4N11A

Crystal structure of plasmodium falciparum reduced glutaredoxin 1 (pfgrx1) complexed with cisplatin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
108
structure length
108
Chain Sequence
TSEAVKKWVNKIIEENIIAVFAKTECPYCIKAISILKGYNLNSHMHVENIEKNPDMANIQAYLKELTGKSSVPRIFINKDVVGGCDDLVKENDEGKLKERLQKLGLVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin
publication title Interaction of Cisplatin with plasmodium falciparum Glutaredoxin 1
rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 39
structure length 108
sequence length 108
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4n11A00
2H6ZA 2YV7A 4TR1B 4P3YB 4KNDA 4IHUA 5AIXA 3FEUA 4GQCA 4F0BA 1ZYEA 3F63A 3LORA 3D6IA 3GV1A 1A0RP 2H6XA 4BA7A 4OO4A 2RLIA 2H1AA 3D0ZA 3KXOA 1GWCA 3FR6A 4ACSA 2GT6A 3KH9A 4N30A 2I3YA 1EEMA 2DJ2A 3KJYA 1SJ6A 2LTKA 1PN9A 4N10A 1ABAA 1Y6EA 2YP6A 5E59A 2PERA 3CYNA 2H73A 2OJLA 2F51A 2HNLA 4IQ1A 1AW9A 1NW2A 1TP9A 3FR9A 6GSWA 3TRPA 2PN8A 1ZGNA 1GTIA 4K7NA 4ZL8A 2P5RA 4JBBA 3TRXA 1OC3A 3KEBA 1M0UA 3F4RA 1GUMA 3M9JA 3GMFA 3GX0A 3UEMA 1R4WA 2MYGA 2IFQA 3H79A 2N5AA 2B3SA 1NHYA 1JLWA 1DSBA 2IIYA 3OR5A 2IL3A 1PKWA 3M1GA 4YH2A 1GSSA 4ZL7A 5DJMA 3HY2A 5D9TA 1R7HA 5ECMB 3TJGA 3UIWA 2YJHA 4NAXA 3CXGA 3JCML 2D2ZA 4ZBAA 5F8BA 4GWRA 4OFTA 2K9FA 2KOKA 6GSXA 4I8BA 3UMAA 2HXKA 4WBRD 4IGJA 2HYXA 5J9BA 4PQIA 1TJDA 1ST9A 4IJIA 3ZFLA 2DJ1A 3D5JA 4DVCA 1PX7A 4HJMA 4ID0A 1TRWA 4IKHA 5CNWA 1BQ7A 1PGTA 1O85A 2AJQB 3TKSE 4XRDA 4L0WA 1WJKA 4L0UA 3DEXA 3MAKA 3ME8A 1FVKA 3KD0A 4PURA 2H01A 5KEJA 3G7JA 2C3NA 1PSQA 4Z7XA 2F9SA 4ZXGA 2H0IA 1XPVA 5D93A 5CRDA 2NBSA 5H5QA 4NPBA 1X9MB 3C1RA 1ZCPA 3WD6A 4GQFA 5JWRB 1I9DA 1T1VA 2FHEA 2FWGA 4X0XA 1GSQA 5HFKA 1LU4A 1JZOA 2LUSA 4DSQA 1JZRA 5J9CA 1GLQA 4ULXA 1ZL9A 1ACVA 5JWOB 3IAM2 2VCTA 1NSWA 2ZUPA 3FYGA 3H8QA 10GSA 1Q4JA 1TKDB 3LG6A 1SJIA 2O85A 2AV4A 3DD3A 5IPGA 1SKSB 3RDWA 3LYPA 1UA5A 1GH2A 3UBLA 3IE3A 1HNBA 3KTBA 3HXSA 17GSA 4EUYA 5L71A 3ZMKA 1TI1A 1J0FA 2BJXA 1Z6NA 1TRSA 3G7IA 4AJ7A 1QGVA 2KUCA 4XS6A 2GSTA 3ZITA 2B6MA 2OBIA 1B8XA 2L6CA 3DYRA 3IDVA 4AJ6A 1GSEA 1MTCA 3GH9A 3W6GA 3Q19A 2IN3A 5G5FA 3S9FA 4N0ZA 2FA8A 2R6KA 3GTUB 1K0CA 6GSUA 4EF0A 2LNSA 4DSSA 2YZHA 4KDXA 2QSIA 3KGKA 4K2DA 3IAS2 2O89A 4EVMA 1GP1A 3FKFA 1XXUA 2X8HA 2JZTA 2VOCA 3EYTA 3EURA 1O7UA 4MH3A 2EC4A 1PQNA 1GRXA 4ECCA 2AYTA 2WB9A 4K7IA 3TCOA 1F37A 1GSYA 4K8MA 1SK0A 3G7YA 3IR4A 4KCEA 5A5KA 3M8NA 2GVPA 5IO2A 3F6FA 1XVWA 2WCIA 2CX4A 1H75A 4QQ7A 3CTGA 2WGRA 2H0GA 2VLUA 4YAVA 1RW1A 3Q74A 2FCHA 1IYIA 2B5XA 4N0VA 2C1YA 4D73A 5D9VA 1AIUA 4FH8A 2B1KA 1MD4A 5CREA 1JZWA 3ZIVA 1BX9A 4XHMA 1TK5B 1M2AA 3CRUA 4ZL9A 3L0HA 4WF5A 1T7PB 3O76A 4OCFA 3CMIA 3J7Yk 2FWFA 3TB2A 1AAZA 3F8UA 1YEXA 2X99A 3VI5A 4Q5QA 1FB6A 2H6YA 2PUKC 3QDNA 1YQ1A 2PWJA 1T8EB 3FZ5A 5HFIA 1Z6MA 4EDYA 2CAIA 3BCKA 2H1BA 2H19A 2P5QA 2KHPA 4GCIA 2K6VA 4XS1A 5C00A 4MJEA 2VAFA 1GUKA 5CRHA 1YJ6A 1KBNA 3RAZA 4AJ8A 1MD3A 2RUEA 4F0CA 1OAZA 3ZVJA 3TKQA 2GZZA 3H1NA 4O7HA 2YOIA 4CDOA 3VWUA 5G1KA 3ME7A 1H4OA 4PUAA 1YY7A 5ECIB 1A8YA 1N8JA 2TIRA 3EC3A 4TN8A 3Q18A 1AQXA 4OCEA 2IPAA 1Y25A 3QCPA 1J08A 4CHSA 1MEKA 5EY6A 2C0EA 4JZQA 1XW6A 3GH6A 4I6XA 3P90A 2CZ3A 2XPDA 3F3RA 2H72A 1BYEA 1NM3A 1F9MA 3I9V2 2N5BA 5B7CA 3UL3A 1ON4A 1SD8A 4O32A 1Z5YE 1ERVA 2M80A 4IQAA 1RQMA 5H5RA 4Q5FA 1M9BA 1XWKA 1DBYA 1C72A 2VCVA 3US3A 5IOWA 2JSZA 3L4NA 4V2MA 5ECOB 2WRTA 3HA9A 2AAWA 3RBTA 2R3XA 3G9BA 4KB3A 4NHZA 3UBKA 2O8VB 5LCZA 1GSDA 4NV5A 1MDIA 2NTOA 5FWGA 3MSZA 2V1MA 1BEDA 3VPTA 2R5GA 2JSYA 1HYUA 6GSSA 4MMMA 1EWXA 2A2SA 3VK9A 5A4UA 3ZIJA 1GULA 1GTBA 2XBQA 1OC9B 4GSSA 2WULA 3WT1A 2E2GA 2ON5A 1YKAA 3DVWA 4ISDA 2HZEA 1HD2A 1K3YA 2HZFA 1URMA 1M9AA 1LJRA 3IOSA 3BJ5A 4EC0A 3GKXA 4POBA 3CBUA 2LJRA 4K0NA 3IBHA 1U6TA 1JZDA 3KH7A 3IA1A 4HU7A 1F3AA 4LLRA 4JR6A 4E8EA 4QL9A 1SKWB 1MDJA 5IMAA 2L57A 5KN1A 2KLXA 1G7OA 3FHKA 1WOUA 3FZ4A 2XHFA 3P8WA 3L9SA 3HHVA 4G9HA 2IWTA 4PNFA 2OACA 4IP1A 3EU4A 1O8XA 2H71A 4HZ4A 1EV4A 1X0RA 1K0NA 2VUPA 5IMCA 4DEJA 4HU9A 4FIWA 3ZYWA 1AQVA 3GHAA 5B8AA 4HOJA 5CRWA 1YF1A 3D4MA 2VD1A 1QQ2A 5IPHA 2BMXA 3BD2A 3GKNA 4OD7A 5JCWA 2L5LA 2V41A 3I6AA 12GSA 2WJUA 3MDKA 5GSSA 2VCXA 2O87A 1QUWA 2GTUA 2H70A 4XS4B 3I69A 1BAYA 2H1DA 2HI7A 1PL2A 1BJXA 3ZVJD 4KSMA 2QKEA 2IMDA 4KDYA 1X5EA 4MZCA 4G2EA 1V2AA 5DQSA 2DJJA 5F06A 1SD9A 3R2QA 2J9HA 2MMAA 2OADA 3C71A 3WGDA 3WGXA 3F4SA 5DQYA 3C7MA 2JACA 2CVDA 1V40A 2H66A 3PR8A 4K6XA 1GNEA 2B7KA 3D4TA 4HDEA 2HFDA 5HQPA 4KA0A 1B48A 4PX1A 1B4QA 3UOMA 2PVQA 1QK8A 2RM6A 2GSSA 4KX4A 1GSFA 1X9WB 2VCQA 4TXVA 3NOFA 1IYHA 3GFKA 2TRXA 4JR4A 5ECRB 3ED3A 2MZCA 3EE2A 6GSYA 4ZB6A 1XFLA 2ON7A 2VL2C 2XBIA 5HR3A 2DIZA 5F0GA 2V32A 5J41A 4GRFA 5ECSA 3LXTA 1XCCA 2R4VA 2CV4A 3O3TA 4FYUA 5EPFA 5B6MA 5KN0A 5G2ZA 2C80A 5ECQB 3P7XA 3TKSC 3M9KA 3GL5A 2VD0A 1TXXA 2X64A 5DVBA 1X5DA 2LRTA 1M2DA 1FHEA 2JZRA 6GSTA 6GSVA 4XCSA 1HNCA 3ZZXA 3SBCA 1TW9A 3EINA 5ECPB 3GX8A 4MPGA 5KN2A 2M46A 1Z9HA 4MF5A 2A4VA 4N11A 5ECKB 3GKMA 5HR2A 1B9XC 3ZLPA 3EMXA 1TRUA 3K8NA 3RPNA 1YDKA 3LSZA 5IOXA 20GSA 5B8BA 4KAEA 1EGOA 4PQ1A 5GAPD 2JU5A 3BCIA 1V58A 3CRTA 1EOGA 2IMFA 3HJPA 2GGTA 2LV3A 2LNTA 2C0GA 5GAND 1ILOA 1UC7A 2Z9SA 4V1Ap 4GLTA 3F6DA 2OA7A 4ZB9A 3PH9A 4PGTA 2FGXA 4GF0A 2KP2A 2NPBA 2YJ7A 4ML1A 4HI7A 4E8HA 5ECHB 1SL1B 2NVLA 3QAGA 2WS2A 1VF2A 5DBQA 8GSSA 3M0FA 4I97A 1FOVA 1QXHA 2LSTA 2YNXA 1FW1A 4MDCA 2N5FA 4OO5A 2WDUA 3PINA 1GTAA 3H4KA 5A4WA 2YWNA 3APSA 1SK2A 1WIKA 3IK7A 1BG5A 3TDGA 1U87A 2XPEA 4HQSA 1UN2A 2PU9C 3F4TA 4FO5A 1VF3A 5GZZB 2C4JA 4AGSA 5ABRA 2MMZA 3HD5A 1YEPA 1YKCA 1NHOA 2YZUA 5ELAA 5JWQB 5ENUA 4RI6A 1AUCA 3HJMA 1SJZA 3GSTA 3C1SA 4IP6A 4MK3A 1VRSD 1A23A 5DALB 3APQA 1T4YA 4RQXA 4YQUA 3C73A 4IN0A 2CQ9A 1G0TA 1V98A 3UVHA 13GSA 1F6MC 3IXRA 2VL9A 3N9JA 3QAVA 2EIQA 4KH7A 3WGEA 3SWLA 2LEGA 2L4QA 2GT5A 4GXZA 4POKA 1XWAA 4O92A 1XIYA 2MBTA 4XRAA 2VLVA 4MA9A 2JZSA 2EIRA 1Q98A 2H1GA 2KP1A 1OC9A 4TKYA 4NWYA 1ERWA 1F2EA 3LYKA 2ES7A 5IIZA 4G19A 1V9WA 3IRAA 4Q5NA 2K18A 3F3QA 3HVXA 5ECLB 4POLA 2VM1A 4TXOA 1WWJA 2MMNA 3QPMA 2L5OA 4OFMA 1T00A 4AF2A 1F3BA 2JADA 1S3CA 2GDRA 3ZMLA 3AY8A 2VM2A 1KNGA 3VPQA 1A0FA 5H5SA 4TR1A 3QD9A 2H8LA 2PGTA 2LJKA 1EEJA 4BL7A 2GQMA 4MPFA 5HR1A 3A2VA 4IJ3A 1ZMAA 2C3QA 4DSSB 2DJ0A 2I1UA 5J4UA 2VLTA 1XOBA 2H75A 2FD3A 2O7KA 1G6WA 3ERGA 5COHA 2YCDA 4K9ZA 3FRCA 4WXTA 4PXOA 1EGRA 1TTZA 4V1Ag 4WR4A 3FZAA 2ZCTA 4IW9A 2G0FA 4EO3A 5A4VA 4XS4A 2IMEA 3LWAA 2CZ2A 4H86A 1A2JA 1KEBA 1PRXA 4JU5A 3TRQA 5JCUA 1OE7A 1HNAA 2FLSA 3DKSA 2VL3A 4V2LA 2LQOA 4TOPA 1YF0A 1K0BA 1VF4A 2C0DA 3HYPA 1M7TA 4EKZA 3LFLA 1SENA 1JLVA 3CSHA 3ZL5A 5ID2B 1O8WA 2HT9A 2VCWA 5J3RA 22GSA 3VWVA 2CVKA 3DGQA 2L6DA 1Z7RA 1SL2B 1VGLA 2E2MA 5G30A 3HDCA 4X1UA 2PMTA 2CAQA 1TI3A 2DMLA 3ZRDA 5J5NA 1WRYA 2GQLA 3DWVA 3F9UA 2RIIA 1THXA 5DAKB 4HEA2 1W4VA 3GKKA 4L5LA 2C0FA 2DJ3A 2C3TA 3VLNA 4TRXA 2FA4A 5D9WA 4KCAA 3KM6A 3I43A 1XWCA 3GUSA 1TK0B 4G10A 1CQGA 3F0IA 2HRNA 4ZILA 3CTFA 1T4ZA 3TOUA 2WFCA 2I81A 2YPMA 4WKWA 3QOUA 1JFUA 2LKUA 1I5GA 3IK9A 3HVVA 4DSRA 3IPZA 3RHCA 1UVZA 4KGIA 4WEYA 3KIJA 4WF4A 1M99A 1G6YA 2FNOA 3GA4A 4MZWA 4I2TA 5DCHA 1FG4A 1EP8A 3HZ8A 1R26A 4JE1A 1J9BA 4J56E 5G31A 4LL4B 3KTLA 2CX3A 3EWLA 4NHWA 1Z3EA 5FHIA 2E7PA 4YQVA 1OYJA 2YN1A 2F8AA 2H0HA 5DJLA 2GS3A 2EIOA 3L9UA 4ZBDA 3TUEA 3Q6OA 3WT2A 3FR3A 2JL4A 18GSA 2B1LA 4I5QA 1FB0A 4ECBA 3DMLA 1FO5A 1GSUA 3C8EA 3TJBA 3A2XA 5IMZA 4FYCA 1B9YC 4OWYA 4MJBA 2B5YA 3GNJA 2YWMA 1ML6A 1OKDA 4MCUA 5LNKe 1AXDA 3TJFA 5D9XA 2MBSA 4J57E 4WR5A 2HE3A 5C04A 2DC5A 4F82A 3FZ9A 3TOTA 3NIVA 2L59A 5CAXA 5G5EA 5F05A 1R5PA 4XTSA 3CSJA 3IHQA 3VFIA 4MJAA 4EE0A 1OVNA 2CVBA 1SYRA 2GSRA 2CA8A 1R5AA 3VWWA 2PPTA 4HJ2A 2HZEB 14GSA 1T3BA 1K0DA 2FUG2 3GTUA 2PVOC 4HQZA 5EVOA 4HZ2A 1OE8A 2AHEA 2GSQA 4X43A 2V2GA 1PX6A 1XWGA 2I4AA 3LJRA 3GL3A 1PA3A 1XBSA 3ZTLA 2GLRA 4IELA 3D21A 3IC4A 5FT3A 3CSIA 1DUGA 1S3DA 2IMKA 5G1LA 4JEDA 5GSTA 3IV4A 1WPIA 3GIXA 5HFGA 5AISA 1WE0A 4ZBBA 2YV9A 4TVEA 2PBJA 3FY7A 4K1FA 3J7Yb 4MLYA 2OBKA 4KE3A 3M3MA 3VI7A 1SL0B 2FY6A 1ERUA 4ECIA 1E6BA 2LJAA 4Q5RA 4XIHA 5DALA 1N2AA 4PQHA 2R37A 2VCZA 3EVIA 1THOA 2BTOT 3WYWA 3DXBA 5D8IA 5KN3A 1A2LA 2H30A 3LGCA 5JCGA 4F9ZA 4K0GA 4LMWA 3RPPA 1ZYQB 1YZXA 1A24A 1K0OA 4GSTA 1E2YA 4NV2A 3V1WA 3HJOA 1X9SB 3DRNA 2V6KA 3VWXA 1TDIA 5AGYA 3HVSA 3UVTA 3E3EA 2RUFA 3N5OA 2K8VA 3TKPA 1ERTA 2G2QA 1ZZYA 1U88A 1K0AA 2IFQB 2GZYA 3ZREA 1K3LA 19GSA 1FAAA 3QFBC 4F2IA 1EOHA 4IVFA 3KCMA 2DLXA 4GTUA 5CP1A 2B5EA 4BVXA 1EV9A 1V57A 5B6NA 3U6VA 3MWHA 3QR6A 4EL1A 3TJJA 4KSOA 3GN3A 1XW5A 3VURA 2DIYA 1PL1A 1XW9A 2YWIA 1A8LA 2OE0A 1M2BA 1JHBA 1U3IA 4WETA 1U3AA 3A2WA 2YWOA 4V2NA 2L4CA 3BOAA 2OE3A 3GURA 2HLSA 1SK1A 4J2FA 1O6JA 2XC2A 1TU8A 2LS5A 3KZQA 4KUNA 5ECNB 1GNWA 2C8UA 3FW2A 4POMA 2M72A 1AQWA 2IJYA 3P2AA 5CO3A 2DSAA 4TW5A 5IM9A 1XWBA 2X8GA 1VF1A 2F8FA 2HSYA 3KMNA 1PMTA 2GQKA 1MDKA 3W8JA 2H74A 1TOFA 5AIVA 5D96A 1TRVA 1TU7A 1PKZA 1TK8B 2ALBA 3L78A 5E4WA 3TGZA 1G7EA 3UARA 2QC7A 4BPYA 4ECJA 3A3TA 1W89A 3QAWA 5ID2A 1Z7PA 4MP4A 2OKAA 1ZOFA 4QL7A 1O81A 1WMJA 2QGVA 3KP9A 4L5OA 1CQHA 4BWSA 3GSSA 2B7JA 1OC8A 16GSA 2HSHA 3UAPA 1A2MA 2HRFA 4HS1A 2WZ9A 5DAKA 3ERFA 5IQYA 5INYA 3QMXA 3LEFA 2FWHA 1KTEA 5DCGA 1XVQA 3APOA 1K0MA 9GSSA 3FK8A 4CW9A 1DE1A 1EZKA 2P31A 3LXZA 1SU9A 4OFNA 4EDZA 4RI7A 3QFAC 3ISOA 4MZBA 2IMIA 4PUFC 4RUVA 5D73A 1XOAA 4IS0A 4YQMA 2REMA 1WP0A 3MNGA 5F07A 3KMOA 2FWEA 4NMUA 4MF7A 3ERWA 5EL8A 2LRCA 3D22A 5LD0A 1GLPA 2DJKA 4GSNA 2CT6A 4F03A 4BWQA 1SYXA 4MABA 1EP7A 2AB6A 4TR4A 1GUHA 4OMVA 3ZFBA 3PGTA 3EMPA 4YAPA 2V6OA 2AUVA 5IMVA 1FVJA 4PNGA 3TJKA 2X8CA 2OE1A 1K3OA 5IMDA 2TRCP 7GSSA 2VIMA 4NXIA 1X5CA 3W8SA 2DMMA 4RQRA 2NDOA 4BVYA 4TR3A 4LA1A 1GTUA 3A5WA 3L9VA 2K8SA 1OKTA 2DBCA 3NZNA 1AC1A 4K7OA 5ELGA 3HCZA 4ZIJA 3EU3A 2P0GA 1QFNA 2E0QA 4ILFA 4KW6A 4EXJA 4I2UA 2F3MA 4MJCA 4D73B 4LL1B 4MH2A 2RM5A 2VL2A 2I9HA 11GSA 4LMVA 1RK4A 2VO4A 1DE2A 3KP8A 4KDUA 4WBJA 2A2RA 1PD21 1O73A 2GZPA 3GRXA 2LQQA 5AN1A 1HQOA 3HKRA 3HZ4A 1LBKA 4L8EA 3E9JB 3GYKA 5IMFA 2ZNMA 3UJ1A 2R2JA 3TKRA 3O6TA 3DIEA 4JRRA 2H76A 3TKSA 2J23A 4ML6A 3RHBA 4IBPA 3E0UA 4TR0A 1B4PA 3U5RE 2MMOA 4O5RA 4ZB8A 5IO0A 5HR0A 5CYYA 4MF6A 1XZOA 4TXOB 3H93A 2LRNA 4FYBA 5DDLA 3LQ7A 3BBYA 1GL8A 1S3AA 1SKRB 3DVXA 1QMVA 4HUAA 1USBA 5CRGA 2YANA
chains in the Genus database with same CATH superfamily
2H6ZA 2QA2A 2YV7A 4TR1B 4P3YB 4KNDA 4IHUA 5AIXA 3FEUA 4GQCA 4BL7B 4F0BA 4KF9A 1ZYEA 3F63A 3LORA 3D6IA 3GV1A 1A0RP 2H6XA 4BA7A 2X4AA 4OO4A 2RLIA 2H1AA 3D0ZA 3KXOA 1GWCA 3FR6A 4ACSA 2GT6A 3KH9A 4N30A 4PTSA 2I3YA 1EEMA 2DJ2A 3KJYA 1SJ6A 2LTKA 1PN9A 4N10A 1ABAA 1Y6EA 2YP6A 5E59A 4K5RA 2PERA 3CYNA 2H73A 2OJLA 2F51A 2HNLA 4IQ1A 1AW9A 1NW2A 1TP9A 3FR9A 6GSWA 3TRPA 2PN8A 1ZGNA 1GTIA 4K7NA 4ZL8A 2P5RA 4JBBA 3TRXA 1OC3A 3KEBA 1M0UA 3F4RA 1GUMA 3M9JA 3GMFA 3GX0A 3UEMA 1R4WA 2MYGA 2IFQA 2QA1A 3H79A 2N5AA 2B3SA 1NHYA 1JLWA 1DSBA 2IIYA 3OR5A 2IL3A 1PKWA 3M1GA 4YH2A 1GSSA 4ZL7A 5DJMA 3HY2A 5D9TA 1R7HA 5ECMB 3TJGA 3UIWA 2YJHA 4NAXA 4X4JA 3CXGA 3JCML 2D2ZA 4ZBAA 5F8BA 4K5SA 4GWRA 4OFTA 2K9FA 2KOKA 6GSXA 4I8BA 3UMAA 2HXKA 4WBRD 4IGJA 2HYXA 5J9BA 4PQIA 1TJDA 1ST9A 4YKFA 4IJIA 3ZFLA 2DJ1A 3D5JA 4DVCA 1PX7A 4HJMA 4ID0A 1TRWA 4IKHA 5CNWA 1BQ7A 1PGTA 1O85A 2AJQB 3TKSE 4XRDA 4L0WA 1WJKA 4L0UA 3DEXA 3MAKA 3ME8A 1FVKA 3KD0A 4PURA 2H01A 5KEJA 3G7JA 2C3NA 1PSQA 4Z7XA 2F9SA 4ZXGA 2H0IA 1XPVA 5D93A 5CRDA 2NBSA 5H5QA 4NPBA 1X9MB 3C1RA 1ZCPA 3WD6A 3MYDA 4GQFA 5JWRB 1I9DA 1T1VA 2FHEA 2FWGA 4X0XA 1GSQA 5HFKA 1LU4A 1JZOA 2LUSA 4DSQA 1JZRA 2DKHA 5J9CA 1GLQA 4ULXA 1ZL9A 1ACVA 5JWOB 3IAM2 2VCTA 1NSWA 2ZUPA 3FYGA 3H8QA 10GSA 1Q4JA 1TKDB 3LG6A 1SJIA 2O85A 2AV4A 3DD3A 5IPGA 1SKSB 3RDWA 3LYPA 1UA5A 1GH2A 3UBLA 3IE3A 1HNBA 3KTBA 3HXSA 17GSA 4EUYA 5L71A 3ZMKA 1TI1A 1J0FA 2BJXA 1Z6NA 1TRSA 3LW9A 3G7IA 4AJ7A 1QGVA 2KUCA 4XS6A 2GSTA 3ZITA 2B6MA 2OBIA 1B8XA 2L6CA 3DYRA 3IDVA 4AJ6A 1GSEA 1MTCA 3GH9A 3W6GA 3Q19A 2IN3A 5G5FA 3S9FA 4N0ZA 2FA8A 2R6KA 3GTUB 1K0CA 3IHGA 6GSUA 4EF0A 2LNSA 4DSSA 4KDXA 2YZHA 2QSIA 3KGKA 4K2DA 3IAS2 2O89A 4EVMA 1GP1A 3FKFA 2X49A 1XXUA 2X8HA 2JZTA 2VOCA 3EYTA 3EURA 1O7UA 4MH3A 2EC4A 1PQNA 1GRXA 4ECCA 2AYTA 2WB9A 4K7IA 3TCOA 1F37A 1GSYA 4K8MA 1SK0A 3G7YA 3IR4A 4KCEA 5A5KA 3M8NA 2GVPA 5IO2A 3F6FA 1XVWA 2WCIA 2CX4A 1H75A 4QQ7A 3CTGA 2WGRA 2H0GA 2VLUA 4YAVA 1RW1A 3Q74A 2FCHA 1IYIA 2B5XA 4N0VA 3PPUA 2C1YA 4D73A 5D9VA 1AIUA 4FH8A 2B1KA 1MD4A 5CREA 1JZWA 3ZIVA 1BX9A 4XHMA 1TK5B 1M2AA 3CRUA 4ZL9A 2A2PA 3L0HA 4WF5A 1T7PB 3O76A 4OCFA 3CMIA 3J7Yk 2FWFA 3TB2A 1AAZA 3F8UA 1YEXA 2X99A 3VI5A 4Q5QA 1FB6A 2H6YA 2PUKC 3QDNA 1YQ1A 4EIQA 2PWJA 1T8EB 3FZ5A 5HFIA 1Z6MA 4EDYA 2CAIA 3BCKA 2H1BA 2H19A 2P5QA 2KHPA 4GCIA 2K6VA 4XS1A 5C00A 4MJEA 2VAFA 1GUKA 5CRHA 1YJ6A 1KBNA 3RAZA 4AJ8A 1MD3A 2RUEA 4F0CA 1OAZA 3ZVJA 3TKQA 2GZZA 3H1NA 4O7HA 2YOIA 4CDOA 3VWUA 5G1KA 3ME7A 1H4OA 1M3JA 4PUAA 1YY7A 5ECIB 1A8YA 1N8JA 2TIRA 3EC3A 4TN8A 3Q18A 1AQXA 4OCEA 2IPAA 1Y25A 3QCPA 1J08A 4CHSA 1MEKA 5EY6A 2C0EA 4JZQA 1XW6A 3GH6A 4I6XA 3P90A 2CZ3A 2XPDA 3F3RA 2H72A 1BYEA 1NM3A 1F9MA 3I9V2 2N5BA 5B7CA 3UL3A 1ON4A 1SD8A 4O32A 1Z5YE 1ERVA 2M80A 4IQAA 1RQMA 5H5RA 4Q5FA 1M9BA 1XWKA 1DBYA 1C72A 2VCVA 3US3A 5IOWA 2JSZA 3L4NA 4V2MA 5ECOB 2WRTA 3HA9A 2AAWA 3RBTA 2R3XA 3G9BA 4KB3A 4NHZA 3UBKA 2O8VB 5LCZA 1GSDA 4NV5A 1MDIA 2NTOA 5FWGA 3MSZA 2V1MA 1BEDA 3VPTA 2R5GA 2JSYA 1HYUA 6GSSA 4MMMA 1EWXA 2A2SA 3VK9A 5A4UA 3ZIJA 1GULA 1GTBA 2XBQA 1OC9B 4GSSA 2WULA 3WT1A 2E2GA 2ON5A 1YKAA 3DVWA 4ISDA 2HZEA 1HD2A 1K3YA 2HZFA 1URMA 1M9AA 1LJRA 3IOSA 3BJ5A 4EC0A 3GKXA 4POBA 3CBUA 2LJRA 4EIPA 2DKIA 4K0NA 3IBHA 1U6TA 1JZDA 3KH7A 3IA1A 4HU7A 1F3AA 4LLRA 4JR6A 4E8EA 4QL9A 1SKWB 1MDJA 5IMAA 2L57A 5KN1A 2KLXA 1G7OA 3FHKA 1WOUA 3FZ4A 2XHFA 3P8WA 3L9SA 3HHVA 4G9HA 2IWTA 4PNFA 2OACA 4IP1A 3EU4A 1O8XA 5BRTA 2H71A 4HZ4A 1EV4A 1X0RA 1K0NA 2VUPA 5IMCA 4DEJA 4HU9A 4FIWA 3ZYWA 1AQVA 3HVNA 3GHAA 5B8AA 4HOJA 5CRWA 1YF1A 3D4MA 2VD1A 1QQ2A 5IPHA 2BMXA 3BD2A 3GKNA 4OD7A 5JCWA 2L5LA 2V41A 3I6AA 12GSA 2WJUA 3MDKA 5GSSA 2VCXA 2O87A 1QUWA 2GTUA 2H70A 4XS4B 3I69A 1BAYA 2H1DA 2HI7A 1PL2A 1BJXA 3ZVJD 4KSMA 4FQUA 2QKEA 2IMDA 4KDYA 1X5EA 4MZCA 4G2EA 1V2AA 5DQSA 2DJJA 5F06A 1SD9A 3R2QA 2J9HA 2MMAA 2OADA 3C71A 3WGDA 3WGXA 3F4SA 5DQYA 3C7MA 2JACA 2CVDA 1V40A 2H66A 3PR8A 4K6XA 1GNEA 2B7KA 3D4TA 4HDEA 2HFDA 5HQPA 4KA0A 1B48A 4PX1A 1B4QA 3UOMA 2PVQA 1QK8A 2RM6A 1S3RA 2GSSA 4KX4A 1GSFA 1X9WB 2VCQA 4TXVA 3NOFA 1IYHA 3GFKA 2TRXA 4JR4A 4BIKA 4Z2TA 5ECRB 4MNNA 3ED3A 2MZCA 3EE2A 6GSYA 4ZB6A 1XFLA 2ON7A 2VL2C 2XBIA 5HR3A 2DIZA 5F0GA 5KOXA 2V32A 5J41A 4GRFA 5ECSA 3LXTA 1XCCA 2R4VA 2CV4A 3O3TA 4FYUA 5EPFA 5B6MA 5KN0A 5G2ZA 2C80A 5ECQB 3P7XA 3TKSC 3M9KA 3GL5A 2VD0A 1TXXA 2X64A 5DVBA 1X5DA 2LRTA 1M2DA 1FHEA 2JZRA 4G0LA 6GSTA 6GSVA 4XCSA 1HNCA 3ZZXA 3SBCA 1TW9A 3EINA 5ECPB 3GX8A 4MPGA 5KN2A 2M46A 2R0GA 1Z9HA 4MF5A 2A4VA 4N11A 5ECKB 3GKMA 5HR2A 1B9XC 3ZLPA 3EMXA 1TRUA 3K8NA 3RPNA 1YDKA 3LSZA 5IOXA 20GSA 5B8BA 4KAEA 1EGOA 4PQ1A 5GAPD 2JU5A 3BCIA 1V58A 3CRTA 1EOGA 2IMFA 3HJPA 2GGTA 2LV3A 2LNTA 2C0GA 5GAND 1PFOA 1ILOA 1UC7A 2Z9SA 4V1Ap 4GLTA 3F6DA 2OA7A 4ZB9A 3PH9A 4PGTA 2FGXA 4GF0A 2KP2A 2NPBA 2YJ7A 4ML1A 4HI7A 4E8HA 5ECHB 1SL1B 2NVLA 3QAGA 2WS2A 1VF2A 5DBQA 3A5IA 8GSSA 3M0FA 4I97A 1FOVA 1QXHA 2LSTA 2YNXA 1FW1A 4MDCA 2N5FA 4OO5A 2WDUA 3PINA 1GTAA 3H4KA 5A4WA 2YWNA 3APSA 1SK2A 1WIKA 3IK7A 4HSCX 1BG5A 3TDGA 1U87A 2XPEA 2A4HA 4HQSA 1UN2A 2PU9C 3F4TA 4FO5A 1VF3A 5GZZB 2C4JA 4AGSA 5ABRA 2MMZA 3HD5A 1YEPA 1YKCA 1NHOA 2YZUA 5ELAA 5JWQB 5ENUA 1ZYPA 4RI6A 1AUCA 3HJMA 1SJZA 3GSTA 3C1SA 4IP6A 4MK3A 1VRSD 1A23A 5DALB 3APQA 1T4YA 4RQXA 4YQUA 3C73A 4IN0A 2CQ9A 1G0TA 1V98A 3UVHA 13GSA 1F6MC 3IXRA 2VL9A 3N9JA 3QAVA 2EIQA 4KH7A 3WGEA 3SWLA 2LEGA 2L4QA 2GT5A 4GXZA 4POKA 1XWAA 4O92A 1XIYA 2MBTA 4XRAA 2VLVA 3IC8A 4MA9A 2JZSA 2EIRA 1Q98A 2H1GA 2KP1A 1OC9A 4TKYA 4NWYA 1ERWA 1F2EA 3LYKA 2ES7A 5IIZA 4G19A 1V9WA 3IRAA 4Q5NA 2K18A 3F3QA 3HVXA 5ECLB 4POLA 2VM1A 4TXOA 1WWJA 2MMNA 3QPMA 2L5OA 4OFMA 4BVXB 1T00A 4AF2A 1F3BA 2JADA 1S3CA 2GDRA 3ZMLA 3AY8A 4Z2UA 2VM2A 1KNGA 3VPQA 1A0FA 2R0PA 5H5SA 4TR1A 3QD9A 2H8LA 2PGTA 2LJKA 1EEJA 4BL7A 2GQMA 4MPFA 2UZ8A 5HR1A 3A2VA 4IJ3A 1ZMAA 2C3QA 4DSSB 2DJ0A 2I1UA 5J4UA 2VLTA 1XOBA 2H75A 2FD3A 2O7KA 1G6WA 3ERGA 5COHA 2YCDA 4K9ZA 3FRCA 5KOWA 4WXTA 4PXOA 1EGRA 1TTZA 4V1Ag 4WR4A 3FZAA 2ZCTA 4IW9A 2G0FA 4EO3A 5A4VA 4XS4A 2IMEA 3LWAA 2CZ2A 2HSMA 4H86A 1A2JA 1KEBA 1PRXA 4JU5A 3TRQA 5JCUA 1OE7A 1HNAA 2FLSA 3DKSA 2VL3A 4V2LA 2LQOA 4TOPA 1YF0A 1K0BA 1VF4A 2C0DA 3HYPA 1M7TA 4EKZA 3LFLA 1SENA 1JLVA 3CSHA 3ZL5A 3MIXA 5ID2B 1O8WA 2HT9A 2VCWA 5J3RA 22GSA 3VWVA 2CVKA 3DGQA 2L6DA 1Z7RA 1SL2B 1VGLA 2E2MA 5G30A 3HDCA 4X1UA 3R3EA 2PMTA 2CAQA 1TI3A 2DMLA 3ZRDA 5J5NA 1WRYA 2GQLA 3DWVA 3F9UA 2RIIA 1THXA 3EPTA 5DAKB 4HEA2 1W4VA 3GKKA 4L5LA 2C0FA 2DJ3A 2C3TA 3VLNA 4TRXA 2FA4A 5D9WA 4KCAA 3KM6A 3I43A 1XWCA 3GUSA 1TK0B 4G10A 1CQGA 3F0IA 2HRNA 4YKGA 4ZILA 3CTFA 1T4ZA 3TOUA 2WFCA 2I81A 2YPMA 4WKWA 3QOUA 1JFUA 2LKUA 1I5GA 3IK9A 3HVVA 4DSRA 3IPZA 3RHCA 1UVZA 4KGIA 4WEYA 3KIJA 4O5QA 4WF4A 1M99A 1ZYNA 1G6YA 2FNOA 3GA4A 4MZWA 4I2TA 5DCHA 1FG4A 1EP8A 3HZ8A 1R26A 4JE1A 1J9BA 4J56E 5G31A 4LL4B 3KTLA 2CX3A 3EWLA 4NHWA 1Z3EA 5FHIA 2E7PA 4YQVA 1OYJA 2YN1A 2F8AA 2H0HA 5DJLA 2GS3A 4BVYB 2EIOA 3L9UA 4ZBDA 3TUEA 3Q6OA 3WT2A 3FR3A 2JL4A 18GSA 2B1LA 4I5QA 1FB0A 4ECBA 3DMLA 1FO5A 1GSUA 3C8EA 3TJBA 3A2XA 5IMZA 4FYCA 1B9YC 4OWYA 4MJBA 2B5YA 3GNJA 2YWMA 1ML6A 1OKDA 4MCUA 5LNKe 1AXDA 3TJFA 5D9XA 2MBSA 4J57E 4WR5A 2HE3A 5C04A 2DC5A 4F82A 3FZ9A 3TOTA 3NIVA 2L59A 5CAXA 5G5EA 3CQFA 5F05A 1R5PA 4XTSA 3CSJA 3IHQA 3VFIA 4MJAA 4EE0A 1OVNA 2CVBA 1SYRA 2GSRA 2CA8A 1FOHA 1R5AA 3VWWA 2PPTA 4HJ2A 2HZEB 14GSA 1T3BA 1K0DA 2FUG2 3GTUA 2PVOC 4HQZA 5EVOA 4HZ2A 1OE8A 2AHEA 2GSQA 4X43A 4O5UA 2V2GA 1PX6A 1XWGA 2I4AA 3LJRA 3GL3A 1PA3A 1XBSA 3ZTLA 2GLRA 4IELA 3D21A 4ICYA 3IC4A 5FT3A 3CSIA 1DUGA 1S3DA 2IMKA 5G1LA 4JEDA 5GSTA 3IV4A 1WPIA 3GIXA 5HFGA 5AISA 1WE0A 4ZBBA 2YV9A 4TVEA 2PBJA 3FY7A 4K1FA 3J7Yb 4MLYA 2OBKA 4KE3A 3M3MA 3VI7A 1SL0B 2FY6A 1ERUA 4ECIA 1E6BA 2LJAA 4Q5RA 4XIHA 5DALA 1N2AA 4PQHA 2R37A 2VCZA 4Z2RA 3EVIA 1THOA 2BTOT 3WYWA 3DXBA 5D8IA 4CY8A 1A2LA 2H30A 5KN3A 3LGCA 5JCGA 4F9ZA 4K0GA 4LMWA 3RPPA 1ZYQB 1YZXA 1A24A 1K0OA 4GSTA 1E2YA 4NV2A 3V1WA 3HJOA 1X9SB 3DRNA 2V6KA 3VWXA 1TDIA 5AGYA 3HVSA 3UVTA 3E3EA 2RUFA 3N5OA 2K8VA 3TKPA 1PN0A 1ERTA 2G2QA 1ZZYA 1U88A 1K0AA 2IFQB 2GZYA 3ZREA 1K3LA 19GSA 1FAAA 3QFBC 4F2IA 1EOHA 4IVFA 3KCMA 2DLXA 4GTUA 5CP1A 2B5EA 2HRAA 4BVXA 1EV9A 1V57A 5B6NA 3U6VA 3MWHA 3QR6A 4EL1A 3TJJA 4KSOA 2HRKA 3GN3A 1XW5A 3VURA 2DIYA 1PL1A 1XW9A 2YWIA 1A8LA 2OE0A 1M2BA 1JHBA 1U3IA 4WETA 1U3AA 3A2WA 2YWOA 4V2NA 2L4CA 4A5PA 3BOAA 2OE3A 3GURA 2HLSA 1SK1A 4J2FA 5BMUA 1O6JA 2XC2A 1TU8A 2LS5A 3KZQA 4USSA 4KUNA 5ECNB 1GNWA 2C8UA 3FW2A 4POMA 2M72A 1AQWA 2IJYA 3P2AA 5CO3A 2DSAA 4TW5A 5IM9A 1XWBA 2X8GA 1VF1A 2F8FA 2HSYA 3KMNA 1PMTA 2GQKA 2R0CA 1MDKA 3W8JA 2H74A 1TOFA 5AIVA 5D96A 1TRVA 1TU7A 1PKZA 1TK8B 2ALBA 3L78A 5E4WA 3TGZA 1G7EA 3UARA 2QC7A 1M3IA 4BPYA 4ECJA 3A3TA 1W89A 3QAWA 5ID2A 1Z7PA 4MP4A 2OKAA 1ZOFA 4QL7A 1O81A 1WMJA 2QGVA 3KP9A 4L5OA 1CQHA 4BWSA 3GSSA 2B7JA 1OC8A 16GSA 2HSHA 3UAPA 1A2MA 2HRFA 4HS1A 2WZ9A 5DAKA 3ERFA 5IQYA 5INYA 3QMXA 3LEFA 2FWHA 1KTEA 5DCGA 4CY6A 1XVQA 3APOA 4G0KA 1K0MA 9GSSA 3FK8A 4CW9A 1DE1A 1EZKA 2P31A 3LXZA 1SU9A 4OFNA 4EDZA 4RI7A 3QFAC 3ISOA 4MZBA 2IMIA 4PUFC 4RUVA 5D73A 1XOAA 4IS0A 4YQMA 2REMA 1WP0A 3FMWA 3MNGA 5F07A 3KMOA 2FWEA 4NMUA 4MF7A 3ERWA 5EL8A 2LRCA 3D22A 5LD0A 1GLPA 2DJKA 4GSNA 2CT6A 4F03A 4BWQA 1SYXA 4MABA 1EP7A 2AB6A 4TR4A 1GUHA 4OMVA 3ZFBA 3PGTA 3EMPA 4YAPA 2V6OA 2AUVA 5IMVA 1FVJA 4PNGA 3TJKA 2X8CA 4K2XA 2OE1A 1K3OA 5IMDA 2TRCP 7GSSA 2VIMA 4NXIA 1X5CA 3W8SA 2DMMA 4RQRA 2NDOA 4BVYA 4TR3A 4LA1A 1GTUA 3A5WA 3L9VA 2K8SA 1OKTA 2DBCA 3NZNA 1AC1A 4K7OA 5ELGA 3HCZA 4ZIJA 3EU3A 2P0GA 1QFNA 2E0QA 4ILFA 4KW6A 4EXJA 4I2UA 2F3MA 4MJCA 4D73B 4LL1B 4MH2A 2RM5A 2VL2A 2I9HA 11GSA 4LMVA 1RK4A 2VO4A 1DE2A 3KP8A 4KDUA 4WBJA 2A2RA 1PD21 1O73A 2GZPA 3GRXA 2LQQA 5AN1A 1HQOA 3HKRA 3HZ4A 1LBKA 4L8EA 3E9JB 3GYKA 5IMFA 2ZNMA 4G0IA 3UJ1A 2R2JA 3TKRA 3O6TA 3DIEA 4JRRA 2H76A 3TKSA 2J23A 4ML6A 3RHBA 4IBPA 3E0UA 4TR0A 1B4PA 1XG8A 3U5RE 2MMOA 4O5RA 4ZB8A 5IO0A 5HR0A 5CYYA 4MF6A 1XZOA 4TXOB 3H93A 2LRNA 4FYBA 5DDLA 3LQ7A 3BBYA 1GL8A 1S3AA 1SKRB 3DVXA 1QMVA 4HUAA 1USBA 5CRGA 2YANA
chains in the Genus database with same CATH topology
2H6ZA 2QA2A 2YV7A 4TR1B 4P3YB 4KNDA 4IHUA 5AIXA 3FEUA 4GQCA 4BL7B 4F0BA 4KF9A 1ZYEA 3F63A 3LORA 3D6IA 3GV1A 1A0RP 2H6XA 4BA7A 2X4AA 4OO4A 2RLIA 2H1AA 3D0ZA 3KXOA 1GWCA 3FR6A 4ACSA 2GT6A 3KH9A 4N30A 4PTSA 2I3YA 1EEMA 2DJ2A 3KJYA 1SJ6A 2LTKA 1PN9A 4N10A 1ABAA 1Y6EA 2YP6A 5E59A 4K5RA 2PERA 3CYNA 2H73A 2OJLA 2F51A 2HNLA 4IQ1A 1AW9A 1NW2A 1TP9A 3FR9A 6GSWA 3TRPA 2PN8A 1ZGNA 1GTIA 4K7NA 4ZL8A 2P5RA 4JBBA 3TRXA 1OC3A 3KEBA 1M0UA 3F4RA 1GUMA 3M9JA 3GMFA 3GX0A 3UEMA 1R4WA 2MYGA 2IFQA 2QA1A 3H79A 2N5AA 2B3SA 1NHYA 1JLWA 1DSBA 2IIYA 3OR5A 2IL3A 1PKWA 3M1GA 4YH2A 1GSSA 4ZL7A 5DJMA 3HY2A 5D9TA 1R7HA 5ECMB 3TJGA 3UIWA 2YJHA 4NAXA 4X4JA 3CXGA 3JCML 2D2ZA 4ZBAA 5F8BA 4K5SA 4GWRA 4OFTA 2K9FA 2KOKA 6GSXA 4I8BA 3UMAA 2HXKA 4WBRD 4IGJA 2HYXA 5J9BA 4PQIA 1TJDA 1ST9A 4YKFA 4IJIA 3ZFLA 2DJ1A 3D5JA 4DVCA 1PX7A 4HJMA 4ID0A 1TRWA 4IKHA 5CNWA 1BQ7A 1PGTA 1O85A 2AJQB 3TKSE 4XRDA 4L0WA 1WJKA 4L0UA 3DEXA 3MAKA 3ME8A 1FVKA 3KD0A 4PURA 2H01A 5KEJA 3G7JA 2C3NA 1PSQA 4Z7XA 2F9SA 4ZXGA 2H0IA 1XPVA 5D93A 5CRDA 2NBSA 5H5QA 4NPBA 1X9MB 3C1RA 1ZCPA 3WD6A 3MYDA 4GQFA 5JWRB 1I9DA 1T1VA 2FHEA 2FWGA 4X0XA 1GSQA 5HFKA 1LU4A 1JZOA 2LUSA 4DSQA 1JZRA 2DKHA 5J9CA 1GLQA 4ULXA 1ZL9A 1ACVA 5JWOB 3IAM2 2VCTA 1NSWA 2ZUPA 3FYGA 3H8QA 10GSA 1Q4JA 1TKDB 3LG6A 1SJIA 2O85A 2AV4A 3DD3A 5IPGA 1SKSB 3RDWA 3LYPA 1UA5A 1GH2A 3UBLA 3IE3A 1HNBA 3KTBA 3HXSA 17GSA 4EUYA 5L71A 3ZMKA 1TI1A 1J0FA 2BJXA 1Z6NA 1TRSA 3LW9A 3G7IA 4AJ7A 1QGVA 2KUCA 4XS6A 2GSTA 3ZITA 2B6MA 2OBIA 1B8XA 2L6CA 3DYRA 3IDVA 4AJ6A 1GSEA 1MTCA 3GH9A 3W6GA 3Q19A 2IN3A 5G5FA 3S9FA 4N0ZA 2FA8A 2R6KA 3GTUB 1K0CA 3IHGA 6GSUA 4EF0A 2LNSA 4DSSA 4KDXA 2YZHA 2QSIA 3KGKA 4K2DA 3IAS2 2O89A 4EVMA 1GP1A 3FKFA 2X49A 1XXUA 2X8HA 2JZTA 2VOCA 3EYTA 3EURA 1O7UA 4MH3A 2EC4A 1PQNA 1GRXA 4ECCA 2AYTA 2WB9A 4K7IA 3TCOA 1F37A 1GSYA 4K8MA 1SK0A 3G7YA 3IR4A 4KCEA 5A5KA 3M8NA 2GVPA 5IO2A 3F6FA 1XVWA 2WCIA 2CX4A 1H75A 4QQ7A 3CTGA 2WGRA 2H0GA 2VLUA 4YAVA 1RW1A 3Q74A 2FCHA 1IYIA 2B5XA 4N0VA 3PPUA 2C1YA 4D73A 5D9VA 1AIUA 4FH8A 2B1KA 1MD4A 5CREA 1JZWA 3ZIVA 1BX9A 4XHMA 1TK5B 1M2AA 3CRUA 4ZL9A 2A2PA 3L0HA 4WF5A 1T7PB 3O76A 4OCFA 3CMIA 3J7Yk 2FWFA 3TB2A 1AAZA 3F8UA 1YEXA 2X99A 3VI5A 4Q5QA 1FB6A 2H6YA 2PUKC 3QDNA 1YQ1A 4EIQA 2PWJA 1T8EB 3FZ5A 5HFIA 1Z6MA 4EDYA 2CAIA 3BCKA 2H1BA 2H19A 2P5QA 2KHPA 4GCIA 2K6VA 4XS1A 5C00A 4MJEA 2VAFA 1GUKA 5CRHA 1YJ6A 1KBNA 3RAZA 4AJ8A 1MD3A 2RUEA 4F0CA 1OAZA 3ZVJA 3TKQA 2GZZA 3H1NA 4O7HA 2YOIA 4CDOA 3VWUA 5G1KA 3ME7A 1H4OA 4PUAA 1YY7A 5ECIB 1A8YA 1N8JA 2TIRA 3EC3A 4TN8A 3Q18A 1AQXA 4OCEA 2IPAA 1Y25A 3QCPA 1J08A 4CHSA 1MEKA 5EY6A 2C0EA 4JZQA 1XW6A 3GH6A 4I6XA 3P90A 2CZ3A 2XPDA 3F3RA 2H72A 1BYEA 1NM3A 1F9MA 3I9V2 2N5BA 5B7CA 3UL3A 1ON4A 1SD8A 4O32A 1Z5YE 1ERVA 2M80A 4IQAA 1RQMA 5H5RA 4Q5FA 1M9BA 1XWKA 1DBYA 1C72A 2VCVA 3US3A 5IOWA 2JSZA 3L4NA 4V2MA 5ECOB 2WRTA 3HA9A 2AAWA 3RBTA 2R3XA 3G9BA 4KB3A 4NHZA 3UBKA 2O8VB 5LCZA 1GSDA 4NV5A 1MDIA 2NTOA 5FWGA 3MSZA 2V1MA 1BEDA 3VPTA 2R5GA 2JSYA 1HYUA 6GSSA 4MMMA 1EWXA 2A2SA 3VK9A 5A4UA 3ZIJA 1GULA 1GTBA 2XBQA 1OC9B 4GSSA 2WULA 3WT1A 2E2GA 2ON5A 1YKAA 3DVWA 4ISDA 2HZEA 1HD2A 1K3YA 2HZFA 1URMA 1M9AA 1LJRA 3IOSA 3BJ5A 4EC0A 3GKXA 4POBA 3CBUA 2LJRA 4EIPA 2DKIA 4K0NA 3IBHA 1U6TA 1JZDA 3KH7A 3IA1A 4HU7A 1F3AA 4LLRA 4JR6A 4E8EA 4QL9A 1SKWB 1MDJA 5IMAA 2L57A 5KN1A 2KLXA 1G7OA 3FHKA 1WOUA 3FZ4A 2XHFA 3P8WA 3L9SA 3HHVA 4G9HA 2IWTA 4PNFA 2OACA 4IP1A 3EU4A 1O8XA 5BRTA 2H71A 4HZ4A 1EV4A 1X0RA 1K0NA 2VUPA 5IMCA 4DEJA 4HU9A 4FIWA 3ZYWA 1AQVA 3GHAA 5B8AA 4HOJA 5CRWA 1YF1A 3D4MA 2VD1A 1QQ2A 5IPHA 2BMXA 3BD2A 3GKNA 4OD7A 5JCWA 2L5LA 2V41A 3I6AA 12GSA 2WJUA 3MDKA 5GSSA 2VCXA 2O87A 1QUWA 2GTUA 2H70A 4XS4B 3I69A 1BAYA 2H1DA 2HI7A 1PL2A 1BJXA 3ZVJD 4KSMA 4FQUA 2QKEA 2IMDA 4KDYA 1X5EA 4MZCA 4G2EA 1V2AA 5DQSA 2DJJA 5F06A 1SD9A 3R2QA 2J9HA 2MMAA 2OADA 3C71A 3WGDA 3WGXA 3F4SA 5DQYA 3C7MA 2JACA 2CVDA 1V40A 2H66A 3PR8A 4K6XA 1GNEA 2B7KA 3D4TA 4HDEA 2HFDA 5HQPA 4KA0A 1B48A 4PX1A 1B4QA 3UOMA 2PVQA 1QK8A 2RM6A 2GSSA 4KX4A 1GSFA 1X9WB 2VCQA 4TXVA 3NOFA 1IYHA 3GFKA 2TRXA 4JR4A 4Z2TA 5ECRB 4MNNA 3ED3A 2MZCA 3EE2A 6GSYA 4ZB6A 1XFLA 2ON7A 2VL2C 2XBIA 5HR3A 2DIZA 5F0GA 5KOXA 2V32A 5J41A 4GRFA 5ECSA 3LXTA 1XCCA 2R4VA 2CV4A 3O3TA 4FYUA 5EPFA 5B6MA 5KN0A 5G2ZA 2C80A 5ECQB 3P7XA 3TKSC 3M9KA 3GL5A 2VD0A 1TXXA 2X64A 5DVBA 1X5DA 2LRTA 1M2DA 1FHEA 2JZRA 4G0LA 6GSTA 6GSVA 4XCSA 1HNCA 3ZZXA 3SBCA 1TW9A 3EINA 5ECPB 3GX8A 4MPGA 5KN2A 2M46A 2R0GA 1Z9HA 4MF5A 2A4VA 4N11A 5ECKB 3GKMA 5HR2A 1B9XC 3ZLPA 3EMXA 1TRUA 3K8NA 3RPNA 1YDKA 3LSZA 5IOXA 20GSA 5B8BA 4KAEA 1EGOA 4PQ1A 5GAPD 2JU5A 3BCIA 1V58A 3CRTA 1EOGA 2IMFA 3HJPA 2GGTA 2LV3A 2LNTA 2C0GA 5GAND 1ILOA 1UC7A 2Z9SA 4V1Ap 4GLTA 3F6DA 2OA7A 4ZB9A 3PH9A 4PGTA 2FGXA 4GF0A 2KP2A 2NPBA 2YJ7A 4ML1A 4HI7A 4E8HA 5ECHB 1SL1B 2NVLA 3QAGA 2WS2A 1VF2A 5DBQA 3A5IA 8GSSA 3M0FA 4I97A 1FOVA 1QXHA 2LSTA 2YNXA 1FW1A 4MDCA 2N5FA 4OO5A 2WDUA 3PINA 1GTAA 3H4KA 5A4WA 2YWNA 3APSA 1SK2A 1WIKA 3IK7A 1BG5A 3TDGA 1U87A 2XPEA 2A4HA 4HQSA 1UN2A 2PU9C 3F4TA 4FO5A 1VF3A 5GZZB 2C4JA 4AGSA 5ABRA 2MMZA 3HD5A 1YEPA 1YKCA 1NHOA 2YZUA 5ELAA 5JWQB 5ENUA 1ZYPA 4RI6A 1AUCA 3HJMA 1SJZA 3GSTA 3C1SA 4IP6A 4MK3A 1VRSD 1A23A 5DALB 3APQA 1T4YA 4RQXA 4YQUA 3C73A 4IN0A 2CQ9A 1G0TA 1V98A 3UVHA 13GSA 1F6MC 3IXRA 2VL9A 3N9JA 3QAVA 2EIQA 4KH7A 3WGEA 3SWLA 2LEGA 2L4QA 2GT5A 4GXZA 4POKA 1XWAA 4O92A 1XIYA 2MBTA 4XRAA 2VLVA 3IC8A 4MA9A 2JZSA 2EIRA 1Q98A 2H1GA 2KP1A 1OC9A 4TKYA 4NWYA 1ERWA 1F2EA 3LYKA 2ES7A 5IIZA 4G19A 1V9WA 3IRAA 4Q5NA 2K18A 3F3QA 3HVXA 5ECLB 4POLA 2VM1A 4TXOA 1WWJA 2MMNA 3QPMA 2L5OA 4OFMA 4BVXB 1T00A 4AF2A 1F3BA 2JADA 1S3CA 2GDRA 3ZMLA 3AY8A 4Z2UA 2VM2A 1KNGA 3VPQA 1A0FA 2R0PA 5H5SA 4TR1A 3QD9A 2H8LA 2PGTA 2LJKA 1EEJA 4BL7A 2GQMA 4MPFA 2UZ8A 5HR1A 3A2VA 4IJ3A 1ZMAA 2C3QA 4DSSB 2DJ0A 2I1UA 5J4UA 2VLTA 1XOBA 2H75A 2FD3A 2O7KA 1G6WA 3ERGA 5COHA 2YCDA 4K9ZA 3FRCA 5KOWA 4WXTA 4PXOA 1EGRA 1TTZA 4V1Ag 4WR4A 3FZAA 2ZCTA 4IW9A 2G0FA 4EO3A 5A4VA 4XS4A 2IMEA 3LWAA 2CZ2A 2HSMA 4H86A 1A2JA 1KEBA 1PRXA 4JU5A 3TRQA 5JCUA 1OE7A 1HNAA 2FLSA 3DKSA 2VL3A 4V2LA 2LQOA 4TOPA 1YF0A 1K0BA 1VF4A 2C0DA 3HYPA 1M7TA 4EKZA 3LFLA 1SENA 1JLVA 3CSHA 3ZL5A 3MIXA 5ID2B 1O8WA 2HT9A 2VCWA 5J3RA 22GSA 3VWVA 2CVKA 3DGQA 2L6DA 1Z7RA 1SL2B 1VGLA 2E2MA 5G30A 3HDCA 4X1UA 3R3EA 2PMTA 2CAQA 1TI3A 2DMLA 3ZRDA 5J5NA 1WRYA 2GQLA 3DWVA 3F9UA 2RIIA 1THXA 3EPTA 5DAKB 4HEA2 1W4VA 3GKKA 4L5LA 2C0FA 2DJ3A 2C3TA 3VLNA 4TRXA 2FA4A 5D9WA 4KCAA 3KM6A 3I43A 1XWCA 3GUSA 1TK0B 4G10A 1CQGA 3F0IA 2HRNA 4YKGA 4ZILA 3CTFA 1T4ZA 3TOUA 2WFCA 2I81A 2YPMA 4WKWA 3QOUA 1JFUA 2LKUA 1I5GA 3IK9A 3HVVA 4DSRA 3IPZA 3RHCA 1UVZA 4KGIA 4WEYA 3KIJA 4O5QA 4WF4A 1M99A 1ZYNA 1G6YA 2FNOA 3GA4A 4MZWA 4I2TA 5DCHA 1FG4A 1EP8A 3HZ8A 1R26A 4JE1A 1J9BA 4J56E 5G31A 4LL4B 3KTLA 2CX3A 3EWLA 4NHWA 1Z3EA 5FHIA 2E7PA 4YQVA 1OYJA 2YN1A 2F8AA 2H0HA 5DJLA 2GS3A 4BVYB 2EIOA 3L9UA 4ZBDA 3TUEA 3Q6OA 3WT2A 3FR3A 2JL4A 18GSA 2B1LA 4I5QA 1FB0A 4ECBA 3DMLA 1FO5A 1GSUA 3C8EA 3TJBA 3A2XA 5IMZA 4FYCA 1B9YC 4OWYA 4MJBA 2B5YA 3GNJA 2YWMA 1ML6A 1OKDA 4MCUA 5LNKe 1AXDA 3TJFA 5D9XA 2MBSA 4J57E 4WR5A 2HE3A 5C04A 2DC5A 4F82A 3FZ9A 3TOTA 3NIVA 2L59A 5CAXA 5G5EA 5F05A 1R5PA 4XTSA 3CSJA 3IHQA 3VFIA 4MJAA 4EE0A 1OVNA 2CVBA 1SYRA 2GSRA 2CA8A 1FOHA 1R5AA 3VWWA 2PPTA 4HJ2A 2HZEB 14GSA 1T3BA 1K0DA 2FUG2 3GTUA 2PVOC 4HQZA 5EVOA 4HZ2A 1OE8A 2AHEA 2GSQA 4X43A 4O5UA 2V2GA 1PX6A 1XWGA 2I4AA 3LJRA 3GL3A 1PA3A 1XBSA 3ZTLA 2GLRA 4IELA 3D21A 4ICYA 3IC4A 5FT3A 3CSIA 1DUGA 1S3DA 2IMKA 5G1LA 4JEDA 5GSTA 3IV4A 1WPIA 3GIXA 5HFGA 5AISA 1WE0A 4ZBBA 2YV9A 4TVEA 2PBJA 3FY7A 4K1FA 3J7Yb 4MLYA 2OBKA 4KE3A 3M3MA 3VI7A 1SL0B 2FY6A 1ERUA 4ECIA 1E6BA 2LJAA 4Q5RA 4XIHA 5DALA 1N2AA 4PQHA 2R37A 2VCZA 4Z2RA 3EVIA 1THOA 2BTOT 3WYWA 3DXBA 5D8IA 4CY8A 1A2LA 2H30A 5KN3A 3LGCA 5JCGA 4F9ZA 4K0GA 4LMWA 3RPPA 1ZYQB 1YZXA 1A24A 1K0OA 4GSTA 1E2YA 4NV2A 3V1WA 3HJOA 1X9SB 3DRNA 2V6KA 3VWXA 1TDIA 5AGYA 3HVSA 3UVTA 3E3EA 2RUFA 3N5OA 2K8VA 3TKPA 1PN0A 1ERTA 2G2QA 1ZZYA 1U88A 1K0AA 2IFQB 2GZYA 3ZREA 1K3LA 19GSA 1FAAA 3QFBC 4F2IA 1EOHA 4IVFA 3KCMA 2DLXA 4GTUA 5CP1A 2B5EA 2HRAA 4BVXA 1EV9A 1V57A 5B6NA 3U6VA 3MWHA 3QR6A 4EL1A 3TJJA 4KSOA 2HRKA 3GN3A 1XW5A 3VURA 2DIYA 1PL1A 1XW9A 2YWIA 1A8LA 2OE0A 1M2BA 1JHBA 1U3IA 4WETA 1U3AA 3A2WA 2YWOA 4V2NA 2L4CA 4A5PA 3BOAA 2OE3A 3GURA 2HLSA 1SK1A 4J2FA 5BMUA 1O6JA 2XC2A 1TU8A 2LS5A 3KZQA 4USSA 4KUNA 5ECNB 1GNWA 2C8UA 3FW2A 4POMA 2M72A 1AQWA 2IJYA 3P2AA 5CO3A 2DSAA 4TW5A 5IM9A 1XWBA 2X8GA 1VF1A 2F8FA 2HSYA 3KMNA 1PMTA 2GQKA 2R0CA 1MDKA 3W8JA 2H74A 1TOFA 5AIVA 5D96A 1TRVA 1TU7A 1PKZA 1TK8B 2ALBA 3L78A 5E4WA 3TGZA 1G7EA 3UARA 2QC7A 4BPYA 4ECJA 3A3TA 1W89A 3QAWA 5ID2A 1Z7PA 4MP4A 2OKAA 1ZOFA 4QL7A 1O81A 1WMJA 2QGVA 3KP9A 4L5OA 1CQHA 4BWSA 3GSSA 2B7JA 1OC8A 16GSA 2HSHA 3UAPA 1A2MA 2HRFA 4HS1A 2WZ9A 5DAKA 3ERFA 5IQYA 5INYA 3QMXA 3LEFA 2FWHA 1KTEA 5DCGA 4CY6A 1XVQA 3APOA 4G0KA 1K0MA 9GSSA 3FK8A 4CW9A 1DE1A 1EZKA 2P31A 3LXZA 1SU9A 4OFNA 4EDZA 4RI7A 3QFAC 3ISOA 4MZBA 2IMIA 4PUFC 4RUVA 5D73A 1XOAA 4IS0A 4YQMA 2REMA 1WP0A 3FMWA 3MNGA 5F07A 3KMOA 2FWEA 4NMUA 4MF7A 3ERWA 5EL8A 2LRCA 3D22A 5LD0A 1GLPA 2DJKA 4GSNA 2CT6A 4F03A 4BWQA 1SYXA 4MABA 1EP7A 2AB6A 4TR4A 1GUHA 4OMVA 3ZFBA 3PGTA 3EMPA 4YAPA 2V6OA 2AUVA 5IMVA 1FVJA 4PNGA 3TJKA 2X8CA 4K2XA 2OE1A 1K3OA 5IMDA 2TRCP 7GSSA 2VIMA 4NXIA 1X5CA 3W8SA 2DMMA 4RQRA 2NDOA 4BVYA 4TR3A 4LA1A 1GTUA 3A5WA 3L9VA 2K8SA 1OKTA 2DBCA 3NZNA 1AC1A 4K7OA 5ELGA 3HCZA 4ZIJA 3EU3A 2P0GA 1QFNA 2E0QA 4ILFA 4KW6A 4EXJA 4I2UA 2F3MA 4MJCA 4D73B 4LL1B 4MH2A 2RM5A 2VL2A 2I9HA 11GSA 4LMVA 1RK4A 2VO4A 1DE2A 3KP8A 4KDUA 4WBJA 2A2RA 1PD21 1O73A 2GZPA 3GRXA 2LQQA 5AN1A 1HQOA 3HKRA 3HZ4A 1LBKA 4L8EA 3E9JB 3GYKA 5IMFA 2ZNMA 4G0IA 3UJ1A 2R2JA 3TKRA 3O6TA 3DIEA 4JRRA 2H76A 3TKSA 2J23A 4ML6A 3RHBA 4IBPA 3E0UA 4TR0A 1B4PA 3U5RE 2MMOA 4O5RA 4ZB8A 5IO0A 5HR0A 5CYYA 4MF6A 1XZOA 4TXOB 3H93A 2LRNA 4FYBA 5DDLA 3LQ7A 3BBYA 1GL8A 1S3AA 1SKRB 3DVXA 1QMVA 4HUAA 1USBA 5CRGA 2YANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6Z A;  2YV7 A;  4TR1 B;  4P3Y B;  4KND A;  4IHU A;  5AIX A;  3FEU A;  4GQC A;  4F0B A;  1ZYE A;  3F63 A;  3LOR A;  3D6I A;  3GV1 A;  1A0R P;  2H6X A;  4BA7 A;  4OO4 A;  2RLI A;  2H1A A;  3D0Z A;  3KXO A;  1GWC A;  3FR6 A;  4ACS A;  2GT6 A;  3KH9 A;  4N30 A;  2I3Y A;  1EEM A;  2DJ2 A;  3KJY A;  1SJ6 A;  2LTK A;  1PN9 A;  4N10 A;  1ABA A;  1Y6E A;  2YP6 A;  5E59 A;  2PER A;  3CYN A;  2H73 A;  2OJL A;  2F51 A;  2HNL A;  4IQ1 A;  1AW9 A;  1NW2 A;  1TP9 A;  3FR9 A;  6GSW A;  3TRP A;  2PN8 A;  1ZGN A;  1GTI A;  4K7N A;  4ZL8 A;  2P5R A;  4JBB A;  3TRX A;  1OC3 A;  3KEB A;  1M0U A;  3F4R A;  1GUM A;  3M9J A;  3GMF A;  3GX0 A;  3UEM A;  1R4W A;  2MYG A;  2IFQ A;  3H79 A;  2N5A A;  2B3S A;  1NHY A;  1JLW A;  1DSB A;  2IIY A;  3OR5 A;  2IL3 A;  1PKW A;  3M1G A;  4YH2 A;  1GSS A;  4ZL7 A;  5DJM A;  3HY2 A;  5D9T A;  1R7H A;  5ECM B;  3TJG A;  3UIW A;  2YJH A;  4NAX A;  3CXG A;  3JCM L;  2D2Z A;  4ZBA A;  5F8B A;  4GWR A;  4OFT A;  2K9F A;  2KOK A;  6GSX A;  4I8B A;  3UMA A;  2HXK A;  4WBR D;  4IGJ A;  2HYX A;  5J9B A;  4PQI A;  1TJD A;  1ST9 A;  4IJI A;  3ZFL A;  2DJ1 A;  3D5J A;  4DVC A;  1PX7 A;  4HJM A;  4ID0 A;  1TRW A;  4IKH A;  5CNW A;  1BQ7 A;  1PGT A;  1O85 A;  2AJQ B;  3TKS E;  4XRD A;  4L0W A;  1WJK A;  4L0U A;  3DEX A;  3MAK A;  3ME8 A;  1FVK A;  3KD0 A;  4PUR A;  2H01 A;  5KEJ A;  3G7J A;  2C3N A;  1PSQ A;  4Z7X A;  2F9S A;  4ZXG A;  2H0I A;  1XPV A;  5D93 A;  5CRD A;  2NBS A;  5H5Q A;  4NPB A;  1X9M B;  3C1R A;  1ZCP A;  3WD6 A;  4GQF A;  5JWR B;  1I9D A;  1T1V A;  2FHE A;  2FWG A;  4X0X A;  1GSQ A;  5HFK A;  1LU4 A;  1JZO A;  2LUS A;  4DSQ A;  1JZR A;  5J9C A;  1GLQ A;  4ULX A;  1ZL9 A;  1ACV A;  5JWO B;  3IAM 2;  2VCT A;  1NSW A;  2ZUP A;  3FYG A;  3H8Q A;  10GS A;  1Q4J A;  1TKD B;  3LG6 A;  1SJI A;  2O85 A;  2AV4 A;  3DD3 A;  5IPG A;  1SKS B;  3RDW A;  3LYP A;  1UA5 A;  1GH2 A;  3UBL A;  3IE3 A;  1HNB A;  3KTB A;  3HXS A;  17GS A;  4EUY A;  5L71 A;  3ZMK A;  1TI1 A;  1J0F A;  2BJX A;  1Z6N A;  1TRS A;  3G7I A;  4AJ7 A;  1QGV A;  2KUC A;  4XS6 A;  2GST A;  3ZIT A;  2B6M A;  2OBI A;  1B8X A;  2L6C A;  3DYR A;  3IDV A;  4AJ6 A;  1GSE A;  1MTC A;  3GH9 A;  3W6G A;  3Q19 A;  2IN3 A;  5G5F A;  3S9F A;  4N0Z A;  2FA8 A;  2R6K A;  3GTU B;  1K0C A;  6GSU A;  4EF0 A;  2LNS A;  4DSS A;  2YZH A;  4KDX A;  2QSI A;  3KGK A;  4K2D A;  3IAS 2;  2O89 A;  4EVM A;  1GP1 A;  3FKF A;  1XXU A;  2X8H A;  2JZT A;  2VOC A;  3EYT A;  3EUR A;  1O7U A;  4MH3 A;  2EC4 A;  1PQN A;  1GRX A;  4ECC A;  2AYT A;  2WB9 A;  4K7I A;  3TCO A;  1F37 A;  1GSY A;  4K8M A;  1SK0 A;  3G7Y A;  3IR4 A;  4KCE A;  5A5K A;  3M8N A;  2GVP A;  5IO2 A;  3F6F A;  1XVW A;  2WCI A;  2CX4 A;  1H75 A;  4QQ7 A;  3CTG A;  2WGR A;  2H0G A;  2VLU A;  4YAV A;  1RW1 A;  3Q74 A;  2FCH A;  1IYI A;  2B5X A;  4N0V A;  2C1Y A;  4D73 A;  5D9V A;  1AIU A;  4FH8 A;  2B1K A;  1MD4 A;  5CRE A;  1JZW A;  3ZIV A;  1BX9 A;  4XHM A;  1TK5 B;  1M2A A;  3CRU A;  4ZL9 A;  3L0H A;  4WF5 A;  1T7P B;  3O76 A;  4OCF A;  3CMI A;  3J7Y k;  2FWF A;  3TB2 A;  1AAZ A;  3F8U A;  1YEX A;  2X99 A;  3VI5 A;  4Q5Q A;  1FB6 A;  2H6Y A;  2PUK C;  3QDN A;  1YQ1 A;  2PWJ A;  1T8E B;  3FZ5 A;  5HFI A;  1Z6M A;  4EDY A;  2CAI A;  3BCK A;  2H1B A;  2H19 A;  2P5Q A;  2KHP A;  4GCI A;  2K6V A;  4XS1 A;  5C00 A;  4MJE A;  2VAF A;  1GUK A;  5CRH A;  1YJ6 A;  1KBN A;  3RAZ A;  4AJ8 A;  1MD3 A;  2RUE A;  4F0C A;  1OAZ A;  3ZVJ A;  3TKQ A;  2GZZ A;  3H1N A;  4O7H A;  2YOI A;  4CDO A;  3VWU A;  5G1K A;  3ME7 A;  1H4O A;  4PUA A;  1YY7 A;  5ECI B;  1A8Y A;  1N8J A;  2TIR A;  3EC3 A;  4TN8 A;  3Q18 A;  1AQX A;  4OCE A;  2IPA A;  1Y25 A;  3QCP A;  1J08 A;  4CHS A;  1MEK A;  5EY6 A;  2C0E A;  4JZQ A;  1XW6 A;  3GH6 A;  4I6X A;  3P90 A;  2CZ3 A;  2XPD A;  3F3R A;  2H72 A;  1BYE A;  1NM3 A;  1F9M A;  3I9V 2;  2N5B A;  5B7C A;  3UL3 A;  1ON4 A;  1SD8 A;  4O32 A;  1Z5Y E;  1ERV A;  2M80 A;  4IQA A;  1RQM A;  5H5R A;  4Q5F A;  1M9B A;  1XWK A;  1DBY A;  1C72 A;  2VCV A;  3US3 A;  5IOW A;  2JSZ A;  3L4N A;  4V2M A;  5ECO B;  2WRT A;  3HA9 A;  2AAW A;  3RBT A;  2R3X A;  3G9B A;  4KB3 A;  4NHZ A;  3UBK A;  2O8V B;  5LCZ A;  1GSD A;  4NV5 A;  1MDI A;  2NTO A;  5FWG A;  3MSZ A;  2V1M A;  1BED A;  3VPT A;  2R5G A;  2JSY A;  1HYU A;  6GSS A;  4MMM A;  1EWX A;  2A2S A;  3VK9 A;  5A4U A;  3ZIJ A;  1GUL A;  1GTB A;  2XBQ A;  1OC9 B;  4GSS A;  2WUL A;  3WT1 A;  2E2G A;  2ON5 A;  1YKA A;  3DVW A;  4ISD A;  2HZE A;  1HD2 A;  1K3Y A;  2HZF A;  1URM A;  1M9A A;  1LJR A;  3IOS A;  3BJ5 A;  4EC0 A;  3GKX A;  4POB A;  3CBU A;  2LJR A;  4K0N A;  3IBH A;  1U6T A;  1JZD A;  3KH7 A;  3IA1 A;  4HU7 A;  1F3A A;  4LLR A;  4JR6 A;  4E8E A;  4QL9 A;  1SKW B;  1MDJ A;  5IMA A;  2L57 A;  5KN1 A;  2KLX A;  1G7O A;  3FHK A;  1WOU A;  3FZ4 A;  2XHF A;  3P8W A;  3L9S A;  3HHV A;  4G9H A;  2IWT A;  4PNF A;  2OAC A;  4IP1 A;  3EU4 A;  1O8X A;  2H71 A;  4HZ4 A;  1EV4 A;  1X0R A;  1K0N A;  2VUP A;  5IMC A;  4DEJ A;  4HU9 A;  4FIW A;  3ZYW A;  1AQV A;  3GHA A;  5B8A A;  4HOJ A;  5CRW A;  1YF1 A;  3D4M A;  2VD1 A;  1QQ2 A;  5IPH A;  2BMX A;  3BD2 A;  3GKN A;  4OD7 A;  5JCW A;  2L5L A;  2V41 A;  3I6A A;  12GS A;  2WJU A;  3MDK A;  5GSS A;  2VCX A;  2O87 A;  1QUW A;  2GTU A;  2H70 A;  4XS4 B;  3I69 A;  1BAY A;  2H1D A;  2HI7 A;  1PL2 A;  1BJX A;  3ZVJ D;  4KSM A;  2QKE A;  2IMD A;  4KDY A;  1X5E A;  4MZC A;  4G2E A;  1V2A A;  5DQS A;  2DJJ A;  5F06 A;  1SD9 A;  3R2Q A;  2J9H A;  2MMA A;  2OAD A;  3C71 A;  3WGD A;  3WGX A;  3F4S A;  5DQY A;  3C7M A;  2JAC A;  2CVD A;  1V40 A;  2H66 A;  3PR8 A;  4K6X A;  1GNE A;  2B7K A;  3D4T A;  4HDE A;  2HFD A;  5HQP A;  4KA0 A;  1B48 A;  4PX1 A;  1B4Q A;  3UOM A;  2PVQ A;  1QK8 A;  2RM6 A;  2GSS A;  4KX4 A;  1GSF A;  1X9W B;  2VCQ A;  4TXV A;  3NOF A;  1IYH A;  3GFK A;  2TRX A;  4JR4 A;  5ECR B;  3ED3 A;  2MZC A;  3EE2 A;  6GSY A;  4ZB6 A;  1XFL A;  2ON7 A;  2VL2 C;  2XBI A;  5HR3 A;  2DIZ A;  5F0G A;  2V32 A;  5J41 A;  4GRF A;  5ECS A;  3LXT A;  1XCC A;  2R4V A;  2CV4 A;  3O3T A;  4FYU A;  5EPF A;  5B6M A;  5KN0 A;  5G2Z A;  2C80 A;  5ECQ B;  3P7X A;  3TKS C;  3M9K A;  3GL5 A;  2VD0 A;  1TXX A;  2X64 A;  5DVB A;  1X5D A;  2LRT A;  1M2D A;  1FHE A;  2JZR A;  6GST A;  6GSV A;  4XCS A;  1HNC A;  3ZZX A;  3SBC A;  1TW9 A;  3EIN A;  5ECP B;  3GX8 A;  4MPG A;  5KN2 A;  2M46 A;  1Z9H A;  4MF5 A;  2A4V A;  4N11 A;  5ECK B;  3GKM A;  5HR2 A;  1B9X C;  3ZLP A;  3EMX A;  1TRU A;  3K8N A;  3RPN A;  1YDK A;  3LSZ A;  5IOX A;  20GS A;  5B8B A;  4KAE A;  1EGO A;  4PQ1 A;  5GAP D;  2JU5 A;  3BCI A;  1V58 A;  3CRT A;  1EOG A;  2IMF A;  3HJP A;  2GGT A;  2LV3 A;  2LNT A;  2C0G A;  5GAN D;  1ILO A;  1UC7 A;  2Z9S A;  4V1A p;  4GLT A;  3F6D A;  2OA7 A;  4ZB9 A;  3PH9 A;  4PGT A;  2FGX A;  4GF0 A;  2KP2 A;  2NPB A;  2YJ7 A;  4ML1 A;  4HI7 A;  4E8H A;  5ECH B;  1SL1 B;  2NVL A;  3QAG A;  2WS2 A;  1VF2 A;  5DBQ A;  8GSS A;  3M0F A;  4I97 A;  1FOV A;  1QXH A;  2LST A;  2YNX A;  1FW1 A;  4MDC A;  2N5F A;  4OO5 A;  2WDU A;  3PIN A;  1GTA A;  3H4K A;  5A4W A;  2YWN A;  3APS A;  1SK2 A;  1WIK A;  3IK7 A;  1BG5 A;  3TDG A;  1U87 A;  2XPE A;  4HQS A;  1UN2 A;  2PU9 C;  3F4T A;  4FO5 A;  1VF3 A;  5GZZ B;  2C4J A;  4AGS A;  5ABR A;  2MMZ A;  3HD5 A;  1YEP A;  1YKC A;  1NHO A;  2YZU A;  5ELA A;  5JWQ B;  5ENU A;  4RI6 A;  1AUC A;  3HJM A;  1SJZ A;  3GST A;  3C1S A;  4IP6 A;  4MK3 A;  1VRS D;  1A23 A;  5DAL B;  3APQ A;  1T4Y A;  4RQX A;  4YQU A;  3C73 A;  4IN0 A;  2CQ9 A;  1G0T A;  1V98 A;  3UVH A;  13GS A;  1F6M C;  3IXR A;  2VL9 A;  3N9J A;  3QAV A;  2EIQ A;  4KH7 A;  3WGE A;  3SWL A;  2LEG A;  2L4Q A;  2GT5 A;  4GXZ A;  4POK A;  1XWA A;  4O92 A;  1XIY A;  2MBT A;  4XRA A;  2VLV A;  4MA9 A;  2JZS A;  2EIR A;  1Q98 A;  2H1G A;  2KP1 A;  1OC9 A;  4TKY A;  4NWY A;  1ERW A;  1F2E A;  3LYK A;  2ES7 A;  5IIZ A;  4G19 A;  1V9W A;  3IRA A;  4Q5N A;  2K18 A;  3F3Q A;  3HVX A;  5ECL B;  4POL A;  2VM1 A;  4TXO A;  1WWJ A;  2MMN A;  3QPM A;  2L5O A;  4OFM A;  1T00 A;  4AF2 A;  1F3B A;  2JAD A;  1S3C A;  2GDR A;  3ZML A;  3AY8 A;  2VM2 A;  1KNG A;  3VPQ A;  1A0F A;  5H5S A;  4TR1 A;  3QD9 A;  2H8L A;  2PGT A;  2LJK A;  1EEJ A;  4BL7 A;  2GQM A;  4MPF A;  5HR1 A;  3A2V A;  4IJ3 A;  1ZMA A;  2C3Q A;  4DSS B;  2DJ0 A;  2I1U A;  5J4U A;  2VLT A;  1XOB A;  2H75 A;  2FD3 A;  2O7K A;  1G6W A;  3ERG A;  5COH A;  2YCD A;  4K9Z A;  3FRC A;  4WXT A;  4PXO A;  1EGR A;  1TTZ A;  4V1A g;  4WR4 A;  3FZA A;  2ZCT A;  4IW9 A;  2G0F A;  4EO3 A;  5A4V A;  4XS4 A;  2IME A;  3LWA A;  2CZ2 A;  4H86 A;  1A2J A;  1KEB A;  1PRX A;  4JU5 A;  3TRQ A;  5JCU A;  1OE7 A;  1HNA A;  2FLS A;  3DKS A;  2VL3 A;  4V2L A;  2LQO A;  4TOP A;  1YF0 A;  1K0B A;  1VF4 A;  2C0D A;  3HYP A;  1M7T A;  4EKZ A;  3LFL A;  1SEN A;  1JLV A;  3CSH A;  3ZL5 A;  5ID2 B;  1O8W A;  2HT9 A;  2VCW A;  5J3R A;  22GS A;  3VWV A;  2CVK A;  3DGQ A;  2L6D A;  1Z7R A;  1SL2 B;  1VGL A;  2E2M A;  5G30 A;  3HDC A;  4X1U A;  2PMT A;  2CAQ A;  1TI3 A;  2DML A;  3ZRD A;  5J5N A;  1WRY A;  2GQL A;  3DWV A;  3F9U A;  2RII A;  1THX A;  5DAK B;  4HEA 2;  1W4V A;  3GKK A;  4L5L A;  2C0F A;  2DJ3 A;  2C3T A;  3VLN A;  4TRX A;  2FA4 A;  5D9W A;  4KCA A;  3KM6 A;  3I43 A;  1XWC A;  3GUS A;  1TK0 B;  4G10 A;  1CQG A;  3F0I A;  2HRN A;  4ZIL A;  3CTF A;  1T4Z A;  3TOU A;  2WFC A;  2I81 A;  2YPM A;  4WKW A;  3QOU A;  1JFU A;  2LKU A;  1I5G A;  3IK9 A;  3HVV A;  4DSR A;  3IPZ A;  3RHC A;  1UVZ A;  4KGI A;  4WEY A;  3KIJ A;  4WF4 A;  1M99 A;  1G6Y A;  2FNO A;  3GA4 A;  4MZW A;  4I2T A;  5DCH A;  1FG4 A;  1EP8 A;  3HZ8 A;  1R26 A;  4JE1 A;  1J9B A;  4J56 E;  5G31 A;  4LL4 B;  3KTL A;  2CX3 A;  3EWL A;  4NHW A;  1Z3E A;  5FHI A;  2E7P A;  4YQV A;  1OYJ A;  2YN1 A;  2F8A A;  2H0H A;  5DJL A;  2GS3 A;  2EIO A;  3L9U A;  4ZBD A;  3TUE A;  3Q6O A;  3WT2 A;  3FR3 A;  2JL4 A;  18GS A;  2B1L A;  4I5Q A;  1FB0 A;  4ECB A;  3DML A;  1FO5 A;  1GSU A;  3C8E A;  3TJB A;  3A2X A;  5IMZ A;  4FYC A;  1B9Y C;  4OWY A;  4MJB A;  2B5Y A;  3GNJ A;  2YWM A;  1ML6 A;  1OKD A;  4MCU A;  5LNK e;  1AXD A;  3TJF A;  5D9X A;  2MBS A;  4J57 E;  4WR5 A;  2HE3 A;  5C04 A;  2DC5 A;  4F82 A;  3FZ9 A;  3TOT A;  3NIV A;  2L59 A;  5CAX A;  5G5E A;  5F05 A;  1R5P A;  4XTS A;  3CSJ A;  3IHQ A;  3VFI A;  4MJA A;  4EE0 A;  1OVN A;  2CVB A;  1SYR A;  2GSR A;  2CA8 A;  1R5A A;  3VWW A;  2PPT A;  4HJ2 A;  2HZE B;  14GS A;  1T3B A;  1K0D A;  2FUG 2;  3GTU A;  2PVO C;  4HQZ A;  5EVO A;  4HZ2 A;  1OE8 A;  2AHE A;  2GSQ A;  4X43 A;  2V2G A;  1PX6 A;  1XWG A;  2I4A A;  3LJR A;  3GL3 A;  1PA3 A;  1XBS A;  3ZTL A;  2GLR A;  4IEL A;  3D21 A;  3IC4 A;  5FT3 A;  3CSI A;  1DUG A;  1S3D A;  2IMK A;  5G1L A;  4JED A;  5GST A;  3IV4 A;  1WPI A;  3GIX A;  5HFG A;  5AIS A;  1WE0 A;  4ZBB A;  2YV9 A;  4TVE A;  2PBJ A;  3FY7 A;  4K1F A;  3J7Y b;  4MLY A;  2OBK A;  4KE3 A;  3M3M A;  3VI7 A;  1SL0 B;  2FY6 A;  1ERU A;  4ECI A;  1E6B A;  2LJA A;  4Q5R A;  4XIH A;  5DAL A;  1N2A A;  4PQH A;  2R37 A;  2VCZ A;  3EVI A;  1THO A;  2BTO T;  3WYW A;  3DXB A;  5D8I A;  5KN3 A;  1A2L A;  2H30 A;  3LGC A;  5JCG A;  4F9Z A;  4K0G A;  4LMW A;  3RPP A;  1ZYQ B;  1YZX A;  1A24 A;  1K0O A;  4GST A;  1E2Y A;  4NV2 A;  3V1W A;  3HJO A;  1X9S B;  3DRN A;  2V6K A;  3VWX A;  1TDI A;  5AGY A;  3HVS A;  3UVT A;  3E3E A;  2RUF A;  3N5O A;  2K8V A;  3TKP A;  1ERT A;  2G2Q A;  1ZZY A;  1U88 A;  1K0A A;  2IFQ B;  2GZY A;  3ZRE A;  1K3L A;  19GS A;  1FAA A;  3QFB C;  4F2I A;  1EOH A;  4IVF A;  3KCM A;  2DLX A;  4GTU A;  5CP1 A;  2B5E A;  4BVX A;  1EV9 A;  1V57 A;  5B6N A;  3U6V A;  3MWH A;  3QR6 A;  4EL1 A;  3TJJ A;  4KSO A;  3GN3 A;  1XW5 A;  3VUR A;  2DIY A;  1PL1 A;  1XW9 A;  2YWI A;  1A8L A;  2OE0 A;  1M2B A;  1JHB A;  1U3I A;  4WET A;  1U3A A;  3A2W A;  2YWO A;  4V2N A;  2L4C A;  3BOA A;  2OE3 A;  3GUR A;  2HLS A;  1SK1 A;  4J2F A;  1O6J A;  2XC2 A;  1TU8 A;  2LS5 A;  3KZQ A;  4KUN A;  5ECN B;  1GNW A;  2C8U A;  3FW2 A;  4POM A;  2M72 A;  1AQW A;  2IJY A;  3P2A A;  5CO3 A;  2DSA A;  4TW5 A;  5IM9 A;  1XWB A;  2X8G A;  1VF1 A;  2F8F A;  2HSY A;  3KMN A;  1PMT A;  2GQK A;  1MDK A;  3W8J A;  2H74 A;  1TOF A;  5AIV A;  5D96 A;  1TRV A;  1TU7 A;  1PKZ A;  1TK8 B;  2ALB A;  3L78 A;  5E4W A;  3TGZ A;  1G7E A;  3UAR A;  2QC7 A;  4BPY A;  4ECJ A;  3A3T A;  1W89 A;  3QAW A;  5ID2 A;  1Z7P A;  4MP4 A;  2OKA A;  1ZOF A;  4QL7 A;  1O81 A;  1WMJ A;  2QGV A;  3KP9 A;  4L5O A;  1CQH A;  4BWS A;  3GSS A;  2B7J A;  1OC8 A;  16GS A;  2HSH A;  3UAP A;  1A2M A;  2HRF A;  4HS1 A;  2WZ9 A;  5DAK A;  3ERF A;  5IQY A;  5INY A;  3QMX A;  3LEF A;  2FWH A;  1KTE A;  5DCG A;  1XVQ A;  3APO A;  1K0M A;  9GSS A;  3FK8 A;  4CW9 A;  1DE1 A;  1EZK A;  2P31 A;  3LXZ A;  1SU9 A;  4OFN A;  4EDZ A;  4RI7 A;  3QFA C;  3ISO A;  4MZB A;  2IMI A;  4PUF C;  4RUV A;  5D73 A;  1XOA A;  4IS0 A;  4YQM A;  2REM A;  1WP0 A;  3MNG A;  5F07 A;  3KMO A;  2FWE A;  4NMU A;  4MF7 A;  3ERW A;  5EL8 A;  2LRC A;  3D22 A;  5LD0 A;  1GLP A;  2DJK A;  4GSN A;  2CT6 A;  4F03 A;  4BWQ A;  1SYX A;  4MAB A;  1EP7 A;  2AB6 A;  4TR4 A;  1GUH A;  4OMV A;  3ZFB A;  3PGT A;  3EMP A;  4YAP A;  2V6O A;  2AUV A;  5IMV A;  1FVJ A;  4PNG A;  3TJK A;  2X8C A;  2OE1 A;  1K3O A;  5IMD A;  2TRC P;  7GSS A;  2VIM A;  4NXI A;  1X5C A;  3W8S A;  2DMM A;  4RQR A;  2NDO A;  4BVY A;  4TR3 A;  4LA1 A;  1GTU A;  3A5W A;  3L9V A;  2K8S A;  1OKT A;  2DBC A;  3NZN A;  1AC1 A;  4K7O A;  5ELG A;  3HCZ A;  4ZIJ A;  3EU3 A;  2P0G A;  1QFN A;  2E0Q A;  4ILF A;  4KW6 A;  4EXJ A;  4I2U A;  2F3M A;  4MJC A;  4D73 B;  4LL1 B;  4MH2 A;  2RM5 A;  2VL2 A;  2I9H A;  11GS A;  4LMV A;  1RK4 A;  2VO4 A;  1DE2 A;  3KP8 A;  4KDU A;  4WBJ A;  2A2R A;  1PD2 1;  1O73 A;  2GZP A;  3GRX A;  2LQQ A;  5AN1 A;  1HQO A;  3HKR A;  3HZ4 A;  1LBK A;  4L8E A;  3E9J B;  3GYK A;  5IMF A;  2ZNM A;  3UJ1 A;  2R2J A;  3TKR A;  3O6T A;  3DIE A;  4JRR A;  2H76 A;  3TKS A;  2J23 A;  4ML6 A;  3RHB A;  4IBP A;  3E0U A;  4TR0 A;  1B4P A;  3U5R E;  2MMO A;  4O5R A;  4ZB8 A;  5IO0 A;  5HR0 A;  5CYY A;  4MF6 A;  1XZO A;  4TXO B;  3H93 A;  2LRN A;  4FYB A;  5DDL A;  3LQ7 A;  3BBY A;  1GL8 A;  1S3A A;  1SKR B;  3DVX A;  1QMV A;  4HUA A;  1USB A;  5CRG A;  2YAN A; 
#chains in the Genus database with same CATH topology
 2H6Z A;  2QA2 A;  2YV7 A;  4TR1 B;  4P3Y B;  4KND A;  4IHU A;  5AIX A;  3FEU A;  4GQC A;  4BL7 B;  4F0B A;  4KF9 A;  1ZYE A;  3F63 A;  3LOR A;  3D6I A;  3GV1 A;  1A0R P;  2H6X A;  4BA7 A;  2X4A A;  4OO4 A;  2RLI A;  2H1A A;  3D0Z A;  3KXO A;  1GWC A;  3FR6 A;  4ACS A;  2GT6 A;  3KH9 A;  4N30 A;  4PTS A;  2I3Y A;  1EEM A;  2DJ2 A;  3KJY A;  1SJ6 A;  2LTK A;  1PN9 A;  4N10 A;  1ABA A;  1Y6E A;  2YP6 A;  5E59 A;  4K5R A;  2PER A;  3CYN A;  2H73 A;  2OJL A;  2F51 A;  2HNL A;  4IQ1 A;  1AW9 A;  1NW2 A;  1TP9 A;  3FR9 A;  6GSW A;  3TRP A;  2PN8 A;  1ZGN A;  1GTI A;  4K7N A;  4ZL8 A;  2P5R A;  4JBB A;  3TRX A;  1OC3 A;  3KEB A;  1M0U A;  3F4R A;  1GUM A;  3M9J A;  3GMF A;  3GX0 A;  3UEM A;  1R4W A;  2MYG A;  2IFQ A;  2QA1 A;  3H79 A;  2N5A A;  2B3S A;  1NHY A;  1JLW A;  1DSB A;  2IIY A;  3OR5 A;  2IL3 A;  1PKW A;  3M1G A;  4YH2 A;  1GSS A;  4ZL7 A;  5DJM A;  3HY2 A;  5D9T A;  1R7H A;  5ECM B;  3TJG A;  3UIW A;  2YJH A;  4NAX A;  4X4J A;  3CXG A;  3JCM L;  2D2Z A;  4ZBA A;  5F8B A;  4K5S A;  4GWR A;  4OFT A;  2K9F A;  2KOK A;  6GSX A;  4I8B A;  3UMA A;  2HXK A;  4WBR D;  4IGJ A;  2HYX A;  5J9B A;  4PQI A;  1TJD A;  1ST9 A;  4YKF A;  4IJI A;  3ZFL A;  2DJ1 A;  3D5J A;  4DVC A;  1PX7 A;  4HJM A;  4ID0 A;  1TRW A;  4IKH A;  5CNW A;  1BQ7 A;  1PGT A;  1O85 A;  2AJQ B;  3TKS E;  4XRD A;  4L0W A;  1WJK A;  4L0U A;  3DEX A;  3MAK A;  3ME8 A;  1FVK A;  3KD0 A;  4PUR A;  2H01 A;  5KEJ A;  3G7J A;  2C3N A;  1PSQ A;  4Z7X A;  2F9S A;  4ZXG A;  2H0I A;  1XPV A;  5D93 A;  5CRD A;  2NBS A;  5H5Q A;  4NPB A;  1X9M B;  3C1R A;  1ZCP A;  3WD6 A;  3MYD A;  4GQF A;  5JWR B;  1I9D A;  1T1V A;  2FHE A;  2FWG A;  4X0X A;  1GSQ A;  5HFK A;  1LU4 A;  1JZO A;  2LUS A;  4DSQ A;  1JZR A;  2DKH A;  5J9C A;  1GLQ A;  4ULX A;  1ZL9 A;  1ACV A;  5JWO B;  3IAM 2;  2VCT A;  1NSW A;  2ZUP A;  3FYG A;  3H8Q A;  10GS A;  1Q4J A;  1TKD B;  3LG6 A;  1SJI A;  2O85 A;  2AV4 A;  3DD3 A;  5IPG A;  1SKS B;  3RDW A;  3LYP A;  1UA5 A;  1GH2 A;  3UBL A;  3IE3 A;  1HNB A;  3KTB A;  3HXS A;  17GS A;  4EUY A;  5L71 A;  3ZMK A;  1TI1 A;  1J0F A;  2BJX A;  1Z6N A;  1TRS A;  3LW9 A;  3G7I A;  4AJ7 A;  1QGV A;  2KUC A;  4XS6 A;  2GST A;  3ZIT A;  2B6M A;  2OBI A;  1B8X A;  2L6C A;  3DYR A;  3IDV A;  4AJ6 A;  1GSE A;  1MTC A;  3GH9 A;  3W6G A;  3Q19 A;  2IN3 A;  5G5F A;  3S9F A;  4N0Z A;  2FA8 A;  2R6K A;  3GTU B;  1K0C A;  3IHG A;  6GSU A;  4EF0 A;  2LNS A;  4DSS A;  4KDX A;  2YZH A;  2QSI A;  3KGK A;  4K2D A;  3IAS 2;  2O89 A;  4EVM A;  1GP1 A;  3FKF A;  2X49 A;  1XXU A;  2X8H A;  2JZT A;  2VOC A;  3EYT A;  3EUR A;  1O7U A;  4MH3 A;  2EC4 A;  1PQN A;  1GRX A;  4ECC A;  2AYT A;  2WB9 A;  4K7I A;  3TCO A;  1F37 A;  1GSY A;  4K8M A;  1SK0 A;  3G7Y A;  3IR4 A;  4KCE A;  5A5K A;  3M8N A;  2GVP A;  5IO2 A;  3F6F A;  1XVW A;  2WCI A;  2CX4 A;  1H75 A;  4QQ7 A;  3CTG A;  2WGR A;  2H0G A;  2VLU A;  4YAV A;  1RW1 A;  3Q74 A;  2FCH A;  1IYI A;  2B5X A;  4N0V A;  3PPU A;  2C1Y A;  4D73 A;  5D9V A;  1AIU A;  4FH8 A;  2B1K A;  1MD4 A;  5CRE A;  1JZW A;  3ZIV A;  1BX9 A;  4XHM A;  1TK5 B;  1M2A A;  3CRU A;  4ZL9 A;  2A2P A;  3L0H A;  4WF5 A;  1T7P B;  3O76 A;  4OCF A;  3CMI A;  3J7Y k;  2FWF A;  3TB2 A;  1AAZ A;  3F8U A;  1YEX A;  2X99 A;  3VI5 A;  4Q5Q A;  1FB6 A;  2H6Y A;  2PUK C;  3QDN A;  1YQ1 A;  4EIQ A;  2PWJ A;  1T8E B;  3FZ5 A;  5HFI A;  1Z6M A;  4EDY A;  2CAI A;  3BCK A;  2H1B A;  2H19 A;  2P5Q A;  2KHP A;  4GCI A;  2K6V A;  4XS1 A;  5C00 A;  4MJE A;  2VAF A;  1GUK A;  5CRH A;  1YJ6 A;  1KBN A;  3RAZ A;  4AJ8 A;  1MD3 A;  2RUE A;  4F0C A;  1OAZ A;  3ZVJ A;  3TKQ A;  2GZZ A;  3H1N A;  4O7H A;  2YOI A;  4CDO A;  3VWU A;  5G1K A;  3ME7 A;  1H4O A;  1M3J A;  4PUA A;  1YY7 A;  5ECI B;  1A8Y A;  1N8J A;  2TIR A;  3EC3 A;  4TN8 A;  3Q18 A;  1AQX A;  4OCE A;  2IPA A;  1Y25 A;  3QCP A;  1J08 A;  4CHS A;  1MEK A;  5EY6 A;  2C0E A;  4JZQ A;  1XW6 A;  3GH6 A;  4I6X A;  3P90 A;  2CZ3 A;  2XPD A;  3F3R A;  2H72 A;  1BYE A;  1NM3 A;  1F9M A;  3I9V 2;  2N5B A;  5B7C A;  3UL3 A;  1ON4 A;  1SD8 A;  4O32 A;  1Z5Y E;  1ERV A;  2M80 A;  4IQA A;  1RQM A;  5H5R A;  4Q5F A;  1M9B A;  1XWK A;  1DBY A;  1C72 A;  2VCV A;  3US3 A;  5IOW A;  2JSZ A;  3L4N A;  4V2M A;  5ECO B;  2WRT A;  3HA9 A;  2AAW A;  3RBT A;  2R3X A;  3G9B A;  4KB3 A;  4NHZ A;  3UBK A;  2O8V B;  5LCZ A;  1GSD A;  4NV5 A;  1MDI A;  2NTO A;  5FWG A;  3MSZ A;  2V1M A;  1BED A;  3VPT A;  2R5G A;  2JSY A;  1HYU A;  6GSS A;  4MMM A;  1EWX A;  2A2S A;  3VK9 A;  5A4U A;  3ZIJ A;  1GUL A;  1GTB A;  2XBQ A;  1OC9 B;  4GSS A;  2WUL A;  3WT1 A;  2E2G A;  2ON5 A;  1YKA A;  3DVW A;  4ISD A;  2HZE A;  1HD2 A;  1K3Y A;  2HZF A;  1URM A;  1M9A A;  1LJR A;  3IOS A;  3BJ5 A;  4EC0 A;  3GKX A;  4POB A;  3CBU A;  2LJR A;  4EIP A;  2DKI A;  4K0N A;  3IBH A;  1U6T A;  1JZD A;  3KH7 A;  3IA1 A;  4HU7 A;  1F3A A;  4LLR A;  4JR6 A;  4E8E A;  4QL9 A;  1SKW B;  1MDJ A;  5IMA A;  2L57 A;  5KN1 A;  2KLX A;  1G7O A;  3FHK A;  1WOU A;  3FZ4 A;  2XHF A;  3P8W A;  3L9S A;  3HHV A;  4G9H A;  2IWT A;  4PNF A;  2OAC A;  4IP1 A;  3EU4 A;  1O8X A;  5BRT A;  2H71 A;  4HZ4 A;  1EV4 A;  1X0R A;  1K0N A;  2VUP A;  5IMC A;  4DEJ A;  4HU9 A;  4FIW A;  3ZYW A;  1AQV A;  3HVN A;  3GHA A;  5B8A A;  4HOJ A;  5CRW A;  1YF1 A;  3D4M A;  2VD1 A;  1QQ2 A;  5IPH A;  2BMX A;  3BD2 A;  3GKN A;  4OD7 A;  5JCW A;  2L5L A;  2V41 A;  3I6A A;  12GS A;  2WJU A;  3MDK A;  5GSS A;  2VCX A;  2O87 A;  1QUW A;  2GTU A;  2H70 A;  4XS4 B;  3I69 A;  1BAY A;  2H1D A;  2HI7 A;  1PL2 A;  1BJX A;  3ZVJ D;  4KSM A;  4FQU A;  2QKE A;  2IMD A;  4KDY A;  1X5E A;  4MZC A;  4G2E A;  1V2A A;  5DQS A;  2DJJ A;  5F06 A;  1SD9 A;  3R2Q A;  2J9H A;  2MMA A;  2OAD A;  3C71 A;  3WGD A;  3WGX A;  3F4S A;  5DQY A;  3C7M A;  2JAC A;  2CVD A;  1V40 A;  2H66 A;  3PR8 A;  4K6X A;  1GNE A;  2B7K A;  3D4T A;  4HDE A;  2HFD A;  5HQP A;  4KA0 A;  1B48 A;  4PX1 A;  1B4Q A;  3UOM A;  2PVQ A;  1QK8 A;  2RM6 A;  1S3R A;  2GSS A;  4KX4 A;  1GSF A;  1X9W B;  2VCQ A;  4TXV A;  3NOF A;  1IYH A;  3GFK A;  2TRX A;  4JR4 A;  4BIK A;  4Z2T A;  5ECR B;  4MNN A;  3ED3 A;  2MZC A;  3EE2 A;  6GSY A;  4ZB6 A;  1XFL A;  2ON7 A;  2VL2 C;  2XBI A;  5HR3 A;  2DIZ A;  5F0G A;  5KOX A;  2V32 A;  5J41 A;  4GRF A;  5ECS A;  3LXT A;  1XCC A;  2R4V A;  2CV4 A;  3O3T A;  4FYU A;  5EPF A;  5B6M A;  5KN0 A;  5G2Z A;  2C80 A;  5ECQ B;  3P7X A;  3TKS C;  3M9K A;  3GL5 A;  2VD0 A;  1TXX A;  2X64 A;  5DVB A;  1X5D A;  2LRT A;  1M2D A;  1FHE A;  2JZR A;  4G0L A;  6GST A;  6GSV A;  4XCS A;  1HNC A;  3ZZX A;  3SBC A;  1TW9 A;  3EIN A;  5ECP B;  3GX8 A;  4MPG A;  5KN2 A;  2M46 A;  2R0G A;  1Z9H A;  4MF5 A;  2A4V A;  4N11 A;  5ECK B;  3GKM A;  5HR2 A;  1B9X C;  3ZLP A;  3EMX A;  1TRU A;  3K8N A;  3RPN A;  1YDK A;  3LSZ A;  5IOX A;  20GS A;  5B8B A;  4KAE A;  1EGO A;  4PQ1 A;  5GAP D;  2JU5 A;  3BCI A;  1V58 A;  3CRT A;  1EOG A;  2IMF A;  3HJP A;  2GGT A;  2LV3 A;  2LNT A;  2C0G A;  5GAN D;  1PFO A;  1ILO A;  1UC7 A;  2Z9S A;  4V1A p;  4GLT A;  3F6D A;  2OA7 A;  4ZB9 A;  3PH9 A;  4PGT A;  2FGX A;  4GF0 A;  2KP2 A;  2NPB A;  2YJ7 A;  4ML1 A;  4HI7 A;  4E8H A;  5ECH B;  1SL1 B;  2NVL A;  3QAG A;  2WS2 A;  1VF2 A;  5DBQ A;  3A5I A;  8GSS A;  3M0F A;  4I97 A;  1FOV A;  1QXH A;  2LST A;  2YNX A;  1FW1 A;  4MDC A;  2N5F A;  4OO5 A;  2WDU A;  3PIN A;  1GTA A;  3H4K A;  5A4W A;  2YWN A;  3APS A;  1SK2 A;  1WIK A;  3IK7 A;  4HSC X;  1BG5 A;  3TDG A;  1U87 A;  2XPE A;  2A4H A;  4HQS A;  1UN2 A;  2PU9 C;  3F4T A;  4FO5 A;  1VF3 A;  5GZZ B;  2C4J A;  4AGS A;  5ABR A;  2MMZ A;  3HD5 A;  1YEP A;  1YKC A;  1NHO A;  2YZU A;  5ELA A;  5JWQ B;  5ENU A;  1ZYP A;  4RI6 A;  1AUC A;  3HJM A;  1SJZ A;  3GST A;  3C1S A;  4IP6 A;  4MK3 A;  1VRS D;  1A23 A;  5DAL B;  3APQ A;  1T4Y A;  4RQX A;  4YQU A;  3C73 A;  4IN0 A;  2CQ9 A;  1G0T A;  1V98 A;  3UVH A;  13GS A;  1F6M C;  3IXR A;  2VL9 A;  3N9J A;  3QAV A;  2EIQ A;  4KH7 A;  3WGE A;  3SWL A;  2LEG A;  2L4Q A;  2GT5 A;  4GXZ A;  4POK A;  1XWA A;  4O92 A;  1XIY A;  2MBT A;  4XRA A;  2VLV A;  3IC8 A;  4MA9 A;  2JZS A;  2EIR A;  1Q98 A;  2H1G A;  2KP1 A;  1OC9 A;  4TKY A;  4NWY A;  1ERW A;  1F2E A;  3LYK A;  2ES7 A;  5IIZ A;  4G19 A;  1V9W A;  3IRA A;  4Q5N A;  2K18 A;  3F3Q A;  3HVX A;  5ECL B;  4POL A;  2VM1 A;  4TXO A;  1WWJ A;  2MMN A;  3QPM A;  2L5O A;  4OFM A;  4BVX B;  1T00 A;  4AF2 A;  1F3B A;  2JAD A;  1S3C A;  2GDR A;  3ZML A;  3AY8 A;  4Z2U A;  2VM2 A;  1KNG A;  3VPQ A;  1A0F A;  2R0P A;  5H5S A;  4TR1 A;  3QD9 A;  2H8L A;  2PGT A;  2LJK A;  1EEJ A;  4BL7 A;  2GQM A;  4MPF A;  2UZ8 A;  5HR1 A;  3A2V A;  4IJ3 A;  1ZMA A;  2C3Q A;  4DSS B;  2DJ0 A;  2I1U A;  5J4U A;  2VLT A;  1XOB A;  2H75 A;  2FD3 A;  2O7K A;  1G6W A;  3ERG A;  5COH A;  2YCD A;  4K9Z A;  3FRC A;  5KOW A;  4WXT A;  4PXO A;  1EGR A;  1TTZ A;  4V1A g;  4WR4 A;  3FZA A;  2ZCT A;  4IW9 A;  2G0F A;  4EO3 A;  5A4V A;  4XS4 A;  2IME A;  3LWA A;  2CZ2 A;  2HSM A;  4H86 A;  1A2J A;  1KEB A;  1PRX A;  4JU5 A;  3TRQ A;  5JCU A;  1OE7 A;  1HNA A;  2FLS A;  3DKS A;  2VL3 A;  4V2L A;  2LQO A;  4TOP A;  1YF0 A;  1K0B A;  1VF4 A;  2C0D A;  3HYP A;  1M7T A;  4EKZ A;  3LFL A;  1SEN A;  1JLV A;  3CSH A;  3ZL5 A;  3MIX A;  5ID2 B;  1O8W A;  2HT9 A;  2VCW A;  5J3R A;  22GS A;  3VWV A;  2CVK A;  3DGQ A;  2L6D A;  1Z7R A;  1SL2 B;  1VGL A;  2E2M A;  5G30 A;  3HDC A;  4X1U A;  3R3E A;  2PMT A;  2CAQ A;  1TI3 A;  2DML A;  3ZRD A;  5J5N A;  1WRY A;  2GQL A;  3DWV A;  3F9U A;  2RII A;  1THX A;  3EPT A;  5DAK B;  4HEA 2;  1W4V A;  3GKK A;  4L5L A;  2C0F A;  2DJ3 A;  2C3T A;  3VLN A;  4TRX A;  2FA4 A;  5D9W A;  4KCA A;  3KM6 A;  3I43 A;  1XWC A;  3GUS A;  1TK0 B;  4G10 A;  1CQG A;  3F0I A;  2HRN A;  4YKG A;  4ZIL A;  3CTF A;  1T4Z A;  3TOU A;  2WFC A;  2I81 A;  2YPM A;  4WKW A;  3QOU A;  1JFU A;  2LKU A;  1I5G A;  3IK9 A;  3HVV A;  4DSR A;  3IPZ A;  3RHC A;  1UVZ A;  4KGI A;  4WEY A;  3KIJ A;  4O5Q A;  4WF4 A;  1M99 A;  1ZYN A;  1G6Y A;  2FNO A;  3GA4 A;  4MZW A;  4I2T A;  5DCH A;  1FG4 A;  1EP8 A;  3HZ8 A;  1R26 A;  4JE1 A;  1J9B A;  4J56 E;  5G31 A;  4LL4 B;  3KTL A;  2CX3 A;  3EWL A;  4NHW A;  1Z3E A;  5FHI A;  2E7P A;  4YQV A;  1OYJ A;  2YN1 A;  2F8A A;  2H0H A;  5DJL A;  2GS3 A;  4BVY B;  2EIO A;  3L9U A;  4ZBD A;  3TUE A;  3Q6O A;  3WT2 A;  3FR3 A;  2JL4 A;  18GS A;  2B1L A;  4I5Q A;  1FB0 A;  4ECB A;  3DML A;  1FO5 A;  1GSU A;  3C8E A;  3TJB A;  3A2X A;  5IMZ A;  4FYC A;  1B9Y C;  4OWY A;  4MJB A;  2B5Y A;  3GNJ A;  2YWM A;  1ML6 A;  1OKD A;  4MCU A;  5LNK e;  1AXD A;  3TJF A;  5D9X A;  2MBS A;  4J57 E;  4WR5 A;  2HE3 A;  5C04 A;  2DC5 A;  4F82 A;  3FZ9 A;  3TOT A;  3NIV A;  2L59 A;  5CAX A;  5G5E A;  3CQF A;  5F05 A;  1R5P A;  4XTS A;  3CSJ A;  3IHQ A;  3VFI A;  4MJA A;  4EE0 A;  1OVN A;  2CVB A;  1SYR A;  2GSR A;  2CA8 A;  1FOH A;  1R5A A;  3VWW A;  2PPT A;  4HJ2 A;  2HZE B;  14GS A;  1T3B A;  1K0D A;  2FUG 2;  3GTU A;  2PVO C;  4HQZ A;  5EVO A;  4HZ2 A;  1OE8 A;  2AHE A;  2GSQ A;  4X43 A;  4O5U A;  2V2G A;  1PX6 A;  1XWG A;  2I4A A;  3LJR A;  3GL3 A;  1PA3 A;  1XBS A;  3ZTL A;  2GLR A;  4IEL A;  3D21 A;  4ICY A;  3IC4 A;  5FT3 A;  3CSI A;  1DUG A;  1S3D A;  2IMK A;  5G1L A;  4JED A;  5GST A;  3IV4 A;  1WPI A;  3GIX A;  5HFG A;  5AIS A;  1WE0 A;  4ZBB A;  2YV9 A;  4TVE A;  2PBJ A;  3FY7 A;  4K1F A;  3J7Y b;  4MLY A;  2OBK A;  4KE3 A;  3M3M A;  3VI7 A;  1SL0 B;  2FY6 A;  1ERU A;  4ECI A;  1E6B A;  2LJA A;  4Q5R A;  4XIH A;  5DAL A;  1N2A A;  4PQH A;  2R37 A;  2VCZ A;  4Z2R A;  3EVI A;  1THO A;  2BTO T;  3WYW A;  3DXB A;  5D8I A;  4CY8 A;  1A2L A;  2H30 A;  5KN3 A;  3LGC A;  5JCG A;  4F9Z A;  4K0G A;  4LMW A;  3RPP A;  1ZYQ B;  1YZX A;  1A24 A;  1K0O A;  4GST A;  1E2Y A;  4NV2 A;  3V1W A;  3HJO A;  1X9S B;  3DRN A;  2V6K A;  3VWX A;  1TDI A;  5AGY A;  3HVS A;  3UVT A;  3E3E A;  2RUF A;  3N5O A;  2K8V A;  3TKP A;  1PN0 A;  1ERT A;  2G2Q A;  1ZZY A;  1U88 A;  1K0A A;  2IFQ B;  2GZY A;  3ZRE A;  1K3L A;  19GS A;  1FAA A;  3QFB C;  4F2I A;  1EOH A;  4IVF A;  3KCM A;  2DLX A;  4GTU A;  5CP1 A;  2B5E A;  2HRA A;  4BVX A;  1EV9 A;  1V57 A;  5B6N A;  3U6V A;  3MWH A;  3QR6 A;  4EL1 A;  3TJJ A;  4KSO A;  2HRK A;  3GN3 A;  1XW5 A;  3VUR A;  2DIY A;  1PL1 A;  1XW9 A;  2YWI A;  1A8L A;  2OE0 A;  1M2B A;  1JHB A;  1U3I A;  4WET A;  1U3A A;  3A2W A;  2YWO A;  4V2N A;  2L4C A;  4A5P A;  3BOA A;  2OE3 A;  3GUR A;  2HLS A;  1SK1 A;  4J2F A;  5BMU A;  1O6J A;  2XC2 A;  1TU8 A;  2LS5 A;  3KZQ A;  4USS A;  4KUN A;  5ECN B;  1GNW A;  2C8U A;  3FW2 A;  4POM A;  2M72 A;  1AQW A;  2IJY A;  3P2A A;  5CO3 A;  2DSA A;  4TW5 A;  5IM9 A;  1XWB A;  2X8G A;  1VF1 A;  2F8F A;  2HSY A;  3KMN A;  1PMT A;  2GQK A;  2R0C A;  1MDK A;  3W8J A;  2H74 A;  1TOF A;  5AIV A;  5D96 A;  1TRV A;  1TU7 A;  1PKZ A;  1TK8 B;  2ALB A;  3L78 A;  5E4W A;  3TGZ A;  1G7E A;  3UAR A;  2QC7 A;  1M3I A;  4BPY A;  4ECJ A;  3A3T A;  1W89 A;  3QAW A;  5ID2 A;  1Z7P A;  4MP4 A;  2OKA A;  1ZOF A;  4QL7 A;  1O81 A;  1WMJ A;  2QGV A;  3KP9 A;  4L5O A;  1CQH A;  4BWS A;  3GSS A;  2B7J A;  1OC8 A;  16GS A;  2HSH A;  3UAP A;  1A2M A;  2HRF A;  4HS1 A;  2WZ9 A;  5DAK A;  3ERF A;  5IQY A;  5INY A;  3QMX A;  3LEF A;  2FWH A;  1KTE A;  5DCG A;  4CY6 A;  1XVQ A;  3APO A;  4G0K A;  1K0M A;  9GSS A;  3FK8 A;  4CW9 A;  1DE1 A;  1EZK A;  2P31 A;  3LXZ A;  1SU9 A;  4OFN A;  4EDZ A;  4RI7 A;  3QFA C;  3ISO A;  4MZB A;  2IMI A;  4PUF C;  4RUV A;  5D73 A;  1XOA A;  4IS0 A;  4YQM A;  2REM A;  1WP0 A;  3FMW A;  3MNG A;  5F07 A;  3KMO A;  2FWE A;  4NMU A;  4MF7 A;  3ERW A;  5EL8 A;  2LRC A;  3D22 A;  5LD0 A;  1GLP A;  2DJK A;  4GSN A;  2CT6 A;  4F03 A;  4BWQ A;  1SYX A;  4MAB A;  1EP7 A;  2AB6 A;  4TR4 A;  1GUH A;  4OMV A;  3ZFB A;  3PGT A;  3EMP A;  4YAP A;  2V6O A;  2AUV A;  5IMV A;  1FVJ A;  4PNG A;  3TJK A;  2X8C A;  4K2X A;  2OE1 A;  1K3O A;  5IMD A;  2TRC P;  7GSS A;  2VIM A;  4NXI A;  1X5C A;  3W8S A;  2DMM A;  4RQR A;  2NDO A;  4BVY A;  4TR3 A;  4LA1 A;  1GTU A;  3A5W A;  3L9V A;  2K8S A;  1OKT A;  2DBC A;  3NZN A;  1AC1 A;  4K7O A;  5ELG A;  3HCZ A;  4ZIJ A;  3EU3 A;  2P0G A;  1QFN A;  2E0Q A;  4ILF A;  4KW6 A;  4EXJ A;  4I2U A;  2F3M A;  4MJC A;  4D73 B;  4LL1 B;  4MH2 A;  2RM5 A;  2VL2 A;  2I9H A;  11GS A;  4LMV A;  1RK4 A;  2VO4 A;  1DE2 A;  3KP8 A;  4KDU A;  4WBJ A;  2A2R A;  1PD2 1;  1O73 A;  2GZP A;  3GRX A;  2LQQ A;  5AN1 A;  1HQO A;  3HKR A;  3HZ4 A;  1LBK A;  4L8E A;  3E9J B;  3GYK A;  5IMF A;  2ZNM A;  4G0I A;  3UJ1 A;  2R2J A;  3TKR A;  3O6T A;  3DIE A;  4JRR A;  2H76 A;  3TKS A;  2J23 A;  4ML6 A;  3RHB A;  4IBP A;  3E0U A;  4TR0 A;  1B4P A;  1XG8 A;  3U5R E;  2MMO A;  4O5R A;  4ZB8 A;  5IO0 A;  5HR0 A;  5CYY A;  4MF6 A;  1XZO A;  4TXO B;  3H93 A;  2LRN A;  4FYB A;  5DDL A;  3LQ7 A;  3BBY A;  1GL8 A;  1S3A A;  1SKR B;  3DVX A;  1QMV A;  4HUA A;  1USB A;  5CRG A;  2YAN A; 
#chains in the Genus database with same CATH homology
 2H6Z A;  2QA2 A;  2YV7 A;  4TR1 B;  4P3Y B;  4KND A;  4IHU A;  5AIX A;  3FEU A;  4GQC A;  4BL7 B;  4F0B A;  4KF9 A;  1ZYE A;  3F63 A;  3LOR A;  3D6I A;  3GV1 A;  1A0R P;  2H6X A;  4BA7 A;  2X4A A;  4OO4 A;  2RLI A;  2H1A A;  3D0Z A;  3KXO A;  1GWC A;  3FR6 A;  4ACS A;  2GT6 A;  3KH9 A;  4N30 A;  4PTS A;  2I3Y A;  1EEM A;  2DJ2 A;  3KJY A;  1SJ6 A;  2LTK A;  1PN9 A;  4N10 A;  1ABA A;  1Y6E A;  2YP6 A;  5E59 A;  4K5R A;  2PER A;  3CYN A;  2H73 A;  2OJL A;  2F51 A;  2HNL A;  4IQ1 A;  1AW9 A;  1NW2 A;  1TP9 A;  3FR9 A;  6GSW A;  3TRP A;  2PN8 A;  1ZGN A;  1GTI A;  4K7N A;  4ZL8 A;  2P5R A;  4JBB A;  3TRX A;  1OC3 A;  3KEB A;  1M0U A;  3F4R A;  1GUM A;  3M9J A;  3GMF A;  3GX0 A;  3UEM A;  1R4W A;  2MYG A;  2IFQ A;  2QA1 A;  3H79 A;  2N5A A;  2B3S A;  1NHY A;  1JLW A;  1DSB A;  2IIY A;  3OR5 A;  2IL3 A;  1PKW A;  3M1G A;  4YH2 A;  1GSS A;  4ZL7 A;  5DJM A;  3HY2 A;  5D9T A;  1R7H A;  5ECM B;  3TJG A;  3UIW A;  2YJH A;  4NAX A;  4X4J A;  3CXG A;  3JCM L;  2D2Z A;  4ZBA A;  5F8B A;  4K5S A;  4GWR A;  4OFT A;  2K9F A;  2KOK A;  6GSX A;  4I8B A;  3UMA A;  2HXK A;  4WBR D;  4IGJ A;  2HYX A;  5J9B A;  4PQI A;  1TJD A;  1ST9 A;  4YKF A;  4IJI A;  3ZFL A;  2DJ1 A;  3D5J A;  4DVC A;  1PX7 A;  4HJM A;  4ID0 A;  1TRW A;  4IKH A;  5CNW A;  1BQ7 A;  1PGT A;  1O85 A;  2AJQ B;  3TKS E;  4XRD A;  4L0W A;  1WJK A;  4L0U A;  3DEX A;  3MAK A;  3ME8 A;  1FVK A;  3KD0 A;  4PUR A;  2H01 A;  5KEJ A;  3G7J A;  2C3N A;  1PSQ A;  4Z7X A;  2F9S A;  4ZXG A;  2H0I A;  1XPV A;  5D93 A;  5CRD A;  2NBS A;  5H5Q A;  4NPB A;  1X9M B;  3C1R A;  1ZCP A;  3WD6 A;  3MYD A;  4GQF A;  5JWR B;  1I9D A;  1T1V A;  2FHE A;  2FWG A;  4X0X A;  1GSQ A;  5HFK A;  1LU4 A;  1JZO A;  2LUS A;  4DSQ A;  1JZR A;  2DKH A;  5J9C A;  1GLQ A;  4ULX A;  1ZL9 A;  1ACV A;  5JWO B;  3IAM 2;  2VCT A;  1NSW A;  2ZUP A;  3FYG A;  3H8Q A;  10GS A;  1Q4J A;  1TKD B;  3LG6 A;  1SJI A;  2O85 A;  2AV4 A;  3DD3 A;  5IPG A;  1SKS B;  3RDW A;  3LYP A;  1UA5 A;  1GH2 A;  3UBL A;  3IE3 A;  1HNB A;  3KTB A;  3HXS A;  17GS A;  4EUY A;  5L71 A;  3ZMK A;  1TI1 A;  1J0F A;  2BJX A;  1Z6N A;  1TRS A;  3LW9 A;  3G7I A;  4AJ7 A;  1QGV A;  2KUC A;  4XS6 A;  2GST A;  3ZIT A;  2B6M A;  2OBI A;  1B8X A;  2L6C A;  3DYR A;  3IDV A;  4AJ6 A;  1GSE A;  1MTC A;  3GH9 A;  3W6G A;  3Q19 A;  2IN3 A;  5G5F A;  3S9F A;  4N0Z A;  2FA8 A;  2R6K A;  3GTU B;  1K0C A;  3IHG A;  6GSU A;  4EF0 A;  2LNS A;  4DSS A;  4KDX A;  2YZH A;  2QSI A;  3KGK A;  4K2D A;  3IAS 2;  2O89 A;  4EVM A;  1GP1 A;  3FKF A;  2X49 A;  1XXU A;  2X8H A;  2JZT A;  2VOC A;  3EYT A;  3EUR A;  1O7U A;  4MH3 A;  2EC4 A;  1PQN A;  1GRX A;  4ECC A;  2AYT A;  2WB9 A;  4K7I A;  3TCO A;  1F37 A;  1GSY A;  4K8M A;  1SK0 A;  3G7Y A;  3IR4 A;  4KCE A;  5A5K A;  3M8N A;  2GVP A;  5IO2 A;  3F6F A;  1XVW A;  2WCI A;  2CX4 A;  1H75 A;  4QQ7 A;  3CTG A;  2WGR A;  2H0G A;  2VLU A;  4YAV A;  1RW1 A;  3Q74 A;  2FCH A;  1IYI A;  2B5X A;  4N0V A;  3PPU A;  2C1Y A;  4D73 A;  5D9V A;  1AIU A;  4FH8 A;  2B1K A;  1MD4 A;  5CRE A;  1JZW A;  3ZIV A;  1BX9 A;  4XHM A;  1TK5 B;  1M2A A;  3CRU A;  4ZL9 A;  2A2P A;  3L0H A;  4WF5 A;  1T7P B;  3O76 A;  4OCF A;  3CMI A;  3J7Y k;  2FWF A;  3TB2 A;  1AAZ A;  3F8U A;  1YEX A;  2X99 A;  3VI5 A;  4Q5Q A;  1FB6 A;  2H6Y A;  2PUK C;  3QDN A;  1YQ1 A;  4EIQ A;  2PWJ A;  1T8E B;  3FZ5 A;  5HFI A;  1Z6M A;  4EDY A;  2CAI A;  3BCK A;  2H1B A;  2H19 A;  2P5Q A;  2KHP A;  4GCI A;  2K6V A;  4XS1 A;  5C00 A;  4MJE A;  2VAF A;  1GUK A;  5CRH A;  1YJ6 A;  1KBN A;  3RAZ A;  4AJ8 A;  1MD3 A;  2RUE A;  4F0C A;  1OAZ A;  3ZVJ A;  3TKQ A;  2GZZ A;  3H1N A;  4O7H A;  2YOI A;  4CDO A;  3VWU A;  5G1K A;  3ME7 A;  1H4O A;  4PUA A;  1YY7 A;  5ECI B;  1A8Y A;  1N8J A;  2TIR A;  3EC3 A;  4TN8 A;  3Q18 A;  1AQX A;  4OCE A;  2IPA A;  1Y25 A;  3QCP A;  1J08 A;  4CHS A;  1MEK A;  5EY6 A;  2C0E A;  4JZQ A;  1XW6 A;  3GH6 A;  4I6X A;  3P90 A;  2CZ3 A;  2XPD A;  3F3R A;  2H72 A;  1BYE A;  1NM3 A;  1F9M A;  3I9V 2;  2N5B A;  5B7C A;  3UL3 A;  1ON4 A;  1SD8 A;  4O32 A;  1Z5Y E;  1ERV A;  2M80 A;  4IQA A;  1RQM A;  5H5R A;  4Q5F A;  1M9B A;  1XWK A;  1DBY A;  1C72 A;  2VCV A;  3US3 A;  5IOW A;  2JSZ A;  3L4N A;  4V2M A;  5ECO B;  2WRT A;  3HA9 A;  2AAW A;  3RBT A;  2R3X A;  3G9B A;  4KB3 A;  4NHZ A;  3UBK A;  2O8V B;  5LCZ A;  1GSD A;  4NV5 A;  1MDI A;  2NTO A;  5FWG A;  3MSZ A;  2V1M A;  1BED A;  3VPT A;  2R5G A;  2JSY A;  1HYU A;  6GSS A;  4MMM A;  1EWX A;  2A2S A;  3VK9 A;  5A4U A;  3ZIJ A;  1GUL A;  1GTB A;  2XBQ A;  1OC9 B;  4GSS A;  2WUL A;  3WT1 A;  2E2G A;  2ON5 A;  1YKA A;  3DVW A;  4ISD A;  2HZE A;  1HD2 A;  1K3Y A;  2HZF A;  1URM A;  1M9A A;  1LJR A;  3IOS A;  3BJ5 A;  4EC0 A;  3GKX A;  4POB A;  3CBU A;  2LJR A;  4EIP A;  2DKI A;  4K0N A;  3IBH A;  1U6T A;  1JZD A;  3KH7 A;  3IA1 A;  4HU7 A;  1F3A A;  4LLR A;  4JR6 A;  4E8E A;  4QL9 A;  1SKW B;  1MDJ A;  5IMA A;  2L57 A;  5KN1 A;  2KLX A;  1G7O A;  3FHK A;  1WOU A;  3FZ4 A;  2XHF A;  3P8W A;  3L9S A;  3HHV A;  4G9H A;  2IWT A;  4PNF A;  2OAC A;  4IP1 A;  3EU4 A;  1O8X A;  5BRT A;  2H71 A;  4HZ4 A;  1EV4 A;  1X0R A;  1K0N A;  2VUP A;  5IMC A;  4DEJ A;  4HU9 A;  4FIW A;  3ZYW A;  1AQV A;  3GHA A;  5B8A A;  4HOJ A;  5CRW A;  1YF1 A;  3D4M A;  2VD1 A;  1QQ2 A;  5IPH A;  2BMX A;  3BD2 A;  3GKN A;  4OD7 A;  5JCW A;  2L5L A;  2V41 A;  3I6A A;  12GS A;  2WJU A;  3MDK A;  5GSS A;  2VCX A;  2O87 A;  1QUW A;  2GTU A;  2H70 A;  4XS4 B;  3I69 A;  1BAY A;  2H1D A;  2HI7 A;  1PL2 A;  1BJX A;  3ZVJ D;  4KSM A;  4FQU A;  2QKE A;  2IMD A;  4KDY A;  1X5E A;  4MZC A;  4G2E A;  1V2A A;  5DQS A;  2DJJ A;  5F06 A;  1SD9 A;  3R2Q A;  2J9H A;  2MMA A;  2OAD A;  3C71 A;  3WGD A;  3WGX A;  3F4S A;  5DQY A;  3C7M A;  2JAC A;  2CVD A;  1V40 A;  2H66 A;  3PR8 A;  4K6X A;  1GNE A;  2B7K A;  3D4T A;  4HDE A;  2HFD A;  5HQP A;  4KA0 A;  1B48 A;  4PX1 A;  1B4Q A;  3UOM A;  2PVQ A;  1QK8 A;  2RM6 A;  2GSS A;  4KX4 A;  1GSF A;  1X9W B;  2VCQ A;  4TXV A;  3NOF A;  1IYH A;  3GFK A;  2TRX A;  4JR4 A;  4Z2T A;  5ECR B;  4MNN A;  3ED3 A;  2MZC A;  3EE2 A;  6GSY A;  4ZB6 A;  1XFL A;  2ON7 A;  2VL2 C;  2XBI A;  5HR3 A;  2DIZ A;  5F0G A;  5KOX A;  2V32 A;  5J41 A;  4GRF A;  5ECS A;  3LXT A;  1XCC A;  2R4V A;  2CV4 A;  3O3T A;  4FYU A;  5EPF A;  5B6M A;  5KN0 A;  5G2Z A;  2C80 A;  5ECQ B;  3P7X A;  3TKS C;  3M9K A;  3GL5 A;  2VD0 A;  1TXX A;  2X64 A;  5DVB A;  1X5D A;  2LRT A;  1M2D A;  1FHE A;  2JZR A;  4G0L A;  6GST A;  6GSV A;  4XCS A;  1HNC A;  3ZZX A;  3SBC A;  1TW9 A;  3EIN A;  5ECP B;  3GX8 A;  4MPG A;  5KN2 A;  2M46 A;  2R0G A;  1Z9H A;  4MF5 A;  2A4V A;  4N11 A;  5ECK B;  3GKM A;  5HR2 A;  1B9X C;  3ZLP A;  3EMX A;  1TRU A;  3K8N A;  3RPN A;  1YDK A;  3LSZ A;  5IOX A;  20GS A;  5B8B A;  4KAE A;  1EGO A;  4PQ1 A;  5GAP D;  2JU5 A;  3BCI A;  1V58 A;  3CRT A;  1EOG A;  2IMF A;  3HJP A;  2GGT A;  2LV3 A;  2LNT A;  2C0G A;  5GAN D;  1ILO A;  1UC7 A;  2Z9S A;  4V1A p;  4GLT A;  3F6D A;  2OA7 A;  4ZB9 A;  3PH9 A;  4PGT A;  2FGX A;  4GF0 A;  2KP2 A;  2NPB A;  2YJ7 A;  4ML1 A;  4HI7 A;  4E8H A;  5ECH B;  1SL1 B;  2NVL A;  3QAG A;  2WS2 A;  1VF2 A;  5DBQ A;  3A5I A;  8GSS A;  3M0F A;  4I97 A;  1FOV A;  1QXH A;  2LST A;  2YNX A;  1FW1 A;  4MDC A;  2N5F A;  4OO5 A;  2WDU A;  3PIN A;  1GTA A;  3H4K A;  5A4W A;  2YWN A;  3APS A;  1SK2 A;  1WIK A;  3IK7 A;  1BG5 A;  3TDG A;  1U87 A;  2XPE A;  2A4H A;  4HQS A;  1UN2 A;  2PU9 C;  3F4T A;  4FO5 A;  1VF3 A;  5GZZ B;  2C4J A;  4AGS A;  5ABR A;  2MMZ A;  3HD5 A;  1YEP A;  1YKC A;  1NHO A;  2YZU A;  5ELA A;  5JWQ B;  5ENU A;  1ZYP A;  4RI6 A;  1AUC A;  3HJM A;  1SJZ A;  3GST A;  3C1S A;  4IP6 A;  4MK3 A;  1VRS D;  1A23 A;  5DAL B;  3APQ A;  1T4Y A;  4RQX A;  4YQU A;  3C73 A;  4IN0 A;  2CQ9 A;  1G0T A;  1V98 A;  3UVH A;  13GS A;  1F6M C;  3IXR A;  2VL9 A;  3N9J A;  3QAV A;  2EIQ A;  4KH7 A;  3WGE A;  3SWL A;  2LEG A;  2L4Q A;  2GT5 A;  4GXZ A;  4POK A;  1XWA A;  4O92 A;  1XIY A;  2MBT A;  4XRA A;  2VLV A;  3IC8 A;  4MA9 A;  2JZS A;  2EIR A;  1Q98 A;  2H1G A;  2KP1 A;  1OC9 A;  4TKY A;  4NWY A;  1ERW A;  1F2E A;  3LYK A;  2ES7 A;  5IIZ A;  4G19 A;  1V9W A;  3IRA A;  4Q5N A;  2K18 A;  3F3Q A;  3HVX A;  5ECL B;  4POL A;  2VM1 A;  4TXO A;  1WWJ A;  2MMN A;  3QPM A;  2L5O A;  4OFM A;  4BVX B;  1T00 A;  4AF2 A;  1F3B A;  2JAD A;  1S3C A;  2GDR A;  3ZML A;  3AY8 A;  4Z2U A;  2VM2 A;  1KNG A;  3VPQ A;  1A0F A;  2R0P A;  5H5S A;  4TR1 A;  3QD9 A;  2H8L A;  2PGT A;  2LJK A;  1EEJ A;  4BL7 A;  2GQM A;  4MPF A;  2UZ8 A;  5HR1 A;  3A2V A;  4IJ3 A;  1ZMA A;  2C3Q A;  4DSS B;  2DJ0 A;  2I1U A;  5J4U A;  2VLT A;  1XOB A;  2H75 A;  2FD3 A;  2O7K A;  1G6W A;  3ERG A;  5COH A;  2YCD A;  4K9Z A;  3FRC A;  5KOW A;  4WXT A;  4PXO A;  1EGR A;  1TTZ A;  4V1A g;  4WR4 A;  3FZA A;  2ZCT A;  4IW9 A;  2G0F A;  4EO3 A;  5A4V A;  4XS4 A;  2IME A;  3LWA A;  2CZ2 A;  2HSM A;  4H86 A;  1A2J A;  1KEB A;  1PRX A;  4JU5 A;  3TRQ A;  5JCU A;  1OE7 A;  1HNA A;  2FLS A;  3DKS A;  2VL3 A;  4V2L A;  2LQO A;  4TOP A;  1YF0 A;  1K0B A;  1VF4 A;  2C0D A;  3HYP A;  1M7T A;  4EKZ A;  3LFL A;  1SEN A;  1JLV A;  3CSH A;  3ZL5 A;  3MIX A;  5ID2 B;  1O8W A;  2HT9 A;  2VCW A;  5J3R A;  22GS A;  3VWV A;  2CVK A;  3DGQ A;  2L6D A;  1Z7R A;  1SL2 B;  1VGL A;  2E2M A;  5G30 A;  3HDC A;  4X1U A;  3R3E A;  2PMT A;  2CAQ A;  1TI3 A;  2DML A;  3ZRD A;  5J5N A;  1WRY A;  2GQL A;  3DWV A;  3F9U A;  2RII A;  1THX A;  3EPT A;  5DAK B;  4HEA 2;  1W4V A;  3GKK A;  4L5L A;  2C0F A;  2DJ3 A;  2C3T A;  3VLN A;  4TRX A;  2FA4 A;  5D9W A;  4KCA A;  3KM6 A;  3I43 A;  1XWC A;  3GUS A;  1TK0 B;  4G10 A;  1CQG A;  3F0I A;  2HRN A;  4YKG A;  4ZIL A;  3CTF A;  1T4Z A;  3TOU A;  2WFC A;  2I81 A;  2YPM A;  4WKW A;  3QOU A;  1JFU A;  2LKU A;  1I5G A;  3IK9 A;  3HVV A;  4DSR A;  3IPZ A;  3RHC A;  1UVZ A;  4KGI A;  4WEY A;  3KIJ A;  4O5Q A;  4WF4 A;  1M99 A;  1ZYN A;  1G6Y A;  2FNO A;  3GA4 A;  4MZW A;  4I2T A;  5DCH A;  1FG4 A;  1EP8 A;  3HZ8 A;  1R26 A;  4JE1 A;  1J9B A;  4J56 E;  5G31 A;  4LL4 B;  3KTL A;  2CX3 A;  3EWL A;  4NHW A;  1Z3E A;  5FHI A;  2E7P A;  4YQV A;  1OYJ A;  2YN1 A;  2F8A A;  2H0H A;  5DJL A;  2GS3 A;  4BVY B;  2EIO A;  3L9U A;  4ZBD A;  3TUE A;  3Q6O A;  3WT2 A;  3FR3 A;  2JL4 A;  18GS A;  2B1L A;  4I5Q A;  1FB0 A;  4ECB A;  3DML A;  1FO5 A;  1GSU A;  3C8E A;  3TJB A;  3A2X A;  5IMZ A;  4FYC A;  1B9Y C;  4OWY A;  4MJB A;  2B5Y A;  3GNJ A;  2YWM A;  1ML6 A;  1OKD A;  4MCU A;  5LNK e;  1AXD A;  3TJF A;  5D9X A;  2MBS A;  4J57 E;  4WR5 A;  2HE3 A;  5C04 A;  2DC5 A;  4F82 A;  3FZ9 A;  3TOT A;  3NIV A;  2L59 A;  5CAX A;  5G5E A;  5F05 A;  1R5P A;  4XTS A;  3CSJ A;  3IHQ A;  3VFI A;  4MJA A;  4EE0 A;  1OVN A;  2CVB A;  1SYR A;  2GSR A;  2CA8 A;  1FOH A;  1R5A A;  3VWW A;  2PPT A;  4HJ2 A;  2HZE B;  14GS A;  1T3B A;  1K0D A;  2FUG 2;  3GTU A;  2PVO C;  4HQZ A;  5EVO A;  4HZ2 A;  1OE8 A;  2AHE A;  2GSQ A;  4X43 A;  4O5U A;  2V2G A;  1PX6 A;  1XWG A;  2I4A A;  3LJR A;  3GL3 A;  1PA3 A;  1XBS A;  3ZTL A;  2GLR A;  4IEL A;  3D21 A;  4ICY A;  3IC4 A;  5FT3 A;  3CSI A;  1DUG A;  1S3D A;  2IMK A;  5G1L A;  4JED A;  5GST A;  3IV4 A;  1WPI A;  3GIX A;  5HFG A;  5AIS A;  1WE0 A;  4ZBB A;  2YV9 A;  4TVE A;  2PBJ A;  3FY7 A;  4K1F A;  3J7Y b;  4MLY A;  2OBK A;  4KE3 A;  3M3M A;  3VI7 A;  1SL0 B;  2FY6 A;  1ERU A;  4ECI A;  1E6B A;  2LJA A;  4Q5R A;  4XIH A;  5DAL A;  1N2A A;  4PQH A;  2R37 A;  2VCZ A;  4Z2R A;  3EVI A;  1THO A;  2BTO T;  3WYW A;  3DXB A;  5D8I A;  4CY8 A;  1A2L A;  2H30 A;  5KN3 A;  3LGC A;  5JCG A;  4F9Z A;  4K0G A;  4LMW A;  3RPP A;  1ZYQ B;  1YZX A;  1A24 A;  1K0O A;  4GST A;  1E2Y A;  4NV2 A;  3V1W A;  3HJO A;  1X9S B;  3DRN A;  2V6K A;  3VWX A;  1TDI A;  5AGY A;  3HVS A;  3UVT A;  3E3E A;  2RUF A;  3N5O A;  2K8V A;  3TKP A;  1PN0 A;  1ERT A;  2G2Q A;  1ZZY A;  1U88 A;  1K0A A;  2IFQ B;  2GZY A;  3ZRE A;  1K3L A;  19GS A;  1FAA A;  3QFB C;  4F2I A;  1EOH A;  4IVF A;  3KCM A;  2DLX A;  4GTU A;  5CP1 A;  2B5E A;  2HRA A;  4BVX A;  1EV9 A;  1V57 A;  5B6N A;  3U6V A;  3MWH A;  3QR6 A;  4EL1 A;  3TJJ A;  4KSO A;  2HRK A;  3GN3 A;  1XW5 A;  3VUR A;  2DIY A;  1PL1 A;  1XW9 A;  2YWI A;  1A8L A;  2OE0 A;  1M2B A;  1JHB A;  1U3I A;  4WET A;  1U3A A;  3A2W A;  2YWO A;  4V2N A;  2L4C A;  4A5P A;  3BOA A;  2OE3 A;  3GUR A;  2HLS A;  1SK1 A;  4J2F A;  5BMU A;  1O6J A;  2XC2 A;  1TU8 A;  2LS5 A;  3KZQ A;  4USS A;  4KUN A;  5ECN B;  1GNW A;  2C8U A;  3FW2 A;  4POM A;  2M72 A;  1AQW A;  2IJY A;  3P2A A;  5CO3 A;  2DSA A;  4TW5 A;  5IM9 A;  1XWB A;  2X8G A;  1VF1 A;  2F8F A;  2HSY A;  3KMN A;  1PMT A;  2GQK A;  2R0C A;  1MDK A;  3W8J A;  2H74 A;  1TOF A;  5AIV A;  5D96 A;  1TRV A;  1TU7 A;  1PKZ A;  1TK8 B;  2ALB A;  3L78 A;  5E4W A;  3TGZ A;  1G7E A;  3UAR A;  2QC7 A;  4BPY A;  4ECJ A;  3A3T A;  1W89 A;  3QAW A;  5ID2 A;  1Z7P A;  4MP4 A;  2OKA A;  1ZOF A;  4QL7 A;  1O81 A;  1WMJ A;  2QGV A;  3KP9 A;  4L5O A;  1CQH A;  4BWS A;  3GSS A;  2B7J A;  1OC8 A;  16GS A;  2HSH A;  3UAP A;  1A2M A;  2HRF A;  4HS1 A;  2WZ9 A;  5DAK A;  3ERF A;  5IQY A;  5INY A;  3QMX A;  3LEF A;  2FWH A;  1KTE A;  5DCG A;  4CY6 A;  1XVQ A;  3APO A;  4G0K A;  1K0M A;  9GSS A;  3FK8 A;  4CW9 A;  1DE1 A;  1EZK A;  2P31 A;  3LXZ A;  1SU9 A;  4OFN A;  4EDZ A;  4RI7 A;  3QFA C;  3ISO A;  4MZB A;  2IMI A;  4PUF C;  4RUV A;  5D73 A;  1XOA A;  4IS0 A;  4YQM A;  2REM A;  1WP0 A;  3FMW A;  3MNG A;  5F07 A;  3KMO A;  2FWE A;  4NMU A;  4MF7 A;  3ERW A;  5EL8 A;  2LRC A;  3D22 A;  5LD0 A;  1GLP A;  2DJK A;  4GSN A;  2CT6 A;  4F03 A;  4BWQ A;  1SYX A;  4MAB A;  1EP7 A;  2AB6 A;  4TR4 A;  1GUH A;  4OMV A;  3ZFB A;  3PGT A;  3EMP A;  4YAP A;  2V6O A;  2AUV A;  5IMV A;  1FVJ A;  4PNG A;  3TJK A;  2X8C A;  4K2X A;  2OE1 A;  1K3O A;  5IMD A;  2TRC P;  7GSS A;  2VIM A;  4NXI A;  1X5C A;  3W8S A;  2DMM A;  4RQR A;  2NDO A;  4BVY A;  4TR3 A;  4LA1 A;  1GTU A;  3A5W A;  3L9V A;  2K8S A;  1OKT A;  2DBC A;  3NZN A;  1AC1 A;  4K7O A;  5ELG A;  3HCZ A;  4ZIJ A;  3EU3 A;  2P0G A;  1QFN A;  2E0Q A;  4ILF A;  4KW6 A;  4EXJ A;  4I2U A;  2F3M A;  4MJC A;  4D73 B;  4LL1 B;  4MH2 A;  2RM5 A;  2VL2 A;  2I9H A;  11GS A;  4LMV A;  1RK4 A;  2VO4 A;  1DE2 A;  3KP8 A;  4KDU A;  4WBJ A;  2A2R A;  1PD2 1;  1O73 A;  2GZP A;  3GRX A;  2LQQ A;  5AN1 A;  1HQO A;  3HKR A;  3HZ4 A;  1LBK A;  4L8E A;  3E9J B;  3GYK A;  5IMF A;  2ZNM A;  4G0I A;  3UJ1 A;  2R2J A;  3TKR A;  3O6T A;  3DIE A;  4JRR A;  2H76 A;  3TKS A;  2J23 A;  4ML6 A;  3RHB A;  4IBP A;  3E0U A;  4TR0 A;  1B4P A;  3U5R E;  2MMO A;  4O5R A;  4ZB8 A;  5IO0 A;  5HR0 A;  5CYY A;  4MF6 A;  1XZO A;  4TXO B;  3H93 A;  2LRN A;  4FYB A;  5DDL A;  3LQ7 A;  3BBY A;  1GL8 A;  1S3A A;  1SKR B;  3DVX A;  1QMV A;  4HUA A;  1USB A;  5CRG A;  2YAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...