1A 1GSSA 4O5RA 4IGJA 3GKMA 3VPTA 1PL2A 1GTUA 4JR4A 5JWOB 2TRXA 4TKYA 1VF3A 3OR5A 1C72A 1EP8A 4NHZA 3HXSA 3EC3A 1S3AA 1XWCA 2V6KA 2YJHA 3DXBA 1F3AA 4QL7A 2K18A 1R5PA 2RM5A 4N10A 2HSMA 4OCEA 2L5OA 4NV5A 1A8LA 2X4AA 4K7OA 3IC4A 4ECBA 3H1NA 5A4WA 4V1Ap 5GSTA 1TOFA 4RQXA 1BAYA 4K7IA 4TR0A 1SL1B 2YOIA 4EVMA 2B5XA 4NV2A 4KUNA 3DD3A 3FR9A 1PRXA 3IE3A 1OKTA 3TKSE 1KBNA 4IP1A 3ZMKA 2XPEA 4G0LA 2AAWA 1ZL9A 1R7HA 3CSHA 3HCZA 4WR5A 5ECNB 4NHWA 3TJBA 3BOAA 3GN3A 4LL4B 3D4TA 4AGSA 3LG6A 3GX8A 1O8XA 1EGRA 1GTBA 2LV3A 2P31A 2H0GA 2X64A 4JU5A 4JZQA 3TJJA 5CNWA 4XS6A 1KNGA 2G2QA 3PR8A 3DIEA 3BD2A 1YEXA 2ALBA 3HDCA 1PQNA 1BYEA 4IQ1A 4GSTA 1SJ6A 4V2MA 2REMA 1K0OA 2VL9A 2O8VB 2HZFA 1M3JA 3APQA 4GRFA 4BVXA 3UOMA 2B1LA 4EDZA 4GXZA 3TRXA 1ON4A 5G1LA 3GKKA 3FZAA 2AUVA 2I1UA 2JU5A 4GWRA 3FY7A 2C8UA 1A0FA 1X9SB 2LJAA 2WJUA 3D5JA 2AB6A 2FCHA 3ZYWA 4EDYA 5HFIA 2O89A 2YZUA 3Q19A 3APOA 3LGCA 1XFLA 2WDUA 3MWHA 3FYGA 1NSWA 1B48A 4BVXB 5C04A 19GSA 1ZCPA 4KX4A 5IMAA 3G7YA 1JZRA 1O81A 3W8SA 1PD21 3C1RA 3VI7A 5ECOB 1ABAA 1BG5A 1F9MA 3TRPA 1ZYEA 3VWXA 1OE8A 1O85A 2KP1A 3ZREA 1DSBA 1FB6A 2OJLA 3TJKA 1ZYNA 2F8AA 1TI3A 3S9FA 4WKWA 3FZ5A 5B7CA 5EY6A 2N5FA 1GUHA 2RIIA 5B8BA 3SWLA 1XIYA 1TK8B 4MMMA 2VAFA 3O3TA 5ECRB 2R4VA 2EC4A 3UL3A 1BQ7A 2L4QA 5CRGA 4HZ2A 3HHVA 1YJ6A 4MF6A 2GSQA 4HQZA 2MMZA 4MP4A 2X8GA 1HD2A 1PKWA 5HFGA 2HLSA 3UIWA 3UVHA 4OO5A 2X99A 4IJ3A 3QPMA 4J2FA 1VGLA 2ES7A 2GZYA 5G2ZA 3FZ4A 4ZB8A 4WF5A 4DSRA 2DMLA 3L78A 4ZXGA 3DMLA 4RI7A 1TRWA 4BPYA 2KP2A 4ID0A 5BMUA 1B8XA 1XWBA 3KH9A 3W6GA 2H66A 1OC9B 1A0RP 1Z5YE 1M99A 3EURA 3TGZA 3CRUA 1JZWA 22GSA 1URMA 3HVVA 2LNSA 1Q98A 3EE2A 2CAQA 3C1SA 1K3YA 4H86A 1YY7A 1EEMA 1V9WA 3V1WA 2NPBA 3CMIA 3TUEA 2YWMA 3D22A 3FKFA 3E9JB 1JLWA 2H75A 3WD6A 1GULA 1ZOFA 4TN8A 4YAVA 1ACVA 1TK0B 5IO0A 4MH2A 2HSYA 4RUVA 2V1MA 1RW1A 4NMUA 4POKA 1A23A 4F03A 1ILOA 1SD9A 4PNFA 4IBPA 1SD8A 2A2RA 5EPFA 3WT2A 2J23A 5IPHA 2DBCA 2C0EA 2RUEA 4AJ6A 4K0GA 3US3A 1TKDB 1PMTA 1FW1A 5DJLA 1EEJA 4F82A 1UC7A 3GV1A 3F3RA 3MIXA 4BL7A 1GSDA 3QCPA 3LEFA 1M9AA 1NHYA 2BTOT 2FHEA 4OCFA 4KDUA 1GNEA 5ABRA 1SK1A 3GL3A 2UZ8A 1SYRA 3TOTA 1V58A 4MABA 2QKEA 3L0HA 3TKSA 5HR2A 4D73B 5CRWA 3LSZA 3TB2A 1S3DA 2OA7A 4X0XA 4ECCA 3HKRA 4E8EA 4QQ7A 1O6JA 4KH7A 2IMFA 1WJKA 1XW5A 5IMDA 5C00A 2LRCA 3HD5A 4BL7B 1FHEA 2E0QA 3P7XA 1VF1A 2DMMA 5DCGA 2XC2A 1VF2A 1G0TA 4G9HA 1PGTA 5HR0A 4TVEA 2CQ9A 1FO5A 5D96A 3KGKA 4ML1A 1DE2A 4HZ4A 3KH7A 6GSTA 2GGTA 5JCGA 5D9VA 3TJGA 2GSRA 4CW9A 2H73A 1SJIA 1M2AA 3LWAA 4K9ZA 5F07A 1G6YA 2Z9SA 3GKXA 4ULXA 4K6XA 4DSSA 1J08A 4ACSA 4O5QA 2D2ZA 1UVZA 3ERFA 4EO3A 1DE1A 2OBKA 5CO3A 2GQMA 2XBIA 3TRQA 4KNDA 4QL9A 3CTGA 1S3RA 3H4KA 4FYCA 5AISA 4MZCA 2FUG2 5D9XA 4GTUA 2HNLA 3H79A 1O73A 2WFCA 2A4VA 2R37A 4TRXA 4DSSB 4F2IA 2YANA 4ZBDA 3M9KA 3KMOA 1XW6A 6GSUA 4NAXA 1T4YA 5AIVA 2H0IA 1I5GA 1K0CA 1N8JA 4DVCA 2L4CA 2CA8A 2X8HA 3QOUA 3IAM2 5IPGA 5CAXA 4XIHA 4L0WA 2HRAA 1PSQA 2P0GA 2L6DA 3F6FA 2NVLA 1SENA 5D9TA 2VL2C 2YWIA 3U5RE 1GUKA 2DKIA 2GSSA 3GA4A 3MNGA 4GQFA 1QK8A 4ZL8A 2LJKA 1MD3A 2IIYA 3D6IA 4XRDA 3KZQA 4F9ZA 4IP6A 5AN1A 4WBRD 5CRDA 1GP1A 4XTSA 2F8FA 3DVWA 3FK8A 4GCIA 2VCTA 4YKGA 4IVFA 1M2DA 2G0FA 1YF0A 4GSSA 5HQPA 2YWNA 2H19A 5KN2A 2XHFA 1V2AA 4JE1A 2LRTA 3QMXA 5G1KA 3F8UA 2P5RA 3FW2A 3GURA 1FOVA 6GSWA 1TRUA 4TOPA 4YKFA 1TU8A 3VPQA 4G2EA 4TR3A 1U88A 4TXVA 1X5EA 2OBIA 3UBKA 4NWYA 3A3TA 1SKSB 4XS4A 3CTFA 3AY8A 9GSSA 4L8EA 5H5QA 1LJRA 4POLA 2H74A 2IWTA 1MDJA 3HVNA 1XG8A 3SBCA 1XWGA 5A5KA 3GUSA 4CY8A 2BJXA 4Q5FA 2X8CA 4KGIA 1OC8A 5D8IA 2C80A 1WOUA 14GSA 4PNGA 2VOCA 5IM9A 2H6XA 2VLTA 1K0BA 3J7Yb 3KMNA 4FYUA 4XS4B 4PGTA 1QMVA 3A2VA 3R2QA 2KUCA 2MBSA 3IBHA 2FY6A 3CSJA 3KJYA 3DKSA 4KCEA 5LNKe 1AQWA 4MJCA 2JZSA 5J9CA 4MPFA 1UA5A 1OAZA 2GTUA 2LRNA 2PMTA 3EYTA 2H8LA 2PU9C 2V41A 2C3TA 2GSTA 16GSA 3N5OA 2VUPA 4LL1B 1K0DA 3IV4A 2DKHA 4ISDA 2VD0A 4HI7A 1M9BA 2KLXA 2CX4A 1MTCA 4MLYA 3Q74A 1WPIA 1E2YA 4MJEA 1XBSA 2CT6A 2ON5A 1Q4JA 2K8VA 1FVKA 2XPDA 1M7TA 4P3YB 3UAPA 1GSEA 2MMOA 4J56E 4IKHA 3QAWA 1OC3A 2HXKA 4X43A 3E0UA 2B6MA 3GKNA 2HT9A 4FYBA 4MZWA 2F9SA 4Z2UA 1AIUA 4EE0A 3UJ1A 1OVNA 5GAND 3VLNA 1AW9A 4DSQA 2OE3A 4YQUA 3ME7A 2PUKC 1K3LA 4GSNA 3BCKA 4YH2A 2TRCP 2DJ2A 2MBTA 1ML6A 3IR4A 2QSIA 3KEBA 4I97A 1BJXA 4CDOA 5J5NA 2MMAA 1QXHA 3C8EA 2OADA 1CQGA 3HZ8A 3WGDA 1GH2A 3M3MA 1ERWA 2NTOA 2FWHA 1EOHA 3KIJA 4K0NA 4WR4A 2VM2A 1TTZA 2B1KA 1TP9A 2LS5A 1UN2A 1THXA 4BIKA 4OFTA 1ERTA 3IC8A 1TJDA 5J3RA 2RLIA 1OYJA 1A2JA 1OC9A 2V32A 2JSZA 5CYYA 1BEDA 1PKZA 3NIVA 1WE0A 5E4WA 1U87A 1A24A 2O85A 4JRRA 3PGTA 4OO4A 4ZL7A 3GL5A 3F4RA 5J4UA 1J9BA 3LXTA 4AF2A 1AAZA 1YZXA 2AHEA 2AYTA 2M80A 1A2LA 1F37A 1QFNA 4EKZA 2VL3A 4MZBA 5H5RA 1PX7A 3G9BA 2DJ0A 4V1Ag 18GSA 4ZIJA 4L5OA 4HQSA 4KDXA 1JHBA 1U3IA 4EL1A 5DDLA 1THOA 2WULA 3A5IA 3MYDA 2HZEA 2O87A 4TW5A 1Z6NA 1LBKA 4HJ2A 1K3OA 4LA1A 1GLPA 2H71A 4HDEA 4I5QA 2VCWA 2H76A 3I6AA 3GYKA 4ML6A 1TU7A 1NHOA 20GSA 4IS0A 4HS1A 3RDWA 2A2SA 3EINA 3EU4A 3LYKA 3ZLPA 1W4VA 4KCAA 1EV9A 5INYA 1JZOA 2R2JA 4MA9A 3FEUA 5HR3A 3F9UA 1Z6MA 5ECIB 2PBJA 4JR6A 3BCIA 2PGTA 1XCCA 2DC5A 2HZEB 4PXOA 2WCIA 4EIPA 4POMA 4ZB9A 2WRTA 13GSA 3F0IA 1XOAA 3U6VA 2A4HA 1A2MA 1MDIA 1T1VA 2C3NA 4D73A 4ZB6A 5B6NA 1U3AA 1SKRB 2GQKA 3ZFBA 1YQ1A 1VF4A 2JZRA 3IA1A 1QGVA 4JBBA 1WWJA 4EF0A 1A8YA 3O6TA 1ZZYA 1OE7A 2L5LA 4KDYA 4MNNA 5JCWA 3KTBA 2OKAA 2DSAA 2ON7A 2DIYA 5KEJA 3D0ZA 5AIXA 2LKUA 3HY2A 3QFAC 4WETA 3ZIVA 5IOXA 4GQCA 2IMEA 5E59A 2H01A 3DWVA 2B7KA 6GSVA 3G7IA 3KM6A 3KTLA 2YNXA 1FOHA 3BBYA 4O5UA 1FB0A 3M1GA 5IMZA 1X5CA 2FLSA 4K5SA 4LMVA 2LQOA 1ST9A 1TDIA 1BX9A 1AC1A 4POBA 1JZDA 3D4MA 3L9VA 2IFQA 5F06A 3GSTA 3PINA 2GVPA 5DVBA 5IOWA 2C0GA 1GSUA 8GSSA 5IMVA 2I3YA 7GSSA 3HA9A 2I9HA 2DJJA 4I2UA 1GSYA 3UEMA 2DLXA 3IDVA 3DYRA 5DQSA 5GSSA 3LYPA 2LUSA 2MYGA 3VK9A 1DUGA 1U6TA 2CVKA 5DBQA 1FG4A 5AGYA 4FH8A 3GHAA 4V2LA 2IFQB 2OE0A 1EZKA 2R3XA 4YQMA 2HRNA 1PFOA 1XVQA 4JEDA 3KD0A 4K7NA 4G19A 3NZNA 1H4OA 2H6ZA 2WB9A 3ZTLA 4F0BA 4PQ1A 1TRVA 4HEA2 2B7JA 5ECMB 5IIZA 1XW9A 4X1UA 2R0PA 1Z7PA 3M9JA 3R3EA 1TK5B 3UARA 5FT3A 2QA2A 1JFUA 2C4JA 5J41A 2YWOA 2MZCA 2R6KA 2LEGA 1RK4A 1HYUA 2EIQA 3C7MA 5GZZB 4PURA 1SK0A 5B8AA 1SL2B 1ERVA 2PERA 4BWQA 2M72A 2IMKA 1E6BA 2B3SA 2H30A 4EIQA 3CSIA 3I9V2 3O76A 4PX1A 3M0FA 2H1DA 4PTSA 4KF9A 1MD4A 1YKCA 4N0ZA 2IMIA 2WS2A 2HI7A 3GRXA 3EU3A 3EVIA 3A2WA 3IXRA 3PPUA 4ILFA 4O7HA 1S3CA 2C0DA 4KSMA 3BJ5A 5ELGA 1WRYA 1FAAA 2HFDA 2RM6A 3IK9A 5DJMA 1Y25A 10GSA 5HFKA 4WBJA 1Z7RA 3VFIA 2H6YA 3L9SA 2LSTA 4MJBA 5EVOA 1T00A 2LJRA 2MMNA 2PVQA 3ZMLA 3VI5A 3D21A 2N5BA 3FZ9A 3CBUA 4AJ8A 3CXGA 4HU7A 4N11A 5KN3A 5KN1A 3HZ4A 1GSFA 3GNJA 4IQAA 3I43A 1WP0A 2VCQA 5FWGA 1J0FA 2RUFA 1HNCA 2YP6A 1SU9A 2HE3A 1GRXA 3ISOA 5BRTA 1QQ2A 2GZZA 1Z3EA 2A2PA 1R5AA 4EC0A 2IJYA 2AV4A 4TR1A 2P5QA 1V40A 1GLQA 5G30A 1EGOA 2WZ9A 1SJZA 3H93A 5KOXA 2AJQB 5ECPB 5LCZA 2JL4A 3P2AA 1IYHA 5D73A 4N30A 4K2XA 2BMXA 4HUAA 4XCSA 11GSA 1ZYQB 3EMXA 1X9MB 4CY6A 1X9WB 2JZTA 2NDOA 3CQFA 3JCML 3IHQA 1HNAA 2ZNMA 1PN0A 2DJKA 3FHKA 4XS1A 3C73A 2C0FA 5ENUA 2DIZA 5A4UA 4TR1B 1B9XC 4HJMA 3LFLA 3WGEA 5IQYA 3PH9A 1DBYA 1R26A 2KOKA 2HRKA 2LNTA 6GSXA 2K6VA 12GSA 3L9UA 1GTIA 4ZBBA 2VCVA 2IMDA 3HJPA 1B9YC 1O8WA 1NM3A 2CAIA 3MDKA 5EL8A 1EP7A 3F3QA 2HYXA 5IO2A 5ECHB 1QUWA 2HRFA 2QGVA 4BVYA 2XBQA 1T3BA 4YQVA 1WIKA 5ID2A 3F6DA 2X49A 4MH3A 1IYIA 3HVSA 3IAS2 2QC7A 5L71A 4X4JA 4Z2RA 1V98A 4PQHA 3Q6OA 4WEYA 3QR6A 3LJRA 4G10A 4K2DA 2VL2A 2VLUA 2CZ2A 4A5PA 5A4VA 1EWXA 2GT5A 5DQYA 4WF4A 5DCHA 4BVYB 2H1GA 4FO5A 4EUYA 2CZ3A 5ID2B 2YN1A 4KSOA 5COHA 1JLVA 3CRTA 4XHMA 3RHBA 4OMVA 1M2BA 3EMPA 2V6OA 2YJ7A 2PPTA 5F8BA 5FHIA 4OFMA 3ED3A 2B5YA 1G7EA 1YKAA 2L57A 2LQQA 3P8WA 1K0NA 4ZBAA 4K5RA 1VRSD 2C1YA 3GSSA 5ELAA 1GL8A 3HJOA 3QAGA 1X0RA 5CRHA 1O7UA 1Z9HA 3KP9A 3I69A 4LLRA 2FGXA 4FQUA 3GH6A 5KOWA 4KE3A 4TR4A 3J7Yk 1MEKA 3LQ7A 4ICYA 3MSZA 2IN3A 4K8MA 4RQRA 2CV4A 1T4ZA 1SYXA 4CHSA 3HVXA 2GDRA 5DAKA 1XZOA 2H72A 2FD3A 3FRCA 4E8HA 4RI6A 2V2GA 1TXXA 2CVBA 3M8NA 3LORA 3TKSC 3TKRA 5DALA 2YPMA 2GLRA 4NXIA 4Z2TA 2FWFA 1F3BA 4O92A 1GNWA 2OACA 1CQHA 2KHPA 1YDKA 3GTUA 2VIMA 2B5EA 3KCMA 1HQOA 4KW6A 2FWGA 2E2GA 1HNBA 2F51A 4ZILA 5DAKB 3HJMA 1SL0B 5JCUA 4KAEA 5F05A 3GH9A 5ECSA 2L59A 5DALB 3TDGA 1K0MA 4AJ7A 5D93A 2K8SA 2VM1A 3LW9A 1TI1A 3UBLA 1ZMAA 5H5SA 5CREA 6GSSA 3A5WA 3GTUB 3ZFLA 2OE1A 2PWJA 2CX3A 4HU9A 1LU4A 17GSA 1PN9A 5D9WA 2I4AA 4IHUA 3GFKA 3FMWA 2JSYA 2YV7A 3ZRDA 1AQXA 3VWVA 1H75A 3QFBC 3RAZA 1T8EB 4HOJA 4L5LA 4ECIA 4L0UA 4I2TA 4PUAA 4ECJA 2TIRA 2H0HA 1F2EA 1RQMA 1X5DA 1V57A 4IELA 3K8NA 5G5FA 2CVDA 4IN0A 2FA4A 3ZITA 4IW9A 3G7JA 4YAPA 2WGRA 3W8JA 4I6XA 3ZIJA 4OFNA 3RPPA 3RBTA 3TKPA 3E3EA 3P90A 3DEXA 5G31A 4MJAA 4G0KA 2NBSA 5LD0A 1PX6A 1AXDA 3APSA 2IPAA 4MF7A 1KEBA 3NOFA 2F3MA 3TKQA 3DVXA 3LXZA 4DEJA 3TOUA 4OD7A 2EIRA 2H70A 1GSQA 3C71A 3IK7A 2L6CA 3UVTA 4O32A 3TCOA 4BWSA 2GQLA 1YEPA 1FVJA 4IJIA 2PVOC 4MPGA 3IRAA 5IMCA 3F63A 2C3QA 2GT6A 5G5EA 3L4NA 1EOGA 3TJFA 1EV4A 4J57E 4MK3A 1I9DA 2M46A 1T7PB 3EPTA 1B4PA 3QAVA 1GWCA 2DJ1A 1GTAA 1OKDA 1USBA 1KTEA 5JWQB 4OWYA 1Y6EA 2H1AA 2JADA 1M0UA 4EXJA 1PL1A 2I81A 2IL3A 2R0CA 4G0IA 4HSCX 3IHGA 1ZGNA 3DGQA 3VWWA 3ZL5A 3GIXA 3WT1A 1ZYPA 3ZVJD 5GAPD 4MDCA 5ECLB 1XPVA 1XWAA 4F0CA 5B6MA 2VO4A 4K1FA 4KB3A 4Q5NA 3IPZA 3VURA 4V2NA 3QD9A 3ZVJA 3IOSA 4MF5A 1MDKA 4N0VA 2N5AA 2LTKA 1W89A 2QA1A 3Q18A 4Q5QA 1WMJA 4GLTA 3QDNA 3RHCA 3UMAA 2FA8A 1XXUA 4I8BA 1GUMA 3GMFA 4WXTA 2VCZA 1AUCA 3H8QA 2ZCTA 3ME8A 2E2MA 3F4TA 3WYWA 3FR3A 2R5GA 5J9BA 1TRSA 1TW9A 1NW2A 1ERUA 2O7KA 5IMFA 5ECKB 4TXOA 3A2XA 2DJ3A 3ERGA 4PQIA 4KA0A 4GF0A 5JWRB 3GX0A 4USSA 2VLVA 3RPNA 2YZHA 2EIOA 2ZUPA 2K9FA 2H1BA 2FWEA 4XRAA 1G7OA 1XVWA 4Z7XA 5HR1A 1G6WA 2VCXA 1XWKA 4Q5RA 2YCDA 2PN8A 3N9JA 3DRNA 1SK2A 2HSHA 1XOBA 3VWUA 1AQVA 1B4QA 1PA3A 4TXOB
chains in the Genus database with same CATH topology
3KXOA 4PUFC 4FIWA 1N2AA 2JACA 2FNOA 2J9HA 5F0GA 2E7PA 3HYPA 1SKWB 3ZZXA 1R4WA 3ERWA 4LMWA 5ECQB 3WGXA 1K0AA 2GZPA 2R0GA 2YV9A 3FR6A 3MAKA 3F4SA 3KP8A 4NPBA 2GS3A 4MCUA 1F6MC 3CYNA 5KN0A 3EWLA 4BA7A 6GSYA 4ZL9A 1YF1A 5CP1A 2VD1A 1GSSA 4O5RA 4IGJA 3GKMA 3VPTA 1PL2A 1GTUA 4JR4A 5JWOB 2TRXA 4TKYA 1VF3A 3OR5A 1C72A 1EP8A 4NHZA 3HXSA 3EC3A 1S3AA 1XWCA 2V6KA 2YJHA 3DXBA 1F3AA 4QL7A 2K18A 1R5PA 2RM5A 4N10A 2HSMA 4OCEA 2L5OA 4NV5A 1A8LA 2X4AA 4K7OA 3IC4A 4ECBA 3H1NA 5A4WA 4V1Ap 5GSTA 1TOFA 4RQXA 1BAYA 4K7IA 4TR0A 1SL1B 2YOIA 4EVMA 2B5XA 4NV2A 4KUNA 3DD3A 3FR9A 1PRXA 3IE3A 1OKTA 3TKSE 1KBNA 4IP1A 3ZMKA 2XPEA 4G0LA 2AAWA 1ZL9A 1R7HA 3CSHA 3HCZA 4WR5A 5ECNB 4NHWA 3TJBA 3BOAA 3GN3A 4LL4B 3D4TA 4AGSA 3LG6A 3GX8A 1O8XA 1EGRA 1GTBA 2LV3A 2P31A 2H0GA 2X64A 4JU5A 4JZQA 3TJJA 5CNWA 4XS6A 1KNGA 2G2QA 3PR8A 3DIEA 3BD2A 1YEXA 2ALBA 3HDCA 1PQNA 1BYEA 4IQ1A 4GSTA 1SJ6A 4V2MA 2REMA 1K0OA 2VL9A 2O8VB 2HZFA 3APQA 4GRFA 4BVXA 3UOMA 2B1LA 4EDZA 4GXZA 3TRXA 1ON4A 5G1LA 3GKKA 3FZAA 2AUVA 2I1UA 2JU5A 4GWRA 3FY7A 2C8UA 1A0FA 1X9SB 2LJAA 2WJUA 3D5JA 2AB6A 2FCHA 3ZYWA 4EDYA 5HFIA 2O89A 2YZUA 3Q19A 3APOA 3LGCA 1XFLA 2WDUA 3MWHA 3FYGA 1NSWA 1B48A 4BVXB 5C04A 19GSA 1ZCPA 4KX4A 5IMAA 3G7YA 1JZRA 1O81A 3W8SA 1PD21 3C1RA 3VI7A 5ECOB 1ABAA 1BG5A 1F9MA 3TRPA 1ZYEA 3VWXA 1OE8A 1O85A 2KP1A 3ZREA 1DSBA 1FB6A 2OJLA 3TJKA 1ZYNA 2F8AA 1TI3A 3S9FA 4WKWA 3FZ5A 5B7CA 5EY6A 2N5FA 1GUHA 2RIIA 5B8BA 3SWLA 1XIYA 1TK8B 4MMMA 2VAFA 3O3TA 5ECRB 2R4VA 2EC4A 3UL3A 1BQ7A 2L4QA 5CRGA 4HZ2A 3HHVA 1YJ6A 4MF6A 2GSQA 4HQZA 2MMZA 4MP4A 2X8GA 1HD2A 1PKWA 5HFGA 2HLSA 3UIWA 3UVHA 4OO5A 2X99A 4IJ3A 3QPMA 4J2FA 1VGLA 2ES7A 2GZYA 5G2ZA 3FZ4A 4ZB8A 4WF5A 4DSRA 2DMLA 3L78A 4ZXGA 3DMLA 4RI7A 1TRWA 4BPYA 2KP2A 4ID0A 5BMUA 1B8XA 1XWBA 3KH9A 3W6GA 2H66A 1OC9B 1A0RP 1Z5YE 1M99A 3EURA 3TGZA 3CRUA 1JZWA 22GSA 1URMA 3HVVA 2LNSA 1Q98A 3EE2A 2CAQA 3C1SA 1K3YA 4H86A 1YY7A 1EEMA 1V9WA 3V1WA 2NPBA 3CMIA 3TUEA 2YWMA 3D22A 3FKFA 3E9JB 1JLWA 2H75A 3WD6A 1GULA 1ZOFA 4TN8A 4YAVA 1ACVA 1TK0B 5IO0A 4MH2A 2HSYA 4RUVA 2V1MA 1RW1A 4NMUA 4POKA 1A23A 4F03A 1ILOA 1SD9A 4PNFA 4IBPA 1SD8A 2A2RA 5EPFA 3WT2A 2J23A 5IPHA 2DBCA 2C0EA 2RUEA 4AJ6A 4K0GA 3US3A 1TKDB 1PMTA 1FW1A 5DJLA 1EEJA 4F82A 1UC7A 3GV1A 3F3RA 3MIXA 4BL7A 1GSDA 3QCPA 3LEFA 1M9AA 1NHYA 2BTOT 2FHEA 4OCFA 4KDUA 1GNEA 5ABRA 1SK1A 3GL3A 2UZ8A 1SYRA 3TOTA 1V58A 4MABA 2QKEA 3L0HA 3TKSA 5HR2A 4D73B 5CRWA 3LSZA 3TB2A 1S3DA 2OA7A 4X0XA 4ECCA 3HKRA 4E8EA 4QQ7A 1O6JA 4KH7A 2IMFA 1WJKA 1XW5A 5IMDA 5C00A 2LRCA 3HD5A 4BL7B 1FHEA 2E0QA 3P7XA 1VF1A 2DMMA 5DCGA 2XC2A 1VF2A 1G0TA 4G9HA 1PGTA 5HR0A 4TVEA 2CQ9A 1FO5A 5D96A 3KGKA 4ML1A 1DE2A 4HZ4A 3KH7A 6GSTA 2GGTA 5JCGA 5D9VA 3TJGA 2GSRA 4CW9A 2H73A 1SJIA 1M2AA 3LWAA 4K9ZA 5F07A 1G6YA 2Z9SA 3GKXA 4ULXA 4K6XA 4DSSA 1J08A 4ACSA 4O5QA 2D2ZA 1UVZA 3ERFA 4EO3A 1DE1A 2OBKA 5CO3A 2GQMA 2XBIA 3TRQA 4KNDA 4QL9A 3CTGA 3H4KA 4FYCA 5AISA 4MZCA 2FUG2 5D9XA 4GTUA 2HNLA 3H79A 1O73A 2WFCA 2A4VA 2R37A 4TRXA 4DSSB 4F2IA 2YANA 4ZBDA 3M9KA 3KMOA 1XW6A 6GSUA 4NAXA 1T4YA 5AIVA 2H0IA 1I5GA 1K0CA 1N8JA 4DVCA 2L4CA 2CA8A 2X8HA 3QOUA 3IAM2 5IPGA 5CAXA 4XIHA 4L0WA 2HRAA 1PSQA 2P0GA 2L6DA 3F6FA 2NVLA 1SENA 5D9TA 2VL2C 2YWIA 3U5RE 1GUKA 2DKIA 2GSSA 3GA4A 3MNGA 4GQFA 1QK8A 4ZL8A 2LJKA 1MD3A 2IIYA 3D6IA 4XRDA 3KZQA 4F9ZA 4IP6A 5AN1A 4WBRD 5CRDA 1GP1A 4XTSA 2F8FA 3DVWA 3FK8A 4GCIA 2VCTA 4YKGA 4IVFA 1M2DA 2G0FA 1YF0A 4GSSA 5HQPA 2YWNA 2H19A 5KN2A 2XHFA 1V2AA 4JE1A 2LRTA 3QMXA 5G1KA 3F8UA 2P5RA 3FW2A 3GURA 1FOVA 6GSWA 1TRUA 4TOPA 4YKFA 1TU8A 3VPQA 4G2EA 4TR3A 1U88A 4TXVA 1X5EA 2OBIA 3UBKA 4NWYA 3A3TA 1SKSB 4XS4A 3CTFA 3AY8A 9GSSA 4L8EA 5H5QA 1LJRA 4POLA 2H74A 2IWTA 1MDJA 3SBCA 1XWGA 5A5KA 3GUSA 4CY8A 2BJXA 4Q5FA 2X8CA 4KGIA 1OC8A 5D8IA 2C80A 1WOUA 14GSA 4PNGA 2VOCA 5IM9A 2H6XA 2VLTA 1K0BA 3J7Yb 3KMNA 4FYUA 4XS4B 4PGTA 1QMVA 3A2VA 3R2QA 2KUCA 2MBSA 3IBHA 2FY6A 3CSJA 3KJYA 3DKSA 4KCEA 5LNKe 1AQWA 4MJCA 2JZSA 5J9CA 4MPFA 1UA5A 1OAZA 2GTUA 2LRNA 2PMTA 3EYTA 2H8LA 2PU9C 2V41A 2C3TA 2GSTA 16GSA 3N5OA 2VUPA 4LL1B 1K0DA 3IV4A 2DKHA 4ISDA 2VD0A 4HI7A 1M9BA 2KLXA 2CX4A 1MTCA 4MLYA 3Q74A 1WPIA 1E2YA 4MJEA 1XBSA 2CT6A 2ON5A 1Q4JA 2K8VA 1FVKA 2XPDA 1M7TA 4P3YB 3UAPA 1GSEA 2MMOA 4J56E 4IKHA 3QAWA 1OC3A 2HXKA 4X43A 3E0UA 2B6MA 3GKNA 2HT9A 4FYBA 4MZWA 2F9SA 4Z2UA 1AIUA 4EE0A 3UJ1A 1OVNA 5GAND 3VLNA 1AW9A 4DSQA 2OE3A 4YQUA 3ME7A 2PUKC 1K3LA 4GSNA 3BCKA 4YH2A 2TRCP 2DJ2A 2MBTA 1ML6A 3IR4A 2QSIA 3KEBA 4I97A 1BJXA 4CDOA 5J5NA 2MMAA 1QXHA 3C8EA 2OADA 1CQGA 3HZ8A 3WGDA 1GH2A 3M3MA 1ERWA 2NTOA 2FWHA 1EOHA 3KIJA 4K0NA 4WR4A 2VM2A 1TTZA 2B1KA 1TP9A 2LS5A 1UN2A 1THXA 4OFTA 1ERTA 3IC8A 1TJDA 5J3RA 2RLIA 1OYJA 1A2JA 1OC9A 2V32A 2JSZA 5CYYA 1BEDA 1PKZA 3NIVA 1WE0A 5E4WA 1U87A 1A24A 2O85A 4JRRA 3PGTA 4OO4A 4ZL7A 3GL5A 3F4RA 5J4UA 1J9BA 3LXTA 4AF2A 1AAZA 1YZXA 2AHEA 2AYTA 2M80A 1A2LA 1F37A 1QFNA 4EKZA 2VL3A 4MZBA 5H5RA 1PX7A 3G9BA 2DJ0A 4V1Ag 18GSA 4ZIJA 4L5OA 4HQSA 4KDXA 1JHBA 1U3IA 4EL1A 5DDLA 1THOA 2WULA 3A5IA 3MYDA 2HZEA 2O87A 4TW5A 1Z6NA 1LBKA 4HJ2A 1K3OA 4LA1A 1GLPA 2H71A 4HDEA 4I5QA 2VCWA 2H76A 3I6AA 3GYKA 4ML6A 1TU7A 1NHOA 20GSA 4IS0A 4HS1A 3RDWA 2A2SA 3EINA 3EU4A 3LYKA 3ZLPA 1W4VA 4KCAA 1EV9A 5INYA 1JZOA 2R2JA 4MA9A 3FEUA 5HR3A 3F9UA 1Z6MA 5ECIB 2PBJA 4JR6A 3BCIA 2PGTA 1XCCA 2DC5A 2HZEB 4PXOA 2WCIA 4EIPA 4POMA 4ZB9A 2WRTA 13GSA 3F0IA 1XOAA 3U6VA 2A4HA 1A2MA 1MDIA 1T1VA 2C3NA 4D73A 4ZB6A 5B6NA 1U3AA 1SKRB 2GQKA 3ZFBA 1YQ1A 1VF4A 2JZRA 3IA1A 1QGVA 4JBBA 1WWJA 4EF0A 1A8YA 3O6TA 1ZZYA 1OE7A 2L5LA 4KDYA 4MNNA 5JCWA 3KTBA 2OKAA 2DSAA 2ON7A 2DIYA 5KEJA 3D0ZA 5AIXA 2LKUA 3HY2A 3QFAC 4WETA 3ZIVA 5IOXA 4GQCA 2IMEA 5E59A 2H01A 3DWVA 2B7KA 6GSVA 3G7IA 3KM6A 3KTLA 2YNXA 1FOHA 3BBYA 4O5UA 1FB0A 3M1GA 5IMZA 1X5CA 2FLSA 4K5SA 4LMVA 2LQOA 1ST9A 1TDIA 1BX9A 1AC1A 4POBA 1JZDA 3D4MA 3L9VA 2IFQA 5F06A 3GSTA 3PINA 2GVPA 5DVBA 5IOWA 2C0GA 1GSUA 8GSSA 5IMVA 2I3YA 7GSSA 3HA9A 2I9HA 2DJJA 4I2UA 1GSYA 3UEMA 2DLXA 3IDVA 3DYRA 5DQSA 5GSSA 3LYPA 2LUSA 2MYGA 3VK9A 1DUGA 1U6TA 2CVKA 5DBQA 1FG4A 5AGYA 4FH8A 3GHAA 4V2LA 2IFQB 2OE0A 1EZKA 2R3XA 4YQMA 2HRNA 4JEDA 1XVQA 4K7NA 3KD0A 4G19A 3NZNA 1H4OA 2H6ZA 2WB9A 3ZTLA 4F0BA 4PQ1A 1TRVA 4HEA2 2B7JA 5ECMB 5IIZA 1XW9A 4X1UA 2R0PA 1Z7PA 3M9JA 3R3EA 1TK5B 3UARA 5FT3A 2QA2A 1JFUA 2C4JA 5J41A 2YWOA 2MZCA 2R6KA 2LEGA 1RK4A 1HYUA 2EIQA 3C7MA 5GZZB 4PURA 1SK0A 5B8AA 1SL2B 1ERVA 2PERA 4BWQA 2M72A 2IMKA 1E6BA 2B3SA 2H30A 4EIQA 3CSIA 3I9V2 3O76A 4PX1A 3M0FA 2H1DA 4PTSA 4KF9A 1MD4A 1YKCA 4N0ZA 2IMIA 2WS2A 2HI7A 3GRXA 3EU3A 3EVIA 3A2WA 3IXRA 3PPUA 4ILFA 4O7HA 1S3CA 2C0DA 4KSMA 3BJ5A 5ELGA 1WRYA 1FAAA 2HFDA 2RM6A 3IK9A 5DJMA 1Y25A 10GSA 5HFKA 4WBJA 1Z7RA 3VFIA 2H6YA 3L9SA 2LSTA 4MJBA 5EVOA 1T00A 2LJRA 2MMNA 2PVQA 3ZMLA 3VI5A 3D21A 2N5BA 3FZ9A 3CBUA 4AJ8A 3CXGA 4HU7A 4N11A 5KN3A 5KN1A 3HZ4A 1GSFA 3GNJA 4IQAA 3I43A 1WP0A 2VCQA 5FWGA 1J0FA 2RUFA 1HNCA 2YP6A 1SU9A 2HE3A 1GRXA 3ISOA 5BRTA 1QQ2A 2GZZA 1Z3EA 2A2PA 1R5AA 4EC0A 2IJYA 2AV4A 4TR1A 2P5QA 1V40A 1GLQA 5G30A 1EGOA 2WZ9A 1SJZA 3H93A 5KOXA 2AJQB 5ECPB 5LCZA 2JL4A 3P2AA 1IYHA 5D73A 4N30A 4K2XA 2BMXA 4HUAA 4XCSA 11GSA 1ZYQB 3EMXA 1X9MB 4CY6A 1X9WB 2JZTA 2NDOA 3JCML 3IHQA 1HNAA 2ZNMA 1PN0A 2DJKA 3FHKA 4XS1A 3C73A 2C0FA 5ENUA 2DIZA 5A4UA 4TR1B 1B9XC 4HJMA 3LFLA 3WGEA 5IQYA 3PH9A 1DBYA 1R26A 2KOKA 2HRKA 2LNTA 6GSXA 2K6VA 12GSA 3L9UA 1GTIA 4ZBBA 2VCVA 2IMDA 3HJPA 1B9YC 1O8WA 1NM3A 2CAIA 3MDKA 5EL8A 1EP7A 3F3QA 2HYXA 5IO2A 5ECHB 1QUWA 2HRFA 2QGVA 4BVYA 2XBQA 1T3BA 4YQVA 1WIKA 5ID2A 3F6DA 2X49A 4MH3A 1IYIA 3HVSA 3IAS2 2QC7A 5L71A 4X4JA 4Z2RA 1V98A 4PQHA 3Q6OA 4WEYA 3QR6A 3LJRA 4G10A 4K2DA 2VL2A 2VLUA 2CZ2A 4A5PA 5A4VA 1EWXA 2GT5A 5DQYA 4WF4A 5DCHA 4BVYB 2H1GA 4FO5A 4EUYA 2CZ3A 5ID2B 2YN1A 4KSOA 5COHA 1JLVA 3CRTA 4XHMA 3RHBA 4OMVA 1M2BA 3EMPA 2V6OA 2YJ7A 2PPTA 5F8BA 5FHIA 4OFMA 3ED3A 2B5YA 1G7EA 1YKAA 2L57A 2LQQA 3P8WA 1K0NA 4ZBAA 4K5RA 1VRSD 2C1YA 3GSSA 5ELAA 1GL8A 3HJOA 3QAGA 1X0RA 5CRHA 1O7UA 1Z9HA 3KP9A 3I69A 4LLRA 2FGXA 4FQUA 3GH6A 5KOWA 4KE3A 4TR4A 3J7Yk 1MEKA 3LQ7A 4ICYA 3MSZA 2IN3A 4K8MA 4RQRA 2CV4A 1T4ZA 1SYXA 4CHSA 3HVXA 2GDRA 5DAKA 1XZOA 2H72A 2FD3A 3FRCA 4E8HA 4RI6A 2V2GA 1TXXA 2CVBA 3M8NA 3LORA 3TKSC 3TKRA 5DALA 2YPMA 2GLRA 4NXIA 4Z2TA 2FWFA 1F3BA 4O92A 1GNWA 2OACA 1CQHA 2KHPA 1YDKA 3GTUA 2VIMA 2B5EA 3KCMA 1HQOA 4KW6A 2FWGA 2E2GA 1HNBA 2F51A 4ZILA 5DAKB 3HJMA 1SL0B 5JCUA 4KAEA 5F05A 3GH9A 5ECSA 2L59A 5DALB 3TDGA 1K0MA 4AJ7A 5D93A 2K8SA 2VM1A 3LW9A 1TI1A 3UBLA 1ZMAA 5H5SA 5CREA 6GSSA 3A5WA 3GTUB 3ZFLA 2OE1A 2PWJA 2CX3A 4HU9A 1LU4A 17GSA 1PN9A 5D9WA 2I4AA 4IHUA 3GFKA 3FMWA 2JSYA 2YV7A 3ZRDA 1AQXA 3VWVA 1H75A 3QFBC 3RAZA 1T8EB 4HOJA 4L5LA 4ECIA 4L0UA 4I2TA 4PUAA 4ECJA 2TIRA 2H0HA 1F2EA 1RQMA 1X5DA 1V57A 4IELA 3K8NA 5G5FA 2CVDA 4IN0A 2FA4A 3ZITA 4IW9A 3G7JA 4YAPA 2WGRA 3W8JA 4I6XA 3ZIJA 4OFNA 3RPPA 3RBTA 3TKPA 3E3EA 3P90A 3DEXA 5G31A 4MJAA 4G0KA 2NBSA 5LD0A 1PX6A 1AXDA 3APSA 2IPAA 4MF7A 1KEBA 3NOFA 2F3MA 3TKQA 3DVXA 3LXZA 4DEJA 3TOUA 4OD7A 2EIRA 2H70A 1GSQA 3C71A 3IK7A 2L6CA 3UVTA 4O32A 3TCOA 4BWSA 2GQLA 1YEPA 1FVJA 4IJIA 2PVOC 4MPGA 3IRAA 5IMCA 3F63A 2C3QA 2GT6A 5G5EA 3L4NA 1EOGA 3TJFA 1EV4A 4J57E 4MK3A 1I9DA 2M46A 1T7PB 3EPTA 1B4PA 3QAVA 1GWCA 2DJ1A 1GTAA 1OKDA 1USBA 1KTEA 5JWQB 4OWYA 1Y6EA 2H1AA 2JADA 1M0UA 4EXJA 1PL1A 2I81A 2IL3A 2R0CA 4G0IA 3IHGA 1ZGNA 3DGQA 3VWWA 3ZL5A 3GIXA 3WT1A 1ZYPA 3ZVJD 5GAPD 4MDCA 5ECLB 1XPVA 1XWAA 4F0CA 5B6MA 2VO4A 4K1FA 4KB3A 4Q5NA 3IPZA 3VURA 4V2NA 3QD9A 3ZVJA 3IOSA 4MF5A 1MDKA 4N0VA 2N5AA 2LTKA 1W89A 2QA1A 3Q18A 4Q5QA 1WMJA 4GLTA 3QDNA 3RHCA 3UMAA 2FA8A 1XXUA 4I8BA 1GUMA 3GMFA 4WXTA 2VCZA 1AUCA 3H8QA 2ZCTA 3ME8A 2E2MA 3F4TA 3WYWA 3FR3A 2R5GA 5J9BA 1TRSA 1TW9A 1NW2A 1ERUA 2O7KA 5IMFA 5ECKB 4TXOA 3A2XA 2DJ3A 3ERGA 4PQIA 4KA0A 4GF0A 5JWRB 3GX0A 4USSA 2VLVA 3RPNA 2YZHA 2EIOA 2ZUPA 2K9FA 2H1BA 2FWEA 4XRAA 1G7OA 1XVWA 4Z7XA 5HR1A 1G6WA 2VCXA 1XWKA 4Q5RA 2YCDA 2PN8A 3N9JA 3DRNA 1SK2A 2HSHA 1XOBA 3VWUA 1AQVA 1B4QA 1PA3A 4TXOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXO A;  4PUF C;  4FIW A;  1N2A A;  2JAC A;  2FNO A;  2J9H A;  5F0G A;  2E7P A;  3HYP A;  1SKW B;  3ZZX A;  1R4W A;  3ERW A;  4LMW A;  5ECQ B;  3WGX A;  1K0A A;  2GZP A;  2YV9 A;  3FR6 A;  3MAK A;  3F4S A;  3KP8 A;  4NPB A;  2GS3 A;  4MCU A;  1F6M C;  3CYN A;  5KN0 A;  3EWL A;  4BA7 A;  6GSY A;  4ZL9 A;  1YF1 A;  5CP1 A;  2VD1 A;  1GSS A;  4O5R A;  4IGJ A;  3GKM A;  3VPT A;  1PL2 A;  1GTU A;  4JR4 A;  5JWO B;  2TRX A;  4TKY A;  1VF3 A;  3OR5 A;  1C72 A;  1EP8 A;  4NHZ A;  3HXS A;  3EC3 A;  1S3A A;  1XWC A;  2V6K A;  2YJH A;  3DXB A;  1F3A A;  4QL7 A;  2K18 A;  1R5P A;  2RM5 A;  4N10 A;  4OCE A;  2L5O A;  4NV5 A;  1A8L A;  4K7O A;  3IC4 A;  4ECB A;  3H1N A;  5A4W A;  4V1A p;  5GST A;  1TOF A;  4RQX A;  1BAY A;  4K7I A;  4TR0 A;  1SL1 B;  2YOI A;  4EVM A;  2B5X A;  4NV2 A;  4KUN A;  3DD3 A;  3FR9 A;  1PRX A;  3IE3 A;  1OKT A;  3TKS E;  1KBN A;  4IP1 A;  3ZMK A;  2XPE A;  2AAW A;  1ZL9 A;  1R7H A;  3CSH A;  3HCZ A;  4WR5 A;  5ECN B;  4NHW A;  3TJB A;  3BOA A;  3GN3 A;  4LL4 B;  3D4T A;  4AGS A;  3LG6 A;  3GX8 A;  1O8X A;  1EGR A;  1GTB A;  2LV3 A;  2P31 A;  2H0G A;  2X64 A;  4JU5 A;  4JZQ A;  3TJJ A;  5CNW A;  4XS6 A;  1KNG A;  2G2Q A;  3PR8 A;  3DIE A;  3BD2 A;  1YEX A;  2ALB A;  3HDC A;  1PQN A;  1BYE A;  4IQ1 A;  4GST A;  1SJ6 A;  4V2M A;  2REM A;  1K0O A;  2VL9 A;  2O8V B;  2HZF A;  3APQ A;  4GRF A;  4BVX A;  3UOM A;  2B1L A;  4EDZ A;  4GXZ A;  3TRX A;  1ON4 A;  5G1L A;  3GKK A;  3FZA A;  2AUV A;  2I1U A;  2JU5 A;  4GWR A;  3FY7 A;  2C8U A;  1A0F A;  1X9S B;  2LJA A;  2WJU A;  3D5J A;  2AB6 A;  2FCH A;  3ZYW A;  4EDY A;  5HFI A;  2O89 A;  2YZU A;  3Q19 A;  3APO A;  3LGC A;  1XFL A;  2WDU A;  3MWH A;  3FYG A;  1NSW A;  1B48 A;  5C04 A;  19GS A;  1ZCP A;  4KX4 A;  5IMA A;  3G7Y A;  1JZR A;  1O81 A;  3W8S A;  1PD2 1;  3C1R A;  3VI7 A;  5ECO B;  1ABA A;  1BG5 A;  1F9M A;  3TRP A;  1ZYE A;  3VWX A;  1OE8 A;  1O85 A;  2KP1 A;  3ZRE A;  1DSB A;  1FB6 A;  2OJL A;  3TJK A;  2F8A A;  1TI3 A;  3S9F A;  4WKW A;  3FZ5 A;  5B7C A;  5EY6 A;  2N5F A;  1GUH A;  2RII A;  5B8B A;  3SWL A;  1XIY A;  1TK8 B;  4MMM A;  2VAF A;  3O3T A;  5ECR B;  2R4V A;  2EC4 A;  3UL3 A;  1BQ7 A;  2L4Q A;  5CRG A;  4HZ2 A;  3HHV A;  1YJ6 A;  4MF6 A;  2GSQ A;  4HQZ A;  2MMZ A;  4MP4 A;  2X8G A;  1HD2 A;  1PKW A;  5HFG A;  2HLS A;  3UIW A;  3UVH A;  4OO5 A;  2X99 A;  4IJ3 A;  3QPM A;  4J2F A;  1VGL A;  2ES7 A;  2GZY A;  5G2Z A;  3FZ4 A;  4ZB8 A;  4WF5 A;  4DSR A;  2DML A;  3L78 A;  4ZXG A;  3DML A;  4RI7 A;  1TRW A;  4BPY A;  2KP2 A;  4ID0 A;  1B8X A;  1XWB A;  3KH9 A;  3W6G A;  2H66 A;  1OC9 B;  1A0R P;  1Z5Y E;  1M99 A;  3EUR A;  3TGZ A;  3CRU A;  1JZW A;  22GS A;  1URM A;  3HVV A;  2LNS A;  1Q98 A;  3EE2 A;  2CAQ A;  3C1S A;  1K3Y A;  4H86 A;  1YY7 A;  1EEM A;  1V9W A;  3V1W A;  2NPB A;  3CMI A;  3TUE A;  2YWM A;  3D22 A;  3FKF A;  3E9J B;  1JLW A;  2H75 A;  3WD6 A;  1GUL A;  1ZOF A;  4TN8 A;  4YAV A;  1ACV A;  1TK0 B;  5IO0 A;  4MH2 A;  2HSY A;  4RUV A;  2V1M A;  1RW1 A;  4NMU A;  4POK A;  1A23 A;  4F03 A;  1ILO A;  1SD9 A;  4PNF A;  4IBP A;  1SD8 A;  2A2R A;  5EPF A;  3WT2 A;  2J23 A;  5IPH A;  2DBC A;  2C0E A;  2RUE A;  4AJ6 A;  4K0G A;  3US3 A;  1TKD B;  1PMT A;  1FW1 A;  5DJL A;  1EEJ A;  4F82 A;  1UC7 A;  3GV1 A;  3F3R A;  4BL7 A;  1GSD A;  3QCP A;  3LEF A;  1M9A A;  1NHY A;  2BTO T;  2FHE A;  4OCF A;  4KDU A;  1GNE A;  5ABR A;  1SK1 A;  3GL3 A;  1SYR A;  3TOT A;  1V58 A;  4MAB A;  2QKE A;  3L0H A;  3TKS A;  5HR2 A;  4D73 B;  5CRW A;  3LSZ A;  3TB2 A;  1S3D A;  2OA7 A;  4X0X A;  4ECC A;  3HKR A;  4E8E A;  4QQ7 A;  1O6J A;  4KH7 A;  2IMF A;  1WJK A;  1XW5 A;  5IMD A;  5C00 A;  2LRC A;  3HD5 A;  1FHE A;  2E0Q A;  3P7X A;  1VF1 A;  2DMM A;  5DCG A;  2XC2 A;  1VF2 A;  1G0T A;  4G9H A;  1PGT A;  5HR0 A;  4TVE A;  2CQ9 A;  1FO5 A;  5D96 A;  3KGK A;  4ML1 A;  1DE2 A;  4HZ4 A;  3KH7 A;  6GST A;  2GGT A;  5JCG A;  5D9V A;  3TJG A;  2GSR A;  4CW9 A;  2H73 A;  1SJI A;  1M2A A;  3LWA A;  4K9Z A;  5F07 A;  1G6Y A;  2Z9S A;  3GKX A;  4ULX A;  4K6X A;  4DSS A;  1J08 A;  4ACS A;  2D2Z A;  1UVZ A;  3ERF A;  4EO3 A;  1DE1 A;  2OBK A;  5CO3 A;  2GQM A;  2XBI A;  3TRQ A;  4KND A;  4QL9 A;  3CTG A;  3H4K A;  4FYC A;  5AIS A;  4MZC A;  2FUG 2;  5D9X A;  4GTU A;  2HNL A;  3H79 A;  1O73 A;  2WFC A;  2A4V A;  2R37 A;  4TRX A;  4DSS B;  4F2I A;  2YAN A;  4ZBD A;  3M9K A;  3KMO A;  1XW6 A;  6GSU A;  4NAX A;  1T4Y A;  5AIV A;  2H0I A;  1I5G A;  1K0C A;  1N8J A;  4DVC A;  2L4C A;  2CA8 A;  2X8H A;  3QOU A;  3IAM 2;  5IPG A;  5CAX A;  4XIH A;  4L0W A;  1PSQ A;  2P0G A;  2L6D A;  3F6F A;  2NVL A;  1SEN A;  5D9T A;  2VL2 C;  2YWI A;  3U5R E;  1GUK A;  3GA4 A;  2GSS A;  4GQF A;  3MNG A;  1QK8 A;  4ZL8 A;  2LJK A;  1MD3 A;  2IIY A;  3D6I A;  4XRD A;  3KZQ A;  4F9Z A;  4IP6 A;  5AN1 A;  4WBR D;  5CRD A;  1GP1 A;  4XTS A;  2F8F A;  3DVW A;  3FK8 A;  4GCI A;  2VCT A;  4IVF A;  1M2D A;  2G0F A;  1YF0 A;  4GSS A;  5HQP A;  2YWN A;  2H19 A;  5KN2 A;  2XHF A;  1V2A A;  4JE1 A;  2LRT A;  3QMX A;  5G1K A;  3F8U A;  2P5R A;  3FW2 A;  3GUR A;  1FOV A;  6GSW A;  1TRU A;  4TOP A;  1TU8 A;  3VPQ A;  4G2E A;  4TR3 A;  1U88 A;  4TXV A;  1X5E A;  2OBI A;  3UBK A;  4NWY A;  3A3T A;  1SKS B;  4XS4 A;  3CTF A;  3AY8 A;  9GSS A;  4L8E A;  5H5Q A;  1LJR A;  4POL A;  2H74 A;  2IWT A;  1MDJ A;  3SBC A;  1XWG A;  5A5K A;  3GUS A;  2BJX A;  4Q5F A;  2X8C A;  4KGI A;  1OC8 A;  5D8I A;  2C80 A;  1WOU A;  14GS A;  4PNG A;  2VOC A;  5IM9 A;  2H6X A;  2VLT A;  1K0B A;  3J7Y b;  3KMN A;  4FYU A;  4XS4 B;  4PGT A;  1QMV A;  3A2V A;  3R2Q A;  2KUC A;  2MBS A;  3IBH A;  2FY6 A;  3CSJ A;  3KJY A;  3DKS A;  4KCE A;  5LNK e;  1AQW A;  4MJC A;  2JZS A;  5J9C A;  4MPF A;  1UA5 A;  1OAZ A;  2GTU A;  2LRN A;  2PMT A;  3EYT A;  2H8L A;  2PU9 C;  2V41 A;  2C3T A;  2GST A;  16GS A;  3N5O A;  2VUP A;  4LL1 B;  1K0D A;  3IV4 A;  4ISD A;  2VD0 A;  4HI7 A;  1M9B A;  2KLX A;  2CX4 A;  1MTC A;  4MLY A;  3Q74 A;  1WPI A;  1E2Y A;  4MJE A;  1XBS A;  2CT6 A;  2ON5 A;  1Q4J A;  2K8V A;  1FVK A;  2XPD A;  1M7T A;  4P3Y B;  3UAP A;  1GSE A;  2MMO A;  4J56 E;  4IKH A;  3QAW A;  1OC3 A;  2HXK A;  4X43 A;  3E0U A;  2B6M A;  3GKN A;  2HT9 A;  4FYB A;  4MZW A;  2F9S A;  1AIU A;  4EE0 A;  3UJ1 A;  1OVN A;  5GAN D;  3VLN A;  1AW9 A;  4DSQ A;  2OE3 A;  4YQU A;  3ME7 A;  2PUK C;  1K3L A;  4GSN A;  3BCK A;  4YH2 A;  2TRC P;  2DJ2 A;  2MBT A;  1ML6 A;  3IR4 A;  2QSI A;  3KEB A;  4I97 A;  1BJX A;  4CDO A;  5J5N A;  2MMA A;  1QXH A;  3C8E A;  2OAD A;  1CQG A;  3HZ8 A;  3WGD A;  1GH2 A;  3M3M A;  1ERW A;  2NTO A;  2FWH A;  1EOH A;  3KIJ A;  4K0N A;  4WR4 A;  2VM2 A;  1TTZ A;  2B1K A;  1TP9 A;  2LS5 A;  1UN2 A;  1THX A;  4OFT A;  1ERT A;  1TJD A;  5J3R A;  2RLI A;  1OYJ A;  1A2J A;  1OC9 A;  2V32 A;  2JSZ A;  5CYY A;  1BED A;  1PKZ A;  3NIV A;  1WE0 A;  5E4W A;  1U87 A;  1A24 A;  2O85 A;  4JRR A;  3PGT A;  4OO4 A;  4ZL7 A;  3GL5 A;  3F4R A;  5J4U A;  1J9B A;  3LXT A;  4AF2 A;  1AAZ A;  1YZX A;  2AHE A;  2AYT A;  2M80 A;  1A2L A;  1F37 A;  1QFN A;  4EKZ A;  2VL3 A;  4MZB A;  5H5R A;  1PX7 A;  3G9B A;  2DJ0 A;  4V1A g;  18GS A;  4ZIJ A;  4L5O A;  4HQS A;  4KDX A;  1JHB A;  1U3I A;  4EL1 A;  5DDL A;  1THO A;  2WUL A;  2HZE A;  2O87 A;  4TW5 A;  1Z6N A;  1LBK A;  4HJ2 A;  1K3O A;  4LA1 A;  1GLP A;  2H71 A;  4HDE A;  4I5Q A;  2VCW A;  2H76 A;  3I6A A;  3GYK A;  4ML6 A;  1TU7 A;  1NHO A;  20GS A;  4IS0 A;  4HS1 A;  3RDW A;  2A2S A;  3EIN A;  3EU4 A;  3LYK A;  3ZLP A;  1W4V A;  4KCA A;  1EV9 A;  5INY A;  1JZO A;  2R2J A;  4MA9 A;  3FEU A;  5HR3 A;  3F9U A;  1Z6M A;  5ECI B;  2PBJ A;  4JR6 A;  3BCI A;  2PGT A;  1XCC A;  2DC5 A;  2HZE B;  4PXO A;  2WCI A;  4POM A;  4ZB9 A;  2WRT A;  13GS A;  3F0I A;  1XOA A;  3U6V A;  1A2M A;  1MDI A;  1T1V A;  2C3N A;  4D73 A;  4ZB6 A;  5B6N A;  1U3A A;  1SKR B;  2GQK A;  3ZFB A;  1YQ1 A;  1VF4 A;  2JZR A;  3IA1 A;  1QGV A;  4JBB A;  1WWJ A;  4EF0 A;  1A8Y A;  3O6T A;  1ZZY A;  1OE7 A;  2L5L A;  4KDY A;  5JCW A;  3KTB A;  2OKA A;  2DSA A;  2ON7 A;  2DIY A;  5KEJ A;  3D0Z A;  5AIX A;  2LKU A;  3HY2 A;  3QFA C;  4WET A;  3ZIV A;  5IOX A;  4GQC A;  2IME A;  5E59 A;  2H01 A;  3DWV A;  2B7K A;  6GSV A;  3G7I A;  3KM6 A;  3KTL A;  2YNX A;  3BBY A;  1FB0 A;  3M1G A;  5IMZ A;  1X5C A;  2FLS A;  4LMV A;  2LQO A;  1ST9 A;  1TDI A;  1BX9 A;  1AC1 A;  4POB A;  1JZD A;  3D4M A;  3L9V A;  2IFQ A;  5F06 A;  3GST A;  3PIN A;  2GVP A;  5DVB A;  5IOW A;  2C0G A;  1GSU A;  8GSS A;  5IMV A;  2I3Y A;  7GSS A;  3HA9 A;  2I9H A;  2DJJ A;  4I2U A;  1GSY A;  3UEM A;  2DLX A;  3IDV A;  3DYR A;  5DQS A;  5GSS A;  3LYP A;  2LUS A;  2MYG A;  3VK9 A;  1DUG A;  1U6T A;  2CVK A;  5DBQ A;  1FG4 A;  5AGY A;  4FH8 A;  3GHA A;  4V2L A;  2IFQ B;  2OE0 A;  1EZK A;  2R3X A;  4YQM A;  2HRN A;  4JED A;  1XVQ A;  4K7N A;  3KD0 A;  4G19 A;  3NZN A;  1H4O A;  2H6Z A;  2WB9 A;  3ZTL A;  4F0B A;  4PQ1 A;  1TRV A;  4HEA 2;  2B7J A;  5ECM B;  5IIZ A;  1XW9 A;  4X1U A;  1Z7P A;  3M9J A;  1TK5 B;  3UAR A;  5FT3 A;  1JFU A;  2C4J A;  5J41 A;  2YWO A;  2MZC A;  2R6K A;  2LEG A;  1RK4 A;  1HYU A;  2EIQ A;  3C7M A;  5GZZ B;  4PUR A;  1SK0 A;  5B8A A;  1SL2 B;  1ERV A;  2PER A;  4BWQ A;  2M72 A;  2IMK A;  1E6B A;  2B3S A;  2H30 A;  3CSI A;  3I9V 2;  3O76 A;  4PX1 A;  3M0F A;  2H1D A;  1MD4 A;  1YKC A;  4N0Z A;  2IMI A;  2WS2 A;  2HI7 A;  3GRX A;  3EU3 A;  3EVI A;  3A2W A;  3IXR A;  4ILF A;  4O7H A;  1S3C A;  2C0D A;  4KSM A;  3BJ5 A;  5ELG A;  1WRY A;  1FAA A;  2HFD A;  2RM6 A;  3IK9 A;  5DJM A;  1Y25 A;  10GS A;  5HFK A;  4WBJ A;  1Z7R A;  3VFI A;  2H6Y A;  3L9S A;  2LST A;  4MJB A;  5EVO A;  1T00 A;  2LJR A;  2MMN A;  2PVQ A;  3ZML A;  3VI5 A;  3D21 A;  2N5B A;  3FZ9 A;  3CBU A;  4AJ8 A;  3CXG A;  4HU7 A;  4N11 A;  5KN3 A;  5KN1 A;  3HZ4 A;  1GSF A;  3GNJ A;  4IQA A;  3I43 A;  1WP0 A;  2VCQ A;  5FWG A;  1J0F A;  2RUF A;  1HNC A;  2YP6 A;  1SU9 A;  2HE3 A;  1GRX A;  3ISO A;  1QQ2 A;  2GZZ A;  1Z3E A;  1R5A A;  4EC0 A;  2IJY A;  2AV4 A;  4TR1 A;  2P5Q A;  1V40 A;  1GLQ A;  5G30 A;  1EGO A;  2WZ9 A;  1SJZ A;  3H93 A;  2AJQ B;  5ECP B;  5LCZ A;  2JL4 A;  3P2A A;  1IYH A;  5D73 A;  4N30 A;  2BMX A;  4HUA A;  4XCS A;  11GS A;  1ZYQ B;  3EMX A;  1X9M B;  1X9W B;  2JZT A;  2NDO A;  3JCM L;  3IHQ A;  1HNA A;  2ZNM A;  2DJK A;  3FHK A;  4XS1 A;  3C73 A;  2C0F A;  5ENU A;  2DIZ A;  5A4U A;  4TR1 B;  1B9X C;  4HJM A;  3LFL A;  3WGE A;  5IQY A;  3PH9 A;  1DBY A;  1R26 A;  2KOK A;  2LNT A;  6GSX A;  2K6V A;  12GS A;  3L9U A;  1GTI A;  4ZBB A;  2VCV A;  2IMD A;  3HJP A;  1B9Y C;  1O8W A;  1NM3 A;  2CAI A;  3MDK A;  5EL8 A;  1EP7 A;  3F3Q A;  2HYX A;  5IO2 A;  5ECH B;  1QUW A;  2HRF A;  2QGV A;  4BVY A;  2XBQ A;  1T3B A;  4YQV A;  1WIK A;  5ID2 A;  3F6D A;  4MH3 A;  1IYI A;  3HVS A;  3IAS 2;  2QC7 A;  5L71 A;  1V98 A;  4PQH A;  3Q6O A;  4WEY A;  3QR6 A;  3LJR A;  4G10 A;  4K2D A;  2VL2 A;  2VLU A;  2CZ2 A;  5A4V A;  1EWX A;  2GT5 A;  5DQY A;  4WF4 A;  5DCH A;  2H1G A;  4FO5 A;  4EUY A;  2CZ3 A;  5ID2 B;  2YN1 A;  4KSO A;  5COH A;  1JLV A;  3CRT A;  4XHM A;  3RHB A;  4OMV A;  1M2B A;  3EMP A;  2V6O A;  2YJ7 A;  2PPT A;  5F8B A;  5FHI A;  4OFM A;  3ED3 A;  2B5Y A;  1G7E A;  1YKA A;  2L57 A;  2LQQ A;  3P8W A;  1K0N A;  4ZBA A;  1VRS D;  2C1Y A;  3GSS A;  5ELA A;  1GL8 A;  3HJO A;  3QAG A;  1X0R A;  5CRH A;  1O7U A;  1Z9H A;  3KP9 A;  3I69 A;  4LLR A;  2FGX A;  3GH6 A;  4KE3 A;  4TR4 A;  3J7Y k;  1MEK A;  3LQ7 A;  3MSZ A;  2IN3 A;  4K8M A;  4RQR A;  2CV4 A;  1T4Z A;  1SYX A;  4CHS A;  3HVX A;  2GDR A;  5DAK A;  1XZO A;  2H72 A;  2FD3 A;  3FRC A;  4E8H A;  4RI6 A;  2V2G A;  1TXX A;  2CVB A;  3M8N A;  3LOR A;  3TKS C;  3TKR A;  5DAL A;  2YPM A;  2GLR A;  4NXI A;  2FWF A;  1F3B A;  4O92 A;  1GNW A;  2OAC A;  1CQH A;  2KHP A;  1YDK A;  3GTU A;  2VIM A;  2B5E A;  3KCM A;  1HQO A;  4KW6 A;  2FWG A;  2E2G A;  1HNB A;  2F51 A;  4ZIL A;  5DAK B;  3HJM A;  1SL0 B;  5JCU A;  4KAE A;  5F05 A;  3GH9 A;  5ECS A;  2L59 A;  5DAL B;  3TDG A;  1K0M A;  4AJ7 A;  5D93 A;  2K8S A;  2VM1 A;  1TI1 A;  3UBL A;  1ZMA A;  5H5S A;  5CRE A;  6GSS A;  3A5W A;  3GTU B;  3ZFL A;  2OE1 A;  2PWJ A;  2CX3 A;  4HU9 A;  1LU4 A;  17GS A;  1PN9 A;  5D9W A;  2I4A A;  4IHU A;  3GFK A;  2JSY A;  2YV7 A;  3ZRD A;  1AQX A;  3VWV A;  1H75 A;  3QFB C;  3RAZ A;  1T8E B;  4HOJ A;  4L5L A;  4ECI A;  4L0U A;  4I2T A;  4PUA A;  4ECJ A;  2TIR A;  2H0H A;  1F2E A;  1RQM A;  1X5D A;  1V57 A;  4IEL A;  3K8N A;  5G5F A;  2CVD A;  4IN0 A;  2FA4 A;  3ZIT A;  4IW9 A;  3G7J A;  4YAP A;  2WGR A;  3W8J A;  4I6X A;  3ZIJ A;  4OFN A;  3RPP A;  3RBT A;  3TKP A;  3E3E A;  3P90 A;  3DEX A;  5G31 A;  4MJA A;  2NBS A;  5LD0 A;  1PX6 A;  1AXD A;  3APS A;  2IPA A;  4MF7 A;  1KEB A;  3NOF A;  2F3M A;  3TKQ A;  3DVX A;  3LXZ A;  4DEJ A;  3TOU A;  4OD7 A;  2EIR A;  2H70 A;  1GSQ A;  3C71 A;  3IK7 A;  2L6C A;  3UVT A;  4O32 A;  3TCO A;  4BWS A;  2GQL A;  1YEP A;  1FVJ A;  4IJI A;  2PVO C;  4MPG A;  3IRA A;  5IMC A;  3F63 A;  2C3Q A;  2GT6 A;  5G5E A;  3L4N A;  1EOG A;  3TJF A;  1EV4 A;  4J57 E;  4MK3 A;  1I9D A;  2M46 A;  1T7P B;  1B4P A;  3QAV A;  1GWC A;  2DJ1 A;  1GTA A;  1OKD A;  1USB A;  1KTE A;  5JWQ B;  4OWY A;  1Y6E A;  2H1A A;  2JAD A;  1M0U A;  4EXJ A;  1PL1 A;  2I81 A;  2IL3 A;  1ZGN A;  3DGQ A;  3VWW A;  3ZL5 A;  3GIX A;  3WT1 A;  3ZVJ D;  5GAP D;  4MDC A;  5ECL B;  1XPV A;  1XWA A;  4F0C A;  5B6M A;  2VO4 A;  4K1F A;  4KB3 A;  4Q5N A;  3IPZ A;  3VUR A;  4V2N A;  3QD9 A;  3ZVJ A;  3IOS A;  4MF5 A;  1MDK A;  4N0V A;  2N5A A;  2LTK A;  1W89 A;  3Q18 A;  4Q5Q A;  1WMJ A;  4GLT A;  3QDN A;  3RHC A;  3UMA A;  2FA8 A;  1XXU A;  4I8B A;  1GUM A;  3GMF A;  4WXT A;  2VCZ A;  1AUC A;  3H8Q A;  2ZCT A;  3ME8 A;  2E2M A;  3F4T A;  3WYW A;  3FR3 A;  2R5G A;  5J9B A;  1TRS A;  1TW9 A;  1NW2 A;  1ERU A;  2O7K A;  5IMF A;  5ECK B;  4TXO A;  3A2X A;  2DJ3 A;  3ERG A;  4PQI A;  4KA0 A;  4GF0 A;  5JWR B;  3GX0 A;  2VLV A;  3RPN A;  2YZH A;  2EIO A;  2ZUP A;  2K9F A;  2H1B A;  2FWE A;  4XRA A;  1G7O A;  1XVW A;  4Z7X A;  5HR1 A;  1G6W A;  2VCX A;  1XWK A;  4Q5R A;  2YCD A;  2PN8 A;  3N9J A;  3DRN A;  1SK2 A;  2HSH A;  1XOB A;  3VWU A;  1AQV A;  1B4Q A;  1PA3 A;  4TXO B; 
#chains in the Genus database with same CATH topology
 3KXO A;  4PUF C;  4FIW A;  1N2A A;  2JAC A;  2FNO A;  2J9H A;  5F0G A;  2E7P A;  3HYP A;  1M3I A;  1SKW B;  3ZZX A;  1R4W A;  3ERW A;  4LMW A;  5ECQ B;  3WGX A;  1K0A A;  2GZP A;  2R0G A;  2YV9 A;  3FR6 A;  3MAK A;  3F4S A;  3KP8 A;  4NPB A;  2GS3 A;  4MCU A;  1F6M C;  3CYN A;  5KN0 A;  3EWL A;  4BA7 A;  6GSY A;  4ZL9 A;  1YF1 A;  5CP1 A;  2VD1 A;  1GSS A;  4O5R A;  4IGJ A;  3GKM A;  3VPT A;  1PL2 A;  1GTU A;  4JR4 A;  5JWO B;  2TRX A;  4TKY A;  1VF3 A;  3OR5 A;  1C72 A;  1EP8 A;  4NHZ A;  3HXS A;  3EC3 A;  1S3A A;  1XWC A;  2V6K A;  2YJH A;  3DXB A;  1F3A A;  4QL7 A;  2K18 A;  1R5P A;  2RM5 A;  4N10 A;  2HSM A;  4OCE A;  2L5O A;  4NV5 A;  1A8L A;  2X4A A;  4K7O A;  3IC4 A;  4ECB A;  3H1N A;  5A4W A;  4V1A p;  5GST A;  1TOF A;  4RQX A;  1BAY A;  4K7I A;  4TR0 A;  1SL1 B;  2YOI A;  4EVM A;  2B5X A;  4NV2 A;  4KUN A;  3DD3 A;  3FR9 A;  1PRX A;  3IE3 A;  1OKT A;  3TKS E;  1KBN A;  4IP1 A;  3ZMK A;  2XPE A;  4G0L A;  2AAW A;  1ZL9 A;  1R7H A;  3CSH A;  3HCZ A;  4WR5 A;  5ECN B;  4NHW A;  3TJB A;  3BOA A;  3GN3 A;  4LL4 B;  3D4T A;  4AGS A;  3LG6 A;  3GX8 A;  1O8X A;  1EGR A;  1GTB A;  2LV3 A;  2P31 A;  2H0G A;  2X64 A;  4JU5 A;  4JZQ A;  3TJJ A;  5CNW A;  4XS6 A;  1KNG A;  2G2Q A;  3PR8 A;  3DIE A;  3BD2 A;  1YEX A;  2ALB A;  3HDC A;  1PQN A;  1BYE A;  4IQ1 A;  4GST A;  1SJ6 A;  4V2M A;  2REM A;  1K0O A;  2VL9 A;  2O8V B;  2HZF A;  1M3J A;  3APQ A;  4GRF A;  4BVX A;  3UOM A;  2B1L A;  4EDZ A;  4GXZ A;  3TRX A;  1ON4 A;  5G1L A;  3GKK A;  3FZA A;  2AUV A;  2I1U A;  2JU5 A;  4GWR A;  3FY7 A;  2C8U A;  1A0F A;  1X9S B;  2LJA A;  2WJU A;  3D5J A;  2AB6 A;  2FCH A;  3ZYW A;  4EDY A;  5HFI A;  2O89 A;  2YZU A;  3Q19 A;  3APO A;  3LGC A;  1XFL A;  2WDU A;  3MWH A;  3FYG A;  1NSW A;  1B48 A;  4BVX B;  5C04 A;  19GS A;  1ZCP A;  4KX4 A;  5IMA A;  3G7Y A;  1JZR A;  1O81 A;  3W8S A;  1PD2 1;  3C1R A;  3VI7 A;  5ECO B;  1ABA A;  1BG5 A;  1F9M A;  3TRP A;  1ZYE A;  3VWX A;  1OE8 A;  1O85 A;  2KP1 A;  3ZRE A;  1DSB A;  1FB6 A;  2OJL A;  3TJK A;  1ZYN A;  2F8A A;  1TI3 A;  3S9F A;  4WKW A;  3FZ5 A;  5B7C A;  5EY6 A;  2N5F A;  1GUH A;  2RII A;  5B8B A;  3SWL A;  1XIY A;  1TK8 B;  4MMM A;  2VAF A;  3O3T A;  5ECR B;  2R4V A;  2EC4 A;  3UL3 A;  1BQ7 A;  2L4Q A;  5CRG A;  4HZ2 A;  3HHV A;  1YJ6 A;  4MF6 A;  2GSQ A;  4HQZ A;  2MMZ A;  4MP4 A;  2X8G A;  1HD2 A;  1PKW A;  5HFG A;  2HLS A;  3UIW A;  3UVH A;  4OO5 A;  2X99 A;  4IJ3 A;  3QPM A;  4J2F A;  1VGL A;  2ES7 A;  2GZY A;  5G2Z A;  3FZ4 A;  4ZB8 A;  4WF5 A;  4DSR A;  2DML A;  3L78 A;  4ZXG A;  3DML A;  4RI7 A;  1TRW A;  4BPY A;  2KP2 A;  4ID0 A;  5BMU A;  1B8X A;  1XWB A;  3KH9 A;  3W6G A;  2H66 A;  1OC9 B;  1A0R P;  1Z5Y E;  1M99 A;  3EUR A;  3TGZ A;  3CRU A;  1JZW A;  22GS A;  1URM A;  3HVV A;  2LNS A;  1Q98 A;  3EE2 A;  2CAQ A;  3C1S A;  1K3Y A;  4H86 A;  1YY7 A;  1EEM A;  1V9W A;  3V1W A;  2NPB A;  3CMI A;  3TUE A;  2YWM A;  3D22 A;  3FKF A;  3E9J B;  1JLW A;  2H75 A;  3WD6 A;  1GUL A;  1ZOF A;  4TN8 A;  4YAV A;  1ACV A;  1TK0 B;  5IO0 A;  4MH2 A;  2HSY A;  4RUV A;  2V1M A;  1RW1 A;  4NMU A;  4POK A;  1A23 A;  4F03 A;  1ILO A;  1SD9 A;  4PNF A;  4IBP A;  1SD8 A;  2A2R A;  5EPF A;  3WT2 A;  2J23 A;  5IPH A;  2DBC A;  2C0E A;  2RUE A;  4AJ6 A;  4K0G A;  3US3 A;  1TKD B;  1PMT A;  1FW1 A;  5DJL A;  1EEJ A;  4F82 A;  1UC7 A;  3GV1 A;  3F3R A;  3MIX A;  4BL7 A;  1GSD A;  3QCP A;  3LEF A;  1M9A A;  1NHY A;  2BTO T;  2FHE A;  4OCF A;  4KDU A;  1GNE A;  5ABR A;  1SK1 A;  3GL3 A;  2UZ8 A;  1SYR A;  3TOT A;  1V58 A;  4MAB A;  2QKE A;  3L0H A;  3TKS A;  5HR2 A;  4D73 B;  5CRW A;  3LSZ A;  3TB2 A;  1S3D A;  2OA7 A;  4X0X A;  4ECC A;  3HKR A;  4E8E A;  4QQ7 A;  1O6J A;  4KH7 A;  2IMF A;  1WJK A;  1XW5 A;  5IMD A;  5C00 A;  2LRC A;  3HD5 A;  4BL7 B;  1FHE A;  2E0Q A;  3P7X A;  1VF1 A;  2DMM A;  5DCG A;  2XC2 A;  1VF2 A;  1G0T A;  4G9H A;  1PGT A;  5HR0 A;  4TVE A;  2CQ9 A;  1FO5 A;  5D96 A;  3KGK A;  4ML1 A;  1DE2 A;  4HZ4 A;  3KH7 A;  6GST A;  2GGT A;  5JCG A;  5D9V A;  3TJG A;  2GSR A;  4CW9 A;  2H73 A;  1SJI A;  1M2A A;  3LWA A;  4K9Z A;  5F07 A;  1G6Y A;  2Z9S A;  3GKX A;  4ULX A;  4K6X A;  4DSS A;  1J08 A;  4ACS A;  4O5Q A;  2D2Z A;  1UVZ A;  3ERF A;  4EO3 A;  1DE1 A;  2OBK A;  5CO3 A;  2GQM A;  2XBI A;  3TRQ A;  4KND A;  4QL9 A;  3CTG A;  1S3R A;  3H4K A;  4FYC A;  5AIS A;  4MZC A;  2FUG 2;  5D9X A;  4GTU A;  2HNL A;  3H79 A;  1O73 A;  2WFC A;  2A4V A;  2R37 A;  4TRX A;  4DSS B;  4F2I A;  2YAN A;  4ZBD A;  3M9K A;  3KMO A;  1XW6 A;  6GSU A;  4NAX A;  1T4Y A;  5AIV A;  2H0I A;  1I5G A;  1K0C A;  1N8J A;  4DVC A;  2L4C A;  2CA8 A;  2X8H A;  3QOU A;  3IAM 2;  5IPG A;  5CAX A;  4XIH A;  4L0W A;  2HRA A;  1PSQ A;  2P0G A;  2L6D A;  3F6F A;  2NVL A;  1SEN A;  5D9T A;  2VL2 C;  2YWI A;  3U5R E;  1GUK A;  2DKI A;  2GSS A;  3GA4 A;  3MNG A;  4GQF A;  1QK8 A;  4ZL8 A;  2LJK A;  1MD3 A;  2IIY A;  3D6I A;  4XRD A;  3KZQ A;  4F9Z A;  4IP6 A;  5AN1 A;  4WBR D;  5CRD A;  1GP1 A;  4XTS A;  2F8F A;  3DVW A;  3FK8 A;  4GCI A;  2VCT A;  4YKG A;  4IVF A;  1M2D A;  2G0F A;  1YF0 A;  4GSS A;  5HQP A;  2YWN A;  2H19 A;  5KN2 A;  2XHF A;  1V2A A;  4JE1 A;  2LRT A;  3QMX A;  5G1K A;  3F8U A;  2P5R A;  3FW2 A;  3GUR A;  1FOV A;  6GSW A;  1TRU A;  4TOP A;  4YKF A;  1TU8 A;  3VPQ A;  4G2E A;  4TR3 A;  1U88 A;  4TXV A;  1X5E A;  2OBI A;  3UBK A;  4NWY A;  3A3T A;  1SKS B;  4XS4 A;  3CTF A;  3AY8 A;  9GSS A;  4L8E A;  5H5Q A;  1LJR A;  4POL A;  2H74 A;  2IWT A;  1MDJ A;  3HVN A;  1XG8 A;  3SBC A;  1XWG A;  5A5K A;  3GUS A;  4CY8 A;  2BJX A;  4Q5F A;  2X8C A;  4KGI A;  1OC8 A;  5D8I A;  2C80 A;  1WOU A;  14GS A;  4PNG A;  2VOC A;  5IM9 A;  2H6X A;  2VLT A;  1K0B A;  3J7Y b;  3KMN A;  4FYU A;  4XS4 B;  4PGT A;  1QMV A;  3A2V A;  3R2Q A;  2KUC A;  2MBS A;  3IBH A;  2FY6 A;  3CSJ A;  3KJY A;  3DKS A;  4KCE A;  5LNK e;  1AQW A;  4MJC A;  2JZS A;  5J9C A;  4MPF A;  1UA5 A;  1OAZ A;  2GTU A;  2LRN A;  2PMT A;  3EYT A;  2H8L A;  2PU9 C;  2V41 A;  2C3T A;  2GST A;  16GS A;  3N5O A;  2VUP A;  4LL1 B;  1K0D A;  3IV4 A;  2DKH A;  4ISD A;  2VD0 A;  4HI7 A;  1M9B A;  2KLX A;  2CX4 A;  1MTC A;  4MLY A;  3Q74 A;  1WPI A;  1E2Y A;  4MJE A;  1XBS A;  2CT6 A;  2ON5 A;  1Q4J A;  2K8V A;  1FVK A;  2XPD A;  1M7T A;  4P3Y B;  3UAP A;  1GSE A;  2MMO A;  4J56 E;  4IKH A;  3QAW A;  1OC3 A;  2HXK A;  4X43 A;  3E0U A;  2B6M A;  3GKN A;  2HT9 A;  4FYB A;  4MZW A;  2F9S A;  4Z2U A;  1AIU A;  4EE0 A;  3UJ1 A;  1OVN A;  5GAN D;  3VLN A;  1AW9 A;  4DSQ A;  2OE3 A;  4YQU A;  3ME7 A;  2PUK C;  1K3L A;  4GSN A;  3BCK A;  4YH2 A;  2TRC P;  2DJ2 A;  2MBT A;  1ML6 A;  3IR4 A;  2QSI A;  3KEB A;  4I97 A;  1BJX A;  4CDO A;  5J5N A;  2MMA A;  1QXH A;  3C8E A;  2OAD A;  1CQG A;  3HZ8 A;  3WGD A;  1GH2 A;  3M3M A;  1ERW A;  2NTO A;  2FWH A;  1EOH A;  3KIJ A;  4K0N A;  4WR4 A;  2VM2 A;  1TTZ A;  2B1K A;  1TP9 A;  2LS5 A;  1UN2 A;  1THX A;  4BIK A;  4OFT A;  1ERT A;  3IC8 A;  1TJD A;  5J3R A;  2RLI A;  1OYJ A;  1A2J A;  1OC9 A;  2V32 A;  2JSZ A;  5CYY A;  1BED A;  1PKZ A;  3NIV A;  1WE0 A;  5E4W A;  1U87 A;  1A24 A;  2O85 A;  4JRR A;  3PGT A;  4OO4 A;  4ZL7 A;  3GL5 A;  3F4R A;  5J4U A;  1J9B A;  3LXT A;  4AF2 A;  1AAZ A;  1YZX A;  2AHE A;  2AYT A;  2M80 A;  1A2L A;  1F37 A;  1QFN A;  4EKZ A;  2VL3 A;  4MZB A;  5H5R A;  1PX7 A;  3G9B A;  2DJ0 A;  4V1A g;  18GS A;  4ZIJ A;  4L5O A;  4HQS A;  4KDX A;  1JHB A;  1U3I A;  4EL1 A;  5DDL A;  1THO A;  2WUL A;  3A5I A;  3MYD A;  2HZE A;  2O87 A;  4TW5 A;  1Z6N A;  1LBK A;  4HJ2 A;  1K3O A;  4LA1 A;  1GLP A;  2H71 A;  4HDE A;  4I5Q A;  2VCW A;  2H76 A;  3I6A A;  3GYK A;  4ML6 A;  1TU7 A;  1NHO A;  20GS A;  4IS0 A;  4HS1 A;  3RDW A;  2A2S A;  3EIN A;  3EU4 A;  3LYK A;  3ZLP A;  1W4V A;  4KCA A;  1EV9 A;  5INY A;  1JZO A;  2R2J A;  4MA9 A;  3FEU A;  5HR3 A;  3F9U A;  1Z6M A;  5ECI B;  2PBJ A;  4JR6 A;  3BCI A;  2PGT A;  1XCC A;  2DC5 A;  2HZE B;  4PXO A;  2WCI A;  4EIP A;  4POM A;  4ZB9 A;  2WRT A;  13GS A;  3F0I A;  1XOA A;  3U6V A;  2A4H A;  1A2M A;  1MDI A;  1T1V A;  2C3N A;  4D73 A;  4ZB6 A;  5B6N A;  1U3A A;  1SKR B;  2GQK A;  3ZFB A;  1YQ1 A;  1VF4 A;  2JZR A;  3IA1 A;  1QGV A;  4JBB A;  1WWJ A;  4EF0 A;  1A8Y A;  3O6T A;  1ZZY A;  1OE7 A;  2L5L A;  4KDY A;  4MNN A;  5JCW A;  3KTB A;  2OKA A;  2DSA A;  2ON7 A;  2DIY A;  5KEJ A;  3D0Z A;  5AIX A;  2LKU A;  3HY2 A;  3QFA C;  4WET A;  3ZIV A;  5IOX A;  4GQC A;  2IME A;  5E59 A;  2H01 A;  3DWV A;  2B7K A;  6GSV A;  3G7I A;  3KM6 A;  3KTL A;  2YNX A;  1FOH A;  3BBY A;  4O5U A;  1FB0 A;  3M1G A;  5IMZ A;  1X5C A;  2FLS A;  4K5S A;  4LMV A;  2LQO A;  1ST9 A;  1TDI A;  1BX9 A;  1AC1 A;  4POB A;  1JZD A;  3D4M A;  3L9V A;  2IFQ A;  5F06 A;  3GST A;  3PIN A;  2GVP A;  5DVB A;  5IOW A;  2C0G A;  1GSU A;  8GSS A;  5IMV A;  2I3Y A;  7GSS A;  3HA9 A;  2I9H A;  2DJJ A;  4I2U A;  1GSY A;  3UEM A;  2DLX A;  3IDV A;  3DYR A;  5DQS A;  5GSS A;  3LYP A;  2LUS A;  2MYG A;  3VK9 A;  1DUG A;  1U6T A;  2CVK A;  5DBQ A;  1FG4 A;  5AGY A;  4FH8 A;  3GHA A;  4V2L A;  2IFQ B;  2OE0 A;  1EZK A;  2R3X A;  4YQM A;  2HRN A;  1PFO A;  1XVQ A;  4JED A;  3KD0 A;  4K7N A;  4G19 A;  3NZN A;  1H4O A;  2H6Z A;  2WB9 A;  3ZTL A;  4F0B A;  4PQ1 A;  1TRV A;  4HEA 2;  2B7J A;  5ECM B;  5IIZ A;  1XW9 A;  4X1U A;  2R0P A;  1Z7P A;  3M9J A;  3R3E A;  1TK5 B;  3UAR A;  5FT3 A;  2QA2 A;  1JFU A;  2C4J A;  5J41 A;  2YWO A;  2MZC A;  2R6K A;  2LEG A;  1RK4 A;  1HYU A;  2EIQ A;  3C7M A;  5GZZ B;  4PUR A;  1SK0 A;  5B8A A;  1SL2 B;  1ERV A;  2PER A;  4BWQ A;  2M72 A;  2IMK A;  1E6B A;  2B3S A;  2H30 A;  4EIQ A;  3CSI A;  3I9V 2;  3O76 A;  4PX1 A;  3M0F A;  2H1D A;  4PTS A;  4KF9 A;  1MD4 A;  1YKC A;  4N0Z A;  2IMI A;  2WS2 A;  2HI7 A;  3GRX A;  3EU3 A;  3EVI A;  3A2W A;  3IXR A;  3PPU A;  4ILF A;  4O7H A;  1S3C A;  2C0D A;  4KSM A;  3BJ5 A;  5ELG A;  1WRY A;  1FAA A;  2HFD A;  2RM6 A;  3IK9 A;  5DJM A;  1Y25 A;  10GS A;  5HFK A;  4WBJ A;  1Z7R A;  3VFI A;  2H6Y A;  3L9S A;  2LST A;  4MJB A;  5EVO A;  1T00 A;  2LJR A;  2MMN A;  2PVQ A;  3ZML A;  3VI5 A;  3D21 A;  2N5B A;  3FZ9 A;  3CBU A;  4AJ8 A;  3CXG A;  4HU7 A;  4N11 A;  5KN3 A;  5KN1 A;  3HZ4 A;  1GSF A;  3GNJ A;  4IQA A;  3I43 A;  1WP0 A;  2VCQ A;  5FWG A;  1J0F A;  2RUF A;  1HNC A;  2YP6 A;  1SU9 A;  2HE3 A;  1GRX A;  3ISO A;  5BRT A;  1QQ2 A;  2GZZ A;  1Z3E A;  2A2P A;  1R5A A;  4EC0 A;  2IJY A;  2AV4 A;  4TR1 A;  2P5Q A;  1V40 A;  1GLQ A;  5G30 A;  1EGO A;  2WZ9 A;  1SJZ A;  3H93 A;  5KOX A;  2AJQ B;  5ECP B;  5LCZ A;  2JL4 A;  3P2A A;  1IYH A;  5D73 A;  4N30 A;  4K2X A;  2BMX A;  4HUA A;  4XCS A;  11GS A;  1ZYQ B;  3EMX A;  1X9M B;  4CY6 A;  1X9W B;  2JZT A;  2NDO A;  3CQF A;  3JCM L;  3IHQ A;  1HNA A;  2ZNM A;  1PN0 A;  2DJK A;  3FHK A;  4XS1 A;  3C73 A;  2C0F A;  5ENU A;  2DIZ A;  5A4U A;  4TR1 B;  1B9X C;  4HJM A;  3LFL A;  3WGE A;  5IQY A;  3PH9 A;  1DBY A;  1R26 A;  2KOK A;  2HRK A;  2LNT A;  6GSX A;  2K6V A;  12GS A;  3L9U A;  1GTI A;  4ZBB A;  2VCV A;  2IMD A;  3HJP A;  1B9Y C;  1O8W A;  1NM3 A;  2CAI A;  3MDK A;  5EL8 A;  1EP7 A;  3F3Q A;  2HYX A;  5IO2 A;  5ECH B;  1QUW A;  2HRF A;  2QGV A;  4BVY A;  2XBQ A;  1T3B A;  4YQV A;  1WIK A;  5ID2 A;  3F6D A;  2X49 A;  4MH3 A;  1IYI A;  3HVS A;  3IAS 2;  2QC7 A;  5L71 A;  4X4J A;  4Z2R A;  1V98 A;  4PQH A;  3Q6O A;  4WEY A;  3QR6 A;  3LJR A;  4G10 A;  4K2D A;  2VL2 A;  2VLU A;  2CZ2 A;  4A5P A;  5A4V A;  1EWX A;  2GT5 A;  5DQY A;  4WF4 A;  5DCH A;  4BVY B;  2H1G A;  4FO5 A;  4EUY A;  2CZ3 A;  5ID2 B;  2YN1 A;  4KSO A;  5COH A;  1JLV A;  3CRT A;  4XHM A;  3RHB A;  4OMV A;  1M2B A;  3EMP A;  2V6O A;  2YJ7 A;  2PPT A;  5F8B A;  5FHI A;  4OFM A;  3ED3 A;  2B5Y A;  1G7E A;  1YKA A;  2L57 A;  2LQQ A;  3P8W A;  1K0N A;  4ZBA A;  4K5R A;  1VRS D;  2C1Y A;  3GSS A;  5ELA A;  1GL8 A;  3HJO A;  3QAG A;  1X0R A;  5CRH A;  1O7U A;  1Z9H A;  3KP9 A;  3I69 A;  4LLR A;  2FGX A;  4FQU A;  3GH6 A;  5KOW A;  4KE3 A;  4TR4 A;  3J7Y k;  1MEK A;  3LQ7 A;  4ICY A;  3MSZ A;  2IN3 A;  4K8M A;  4RQR A;  2CV4 A;  1T4Z A;  1SYX A;  4CHS A;  3HVX A;  2GDR A;  5DAK A;  1XZO A;  2H72 A;  2FD3 A;  3FRC A;  4E8H A;  4RI6 A;  2V2G A;  1TXX A;  2CVB A;  3M8N A;  3LOR A;  3TKS C;  3TKR A;  5DAL A;  2YPM A;  2GLR A;  4NXI A;  4Z2T A;  2FWF A;  1F3B A;  4O92 A;  1GNW A;  2OAC A;  1CQH A;  2KHP A;  1YDK A;  3GTU A;  2VIM A;  2B5E A;  3KCM A;  1HQO A;  4KW6 A;  2FWG A;  2E2G A;  1HNB A;  2F51 A;  4ZIL A;  5DAK B;  3HJM A;  1SL0 B;  5JCU A;  4KAE A;  5F05 A;  3GH9 A;  5ECS A;  2L59 A;  5DAL B;  3TDG A;  1K0M A;  4AJ7 A;  5D93 A;  2K8S A;  2VM1 A;  3LW9 A;  1TI1 A;  3UBL A;  1ZMA A;  5H5S A;  5CRE A;  6GSS A;  3A5W A;  3GTU B;  3ZFL A;  2OE1 A;  2PWJ A;  2CX3 A;  4HU9 A;  1LU4 A;  17GS A;  1PN9 A;  5D9W A;  2I4A A;  4IHU A;  3GFK A;  3FMW A;  2JSY A;  2YV7 A;  3ZRD A;  1AQX A;  3VWV A;  1H75 A;  3QFB C;  3RAZ A;  1T8E B;  4HOJ A;  4L5L A;  4ECI A;  4L0U A;  4I2T A;  4PUA A;  4ECJ A;  2TIR A;  2H0H A;  1F2E A;  1RQM A;  1X5D A;  1V57 A;  4IEL A;  3K8N A;  5G5F A;  2CVD A;  4IN0 A;  2FA4 A;  3ZIT A;  4IW9 A;  3G7J A;  4YAP A;  2WGR A;  3W8J A;  4I6X A;  3ZIJ A;  4OFN A;  3RPP A;  3RBT A;  3TKP A;  3E3E A;  3P90 A;  3DEX A;  5G31 A;  4MJA A;  4G0K A;  2NBS A;  5LD0 A;  1PX6 A;  1AXD A;  3APS A;  2IPA A;  4MF7 A;  1KEB A;  3NOF A;  2F3M A;  3TKQ A;  3DVX A;  3LXZ A;  4DEJ A;  3TOU A;  4OD7 A;  2EIR A;  2H70 A;  1GSQ A;  3C71 A;  3IK7 A;  2L6C A;  3UVT A;  4O32 A;  3TCO A;  4BWS A;  2GQL A;  1YEP A;  1FVJ A;  4IJI A;  2PVO C;  4MPG A;  3IRA A;  5IMC A;  3F63 A;  2C3Q A;  2GT6 A;  5G5E A;  3L4N A;  1EOG A;  3TJF A;  1EV4 A;  4J57 E;  4MK3 A;  1I9D A;  2M46 A;  1T7P B;  3EPT A;  1B4P A;  3QAV A;  1GWC A;  2DJ1 A;  1GTA A;  1OKD A;  1USB A;  1KTE A;  5JWQ B;  4OWY A;  1Y6E A;  2H1A A;  2JAD A;  1M0U A;  4EXJ A;  1PL1 A;  2I81 A;  2IL3 A;  2R0C A;  4G0I A;  4HSC X;  3IHG A;  1ZGN A;  3DGQ A;  3VWW A;  3ZL5 A;  3GIX A;  3WT1 A;  1ZYP A;  3ZVJ D;  5GAP D;  4MDC A;  5ECL B;  1XPV A;  1XWA A;  4F0C A;  5B6M A;  2VO4 A;  4K1F A;  4KB3 A;  4Q5N A;  3IPZ A;  3VUR A;  4V2N A;  3QD9 A;  3ZVJ A;  3IOS A;  4MF5 A;  1MDK A;  4N0V A;  2N5A A;  2LTK A;  1W89 A;  2QA1 A;  3Q18 A;  4Q5Q A;  1WMJ A;  4GLT A;  3QDN A;  3RHC A;  3UMA A;  2FA8 A;  1XXU A;  4I8B A;  1GUM A;  3GMF A;  4WXT A;  2VCZ A;  1AUC A;  3H8Q A;  2ZCT A;  3ME8 A;  2E2M A;  3F4T A;  3WYW A;  3FR3 A;  2R5G A;  5J9B A;  1TRS A;  1TW9 A;  1NW2 A;  1ERU A;  2O7K A;  5IMF A;  5ECK B;  4TXO A;  3A2X A;  2DJ3 A;  3ERG A;  4PQI A;  4KA0 A;  4GF0 A;  5JWR B;  3GX0 A;  4USS A;  2VLV A;  3RPN A;  2YZH A;  2EIO A;  2ZUP A;  2K9F A;  2H1B A;  2FWE A;  4XRA A;  1G7O A;  1XVW A;  4Z7X A;  5HR1 A;  1G6W A;  2VCX A;  1XWK A;  4Q5R A;  2YCD A;  2PN8 A;  3N9J A;  3DRN A;  1SK2 A;  2HSH A;  1XOB A;  3VWU A;  1AQV A;  1B4Q A;  1PA3 A;  4TXO B; 
#chains in the Genus database with same CATH homology
 3KXO A;  4PUF C;  4FIW A;  1N2A A;  2JAC A;  2FNO A;  2J9H A;  5F0G A;  2E7P A;  3HYP A;  1SKW B;  3ZZX A;  1R4W A;  3ERW A;  4LMW A;  5ECQ B;  3WGX A;  1K0A A;  2GZP A;  2R0G A;  2YV9 A;  3FR6 A;  3MAK A;  3F4S A;  3KP8 A;  4NPB A;  2GS3 A;  4MCU A;  1F6M C;  3CYN A;  5KN0 A;  3EWL A;  4BA7 A;  6GSY A;  4ZL9 A;  1YF1 A;  5CP1 A;  2VD1 A;  1GSS A;  4O5R A;  4IGJ A;  3GKM A;  3VPT A;  1PL2 A;  1GTU A;  4JR4 A;  5JWO B;  2TRX A;  4TKY A;  1VF3 A;  3OR5 A;  1C72 A;  1EP8 A;  4NHZ A;  3HXS A;  3EC3 A;  1S3A A;  1XWC A;  2V6K A;  2YJH A;  3DXB A;  1F3A A;  4QL7 A;  2K18 A;  1R5P A;  2RM5 A;  4N10 A;  2HSM A;  4OCE A;  2L5O A;  4NV5 A;  1A8L A;  2X4A A;  4K7O A;  3IC4 A;  4ECB A;  3H1N A;  5A4W A;  4V1A p;  5GST A;  1TOF A;  4RQX A;  1BAY A;  4K7I A;  4TR0 A;  1SL1 B;  2YOI A;  4EVM A;  2B5X A;  4NV2 A;  4KUN A;  3DD3 A;  3FR9 A;  1PRX A;  3IE3 A;  1OKT A;  3TKS E;  1KBN A;  4IP1 A;  3ZMK A;  2XPE A;  4G0L A;  2AAW A;  1ZL9 A;  1R7H A;  3CSH A;  3HCZ A;  4WR5 A;  5ECN B;  4NHW A;  3TJB A;  3BOA A;  3GN3 A;  4LL4 B;  3D4T A;  4AGS A;  3LG6 A;  3GX8 A;  1O8X A;  1EGR A;  1GTB A;  2LV3 A;  2P31 A;  2H0G A;  2X64 A;  4JU5 A;  4JZQ A;  3TJJ A;  5CNW A;  4XS6 A;  1KNG A;  2G2Q A;  3PR8 A;  3DIE A;  3BD2 A;  1YEX A;  2ALB A;  3HDC A;  1PQN A;  1BYE A;  4IQ1 A;  4GST A;  1SJ6 A;  4V2M A;  2REM A;  1K0O A;  2VL9 A;  2O8V B;  2HZF A;  3APQ A;  4GRF A;  4BVX A;  3UOM A;  2B1L A;  4EDZ A;  4GXZ A;  3TRX A;  1ON4 A;  5G1L A;  3GKK A;  3FZA A;  2AUV A;  2I1U A;  2JU5 A;  4GWR A;  3FY7 A;  2C8U A;  1A0F A;  1X9S B;  2LJA A;  2WJU A;  3D5J A;  2AB6 A;  2FCH A;  3ZYW A;  4EDY A;  5HFI A;  2O89 A;  2YZU A;  3Q19 A;  3APO A;  3LGC A;  1XFL A;  2WDU A;  3MWH A;  3FYG A;  1NSW A;  1B48 A;  4BVX B;  5C04 A;  19GS A;  1ZCP A;  4KX4 A;  5IMA A;  3G7Y A;  1JZR A;  1O81 A;  3W8S A;  1PD2 1;  3C1R A;  3VI7 A;  5ECO B;  1ABA A;  1BG5 A;  1F9M A;  3TRP A;  1ZYE A;  3VWX A;  1OE8 A;  1O85 A;  2KP1 A;  3ZRE A;  1DSB A;  1FB6 A;  2OJL A;  3TJK A;  1ZYN A;  2F8A A;  1TI3 A;  3S9F A;  4WKW A;  3FZ5 A;  5B7C A;  5EY6 A;  2N5F A;  1GUH A;  2RII A;  5B8B A;  3SWL A;  1XIY A;  1TK8 B;  4MMM A;  2VAF A;  3O3T A;  5ECR B;  2R4V A;  2EC4 A;  3UL3 A;  1BQ7 A;  2L4Q A;  5CRG A;  4HZ2 A;  3HHV A;  1YJ6 A;  4MF6 A;  2GSQ A;  4HQZ A;  2MMZ A;  4MP4 A;  2X8G A;  1HD2 A;  1PKW A;  5HFG A;  2HLS A;  3UIW A;  3UVH A;  4OO5 A;  2X99 A;  4IJ3 A;  3QPM A;  4J2F A;  1VGL A;  2ES7 A;  2GZY A;  5G2Z A;  3FZ4 A;  4ZB8 A;  4WF5 A;  4DSR A;  2DML A;  3L78 A;  4ZXG A;  3DML A;  4RI7 A;  1TRW A;  4BPY A;  2KP2 A;  4ID0 A;  5BMU A;  1B8X A;  1XWB A;  3KH9 A;  3W6G A;  2H66 A;  1OC9 B;  1A0R P;  1Z5Y E;  1M99 A;  3EUR A;  3TGZ A;  3CRU A;  1JZW A;  22GS A;  1URM A;  3HVV A;  2LNS A;  1Q98 A;  3EE2 A;  2CAQ A;  3C1S A;  1K3Y A;  4H86 A;  1YY7 A;  1EEM A;  1V9W A;  3V1W A;  2NPB A;  3CMI A;  3TUE A;  2YWM A;  3D22 A;  3FKF A;  3E9J B;  1JLW A;  2H75 A;  3WD6 A;  1GUL A;  1ZOF A;  4TN8 A;  4YAV A;  1ACV A;  1TK0 B;  5IO0 A;  4MH2 A;  2HSY A;  4RUV A;  2V1M A;  1RW1 A;  4NMU A;  4POK A;  1A23 A;  4F03 A;  1ILO A;  1SD9 A;  4PNF A;  4IBP A;  1SD8 A;  2A2R A;  5EPF A;  3WT2 A;  2J23 A;  5IPH A;  2DBC A;  2C0E A;  2RUE A;  4AJ6 A;  4K0G A;  3US3 A;  1TKD B;  1PMT A;  1FW1 A;  5DJL A;  1EEJ A;  4F82 A;  1UC7 A;  3GV1 A;  3F3R A;  3MIX A;  4BL7 A;  1GSD A;  3QCP A;  3LEF A;  1M9A A;  1NHY A;  2BTO T;  2FHE A;  4OCF A;  4KDU A;  1GNE A;  5ABR A;  1SK1 A;  3GL3 A;  2UZ8 A;  1SYR A;  3TOT A;  1V58 A;  4MAB A;  2QKE A;  3L0H A;  3TKS A;  5HR2 A;  4D73 B;  5CRW A;  3LSZ A;  3TB2 A;  1S3D A;  2OA7 A;  4X0X A;  4ECC A;  3HKR A;  4E8E A;  4QQ7 A;  1O6J A;  4KH7 A;  2IMF A;  1WJK A;  1XW5 A;  5IMD A;  5C00 A;  2LRC A;  3HD5 A;  4BL7 B;  1FHE A;  2E0Q A;  3P7X A;  1VF1 A;  2DMM A;  5DCG A;  2XC2 A;  1VF2 A;  1G0T A;  4G9H A;  1PGT A;  5HR0 A;  4TVE A;  2CQ9 A;  1FO5 A;  5D96 A;  3KGK A;  4ML1 A;  1DE2 A;  4HZ4 A;  3KH7 A;  6GST A;  2GGT A;  5JCG A;  5D9V A;  3TJG A;  2GSR A;  4CW9 A;  2H73 A;  1SJI A;  1M2A A;  3LWA A;  4K9Z A;  5F07 A;  1G6Y A;  2Z9S A;  3GKX A;  4ULX A;  4K6X A;  4DSS A;  1J08 A;  4ACS A;  4O5Q A;  2D2Z A;  1UVZ A;  3ERF A;  4EO3 A;  1DE1 A;  2OBK A;  5CO3 A;  2GQM A;  2XBI A;  3TRQ A;  4KND A;  4QL9 A;  3CTG A;  3H4K A;  4FYC A;  5AIS A;  4MZC A;  2FUG 2;  5D9X A;  4GTU A;  2HNL A;  3H79 A;  1O73 A;  2WFC A;  2A4V A;  2R37 A;  4TRX A;  4DSS B;  4F2I A;  2YAN A;  4ZBD A;  3M9K A;  3KMO A;  1XW6 A;  6GSU A;  4NAX A;  1T4Y A;  5AIV A;  2H0I A;  1I5G A;  1K0C A;  1N8J A;  4DVC A;  2L4C A;  2CA8 A;  2X8H A;  3QOU A;  3IAM 2;  5IPG A;  5CAX A;  4XIH A;  4L0W A;  2HRA A;  1PSQ A;  2P0G A;  2L6D A;  3F6F A;  2NVL A;  1SEN A;  5D9T A;  2VL2 C;  2YWI A;  3U5R E;  1GUK A;  2DKI A;  2GSS A;  3GA4 A;  3MNG A;  4GQF A;  1QK8 A;  4ZL8 A;  2LJK A;  1MD3 A;  2IIY A;  3D6I A;  4XRD A;  3KZQ A;  4F9Z A;  4IP6 A;  5AN1 A;  4WBR D;  5CRD A;  1GP1 A;  4XTS A;  2F8F A;  3DVW A;  3FK8 A;  4GCI A;  2VCT A;  4YKG A;  4IVF A;  1M2D A;  2G0F A;  1YF0 A;  4GSS A;  5HQP A;  2YWN A;  2H19 A;  5KN2 A;  2XHF A;  1V2A A;  4JE1 A;  2LRT A;  3QMX A;  5G1K A;  3F8U A;  2P5R A;  3FW2 A;  3GUR A;  1FOV A;  6GSW A;  1TRU A;  4TOP A;  4YKF A;  1TU8 A;  3VPQ A;  4G2E A;  4TR3 A;  1U88 A;  4TXV A;  1X5E A;  2OBI A;  3UBK A;  4NWY A;  3A3T A;  1SKS B;  4XS4 A;  3CTF A;  3AY8 A;  9GSS A;  4L8E A;  5H5Q A;  1LJR A;  4POL A;  2H74 A;  2IWT A;  1MDJ A;  3SBC A;  1XWG A;  5A5K A;  3GUS A;  4CY8 A;  2BJX A;  4Q5F A;  2X8C A;  4KGI A;  1OC8 A;  5D8I A;  2C80 A;  1WOU A;  14GS A;  4PNG A;  2VOC A;  5IM9 A;  2H6X A;  2VLT A;  1K0B A;  3J7Y b;  3KMN A;  4FYU A;  4XS4 B;  4PGT A;  1QMV A;  3A2V A;  3R2Q A;  2KUC A;  2MBS A;  3IBH A;  2FY6 A;  3CSJ A;  3KJY A;  3DKS A;  4KCE A;  5LNK e;  1AQW A;  4MJC A;  2JZS A;  5J9C A;  4MPF A;  1UA5 A;  1OAZ A;  2GTU A;  2LRN A;  2PMT A;  3EYT A;  2H8L A;  2PU9 C;  2V41 A;  2C3T A;  2GST A;  16GS A;  3N5O A;  2VUP A;  4LL1 B;  1K0D A;  3IV4 A;  2DKH A;  4ISD A;  2VD0 A;  4HI7 A;  1M9B A;  2KLX A;  2CX4 A;  1MTC A;  4MLY A;  3Q74 A;  1WPI A;  1E2Y A;  4MJE A;  1XBS A;  2CT6 A;  2ON5 A;  1Q4J A;  2K8V A;  1FVK A;  2XPD A;  1M7T A;  4P3Y B;  3UAP A;  1GSE A;  2MMO A;  4J56 E;  4IKH A;  3QAW A;  1OC3 A;  2HXK A;  4X43 A;  3E0U A;  2B6M A;  3GKN A;  2HT9 A;  4FYB A;  4MZW A;  2F9S A;  4Z2U A;  1AIU A;  4EE0 A;  3UJ1 A;  1OVN A;  5GAN D;  3VLN A;  1AW9 A;  4DSQ A;  2OE3 A;  4YQU A;  3ME7 A;  2PUK C;  1K3L A;  4GSN A;  3BCK A;  4YH2 A;  2TRC P;  2DJ2 A;  2MBT A;  1ML6 A;  3IR4 A;  2QSI A;  3KEB A;  4I97 A;  1BJX A;  4CDO A;  5J5N A;  2MMA A;  1QXH A;  3C8E A;  2OAD A;  1CQG A;  3HZ8 A;  3WGD A;  1GH2 A;  3M3M A;  1ERW A;  2NTO A;  2FWH A;  1EOH A;  3KIJ A;  4K0N A;  4WR4 A;  2VM2 A;  1TTZ A;  2B1K A;  1TP9 A;  2LS5 A;  1UN2 A;  1THX A;  4OFT A;  1ERT A;  3IC8 A;  1TJD A;  5J3R A;  2RLI A;  1OYJ A;  1A2J A;  1OC9 A;  2V32 A;  2JSZ A;  5CYY A;  1BED A;  1PKZ A;  3NIV A;  1WE0 A;  5E4W A;  1U87 A;  1A24 A;  2O85 A;  4JRR A;  3PGT A;  4OO4 A;  4ZL7 A;  3GL5 A;  3F4R A;  5J4U A;  1J9B A;  3LXT A;  4AF2 A;  1AAZ A;  1YZX A;  2AHE A;  2AYT A;  2M80 A;  1A2L A;  1F37 A;  1QFN A;  4EKZ A;  2VL3 A;  4MZB A;  5H5R A;  1PX7 A;  3G9B A;  2DJ0 A;  4V1A g;  18GS A;  4ZIJ A;  4L5O A;  4HQS A;  4KDX A;  1JHB A;  1U3I A;  4EL1 A;  5DDL A;  1THO A;  2WUL A;  3A5I A;  3MYD A;  2HZE A;  2O87 A;  4TW5 A;  1Z6N A;  1LBK A;  4HJ2 A;  1K3O A;  4LA1 A;  1GLP A;  2H71 A;  4HDE A;  4I5Q A;  2VCW A;  2H76 A;  3I6A A;  3GYK A;  4ML6 A;  1TU7 A;  1NHO A;  20GS A;  4IS0 A;  4HS1 A;  3RDW A;  2A2S A;  3EIN A;  3EU4 A;  3LYK A;  3ZLP A;  1W4V A;  4KCA A;  1EV9 A;  5INY A;  1JZO A;  2R2J A;  4MA9 A;  3FEU A;  5HR3 A;  3F9U A;  1Z6M A;  5ECI B;  2PBJ A;  4JR6 A;  3BCI A;  2PGT A;  1XCC A;  2DC5 A;  2HZE B;  4PXO A;  2WCI A;  4EIP A;  4POM A;  4ZB9 A;  2WRT A;  13GS A;  3F0I A;  1XOA A;  3U6V A;  2A4H A;  1A2M A;  1MDI A;  1T1V A;  2C3N A;  4D73 A;  4ZB6 A;  5B6N A;  1U3A A;  1SKR B;  2GQK A;  3ZFB A;  1YQ1 A;  1VF4 A;  2JZR A;  3IA1 A;  1QGV A;  4JBB A;  1WWJ A;  4EF0 A;  1A8Y A;  3O6T A;  1ZZY A;  1OE7 A;  2L5L A;  4KDY A;  4MNN A;  5JCW A;  3KTB A;  2OKA A;  2DSA A;  2ON7 A;  2DIY A;  5KEJ A;  3D0Z A;  5AIX A;  2LKU A;  3HY2 A;  3QFA C;  4WET A;  3ZIV A;  5IOX A;  4GQC A;  2IME A;  5E59 A;  2H01 A;  3DWV A;  2B7K A;  6GSV A;  3G7I A;  3KM6 A;  3KTL A;  2YNX A;  1FOH A;  3BBY A;  4O5U A;  1FB0 A;  3M1G A;  5IMZ A;  1X5C A;  2FLS A;  4K5S A;  4LMV A;  2LQO A;  1ST9 A;  1TDI A;  1BX9 A;  1AC1 A;  4POB A;  1JZD A;  3D4M A;  3L9V A;  2IFQ A;  5F06 A;  3GST A;  3PIN A;  2GVP A;  5DVB A;  5IOW A;  2C0G A;  1GSU A;  8GSS A;  5IMV A;  2I3Y A;  7GSS A;  3HA9 A;  2I9H A;  2DJJ A;  4I2U A;  1GSY A;  3UEM A;  2DLX A;  3IDV A;  3DYR A;  5DQS A;  5GSS A;  3LYP A;  2LUS A;  2MYG A;  3VK9 A;  1DUG A;  1U6T A;  2CVK A;  5DBQ A;  1FG4 A;  5AGY A;  4FH8 A;  3GHA A;  4V2L A;  2IFQ B;  2OE0 A;  1EZK A;  2R3X A;  4YQM A;  2HRN A;  4JED A;  1XVQ A;  4K7N A;  3KD0 A;  4G19 A;  3NZN A;  1H4O A;  2H6Z A;  2WB9 A;  3ZTL A;  4F0B A;  4PQ1 A;  1TRV A;  4HEA 2;  2B7J A;  5ECM B;  5IIZ A;  1XW9 A;  4X1U A;  2R0P A;  1Z7P A;  3M9J A;  3R3E A;  1TK5 B;  3UAR A;  5FT3 A;  2QA2 A;  1JFU A;  2C4J A;  5J41 A;  2YWO A;  2MZC A;  2R6K A;  2LEG A;  1RK4 A;  1HYU A;  2EIQ A;  3C7M A;  5GZZ B;  4PUR A;  1SK0 A;  5B8A A;  1SL2 B;  1ERV A;  2PER A;  4BWQ A;  2M72 A;  2IMK A;  1E6B A;  2B3S A;  2H30 A;  4EIQ A;  3CSI A;  3I9V 2;  3O76 A;  4PX1 A;  3M0F A;  2H1D A;  4PTS A;  4KF9 A;  1MD4 A;  1YKC A;  4N0Z A;  2IMI A;  2WS2 A;  2HI7 A;  3GRX A;  3EU3 A;  3EVI A;  3A2W A;  3IXR A;  3PPU A;  4ILF A;  4O7H A;  1S3C A;  2C0D A;  4KSM A;  3BJ5 A;  5ELG A;  1WRY A;  1FAA A;  2HFD A;  2RM6 A;  3IK9 A;  5DJM A;  1Y25 A;  10GS A;  5HFK A;  4WBJ A;  1Z7R A;  3VFI A;  2H6Y A;  3L9S A;  2LST A;  4MJB A;  5EVO A;  1T00 A;  2LJR A;  2MMN A;  2PVQ A;  3ZML A;  3VI5 A;  3D21 A;  2N5B A;  3FZ9 A;  3CBU A;  4AJ8 A;  3CXG A;  4HU7 A;  4N11 A;  5KN3 A;  5KN1 A;  3HZ4 A;  1GSF A;  3GNJ A;  4IQA A;  3I43 A;  1WP0 A;  2VCQ A;  5FWG A;  1J0F A;  2RUF A;  1HNC A;  2YP6 A;  1SU9 A;  2HE3 A;  1GRX A;  3ISO A;  5BRT A;  1QQ2 A;  2GZZ A;  1Z3E A;  2A2P A;  1R5A A;  4EC0 A;  2IJY A;  2AV4 A;  4TR1 A;  2P5Q A;  1V40 A;  1GLQ A;  5G30 A;  1EGO A;  2WZ9 A;  1SJZ A;  3H93 A;  5KOX A;  2AJQ B;  5ECP B;  5LCZ A;  2JL4 A;  3P2A A;  1IYH A;  5D73 A;  4N30 A;  4K2X A;  2BMX A;  4HUA A;  4XCS A;  11GS A;  1ZYQ B;  3EMX A;  1X9M B;  4CY6 A;  1X9W B;  2JZT A;  2NDO A;  3JCM L;  3IHQ A;  1HNA A;  2ZNM A;  1PN0 A;  2DJK A;  3FHK A;  4XS1 A;  3C73 A;  2C0F A;  5ENU A;  2DIZ A;  5A4U A;  4TR1 B;  1B9X C;  4HJM A;  3LFL A;  3WGE A;  5IQY A;  3PH9 A;  1DBY A;  1R26 A;  2KOK A;  2HRK A;  2LNT A;  6GSX A;  2K6V A;  12GS A;  3L9U A;  1GTI A;  4ZBB A;  2VCV A;  2IMD A;  3HJP A;  1B9Y C;  1O8W A;  1NM3 A;  2CAI A;  3MDK A;  5EL8 A;  1EP7 A;  3F3Q A;  2HYX A;  5IO2 A;  5ECH B;  1QUW A;  2HRF A;  2QGV A;  4BVY A;  2XBQ A;  1T3B A;  4YQV A;  1WIK A;  5ID2 A;  3F6D A;  2X49 A;  4MH3 A;  1IYI A;  3HVS A;  3IAS 2;  2QC7 A;  5L71 A;  4X4J A;  4Z2R A;  1V98 A;  4PQH A;  3Q6O A;  4WEY A;  3QR6 A;  3LJR A;  4G10 A;  4K2D A;  2VL2 A;  2VLU A;  2CZ2 A;  4A5P A;  5A4V A;  1EWX A;  2GT5 A;  5DQY A;  4WF4 A;  5DCH A;  4BVY B;  2H1G A;  4FO5 A;  4EUY A;  2CZ3 A;  5ID2 B;  2YN1 A;  4KSO A;  5COH A;  1JLV A;  3CRT A;  4XHM A;  3RHB A;  4OMV A;  1M2B A;  3EMP A;  2V6O A;  2YJ7 A;  2PPT A;  5F8B A;  5FHI A;  4OFM A;  3ED3 A;  2B5Y A;  1G7E A;  1YKA A;  2L57 A;  2LQQ A;  3P8W A;  1K0N A;  4ZBA A;  4K5R A;  1VRS D;  2C1Y A;  3GSS A;  5ELA A;  1GL8 A;  3HJO A;  3QAG A;  1X0R A;  5CRH A;  1O7U A;  1Z9H A;  3KP9 A;  3I69 A;  4LLR A;  2FGX A;  4FQU A;  3GH6 A;  5KOW A;  4KE3 A;  4TR4 A;  3J7Y k;  1MEK A;  3LQ7 A;  4ICY A;  3MSZ A;  2IN3 A;  4K8M A;  4RQR A;  2CV4 A;  1T4Z A;  1SYX A;  4CHS A;  3HVX A;  2GDR A;  5DAK A;  1XZO A;  2H72 A;  2FD3 A;  3FRC A;  4E8H A;  4RI6 A;  2V2G A;  1TXX A;  2CVB A;  3M8N A;  3LOR A;  3TKS C;  3TKR A;  5DAL A;  2YPM A;  2GLR A;  4NXI A;  4Z2T A;  2FWF A;  1F3B A;  4O92 A;  1GNW A;  2OAC A;  1CQH A;  2KHP A;  1YDK A;  3GTU A;  2VIM A;  2B5E A;  3KCM A;  1HQO A;  4KW6 A;  2FWG A;  2E2G A;  1HNB A;  2F51 A;  4ZIL A;  5DAK B;  3HJM A;  1SL0 B;  5JCU A;  4KAE A;  5F05 A;  3GH9 A;  5ECS A;  2L59 A;  5DAL B;  3TDG A;  1K0M A;  4AJ7 A;  5D93 A;  2K8S A;  2VM1 A;  3LW9 A;  1TI1 A;  3UBL A;  1ZMA A;  5H5S A;  5CRE A;  6GSS A;  3A5W A;  3GTU B;  3ZFL A;  2OE1 A;  2PWJ A;  2CX3 A;  4HU9 A;  1LU4 A;  17GS A;  1PN9 A;  5D9W A;  2I4A A;  4IHU A;  3GFK A;  3FMW A;  2JSY A;  2YV7 A;  3ZRD A;  1AQX A;  3VWV A;  1H75 A;  3QFB C;  3RAZ A;  1T8E B;  4HOJ A;  4L5L A;  4ECI A;  4L0U A;  4I2T A;  4PUA A;  4ECJ A;  2TIR A;  2H0H A;  1F2E A;  1RQM A;  1X5D A;  1V57 A;  4IEL A;  3K8N A;  5G5F A;  2CVD A;  4IN0 A;  2FA4 A;  3ZIT A;  4IW9 A;  3G7J A;  4YAP A;  2WGR A;  3W8J A;  4I6X A;  3ZIJ A;  4OFN A;  3RPP A;  3RBT A;  3TKP A;  3E3E A;  3P90 A;  3DEX A;  5G31 A;  4MJA A;  4G0K A;  2NBS A;  5LD0 A;  1PX6 A;  1AXD A;  3APS A;  2IPA A;  4MF7 A;  1KEB A;  3NOF A;  2F3M A;  3TKQ A;  3DVX A;  3LXZ A;  4DEJ A;  3TOU A;  4OD7 A;  2EIR A;  2H70 A;  1GSQ A;  3C71 A;  3IK7 A;  2L6C A;  3UVT A;  4O32 A;  3TCO A;  4BWS A;  2GQL A;  1YEP A;  1FVJ A;  4IJI A;  2PVO C;  4MPG A;  3IRA A;  5IMC A;  3F63 A;  2C3Q A;  2GT6 A;  5G5E A;  3L4N A;  1EOG A;  3TJF A;  1EV4 A;  4J57 E;  4MK3 A;  1I9D A;  2M46 A;  1T7P B;  3EPT A;  1B4P A;  3QAV A;  1GWC A;  2DJ1 A;  1GTA A;  1OKD A;  1USB A;  1KTE A;  5JWQ B;  4OWY A;  1Y6E A;  2H1A A;  2JAD A;  1M0U A;  4EXJ A;  1PL1 A;  2I81 A;  2IL3 A;  2R0C A;  4G0I A;  3IHG A;  1ZGN A;  3DGQ A;  3VWW A;  3ZL5 A;  3GIX A;  3WT1 A;  1ZYP A;  3ZVJ D;  5GAP D;  4MDC A;  5ECL B;  1XPV A;  1XWA A;  4F0C A;  5B6M A;  2VO4 A;  4K1F A;  4KB3 A;  4Q5N A;  3IPZ A;  3VUR A;  4V2N A;  3QD9 A;  3ZVJ A;  3IOS A;  4MF5 A;  1MDK A;  4N0V A;  2N5A A;  2LTK A;  1W89 A;  2QA1 A;  3Q18 A;  4Q5Q A;  1WMJ A;  4GLT A;  3QDN A;  3RHC A;  3UMA A;  2FA8 A;  1XXU A;  4I8B A;  1GUM A;  3GMF A;  4WXT A;  2VCZ A;  1AUC A;  3H8Q A;  2ZCT A;  3ME8 A;  2E2M A;  3F4T A;  3WYW A;  3FR3 A;  2R5G A;  5J9B A;  1TRS A;  1TW9 A;  1NW2 A;  1ERU A;  2O7K A;  5IMF A;  5ECK B;  4TXO A;  3A2X A;  2DJ3 A;  3ERG A;  4PQI A;  4KA0 A;  4GF0 A;  5JWR B;  3GX0 A;  4USS A;  2VLV A;  3RPN A;  2YZH A;  2EIO A;  2ZUP A;  2K9F A;  2H1B A;  2FWE A;  4XRA A;  1G7O A;  1XVW A;  4Z7X A;  5HR1 A;  1G6W A;  2VCX A;  1XWK A;  4Q5R A;  2YCD A;  2PN8 A;  3N9J A;  3DRN A;  1SK2 A;  2HSH A;  1XOB A;  3VWU A;  1AQV A;  1B4Q A;  1PA3 A;  4TXO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...