4N11A

Crystal structure of plasmodium falciparum reduced glutaredoxin 1 (pfgrx1) complexed with cisplatin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
108
structure length
108
Chain Sequence
TSEAVKKWVNKIIEENIIAVFAKTECPYCIKAISILKGYNLNSHMHVENIEKNPDMANIQAYLKELTGKSSVPRIFINKDVVGGCDDLVKENDEGKLKERLQKLGLVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin
publication title Interaction of Cisplatin with plasmodium falciparum Glutaredoxin 1
rcsb
source organism Plasmodium falciparum
total genus 39
structure length 108
sequence length 108
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4n11A00
4HQSA 3KD0A 2JZRA 5IO0A 2HYXA 2H6XA 3RDWA 3A5WA 1TRVA 2QKEA 1M2AA 4NXIA 1NSWA 4MZWA 2YANA 3VWWA 4WBJA 2H6ZA 3GNJA 3M0FA 3TKQA 2VM1A 2RIIA 3LGCA 4N0VA 4MZCA 4EL1A 3QAVA 1OYJA 1OC9A 3DMLA 1XWCA 1B4QA 2LRNA 2WULA 4IVFA 2LTKA 2P5QA 5ECKB 1ERVA 1THOA 4X43A 5EVOA 4WKWA 3VURA 2I9HA 1OKDA 3TJGA 3O3TA 4PQ1A 2LNSA 2NVLA 3H1NA 3HVXA 1X5EA 2L6CA 4JZQA 2R5GA 1O6JA 2NBSA 2LNTA 3CSHA 2VIMA 4GQFA 2P0GA 4TR1B 4F03A 2OE0A 5J5NA 3BD2A 3FHKA 3TKSC 3ISOA 3FR9A 2HRNA 5D93A 2CVKA 2YWOA 4HZ2A 4RQXA 1Z5YE 1K3YA 2VCTA 4OMVA 1Z7PA 5FHIA 5EPFA 3KJYA 4BVYA 1VF1A 4DVCA 1QGVA 2V1MA 1MD4A 1GSEA 4RUVA 3IC4A 2O89A 3D0ZA 4NMUA 3UVHA 2HFDA 5KN3A 10GSA 4D73A 4NV2A 3P8WA 4PX1A 2MZCA 4OO4A 4HU9A 2TRXA 5D9XA 1FG4A 4JEDA 2Z9SA 2OE1A 3RPPA 3VPTA 3LFLA 1GNWA 2HRFA 4TOPA 1X5DA 1GSDA 4PUFC 2YOIA 5ECHB 2VLVA 5LCZA 3ZIVA 3HHVA 3UAPA 1O7UA 1PA3A 4DSSB 3AY8A 3DGQA 5H5RA 4EC0A 4OD7A 4YQVA 4IELA 4L0WA 2G0FA 1BX9A 2LV3A 3HZ8A 3H79A 6GSYA 3ZMLA 5B6MA 2HNLA 4WF5A 2GZZA 3EU4A 2CVDA 3OR5A 3J7Yb 2MYGA 2XPDA 4GWRA 1O8XA 4AJ8A 2VUPA 2HZEA 4LMVA 3GYKA 5IPHA 3FR6A 1V98A 2DSAA 1Q98A 3MNGA 1A2JA 1GSQA 2EC4A 2OA7A 2GS3A 4XS4A 1DUGA 2MBSA 3KGKA 2N5FA 3TJJA 2H1BA 4JR4A 3IK7A 3CSJA 3FY7A 4JR6A 1SYXA 2CVBA 3L9UA 4OFNA 1LBKA 2GSQA 1WE0A 2DJ3A 5JWRB 3D6IA 4OCFA 4RI7A 2VL2C 2FWHA 2XPEA 4IQ1A 3D5JA 1NHYA 4AF2A 1O85A 3TUEA 3VI7A 1GP1A 3VWVA 3CTFA 3HVSA 2A2SA 4NHZA 3LJRA 4MJBA 1ON4A 3DEXA 6GSUA 1M2BA 3F4TA 3HYPA 3NOFA 2RUFA 1EV9A 1CQHA 3KMOA 3IBHA 3QDNA 3FZ5A 1MD3A 4FH8A 4XRAA 4O5RA 3C7MA 5DJMA 4DEJA 3M9KA 1PKZA 3KH9A 5IO2A 4POMA 5IMZA 1WP0A 3IOSA 2L4CA 2VOCA 2HSHA 2K6VA 1NHOA 2OJLA 3LYKA 1TP9A 1JLWA 3VPQA 4JE1A 4TR4A 3C1SA 3HDCA 2F51A 2H0IA 4HUAA 4EF0A 4GLTA 4V1Ag 3CYNA 4IJIA 4OFMA 1FO5A 5LNKe 1TRWA 1QUWA 3IAM2 4KCEA 2P5RA 3N5OA 5ECRB 1SENA 2GGTA 4POKA 4TKYA 3IDVA 5J9BA 2FGXA 1A8LA 5D96A 5ECLB 4KDYA 2L4QA 3TCOA 3MAKA 2KP1A 4ML1A 1DE1A 1DSBA 4Q5FA 3FZAA 1SJZA 4BWQA 1TRUA 4POBA 5F07A 1GLQA 4FO5A 5ECPB 1N8JA 2LJRA 4KX4A 3DRNA 1PKWA 1XXUA 3GURA 1SU9A 4KUNA 1YF1A 4PGTA 5J41A 1ZGNA 4ZBAA 1CQGA 4K0GA 4WEYA 4TR0A 1ILOA 4V2LA 4BA7A 3APQA 3GN3A 2FCHA 5AGYA 4MPFA 1ML6A 5DDLA 4HDEA 3ZLPA 3ZIJA 3J7Yk 3QFBC 4LLRA 1F9MA 1C72A 4WF4A 1SD9A 3UBLA 4QL9A 4TXOB 2I4AA 5CRWA 1R26A 1EP7A 1X9WB 1XFLA 3IV4A 3LQ7A 3UBKA 4KH7A 3GL5A 3G7IA 1KBNA 3KEBA 4TVEA 3KM6A 2IN3A 3HZ4A 1XPVA 5ECOB 2VM2A 2IMIA 3E0UA 4PNFA 2HT9A 1U87A 3FEUA 4GSNA 2DC5A 2ES7A 1ERWA 2YPMA 1E2YA 1Z7RA 1OAZA 3EURA 2VL3A 5CRHA 2FA8A 2VO4A 4PUAA 2H0GA 2VCXA 2PVOC 2BMXA 1GH2A 2C0DA 3BJ5A 3GH6A 4N30A 1X9MB 3FZ4A 2IMKA 4ZXGA 1U6TA 2RUEA 1PN9A 3DXBA 1A2LA 2JSZA 1XCCA 4PXOA 3PGTA 1SK1A 1O81A 4Z7XA 2GQLA 2WGRA 1YKCA 3QAGA 4IHUA 4YQUA 1SD8A 2ZNMA 1A0FA 5DQYA 2JU5A 3KMNA 1NM3A 3IR4A 2JSYA 5C04A 13GSA 2H6YA 1K0CA 3VLNA 1U3IA 4K9ZA 1WJKA 4BVXA 4MABA 1AQXA 1WOUA 1PL1A 1FW1A 3PINA 5F06A 3BCKA 4KNDA 1M9BA 2M80A 5JCWA 5DCGA 3DWVA 3UMAA 3TOTA 16GSA 5DAKB 3ZFLA 2CQ9A 3RBTA 5A5KA 3ERFA 1QMVA 2XBQA 1T8EB 4FYCA 1U3AA 3KTBA 1M99A 2H74A 3H4KA 5HFGA 2CV4A 3DIEA 1JZOA 5G5FA 3FK8A 2J23A 2VLTA 2L5LA 3ZVJD 4NWYA 1G6YA 1JZRA 1MTCA 4HZ4A 5IIZA 4MF5A 3K8NA 5ELGA 1BYEA 2WFCA 4MMMA 1XWBA 5CREA 4IQAA 1FAAA 2JZTA 3KXOA 2PVQA 2R37A 1GSUA 3O6TA 2B1LA 4ECIA 3PR8A 3M9JA 2IIYA 1SJIA 2PU9C 2R6KA 2OACA 1W89A 1XZOA 2VCWA 1HNBA 1GUKA 3M1GA 2DLXA 5HR0A 3HA9A 4ILFA 2L5OA 1F2EA 1HNCA 1G6WA 3IAS2 1A8YA 3QR6A 5IQYA 3IHQA 2LQQA 4ZB8A 2H72A 1ZMAA 1IYHA 5EY6A 2LKUA 1K0BA 3D22A 2X64A 1A23A 2C3QA 5KN1A 4H86A 2F8AA 1EOHA 4GXZA 1PRXA 1SK0A 2B5XA 3TJFA 5HR1A 4DSSA 3TKRA 1RK4A 2N5BA 3FKFA 2H66A 2GDRA 3WGDA 1XW9A 2B3SA 1A0RP 4GSTA 1K0DA 4FIWA 3ZREA 1R5AA 5IMDA 3EE2A 1JHBA 3IK9A 3TJBA 4TRXA 4AGSA 2CX3A 3I6AA 3CTGA 4ZILA 3RAZA 1TKDB 5AN1A 5FWGA 5CNWA 1X0RA 1WIKA 2O85A 1GTUA 4QQ7A 4CHSA 3QMXA 5DALA 4XHMA 1BJXA 1EEMA 3Q6OA 1OE7A 2YJ7A 5ECMB 1V57A 3TGZA 4EKZA 5A4VA 4MJEA 2VCZA 3F4RA 2H76A 2WB9A 4ACSA 3U5RE 5G1KA 1T3BA 2H1DA 2HXKA 5DCHA 1NW2A 4IS0A 4WR4A 1Q4JA 2VCQA 2GZPA 3APOA 5HFIA 4G19A 2HSYA 4RQRA 4P3YB 4O32A 2J9HA 1A24A 2CZ2A 4ISDA 2KLXA 2WJUA 6GSSA 4ZB6A 5AIXA 3A2VA 1AC1A 2JL4A 1OC9B 4I5QA 3UIWA 2LUSA 3BCIA 2MMOA 2PPTA 1WRYA 4F9ZA 3TKSE 2AJQB 3NZNA 2R2JA 4WXTA 1TK8B 4ML6A 3QCPA 5LD0A 1PQNA 1PGTA 1QXHA 3QOUA 2F8FA 4LMWA 3L9VA 1XWKA 8GSSA 1USBA 3EMXA 1QK8A 3KZQA 2DIZA 1B4PA 2VCVA 1H4OA 2IJYA 4PQIA 4NPBA 2IFQA 4IGJA 3LEFA 2GVPA 3TOUA 1PX7A 1TJDA 4EDYA 4GTUA 3RHBA 1TU7A 2B5YA 4DSRA 9GSSA 3LYPA 3GKKA 4XRDA 1FVJA 1XBSA 2FY6A 3Q19A 5IPGA 1GULA 1GUMA 3P2AA 1ERTA 4D73B 3HVVA 4EE0A 2AYTA 1AW9A 1G7EA 3U6VA 1V58A 3CXGA 2K8VA 3P90A 2PMTA 5IM9A 3UVTA 4IJ3A 5F0GA 4BL7A 3NIVA 2DIYA 5CYYA 5G30A 4I8BA 1U88A 3WYWA 1GUHA 2VD1A 3ZVJA 1AIUA 2KOKA 5AISA 4HS1A 4ZL9A 1G0TA 1T4ZA 1M2DA 1V2AA 1FB0A 5ABRA 3C71A 1FVKA 4EVMA 2HZFA 2E2GA 3FW2A 4GSSA 2FLSA 5IMVA 4DSQA 2H1GA 4BWSA 1J08A 1ZOFA 4IKHA 2AUVA 4MH2A 3GL3A 4KDXA 2HZEB 2JACA 2P31A 2NDOA 2PUKC 3GTUA 3GX0A 4XS6A 5CO3A 3ZL5A 2KHPA 2WDUA 2XBIA 1T4YA 4Q5NA 4N10A 5A4WA 4XS4B 2LRCA 3IE3A 1Z3EA 2WZ9A 2FWFA 4GF0A 2H71A 5D8IA 3TDGA 3GFKA 5GAPD 3ZTLA 2K8SA 2MBTA 1YDKA 2D2ZA 3H8QA 3P7XA 4LL1B 2RLIA 4ECBA 1R5PA 3E3EA 1OKTA 1ERUA 1SK2A 2JZSA 3ZFBA 4XS1A 4IW9A 4AJ6A 1G7OA 2H30A 2C0EA 2YWIA 5JWQB 3VWUA 4TR3A 4TXVA 3CRUA 4X0XA 1J9BA 3L0HA 1AQWA 2NTOA 5ID2A 5KN0A 2KUCA 2GT5A 3ERWA 1ZL9A 4WR5A 4AJ7A 3A3TA 2YNXA 4KCAA 4ZBBA 4Q5RA 11GSA 3IRAA 3VI5A 1B9XC 1K0NA 1OVNA 1DBYA 1PD21 5DAKA 1T00A 2F3MA 3VWXA 2C0FA 5C00A 3EMPA 4MJAA 3ED3A 3G7JA 4N0ZA 2I3YA 4N11A 1K0AA 1TI1A 3GV1A 2B7KA 2L6DA 2YZUA 1VF2A 1YJ6A 3LXZA 1QFNA 4V2MA 2ZUPA 4ZL8A 5JWOB 1J0FA 1GSSA 1ZYEA 1M0UA 2XC2A 3GIXA 1AUCA 2PBJA 1WWJA 2V6OA 3D4TA 4V1Ap 12GSA 2L59A 3BBYA 4MLYA 3UEMA 3MWHA 4NHWA 1Z9HA 1ZYQB 2NPBA 2IWTA 18GSA 5DVBA 1I9DA 1PMTA 1KEBA 1I5GA 1EGOA 4O7HA 5L71A 4MJCA 4JBBA 3C73A 4HI7A 6GSTA 1ACVA 4IP6A 4XTSA 1WMJA 2YV7A 1VF3A 1UN2A 4X1UA 3GX8A 2F9SA 1GTAA 4ZBDA 2HLSA 3WT2A 3GMFA 1K0MA 4EUYA 1VF4A 3CSIA 2EIQA 1YY7A 3SBCA 4L5OA 1B48A 5CAXA 7GSSA 2CAIA 2H01A 3L78A 3ME8A 5INYA 1YQ1A 2PWJA 5B7CA 17GSA 1SYRA 4TN8A 1YEPA 2O8VB 5E59A 3VFIA 3TKPA 3UOMA 3M8NA 2YN1A 1TXXA 3F4SA 3TB2A 1TU8A 2GLRA 3JCML 5IMFA 4YQMA 4TR1A 19GSA 2N5AA 4OCEA 1ZZYA 3W6GA 4KB3A 4MK3A 2REMA 1XVQA 1YZXA 2GSSA 6GSWA 1YF0A 3F63A 4K0NA 2DMMA 2PGTA 3O76A 5ECIB 3WGEA 4WETA 4EO3A 1A2MA 1EZKA 4LL4B 3EYTA 2LSTA 2GSRA 1EV4A 2FNOA 1XOAA 1GNEA 1QQ2A 3Q74A 3QAWA 5EL8A 5FT3A 3GKMA 3TJKA 1SL2B 3QD9A 3IA1A 2EIRA 2H8LA 5DQSA 4K8MA 5G1LA 1GWCA 3KP8A 4F0CA 1B8XA 2WRTA 2LS5A 5ENUA 2AV4A 6GSXA 2E2MA 2TRCP 2H19A 2OKAA 4GCIA 1HNAA 3GA4A 1EOGA 1E6BA 4ZB9A 1TI3A 3TKSA 4MF6A 3UL3A 3GKXA 1FHEA 4GQCA 3A2WA 4YAVA 3HXSA 1SJ6A 1RW1A 3FYGA 3DD3A 5D9TA 5ECSA 4K2DA 2DJ1A 4K7IA 3W8JA 1UVZA 3WGXA 1XW5A 5DBQA 1V40A 3ZYWA 5ECQB 1GSYA 1K3OA 2B5EA 1RQMA 4JRRA 3S9FA 3GKNA 2PERA 2H70A 5CRGA 2VAFA 3E9JB 1IYIA 2K18A 1XWAA 3TRQA 5D9VA 3EVIA 2R4VA 4KA0A 5H5SA 2CZ3A 5J9CA 3FZ9A 4XIHA 1SKRB 1BAYA 2MMNA 3F3QA 3RPNA 4POLA 1S3AA 4G10A 4ZL7A 3D21A 3ZMKA 2OE3A 1XOBA 2E7PA 4O92A 1XWGA 5F8BA 4F0BA 1EGRA 1EWXA 2HI7A 2X99A 3HY2A 1AXDA 3WT1A 3G9BA 1W4VA 2YP6A 3RHCA 3F6DA 2C3NA 4KE3A 1ZCPA 4OWYA 5D73A 5KEJA 3M3MA 2IPAA 3LWAA 3W8SA 5HQPA 1UA5A 2C3TA 2OADA 4GRFA 2AHEA 2G2QA 4MZBA 4I97A 2V32A 3QFAC 1HD2A 1X9SB 2DJ2A 2FHEA 2YWNA 4MCUA 1V9WA 3F3RA 1PSQA 3LXTA 3F9UA 1MDKA 1PL2A 1SKSB 3TRPA 2EIOA 3MSZA 3I9V2 5F05A 20GSA 5H5QA 4PNGA 2VL2A 3QPMA 5DALB 2K9FA 4G2EA 3N9JA 4TW5A 6GSVA 4QL7A 2FUG2 5G5EA 4KGIA 1S3CA 2ZCTA 3A2XA 4HJMA 2GTUA 1F6MC 3LORA 5DJLA 3VK9A 2CAQA 2E0QA 3R2QA 2I81A 4NAXA 2CA8A 1X5CA 4MDCA 5GSSA 2B1KA 1OC3A 4L8EA 3APSA 5B8AA 3MDKA 4IP1A 2QC7A 3KTLA 2FA4A 3GSTA 3ERGA 3HKRA 1JLVA 4PURA 1UC7A 4RI6A 1YKAA 4HEA2 4MF7A 1GL8A 5IOXA 2A4VA 1EP8A 2CX4A 2M72A 4OFTA 1H75A 4PQHA 4FYBA 4ECCA 4F82A 3L4NA 3Q18A 2C1YA 1HQOA 4EXJA 4FYUA 1AAZA 4TXOA 2DBCA 5IMAA 4YH2A 1JZWA 1LU4A 4ZIJA 4HJ2A 3CMIA 4K7NA 3TRXA 2GZYA 5ECNB 3HCZA 1SKWB 1PX6A 3HD5A 3PH9A 1SL1B 5HR2A 4HU7A 1K0OA 2RM5A 4WBRD 3V1WA 1F3AA 2AB6A 3EU3A 4I6XA 3ZZXA 3GUSA 2GQMA 1VGLA 5COHA 3GHAA 3D4MA 2IFQB 2LJAA 2ALBA 1ST9A 2B7JA 2GQKA 22GSA 2R3XA 4IBPA 4I2UA 3CRTA 2X8HA 2OBKA 3DVWA 2LEGA 2B6MA 4JU5A 1T7PB 1GLPA 4KW6A 4J56E 3EWLA 1LJRA 4MH3A 2DJ0A 3L9SA 2MMAA 3FR3A 5IOWA 1MDIA 2X8GA 4E8EA 3IXRA 3US3A 1JFUA 4ID0A 3DKSA 2L57A 1Y6EA 1JZDA 4MA9A 5G2ZA 5D9WA 1GRXA 1TOFA 1R4WA 4EDZA 4OO5A 2KP2A 3KCMA 4MP4A 4V2NA 3HJOA 14GSA 1FB6A 1F37A 2HE3A 3FRCA 5GZZB 4BPYA 4ECJA 3ME7A 2IMDA 3CBUA 1GSFA 4KSOA 5ELAA 1GTBA 1XVWA 3DYRA 4ULXA 2C0GA 2BJXA 2PN8A 3HJPA 3F0IA 2I1UA 1TK0B 2C4JA 1BG5A 2O7KA 3LG6A 4J2FA 3DVXA 1FOVA 4CDOA 4HOJA 3LSZA 4E8HA 4LA1A 1BQ7A 1TDIA 3WD6A 2YCDA 4F2IA 3F8UA 2WS2A 1AQVA 3GTUB 1Y25A 1TTZA 5HR3A 5E4WA 3KH7A 1M9AA 2H1AA 2A2RA 3HJMA 2YZHA 4CW9A 1VRSD 2V6KA 2VL9A 1DE2A 1M7TA 2FWGA 2WCIA 4IN0A 2YV9A 4K6XA 1OE8A 2C8UA 2GSTA 3I43A 3KIJA 2TIRA 1KNGA 2YWMA 5JCUA 1Z6NA 1TK5B 2V41A 1MEKA 5G31A 4NV5A 3ZITA 2M46A 2AAWA 1HYUA 2DMLA 1T1VA 5KN2A 3UARA 2X8CA 3EC3A 4XCSA 1Z6MA 4Q5QA 1B9YC 1O8WA 3UJ1A 4I2TA 4K1FA 5GSTA 1SL0B 1ABAA 2OBIA 5J3RA 2IMFA 3EINA 2FWEA 4KDUA 5ID2B 3IPZA 1GTIA 2H73A 5B6NA 2DJKA 4HQZA 4MPGA 3I69A 3SWLA 5AIVA 1N2AA 2C80A 2VLUA 2FD3A 4YAPA 1WPIA 3GRXA 1BEDA 4J57E 5HFKA 2ON7A 3GH9A 2LQOA 4L5LA 2GT6A 1THXA 5J4UA 2H0HA 5CRDA 1TRSA 1OC8A 2YJHA 3G7YA 4G9HA 5CP1A 3C8EA 4KSMA 2VD0A 5B8BA 2LRTA 2XHFA 5GAND 1R7HA 1TW9A 2O87A 4KAEA 2LJKA 1MDJA 3ZRDA 2RM6A 3BOAA 2ON5A 2IMEA 2QGVA 5A4UA 2V2GA 1URMA 1O73A 5IMCA 1XW6A 2MMZA 1XIYA 3F6FA 1F3BA 2IL3A 2JADA 1YEXA 2DJJA 1KTEA 4K7OA 2BTOT 2H75A 3H93A 3GSSA 1K3LA 3C1RA 2QSIA 3KP9A 5JCGA 1S3DA 2CT6A 4L0UA 1EEJA
chains in the Genus database with same CATH superfamily
4HQSA 3KD0A 2JZRA 5IO0A 2HYXA 2H6XA 3RDWA 2A2PA 3A5WA 1TRVA 2QKEA 1M2AA 4NXIA 4BVXB 1NSWA 4MZWA 2YANA 3VWWA 4WBJA 2H6ZA 3GNJA 3M0FA 3TKQA 2VM1A 2RIIA 3LGCA 4N0VA 4MZCA 4EL1A 3QAVA 1OYJA 1OC9A 3DMLA 1XWCA 1B4QA 2LRNA 2WULA 4IVFA 2LTKA 2P5QA 5ECKB 1ERVA 1THOA 4X43A 5EVOA 4WKWA 3VURA 2I9HA 1OKDA 3TJGA 3O3TA 4PQ1A 2LNSA 2NVLA 3H1NA 3HVXA 1X5EA 2L6CA 4JZQA 2R5GA 1O6JA 2NBSA 2LNTA 3CSHA 2VIMA 4GQFA 2P0GA 4TR1B 4F03A 2OE0A 5J5NA 3BD2A 3FHKA 3TKSC 3ISOA 3FR9A 2HRNA 5D93A 2CVKA 2YWOA 4HZ2A 4RQXA 1Z5YE 1K3YA 2VCTA 4OMVA 1Z7PA 5FHIA 4G0LA 5EPFA 3KJYA 4BVYA 1VF1A 4DVCA 1QGVA 2V1MA 1MD4A 1GSEA 4RUVA 3IC4A 2O89A 3D0ZA 4NMUA 3UVHA 2HFDA 5KN3A 10GSA 4D73A 4NV2A 3P8WA 4PX1A 2MZCA 4OO4A 4HU9A 2TRXA 5D9XA 1FG4A 4JEDA 2Z9SA 2OE1A 3RPPA 3VPTA 3LFLA 1GNWA 2HRFA 4TOPA 1X5DA 1GSDA 4PUFC 2YOIA 5ECHB 2VLVA 5LCZA 3ZIVA 3HHVA 3UAPA 4CY8A 1O7UA 1PA3A 4DSSB 3AY8A 3DGQA 5H5RA 4EC0A 4OD7A 4FQUA 4YQVA 4IELA 4L0WA 2G0FA 1BX9A 3IHGA 2LV3A 3HZ8A 3H79A 6GSYA 4Z2TA 3ZMLA 5B6MA 2HNLA 4WF5A 2HRKA 2GZZA 3EU4A 2CVDA 3OR5A 3J7Yb 2MYGA 2XPDA 4GWRA 3MYDA 1O8XA 4AJ8A 2VUPA 2HZEA 4LMVA 3GYKA 5IPHA 3FR6A 1V98A 2DSAA 1Q98A 3MNGA 1A2JA 1GSQA 2EC4A 2OA7A 2GS3A 4XS4A 1DUGA 2MBSA 3KGKA 2N5FA 3TJJA 2H1BA 4JR4A 3IK7A 3CSJA 3FY7A 4JR6A 1SYXA 2CVBA 3L9UA 4OFNA 1LBKA 2GSQA 1WE0A 2DJ3A 5JWRB 3D6IA 4OCFA 4RI7A 2VL2C 2FWHA 2XPEA 4IQ1A 3D5JA 1NHYA 4AF2A 1O85A 3TUEA 3VI7A 1GP1A 3VWVA 3CTFA 3HVSA 2A2SA 4NHZA 3LJRA 4MJBA 1ON4A 3DEXA 6GSUA 1M2BA 3F4TA 3HYPA 3NOFA 2HRAA 2RUFA 1EV9A 1CQHA 3KMOA 3IBHA 3QDNA 3FZ5A 5BMUA 1MD3A 4HSCX 4FH8A 2X49A 4XRAA 4O5RA 3C7MA 5DJMA 4DEJA 3M9KA 1PKZA 3KH9A 5IO2A 4POMA 5IMZA 1WP0A 3IOSA 2L4CA 2VOCA 2HSHA 2K6VA 1NHOA 2OJLA 3LYKA 1TP9A 1JLWA 3VPQA 4JE1A 4TR4A 3C1SA 3HDCA 2F51A 2H0IA 4HUAA 4EF0A 4GLTA 4V1Ag 3CYNA 4IJIA 4OFMA 1FO5A 5LNKe 1TRWA 1QUWA 3IAM2 4KCEA 2P5RA 3N5OA 5ECRB 1SENA 2GGTA 4POKA 4TKYA 3IDVA 5J9BA 2FGXA 1A8LA 5D96A 5ECLB 4KDYA 2L4QA 3TCOA 3MAKA 2KP1A 4ML1A 1DE1A 1DSBA 4Q5FA 3FZAA 1SJZA 4BWQA 1TRUA 4POBA 5F07A 1GLQA 4FO5A 5ECPB 1N8JA 2LJRA 4YKGA 4KX4A 3DRNA 1PKWA 1XXUA 3GURA 1SU9A 4KUNA 1YF1A 4PGTA 4BL7B 1ZGNA 5J41A 4ZBAA 1CQGA 4K0GA 4WEYA 4TR0A 1ILOA 4V2LA 4BA7A 3APQA 3GN3A 2FCHA 5AGYA 4MPFA 1ML6A 5DDLA 4HDEA 3ZLPA 3ZIJA 3J7Yk 3QFBC 4LLRA 1F9MA 1C72A 4WF4A 1SD9A 3UBLA 4QL9A 4TXOB 2I4AA 5CRWA 1R26A 1EP7A 1X9WB 1XFLA 4EIPA 3IV4A 3LQ7A 3UBKA 4KH7A 3GL5A 3G7IA 1KBNA 3KEBA 4TVEA 3LW9A 3KM6A 2IN3A 3HZ4A 1XPVA 5ECOB 1FOHA 2VM2A 2IMIA 3E0UA 4PNFA 2HT9A 1U87A 3FEUA 4GSNA 2DC5A 2ES7A 1ERWA 2YPMA 1E2YA 1Z7RA 1OAZA 3EURA 2VL3A 5CRHA 2FA8A 2VO4A 4PUAA 2H0GA 2VCXA 2PVOC 2BMXA 4Z2RA 1GH2A 2C0DA 3BJ5A 3GH6A 4N30A 1X9MB 3FZ4A 2IMKA 4ZXGA 1U6TA 2RUEA 1PN9A 3DXBA 1A2LA 2JSZA 1XCCA 4PXOA 3PGTA 1SK1A 1O81A 4Z7XA 4KF9A 2GQLA 2WGRA 1YKCA 3QAGA 4IHUA 4YQUA 1SD8A 2ZNMA 1A0FA 5DQYA 2JU5A 3KMNA 1NM3A 3IR4A 2JSYA 5C04A 13GSA 2H6YA 1K0CA 3VLNA 1U3IA 4K9ZA 1WJKA 4BVXA 4MABA 1AQXA 1WOUA 1PL1A 1FW1A 3PINA 4Z2UA 5F06A 3BCKA 4KNDA 1M9BA 2M80A 5JCWA 5DCGA 3DWVA 3UMAA 3TOTA 16GSA 5DAKB 3ZFLA 2CQ9A 3RBTA 4O5UA 5A5KA 3ERFA 1QMVA 2XBQA 1T8EB 4FYCA 1U3AA 3KTBA 1M99A 2H74A 3H4KA 5HFGA 1PN0A 2CV4A 3MIXA 3DIEA 1JZOA 5G5FA 3FK8A 2J23A 2VLTA 2L5LA 3ZVJD 4NWYA 1G6YA 1JZRA 1MTCA 4HZ4A 5IIZA 4MF5A 3K8NA 5ELGA 1BYEA 2WFCA 4MMMA 1XWBA 4EIQA 5CREA 4IQAA 1FAAA 2JZTA 3KXOA 2PVQA 2R37A 1GSUA 3O6TA 2B1LA 4ECIA 3PR8A 3M9JA 2IIYA 1SJIA 2PU9C 2R6KA 2OACA 1W89A 1XZOA 2VCWA 1HNBA 1GUKA 3M1GA 2DLXA 5HR0A 3HA9A 4ILFA 2L5OA 1F2EA 1HNCA 1G6WA 3IAS2 1A8YA 3QR6A 5IQYA 3IHQA 2LQQA 4ZB8A 2H72A 3HVNA 1ZMAA 1IYHA 5EY6A 2LKUA 1K0BA 3D22A 2X64A 1A23A 2C3QA 5KN1A 4H86A 2F8AA 1EOHA 4GXZA 1PRXA 1SK0A 2B5XA 3TJFA 5HR1A 4DSSA 3TKRA 1RK4A 2N5BA 3FKFA 4CY6A 2H66A 2GDRA 3WGDA 1XW9A 2B3SA 1A0RP 4GSTA 1K0DA 4FIWA 3ZREA 1R5AA 5IMDA 3EE2A 1JHBA 3IK9A 3TJBA 4TRXA 4AGSA 2CX3A 3I6AA 3CTGA 4ZILA 3RAZA 1TKDB 5AN1A 5FWGA 5CNWA 1X0RA 1WIKA 4X4JA 2O85A 1GTUA 4QQ7A 4CHSA 3QMXA 5DALA 4XHMA 1BJXA 1EEMA 3Q6OA 1OE7A 2YJ7A 5ECMB 1V57A 3TGZA 4EKZA 5A4VA 4MJEA 2VCZA 3F4RA 2H76A 2WB9A 4ACSA 3U5RE 5G1KA 1T3BA 2H1DA 2HXKA 5DCHA 1NW2A 4IS0A 4WR4A 1Q4JA 2VCQA 2GZPA 3APOA 5HFIA 4G19A 2HSYA 4RQRA 4P3YB 4O32A 2J9HA 1A24A 2CZ2A 4ISDA 2KLXA 2WJUA 6GSSA 4ZB6A 5AIXA 3A5IA 3A2VA 1AC1A 2JL4A 1OC9B 4I5QA 3UIWA 2LUSA 3BCIA 2MMOA 2PPTA 1WRYA 4F9ZA 3TKSE 2AJQB 3NZNA 2R2JA 4WXTA 1TK8B 4ML6A 4USSA 3QCPA 5LD0A 1PQNA 1PGTA 1QXHA 3QOUA 2F8FA 4K2XA 4LMWA 3L9VA 1XWKA 8GSSA 1USBA 3EMXA 1QK8A 3KZQA 2DIZA 1B4PA 2VCVA 1H4OA 2IJYA 4PQIA 4NPBA 2IFQA 4IGJA 1ZYPA 3LEFA 2GVPA 3TOUA 1PX7A 1TJDA 4EDYA 4GTUA 3RHBA 4BVYB 1TU7A 2B5YA 4DSRA 9GSSA 3LYPA 3GKKA 4XRDA 1FVJA 1XBSA 2FY6A 3Q19A 5IPGA 1GULA 1GUMA 3P2AA 2QA1A 1ERTA 4D73B 4G0KA 3HVVA 4EE0A 2AYTA 1AW9A 1G7EA 3U6VA 1V58A 3CXGA 2K8VA 3P90A 2PMTA 5IM9A 3UVTA 4IJ3A 5F0GA 4BL7A 3NIVA 2DIYA 5CYYA 5G30A 4I8BA 1U88A 3WYWA 1GUHA 2VD1A 3ZVJA 1AIUA 1PFOA 2KOKA 5AISA 4HS1A 4ZL9A 1G0TA 1T4ZA 1M2DA 1V2AA 1FB0A 5ABRA 3C71A 1FVKA 4EVMA 2HZFA 2E2GA 3FW2A 2A4HA 4GSSA 2FLSA 5IMVA 4DSQA 2H1GA 4BWSA 1J08A 1ZOFA 4IKHA 2R0PA 2AUVA 4MH2A 3GL3A 4KDXA 2HZEB 2JACA 2P31A 2NDOA 2PUKC 3GTUA 3GX0A 4XS6A 5CO3A 3ZL5A 2KHPA 2WDUA 2XBIA 2UZ8A 1T4YA 4Q5NA 2QA2A 4N10A 5A4WA 4XS4B 2LRCA 3IE3A 1Z3EA 2WZ9A 2FWFA 4GF0A 2H71A 5D8IA 3TDGA 3GFKA 5GAPD 3ZTLA 2K8SA 2MBTA 1YDKA 2D2ZA 3H8QA 3P7XA 4LL1B 2RLIA 4ECBA 1R5PA 4K5SA 3E3EA 1OKTA 1ERUA 1SK2A 2JZSA 3ZFBA 4XS1A 4IW9A 4AJ6A 1G7OA 2H30A 2C0EA 2YWIA 5JWQB 3CQFA 3VWUA 4TR3A 4TXVA 3CRUA 4X0XA 1J9BA 3L0HA 1AQWA 2NTOA 5ID2A 5KN0A 2KUCA 2GT5A 3ERWA 1ZL9A 4WR5A 4AJ7A 3A3TA 2YNXA 4KCAA 4ZBBA 4Q5RA 11GSA 3IRAA 3VI5A 1B9XC 1K0NA 1M3JA 1OVNA 1DBYA 1PD21 5DAKA 1T00A 2F3MA 3VWXA 2C0FA 5C00A 3EMPA 4MJAA 3ED3A 3G7JA 4N0ZA 2I3YA 4N11A 1K0AA 1TI1A 3GV1A 2B7KA 2L6DA 2YZUA 1VF2A 1YJ6A 3LXZA 1QFNA 4V2MA 2ZUPA 4ZL8A 5JWOB 1J0FA 1GSSA 1ZYEA 1M0UA 2XC2A 3GIXA 1AUCA 2PBJA 1WWJA 2V6OA 3D4TA 4V1Ap 12GSA 2L59A 3BBYA 4MLYA 3UEMA 3MWHA 4NHWA 1Z9HA 1ZYQB 2NPBA 2IWTA 18GSA 2X4AA 5DVBA 4BIKA 1I9DA 1PMTA 1KEBA 1I5GA 1EGOA 4O7HA 5L71A 4MJCA 4JBBA 3C73A 4HI7A 6GSTA 1ACVA 4IP6A 4XTSA 1WMJA 2YV7A 1VF3A 1UN2A 4X1UA 3GX8A 2F9SA 1GTAA 4ZBDA 2HLSA 3WT2A 3GMFA 1K0MA 4EUYA 1VF4A 3CSIA 2EIQA 1YY7A 4O5QA 3SBCA 4L5OA 1B48A 5CAXA 7GSSA 2CAIA 2H01A 3L78A 3ME8A 5INYA 1YQ1A 2PWJA 5B7CA 17GSA 1SYRA 4TN8A 1YEPA 2O8VB 5E59A 3VFIA 3TKPA 3UOMA 3M8NA 2YN1A 1TXXA 3F4SA 3TB2A 1TU8A 2GLRA 3JCML 5IMFA 4YQMA 4TR1A 19GSA 2N5AA 4OCEA 1ZZYA 3W6GA 4KB3A 4MK3A 2REMA 1XVQA 3FMWA 1YZXA 2GSSA 6GSWA 1YF0A 3F63A 4K0NA 1S3RA 2DMMA 2PGTA 3O76A 5ECIB 3WGEA 4WETA 4EO3A 1A2MA 1EZKA 4LL4B 3EYTA 2LSTA 2GSRA 3IC8A 1EV4A 2FNOA 1XOAA 1GNEA 1QQ2A 3Q74A 3QAWA 5EL8A 3EPTA 5FT3A 3GKMA 3TJKA 1SL2B 3QD9A 3IA1A 2EIRA 2H8LA 5DQSA 4K8MA 5G1LA 1GWCA 3KP8A 4A5PA 4F0CA 1B8XA 2WRTA 2LS5A 5ENUA 2AV4A 6GSXA 2E2MA 2TRCP 2H19A 2OKAA 4GCIA 1HNAA 3GA4A 1EOGA 1E6BA 4ZB9A 1TI3A 3TKSA 4MF6A 3UL3A 3GKXA 1FHEA 4GQCA 3A2WA 4YAVA 3HXSA 1SJ6A 1RW1A 3FYGA 3PPUA 3DD3A 5D9TA 5ECSA 4K2DA 2DJ1A 4K7IA 3W8JA 1UVZA 3WGXA 1XW5A 5DBQA 1V40A 3ZYWA 5ECQB 1GSYA 1K3OA 2B5EA 1RQMA 2DKHA 4JRRA 3S9FA 3GKNA 2PERA 2H70A 5CRGA 2VAFA 3E9JB 1IYIA 2R0CA 2K18A 1XWAA 3TRQA 4YKFA 3EVIA 5D9VA 2R4VA 4KA0A 5H5SA 2CZ3A 5J9CA 3FZ9A 4XIHA 1SKRB 1BAYA 2MMNA 3F3QA 3RPNA 4POLA 1S3AA 4G10A 4ZL7A 3D21A 3ZMKA 2OE3A 1XOBA 2E7PA 4O92A 1XWGA 5F8BA 4F0BA 1EGRA 1EWXA 2HI7A 2X99A 3HY2A 1AXDA 3WT1A 3G9BA 1W4VA 2YP6A 3RHCA 3F6DA 2C3NA 4KE3A 5KOWA 1ZCPA 4OWYA 5D73A 5KEJA 3M3MA 2IPAA 3LWAA 2DKIA 3W8SA 5HQPA 1UA5A 2C3TA 2OADA 4GRFA 2AHEA 2G2QA 4MZBA 4I97A 2V32A 3QFAC 1HD2A 1X9SB 2DJ2A 2FHEA 2YWNA 4MCUA 1V9WA 3F3RA 1PSQA 3LXTA 3F9UA 5KOXA 1MDKA 1PL2A 1SKSB 3TRPA 2EIOA 3MSZA 3I9V2 5F05A 20GSA 5H5QA 4PNGA 2VL2A 3QPMA 5DALB 2K9FA 4G2EA 3N9JA 4TW5A 6GSVA 4QL7A 2FUG2 5G5EA 4KGIA 1S3CA 2ZCTA 3A2XA 4HJMA 2GTUA 1F6MC 3LORA 5DJLA 3VK9A 2CAQA 2E0QA 3R2QA 2I81A 4NAXA 2CA8A 1X5CA 4MDCA 5GSSA 2B1KA 1OC3A 4L8EA 3APSA 5B8AA 3MDKA 4IP1A 2QC7A 3KTLA 4G0IA 2FA4A 3GSTA 3ERGA 3HKRA 1JLVA 4PURA 1UC7A 4RI6A 1YKAA 4HEA2 4MF7A 1GL8A 5IOXA 2A4VA 1EP8A 2CX4A 2M72A 4OFTA 1H75A 4PQHA 4FYBA 4ECCA 4F82A 3L4NA 3Q18A 2C1YA 1HQOA 4ICYA 4EXJA 4FYUA 1AAZA 4TXOA 2DBCA 5IMAA 4YH2A 1JZWA 1LU4A 4ZIJA 4HJ2A 3CMIA 4K7NA 3TRXA 2GZYA 5ECNB 3HCZA 1SKWB 1PX6A 3HD5A 3PH9A 1SL1B 5HR2A 4HU7A 1K0OA 2RM5A 4WBRD 3V1WA 1F3AA 1XG8A 2AB6A 3EU3A 4I6XA 3ZZXA 3GUSA 2GQMA 1VGLA 5COHA 4MNNA 3GHAA 3D4MA 2IFQB 2LJAA 2ALBA 1ST9A 2B7JA 2GQKA 22GSA 2R3XA 4IBPA 4I2UA 3CRTA 2X8HA 2OBKA 3DVWA 2LEGA 2B6MA 1M3IA 4JU5A 1T7PB 1GLPA 4KW6A 4J56E 3EWLA 1LJRA 4MH3A 2DJ0A 3L9SA 2MMAA 3FR3A 5IOWA 1MDIA 2X8GA 4E8EA 3IXRA 3US3A 1JFUA 4ID0A 3DKSA 2L57A 1Y6EA 1JZDA 4MA9A 5G2ZA 5D9WA 1GRXA 1TOFA 1R4WA 4EDZA 4OO5A 2KP2A 3KCMA 4MP4A 4V2NA 3HJOA 14GSA 1FB6A 1F37A 2HE3A 3FRCA 5GZZB 4BPYA 4ECJA 3ME7A 2IMDA 3CBUA 1GSFA 4KSOA 5ELAA 1GTBA 1XVWA 3DYRA 4ULXA 2C0GA 2BJXA 2PN8A 3HJPA 3F0IA 2I1UA 1TK0B 2C4JA 1BG5A 2O7KA 3LG6A 4J2FA 3DVXA 1FOVA 4CDOA 5BRTA 4HOJA 3LSZA 4E8HA 4LA1A 1BQ7A 1TDIA 3WD6A 2YCDA 4F2IA 3F8UA 2WS2A 1AQVA 3GTUB 1Y25A 1TTZA 5HR3A 5E4WA 3KH7A 1M9AA 2H1AA 2A2RA 3HJMA 2YZHA 4CW9A 1VRSD 2V6KA 2VL9A 1DE2A 1M7TA 2FWGA 2WCIA 4IN0A 2YV9A 4K6XA 1OE8A 2C8UA 2GSTA 3I43A 3KIJA 2TIRA 1KNGA 2YWMA 5JCUA 1Z6NA 1TK5B 4K5RA 2V41A 1MEKA 5G31A 4NV5A 3ZITA 2M46A 2AAWA 1HYUA 3R3EA 2DMLA 1T1VA 2HSMA 5KN2A 3UARA 2X8CA 3EC3A 4XCSA 1Z6MA 4Q5QA 1B9YC 1O8WA 3UJ1A 4I2TA 4K1FA 5GSTA 1SL0B 1ABAA 2OBIA 5J3RA 2IMFA 3EINA 2FWEA 4KDUA 5ID2B 3IPZA 1GTIA 2H73A 5B6NA 2DJKA 4HQZA 4MPGA 3I69A 3SWLA 5AIVA 1N2AA 2C80A 2VLUA 2FD3A 4YAPA 1WPIA 3GRXA 1BEDA 4J57E 5HFKA 2ON7A 3GH9A 2LQOA 4L5LA 2GT6A 1THXA 5J4UA 2H0HA 5CRDA 1TRSA 1OC8A 2YJHA 3G7YA 4G9HA 5CP1A 3C8EA 4KSMA 2R0GA 2VD0A 5B8BA 2LRTA 2XHFA 5GAND 1R7HA 1TW9A 2O87A 4KAEA 2LJKA 1MDJA 3ZRDA 2RM6A 3BOAA 2ON5A 2IMEA 2QGVA 5A4UA 2V2GA 1URMA 1O73A 5IMCA 1XW6A 2MMZA 1ZYNA 1XIYA 3F6FA 1F3BA 2IL3A 2JADA 1YEXA 2DJJA 1KTEA 4K7OA 2BTOT 2H75A 3H93A 3GSSA 1K3LA 3C1RA 2QSIA 4PTSA 3KP9A 5JCGA 1S3DA 2CT6A 4L0UA 1EEJA
chains in the Genus database with same CATH topology
4HQSA 3KD0A 2JZRA 5IO0A 2HYXA 2H6XA 3RDWA 2A2PA 3A5WA 1TRVA 2QKEA 1M2AA 4NXIA 4BVXB 1NSWA 4MZWA 2YANA 3VWWA 4WBJA 2H6ZA 3GNJA 3M0FA 3TKQA 2VM1A 2RIIA 3LGCA 4N0VA 4MZCA 4EL1A 3QAVA 1OYJA 1OC9A 3DMLA 1XWCA 1B4QA 2LRNA 2WULA 4IVFA 2LTKA 2P5QA 5ECKB 1ERVA 1THOA 4X43A 5EVOA 4WKWA 3VURA 2I9HA 1OKDA 3TJGA 3O3TA 4PQ1A 2LNSA 2NVLA 3H1NA 3HVXA 1X5EA 2L6CA 4JZQA 2R5GA 1O6JA 2NBSA 2LNTA 3CSHA 2VIMA 4GQFA 2P0GA 4TR1B 4F03A 2OE0A 5J5NA 3BD2A 3FHKA 3TKSC 3ISOA 3FR9A 2HRNA 5D93A 2CVKA 2YWOA 4HZ2A 4RQXA 1Z5YE 1K3YA 2VCTA 4OMVA 1Z7PA 5FHIA 4G0LA 5EPFA 3KJYA 4BVYA 1VF1A 4DVCA 1QGVA 2V1MA 1MD4A 1GSEA 4RUVA 3IC4A 2O89A 3D0ZA 4NMUA 3UVHA 2HFDA 5KN3A 10GSA 4D73A 4NV2A 3P8WA 4PX1A 2MZCA 4OO4A 4HU9A 2TRXA 5D9XA 1FG4A 4JEDA 2Z9SA 2OE1A 3RPPA 3VPTA 3LFLA 1GNWA 2HRFA 4TOPA 1X5DA 1GSDA 4PUFC 2YOIA 5ECHB 2VLVA 5LCZA 3ZIVA 3HHVA 3UAPA 4CY8A 1O7UA 1PA3A 4DSSB 3AY8A 3DGQA 5H5RA 4EC0A 4OD7A 4FQUA 4YQVA 4IELA 4L0WA 2G0FA 1BX9A 3IHGA 2LV3A 3HZ8A 3H79A 6GSYA 4Z2TA 3ZMLA 5B6MA 2HNLA 4WF5A 2HRKA 2GZZA 3EU4A 2CVDA 3OR5A 3J7Yb 2MYGA 2XPDA 4GWRA 3MYDA 1O8XA 4AJ8A 2VUPA 2HZEA 4LMVA 3GYKA 5IPHA 3FR6A 1V98A 2DSAA 1Q98A 3MNGA 1A2JA 1GSQA 2EC4A 2OA7A 2GS3A 4XS4A 1DUGA 2MBSA 3KGKA 2N5FA 3TJJA 2H1BA 4JR4A 3IK7A 3CSJA 3FY7A 4JR6A 1SYXA 2CVBA 3L9UA 4OFNA 1LBKA 2GSQA 1WE0A 2DJ3A 5JWRB 3D6IA 4OCFA 4RI7A 2VL2C 2FWHA 2XPEA 4IQ1A 3D5JA 1NHYA 4AF2A 1O85A 3TUEA 3VI7A 1GP1A 3VWVA 3CTFA 3HVSA 2A2SA 4NHZA 3LJRA 4MJBA 1ON4A 3DEXA 6GSUA 1M2BA 3F4TA 3HYPA 3NOFA 2HRAA 2RUFA 1EV9A 1CQHA 3KMOA 3IBHA 3QDNA 3FZ5A 5BMUA 1MD3A 4FH8A 2X49A 4XRAA 4O5RA 3C7MA 5DJMA 4DEJA 3M9KA 1PKZA 3KH9A 5IO2A 4POMA 5IMZA 1WP0A 3IOSA 2L4CA 2VOCA 2HSHA 2K6VA 1NHOA 2OJLA 3LYKA 1TP9A 1JLWA 3VPQA 4JE1A 4TR4A 3C1SA 3HDCA 2F51A 2H0IA 4HUAA 4EF0A 4GLTA 4V1Ag 3CYNA 4IJIA 4OFMA 1FO5A 5LNKe 1TRWA 1QUWA 3IAM2 4KCEA 2P5RA 3N5OA 5ECRB 1SENA 2GGTA 4POKA 4TKYA 3IDVA 5J9BA 2FGXA 1A8LA 5D96A 5ECLB 4KDYA 2L4QA 3TCOA 3MAKA 2KP1A 4ML1A 1DE1A 1DSBA 4Q5FA 3FZAA 1SJZA 4BWQA 1TRUA 4POBA 5F07A 1GLQA 4FO5A 5ECPB 1N8JA 2LJRA 4YKGA 4KX4A 3DRNA 1PKWA 1XXUA 3GURA 1SU9A 4KUNA 1YF1A 4PGTA 4BL7B 1ZGNA 5J41A 4ZBAA 1CQGA 4K0GA 4WEYA 4TR0A 1ILOA 4V2LA 4BA7A 3APQA 3GN3A 2FCHA 5AGYA 4MPFA 1ML6A 5DDLA 4HDEA 3ZLPA 3ZIJA 3J7Yk 3QFBC 4LLRA 1F9MA 1C72A 4WF4A 1SD9A 3UBLA 4QL9A 4TXOB 2I4AA 5CRWA 1R26A 1EP7A 1X9WB 1XFLA 4EIPA 3IV4A 3LQ7A 3UBKA 4KH7A 3GL5A 3G7IA 1KBNA 3KEBA 4TVEA 3LW9A 3KM6A 2IN3A 3HZ4A 1XPVA 5ECOB 1FOHA 2VM2A 2IMIA 3E0UA 4PNFA 2HT9A 1U87A 3FEUA 4GSNA 2DC5A 2ES7A 1ERWA 2YPMA 1E2YA 1Z7RA 1OAZA 3EURA 2VL3A 5CRHA 2FA8A 2VO4A 4PUAA 2H0GA 2VCXA 2PVOC 2BMXA 4Z2RA 1GH2A 2C0DA 3BJ5A 3GH6A 4N30A 1X9MB 3FZ4A 2IMKA 4ZXGA 1U6TA 2RUEA 1PN9A 3DXBA 1A2LA 2JSZA 1XCCA 4PXOA 3PGTA 1SK1A 1O81A 4Z7XA 4KF9A 2GQLA 2WGRA 1YKCA 3QAGA 4IHUA 4YQUA 1SD8A 2ZNMA 1A0FA 5DQYA 2JU5A 3KMNA 1NM3A 3IR4A 2JSYA 5C04A 13GSA 2H6YA 1K0CA 3VLNA 1U3IA 4K9ZA 1WJKA 4BVXA 4MABA 1AQXA 1WOUA 1PL1A 1FW1A 3PINA 4Z2UA 5F06A 3BCKA 4KNDA 1M9BA 2M80A 5JCWA 5DCGA 3DWVA 3UMAA 3TOTA 16GSA 5DAKB 3ZFLA 2CQ9A 3RBTA 4O5UA 5A5KA 3ERFA 1QMVA 2XBQA 1T8EB 4FYCA 1U3AA 3KTBA 1M99A 2H74A 3H4KA 5HFGA 1PN0A 2CV4A 3MIXA 3DIEA 1JZOA 5G5FA 3FK8A 2J23A 2VLTA 2L5LA 3ZVJD 4NWYA 1G6YA 1JZRA 1MTCA 4HZ4A 5IIZA 4MF5A 3K8NA 5ELGA 1BYEA 2WFCA 4MMMA 1XWBA 4EIQA 5CREA 4IQAA 1FAAA 2JZTA 3KXOA 2PVQA 2R37A 1GSUA 3O6TA 2B1LA 4ECIA 3PR8A 3M9JA 2IIYA 1SJIA 2PU9C 2R6KA 2OACA 1W89A 1XZOA 2VCWA 1HNBA 1GUKA 3M1GA 2DLXA 5HR0A 3HA9A 4ILFA 2L5OA 1F2EA 1HNCA 1G6WA 3IAS2 1A8YA 3QR6A 5IQYA 3IHQA 2LQQA 4ZB8A 2H72A 1ZMAA 1IYHA 5EY6A 2LKUA 1K0BA 3D22A 2X64A 1A23A 2C3QA 5KN1A 4H86A 2F8AA 1EOHA 4GXZA 1PRXA 1SK0A 2B5XA 3TJFA 5HR1A 4DSSA 3TKRA 1RK4A 2N5BA 3FKFA 4CY6A 2H66A 2GDRA 3WGDA 1XW9A 2B3SA 1A0RP 4GSTA 1K0DA 4FIWA 3ZREA 1R5AA 5IMDA 3EE2A 1JHBA 3IK9A 3TJBA 4TRXA 4AGSA 2CX3A 3I6AA 3CTGA 4ZILA 3RAZA 1TKDB 5AN1A 5FWGA 5CNWA 1X0RA 1WIKA 4X4JA 2O85A 1GTUA 4QQ7A 4CHSA 3QMXA 5DALA 4XHMA 1BJXA 1EEMA 3Q6OA 1OE7A 2YJ7A 5ECMB 1V57A 3TGZA 4EKZA 5A4VA 4MJEA 2VCZA 3F4RA 2H76A 2WB9A 4ACSA 3U5RE 5G1KA 1T3BA 2H1DA 2HXKA 5DCHA 1NW2A 4IS0A 4WR4A 1Q4JA 2VCQA 2GZPA 3APOA 5HFIA 4G19A 2HSYA 4RQRA 4P3YB 4O32A 2J9HA 1A24A 2CZ2A 4ISDA 2KLXA 2WJUA 6GSSA 4ZB6A 5AIXA 3A5IA 3A2VA 1AC1A 2JL4A 1OC9B 4I5QA 3UIWA 2LUSA 3BCIA 2MMOA 2PPTA 1WRYA 4F9ZA 3TKSE 2AJQB 3NZNA 2R2JA 4WXTA 1TK8B 4ML6A 4USSA 3QCPA 5LD0A 1PQNA 1PGTA 1QXHA 3QOUA 2F8FA 4K2XA 4LMWA 3L9VA 1XWKA 8GSSA 1USBA 3EMXA 1QK8A 3KZQA 2DIZA 1B4PA 2VCVA 1H4OA 2IJYA 4PQIA 4NPBA 2IFQA 4IGJA 1ZYPA 3LEFA 2GVPA 3TOUA 1PX7A 1TJDA 4EDYA 4GTUA 3RHBA 4BVYB 1TU7A 2B5YA 4DSRA 9GSSA 3LYPA 3GKKA 4XRDA 1FVJA 1XBSA 2FY6A 3Q19A 5IPGA 1GULA 1GUMA 3P2AA 2QA1A 1ERTA 4D73B 4G0KA 3HVVA 4EE0A 2AYTA 1AW9A 1G7EA 3U6VA 1V58A 3CXGA 2K8VA 3P90A 2PMTA 5IM9A 3UVTA 4IJ3A 5F0GA 4BL7A 3NIVA 2DIYA 5CYYA 5G30A 4I8BA 1U88A 3WYWA 1GUHA 2VD1A 3ZVJA 1AIUA 2KOKA 5AISA 4HS1A 4ZL9A 1G0TA 1T4ZA 1M2DA 1V2AA 1FB0A 5ABRA 3C71A 1FVKA 4EVMA 2HZFA 2E2GA 3FW2A 2A4HA 4GSSA 2FLSA 5IMVA 4DSQA 2H1GA 4BWSA 1J08A 1ZOFA 4IKHA 2R0PA 2AUVA 4MH2A 3GL3A 4KDXA 2HZEB 2JACA 2P31A 2NDOA 2PUKC 3GTUA 3GX0A 4XS6A 5CO3A 3ZL5A 2KHPA 2WDUA 2XBIA 2UZ8A 1T4YA 4Q5NA 2QA2A 4N10A 5A4WA 4XS4B 2LRCA 3IE3A 1Z3EA 2WZ9A 2FWFA 4GF0A 2H71A 5D8IA 3TDGA 3GFKA 5GAPD 3ZTLA 2K8SA 2MBTA 1YDKA 2D2ZA 3H8QA 3P7XA 4LL1B 2RLIA 4ECBA 1R5PA 4K5SA 3E3EA 1OKTA 1ERUA 1SK2A 2JZSA 3ZFBA 4XS1A 4IW9A 4AJ6A 1G7OA 2H30A 2C0EA 2YWIA 5JWQB 3VWUA 4TR3A 4TXVA 3CRUA 4X0XA 1J9BA 3L0HA 1AQWA 2NTOA 5ID2A 5KN0A 2KUCA 2GT5A 3ERWA 1ZL9A 4WR5A 4AJ7A 3A3TA 2YNXA 4KCAA 4ZBBA 4Q5RA 11GSA 3IRAA 3VI5A 1B9XC 1K0NA 1OVNA 1DBYA 1PD21 5DAKA 1T00A 2F3MA 3VWXA 2C0FA 5C00A 3EMPA 4MJAA 3ED3A 3G7JA 4N0ZA 2I3YA 4N11A 1K0AA 1TI1A 3GV1A 2B7KA 2L6DA 2YZUA 1VF2A 1YJ6A 3LXZA 1QFNA 4V2MA 2ZUPA 4ZL8A 5JWOB 1J0FA 1GSSA 1ZYEA 1M0UA 2XC2A 3GIXA 1AUCA 2PBJA 1WWJA 2V6OA 3D4TA 4V1Ap 12GSA 2L59A 3BBYA 4MLYA 3UEMA 3MWHA 4NHWA 1Z9HA 1ZYQB 2NPBA 2IWTA 18GSA 2X4AA 5DVBA 1I9DA 1PMTA 1KEBA 1I5GA 1EGOA 4O7HA 5L71A 4MJCA 4JBBA 3C73A 4HI7A 6GSTA 1ACVA 4IP6A 4XTSA 1WMJA 2YV7A 1VF3A 1UN2A 4X1UA 3GX8A 2F9SA 1GTAA 4ZBDA 2HLSA 3WT2A 3GMFA 1K0MA 4EUYA 1VF4A 3CSIA 2EIQA 1YY7A 4O5QA 3SBCA 4L5OA 1B48A 5CAXA 7GSSA 2CAIA 2H01A 3L78A 3ME8A 5INYA 1YQ1A 2PWJA 5B7CA 17GSA 1SYRA 4TN8A 1YEPA 2O8VB 5E59A 3VFIA 3TKPA 3UOMA 3M8NA 2YN1A 1TXXA 3F4SA 3TB2A 1TU8A 2GLRA 3JCML 5IMFA 4YQMA 4TR1A 19GSA 2N5AA 4OCEA 1ZZYA 3W6GA 4KB3A 4MK3A 2REMA 1XVQA 3FMWA 1YZXA 2GSSA 6GSWA 1YF0A 3F63A 4K0NA 2DMMA 2PGTA 3O76A 5ECIB 3WGEA 4WETA 4EO3A 1A2MA 1EZKA 4LL4B 3EYTA 2LSTA 2GSRA 3IC8A 1EV4A 2FNOA 1XOAA 1GNEA 1QQ2A 3Q74A 3QAWA 5EL8A 3EPTA 5FT3A 3GKMA 3TJKA 1SL2B 3QD9A 3IA1A 2EIRA 2H8LA 5DQSA 4K8MA 5G1LA 1GWCA 3KP8A 4A5PA 4F0CA 1B8XA 2WRTA 2LS5A 5ENUA 2AV4A 6GSXA 2E2MA 2TRCP 2H19A 2OKAA 4GCIA 1HNAA 3GA4A 1EOGA 1E6BA 4ZB9A 1TI3A 3TKSA 4MF6A 3UL3A 3GKXA 1FHEA 4GQCA 3A2WA 4YAVA 3HXSA 1SJ6A 1RW1A 3FYGA 3PPUA 3DD3A 5D9TA 5ECSA 4K2DA 2DJ1A 4K7IA 3W8JA 1UVZA 3WGXA 1XW5A 5DBQA 1V40A 3ZYWA 5ECQB 1GSYA 1K3OA 2B5EA 1RQMA 2DKHA 4JRRA 3S9FA 3GKNA 2PERA 2H70A 5CRGA 2VAFA 3E9JB 1IYIA 2R0CA 2K18A 1XWAA 3TRQA 4YKFA 3EVIA 5D9VA 2R4VA 4KA0A 5H5SA 2CZ3A 5J9CA 3FZ9A 4XIHA 1SKRB 1BAYA 2MMNA 3F3QA 3RPNA 4POLA 1S3AA 4G10A 4ZL7A 3D21A 3ZMKA 2OE3A 1XOBA 2E7PA 4O92A 1XWGA 5F8BA 4F0BA 1EGRA 1EWXA 2HI7A 2X99A 3HY2A 1AXDA 3WT1A 3G9BA 1W4VA 2YP6A 3RHCA 3F6DA 2C3NA 4KE3A 5KOWA 1ZCPA 4OWYA 5D73A 5KEJA 3M3MA 2IPAA 3LWAA 2DKIA 3W8SA 5HQPA 1UA5A 2C3TA 2OADA 4GRFA 2AHEA 2G2QA 4MZBA 4I97A 2V32A 3QFAC 1HD2A 1X9SB 2DJ2A 2FHEA 2YWNA 4MCUA 1V9WA 3F3RA 1PSQA 3LXTA 3F9UA 5KOXA 1MDKA 1PL2A 1SKSB 3TRPA 2EIOA 3MSZA 3I9V2 5F05A 20GSA 5H5QA 4PNGA 2VL2A 3QPMA 5DALB 2K9FA 4G2EA 3N9JA 4TW5A 6GSVA 4QL7A 2FUG2 5G5EA 4KGIA 1S3CA 2ZCTA 3A2XA 4HJMA 2GTUA 1F6MC 3LORA 5DJLA 3VK9A 2CAQA 2E0QA 3R2QA 2I81A 4NAXA 2CA8A 1X5CA 4MDCA 5GSSA 2B1KA 1OC3A 4L8EA 3APSA 5B8AA 3MDKA 4IP1A 2QC7A 3KTLA 4G0IA 2FA4A 3GSTA 3ERGA 3HKRA 1JLVA 4PURA 1UC7A 4RI6A 1YKAA 4HEA2 4MF7A 1GL8A 5IOXA 2A4VA 1EP8A 2CX4A 2M72A 4OFTA 1H75A 4PQHA 4FYBA 4ECCA 4F82A 3L4NA 3Q18A 2C1YA 1HQOA 4ICYA 4EXJA 4FYUA 1AAZA 4TXOA 2DBCA 5IMAA 4YH2A 1JZWA 1LU4A 4ZIJA 4HJ2A 3CMIA 4K7NA 3TRXA 2GZYA 5ECNB 3HCZA 1SKWB 1PX6A 3HD5A 3PH9A 1SL1B 5HR2A 4HU7A 1K0OA 2RM5A 4WBRD 3V1WA 1F3AA 2AB6A 3EU3A 4I6XA 3ZZXA 3GUSA 2GQMA 1VGLA 5COHA 4MNNA 3GHAA 3D4MA 2IFQB 2LJAA 2ALBA 1ST9A 2B7JA 2GQKA 22GSA 2R3XA 4IBPA 4I2UA 3CRTA 2X8HA 2OBKA 3DVWA 2LEGA 2B6MA 4JU5A 1T7PB 1GLPA 4KW6A 4J56E 3EWLA 1LJRA 4MH3A 2DJ0A 3L9SA 2MMAA 3FR3A 5IOWA 1MDIA 2X8GA 4E8EA 3IXRA 3US3A 1JFUA 4ID0A 3DKSA 2L57A 1Y6EA 1JZDA 4MA9A 5G2ZA 5D9WA 1GRXA 1TOFA 1R4WA 4EDZA 4OO5A 2KP2A 3KCMA 4MP4A 4V2NA 3HJOA 14GSA 1FB6A 1F37A 2HE3A 3FRCA 5GZZB 4BPYA 4ECJA 3ME7A 2IMDA 3CBUA 1GSFA 4KSOA 5ELAA 1GTBA 1XVWA 3DYRA 4ULXA 2C0GA 2BJXA 2PN8A 3HJPA 3F0IA 2I1UA 1TK0B 2C4JA 1BG5A 2O7KA 3LG6A 4J2FA 3DVXA 1FOVA 4CDOA 5BRTA 4HOJA 3LSZA 4E8HA 4LA1A 1BQ7A 1TDIA 3WD6A 2YCDA 4F2IA 3F8UA 2WS2A 1AQVA 3GTUB 1Y25A 1TTZA 5HR3A 5E4WA 3KH7A 1M9AA 2H1AA 2A2RA 3HJMA 2YZHA 4CW9A 1VRSD 2V6KA 2VL9A 1DE2A 1M7TA 2FWGA 2WCIA 4IN0A 2YV9A 4K6XA 1OE8A 2C8UA 2GSTA 3I43A 3KIJA 2TIRA 1KNGA 2YWMA 5JCUA 1Z6NA 1TK5B 4K5RA 2V41A 1MEKA 5G31A 4NV5A 3ZITA 2M46A 2AAWA 1HYUA 3R3EA 2DMLA 1T1VA 2HSMA 5KN2A 3UARA 2X8CA 3EC3A 4XCSA 1Z6MA 4Q5QA 1B9YC 1O8WA 3UJ1A 4I2TA 4K1FA 5GSTA 1SL0B 1ABAA 2OBIA 5J3RA 2IMFA 3EINA 2FWEA 4KDUA 5ID2B 3IPZA 1GTIA 2H73A 5B6NA 2DJKA 4HQZA 4MPGA 3I69A 3SWLA 5AIVA 1N2AA 2C80A 2VLUA 2FD3A 4YAPA 1WPIA 3GRXA 1BEDA 4J57E 5HFKA 2ON7A 3GH9A 2LQOA 4L5LA 2GT6A 1THXA 5J4UA 2H0HA 5CRDA 1TRSA 1OC8A 2YJHA 3G7YA 4G9HA 5CP1A 3C8EA 4KSMA 2R0GA 2VD0A 5B8BA 2LRTA 2XHFA 5GAND 1R7HA 1TW9A 2O87A 4KAEA 2LJKA 1MDJA 3ZRDA 2RM6A 3BOAA 2ON5A 2IMEA 2QGVA 5A4UA 2V2GA 1URMA 1O73A 5IMCA 1XW6A 2MMZA 1ZYNA 1XIYA 3F6FA 1F3BA 2IL3A 2JADA 1YEXA 2DJJA 1KTEA 4K7OA 2BTOT 2H75A 3H93A 3GSSA 1K3LA 3C1RA 2QSIA 4PTSA 3KP9A 5JCGA 1S3DA 2CT6A 4L0UA 1EEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HQS A;  3KD0 A;  2JZR A;  5IO0 A;  2HYX A;  2H6X A;  3RDW A;  3A5W A;  1TRV A;  2QKE A;  1M2A A;  4NXI A;  1NSW A;  4MZW A;  2YAN A;  3VWW A;  4WBJ A;  2H6Z A;  3GNJ A;  3M0F A;  3TKQ A;  2VM1 A;  2RII A;  3LGC A;  4N0V A;  4MZC A;  4EL1 A;  3QAV A;  1OYJ A;  1OC9 A;  3DML A;  1XWC A;  1B4Q A;  2LRN A;  2WUL A;  4IVF A;  2LTK A;  2P5Q A;  5ECK B;  1ERV A;  1THO A;  4X43 A;  5EVO A;  4WKW A;  3VUR A;  2I9H A;  1OKD A;  3TJG A;  3O3T A;  4PQ1 A;  2LNS A;  2NVL A;  3H1N A;  3HVX A;  1X5E A;  2L6C A;  4JZQ A;  2R5G A;  1O6J A;  2NBS A;  2LNT A;  3CSH A;  2VIM A;  4GQF A;  2P0G A;  4TR1 B;  4F03 A;  2OE0 A;  5J5N A;  3BD2 A;  3FHK A;  3TKS C;  3ISO A;  3FR9 A;  2HRN A;  5D93 A;  2CVK A;  2YWO A;  4HZ2 A;  4RQX A;  1Z5Y E;  1K3Y A;  2VCT A;  4OMV A;  1Z7P A;  5FHI A;  5EPF A;  3KJY A;  4BVY A;  1VF1 A;  4DVC A;  1QGV A;  2V1M A;  1MD4 A;  1GSE A;  4RUV A;  3IC4 A;  2O89 A;  3D0Z A;  4NMU A;  3UVH A;  2HFD A;  5KN3 A;  10GS A;  4D73 A;  4NV2 A;  3P8W A;  4PX1 A;  2MZC A;  4OO4 A;  4HU9 A;  2TRX A;  5D9X A;  1FG4 A;  4JED A;  2Z9S A;  2OE1 A;  3RPP A;  3VPT A;  3LFL A;  1GNW A;  2HRF A;  4TOP A;  1X5D A;  1GSD A;  4PUF C;  2YOI A;  5ECH B;  2VLV A;  5LCZ A;  3ZIV A;  3HHV A;  3UAP A;  1O7U A;  1PA3 A;  4DSS B;  3AY8 A;  3DGQ A;  5H5R A;  4EC0 A;  4OD7 A;  4YQV A;  4IEL A;  4L0W A;  2G0F A;  1BX9 A;  2LV3 A;  3HZ8 A;  3H79 A;  6GSY A;  3ZML A;  5B6M A;  2HNL A;  4WF5 A;  2GZZ A;  3EU4 A;  2CVD A;  3OR5 A;  3J7Y b;  2MYG A;  2XPD A;  4GWR A;  1O8X A;  4AJ8 A;  2VUP A;  2HZE A;  4LMV A;  3GYK A;  5IPH A;  3FR6 A;  1V98 A;  2DSA A;  1Q98 A;  3MNG A;  1A2J A;  1GSQ A;  2EC4 A;  2OA7 A;  2GS3 A;  4XS4 A;  1DUG A;  2MBS A;  3KGK A;  2N5F A;  3TJJ A;  2H1B A;  4JR4 A;  3IK7 A;  3CSJ A;  3FY7 A;  4JR6 A;  1SYX A;  2CVB A;  3L9U A;  4OFN A;  1LBK A;  2GSQ A;  1WE0 A;  2DJ3 A;  5JWR B;  3D6I A;  4OCF A;  4RI7 A;  2VL2 C;  2FWH A;  2XPE A;  4IQ1 A;  3D5J A;  1NHY A;  4AF2 A;  1O85 A;  3TUE A;  3VI7 A;  1GP1 A;  3VWV A;  3CTF A;  3HVS A;  2A2S A;  4NHZ A;  3LJR A;  4MJB A;  1ON4 A;  3DEX A;  6GSU A;  1M2B A;  3F4T A;  3HYP A;  3NOF A;  2RUF A;  1EV9 A;  1CQH A;  3KMO A;  3IBH A;  3QDN A;  3FZ5 A;  1MD3 A;  4FH8 A;  4XRA A;  4O5R A;  3C7M A;  5DJM A;  4DEJ A;  3M9K A;  1PKZ A;  3KH9 A;  5IO2 A;  4POM A;  5IMZ A;  1WP0 A;  3IOS A;  2L4C A;  2VOC A;  2HSH A;  2K6V A;  1NHO A;  2OJL A;  3LYK A;  1TP9 A;  1JLW A;  3VPQ A;  4JE1 A;  4TR4 A;  3C1S A;  3HDC A;  2F51 A;  2H0I A;  4HUA A;  4EF0 A;  4GLT A;  4V1A g;  3CYN A;  4IJI A;  4OFM A;  1FO5 A;  5LNK e;  1TRW A;  1QUW A;  3IAM 2;  4KCE A;  2P5R A;  3N5O A;  5ECR B;  1SEN A;  2GGT A;  4POK A;  4TKY A;  3IDV A;  5J9B A;  2FGX A;  1A8L A;  5D96 A;  5ECL B;  4KDY A;  2L4Q A;  3TCO A;  3MAK A;  2KP1 A;  4ML1 A;  1DE1 A;  1DSB A;  4Q5F A;  3FZA A;  1SJZ A;  4BWQ A;  1TRU A;  4POB A;  5F07 A;  1GLQ A;  4FO5 A;  5ECP B;  1N8J A;  2LJR A;  4KX4 A;  3DRN A;  1PKW A;  1XXU A;  3GUR A;  1SU9 A;  4KUN A;  1YF1 A;  4PGT A;  5J41 A;  1ZGN A;  4ZBA A;  1CQG A;  4K0G A;  4WEY A;  4TR0 A;  1ILO A;  4V2L A;  4BA7 A;  3APQ A;  3GN3 A;  2FCH A;  5AGY A;  4MPF A;  1ML6 A;  5DDL A;  4HDE A;  3ZLP A;  3ZIJ A;  3J7Y k;  3QFB C;  4LLR A;  1F9M A;  1C72 A;  4WF4 A;  1SD9 A;  3UBL A;  4QL9 A;  4TXO B;  2I4A A;  5CRW A;  1R26 A;  1EP7 A;  1X9W B;  1XFL A;  3IV4 A;  3LQ7 A;  3UBK A;  4KH7 A;  3GL5 A;  3G7I A;  1KBN A;  3KEB A;  4TVE A;  3KM6 A;  2IN3 A;  3HZ4 A;  1XPV A;  5ECO B;  2VM2 A;  2IMI A;  3E0U A;  4PNF A;  2HT9 A;  1U87 A;  3FEU A;  4GSN A;  2DC5 A;  2ES7 A;  1ERW A;  2YPM A;  1E2Y A;  1Z7R A;  1OAZ A;  3EUR A;  2VL3 A;  5CRH A;  2FA8 A;  2VO4 A;  4PUA A;  2H0G A;  2VCX A;  2PVO C;  2BMX A;  1GH2 A;  2C0D A;  3BJ5 A;  3GH6 A;  4N30 A;  1X9M B;  3FZ4 A;  2IMK A;  4ZXG A;  1U6T A;  2RUE A;  1PN9 A;  3DXB A;  1A2L A;  2JSZ A;  1XCC A;  4PXO A;  3PGT A;  1SK1 A;  1O81 A;  4Z7X A;  2GQL A;  2WGR A;  1YKC A;  3QAG A;  4IHU A;  4YQU A;  1SD8 A;  2ZNM A;  1A0F A;  5DQY A;  2JU5 A;  3KMN A;  1NM3 A;  3IR4 A;  2JSY A;  5C04 A;  13GS A;  2H6Y A;  1K0C A;  3VLN A;  1U3I A;  4K9Z A;  1WJK A;  4BVX A;  4MAB A;  1AQX A;  1WOU A;  1PL1 A;  1FW1 A;  3PIN A;  5F06 A;  3BCK A;  4KND A;  1M9B A;  2M80 A;  5JCW A;  5DCG A;  3DWV A;  3UMA A;  3TOT A;  16GS A;  5DAK B;  3ZFL A;  2CQ9 A;  3RBT A;  5A5K A;  3ERF A;  1QMV A;  2XBQ A;  1T8E B;  4FYC A;  1U3A A;  3KTB A;  1M99 A;  2H74 A;  3H4K A;  5HFG A;  2CV4 A;  3DIE A;  1JZO A;  5G5F A;  3FK8 A;  2J23 A;  2VLT A;  2L5L A;  3ZVJ D;  4NWY A;  1G6Y A;  1JZR A;  1MTC A;  4HZ4 A;  5IIZ A;  4MF5 A;  3K8N A;  5ELG A;  1BYE A;  2WFC A;  4MMM A;  1XWB A;  5CRE A;  4IQA A;  1FAA A;  2JZT A;  3KXO A;  2PVQ A;  2R37 A;  1GSU A;  3O6T A;  2B1L A;  4ECI A;  3PR8 A;  3M9J A;  2IIY A;  1SJI A;  2PU9 C;  2R6K A;  2OAC A;  1W89 A;  1XZO A;  2VCW A;  1HNB A;  1GUK A;  3M1G A;  2DLX A;  5HR0 A;  3HA9 A;  4ILF A;  2L5O A;  1F2E A;  1HNC A;  1G6W A;  3IAS 2;  1A8Y A;  3QR6 A;  5IQY A;  3IHQ A;  2LQQ A;  4ZB8 A;  2H72 A;  1ZMA A;  1IYH A;  5EY6 A;  2LKU A;  1K0B A;  3D22 A;  2X64 A;  1A23 A;  2C3Q A;  5KN1 A;  4H86 A;  2F8A A;  1EOH A;  4GXZ A;  1PRX A;  1SK0 A;  2B5X A;  3TJF A;  5HR1 A;  4DSS A;  3TKR A;  1RK4 A;  2N5B A;  3FKF A;  2H66 A;  2GDR A;  3WGD A;  1XW9 A;  2B3S A;  1A0R P;  4GST A;  1K0D A;  4FIW A;  3ZRE A;  1R5A A;  5IMD A;  3EE2 A;  1JHB A;  3IK9 A;  3TJB A;  4TRX A;  4AGS A;  2CX3 A;  3I6A A;  3CTG A;  4ZIL A;  3RAZ A;  1TKD B;  5AN1 A;  5FWG A;  5CNW A;  1X0R A;  1WIK A;  2O85 A;  1GTU A;  4QQ7 A;  4CHS A;  3QMX A;  5DAL A;  4XHM A;  1BJX A;  1EEM A;  3Q6O A;  1OE7 A;  2YJ7 A;  5ECM B;  1V57 A;  3TGZ A;  4EKZ A;  5A4V A;  4MJE A;  2VCZ A;  3F4R A;  2H76 A;  2WB9 A;  4ACS A;  3U5R E;  5G1K A;  1T3B A;  2H1D A;  2HXK A;  5DCH A;  1NW2 A;  4IS0 A;  4WR4 A;  1Q4J A;  2VCQ A;  2GZP A;  3APO A;  5HFI A;  4G19 A;  2HSY A;  4RQR A;  4P3Y B;  4O32 A;  2J9H A;  1A24 A;  2CZ2 A;  4ISD A;  2KLX A;  2WJU A;  6GSS A;  4ZB6 A;  5AIX A;  3A2V A;  1AC1 A;  2JL4 A;  1OC9 B;  4I5Q A;  3UIW A;  2LUS A;  3BCI A;  2MMO A;  2PPT A;  1WRY A;  4F9Z A;  3TKS E;  2AJQ B;  3NZN A;  2R2J A;  4WXT A;  1TK8 B;  4ML6 A;  3QCP A;  5LD0 A;  1PQN A;  1PGT A;  1QXH A;  3QOU A;  2F8F A;  4LMW A;  3L9V A;  1XWK A;  8GSS A;  1USB A;  3EMX A;  1QK8 A;  3KZQ A;  2DIZ A;  1B4P A;  2VCV A;  1H4O A;  2IJY A;  4PQI A;  4NPB A;  2IFQ A;  4IGJ A;  3LEF A;  2GVP A;  3TOU A;  1PX7 A;  1TJD A;  4EDY A;  4GTU A;  3RHB A;  1TU7 A;  2B5Y A;  4DSR A;  9GSS A;  3LYP A;  3GKK A;  4XRD A;  1FVJ A;  1XBS A;  2FY6 A;  3Q19 A;  5IPG A;  1GUL A;  1GUM A;  3P2A A;  1ERT A;  4D73 B;  3HVV A;  4EE0 A;  2AYT A;  1AW9 A;  1G7E A;  3U6V A;  1V58 A;  3CXG A;  2K8V A;  3P90 A;  2PMT A;  5IM9 A;  3UVT A;  4IJ3 A;  5F0G A;  4BL7 A;  3NIV A;  2DIY A;  5CYY A;  5G30 A;  4I8B A;  1U88 A;  3WYW A;  1GUH A;  2VD1 A;  3ZVJ A;  1AIU A;  2KOK A;  5AIS A;  4HS1 A;  4ZL9 A;  1G0T A;  1T4Z A;  1M2D A;  1V2A A;  1FB0 A;  5ABR A;  3C71 A;  1FVK A;  4EVM A;  2HZF A;  2E2G A;  3FW2 A;  4GSS A;  2FLS A;  5IMV A;  4DSQ A;  2H1G A;  4BWS A;  1J08 A;  1ZOF A;  4IKH A;  2AUV A;  4MH2 A;  3GL3 A;  4KDX A;  2HZE B;  2JAC A;  2P31 A;  2NDO A;  2PUK C;  3GTU A;  3GX0 A;  4XS6 A;  5CO3 A;  3ZL5 A;  2KHP A;  2WDU A;  2XBI A;  1T4Y A;  4Q5N A;  4N10 A;  5A4W A;  4XS4 B;  2LRC A;  3IE3 A;  1Z3E A;  2WZ9 A;  2FWF A;  4GF0 A;  2H71 A;  5D8I A;  3TDG A;  3GFK A;  5GAP D;  3ZTL A;  2K8S A;  2MBT A;  1YDK A;  2D2Z A;  3H8Q A;  3P7X A;  4LL1 B;  2RLI A;  4ECB A;  1R5P A;  3E3E A;  1OKT A;  1ERU A;  1SK2 A;  2JZS A;  3ZFB A;  4XS1 A;  4IW9 A;  4AJ6 A;  1G7O A;  2H30 A;  2C0E A;  2YWI A;  5JWQ B;  3VWU A;  4TR3 A;  4TXV A;  3CRU A;  4X0X A;  1J9B A;  3L0H A;  1AQW A;  2NTO A;  5ID2 A;  5KN0 A;  2KUC A;  2GT5 A;  3ERW A;  1ZL9 A;  4WR5 A;  4AJ7 A;  3A3T A;  2YNX A;  4KCA A;  4ZBB A;  4Q5R A;  11GS A;  3IRA A;  3VI5 A;  1B9X C;  1K0N A;  1OVN A;  1DBY A;  1PD2 1;  5DAK A;  1T00 A;  2F3M A;  3VWX A;  2C0F A;  5C00 A;  3EMP A;  4MJA A;  3ED3 A;  3G7J A;  4N0Z A;  2I3Y A;  4N11 A;  1K0A A;  1TI1 A;  3GV1 A;  2B7K A;  2L6D A;  2YZU A;  1VF2 A;  1YJ6 A;  3LXZ A;  1QFN A;  4V2M A;  2ZUP A;  4ZL8 A;  5JWO B;  1J0F A;  1GSS A;  1ZYE A;  1M0U A;  2XC2 A;  3GIX A;  1AUC A;  2PBJ A;  1WWJ A;  2V6O A;  3D4T A;  4V1A p;  12GS A;  2L59 A;  3BBY A;  4MLY A;  3UEM A;  3MWH A;  4NHW A;  1Z9H A;  1ZYQ B;  2NPB A;  2IWT A;  18GS A;  5DVB A;  1I9D A;  1PMT A;  1KEB A;  1I5G A;  1EGO A;  4O7H A;  5L71 A;  4MJC A;  4JBB A;  3C73 A;  4HI7 A;  6GST A;  1ACV A;  4IP6 A;  4XTS A;  1WMJ A;  2YV7 A;  1VF3 A;  1UN2 A;  4X1U A;  3GX8 A;  2F9S A;  1GTA A;  4ZBD A;  2HLS A;  3WT2 A;  3GMF A;  1K0M A;  4EUY A;  1VF4 A;  3CSI A;  2EIQ A;  1YY7 A;  3SBC A;  4L5O A;  1B48 A;  5CAX A;  7GSS A;  2CAI A;  2H01 A;  3L78 A;  3ME8 A;  5INY A;  1YQ1 A;  2PWJ A;  5B7C A;  17GS A;  1SYR A;  4TN8 A;  1YEP A;  2O8V B;  5E59 A;  3VFI A;  3TKP A;  3UOM A;  3M8N A;  2YN1 A;  1TXX A;  3F4S A;  3TB2 A;  1TU8 A;  2GLR A;  3JCM L;  5IMF A;  4YQM A;  4TR1 A;  19GS A;  2N5A A;  4OCE A;  1ZZY A;  3W6G A;  4KB3 A;  4MK3 A;  2REM A;  1XVQ A;  1YZX A;  2GSS A;  6GSW A;  1YF0 A;  3F63 A;  4K0N A;  2DMM A;  2PGT A;  3O76 A;  5ECI B;  3WGE A;  4WET A;  4EO3 A;  1A2M A;  1EZK A;  4LL4 B;  3EYT A;  2LST A;  2GSR A;  1EV4 A;  2FNO A;  1XOA A;  1GNE A;  1QQ2 A;  3Q74 A;  3QAW A;  5EL8 A;  5FT3 A;  3GKM A;  3TJK A;  1SL2 B;  3QD9 A;  3IA1 A;  2EIR A;  2H8L A;  5DQS A;  4K8M A;  5G1L A;  1GWC A;  3KP8 A;  4F0C A;  1B8X A;  2WRT A;  2LS5 A;  5ENU A;  2AV4 A;  6GSX A;  2E2M A;  2TRC P;  2H19 A;  2OKA A;  4GCI A;  1HNA A;  3GA4 A;  1EOG A;  1E6B A;  4ZB9 A;  1TI3 A;  3TKS A;  4MF6 A;  3UL3 A;  3GKX A;  1FHE A;  4GQC A;  3A2W A;  4YAV A;  3HXS A;  1SJ6 A;  1RW1 A;  3FYG A;  3DD3 A;  5D9T A;  5ECS A;  4K2D A;  2DJ1 A;  4K7I A;  3W8J A;  1UVZ A;  3WGX A;  1XW5 A;  5DBQ A;  1V40 A;  3ZYW A;  5ECQ B;  1GSY A;  1K3O A;  2B5E A;  1RQM A;  4JRR A;  3S9F A;  3GKN A;  2PER A;  2H70 A;  5CRG A;  2VAF A;  3E9J B;  1IYI A;  2K18 A;  1XWA A;  3TRQ A;  5D9V A;  3EVI A;  2R4V A;  4KA0 A;  5H5S A;  2CZ3 A;  5J9C A;  3FZ9 A;  4XIH A;  1SKR B;  1BAY A;  2MMN A;  3F3Q A;  3RPN A;  4POL A;  1S3A A;  4G10 A;  4ZL7 A;  3D21 A;  3ZMK A;  2OE3 A;  1XOB A;  2E7P A;  4O92 A;  1XWG A;  5F8B A;  4F0B A;  1EGR A;  1EWX A;  2HI7 A;  2X99 A;  3HY2 A;  1AXD A;  3WT1 A;  3G9B A;  1W4V A;  2YP6 A;  3RHC A;  3F6D A;  2C3N A;  4KE3 A;  1ZCP A;  4OWY A;  5D73 A;  5KEJ A;  3M3M A;  2IPA A;  3LWA A;  3W8S A;  5HQP A;  1UA5 A;  2C3T A;  2OAD A;  4GRF A;  2AHE A;  2G2Q A;  4MZB A;  4I97 A;  2V32 A;  3QFA C;  1HD2 A;  1X9S B;  2DJ2 A;  2FHE A;  2YWN A;  4MCU A;  1V9W A;  3F3R A;  1PSQ A;  3LXT A;  3F9U A;  1MDK A;  1PL2 A;  1SKS B;  3TRP A;  2EIO A;  3MSZ A;  3I9V 2;  5F05 A;  20GS A;  5H5Q A;  4PNG A;  2VL2 A;  3QPM A;  5DAL B;  2K9F A;  4G2E A;  3N9J A;  4TW5 A;  6GSV A;  4QL7 A;  2FUG 2;  5G5E A;  4KGI A;  1S3C A;  2ZCT A;  3A2X A;  4HJM A;  2GTU A;  1F6M C;  3LOR A;  5DJL A;  3VK9 A;  2CAQ A;  2E0Q A;  3R2Q A;  2I81 A;  4NAX A;  2CA8 A;  1X5C A;  4MDC A;  5GSS A;  2B1K A;  1OC3 A;  4L8E A;  3APS A;  5B8A A;  3MDK A;  4IP1 A;  2QC7 A;  3KTL A;  2FA4 A;  3GST A;  3ERG A;  3HKR A;  1JLV A;  4PUR A;  1UC7 A;  4RI6 A;  1YKA A;  4HEA 2;  4MF7 A;  1GL8 A;  5IOX A;  2A4V A;  1EP8 A;  2CX4 A;  2M72 A;  4OFT A;  1H75 A;  4PQH A;  4FYB A;  4ECC A;  4F82 A;  3L4N A;  3Q18 A;  2C1Y A;  1HQO A;  4EXJ A;  4FYU A;  1AAZ A;  4TXO A;  2DBC A;  5IMA A;  4YH2 A;  1JZW A;  1LU4 A;  4ZIJ A;  4HJ2 A;  3CMI A;  4K7N A;  3TRX A;  2GZY A;  5ECN B;  3HCZ A;  1SKW B;  1PX6 A;  3HD5 A;  3PH9 A;  1SL1 B;  5HR2 A;  4HU7 A;  1K0O A;  2RM5 A;  4WBR D;  3V1W A;  1F3A A;  2AB6 A;  3EU3 A;  4I6X A;  3ZZX A;  3GUS A;  2GQM A;  1VGL A;  5COH A;  3GHA A;  3D4M A;  2IFQ B;  2LJA A;  2ALB A;  1ST9 A;  2B7J A;  2GQK A;  22GS A;  2R3X A;  4IBP A;  4I2U A;  3CRT A;  2X8H A;  2OBK A;  3DVW A;  2LEG A;  2B6M A;  4JU5 A;  1T7P B;  1GLP A;  4KW6 A;  4J56 E;  3EWL A;  1LJR A;  4MH3 A;  2DJ0 A;  3L9S A;  2MMA A;  3FR3 A;  5IOW A;  1MDI A;  2X8G A;  4E8E A;  3IXR A;  3US3 A;  1JFU A;  4ID0 A;  3DKS A;  2L57 A;  1Y6E A;  1JZD A;  4MA9 A;  5G2Z A;  5D9W A;  1GRX A;  1TOF A;  1R4W A;  4EDZ A;  4OO5 A;  2KP2 A;  3KCM A;  4MP4 A;  4V2N A;  3HJO A;  14GS A;  1FB6 A;  1F37 A;  2HE3 A;  3FRC A;  5GZZ B;  4BPY A;  4ECJ A;  3ME7 A;  2IMD A;  3CBU A;  1GSF A;  4KSO A;  5ELA A;  1GTB A;  1XVW A;  3DYR A;  4ULX A;  2C0G A;  2BJX A;  2PN8 A;  3HJP A;  3F0I A;  2I1U A;  1TK0 B;  2C4J A;  1BG5 A;  2O7K A;  3LG6 A;  4J2F A;  3DVX A;  1FOV A;  4CDO A;  4HOJ A;  3LSZ A;  4E8H A;  4LA1 A;  1BQ7 A;  1TDI A;  3WD6 A;  2YCD A;  4F2I A;  3F8U A;  2WS2 A;  1AQV A;  3GTU B;  1Y25 A;  1TTZ A;  5HR3 A;  5E4W A;  3KH7 A;  1M9A A;  2H1A A;  2A2R A;  3HJM A;  2YZH A;  4CW9 A;  1VRS D;  2V6K A;  2VL9 A;  1DE2 A;  1M7T A;  2FWG A;  2WCI A;  4IN0 A;  2YV9 A;  4K6X A;  1OE8 A;  2C8U A;  2GST A;  3I43 A;  3KIJ A;  2TIR A;  1KNG A;  2YWM A;  5JCU A;  1Z6N A;  1TK5 B;  2V41 A;  1MEK A;  5G31 A;  4NV5 A;  3ZIT A;  2M46 A;  2AAW A;  1HYU A;  2DML A;  1T1V A;  5KN2 A;  3UAR A;  2X8C A;  3EC3 A;  4XCS A;  1Z6M A;  4Q5Q A;  1B9Y C;  1O8W A;  3UJ1 A;  4I2T A;  4K1F A;  5GST A;  1SL0 B;  1ABA A;  2OBI A;  5J3R A;  2IMF A;  3EIN A;  2FWE A;  4KDU A;  5ID2 B;  3IPZ A;  1GTI A;  2H73 A;  5B6N A;  2DJK A;  4HQZ A;  4MPG A;  3I69 A;  3SWL A;  5AIV A;  1N2A A;  2C80 A;  2VLU A;  2FD3 A;  4YAP A;  1WPI A;  3GRX A;  1BED A;  4J57 E;  5HFK A;  2ON7 A;  3GH9 A;  2LQO A;  4L5L A;  2GT6 A;  1THX A;  5J4U A;  2H0H A;  5CRD A;  1TRS A;  1OC8 A;  2YJH A;  3G7Y A;  4G9H A;  5CP1 A;  3C8E A;  4KSM A;  2VD0 A;  5B8B A;  2LRT A;  2XHF A;  5GAN D;  1R7H A;  1TW9 A;  2O87 A;  4KAE A;  2LJK A;  1MDJ A;  3ZRD A;  2RM6 A;  3BOA A;  2ON5 A;  2IME A;  2QGV A;  5A4U A;  2V2G A;  1URM A;  1O73 A;  5IMC A;  1XW6 A;  2MMZ A;  1XIY A;  3F6F A;  1F3B A;  2IL3 A;  2JAD A;  1YEX A;  2DJJ A;  1KTE A;  4K7O A;  2BTO T;  2H75 A;  3H93 A;  3GSS A;  1K3L A;  3C1R A;  2QSI A;  3KP9 A;  5JCG A;  1S3D A;  2CT6 A;  4L0U A;  1EEJ A; 
#chains in the Genus database with same CATH topology
 4HQS A;  3KD0 A;  2JZR A;  5IO0 A;  2HYX A;  2H6X A;  3RDW A;  2A2P A;  3A5W A;  1TRV A;  2QKE A;  1M2A A;  4NXI A;  4BVX B;  1NSW A;  4MZW A;  2YAN A;  3VWW A;  4WBJ A;  2H6Z A;  3GNJ A;  3M0F A;  3TKQ A;  2VM1 A;  2RII A;  3LGC A;  4N0V A;  4MZC A;  4EL1 A;  3QAV A;  1OYJ A;  1OC9 A;  3DML A;  1XWC A;  1B4Q A;  2LRN A;  2WUL A;  4IVF A;  2LTK A;  2P5Q A;  5ECK B;  1ERV A;  1THO A;  4X43 A;  5EVO A;  4WKW A;  3VUR A;  2I9H A;  1OKD A;  3TJG A;  3O3T A;  4PQ1 A;  2LNS A;  2NVL A;  3H1N A;  3HVX A;  1X5E A;  2L6C A;  4JZQ A;  2R5G A;  1O6J A;  2NBS A;  2LNT A;  3CSH A;  2VIM A;  4GQF A;  2P0G A;  4TR1 B;  4F03 A;  2OE0 A;  5J5N A;  3BD2 A;  3FHK A;  3TKS C;  3ISO A;  3FR9 A;  2HRN A;  5D93 A;  2CVK A;  2YWO A;  4HZ2 A;  4RQX A;  1Z5Y E;  1K3Y A;  2VCT A;  4OMV A;  1Z7P A;  5FHI A;  4G0L A;  5EPF A;  3KJY A;  4BVY A;  1VF1 A;  4DVC A;  1QGV A;  2V1M A;  1MD4 A;  1GSE A;  4RUV A;  3IC4 A;  2O89 A;  3D0Z A;  4NMU A;  3UVH A;  2HFD A;  5KN3 A;  10GS A;  4D73 A;  4NV2 A;  3P8W A;  4PX1 A;  2MZC A;  4OO4 A;  4HU9 A;  2TRX A;  5D9X A;  1FG4 A;  4JED A;  2Z9S A;  2OE1 A;  3RPP A;  3VPT A;  3LFL A;  1GNW A;  2HRF A;  4TOP A;  1X5D A;  1GSD A;  4PUF C;  2YOI A;  5ECH B;  2VLV A;  5LCZ A;  3ZIV A;  3HHV A;  3UAP A;  4CY8 A;  1O7U A;  1PA3 A;  4DSS B;  3AY8 A;  3DGQ A;  5H5R A;  4EC0 A;  4OD7 A;  4FQU A;  4YQV A;  4IEL A;  4L0W A;  2G0F A;  1BX9 A;  3IHG A;  2LV3 A;  3HZ8 A;  3H79 A;  6GSY A;  4Z2T A;  3ZML A;  5B6M A;  2HNL A;  4WF5 A;  2HRK A;  2GZZ A;  3EU4 A;  2CVD A;  3OR5 A;  3J7Y b;  2MYG A;  2XPD A;  4GWR A;  3MYD A;  1O8X A;  4AJ8 A;  2VUP A;  2HZE A;  4LMV A;  3GYK A;  5IPH A;  3FR6 A;  1V98 A;  2DSA A;  1Q98 A;  3MNG A;  1A2J A;  1GSQ A;  2EC4 A;  2OA7 A;  2GS3 A;  4XS4 A;  1DUG A;  2MBS A;  3KGK A;  2N5F A;  3TJJ A;  2H1B A;  4JR4 A;  3IK7 A;  3CSJ A;  3FY7 A;  4JR6 A;  1SYX A;  2CVB A;  3L9U A;  4OFN A;  1LBK A;  2GSQ A;  1WE0 A;  2DJ3 A;  5JWR B;  3D6I A;  4OCF A;  4RI7 A;  2VL2 C;  2FWH A;  2XPE A;  4IQ1 A;  3D5J A;  1NHY A;  4AF2 A;  1O85 A;  3TUE A;  3VI7 A;  1GP1 A;  3VWV A;  3CTF A;  3HVS A;  2A2S A;  4NHZ A;  3LJR A;  4MJB A;  1ON4 A;  3DEX A;  6GSU A;  1M2B A;  3F4T A;  3HYP A;  3NOF A;  2HRA A;  2RUF A;  1EV9 A;  1CQH A;  3KMO A;  3IBH A;  3QDN A;  3FZ5 A;  5BMU A;  1MD3 A;  4HSC X;  4FH8 A;  2X49 A;  4XRA A;  4O5R A;  3C7M A;  5DJM A;  4DEJ A;  3M9K A;  1PKZ A;  3KH9 A;  5IO2 A;  4POM A;  5IMZ A;  1WP0 A;  3IOS A;  2L4C A;  2VOC A;  2HSH A;  2K6V A;  1NHO A;  2OJL A;  3LYK A;  1TP9 A;  1JLW A;  3VPQ A;  4JE1 A;  4TR4 A;  3C1S A;  3HDC A;  2F51 A;  2H0I A;  4HUA A;  4EF0 A;  4GLT A;  4V1A g;  3CYN A;  4IJI A;  4OFM A;  1FO5 A;  5LNK e;  1TRW A;  1QUW A;  3IAM 2;  4KCE A;  2P5R A;  3N5O A;  5ECR B;  1SEN A;  2GGT A;  4POK A;  4TKY A;  3IDV A;  5J9B A;  2FGX A;  1A8L A;  5D96 A;  5ECL B;  4KDY A;  2L4Q A;  3TCO A;  3MAK A;  2KP1 A;  4ML1 A;  1DE1 A;  1DSB A;  4Q5F A;  3FZA A;  1SJZ A;  4BWQ A;  1TRU A;  4POB A;  5F07 A;  1GLQ A;  4FO5 A;  5ECP B;  1N8J A;  2LJR A;  4YKG A;  4KX4 A;  3DRN A;  1PKW A;  1XXU A;  3GUR A;  1SU9 A;  4KUN A;  1YF1 A;  4PGT A;  4BL7 B;  1ZGN A;  5J41 A;  4ZBA A;  1CQG A;  4K0G A;  4WEY A;  4TR0 A;  1ILO A;  4V2L A;  4BA7 A;  3APQ A;  3GN3 A;  2FCH A;  5AGY A;  4MPF A;  1ML6 A;  5DDL A;  4HDE A;  3ZLP A;  3ZIJ A;  3J7Y k;  3QFB C;  4LLR A;  1F9M A;  1C72 A;  4WF4 A;  1SD9 A;  3UBL A;  4QL9 A;  4TXO B;  2I4A A;  5CRW A;  1R26 A;  1EP7 A;  1X9W B;  1XFL A;  4EIP A;  3IV4 A;  3LQ7 A;  3UBK A;  4KH7 A;  3GL5 A;  3G7I A;  1KBN A;  3KEB A;  4TVE A;  3LW9 A;  3KM6 A;  2IN3 A;  3HZ4 A;  1XPV A;  5ECO B;  1FOH A;  2VM2 A;  2IMI A;  3E0U A;  4PNF A;  2HT9 A;  1U87 A;  3FEU A;  4GSN A;  2DC5 A;  2ES7 A;  1ERW A;  2YPM A;  1E2Y A;  1Z7R A;  1OAZ A;  3EUR A;  2VL3 A;  5CRH A;  2FA8 A;  2VO4 A;  4PUA A;  2H0G A;  2VCX A;  2PVO C;  2BMX A;  4Z2R A;  1GH2 A;  2C0D A;  3BJ5 A;  3GH6 A;  4N30 A;  1X9M B;  3FZ4 A;  2IMK A;  4ZXG A;  1U6T A;  2RUE A;  1PN9 A;  3DXB A;  1A2L A;  2JSZ A;  1XCC A;  4PXO A;  3PGT A;  1SK1 A;  1O81 A;  4Z7X A;  4KF9 A;  2GQL A;  2WGR A;  1YKC A;  3QAG A;  4IHU A;  4YQU A;  1SD8 A;  2ZNM A;  1A0F A;  5DQY A;  2JU5 A;  3KMN A;  1NM3 A;  3IR4 A;  2JSY A;  5C04 A;  13GS A;  2H6Y A;  1K0C A;  3VLN A;  1U3I A;  4K9Z A;  1WJK A;  4BVX A;  4MAB A;  1AQX A;  1WOU A;  1PL1 A;  1FW1 A;  3PIN A;  4Z2U A;  5F06 A;  3BCK A;  4KND A;  1M9B A;  2M80 A;  5JCW A;  5DCG A;  3DWV A;  3UMA A;  3TOT A;  16GS A;  5DAK B;  3ZFL A;  2CQ9 A;  3RBT A;  4O5U A;  5A5K A;  3ERF A;  1QMV A;  2XBQ A;  1T8E B;  4FYC A;  1U3A A;  3KTB A;  1M99 A;  2H74 A;  3H4K A;  5HFG A;  1PN0 A;  2CV4 A;  3MIX A;  3DIE A;  1JZO A;  5G5F A;  3FK8 A;  2J23 A;  2VLT A;  2L5L A;  3ZVJ D;  4NWY A;  1G6Y A;  1JZR A;  1MTC A;  4HZ4 A;  5IIZ A;  4MF5 A;  3K8N A;  5ELG A;  1BYE A;  2WFC A;  4MMM A;  1XWB A;  4EIQ A;  5CRE A;  4IQA A;  1FAA A;  2JZT A;  3KXO A;  2PVQ A;  2R37 A;  1GSU A;  3O6T A;  2B1L A;  4ECI A;  3PR8 A;  3M9J A;  2IIY A;  1SJI A;  2PU9 C;  2R6K A;  2OAC A;  1W89 A;  1XZO A;  2VCW A;  1HNB A;  1GUK A;  3M1G A;  2DLX A;  5HR0 A;  3HA9 A;  4ILF A;  2L5O A;  1F2E A;  1HNC A;  1G6W A;  3IAS 2;  1A8Y A;  3QR6 A;  5IQY A;  3IHQ A;  2LQQ A;  4ZB8 A;  2H72 A;  3HVN A;  1ZMA A;  1IYH A;  5EY6 A;  2LKU A;  1K0B A;  3D22 A;  2X64 A;  1A23 A;  2C3Q A;  5KN1 A;  4H86 A;  2F8A A;  1EOH A;  4GXZ A;  1PRX A;  1SK0 A;  2B5X A;  3TJF A;  5HR1 A;  4DSS A;  3TKR A;  1RK4 A;  2N5B A;  3FKF A;  4CY6 A;  2H66 A;  2GDR A;  3WGD A;  1XW9 A;  2B3S A;  1A0R P;  4GST A;  1K0D A;  4FIW A;  3ZRE A;  1R5A A;  5IMD A;  3EE2 A;  1JHB A;  3IK9 A;  3TJB A;  4TRX A;  4AGS A;  2CX3 A;  3I6A A;  3CTG A;  4ZIL A;  3RAZ A;  1TKD B;  5AN1 A;  5FWG A;  5CNW A;  1X0R A;  1WIK A;  4X4J A;  2O85 A;  1GTU A;  4QQ7 A;  4CHS A;  3QMX A;  5DAL A;  4XHM A;  1BJX A;  1EEM A;  3Q6O A;  1OE7 A;  2YJ7 A;  5ECM B;  1V57 A;  3TGZ A;  4EKZ A;  5A4V A;  4MJE A;  2VCZ A;  3F4R A;  2H76 A;  2WB9 A;  4ACS A;  3U5R E;  5G1K A;  1T3B A;  2H1D A;  2HXK A;  5DCH A;  1NW2 A;  4IS0 A;  4WR4 A;  1Q4J A;  2VCQ A;  2GZP A;  3APO A;  5HFI A;  4G19 A;  2HSY A;  4RQR A;  4P3Y B;  4O32 A;  2J9H A;  1A24 A;  2CZ2 A;  4ISD A;  2KLX A;  2WJU A;  6GSS A;  4ZB6 A;  5AIX A;  3A5I A;  3A2V A;  1AC1 A;  2JL4 A;  1OC9 B;  4I5Q A;  3UIW A;  2LUS A;  3BCI A;  2MMO A;  2PPT A;  1WRY A;  4F9Z A;  3TKS E;  2AJQ B;  3NZN A;  2R2J A;  4WXT A;  1TK8 B;  4ML6 A;  4USS A;  3QCP A;  5LD0 A;  1PQN A;  1PGT A;  1QXH A;  3QOU A;  2F8F A;  4K2X A;  4LMW A;  3L9V A;  1XWK A;  8GSS A;  1USB A;  3EMX A;  1QK8 A;  3KZQ A;  2DIZ A;  1B4P A;  2VCV A;  1H4O A;  2IJY A;  4PQI A;  4NPB A;  2IFQ A;  4IGJ A;  1ZYP A;  3LEF A;  2GVP A;  3TOU A;  1PX7 A;  1TJD A;  4EDY A;  4GTU A;  3RHB A;  4BVY B;  1TU7 A;  2B5Y A;  4DSR A;  9GSS A;  3LYP A;  3GKK A;  4XRD A;  1FVJ A;  1XBS A;  2FY6 A;  3Q19 A;  5IPG A;  1GUL A;  1GUM A;  3P2A A;  2QA1 A;  1ERT A;  4D73 B;  4G0K A;  3HVV A;  4EE0 A;  2AYT A;  1AW9 A;  1G7E A;  3U6V A;  1V58 A;  3CXG A;  2K8V A;  3P90 A;  2PMT A;  5IM9 A;  3UVT A;  4IJ3 A;  5F0G A;  4BL7 A;  3NIV A;  2DIY A;  5CYY A;  5G30 A;  4I8B A;  1U88 A;  3WYW A;  1GUH A;  2VD1 A;  3ZVJ A;  1AIU A;  1PFO A;  2KOK A;  5AIS A;  4HS1 A;  4ZL9 A;  1G0T A;  1T4Z A;  1M2D A;  1V2A A;  1FB0 A;  5ABR A;  3C71 A;  1FVK A;  4EVM A;  2HZF A;  2E2G A;  3FW2 A;  2A4H A;  4GSS A;  2FLS A;  5IMV A;  4DSQ A;  2H1G A;  4BWS A;  1J08 A;  1ZOF A;  4IKH A;  2R0P A;  2AUV A;  4MH2 A;  3GL3 A;  4KDX A;  2HZE B;  2JAC A;  2P31 A;  2NDO A;  2PUK C;  3GTU A;  3GX0 A;  4XS6 A;  5CO3 A;  3ZL5 A;  2KHP A;  2WDU A;  2XBI A;  2UZ8 A;  1T4Y A;  4Q5N A;  2QA2 A;  4N10 A;  5A4W A;  4XS4 B;  2LRC A;  3IE3 A;  1Z3E A;  2WZ9 A;  2FWF A;  4GF0 A;  2H71 A;  5D8I A;  3TDG A;  3GFK A;  5GAP D;  3ZTL A;  2K8S A;  2MBT A;  1YDK A;  2D2Z A;  3H8Q A;  3P7X A;  4LL1 B;  2RLI A;  4ECB A;  1R5P A;  4K5S A;  3E3E A;  1OKT A;  1ERU A;  1SK2 A;  2JZS A;  3ZFB A;  4XS1 A;  4IW9 A;  4AJ6 A;  1G7O A;  2H30 A;  2C0E A;  2YWI A;  5JWQ B;  3CQF A;  3VWU A;  4TR3 A;  4TXV A;  3CRU A;  4X0X A;  1J9B A;  3L0H A;  1AQW A;  2NTO A;  5ID2 A;  5KN0 A;  2KUC A;  2GT5 A;  3ERW A;  1ZL9 A;  4WR5 A;  4AJ7 A;  3A3T A;  2YNX A;  4KCA A;  4ZBB A;  4Q5R A;  11GS A;  3IRA A;  3VI5 A;  1B9X C;  1K0N A;  1M3J A;  1OVN A;  1DBY A;  1PD2 1;  5DAK A;  1T00 A;  2F3M A;  3VWX A;  2C0F A;  5C00 A;  3EMP A;  4MJA A;  3ED3 A;  3G7J A;  4N0Z A;  2I3Y A;  4N11 A;  1K0A A;  1TI1 A;  3GV1 A;  2B7K A;  2L6D A;  2YZU A;  1VF2 A;  1YJ6 A;  3LXZ A;  1QFN A;  4V2M A;  2ZUP A;  4ZL8 A;  5JWO B;  1J0F A;  1GSS A;  1ZYE A;  1M0U A;  2XC2 A;  3GIX A;  1AUC A;  2PBJ A;  1WWJ A;  2V6O A;  3D4T A;  4V1A p;  12GS A;  2L59 A;  3BBY A;  4MLY A;  3UEM A;  3MWH A;  4NHW A;  1Z9H A;  1ZYQ B;  2NPB A;  2IWT A;  18GS A;  2X4A A;  5DVB A;  4BIK A;  1I9D A;  1PMT A;  1KEB A;  1I5G A;  1EGO A;  4O7H A;  5L71 A;  4MJC A;  4JBB A;  3C73 A;  4HI7 A;  6GST A;  1ACV A;  4IP6 A;  4XTS A;  1WMJ A;  2YV7 A;  1VF3 A;  1UN2 A;  4X1U A;  3GX8 A;  2F9S A;  1GTA A;  4ZBD A;  2HLS A;  3WT2 A;  3GMF A;  1K0M A;  4EUY A;  1VF4 A;  3CSI A;  2EIQ A;  1YY7 A;  4O5Q A;  3SBC A;  4L5O A;  1B48 A;  5CAX A;  7GSS A;  2CAI A;  2H01 A;  3L78 A;  3ME8 A;  5INY A;  1YQ1 A;  2PWJ A;  5B7C A;  17GS A;  1SYR A;  4TN8 A;  1YEP A;  2O8V B;  5E59 A;  3VFI A;  3TKP A;  3UOM A;  3M8N A;  2YN1 A;  1TXX A;  3F4S A;  3TB2 A;  1TU8 A;  2GLR A;  3JCM L;  5IMF A;  4YQM A;  4TR1 A;  19GS A;  2N5A A;  4OCE A;  1ZZY A;  3W6G A;  4KB3 A;  4MK3 A;  2REM A;  1XVQ A;  3FMW A;  1YZX A;  2GSS A;  6GSW A;  1YF0 A;  3F63 A;  4K0N A;  1S3R A;  2DMM A;  2PGT A;  3O76 A;  5ECI B;  3WGE A;  4WET A;  4EO3 A;  1A2M A;  1EZK A;  4LL4 B;  3EYT A;  2LST A;  2GSR A;  3IC8 A;  1EV4 A;  2FNO A;  1XOA A;  1GNE A;  1QQ2 A;  3Q74 A;  3QAW A;  5EL8 A;  3EPT A;  5FT3 A;  3GKM A;  3TJK A;  1SL2 B;  3QD9 A;  3IA1 A;  2EIR A;  2H8L A;  5DQS A;  4K8M A;  5G1L A;  1GWC A;  3KP8 A;  4A5P A;  4F0C A;  1B8X A;  2WRT A;  2LS5 A;  5ENU A;  2AV4 A;  6GSX A;  2E2M A;  2TRC P;  2H19 A;  2OKA A;  4GCI A;  1HNA A;  3GA4 A;  1EOG A;  1E6B A;  4ZB9 A;  1TI3 A;  3TKS A;  4MF6 A;  3UL3 A;  3GKX A;  1FHE A;  4GQC A;  3A2W A;  4YAV A;  3HXS A;  1SJ6 A;  1RW1 A;  3FYG A;  3PPU A;  3DD3 A;  5D9T A;  5ECS A;  4K2D A;  2DJ1 A;  4K7I A;  3W8J A;  1UVZ A;  3WGX A;  1XW5 A;  5DBQ A;  1V40 A;  3ZYW A;  5ECQ B;  1GSY A;  1K3O A;  2B5E A;  1RQM A;  2DKH A;  4JRR A;  3S9F A;  3GKN A;  2PER A;  2H70 A;  5CRG A;  2VAF A;  3E9J B;  1IYI A;  2R0C A;  2K18 A;  1XWA A;  3TRQ A;  4YKF A;  3EVI A;  5D9V A;  2R4V A;  4KA0 A;  5H5S A;  2CZ3 A;  5J9C A;  3FZ9 A;  4XIH A;  1SKR B;  1BAY A;  2MMN A;  3F3Q A;  3RPN A;  4POL A;  1S3A A;  4G10 A;  4ZL7 A;  3D21 A;  3ZMK A;  2OE3 A;  1XOB A;  2E7P A;  4O92 A;  1XWG A;  5F8B A;  4F0B A;  1EGR A;  1EWX A;  2HI7 A;  2X99 A;  3HY2 A;  1AXD A;  3WT1 A;  3G9B A;  1W4V A;  2YP6 A;  3RHC A;  3F6D A;  2C3N A;  4KE3 A;  5KOW A;  1ZCP A;  4OWY A;  5D73 A;  5KEJ A;  3M3M A;  2IPA A;  3LWA A;  2DKI A;  3W8S A;  5HQP A;  1UA5 A;  2C3T A;  2OAD A;  4GRF A;  2AHE A;  2G2Q A;  4MZB A;  4I97 A;  2V32 A;  3QFA C;  1HD2 A;  1X9S B;  2DJ2 A;  2FHE A;  2YWN A;  4MCU A;  1V9W A;  3F3R A;  1PSQ A;  3LXT A;  3F9U A;  5KOX A;  1MDK A;  1PL2 A;  1SKS B;  3TRP A;  2EIO A;  3MSZ A;  3I9V 2;  5F05 A;  20GS A;  5H5Q A;  4PNG A;  2VL2 A;  3QPM A;  5DAL B;  2K9F A;  4G2E A;  3N9J A;  4TW5 A;  6GSV A;  4QL7 A;  2FUG 2;  5G5E A;  4KGI A;  1S3C A;  2ZCT A;  3A2X A;  4HJM A;  2GTU A;  1F6M C;  3LOR A;  5DJL A;  3VK9 A;  2CAQ A;  2E0Q A;  3R2Q A;  2I81 A;  4NAX A;  2CA8 A;  1X5C A;  4MDC A;  5GSS A;  2B1K A;  1OC3 A;  4L8E A;  3APS A;  5B8A A;  3MDK A;  4IP1 A;  2QC7 A;  3KTL A;  4G0I A;  2FA4 A;  3GST A;  3ERG A;  3HKR A;  1JLV A;  4PUR A;  1UC7 A;  4RI6 A;  1YKA A;  4HEA 2;  4MF7 A;  1GL8 A;  5IOX A;  2A4V A;  1EP8 A;  2CX4 A;  2M72 A;  4OFT A;  1H75 A;  4PQH A;  4FYB A;  4ECC A;  4F82 A;  3L4N A;  3Q18 A;  2C1Y A;  1HQO A;  4ICY A;  4EXJ A;  4FYU A;  1AAZ A;  4TXO A;  2DBC A;  5IMA A;  4YH2 A;  1JZW A;  1LU4 A;  4ZIJ A;  4HJ2 A;  3CMI A;  4K7N A;  3TRX A;  2GZY A;  5ECN B;  3HCZ A;  1SKW B;  1PX6 A;  3HD5 A;  3PH9 A;  1SL1 B;  5HR2 A;  4HU7 A;  1K0O A;  2RM5 A;  4WBR D;  3V1W A;  1F3A A;  1XG8 A;  2AB6 A;  3EU3 A;  4I6X A;  3ZZX A;  3GUS A;  2GQM A;  1VGL A;  5COH A;  4MNN A;  3GHA A;  3D4M A;  2IFQ B;  2LJA A;  2ALB A;  1ST9 A;  2B7J A;  2GQK A;  22GS A;  2R3X A;  4IBP A;  4I2U A;  3CRT A;  2X8H A;  2OBK A;  3DVW A;  2LEG A;  2B6M A;  1M3I A;  4JU5 A;  1T7P B;  1GLP A;  4KW6 A;  4J56 E;  3EWL A;  1LJR A;  4MH3 A;  2DJ0 A;  3L9S A;  2MMA A;  3FR3 A;  5IOW A;  1MDI A;  2X8G A;  4E8E A;  3IXR A;  3US3 A;  1JFU A;  4ID0 A;  3DKS A;  2L57 A;  1Y6E A;  1JZD A;  4MA9 A;  5G2Z A;  5D9W A;  1GRX A;  1TOF A;  1R4W A;  4EDZ A;  4OO5 A;  2KP2 A;  3KCM A;  4MP4 A;  4V2N A;  3HJO A;  14GS A;  1FB6 A;  1F37 A;  2HE3 A;  3FRC A;  5GZZ B;  4BPY A;  4ECJ A;  3ME7 A;  2IMD A;  3CBU A;  1GSF A;  4KSO A;  5ELA A;  1GTB A;  1XVW A;  3DYR A;  4ULX A;  2C0G A;  2BJX A;  2PN8 A;  3HJP A;  3F0I A;  2I1U A;  1TK0 B;  2C4J A;  1BG5 A;  2O7K A;  3LG6 A;  4J2F A;  3DVX A;  1FOV A;  4CDO A;  5BRT A;  4HOJ A;  3LSZ A;  4E8H A;  4LA1 A;  1BQ7 A;  1TDI A;  3WD6 A;  2YCD A;  4F2I A;  3F8U A;  2WS2 A;  1AQV A;  3GTU B;  1Y25 A;  1TTZ A;  5HR3 A;  5E4W A;  3KH7 A;  1M9A A;  2H1A A;  2A2R A;  3HJM A;  2YZH A;  4CW9 A;  1VRS D;  2V6K A;  2VL9 A;  1DE2 A;  1M7T A;  2FWG A;  2WCI A;  4IN0 A;  2YV9 A;  4K6X A;  1OE8 A;  2C8U A;  2GST A;  3I43 A;  3KIJ A;  2TIR A;  1KNG A;  2YWM A;  5JCU A;  1Z6N A;  1TK5 B;  4K5R A;  2V41 A;  1MEK A;  5G31 A;  4NV5 A;  3ZIT A;  2M46 A;  2AAW A;  1HYU A;  3R3E A;  2DML A;  1T1V A;  2HSM A;  5KN2 A;  3UAR A;  2X8C A;  3EC3 A;  4XCS A;  1Z6M A;  4Q5Q A;  1B9Y C;  1O8W A;  3UJ1 A;  4I2T A;  4K1F A;  5GST A;  1SL0 B;  1ABA A;  2OBI A;  5J3R A;  2IMF A;  3EIN A;  2FWE A;  4KDU A;  5ID2 B;  3IPZ A;  1GTI A;  2H73 A;  5B6N A;  2DJK A;  4HQZ A;  4MPG A;  3I69 A;  3SWL A;  5AIV A;  1N2A A;  2C80 A;  2VLU A;  2FD3 A;  4YAP A;  1WPI A;  3GRX A;  1BED A;  4J57 E;  5HFK A;  2ON7 A;  3GH9 A;  2LQO A;  4L5L A;  2GT6 A;  1THX A;  5J4U A;  2H0H A;  5CRD A;  1TRS A;  1OC8 A;  2YJH A;  3G7Y A;  4G9H A;  5CP1 A;  3C8E A;  4KSM A;  2R0G A;  2VD0 A;  5B8B A;  2LRT A;  2XHF A;  5GAN D;  1R7H A;  1TW9 A;  2O87 A;  4KAE A;  2LJK A;  1MDJ A;  3ZRD A;  2RM6 A;  3BOA A;  2ON5 A;  2IME A;  2QGV A;  5A4U A;  2V2G A;  1URM A;  1O73 A;  5IMC A;  1XW6 A;  2MMZ A;  1ZYN A;  1XIY A;  3F6F A;  1F3B A;  2IL3 A;  2JAD A;  1YEX A;  2DJJ A;  1KTE A;  4K7O A;  2BTO T;  2H75 A;  3H93 A;  3GSS A;  1K3L A;  3C1R A;  2QSI A;  4PTS A;  3KP9 A;  5JCG A;  1S3D A;  2CT6 A;  4L0U A;  1EEJ A; 
#chains in the Genus database with same CATH homology
 4HQS A;  3KD0 A;  2JZR A;  5IO0 A;  2HYX A;  2H6X A;  3RDW A;  2A2P A;  3A5W A;  1TRV A;  2QKE A;  1M2A A;  4NXI A;  4BVX B;  1NSW A;  4MZW A;  2YAN A;  3VWW A;  4WBJ A;  2H6Z A;  3GNJ A;  3M0F A;  3TKQ A;  2VM1 A;  2RII A;  3LGC A;  4N0V A;  4MZC A;  4EL1 A;  3QAV A;  1OYJ A;  1OC9 A;  3DML A;  1XWC A;  1B4Q A;  2LRN A;  2WUL A;  4IVF A;  2LTK A;  2P5Q A;  5ECK B;  1ERV A;  1THO A;  4X43 A;  5EVO A;  4WKW A;  3VUR A;  2I9H A;  1OKD A;  3TJG A;  3O3T A;  4PQ1 A;  2LNS A;  2NVL A;  3H1N A;  3HVX A;  1X5E A;  2L6C A;  4JZQ A;  2R5G A;  1O6J A;  2NBS A;  2LNT A;  3CSH A;  2VIM A;  4GQF A;  2P0G A;  4TR1 B;  4F03 A;  2OE0 A;  5J5N A;  3BD2 A;  3FHK A;  3TKS C;  3ISO A;  3FR9 A;  2HRN A;  5D93 A;  2CVK A;  2YWO A;  4HZ2 A;  4RQX A;  1Z5Y E;  1K3Y A;  2VCT A;  4OMV A;  1Z7P A;  5FHI A;  4G0L A;  5EPF A;  3KJY A;  4BVY A;  1VF1 A;  4DVC A;  1QGV A;  2V1M A;  1MD4 A;  1GSE A;  4RUV A;  3IC4 A;  2O89 A;  3D0Z A;  4NMU A;  3UVH A;  2HFD A;  5KN3 A;  10GS A;  4D73 A;  4NV2 A;  3P8W A;  4PX1 A;  2MZC A;  4OO4 A;  4HU9 A;  2TRX A;  5D9X A;  1FG4 A;  4JED A;  2Z9S A;  2OE1 A;  3RPP A;  3VPT A;  3LFL A;  1GNW A;  2HRF A;  4TOP A;  1X5D A;  1GSD A;  4PUF C;  2YOI A;  5ECH B;  2VLV A;  5LCZ A;  3ZIV A;  3HHV A;  3UAP A;  4CY8 A;  1O7U A;  1PA3 A;  4DSS B;  3AY8 A;  3DGQ A;  5H5R A;  4EC0 A;  4OD7 A;  4FQU A;  4YQV A;  4IEL A;  4L0W A;  2G0F A;  1BX9 A;  3IHG A;  2LV3 A;  3HZ8 A;  3H79 A;  6GSY A;  4Z2T A;  3ZML A;  5B6M A;  2HNL A;  4WF5 A;  2HRK A;  2GZZ A;  3EU4 A;  2CVD A;  3OR5 A;  3J7Y b;  2MYG A;  2XPD A;  4GWR A;  3MYD A;  1O8X A;  4AJ8 A;  2VUP A;  2HZE A;  4LMV A;  3GYK A;  5IPH A;  3FR6 A;  1V98 A;  2DSA A;  1Q98 A;  3MNG A;  1A2J A;  1GSQ A;  2EC4 A;  2OA7 A;  2GS3 A;  4XS4 A;  1DUG A;  2MBS A;  3KGK A;  2N5F A;  3TJJ A;  2H1B A;  4JR4 A;  3IK7 A;  3CSJ A;  3FY7 A;  4JR6 A;  1SYX A;  2CVB A;  3L9U A;  4OFN A;  1LBK A;  2GSQ A;  1WE0 A;  2DJ3 A;  5JWR B;  3D6I A;  4OCF A;  4RI7 A;  2VL2 C;  2FWH A;  2XPE A;  4IQ1 A;  3D5J A;  1NHY A;  4AF2 A;  1O85 A;  3TUE A;  3VI7 A;  1GP1 A;  3VWV A;  3CTF A;  3HVS A;  2A2S A;  4NHZ A;  3LJR A;  4MJB A;  1ON4 A;  3DEX A;  6GSU A;  1M2B A;  3F4T A;  3HYP A;  3NOF A;  2HRA A;  2RUF A;  1EV9 A;  1CQH A;  3KMO A;  3IBH A;  3QDN A;  3FZ5 A;  5BMU A;  1MD3 A;  4FH8 A;  2X49 A;  4XRA A;  4O5R A;  3C7M A;  5DJM A;  4DEJ A;  3M9K A;  1PKZ A;  3KH9 A;  5IO2 A;  4POM A;  5IMZ A;  1WP0 A;  3IOS A;  2L4C A;  2VOC A;  2HSH A;  2K6V A;  1NHO A;  2OJL A;  3LYK A;  1TP9 A;  1JLW A;  3VPQ A;  4JE1 A;  4TR4 A;  3C1S A;  3HDC A;  2F51 A;  2H0I A;  4HUA A;  4EF0 A;  4GLT A;  4V1A g;  3CYN A;  4IJI A;  4OFM A;  1FO5 A;  5LNK e;  1TRW A;  1QUW A;  3IAM 2;  4KCE A;  2P5R A;  3N5O A;  5ECR B;  1SEN A;  2GGT A;  4POK A;  4TKY A;  3IDV A;  5J9B A;  2FGX A;  1A8L A;  5D96 A;  5ECL B;  4KDY A;  2L4Q A;  3TCO A;  3MAK A;  2KP1 A;  4ML1 A;  1DE1 A;  1DSB A;  4Q5F A;  3FZA A;  1SJZ A;  4BWQ A;  1TRU A;  4POB A;  5F07 A;  1GLQ A;  4FO5 A;  5ECP B;  1N8J A;  2LJR A;  4YKG A;  4KX4 A;  3DRN A;  1PKW A;  1XXU A;  3GUR A;  1SU9 A;  4KUN A;  1YF1 A;  4PGT A;  4BL7 B;  1ZGN A;  5J41 A;  4ZBA A;  1CQG A;  4K0G A;  4WEY A;  4TR0 A;  1ILO A;  4V2L A;  4BA7 A;  3APQ A;  3GN3 A;  2FCH A;  5AGY A;  4MPF A;  1ML6 A;  5DDL A;  4HDE A;  3ZLP A;  3ZIJ A;  3J7Y k;  3QFB C;  4LLR A;  1F9M A;  1C72 A;  4WF4 A;  1SD9 A;  3UBL A;  4QL9 A;  4TXO B;  2I4A A;  5CRW A;  1R26 A;  1EP7 A;  1X9W B;  1XFL A;  4EIP A;  3IV4 A;  3LQ7 A;  3UBK A;  4KH7 A;  3GL5 A;  3G7I A;  1KBN A;  3KEB A;  4TVE A;  3LW9 A;  3KM6 A;  2IN3 A;  3HZ4 A;  1XPV A;  5ECO B;  1FOH A;  2VM2 A;  2IMI A;  3E0U A;  4PNF A;  2HT9 A;  1U87 A;  3FEU A;  4GSN A;  2DC5 A;  2ES7 A;  1ERW A;  2YPM A;  1E2Y A;  1Z7R A;  1OAZ A;  3EUR A;  2VL3 A;  5CRH A;  2FA8 A;  2VO4 A;  4PUA A;  2H0G A;  2VCX A;  2PVO C;  2BMX A;  4Z2R A;  1GH2 A;  2C0D A;  3BJ5 A;  3GH6 A;  4N30 A;  1X9M B;  3FZ4 A;  2IMK A;  4ZXG A;  1U6T A;  2RUE A;  1PN9 A;  3DXB A;  1A2L A;  2JSZ A;  1XCC A;  4PXO A;  3PGT A;  1SK1 A;  1O81 A;  4Z7X A;  4KF9 A;  2GQL A;  2WGR A;  1YKC A;  3QAG A;  4IHU A;  4YQU A;  1SD8 A;  2ZNM A;  1A0F A;  5DQY A;  2JU5 A;  3KMN A;  1NM3 A;  3IR4 A;  2JSY A;  5C04 A;  13GS A;  2H6Y A;  1K0C A;  3VLN A;  1U3I A;  4K9Z A;  1WJK A;  4BVX A;  4MAB A;  1AQX A;  1WOU A;  1PL1 A;  1FW1 A;  3PIN A;  4Z2U A;  5F06 A;  3BCK A;  4KND A;  1M9B A;  2M80 A;  5JCW A;  5DCG A;  3DWV A;  3UMA A;  3TOT A;  16GS A;  5DAK B;  3ZFL A;  2CQ9 A;  3RBT A;  4O5U A;  5A5K A;  3ERF A;  1QMV A;  2XBQ A;  1T8E B;  4FYC A;  1U3A A;  3KTB A;  1M99 A;  2H74 A;  3H4K A;  5HFG A;  1PN0 A;  2CV4 A;  3MIX A;  3DIE A;  1JZO A;  5G5F A;  3FK8 A;  2J23 A;  2VLT A;  2L5L A;  3ZVJ D;  4NWY A;  1G6Y A;  1JZR A;  1MTC A;  4HZ4 A;  5IIZ A;  4MF5 A;  3K8N A;  5ELG A;  1BYE A;  2WFC A;  4MMM A;  1XWB A;  4EIQ A;  5CRE A;  4IQA A;  1FAA A;  2JZT A;  3KXO A;  2PVQ A;  2R37 A;  1GSU A;  3O6T A;  2B1L A;  4ECI A;  3PR8 A;  3M9J A;  2IIY A;  1SJI A;  2PU9 C;  2R6K A;  2OAC A;  1W89 A;  1XZO A;  2VCW A;  1HNB A;  1GUK A;  3M1G A;  2DLX A;  5HR0 A;  3HA9 A;  4ILF A;  2L5O A;  1F2E A;  1HNC A;  1G6W A;  3IAS 2;  1A8Y A;  3QR6 A;  5IQY A;  3IHQ A;  2LQQ A;  4ZB8 A;  2H72 A;  1ZMA A;  1IYH A;  5EY6 A;  2LKU A;  1K0B A;  3D22 A;  2X64 A;  1A23 A;  2C3Q A;  5KN1 A;  4H86 A;  2F8A A;  1EOH A;  4GXZ A;  1PRX A;  1SK0 A;  2B5X A;  3TJF A;  5HR1 A;  4DSS A;  3TKR A;  1RK4 A;  2N5B A;  3FKF A;  4CY6 A;  2H66 A;  2GDR A;  3WGD A;  1XW9 A;  2B3S A;  1A0R P;  4GST A;  1K0D A;  4FIW A;  3ZRE A;  1R5A A;  5IMD A;  3EE2 A;  1JHB A;  3IK9 A;  3TJB A;  4TRX A;  4AGS A;  2CX3 A;  3I6A A;  3CTG A;  4ZIL A;  3RAZ A;  1TKD B;  5AN1 A;  5FWG A;  5CNW A;  1X0R A;  1WIK A;  4X4J A;  2O85 A;  1GTU A;  4QQ7 A;  4CHS A;  3QMX A;  5DAL A;  4XHM A;  1BJX A;  1EEM A;  3Q6O A;  1OE7 A;  2YJ7 A;  5ECM B;  1V57 A;  3TGZ A;  4EKZ A;  5A4V A;  4MJE A;  2VCZ A;  3F4R A;  2H76 A;  2WB9 A;  4ACS A;  3U5R E;  5G1K A;  1T3B A;  2H1D A;  2HXK A;  5DCH A;  1NW2 A;  4IS0 A;  4WR4 A;  1Q4J A;  2VCQ A;  2GZP A;  3APO A;  5HFI A;  4G19 A;  2HSY A;  4RQR A;  4P3Y B;  4O32 A;  2J9H A;  1A24 A;  2CZ2 A;  4ISD A;  2KLX A;  2WJU A;  6GSS A;  4ZB6 A;  5AIX A;  3A5I A;  3A2V A;  1AC1 A;  2JL4 A;  1OC9 B;  4I5Q A;  3UIW A;  2LUS A;  3BCI A;  2MMO A;  2PPT A;  1WRY A;  4F9Z A;  3TKS E;  2AJQ B;  3NZN A;  2R2J A;  4WXT A;  1TK8 B;  4ML6 A;  4USS A;  3QCP A;  5LD0 A;  1PQN A;  1PGT A;  1QXH A;  3QOU A;  2F8F A;  4K2X A;  4LMW A;  3L9V A;  1XWK A;  8GSS A;  1USB A;  3EMX A;  1QK8 A;  3KZQ A;  2DIZ A;  1B4P A;  2VCV A;  1H4O A;  2IJY A;  4PQI A;  4NPB A;  2IFQ A;  4IGJ A;  1ZYP A;  3LEF A;  2GVP A;  3TOU A;  1PX7 A;  1TJD A;  4EDY A;  4GTU A;  3RHB A;  4BVY B;  1TU7 A;  2B5Y A;  4DSR A;  9GSS A;  3LYP A;  3GKK A;  4XRD A;  1FVJ A;  1XBS A;  2FY6 A;  3Q19 A;  5IPG A;  1GUL A;  1GUM A;  3P2A A;  2QA1 A;  1ERT A;  4D73 B;  4G0K A;  3HVV A;  4EE0 A;  2AYT A;  1AW9 A;  1G7E A;  3U6V A;  1V58 A;  3CXG A;  2K8V A;  3P90 A;  2PMT A;  5IM9 A;  3UVT A;  4IJ3 A;  5F0G A;  4BL7 A;  3NIV A;  2DIY A;  5CYY A;  5G30 A;  4I8B A;  1U88 A;  3WYW A;  1GUH A;  2VD1 A;  3ZVJ A;  1AIU A;  2KOK A;  5AIS A;  4HS1 A;  4ZL9 A;  1G0T A;  1T4Z A;  1M2D A;  1V2A A;  1FB0 A;  5ABR A;  3C71 A;  1FVK A;  4EVM A;  2HZF A;  2E2G A;  3FW2 A;  2A4H A;  4GSS A;  2FLS A;  5IMV A;  4DSQ A;  2H1G A;  4BWS A;  1J08 A;  1ZOF A;  4IKH A;  2R0P A;  2AUV A;  4MH2 A;  3GL3 A;  4KDX A;  2HZE B;  2JAC A;  2P31 A;  2NDO A;  2PUK C;  3GTU A;  3GX0 A;  4XS6 A;  5CO3 A;  3ZL5 A;  2KHP A;  2WDU A;  2XBI A;  2UZ8 A;  1T4Y A;  4Q5N A;  2QA2 A;  4N10 A;  5A4W A;  4XS4 B;  2LRC A;  3IE3 A;  1Z3E A;  2WZ9 A;  2FWF A;  4GF0 A;  2H71 A;  5D8I A;  3TDG A;  3GFK A;  5GAP D;  3ZTL A;  2K8S A;  2MBT A;  1YDK A;  2D2Z A;  3H8Q A;  3P7X A;  4LL1 B;  2RLI A;  4ECB A;  1R5P A;  4K5S A;  3E3E A;  1OKT A;  1ERU A;  1SK2 A;  2JZS A;  3ZFB A;  4XS1 A;  4IW9 A;  4AJ6 A;  1G7O A;  2H30 A;  2C0E A;  2YWI A;  5JWQ B;  3VWU A;  4TR3 A;  4TXV A;  3CRU A;  4X0X A;  1J9B A;  3L0H A;  1AQW A;  2NTO A;  5ID2 A;  5KN0 A;  2KUC A;  2GT5 A;  3ERW A;  1ZL9 A;  4WR5 A;  4AJ7 A;  3A3T A;  2YNX A;  4KCA A;  4ZBB A;  4Q5R A;  11GS A;  3IRA A;  3VI5 A;  1B9X C;  1K0N A;  1OVN A;  1DBY A;  1PD2 1;  5DAK A;  1T00 A;  2F3M A;  3VWX A;  2C0F A;  5C00 A;  3EMP A;  4MJA A;  3ED3 A;  3G7J A;  4N0Z A;  2I3Y A;  4N11 A;  1K0A A;  1TI1 A;  3GV1 A;  2B7K A;  2L6D A;  2YZU A;  1VF2 A;  1YJ6 A;  3LXZ A;  1QFN A;  4V2M A;  2ZUP A;  4ZL8 A;  5JWO B;  1J0F A;  1GSS A;  1ZYE A;  1M0U A;  2XC2 A;  3GIX A;  1AUC A;  2PBJ A;  1WWJ A;  2V6O A;  3D4T A;  4V1A p;  12GS A;  2L59 A;  3BBY A;  4MLY A;  3UEM A;  3MWH A;  4NHW A;  1Z9H A;  1ZYQ B;  2NPB A;  2IWT A;  18GS A;  2X4A A;  5DVB A;  1I9D A;  1PMT A;  1KEB A;  1I5G A;  1EGO A;  4O7H A;  5L71 A;  4MJC A;  4JBB A;  3C73 A;  4HI7 A;  6GST A;  1ACV A;  4IP6 A;  4XTS A;  1WMJ A;  2YV7 A;  1VF3 A;  1UN2 A;  4X1U A;  3GX8 A;  2F9S A;  1GTA A;  4ZBD A;  2HLS A;  3WT2 A;  3GMF A;  1K0M A;  4EUY A;  1VF4 A;  3CSI A;  2EIQ A;  1YY7 A;  4O5Q A;  3SBC A;  4L5O A;  1B48 A;  5CAX A;  7GSS A;  2CAI A;  2H01 A;  3L78 A;  3ME8 A;  5INY A;  1YQ1 A;  2PWJ A;  5B7C A;  17GS A;  1SYR A;  4TN8 A;  1YEP A;  2O8V B;  5E59 A;  3VFI A;  3TKP A;  3UOM A;  3M8N A;  2YN1 A;  1TXX A;  3F4S A;  3TB2 A;  1TU8 A;  2GLR A;  3JCM L;  5IMF A;  4YQM A;  4TR1 A;  19GS A;  2N5A A;  4OCE A;  1ZZY A;  3W6G A;  4KB3 A;  4MK3 A;  2REM A;  1XVQ A;  3FMW A;  1YZX A;  2GSS A;  6GSW A;  1YF0 A;  3F63 A;  4K0N A;  2DMM A;  2PGT A;  3O76 A;  5ECI B;  3WGE A;  4WET A;  4EO3 A;  1A2M A;  1EZK A;  4LL4 B;  3EYT A;  2LST A;  2GSR A;  3IC8 A;  1EV4 A;  2FNO A;  1XOA A;  1GNE A;  1QQ2 A;  3Q74 A;  3QAW A;  5EL8 A;  3EPT A;  5FT3 A;  3GKM A;  3TJK A;  1SL2 B;  3QD9 A;  3IA1 A;  2EIR A;  2H8L A;  5DQS A;  4K8M A;  5G1L A;  1GWC A;  3KP8 A;  4A5P A;  4F0C A;  1B8X A;  2WRT A;  2LS5 A;  5ENU A;  2AV4 A;  6GSX A;  2E2M A;  2TRC P;  2H19 A;  2OKA A;  4GCI A;  1HNA A;  3GA4 A;  1EOG A;  1E6B A;  4ZB9 A;  1TI3 A;  3TKS A;  4MF6 A;  3UL3 A;  3GKX A;  1FHE A;  4GQC A;  3A2W A;  4YAV A;  3HXS A;  1SJ6 A;  1RW1 A;  3FYG A;  3PPU A;  3DD3 A;  5D9T A;  5ECS A;  4K2D A;  2DJ1 A;  4K7I A;  3W8J A;  1UVZ A;  3WGX A;  1XW5 A;  5DBQ A;  1V40 A;  3ZYW A;  5ECQ B;  1GSY A;  1K3O A;  2B5E A;  1RQM A;  2DKH A;  4JRR A;  3S9F A;  3GKN A;  2PER A;  2H70 A;  5CRG A;  2VAF A;  3E9J B;  1IYI A;  2R0C A;  2K18 A;  1XWA A;  3TRQ A;  4YKF A;  3EVI A;  5D9V A;  2R4V A;  4KA0 A;  5H5S A;  2CZ3 A;  5J9C A;  3FZ9 A;  4XIH A;  1SKR B;  1BAY A;  2MMN A;  3F3Q A;  3RPN A;  4POL A;  1S3A A;  4G10 A;  4ZL7 A;  3D21 A;  3ZMK A;  2OE3 A;  1XOB A;  2E7P A;  4O92 A;  1XWG A;  5F8B A;  4F0B A;  1EGR A;  1EWX A;  2HI7 A;  2X99 A;  3HY2 A;  1AXD A;  3WT1 A;  3G9B A;  1W4V A;  2YP6 A;  3RHC A;  3F6D A;  2C3N A;  4KE3 A;  5KOW A;  1ZCP A;  4OWY A;  5D73 A;  5KEJ A;  3M3M A;  2IPA A;  3LWA A;  2DKI A;  3W8S A;  5HQP A;  1UA5 A;  2C3T A;  2OAD A;  4GRF A;  2AHE A;  2G2Q A;  4MZB A;  4I97 A;  2V32 A;  3QFA C;  1HD2 A;  1X9S B;  2DJ2 A;  2FHE A;  2YWN A;  4MCU A;  1V9W A;  3F3R A;  1PSQ A;  3LXT A;  3F9U A;  5KOX A;  1MDK A;  1PL2 A;  1SKS B;  3TRP A;  2EIO A;  3MSZ A;  3I9V 2;  5F05 A;  20GS A;  5H5Q A;  4PNG A;  2VL2 A;  3QPM A;  5DAL B;  2K9F A;  4G2E A;  3N9J A;  4TW5 A;  6GSV A;  4QL7 A;  2FUG 2;  5G5E A;  4KGI A;  1S3C A;  2ZCT A;  3A2X A;  4HJM A;  2GTU A;  1F6M C;  3LOR A;  5DJL A;  3VK9 A;  2CAQ A;  2E0Q A;  3R2Q A;  2I81 A;  4NAX A;  2CA8 A;  1X5C A;  4MDC A;  5GSS A;  2B1K A;  1OC3 A;  4L8E A;  3APS A;  5B8A A;  3MDK A;  4IP1 A;  2QC7 A;  3KTL A;  4G0I A;  2FA4 A;  3GST A;  3ERG A;  3HKR A;  1JLV A;  4PUR A;  1UC7 A;  4RI6 A;  1YKA A;  4HEA 2;  4MF7 A;  1GL8 A;  5IOX A;  2A4V A;  1EP8 A;  2CX4 A;  2M72 A;  4OFT A;  1H75 A;  4PQH A;  4FYB A;  4ECC A;  4F82 A;  3L4N A;  3Q18 A;  2C1Y A;  1HQO A;  4ICY A;  4EXJ A;  4FYU A;  1AAZ A;  4TXO A;  2DBC A;  5IMA A;  4YH2 A;  1JZW A;  1LU4 A;  4ZIJ A;  4HJ2 A;  3CMI A;  4K7N A;  3TRX A;  2GZY A;  5ECN B;  3HCZ A;  1SKW B;  1PX6 A;  3HD5 A;  3PH9 A;  1SL1 B;  5HR2 A;  4HU7 A;  1K0O A;  2RM5 A;  4WBR D;  3V1W A;  1F3A A;  2AB6 A;  3EU3 A;  4I6X A;  3ZZX A;  3GUS A;  2GQM A;  1VGL A;  5COH A;  4MNN A;  3GHA A;  3D4M A;  2IFQ B;  2LJA A;  2ALB A;  1ST9 A;  2B7J A;  2GQK A;  22GS A;  2R3X A;  4IBP A;  4I2U A;  3CRT A;  2X8H A;  2OBK A;  3DVW A;  2LEG A;  2B6M A;  4JU5 A;  1T7P B;  1GLP A;  4KW6 A;  4J56 E;  3EWL A;  1LJR A;  4MH3 A;  2DJ0 A;  3L9S A;  2MMA A;  3FR3 A;  5IOW A;  1MDI A;  2X8G A;  4E8E A;  3IXR A;  3US3 A;  1JFU A;  4ID0 A;  3DKS A;  2L57 A;  1Y6E A;  1JZD A;  4MA9 A;  5G2Z A;  5D9W A;  1GRX A;  1TOF A;  1R4W A;  4EDZ A;  4OO5 A;  2KP2 A;  3KCM A;  4MP4 A;  4V2N A;  3HJO A;  14GS A;  1FB6 A;  1F37 A;  2HE3 A;  3FRC A;  5GZZ B;  4BPY A;  4ECJ A;  3ME7 A;  2IMD A;  3CBU A;  1GSF A;  4KSO A;  5ELA A;  1GTB A;  1XVW A;  3DYR A;  4ULX A;  2C0G A;  2BJX A;  2PN8 A;  3HJP A;  3F0I A;  2I1U A;  1TK0 B;  2C4J A;  1BG5 A;  2O7K A;  3LG6 A;  4J2F A;  3DVX A;  1FOV A;  4CDO A;  5BRT A;  4HOJ A;  3LSZ A;  4E8H A;  4LA1 A;  1BQ7 A;  1TDI A;  3WD6 A;  2YCD A;  4F2I A;  3F8U A;  2WS2 A;  1AQV A;  3GTU B;  1Y25 A;  1TTZ A;  5HR3 A;  5E4W A;  3KH7 A;  1M9A A;  2H1A A;  2A2R A;  3HJM A;  2YZH A;  4CW9 A;  1VRS D;  2V6K A;  2VL9 A;  1DE2 A;  1M7T A;  2FWG A;  2WCI A;  4IN0 A;  2YV9 A;  4K6X A;  1OE8 A;  2C8U A;  2GST A;  3I43 A;  3KIJ A;  2TIR A;  1KNG A;  2YWM A;  5JCU A;  1Z6N A;  1TK5 B;  4K5R A;  2V41 A;  1MEK A;  5G31 A;  4NV5 A;  3ZIT A;  2M46 A;  2AAW A;  1HYU A;  3R3E A;  2DML A;  1T1V A;  2HSM A;  5KN2 A;  3UAR A;  2X8C A;  3EC3 A;  4XCS A;  1Z6M A;  4Q5Q A;  1B9Y C;  1O8W A;  3UJ1 A;  4I2T A;  4K1F A;  5GST A;  1SL0 B;  1ABA A;  2OBI A;  5J3R A;  2IMF A;  3EIN A;  2FWE A;  4KDU A;  5ID2 B;  3IPZ A;  1GTI A;  2H73 A;  5B6N A;  2DJK A;  4HQZ A;  4MPG A;  3I69 A;  3SWL A;  5AIV A;  1N2A A;  2C80 A;  2VLU A;  2FD3 A;  4YAP A;  1WPI A;  3GRX A;  1BED A;  4J57 E;  5HFK A;  2ON7 A;  3GH9 A;  2LQO A;  4L5L A;  2GT6 A;  1THX A;  5J4U A;  2H0H A;  5CRD A;  1TRS A;  1OC8 A;  2YJH A;  3G7Y A;  4G9H A;  5CP1 A;  3C8E A;  4KSM A;  2R0G A;  2VD0 A;  5B8B A;  2LRT A;  2XHF A;  5GAN D;  1R7H A;  1TW9 A;  2O87 A;  4KAE A;  2LJK A;  1MDJ A;  3ZRD A;  2RM6 A;  3BOA A;  2ON5 A;  2IME A;  2QGV A;  5A4U A;  2V2G A;  1URM A;  1O73 A;  5IMC A;  1XW6 A;  2MMZ A;  1ZYN A;  1XIY A;  3F6F A;  1F3B A;  2IL3 A;  2JAD A;  1YEX A;  2DJJ A;  1KTE A;  4K7O A;  2BTO T;  2H75 A;  3H93 A;  3GSS A;  1K3L A;  3C1R A;  2QSI A;  4PTS A;  3KP9 A;  5JCG A;  1S3D A;  2CT6 A;  4L0U A;  1EEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...