1I9DA

Arsenate reductase from e. coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
138
structure length
138
Chain Sequence
NITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLRKNVEPYEQLGLAEDKFTDDQLIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARSENATE REDUCTASE
publication title Insights into the structure, solvation, and mechanism of ArsC arsenate reductase, a novel arsenic detoxification enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 38
structure length 138
sequence length 138
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03960 ArsC ArsC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1i9dA00
2LNTA 2X99A 3GH6A 3EINA 4WBRD 1OKDA 1JZWA 4MA9A 6GSTA 3D22A 4PXOA 1RQMA 1OE8A 1OC3A 1GSEA 4NV2A 1GTAA 1JLVA 3VURA 1O8XA 3KH7A 3G7YA 2K18A 2EC4A 1FOVA 5ECOB 1GUMA 3GKXA 3P7XA 4GCIA 1XFLA 4YH2A 1GLQA 1O85A 5CYYA 1AQVA 3UVTA 2VL2A 5KN3A 2PUKC 3C7MA 1XXUA 4JR6A 1QGVA 1VF1A 3UBKA 4GRFA 3IOSA 1A2MA 5G30A 1SJ6A 1Q4JA 4TVEA 2ES7A 5HFGA 2YWOA 1GLPA 3ZREA 1F6MC 3Q74A 3IXRA 3F63A 2IN3A 3TRXA 1W4VA 1A0FA 2IMIA 2H8LA 2LEGA 4O5RA 3L9UA 3A2VA 2AHEA 3KZQA 3KP9A 2ALBA 3GUSA 5KEJA 1TI3A 4ID0A 5D9TA 1QMVA 2TRXA 4P3YB 2FLSA 2CZ2A 3H4KA 1R5PA 1VGLA 3GL5A 3M9KA 5CRDA 3VI7A 1O7UA 3EE2A 2F3MA 4G2EA 4BL7A 1ZYQB 2I9HA 3WGDA 5ECRB 2GQMA 3GRXA 5DCGA 4X43A 4I6XA 2KOKA 4HQSA 2AB6A 5HR3A 1B48A 2LQQA 2HSHA 4D73B 3BOAA 5HQPA 3LYKA 1PA3A 2IFQB 5J9CA 1GUHA 1FHEA 4IKHA 3UARA 3K8NA 3CSIA 2B1KA 4FO5A 3GTUA 2V6OA 3IV4A 2JU5A 2HZFA 5EVOA 1GTUA 4BVXA 2OE1A 3KMOA 2O85A 4DSQA 2P0GA 4L5OA 2B7KA 2FHEA 5AISA 3EC3A 4NHZA 3HYPA 4N0ZA 1UC7A 3I43A 1AUCA 1GL8A 4YQVA 3BJ5A 2OE3A 2DIYA 4FYUA 3UMAA 3DMLA 1V9WA 4DSSA 1XVQA 4POBA 1YEPA 5B7CA 4EC0A 2F8FA 5F07A 5EY6A 3HJPA 2RIIA 1OE7A 3FY7A 5IMFA 3EWLA 1V58A 4Q5QA 1XWKA 2QKEA 1ON4A 3AY8A 1XIYA 1BJXA 5DAKA 3J7Yb 2H1GA 4FIWA 2YWMA 1ERTA 2CV4A 4MPGA 1PL2A 2PVOC 3Q19A 1T8EB 2CA8A 5ECIB 1AQWA 13GSA 2YOIA 2PWJA 4JU5A 2YN1A 2MMNA 2O7KA 4WF5A 5KN0A 3BCIA 1F37A 1XBSA 4WXTA 3GN3A 6GSSA 5CRWA 2REMA 2VCZA 3GH9A 2KLXA 3HA9A 1M99A 4V2MA 2O89A 1PGTA 1MDJA 4MF7A 2H66A 2VCVA 1X9SB 5FT3A 5J41A 3LXTA 4G9HA 2XPEA 3HHVA 3IAM2 1V57A 2WS2A 4PGTA 2AV4A 4PQHA 3I9V2 4PUFC 4HS1A 3ZYWA 2H6ZA 4TR1A 3GSSA 4L8EA 5J3RA 3ZL5A 1X9WB 1TK5B 1LU4A 2C0GA 1XZOA 1J9BA 1GULA 3R2QA 5ECHB 3TKSE 1DUGA 4MJAA 4XS1A 2GQLA 1K0MA 1OC9A 3KD0A 1X0RA 3IAS2 2OE0A 4WEYA 3VWVA 8GSSA 1ZZYA 3HDCA 4OWYA 1K0CA 1GRXA 1V98A 5EL8A 2OJLA 4KDXA 2YV9A 3DGQA 3QDNA 2V1MA 2VCXA 4OCEA 2CX3A 1WE0A 1R5AA 4MPFA 4EXJA 3GIXA 4ZL8A 5GAPD 4GSNA 5F05A 4K7IA 4ACSA 5HR2A 3H1NA 1YQ1A 4KH7A 3CRTA 4TR4A 3UOMA 3RPNA 5J4UA 1M7TA 3BBYA 2MMOA 1AXDA 5IPGA 3HVXA 4NAXA 2H74A 3HVSA 1DE1A 3KEBA 1SD8A 5B8AA 4TOPA 2LNSA 1TDIA 5IQYA 2X8CA 1FG4A 3ME7A 4PNFA 1ERVA 2D2ZA 3CYNA 4GSTA 2H1BA 4DVCA 5HR0A 3RHBA 3VLNA 1GSDA 2KHPA 3WGEA 4N10A 1U87A 4AJ6A 4OCFA 3ISOA 4ZBBA 4XCSA 1TJDA 3HZ8A 2NVLA 2LJRA 1SL1B 1UVZA 1VF3A 2OKAA 1T4ZA 4G10A 5GAND 6GSXA 1A23A 3GSTA 3GA4A 2L4CA 1K0DA 3UJ1A 1U3IA 1B9YC 3P2AA 2V32A 4POKA 4K0GA 4X1UA 2FWFA 2GTUA 1HQOA 5DALA 2V41A 2KUCA 1OC8A 2OA7A 1EP7A 4I8BA 5J5NA 3FRCA 3ZMLA 3RDWA 4KX4A 2H6XA 3LQ7A 1C72A 2GGTA 4XS4B 2PU9C 3G7JA 2WCIA 2IJYA 2GSQA 3WT1A 2O8VB 3C8EA 2C0DA 2HLSA 4Q5RA 4GWRA 3D4MA 1FB0A 3HCZA 3GL3A 1USBA 2FNOA 1JHBA 1TXXA 1YJ6A 5DQSA 4JRRA 3ZITA 4EDZA 5GZZB 3TRQA 2HE3A 2F9SA 5IMAA 1EOGA 2H76A 4K2DA 2CVBA 3VFIA 2L5LA 3KTBA 2FWHA 1K0OA 4O92A 2MMZA 4GSSA 1GWCA 1G6YA 5D9VA 3O76A 3H79A 2IMDA 3IE3A 1QFNA 4KCAA 5INYA 4KA0A 5A5KA 4HDEA 3DXBA 2F51A 1DE2A 4TXVA 5CREA 14GSA 3GX8A 4PQ1A 4OFTA 5ECSA 4KDYA 3IRAA 3EMPA 4RQRA 3FR9A 3PGTA 4L0UA 1Z6MA 3ZIJA 2JL4A 2CVKA 4CHSA 3Q6OA 2NDOA 5CP1A 4Z7XA 4GXZA 4MH3A 2C8UA 4ECCA 1T7PB 5G31A 1RW1A 2HT9A 3J7Yk 2JSYA 1A2JA 5GSTA 5ID2A 1AW9A 4WKWA 4MP4A 2B5YA 5G2ZA 5JCUA 5AIXA 2VL9A 3DKSA 4HU9A 3FR6A 1EEJA 2LSTA 3TCOA 1GNWA 2CT6A 2PPTA 2I4AA 2OACA 1XW6A 4V2NA 2GS3A 4MLYA 4QQ7A 1BAYA 1QUWA 2LJKA 2G2QA 1JFUA 3US3A 4BVYA 1PKZA 4KDUA 5ECPB 1B4PA 2A4VA 4FH8A 3GTUB 4ML1A 3P8WA 4K8MA 2DC5A 1N2AA 4NMUA 4ZXGA 5IOWA 5IMCA 4J2FA 1Y25A 3WT2A 1B9XC 3F0IA 5FWGA 1J0FA 2I1UA 4DSSB 1I9DA 2C3QA 1HNAA 2GSRA 3DVXA 3TOTA 4HQZA 1X5DA 4GQFA 4IQ1A 2C80A 1VF2A 5G1LA 4CW9A 2RLIA 1YF1A 4LLRA 3TJJA 1ABAA 1ACVA 4HI7A 4EO3A 1M2BA 2B3SA 3ZFLA 2VM2A 4ECIA 5DJLA 3W8SA 3TKRA 5DQYA 2L6CA 1EEMA 4O7HA 5DAKB 1MTCA 4HEA2 1Z6NA 3FZ4A 3E9JB 4HJ2A 4PUAA 4F0BA 4EKZA 1B4QA 2HYXA 2G0FA 1ZYEA 2RUFA 1O8WA 3F4TA 4IBPA 1SK0A 3EVIA 1K3OA 2R37A 3TKPA 5J9BA 1EV4A 3OR5A 2AAWA 4J57E 3LORA 1EZKA 3WYWA 1R26A 4XTSA 4F2IA 3FZ5A 1PX6A 3IBHA 3SWLA 3ZMKA 4POMA 2OBKA 4K9ZA 3G9BA 2WB9A 5IPHA 3MDKA 1QK8A 2N5FA 1ZGNA 1YZXA 2QC7A 4O32A 1PD21 3TUEA 2IPAA 5G5FA 1IYIA 4KAEA 5F8BA 5IM9A 2VCWA 1TKDB 2J9HA 1EWXA 5ECNB 2GQKA 1EGRA 1ERWA 4G19A 3GURA 4TXOA 4NHWA 2VO4A 3PH9A 1Z7RA 2DJ0A 3GV1A 1KBNA 3D5JA 1A24A 2LTKA 1MDIA 1SYRA 2QGVA 4OFNA 1OC9B 1S3CA 1SL0B 4MJCA 3EU4A 5B6NA 1PX7A 4CDOA 5D73A 4KSMA 1TTZA 2WJUA 5KN1A 3TKSC 5B8BA 3L9VA 3F3QA 5DBQA 4J56E 2BJXA 2FWGA 2DSAA 4HUAA 4MF5A 5ENUA 2GZYA 5AGYA 1F2EA 5DDLA 9GSSA 5FHIA 2ZUPA 3FW2A 2PMTA 1V2AA 2M80A 1YKCA 3TJFA 3N9JA 4NPBA 2VL2C 1QQ2A 1SJIA 5IIZA 3VPQA 1WJKA 1G6WA 4IP6A 2WGRA 1THXA 2AJQB 2B5XA 2IFQA 3FEUA 3I6AA 3LG6A 4MZCA 1BEDA 1TU7A 1FAAA 4KUNA 3IDVA 2L5OA 3GFKA 4N0VA 3ERWA 1U88A 1CQGA 3MAKA 3QAGA 1H75A 1FVKA 2DJ2A 2VLUA 2H19A 4Q5FA 4RI7A 1JZDA 2EIQA 2M72A 1VF4A 2XBIA 4TKYA 1SKRB 1XPVA 5IMZA 3FK8A 5DVBA 2H70A 2PGTA 1JZRA 3KMNA 2LKUA 4BWQA 4ZL9A 1AIUA 3CBUA 3DIEA 2EIOA 1HNBA 1SK1A 2DJJA 7GSSA 1OAZA 5EPFA 1CQHA 2R3XA 1PL1A 3KXOA 1GH2A 2VLTA 2B7JA 3QOUA 4MABA 2RM5A 3N5OA 4RQXA 4KSOA 1ILOA 4XRDA 5DALB 5LCZA 22GSA 4ZILA 2CX4A 3W8JA 2FD3A 1SL2B 3GNJA 1YY7A 2C3NA 1XWAA 3GMFA 3ZRDA 4XHMA 2GLRA 2WDUA 2X8GA 4ZIJA 1ZMAA 4GQCA 2B1LA 2ZNMA 4MZWA 2B6MA 2C0EA 2YP6A 5JWOB 2R4VA 1TRWA 18GSA 5ECKB 1RK4A 2E0QA 1SD9A 5D8IA 4RUVA 3UAPA 1UA5A 5JWRB 1A8LA 1JLWA 1PMTA 4IJIA 1MD4A 1EOHA 1TRSA 4GF0A 1YEXA 1K0NA 4I5QA 3HD5A 6GSUA 2CQ9A 3HJOA 2FA8A 3GKNA 1PN9A 4YAPA 4HU7A 4YAVA 1HNCA 4K0NA 5C00A 2H73A 3GKMA 3TJBA 3TJKA 3DEXA 3APOA 4OD7A 4MJEA 1XVWA 3IA1A 2X8HA 3KH9A 4I2TA 3E3EA 3HY2A 1TOFA 2IMEA 3HJMA 3O6TA 2BMXA 1SU9A 12GSA 3A3TA 5L71A 20GSA 2H72A 1K3YA 3UEMA 5D9XA 1AQXA 5C04A 4F9ZA 4ZB6A 3LYPA 1K3LA 3TOUA 4K1FA 5A4WA 4MMMA 4ZB9A 3F4SA 1S3DA 4WF4A 1G7EA 2P31A 3S9FA 3TKQA 5ID2B 2GZZA 2A2SA 1M9BA 2LRNA 2MZCA 1Q98A 2FA4A 3ZVJD 5IOXA 2VM1A 4JR4A 4OMVA 4X0XA 4JE1A 3LWAA 5E4WA 2LRCA 3F6DA 3HKRA 1DSBA 2PN8A 4MDCA 2LQOA 3APQA 2JADA 5CRGA 3QR6A 1FO5A 1THOA 4ULXA 2XPDA 1SK2A 1NHYA 1O73A 2NTOA 2N5BA 4PNGA 2R2JA 1A0RP 4OO4A 3L0HA 4K7OA 3F3RA 5G5EA 1PSQA 3EMXA 3QD9A 2V6KA 1ST9A 5CAXA 5D96A 5AIVA 5H5RA 1TRUA 2YANA 3C71A 3CSHA 1S3AA 2FCHA 3DVWA 3WD6A 2YJHA 2H0HA 3CXGA 1WOUA 3E0UA 1Z9HA 3LXZA 2E2GA 2H01A 2VD1A 1WMJA 1HYUA 3G7IA 2MBSA 1A2LA 2A2RA 19GSA 4MK3A 3TB2A 3ME8A 3QFAC 5DJMA 1TRVA 3CRUA 3U5RE 2XC2A 3QCPA 1XOAA 2J23A 4PQIA 4AJ7A 1UN2A 1K0AA 3KP8A 3ZZXA 1OYJA 2IMFA 3PINA 2HZEA 4AF2A 2AYTA 2L6DA 3DYRA 2VCQA 1LJRA 5HR1A 3EURA 2RUEA 2JZTA 2B5EA 4XIHA 2N5AA 3P90A 4XS4A 5A4UA 1XWCA 2DLXA 4BWSA 3F6FA 3L4NA 1BQ7A 4V1Ag 4IELA 4KCEA 4NV5A 4E8HA 1X9MB 3A2XA 4EF0A 4TN8A 1M2AA 5IMDA 1FB6A 4TR3A 1T1VA 3GHAA 2PERA 1K0BA 4ZBAA 3TKSA 2IIYA 2Z9SA 4EL1A 1KNGA 3GX0A 4EDYA 4V2LA 1F3AA 3LSZA 2H71A 2C3TA 16GSA 1M9AA 5ELAA 4IHUA 3VWUA 1NSWA 2I81A 3BCKA 3ZFBA 1B8XA 2PBJA 1G0TA 3VWXA 4KW6A 2HRNA 1G7OA 3F9UA 3H93A 1W89A 3RAZA 5G1KA 4I97A 2YZUA 3FR3A 1XOBA 1WWJA 1YF0A 4TXOB 1U3AA 2GT5A 2K6VA 5H5QA 4YQUA 2EIRA 3FHKA 4F03A 1TI1A 4L5LA 4LL4B 3VI5A 1A8YA 3A2WA 2L57A 6GSVA 2V2GA 3M1GA 4NXIA 1PKWA 3QFBC 3M0FA 4LL1B 1XCCA 4H86A 4KE3A 1HD2A 1OKTA 5JCGA 2ON5A 4MJBA 4KNDA 4IQAA 3DWVA 3FZ9A 4IJ3A 1TU8A 1T00A 3D0ZA 3VK9A 2CVDA 1KTEA 3H8QA 4K6XA 2MMAA 1BG5A 2M46A 1NM3A 3KTLA 3GYKA 2JZSA 2YWIA 1WIKA 1T3BA 1SKSB 4L0WA 3IHQA 1EGOA 1MEKA 3M3MA 1LBKA 2VL3A 4XS6A 4ECJA 3SBCA 1XWGA 4MCUA 2GDRA 1Z5YE 4EUYA 1TP9A 2GSSA 4WETA 4PURA 4DSRA 4EVMA 2HNLA 2KP1A 4HJMA 3I69A 3QAVA 3ERFA 3KCMA 2VD0A 3IR4A 1WPIA 3UIWA 5CO3A 4IVFA 2OADA 2YNXA 17GSA 2FGXA 5A4VA 1GSYA 2YV7A 4RI6A 3DD3A 1DBYA 3LEFA 2HRFA 3CSJA 1FW1A 3VWWA 3IC4A 3RPPA 4TR1B 3QPMA 2K9FA 2HXKA 1ZCPA 3JCML 2I3YA 4EE0A 3FYGA 3LGCA 5GSSA 5IO0A 4GLTA 1M0UA 5H5SA 3RBTA 3M9JA 5E59A 3DRNA 1R4WA 3NZNA 3IK9A 5ECLB 3U6VA 3A5WA 2LUSA 4AGSA 2VUPA 4K7NA 3F8UA 1KEBA 3ED3A 2DBCA 3APSA 5D9WA 2PVQA 2NPBA 2H75A 3LFLA 1Z7PA 2QSIA 2O87A 3KJYA 2XBQA 2LRTA 5CNWA 1OVNA 5LNKe 1ZOFA 4ISDA 11GSA 2YWNA 1MDKA 2R6KA 4IW9A 4WBJA 5IO2A 4WR4A 5IMVA 1XWBA 2P5RA 2C1YA 2E7PA 2MBTA 2C4JA 4OFMA 2DJ1A 3NIVA 4ZL7A 2CAQA 3CMIA 4HOJA 2YJ7A 2C0FA 4D73A 3TRPA 2JSZA 2P5QA 1Z3EA 3IK7A 2DJKA 1EV9A 1IYHA 4TRXA 3UL3A 4IN0A 1O81A 3D4TA 3CTFA 4FYBA 4GTUA 3ZIVA 5ELGA 2HFDA 2LJAA 1YDKA 1V40A 1ERUA 5HFKA 6GSWA 4OO5A 2DMMA 2VOCA 4N30A 4E8EA 2DMLA 2FY6A 4POLA 1SJZA 1FVJA 1SENA 1F3BA 2H6YA 2ON7A 3GKKA 1R7HA 4ZB8A 1Y6EA 1JZOA 3EU3A 1MD3A 5KN2A 1GSFA 2YCDA 2VAFA 5AN1A 4ZBDA 1M2DA 4TR0A 3KGKA 3CTGA 4PX1A 3ERGA 4MZBA 4JEDA 2H30A 2NBSA 1EP8A 1GSQA 4FYCA 4N11A 5F06A 3C73A 2KP2A 2ZCTA 5D93A 2JACA 1VRSD 5JCWA 1NHOA 2FUG2 2TRCP 2VCTA 3ZLPA 1GNEA 4NWYA 1J08A 1ZL9A 5CRHA 2XHFA 4XRAA 2MYGA 2HI7A 1WRYA 3HXSA 4HZ2A 4V1Ap 4IP1A 2H1AA 4JZQA 3W6GA 4HZ4A 1H4OA 4IGJA 3RHCA 2VLVA 6GSYA 3KIJA 4BA7A 4BPYA 1GTBA 2WZ9A 3ZVJA 2CZ3A 2LS5A 3MNGA 2BTOT 3KM6A 3L78A 5ECMB 2H0IA 3O3TA 1GSUA 4MF6A 2OBIA 2IL3A 2X64A 1X5EA 1GUKA 4ILFA 4DEJA 2H1DA 1X5CA 2YPMA 3TDGA 1SKWB 4QL9A 1GTIA 2GSTA 3PR8A 3D6IA 2H0GA 2JZRA 1AC1A 2K8SA 3UVHA 2WRTA 3BD2A 3QAWA 3M8NA 3FZAA 3QMXA 5LD0A 1BYEA 3ZTLA 4WR5A 1GSSA 3C1SA 1F9MA 2AUVA 5COHA 4LMVA 3Q18A 1QXHA 4I2UA 2WFCA 5ECQB 4YQMA 3WGXA 2FWEA 5DCHA 4LA1A 4AJ8A 2IMKA 2HZEB 4F82A 2GT6A 5ABRA 5F0GA 2VIMA 1E6BA 1TK0B 2YZHA 3TGZA 2CAIA 4KGIA 3V1WA 5B6MA 1PQNA 4TW5A 1ML6A 1BX9A 2RM6A 1GP1A 3NOFA 2IWTA 1AAZA 4QL7A 3C1RA 1O6JA 10GSA 2F8AA 4ML6A 2R5GA 1SYXA 3MWHA 5HFIA 1T4YA 2K8VA 4F0CA 4ECBA 3HZ4A 1WP0A 3TJGA 1NW2A 2DIZA 3VPTA 3EYTA 3F4RA 3D21A 3FKFA 4JBBA 2L4QA 3UBLA 5JWQB 3IPZA 1XW9A 2GZPA 2HSYA 4LMWA 4MH2A 1I5GA 1YKAA 1TW9A 2E2MA 3LJRA 3MSZA 1URMA 2DJ3A 1PRXA 4IS0A 2L59A 1XW5A 3L9SA 4Q5NA 1TK8B 2GVPA 3HVVA 1E2YA 2LV3A 2TIRA 2WULA 1N8JA 1U6TA 4KB3A
chains in the Genus database with same CATH superfamily
2LNTA 2X99A 3GH6A 3EINA 4WBRD 1M3JA 1OKDA 3IHGA 1JZWA 3MYDA 4MA9A 4A5PA 3FMWA 6GSTA 3D22A 4Z2RA 4PXOA 1RQMA 1OE8A 1OC3A 1GSEA 4NV2A 1GTAA 1JLVA 3VURA 1O8XA 3KH7A 3G7YA 2K18A 2EC4A 1FOVA 5ECOB 1GUMA 3GKXA 3P7XA 4GCIA 1XFLA 4YH2A 1GLQA 1O85A 5CYYA 1AQVA 3UVTA 2VL2A 5KN3A 2PUKC 3C7MA 1XXUA 4JR6A 1QGVA 1VF1A 3UBKA 4GRFA 3IOSA 5KOWA 1A2MA 5G30A 1SJ6A 1Q4JA 4TVEA 2ES7A 5HFGA 2YWOA 1GLPA 3ZREA 1F6MC 3Q74A 3IXRA 3F63A 2IN3A 3TRXA 1W4VA 1A0FA 2IMIA 1FOHA 2H8LA 2LEGA 4O5RA 3L9UA 3A2VA 2AHEA 3KZQA 3KP9A 2ALBA 3GUSA 5KEJA 1TI3A 4ID0A 5D9TA 1QMVA 2TRXA 4P3YB 2FLSA 2CZ2A 3H4KA 1R5PA 1VGLA 3GL5A 3M9KA 5CRDA 3VI7A 1O7UA 3EE2A 2F3MA 2R0PA 4G2EA 4BL7A 1ZYQB 2I9HA 3WGDA 5ECRB 2GQMA 3GRXA 5DCGA 4X43A 4I6XA 2KOKA 4YKFA 4HQSA 2AB6A 5HR3A 1B48A 2LQQA 2HSHA 4D73B 3BOAA 5HQPA 3LYKA 1PA3A 2IFQB 5J9CA 1GUHA 1FHEA 4IKHA 3UARA 3K8NA 3CSIA 2B1KA 4FO5A 3GTUA 2HRAA 2V6OA 3IV4A 2JU5A 2HZFA 5EVOA 1GTUA 4BVXA 2OE1A 3KMOA 2O85A 4DSQA 2P0GA 4L5OA 2B7KA 2FHEA 5AISA 3EC3A 4NHZA 3HYPA 4N0ZA 1UC7A 3I43A 1AUCA 1GL8A 4YQVA 3BJ5A 2OE3A 2DIYA 4FYUA 3UMAA 3DMLA 1V9WA 4DSSA 1XVQA 4POBA 1YEPA 5B7CA 4EC0A 2F8FA 5F07A 5EY6A 3HJPA 2RIIA 1OE7A 3FY7A 5IMFA 2DKHA 3EWLA 1V58A 4Q5QA 5BRTA 1XWKA 2QKEA 1ON4A 3AY8A 1XIYA 1BJXA 5DAKA 3J7Yb 2H1GA 4FIWA 2YWMA 1ERTA 2CV4A 4MPGA 1PL2A 2PVOC 3Q19A 3LW9A 1T8EB 2CA8A 5ECIB 1AQWA 13GSA 2YOIA 2PWJA 4JU5A 2YN1A 2MMNA 2O7KA 4WF5A 5KN0A 3BCIA 1F37A 3IC8A 1XBSA 1ZYPA 4WXTA 3GN3A 1S3RA 6GSSA 5CRWA 2REMA 2VCZA 3GH9A 2KLXA 3HA9A 1M99A 4V2MA 2O89A 1PGTA 1MDJA 4MF7A 2H66A 2VCVA 1X9SB 5FT3A 5J41A 3LXTA 1PFOA 2XPEA 3HHVA 3IAM2 1V57A 4G9HA 2WS2A 4PGTA 2AV4A 4PQHA 3I9V2 4PUFC 4HSCX 4HS1A 3ZYWA 2H6ZA 4TR1A 3GSSA 4L8EA 5J3RA 3ZL5A 3MIXA 1X9WB 1TK5B 1LU4A 2C0GA 1XZOA 1J9BA 1GULA 3R2QA 5ECHB 4O5UA 3TKSE 1DUGA 4MJAA 4XS1A 2GQLA 1K0MA 1OC9A 3KD0A 1X0RA 3IAS2 2OE0A 4WEYA 3VWVA 8GSSA 1ZZYA 3HDCA 4OWYA 1K0CA 1GRXA 1V98A 5EL8A 2OJLA 4KDXA 2YV9A 3DGQA 3QDNA 4OCEA 2V1MA 2VCXA 2CX3A 1WE0A 1R5AA 4MPFA 4EXJA 3GIXA 4ZL8A 5GAPD 4GSNA 5F05A 4K7IA 4ACSA 5HR2A 3H1NA 1YQ1A 4KH7A 3CRTA 4TR4A 3UOMA 3RPNA 5J4UA 1M7TA 3BBYA 2MMOA 1AXDA 5IPGA 3HVXA 2DKIA 4NAXA 2H74A 3HVSA 1DE1A 3KEBA 1SD8A 5B8AA 4TOPA 2LNSA 1TDIA 5IQYA 2X8CA 1FG4A 3ME7A 4PNFA 1ERVA 2D2ZA 3CYNA 4GSTA 2H1BA 4DVCA 5HR0A 3RHBA 3VLNA 1GSDA 2KHPA 3WGEA 4N10A 1U87A 4AJ6A 4OCFA 3ISOA 4ZBBA 4XCSA 1TJDA 3HZ8A 2NVLA 2LJRA 1SL1B 1UVZA 1VF3A 2OKAA 1T4ZA 4G10A 5GAND 6GSXA 1A23A 3GSTA 3GA4A 2L4CA 1K0DA 3UJ1A 1U3IA 1B9YC 3P2AA 2V32A 4POKA 4K0GA 4X1UA 2FWFA 2GTUA 1HQOA 5DALA 2V41A 2KUCA 1OC8A 2OA7A 1EP7A 4I8BA 5J5NA 3FRCA 3ZMLA 3RDWA 4KX4A 2H6XA 3LQ7A 1C72A 2GGTA 4XS4B 2PU9C 3G7JA 2WCIA 2IJYA 2GSQA 3WT1A 2O8VB 3C8EA 2C0DA 2HLSA 4Q5RA 4GWRA 1M3IA 3D4MA 1FB0A 2QA2A 3HCZA 3GL3A 1USBA 2FNOA 4Z2UA 1JHBA 1TXXA 1YJ6A 5DQSA 4JRRA 3ZITA 4EDZA 5GZZB 3TRQA 2HE3A 1XG8A 4BIKA 2F9SA 5IMAA 1EOGA 2H76A 4K2DA 2CVBA 3VFIA 2L5LA 3KTBA 2FWHA 1K0OA 4O92A 2MMZA 4GSSA 1GWCA 1G6YA 3O76A 5D9VA 3H79A 2IMDA 3IE3A 1QFNA 4KCAA 5INYA 4KA0A 5A5KA 4HDEA 3DXBA 2F51A 1DE2A 4TXVA 5CREA 14GSA 3GX8A 4PQ1A 4OFTA 5ECSA 4KDYA 3IRAA 3EMPA 4RQRA 1PN0A 3FR9A 3PGTA 4L0UA 1Z6MA 3ZIJA 2JL4A 2CVKA 4CHSA 3Q6OA 2NDOA 5CP1A 4Z7XA 4GXZA 4MH3A 2C8UA 4ECCA 1T7PB 5G31A 1RW1A 2HT9A 3J7Yk 2JSYA 1A2JA 5GSTA 5ID2A 1AW9A 4WKWA 4BL7B 4MP4A 2B5YA 5G2ZA 4USSA 5JCUA 5AIXA 2VL9A 3DKSA 4HU9A 3FR6A 1EEJA 2LSTA 3TCOA 1GNWA 2CT6A 4FQUA 2HSMA 2PPTA 2I4AA 2OACA 1XW6A 4V2NA 2GS3A 4MLYA 4QQ7A 1BAYA 1QUWA 2LJKA 2G2QA 1JFUA 3US3A 4BVYA 1PKZA 4KDUA 5ECPB 1B4PA 2A4VA 4FH8A 3GTUB 4G0LA 4ML1A 3P8WA 4K8MA 2DC5A 1N2AA 4NMUA 4ZXGA 5IOWA 5IMCA 4J2FA 1Y25A 3WT2A 1B9XC 3F0IA 5FWGA 1J0FA 2I1UA 4DSSB 1I9DA 2C3QA 1HNAA 2GSRA 3DVXA 3TOTA 4HQZA 1X5DA 4GQFA 4IQ1A 2C80A 1VF2A 5G1LA 4CW9A 2RLIA 1YF1A 4LLRA 3TJJA 1ABAA 1ACVA 4HI7A 4EO3A 1M2BA 2B3SA 3ZFLA 2VM2A 4ECIA 5DJLA 3W8SA 3TKRA 2L6CA 1EEMA 4O7HA 5DAKB 5DQYA 1MTCA 4HEA2 1Z6NA 3FZ4A 3E9JB 4HJ2A 4PUAA 4F0BA 4EKZA 2QA1A 1B4QA 2HYXA 2G0FA 1ZYEA 2RUFA 1O8WA 3F4TA 4IBPA 1SK0A 3EVIA 1K3OA 2R37A 3TKPA 4O5QA 5J9BA 1EV4A 3OR5A 2AAWA 4J57E 3LORA 1EZKA 3WYWA 1R26A 4XTSA 4F2IA 3FZ5A 1PX6A 3IBHA 3SWLA 3ZMKA 4POMA 2OBKA 4K9ZA 3G9BA 2WB9A 5IPHA 3MDKA 1QK8A 2N5FA 1ZGNA 1YZXA 2QC7A 4O32A 1PD21 3TUEA 2IPAA 5G5FA 1IYIA 4KAEA 5F8BA 5IM9A 2VCWA 1TKDB 2J9HA 3HVNA 1EWXA 5ECNB 2GQKA 1EGRA 1ERWA 4G19A 3GURA 4TXOA 4NHWA 2VO4A 3PH9A 1Z7RA 2DJ0A 3GV1A 1KBNA 2A4HA 3D5JA 1A24A 2LTKA 1MDIA 1SYRA 2QGVA 4OFNA 1OC9B 1S3CA 1SL0B 4MJCA 3EU4A 5B6NA 1PX7A 4CDOA 5D73A 4KSMA 1TTZA 2WJUA 5KN1A 3TKSC 5B8BA 3L9VA 3F3QA 4K5RA 4J56E 2BJXA 5DBQA 2FWGA 2DSAA 4HUAA 4MF5A 5ENUA 2GZYA 5AGYA 1F2EA 5DDLA 9GSSA 5FHIA 2ZUPA 2R0CA 3FW2A 2PMTA 1V2AA 2M80A 1YKCA 3TJFA 3N9JA 4NPBA 2VL2C 1QQ2A 1SJIA 5IIZA 3VPQA 1WJKA 1G6WA 4IP6A 2WGRA 1THXA 2AJQB 2B5XA 2IFQA 3FEUA 3I6AA 3LG6A 4MZCA 1BEDA 1TU7A 1FAAA 4KUNA 3IDVA 2L5OA 3GFKA 4N0VA 3ERWA 1U88A 1CQGA 3MAKA 3QAGA 1H75A 1FVKA 2DJ2A 2VLUA 2H19A 4Q5FA 4RI7A 1JZDA 2EIQA 2M72A 1VF4A 2XBIA 4TKYA 1SKRB 1XPVA 5IMZA 3FK8A 5DVBA 2H70A 2PGTA 1JZRA 3KMNA 2LKUA 4BWQA 4ZL9A 1AIUA 3CBUA 3DIEA 2EIOA 1HNBA 1SK1A 2DJJA 7GSSA 1OAZA 5EPFA 1CQHA 2R3XA 1PL1A 3KXOA 1GH2A 2VLTA 2B7JA 3QOUA 4MABA 2RM5A 3N5OA 4RQXA 4KSOA 1ILOA 4XRDA 5DALB 5LCZA 22GSA 4ZILA 2CX4A 3W8JA 2FD3A 1SL2B 3GNJA 1YY7A 2C3NA 1XWAA 3GMFA 3ZRDA 4XHMA 2GLRA 2HRKA 2WDUA 2X8GA 4YKGA 4ZIJA 1ZMAA 4GQCA 2B1LA 2ZNMA 4MZWA 2B6MA 2C0EA 2YP6A 5JWOB 2R4VA 1TRWA 18GSA 5ECKB 1RK4A 2E0QA 1SD9A 5D8IA 4RUVA 3UAPA 1UA5A 5JWRB 1A8LA 1JLWA 1PMTA 4IJIA 1MD4A 1EOHA 1TRSA 4GF0A 1YEXA 1K0NA 4I5QA 3HD5A 6GSUA 2CQ9A 3HJOA 2FA8A 3GKNA 1PN9A 4YAPA 4HU7A 4YAVA 1HNCA 4K0NA 5C00A 2H73A 3GKMA 3TJBA 3TJKA 3DEXA 3APOA 4OD7A 4G0IA 4MJEA 1XVWA 3IA1A 2X8HA 3KH9A 4I2TA 3E3EA 3HY2A 1TOFA 2IMEA 3HJMA 3O6TA 2BMXA 1SU9A 12GSA 3A3TA 5L71A 20GSA 2H72A 1K3YA 3UEMA 5D9XA 1AQXA 5C04A 4F9ZA 4ZB6A 3LYPA 1K3LA 3TOUA 4K1FA 5A4WA 4MMMA 4ZB9A 3F4SA 1S3DA 4WF4A 1G7EA 2P31A 3S9FA 3CQFA 3TKQA 5ID2B 2GZZA 2A2SA 1M9BA 2LRNA 2MZCA 1Q98A 2FA4A 3ZVJD 5IOXA 2VM1A 4JR4A 4OMVA 4X0XA 4JE1A 3LWAA 5E4WA 2LRCA 3F6DA 3HKRA 1DSBA 2PN8A 4MDCA 2LQOA 3APQA 2JADA 5CRGA 3QR6A 1FO5A 1THOA 4ULXA 2XPDA 4BVYB 1SK2A 4CY8A 1NHYA 1O73A 2NTOA 2N5BA 4PNGA 2R2JA 1A0RP 4OO4A 3L0HA 4K7OA 3F3RA 5G5EA 1PSQA 3EMXA 3QD9A 2V6KA 1ST9A 5CAXA 5D96A 4K2XA 5KOXA 5AIVA 5H5RA 1TRUA 2YANA 3C71A 3CSHA 1S3AA 2FCHA 3DVWA 3WD6A 2YJHA 2H0HA 3CXGA 1WOUA 3E0UA 1Z9HA 3LXZA 2E2GA 2H01A 2VD1A 1WMJA 1HYUA 3G7IA 2MBSA 1A2LA 2A2RA 19GSA 4MK3A 3TB2A 3ME8A 3QFAC 5DJMA 1TRVA 3CRUA 3U5RE 2XC2A 3QCPA 1XOAA 2J23A 4PQIA 4AJ7A 1UN2A 1K0AA 3KP8A 3ZZXA 1OYJA 5BMUA 2IMFA 3PINA 2HZEA 4AF2A 2AYTA 2L6DA 3DYRA 2VCQA 1LJRA 5HR1A 3EURA 2RUEA 2JZTA 2B5EA 4XIHA 2N5AA 3P90A 4XS4A 5A4UA 1XWCA 2DLXA 4BWSA 3F6FA 4PTSA 3L4NA 1BQ7A 4V1Ag 4IELA 4KCEA 4NV5A 4E8HA 1X9MB 3A2XA 4EF0A 4TN8A 1M2AA 5IMDA 1FB6A 4TR3A 1T1VA 3GHAA 2PERA 1K0BA 4ZBAA 3TKSA 2IIYA 2Z9SA 4EL1A 1KNGA 3GX0A 4EDYA 4V2LA 1F3AA 3LSZA 2H71A 4BVXB 2C3TA 16GSA 1M9AA 5ELAA 4IHUA 3VWUA 1NSWA 2I81A 3BCKA 3ZFBA 1B8XA 2PBJA 1G0TA 3VWXA 4KW6A 2HRNA 1G7OA 3F9UA 3H93A 1W89A 3RAZA 5G1KA 4I97A 2YZUA 2UZ8A 3FR3A 1XOBA 1WWJA 1YF0A 4TXOB 1U3AA 2GT5A 2K6VA 5H5QA 4YQUA 2EIRA 3FHKA 4F03A 1TI1A 4L5LA 4K5SA 4LL4B 3VI5A 1A8YA 3A2WA 2L57A 6GSVA 2V2GA 3M1GA 4NXIA 1PKWA 3QFBC 3M0FA 4LL1B 1XCCA 4H86A 4KE3A 1HD2A 1OKTA 5JCGA 2ON5A 4MJBA 4KNDA 4IQAA 3DWVA 3FZ9A 4IJ3A 1TU8A 1ZYNA 1T00A 3D0ZA 3VK9A 2CVDA 1KTEA 3H8QA 4K6XA 2MMAA 1BG5A 2M46A 1NM3A 3KTLA 3GYKA 2JZSA 3R3EA 2YWIA 1WIKA 1T3BA 1SKSB 4L0WA 3IHQA 1EGOA 1MEKA 3M3MA 1LBKA 2VL3A 4XS6A 4ECJA 3SBCA 1XWGA 4MCUA 2GDRA 1Z5YE 4EUYA 1TP9A 2GSSA 4WETA 4PURA 4DSRA 4EVMA 2HNLA 2KP1A 4HJMA 3I69A 3QAVA 3ERFA 3KCMA 2VD0A 3IR4A 1WPIA 3UIWA 5CO3A 4IVFA 2OADA 2YNXA 17GSA 2FGXA 5A4VA 1GSYA 2YV7A 4RI6A 3DD3A 1DBYA 3LEFA 2HRFA 3CSJA 1FW1A 3VWWA 3IC4A 3RPPA 4TR1B 3QPMA 2K9FA 2HXKA 1ZCPA 3JCML 2I3YA 4EE0A 3FYGA 3LGCA 5GSSA 5IO0A 4GLTA 1M0UA 5H5SA 3RBTA 3M9JA 5E59A 3DRNA 1R4WA 3NZNA 3IK9A 5ECLB 3U6VA 3A5WA 2LUSA 4AGSA 2VUPA 4K7NA 3F8UA 1KEBA 3ED3A 2DBCA 3APSA 5D9WA 2PVQA 2NPBA 2H75A 3LFLA 1Z7PA 2QSIA 2O87A 3KJYA 2XBQA 2LRTA 5CNWA 1OVNA 5LNKe 1ZOFA 4ISDA 11GSA 2YWNA 1MDKA 2R6KA 4IW9A 4WBJA 4EIQA 5IO2A 4WR4A 5IMVA 1XWBA 2P5RA 2C1YA 2E7PA 2MBTA 2C4JA 3EPTA 4OFMA 2DJ1A 3NIVA 4ZL7A 2CAQA 3CMIA 4HOJA 2YJ7A 2C0FA 4D73A 3TRPA 2JSZA 2P5QA 1Z3EA 3IK7A 2DJKA 1EV9A 1IYHA 4TRXA 3UL3A 4IN0A 1O81A 3D4TA 3CTFA 4FYBA 4GTUA 3ZIVA 5ELGA 2HFDA 2LJAA 1YDKA 1V40A 1ERUA 5HFKA 6GSWA 4OO5A 2DMMA 2VOCA 4N30A 4E8EA 2DMLA 2FY6A 4POLA 1SJZA 1FVJA 1SENA 1F3BA 2H6YA 2ON7A 3GKKA 1R7HA 4ZB8A 1Y6EA 1JZOA 3EU3A 1MD3A 5KN2A 1GSFA 2YCDA 2VAFA 5AN1A 4ZBDA 1M2DA 4TR0A 3KGKA 3CTGA 4PX1A 3ERGA 4MZBA 4JEDA 2H30A 2NBSA 1EP8A 1GSQA 4FYCA 4N11A 5F06A 3C73A 2KP2A 2ZCTA 5D93A 2JACA 1VRSD 5JCWA 1NHOA 2FUG2 2TRCP 2VCTA 2R0GA 3ZLPA 1GNEA 4NWYA 1J08A 1ZL9A 5CRHA 2XHFA 4XRAA 2MYGA 2HI7A 1WRYA 3HXSA 4HZ2A 4V1Ap 4IP1A 2H1AA 4JZQA 3W6GA 4HZ4A 2A2PA 1H4OA 4IGJA 3RHCA 4KF9A 2VLVA 6GSYA 3KIJA 4G0KA 4MNNA 4BA7A 4BPYA 1GTBA 2WZ9A 3ZVJA 2CZ3A 2LS5A 3MNGA 2BTOT 3KM6A 3L78A 5ECMB 2H0IA 3O3TA 1GSUA 4MF6A 2OBIA 2IL3A 2X64A 1X5EA 1GUKA 4ILFA 4Z2TA 4DEJA 2H1DA 1X5CA 2YPMA 3TDGA 1SKWB 4X4JA 4QL9A 1GTIA 2GSTA 3PR8A 4EIPA 3D6IA 2H0GA 2JZRA 1AC1A 4CY6A 2K8SA 3UVHA 2WRTA 3BD2A 3QAWA 3M8NA 2X49A 3FZAA 3QMXA 5LD0A 1BYEA 3ZTLA 4WR5A 1GSSA 3C1SA 1F9MA 2AUVA 5COHA 4LMVA 3Q18A 1QXHA 4I2UA 2WFCA 5ECQB 4YQMA 3WGXA 2FWEA 5DCHA 4LA1A 4AJ8A 2IMKA 2HZEB 3PPUA 4F82A 2X4AA 2GT6A 5ABRA 5F0GA 2VIMA 1E6BA 1TK0B 2YZHA 3TGZA 2CAIA 4KGIA 3V1WA 5B6MA 1PQNA 4TW5A 1ML6A 1BX9A 2RM6A 1GP1A 3NOFA 2IWTA 1AAZA 4QL7A 3C1RA 4ICYA 1O6JA 10GSA 2F8AA 4ML6A 2R5GA 1SYXA 3MWHA 5HFIA 1T4YA 2K8VA 4F0CA 4ECBA 3HZ4A 1WP0A 3TJGA 1NW2A 2DIZA 3VPTA 3EYTA 3F4RA 3D21A 3FKFA 4JBBA 2L4QA 3UBLA 5JWQB 3IPZA 1XW9A 2GZPA 2HSYA 4LMWA 4MH2A 1I5GA 1YKAA 1TW9A 2E2MA 3LJRA 3MSZA 1URMA 3A5IA 2DJ3A 1PRXA 4IS0A 2L59A 1XW5A 3L9SA 4Q5NA 1TK8B 2GVPA 3HVVA 1E2YA 2LV3A 2TIRA 2WULA 1N8JA 1U6TA 4KB3A
chains in the Genus database with same CATH topology
2LNTA 2X99A 3GH6A 3EINA 4WBRD 1OKDA 3IHGA 1JZWA 3MYDA 4MA9A 4A5PA 3FMWA 6GSTA 3D22A 4Z2RA 4PXOA 1RQMA 1OE8A 1OC3A 1GSEA 4NV2A 1GTAA 1JLVA 3VURA 1O8XA 3KH7A 3G7YA 2K18A 2EC4A 1FOVA 5ECOB 1GUMA 3GKXA 3P7XA 4GCIA 1XFLA 4YH2A 1GLQA 1O85A 5CYYA 1AQVA 3UVTA 2VL2A 5KN3A 2PUKC 3C7MA 1XXUA 4JR6A 1QGVA 1VF1A 3UBKA 4GRFA 3IOSA 5KOWA 1A2MA 5G30A 1SJ6A 1Q4JA 4TVEA 2ES7A 5HFGA 2YWOA 1GLPA 3ZREA 1F6MC 3Q74A 3IXRA 3F63A 2IN3A 3TRXA 1W4VA 1A0FA 2IMIA 1FOHA 2H8LA 2LEGA 4O5RA 3L9UA 3A2VA 2AHEA 3KZQA 3KP9A 2ALBA 3GUSA 5KEJA 1TI3A 4ID0A 5D9TA 1QMVA 2TRXA 4P3YB 2FLSA 2CZ2A 3H4KA 1R5PA 1VGLA 3GL5A 3M9KA 5CRDA 3VI7A 1O7UA 3EE2A 2F3MA 2R0PA 4G2EA 4BL7A 1ZYQB 2I9HA 3WGDA 5ECRB 2GQMA 3GRXA 5DCGA 4X43A 4I6XA 2KOKA 4YKFA 4HQSA 2AB6A 5HR3A 1B48A 2LQQA 2HSHA 4D73B 3BOAA 5HQPA 3LYKA 1PA3A 2IFQB 5J9CA 1GUHA 1FHEA 4IKHA 3UARA 3K8NA 3CSIA 2B1KA 4FO5A 3GTUA 2HRAA 2V6OA 3IV4A 2JU5A 2HZFA 5EVOA 1GTUA 4BVXA 2OE1A 3KMOA 2O85A 4DSQA 2P0GA 4L5OA 2B7KA 2FHEA 5AISA 3EC3A 4NHZA 3HYPA 4N0ZA 1UC7A 3I43A 1AUCA 1GL8A 4YQVA 3BJ5A 2OE3A 2DIYA 4FYUA 3UMAA 3DMLA 1V9WA 4DSSA 1XVQA 4POBA 1YEPA 5B7CA 4EC0A 2F8FA 5F07A 5EY6A 3HJPA 2RIIA 1OE7A 3FY7A 5IMFA 2DKHA 3EWLA 1V58A 4Q5QA 5BRTA 1XWKA 2QKEA 1ON4A 3AY8A 1XIYA 1BJXA 5DAKA 3J7Yb 2H1GA 4FIWA 2YWMA 1ERTA 2CV4A 4MPGA 1PL2A 2PVOC 3Q19A 3LW9A 1T8EB 2CA8A 5ECIB 1AQWA 13GSA 2YOIA 2PWJA 4JU5A 2YN1A 2MMNA 2O7KA 4WF5A 5KN0A 3BCIA 1F37A 3IC8A 1XBSA 1ZYPA 4WXTA 3GN3A 6GSSA 5CRWA 2REMA 2VCZA 3GH9A 2KLXA 3HA9A 1M99A 4V2MA 2O89A 1PGTA 1MDJA 4MF7A 2H66A 2VCVA 1X9SB 5FT3A 5J41A 3LXTA 4G9HA 2XPEA 3HHVA 3IAM2 1V57A 2WS2A 4PGTA 2AV4A 4PQHA 3I9V2 4PUFC 4HS1A 3ZYWA 2H6ZA 4TR1A 3GSSA 4L8EA 5J3RA 3ZL5A 3MIXA 1X9WB 1TK5B 1LU4A 2C0GA 1XZOA 1J9BA 1GULA 3R2QA 5ECHB 4O5UA 3TKSE 1DUGA 4MJAA 4XS1A 2GQLA 1K0MA 1OC9A 3KD0A 1X0RA 3IAS2 2OE0A 4WEYA 3VWVA 8GSSA 1ZZYA 3HDCA 4OWYA 1K0CA 1GRXA 1V98A 5EL8A 2OJLA 4KDXA 2YV9A 3DGQA 3QDNA 4OCEA 2V1MA 2VCXA 2CX3A 1WE0A 1R5AA 4MPFA 4EXJA 3GIXA 4ZL8A 5GAPD 4GSNA 5F05A 4K7IA 4ACSA 5HR2A 3H1NA 1YQ1A 4KH7A 3CRTA 4TR4A 3UOMA 3RPNA 5J4UA 1M7TA 3BBYA 2MMOA 1AXDA 5IPGA 3HVXA 2DKIA 4NAXA 2H74A 3HVSA 1DE1A 3KEBA 1SD8A 5B8AA 4TOPA 2LNSA 1TDIA 5IQYA 2X8CA 1FG4A 3ME7A 4PNFA 1ERVA 2D2ZA 3CYNA 4GSTA 2H1BA 4DVCA 5HR0A 3RHBA 3VLNA 1GSDA 2KHPA 3WGEA 4N10A 1U87A 4AJ6A 4OCFA 3ISOA 4ZBBA 4XCSA 1TJDA 3HZ8A 2NVLA 2LJRA 1SL1B 1UVZA 1VF3A 2OKAA 1T4ZA 4G10A 5GAND 6GSXA 1A23A 3GSTA 3GA4A 2L4CA 1K0DA 3UJ1A 1U3IA 1B9YC 3P2AA 2V32A 4POKA 4K0GA 4X1UA 2FWFA 2GTUA 1HQOA 5DALA 2V41A 2KUCA 1OC8A 2OA7A 1EP7A 4I8BA 5J5NA 3FRCA 3ZMLA 3RDWA 4KX4A 2H6XA 3LQ7A 1C72A 2GGTA 4XS4B 2PU9C 3G7JA 2WCIA 2IJYA 2GSQA 3WT1A 2O8VB 3C8EA 2C0DA 2HLSA 4Q5RA 4GWRA 3D4MA 1FB0A 2QA2A 3HCZA 3GL3A 1USBA 2FNOA 4Z2UA 1JHBA 1TXXA 1YJ6A 5DQSA 4JRRA 3ZITA 4EDZA 5GZZB 3TRQA 2HE3A 2F9SA 5IMAA 1EOGA 2H76A 4K2DA 2CVBA 3VFIA 2L5LA 3KTBA 2FWHA 1K0OA 4O92A 2MMZA 4GSSA 1GWCA 1G6YA 3O76A 5D9VA 3H79A 2IMDA 3IE3A 1QFNA 4KCAA 5INYA 4KA0A 5A5KA 4HDEA 3DXBA 2F51A 1DE2A 4TXVA 5CREA 14GSA 3GX8A 4PQ1A 4OFTA 5ECSA 4KDYA 3IRAA 3EMPA 4RQRA 1PN0A 3FR9A 3PGTA 4L0UA 1Z6MA 3ZIJA 2JL4A 2CVKA 4CHSA 3Q6OA 2NDOA 5CP1A 4Z7XA 4GXZA 4MH3A 2C8UA 4ECCA 1T7PB 5G31A 1RW1A 2HT9A 3J7Yk 2JSYA 1A2JA 5GSTA 5ID2A 1AW9A 4WKWA 4BL7B 4MP4A 2B5YA 5G2ZA 4USSA 5JCUA 5AIXA 2VL9A 3DKSA 4HU9A 3FR6A 1EEJA 2LSTA 3TCOA 1GNWA 2CT6A 4FQUA 2HSMA 2PPTA 2I4AA 2OACA 1XW6A 4V2NA 2GS3A 4MLYA 4QQ7A 1BAYA 1QUWA 2LJKA 2G2QA 1JFUA 3US3A 4BVYA 1PKZA 4KDUA 5ECPB 1B4PA 2A4VA 4FH8A 3GTUB 4G0LA 4ML1A 3P8WA 4K8MA 2DC5A 1N2AA 4NMUA 4ZXGA 5IOWA 5IMCA 4J2FA 1Y25A 3WT2A 1B9XC 3F0IA 5FWGA 1J0FA 2I1UA 4DSSB 1I9DA 2C3QA 1HNAA 2GSRA 3DVXA 3TOTA 4HQZA 1X5DA 4GQFA 4IQ1A 2C80A 1VF2A 5G1LA 4CW9A 2RLIA 1YF1A 4LLRA 3TJJA 1ABAA 1ACVA 4HI7A 4EO3A 1M2BA 2B3SA 3ZFLA 2VM2A 4ECIA 5DJLA 3W8SA 3TKRA 2L6CA 1EEMA 4O7HA 5DAKB 5DQYA 1MTCA 4HEA2 1Z6NA 3FZ4A 3E9JB 4HJ2A 4PUAA 4F0BA 4EKZA 2QA1A 1B4QA 2HYXA 2G0FA 1ZYEA 2RUFA 1O8WA 3F4TA 4IBPA 1SK0A 3EVIA 1K3OA 2R37A 3TKPA 4O5QA 5J9BA 1EV4A 3OR5A 2AAWA 4J57E 3LORA 1EZKA 3WYWA 1R26A 4XTSA 4F2IA 3FZ5A 1PX6A 3IBHA 3SWLA 3ZMKA 4POMA 2OBKA 4K9ZA 3G9BA 2WB9A 5IPHA 3MDKA 1QK8A 2N5FA 1ZGNA 1YZXA 2QC7A 4O32A 1PD21 3TUEA 2IPAA 5G5FA 1IYIA 4KAEA 5F8BA 5IM9A 2VCWA 1TKDB 2J9HA 1EWXA 5ECNB 2GQKA 1EGRA 1ERWA 4G19A 3GURA 4TXOA 4NHWA 2VO4A 3PH9A 1Z7RA 2DJ0A 3GV1A 1KBNA 2A4HA 3D5JA 1A24A 2LTKA 1MDIA 1SYRA 2QGVA 4OFNA 1OC9B 1S3CA 1SL0B 4MJCA 3EU4A 5B6NA 1PX7A 4CDOA 5D73A 4KSMA 1TTZA 2WJUA 5KN1A 3TKSC 5B8BA 3L9VA 3F3QA 4K5RA 4J56E 2BJXA 5DBQA 2FWGA 2DSAA 4HUAA 4MF5A 5ENUA 2GZYA 5AGYA 1F2EA 5DDLA 9GSSA 5FHIA 2ZUPA 2R0CA 3FW2A 2PMTA 1V2AA 2M80A 1YKCA 3TJFA 3N9JA 4NPBA 2VL2C 1QQ2A 1SJIA 5IIZA 3VPQA 1WJKA 1G6WA 4IP6A 2WGRA 1THXA 2AJQB 2B5XA 2IFQA 3FEUA 3I6AA 3LG6A 4MZCA 1BEDA 1TU7A 1FAAA 4KUNA 3IDVA 2L5OA 3GFKA 4N0VA 3ERWA 1U88A 1CQGA 3MAKA 3QAGA 1H75A 1FVKA 2DJ2A 2VLUA 2H19A 4Q5FA 4RI7A 1JZDA 2EIQA 2M72A 1VF4A 2XBIA 4TKYA 1SKRB 1XPVA 5IMZA 3FK8A 5DVBA 2H70A 2PGTA 1JZRA 3KMNA 2LKUA 4BWQA 4ZL9A 1AIUA 3CBUA 3DIEA 2EIOA 1HNBA 1SK1A 2DJJA 7GSSA 1OAZA 5EPFA 1CQHA 2R3XA 1PL1A 3KXOA 1GH2A 2VLTA 2B7JA 3QOUA 4MABA 2RM5A 3N5OA 4RQXA 4KSOA 1ILOA 4XRDA 5DALB 5LCZA 22GSA 4ZILA 2CX4A 3W8JA 2FD3A 1SL2B 3GNJA 1YY7A 2C3NA 1XWAA 3GMFA 3ZRDA 4XHMA 2GLRA 2HRKA 2WDUA 2X8GA 4YKGA 4ZIJA 1ZMAA 4GQCA 2B1LA 2ZNMA 4MZWA 2B6MA 2C0EA 2YP6A 5JWOB 2R4VA 1TRWA 18GSA 5ECKB 1RK4A 2E0QA 1SD9A 5D8IA 4RUVA 3UAPA 1UA5A 5JWRB 1A8LA 1JLWA 1PMTA 4IJIA 1MD4A 1EOHA 1TRSA 4GF0A 1YEXA 1K0NA 4I5QA 3HD5A 6GSUA 2CQ9A 3HJOA 2FA8A 3GKNA 1PN9A 4YAPA 4HU7A 4YAVA 1HNCA 4K0NA 5C00A 2H73A 3GKMA 3TJBA 3TJKA 3DEXA 3APOA 4OD7A 4G0IA 4MJEA 1XVWA 3IA1A 2X8HA 3KH9A 4I2TA 3E3EA 3HY2A 1TOFA 2IMEA 3HJMA 3O6TA 2BMXA 1SU9A 12GSA 3A3TA 5L71A 20GSA 2H72A 1K3YA 3UEMA 5D9XA 1AQXA 5C04A 4F9ZA 4ZB6A 3LYPA 1K3LA 3TOUA 4K1FA 5A4WA 4MMMA 4ZB9A 3F4SA 1S3DA 4WF4A 1G7EA 2P31A 3S9FA 3TKQA 5ID2B 2GZZA 2A2SA 1M9BA 2LRNA 2MZCA 1Q98A 2FA4A 3ZVJD 5IOXA 2VM1A 4JR4A 4OMVA 4X0XA 4JE1A 3LWAA 5E4WA 2LRCA 3F6DA 3HKRA 1DSBA 2PN8A 4MDCA 2LQOA 3APQA 2JADA 5CRGA 3QR6A 1FO5A 1THOA 4ULXA 2XPDA 4BVYB 1SK2A 4CY8A 1NHYA 1O73A 2NTOA 2N5BA 4PNGA 2R2JA 1A0RP 4OO4A 3L0HA 4K7OA 3F3RA 5G5EA 1PSQA 3EMXA 3QD9A 2V6KA 1ST9A 5CAXA 5D96A 4K2XA 5KOXA 5AIVA 5H5RA 1TRUA 2YANA 3C71A 3CSHA 1S3AA 2FCHA 3DVWA 3WD6A 2YJHA 2H0HA 3CXGA 1WOUA 3E0UA 1Z9HA 3LXZA 2E2GA 2H01A 2VD1A 1WMJA 1HYUA 3G7IA 2MBSA 1A2LA 2A2RA 19GSA 4MK3A 3TB2A 3ME8A 3QFAC 5DJMA 1TRVA 3CRUA 3U5RE 2XC2A 3QCPA 1XOAA 2J23A 4PQIA 4AJ7A 1UN2A 1K0AA 3KP8A 3ZZXA 1OYJA 5BMUA 2IMFA 3PINA 2HZEA 4AF2A 2AYTA 2L6DA 3DYRA 2VCQA 1LJRA 5HR1A 3EURA 2RUEA 2JZTA 2B5EA 4XIHA 2N5AA 3P90A 4XS4A 5A4UA 1XWCA 2DLXA 4BWSA 3F6FA 4PTSA 3L4NA 1BQ7A 4V1Ag 4IELA 4KCEA 4NV5A 4E8HA 1X9MB 3A2XA 4EF0A 4TN8A 1M2AA 5IMDA 1FB6A 4TR3A 1T1VA 3GHAA 2PERA 1K0BA 4ZBAA 3TKSA 2IIYA 2Z9SA 4EL1A 1KNGA 3GX0A 4EDYA 4V2LA 1F3AA 3LSZA 2H71A 4BVXB 2C3TA 16GSA 1M9AA 5ELAA 4IHUA 3VWUA 1NSWA 2I81A 3BCKA 3ZFBA 1B8XA 2PBJA 1G0TA 3VWXA 4KW6A 2HRNA 1G7OA 3F9UA 3H93A 1W89A 3RAZA 5G1KA 4I97A 2YZUA 2UZ8A 3FR3A 1XOBA 1WWJA 1YF0A 4TXOB 1U3AA 2GT5A 2K6VA 5H5QA 4YQUA 2EIRA 3FHKA 4F03A 1TI1A 4L5LA 4K5SA 4LL4B 3VI5A 1A8YA 3A2WA 2L57A 6GSVA 2V2GA 3M1GA 4NXIA 1PKWA 3QFBC 3M0FA 4LL1B 1XCCA 4H86A 4KE3A 1HD2A 1OKTA 5JCGA 2ON5A 4MJBA 4KNDA 4IQAA 3DWVA 3FZ9A 4IJ3A 1TU8A 1ZYNA 1T00A 3D0ZA 3VK9A 2CVDA 1KTEA 3H8QA 4K6XA 2MMAA 1BG5A 2M46A 1NM3A 3KTLA 3GYKA 2JZSA 3R3EA 2YWIA 1WIKA 1T3BA 1SKSB 4L0WA 3IHQA 1EGOA 1MEKA 3M3MA 1LBKA 2VL3A 4XS6A 4ECJA 3SBCA 1XWGA 4MCUA 2GDRA 1Z5YE 4EUYA 1TP9A 2GSSA 4WETA 4PURA 4DSRA 4EVMA 2HNLA 2KP1A 4HJMA 3I69A 3QAVA 3ERFA 3KCMA 2VD0A 3IR4A 1WPIA 3UIWA 5CO3A 4IVFA 2OADA 2YNXA 17GSA 2FGXA 5A4VA 1GSYA 2YV7A 4RI6A 3DD3A 1DBYA 3LEFA 2HRFA 3CSJA 1FW1A 3VWWA 3IC4A 3RPPA 4TR1B 3QPMA 2K9FA 2HXKA 1ZCPA 3JCML 2I3YA 4EE0A 3FYGA 3LGCA 5GSSA 5IO0A 4GLTA 1M0UA 5H5SA 3RBTA 3M9JA 5E59A 3DRNA 1R4WA 3NZNA 3IK9A 5ECLB 3U6VA 3A5WA 2LUSA 4AGSA 2VUPA 4K7NA 3F8UA 1KEBA 3ED3A 2DBCA 3APSA 5D9WA 2PVQA 2NPBA 2H75A 3LFLA 1Z7PA 2QSIA 2O87A 3KJYA 2XBQA 2LRTA 5CNWA 1OVNA 5LNKe 1ZOFA 4ISDA 11GSA 2YWNA 1MDKA 2R6KA 4IW9A 4WBJA 4EIQA 5IO2A 4WR4A 5IMVA 1XWBA 2P5RA 2C1YA 2E7PA 2MBTA 2C4JA 3EPTA 4OFMA 2DJ1A 3NIVA 4ZL7A 2CAQA 3CMIA 4HOJA 2YJ7A 2C0FA 4D73A 3TRPA 2JSZA 2P5QA 1Z3EA 3IK7A 2DJKA 1EV9A 1IYHA 4TRXA 3UL3A 4IN0A 1O81A 3D4TA 3CTFA 4FYBA 4GTUA 3ZIVA 5ELGA 2HFDA 2LJAA 1YDKA 1V40A 1ERUA 5HFKA 6GSWA 4OO5A 2DMMA 2VOCA 4N30A 4E8EA 2DMLA 2FY6A 4POLA 1SJZA 1FVJA 1SENA 1F3BA 2H6YA 2ON7A 3GKKA 1R7HA 4ZB8A 1Y6EA 1JZOA 3EU3A 1MD3A 5KN2A 1GSFA 2YCDA 2VAFA 5AN1A 4ZBDA 1M2DA 4TR0A 3KGKA 3CTGA 4PX1A 3ERGA 4MZBA 4JEDA 2H30A 2NBSA 1EP8A 1GSQA 4FYCA 4N11A 5F06A 3C73A 2KP2A 2ZCTA 5D93A 2JACA 1VRSD 5JCWA 1NHOA 2FUG2 2TRCP 2VCTA 2R0GA 3ZLPA 1GNEA 4NWYA 1J08A 1ZL9A 5CRHA 2XHFA 4XRAA 2MYGA 2HI7A 1WRYA 3HXSA 4HZ2A 4V1Ap 4IP1A 2H1AA 4JZQA 3W6GA 4HZ4A 2A2PA 1H4OA 4IGJA 3RHCA 4KF9A 2VLVA 6GSYA 3KIJA 4G0KA 4MNNA 4BA7A 4BPYA 1GTBA 2WZ9A 3ZVJA 2CZ3A 2LS5A 3MNGA 2BTOT 3KM6A 3L78A 5ECMB 2H0IA 3O3TA 1GSUA 4MF6A 2OBIA 2IL3A 2X64A 1X5EA 1GUKA 4ILFA 4Z2TA 4DEJA 2H1DA 1X5CA 2YPMA 3TDGA 1SKWB 4X4JA 4QL9A 1GTIA 2GSTA 3PR8A 4EIPA 3D6IA 2H0GA 2JZRA 1AC1A 4CY6A 2K8SA 3UVHA 2WRTA 3BD2A 3QAWA 3M8NA 2X49A 3FZAA 3QMXA 5LD0A 1BYEA 3ZTLA 4WR5A 1GSSA 3C1SA 1F9MA 2AUVA 5COHA 4LMVA 3Q18A 1QXHA 4I2UA 2WFCA 5ECQB 4YQMA 3WGXA 2FWEA 5DCHA 4LA1A 4AJ8A 2IMKA 2HZEB 3PPUA 4F82A 2X4AA 2GT6A 5ABRA 5F0GA 2VIMA 1E6BA 1TK0B 2YZHA 3TGZA 2CAIA 4KGIA 3V1WA 5B6MA 1PQNA 4TW5A 1ML6A 1BX9A 2RM6A 1GP1A 3NOFA 2IWTA 1AAZA 4QL7A 3C1RA 4ICYA 1O6JA 10GSA 2F8AA 4ML6A 2R5GA 1SYXA 3MWHA 5HFIA 1T4YA 2K8VA 4F0CA 4ECBA 3HZ4A 1WP0A 3TJGA 1NW2A 2DIZA 3VPTA 3EYTA 3F4RA 3D21A 3FKFA 4JBBA 2L4QA 3UBLA 5JWQB 3IPZA 1XW9A 2GZPA 2HSYA 4LMWA 4MH2A 1I5GA 1YKAA 1TW9A 2E2MA 3LJRA 3MSZA 1URMA 3A5IA 2DJ3A 1PRXA 4IS0A 2L59A 1XW5A 3L9SA 4Q5NA 1TK8B 2GVPA 3HVVA 1E2YA 2LV3A 2TIRA 2WULA 1N8JA 1U6TA 4KB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNT A;  2X99 A;  3GH6 A;  3EIN A;  4WBR D;  1OKD A;  1JZW A;  4MA9 A;  6GST A;  3D22 A;  4PXO A;  1RQM A;  1OE8 A;  1OC3 A;  1GSE A;  4NV2 A;  1GTA A;  1JLV A;  3VUR A;  1O8X A;  3KH7 A;  3G7Y A;  2K18 A;  2EC4 A;  1FOV A;  5ECO B;  1GUM A;  3GKX A;  3P7X A;  4GCI A;  1XFL A;  4YH2 A;  1GLQ A;  1O85 A;  5CYY A;  1AQV A;  3UVT A;  2VL2 A;  5KN3 A;  2PUK C;  3C7M A;  1XXU A;  4JR6 A;  1QGV A;  1VF1 A;  3UBK A;  4GRF A;  3IOS A;  1A2M A;  5G30 A;  1SJ6 A;  1Q4J A;  4TVE A;  2ES7 A;  5HFG A;  2YWO A;  1GLP A;  3ZRE A;  1F6M C;  3Q74 A;  3IXR A;  3F63 A;  2IN3 A;  3TRX A;  1W4V A;  1A0F A;  2IMI A;  2H8L A;  2LEG A;  4O5R A;  3L9U A;  3A2V A;  2AHE A;  3KZQ A;  3KP9 A;  2ALB A;  3GUS A;  5KEJ A;  1TI3 A;  4ID0 A;  5D9T A;  1QMV A;  2TRX A;  4P3Y B;  2FLS A;  2CZ2 A;  3H4K A;  1R5P A;  1VGL A;  3GL5 A;  3M9K A;  5CRD A;  3VI7 A;  1O7U A;  3EE2 A;  2F3M A;  4G2E A;  4BL7 A;  1ZYQ B;  2I9H A;  3WGD A;  5ECR B;  2GQM A;  3GRX A;  5DCG A;  4X43 A;  4I6X A;  2KOK A;  4HQS A;  2AB6 A;  5HR3 A;  1B48 A;  2LQQ A;  2HSH A;  4D73 B;  3BOA A;  5HQP A;  3LYK A;  1PA3 A;  2IFQ B;  5J9C A;  1GUH A;  1FHE A;  4IKH A;  3UAR A;  3K8N A;  3CSI A;  2B1K A;  4FO5 A;  3GTU A;  2V6O A;  3IV4 A;  2JU5 A;  2HZF A;  5EVO A;  1GTU A;  4BVX A;  2OE1 A;  3KMO A;  2O85 A;  4DSQ A;  2P0G A;  4L5O A;  2B7K A;  2FHE A;  5AIS A;  3EC3 A;  4NHZ A;  3HYP A;  4N0Z A;  1UC7 A;  3I43 A;  1AUC A;  1GL8 A;  4YQV A;  3BJ5 A;  2OE3 A;  2DIY A;  4FYU A;  3UMA A;  3DML A;  1V9W A;  4DSS A;  1XVQ A;  4POB A;  1YEP A;  5B7C A;  4EC0 A;  2F8F A;  5F07 A;  5EY6 A;  3HJP A;  2RII A;  1OE7 A;  3FY7 A;  5IMF A;  3EWL A;  1V58 A;  4Q5Q A;  1XWK A;  2QKE A;  1ON4 A;  3AY8 A;  1XIY A;  1BJX A;  5DAK A;  3J7Y b;  2H1G A;  4FIW A;  2YWM A;  1ERT A;  2CV4 A;  4MPG A;  1PL2 A;  2PVO C;  3Q19 A;  1T8E B;  2CA8 A;  5ECI B;  1AQW A;  13GS A;  2YOI A;  2PWJ A;  4JU5 A;  2YN1 A;  2MMN A;  2O7K A;  4WF5 A;  5KN0 A;  3BCI A;  1F37 A;  1XBS A;  4WXT A;  3GN3 A;  6GSS A;  5CRW A;  2REM A;  2VCZ A;  3GH9 A;  2KLX A;  3HA9 A;  1M99 A;  4V2M A;  2O89 A;  1PGT A;  1MDJ A;  4MF7 A;  2H66 A;  2VCV A;  1X9S B;  5FT3 A;  5J41 A;  3LXT A;  4G9H A;  2XPE A;  3HHV A;  3IAM 2;  1V57 A;  2WS2 A;  4PGT A;  2AV4 A;  4PQH A;  3I9V 2;  4PUF C;  4HS1 A;  3ZYW A;  2H6Z A;  4TR1 A;  3GSS A;  4L8E A;  5J3R A;  3ZL5 A;  1X9W B;  1TK5 B;  1LU4 A;  2C0G A;  1XZO A;  1J9B A;  1GUL A;  3R2Q A;  5ECH B;  3TKS E;  1DUG A;  4MJA A;  4XS1 A;  2GQL A;  1K0M A;  1OC9 A;  3KD0 A;  1X0R A;  3IAS 2;  2OE0 A;  4WEY A;  3VWV A;  8GSS A;  1ZZY A;  3HDC A;  4OWY A;  1K0C A;  1GRX A;  1V98 A;  5EL8 A;  2OJL A;  4KDX A;  2YV9 A;  3DGQ A;  3QDN A;  2V1M A;  2VCX A;  4OCE A;  2CX3 A;  1WE0 A;  1R5A A;  4MPF A;  4EXJ A;  3GIX A;  4ZL8 A;  5GAP D;  4GSN A;  5F05 A;  4K7I A;  4ACS A;  5HR2 A;  3H1N A;  1YQ1 A;  4KH7 A;  3CRT A;  4TR4 A;  3UOM A;  3RPN A;  5J4U A;  1M7T A;  3BBY A;  2MMO A;  1AXD A;  5IPG A;  3HVX A;  4NAX A;  2H74 A;  3HVS A;  1DE1 A;  3KEB A;  1SD8 A;  5B8A A;  4TOP A;  2LNS A;  1TDI A;  5IQY A;  2X8C A;  1FG4 A;  3ME7 A;  4PNF A;  1ERV A;  2D2Z A;  3CYN A;  4GST A;  2H1B A;  4DVC A;  5HR0 A;  3RHB A;  3VLN A;  1GSD A;  2KHP A;  3WGE A;  4N10 A;  1U87 A;  4AJ6 A;  4OCF A;  3ISO A;  4ZBB A;  4XCS A;  1TJD A;  3HZ8 A;  2NVL A;  2LJR A;  1SL1 B;  1UVZ A;  1VF3 A;  2OKA A;  1T4Z A;  4G10 A;  5GAN D;  6GSX A;  1A23 A;  3GST A;  3GA4 A;  2L4C A;  1K0D A;  3UJ1 A;  1U3I A;  1B9Y C;  3P2A A;  2V32 A;  4POK A;  4K0G A;  4X1U A;  2FWF A;  2GTU A;  1HQO A;  5DAL A;  2V41 A;  2KUC A;  1OC8 A;  2OA7 A;  1EP7 A;  4I8B A;  5J5N A;  3FRC A;  3ZML A;  3RDW A;  4KX4 A;  2H6X A;  3LQ7 A;  1C72 A;  2GGT A;  4XS4 B;  2PU9 C;  3G7J A;  2WCI A;  2IJY A;  2GSQ A;  3WT1 A;  2O8V B;  3C8E A;  2C0D A;  2HLS A;  4Q5R A;  4GWR A;  3D4M A;  1FB0 A;  3HCZ A;  3GL3 A;  1USB A;  2FNO A;  1JHB A;  1TXX A;  1YJ6 A;  5DQS A;  4JRR A;  3ZIT A;  4EDZ A;  5GZZ B;  3TRQ A;  2HE3 A;  2F9S A;  5IMA A;  1EOG A;  2H76 A;  4K2D A;  2CVB A;  3VFI A;  2L5L A;  3KTB A;  2FWH A;  1K0O A;  4O92 A;  2MMZ A;  4GSS A;  1GWC A;  1G6Y A;  5D9V A;  3O76 A;  3H79 A;  2IMD A;  3IE3 A;  1QFN A;  4KCA A;  5INY A;  4KA0 A;  5A5K A;  4HDE A;  3DXB A;  2F51 A;  1DE2 A;  4TXV A;  5CRE A;  14GS A;  3GX8 A;  4PQ1 A;  4OFT A;  5ECS A;  4KDY A;  3IRA A;  3EMP A;  4RQR A;  3FR9 A;  3PGT A;  4L0U A;  1Z6M A;  3ZIJ A;  2JL4 A;  2CVK A;  4CHS A;  3Q6O A;  2NDO A;  5CP1 A;  4Z7X A;  4GXZ A;  4MH3 A;  2C8U A;  4ECC A;  1T7P B;  5G31 A;  1RW1 A;  2HT9 A;  3J7Y k;  2JSY A;  1A2J A;  5GST A;  5ID2 A;  1AW9 A;  4WKW A;  4MP4 A;  2B5Y A;  5G2Z A;  5JCU A;  5AIX A;  2VL9 A;  3DKS A;  4HU9 A;  3FR6 A;  1EEJ A;  2LST A;  3TCO A;  1GNW A;  2CT6 A;  2PPT A;  2I4A A;  2OAC A;  1XW6 A;  4V2N A;  2GS3 A;  4MLY A;  4QQ7 A;  1BAY A;  1QUW A;  2LJK A;  2G2Q A;  1JFU A;  3US3 A;  4BVY A;  1PKZ A;  4KDU A;  5ECP B;  1B4P A;  2A4V A;  4FH8 A;  3GTU B;  4ML1 A;  3P8W A;  4K8M A;  2DC5 A;  1N2A A;  4NMU A;  4ZXG A;  5IOW A;  5IMC A;  4J2F A;  1Y25 A;  3WT2 A;  1B9X C;  3F0I A;  5FWG A;  1J0F A;  2I1U A;  4DSS B;  1I9D A;  2C3Q A;  1HNA A;  2GSR A;  3DVX A;  3TOT A;  4HQZ A;  1X5D A;  4GQF A;  4IQ1 A;  2C80 A;  1VF2 A;  5G1L A;  4CW9 A;  2RLI A;  1YF1 A;  4LLR A;  3TJJ A;  1ABA A;  1ACV A;  4HI7 A;  4EO3 A;  1M2B A;  2B3S A;  3ZFL A;  2VM2 A;  4ECI A;  5DJL A;  3W8S A;  3TKR A;  5DQY A;  2L6C A;  1EEM A;  4O7H A;  5DAK B;  1MTC A;  4HEA 2;  1Z6N A;  3FZ4 A;  3E9J B;  4HJ2 A;  4PUA A;  4F0B A;  4EKZ A;  1B4Q A;  2HYX A;  2G0F A;  1ZYE A;  2RUF A;  1O8W A;  3F4T A;  4IBP A;  1SK0 A;  3EVI A;  1K3O A;  2R37 A;  3TKP A;  5J9B A;  1EV4 A;  3OR5 A;  2AAW A;  4J57 E;  3LOR A;  1EZK A;  3WYW A;  1R26 A;  4XTS A;  4F2I A;  3FZ5 A;  1PX6 A;  3IBH A;  3SWL A;  3ZMK A;  4POM A;  2OBK A;  4K9Z A;  3G9B A;  2WB9 A;  5IPH A;  3MDK A;  1QK8 A;  2N5F A;  1ZGN A;  1YZX A;  2QC7 A;  4O32 A;  1PD2 1;  3TUE A;  2IPA A;  5G5F A;  1IYI A;  4KAE A;  5F8B A;  5IM9 A;  2VCW A;  1TKD B;  2J9H A;  1EWX A;  5ECN B;  2GQK A;  1EGR A;  1ERW A;  4G19 A;  3GUR A;  4TXO A;  4NHW A;  2VO4 A;  3PH9 A;  1Z7R A;  2DJ0 A;  3GV1 A;  1KBN A;  3D5J A;  1A24 A;  2LTK A;  1MDI A;  1SYR A;  2QGV A;  4OFN A;  1OC9 B;  1S3C A;  1SL0 B;  4MJC A;  3EU4 A;  5B6N A;  1PX7 A;  4CDO A;  5D73 A;  4KSM A;  1TTZ A;  2WJU A;  5KN1 A;  3TKS C;  5B8B A;  3L9V A;  3F3Q A;  5DBQ A;  4J56 E;  2BJX A;  2FWG A;  2DSA A;  4HUA A;  4MF5 A;  5ENU A;  2GZY A;  5AGY A;  1F2E A;  5DDL A;  9GSS A;  5FHI A;  2ZUP A;  3FW2 A;  2PMT A;  1V2A A;  2M80 A;  1YKC A;  3TJF A;  3N9J A;  4NPB A;  2VL2 C;  1QQ2 A;  1SJI A;  5IIZ A;  3VPQ A;  1WJK A;  1G6W A;  4IP6 A;  2WGR A;  1THX A;  2AJQ B;  2B5X A;  2IFQ A;  3FEU A;  3I6A A;  3LG6 A;  4MZC A;  1BED A;  1TU7 A;  1FAA A;  4KUN A;  3IDV A;  2L5O A;  3GFK A;  4N0V A;  3ERW A;  1U88 A;  1CQG A;  3MAK A;  3QAG A;  1H75 A;  1FVK A;  2DJ2 A;  2VLU A;  2H19 A;  4Q5F A;  4RI7 A;  1JZD A;  2EIQ A;  2M72 A;  1VF4 A;  2XBI A;  4TKY A;  1SKR B;  1XPV A;  5IMZ A;  3FK8 A;  5DVB A;  2H70 A;  2PGT A;  1JZR A;  3KMN A;  2LKU A;  4BWQ A;  4ZL9 A;  1AIU A;  3CBU A;  3DIE A;  2EIO A;  1HNB A;  1SK1 A;  2DJJ A;  7GSS A;  1OAZ A;  5EPF A;  1CQH A;  2R3X A;  1PL1 A;  3KXO A;  1GH2 A;  2VLT A;  2B7J A;  3QOU A;  4MAB A;  2RM5 A;  3N5O A;  4RQX A;  4KSO A;  1ILO A;  4XRD A;  5DAL B;  5LCZ A;  22GS A;  4ZIL A;  2CX4 A;  3W8J A;  2FD3 A;  1SL2 B;  3GNJ A;  1YY7 A;  2C3N A;  1XWA A;  3GMF A;  3ZRD A;  4XHM A;  2GLR A;  2WDU A;  2X8G A;  4ZIJ A;  1ZMA A;  4GQC A;  2B1L A;  2ZNM A;  4MZW A;  2B6M A;  2C0E A;  2YP6 A;  5JWO B;  2R4V A;  1TRW A;  18GS A;  5ECK B;  1RK4 A;  2E0Q A;  1SD9 A;  5D8I A;  4RUV A;  3UAP A;  1UA5 A;  5JWR B;  1A8L A;  1JLW A;  1PMT A;  4IJI A;  1MD4 A;  1EOH A;  1TRS A;  4GF0 A;  1YEX A;  1K0N A;  4I5Q A;  3HD5 A;  6GSU A;  2CQ9 A;  3HJO A;  2FA8 A;  3GKN A;  1PN9 A;  4YAP A;  4HU7 A;  4YAV A;  1HNC A;  4K0N A;  5C00 A;  2H73 A;  3GKM A;  3TJB A;  3TJK A;  3DEX A;  3APO A;  4OD7 A;  4MJE A;  1XVW A;  3IA1 A;  2X8H A;  3KH9 A;  4I2T A;  3E3E A;  3HY2 A;  1TOF A;  2IME A;  3HJM A;  3O6T A;  2BMX A;  1SU9 A;  12GS A;  3A3T A;  5L71 A;  20GS A;  2H72 A;  1K3Y A;  3UEM A;  5D9X A;  1AQX A;  5C04 A;  4F9Z A;  4ZB6 A;  3LYP A;  1K3L A;  3TOU A;  4K1F A;  5A4W A;  4MMM A;  4ZB9 A;  3F4S A;  1S3D A;  4WF4 A;  1G7E A;  2P31 A;  3S9F A;  3TKQ A;  5ID2 B;  2GZZ A;  2A2S A;  1M9B A;  2LRN A;  2MZC A;  1Q98 A;  2FA4 A;  3ZVJ D;  5IOX A;  2VM1 A;  4JR4 A;  4OMV A;  4X0X A;  4JE1 A;  3LWA A;  5E4W A;  2LRC A;  3F6D A;  3HKR A;  1DSB A;  2PN8 A;  4MDC A;  2LQO A;  3APQ A;  2JAD A;  5CRG A;  3QR6 A;  1FO5 A;  1THO A;  4ULX A;  2XPD A;  1SK2 A;  1NHY A;  1O73 A;  2NTO A;  2N5B A;  4PNG A;  2R2J A;  1A0R P;  4OO4 A;  3L0H A;  4K7O A;  3F3R A;  5G5E A;  1PSQ A;  3EMX A;  3QD9 A;  2V6K A;  1ST9 A;  5CAX A;  5D96 A;  5AIV A;  5H5R A;  1TRU A;  2YAN A;  3C71 A;  3CSH A;  1S3A A;  2FCH A;  3DVW A;  3WD6 A;  2YJH A;  2H0H A;  3CXG A;  1WOU A;  3E0U A;  1Z9H A;  3LXZ A;  2E2G A;  2H01 A;  2VD1 A;  1WMJ A;  1HYU A;  3G7I A;  2MBS A;  1A2L A;  2A2R A;  19GS A;  4MK3 A;  3TB2 A;  3ME8 A;  3QFA C;  5DJM A;  1TRV A;  3CRU A;  3U5R E;  2XC2 A;  3QCP A;  1XOA A;  2J23 A;  4PQI A;  4AJ7 A;  1UN2 A;  1K0A A;  3KP8 A;  3ZZX A;  1OYJ A;  2IMF A;  3PIN A;  2HZE A;  4AF2 A;  2AYT A;  2L6D A;  3DYR A;  2VCQ A;  1LJR A;  5HR1 A;  3EUR A;  2RUE A;  2JZT A;  2B5E A;  4XIH A;  2N5A A;  3P90 A;  4XS4 A;  5A4U A;  1XWC A;  2DLX A;  4BWS A;  3F6F A;  3L4N A;  1BQ7 A;  4V1A g;  4IEL A;  4KCE A;  4NV5 A;  4E8H A;  1X9M B;  3A2X A;  4EF0 A;  4TN8 A;  1M2A A;  5IMD A;  1FB6 A;  4TR3 A;  1T1V A;  3GHA A;  2PER A;  1K0B A;  4ZBA A;  3TKS A;  2IIY A;  2Z9S A;  4EL1 A;  1KNG A;  3GX0 A;  4EDY A;  4V2L A;  1F3A A;  3LSZ A;  2H71 A;  2C3T A;  16GS A;  1M9A A;  5ELA A;  4IHU A;  3VWU A;  1NSW A;  2I81 A;  3BCK A;  3ZFB A;  1B8X A;  2PBJ A;  1G0T A;  3VWX A;  4KW6 A;  2HRN A;  1G7O A;  3F9U A;  3H93 A;  1W89 A;  3RAZ A;  5G1K A;  4I97 A;  2YZU A;  3FR3 A;  1XOB A;  1WWJ A;  1YF0 A;  4TXO B;  1U3A A;  2GT5 A;  2K6V A;  5H5Q A;  4YQU A;  2EIR A;  3FHK A;  4F03 A;  1TI1 A;  4L5L A;  4LL4 B;  3VI5 A;  1A8Y A;  3A2W A;  2L57 A;  6GSV A;  2V2G A;  3M1G A;  4NXI A;  1PKW A;  3QFB C;  3M0F A;  4LL1 B;  1XCC A;  4H86 A;  4KE3 A;  1HD2 A;  1OKT A;  5JCG A;  2ON5 A;  4MJB A;  4KND A;  4IQA A;  3DWV A;  3FZ9 A;  4IJ3 A;  1TU8 A;  1T00 A;  3D0Z A;  3VK9 A;  2CVD A;  1KTE A;  3H8Q A;  4K6X A;  2MMA A;  1BG5 A;  2M46 A;  1NM3 A;  3KTL A;  3GYK A;  2JZS A;  2YWI A;  1WIK A;  1T3B A;  1SKS B;  4L0W A;  3IHQ A;  1EGO A;  1MEK A;  3M3M A;  1LBK A;  2VL3 A;  4XS6 A;  4ECJ A;  3SBC A;  1XWG A;  4MCU A;  2GDR A;  1Z5Y E;  4EUY A;  1TP9 A;  2GSS A;  4WET A;  4PUR A;  4DSR A;  4EVM A;  2HNL A;  2KP1 A;  4HJM A;  3I69 A;  3QAV A;  3ERF A;  3KCM A;  2VD0 A;  3IR4 A;  1WPI A;  3UIW A;  5CO3 A;  4IVF A;  2OAD A;  2YNX A;  17GS A;  2FGX A;  5A4V A;  1GSY A;  2YV7 A;  4RI6 A;  3DD3 A;  1DBY A;  3LEF A;  2HRF A;  3CSJ A;  1FW1 A;  3VWW A;  3IC4 A;  3RPP A;  4TR1 B;  3QPM A;  2K9F A;  2HXK A;  1ZCP A;  3JCM L;  2I3Y A;  4EE0 A;  3FYG A;  3LGC A;  5GSS A;  5IO0 A;  4GLT A;  1M0U A;  5H5S A;  3RBT A;  3M9J A;  5E59 A;  3DRN A;  1R4W A;  3NZN A;  3IK9 A;  5ECL B;  3U6V A;  3A5W A;  2LUS A;  4AGS A;  2VUP A;  4K7N A;  3F8U A;  1KEB A;  3ED3 A;  2DBC A;  3APS A;  5D9W A;  2PVQ A;  2NPB A;  2H75 A;  3LFL A;  1Z7P A;  2QSI A;  2O87 A;  3KJY A;  2XBQ A;  2LRT A;  5CNW A;  1OVN A;  5LNK e;  1ZOF A;  4ISD A;  11GS A;  2YWN A;  1MDK A;  2R6K A;  4IW9 A;  4WBJ A;  5IO2 A;  4WR4 A;  5IMV A;  1XWB A;  2P5R A;  2C1Y A;  2E7P A;  2MBT A;  2C4J A;  4OFM A;  2DJ1 A;  3NIV A;  4ZL7 A;  2CAQ A;  3CMI A;  4HOJ A;  2YJ7 A;  2C0F A;  4D73 A;  3TRP A;  2JSZ A;  2P5Q A;  1Z3E A;  3IK7 A;  2DJK A;  1EV9 A;  1IYH A;  4TRX A;  3UL3 A;  4IN0 A;  1O81 A;  3D4T A;  3CTF A;  4FYB A;  4GTU A;  3ZIV A;  5ELG A;  2HFD A;  2LJA A;  1YDK A;  1V40 A;  1ERU A;  5HFK A;  6GSW A;  4OO5 A;  2DMM A;  2VOC A;  4N30 A;  4E8E A;  2DML A;  2FY6 A;  4POL A;  1SJZ A;  1FVJ A;  1SEN A;  1F3B A;  2H6Y A;  2ON7 A;  3GKK A;  1R7H A;  4ZB8 A;  1Y6E A;  1JZO A;  3EU3 A;  1MD3 A;  5KN2 A;  1GSF A;  2YCD A;  2VAF A;  5AN1 A;  4ZBD A;  1M2D A;  4TR0 A;  3KGK A;  3CTG A;  4PX1 A;  3ERG A;  4MZB A;  4JED A;  2H30 A;  2NBS A;  1EP8 A;  1GSQ A;  4FYC A;  4N11 A;  5F06 A;  3C73 A;  2KP2 A;  2ZCT A;  5D93 A;  2JAC A;  1VRS D;  5JCW A;  1NHO A;  2FUG 2;  2TRC P;  2VCT A;  3ZLP A;  1GNE A;  4NWY A;  1J08 A;  1ZL9 A;  5CRH A;  2XHF A;  4XRA A;  2MYG A;  2HI7 A;  1WRY A;  3HXS A;  4HZ2 A;  4V1A p;  4IP1 A;  2H1A A;  4JZQ A;  3W6G A;  4HZ4 A;  1H4O A;  4IGJ A;  3RHC A;  2VLV A;  6GSY A;  3KIJ A;  4BA7 A;  4BPY A;  1GTB A;  2WZ9 A;  3ZVJ A;  2CZ3 A;  2LS5 A;  3MNG A;  2BTO T;  3KM6 A;  3L78 A;  5ECM B;  2H0I A;  3O3T A;  1GSU A;  4MF6 A;  2OBI A;  2IL3 A;  2X64 A;  1X5E A;  1GUK A;  4ILF A;  4DEJ A;  2H1D A;  1X5C A;  2YPM A;  3TDG A;  1SKW B;  4QL9 A;  1GTI A;  2GST A;  3PR8 A;  3D6I A;  2H0G A;  2JZR A;  1AC1 A;  2K8S A;  3UVH A;  2WRT A;  3BD2 A;  3QAW A;  3M8N A;  3FZA A;  3QMX A;  5LD0 A;  1BYE A;  3ZTL A;  4WR5 A;  1GSS A;  3C1S A;  1F9M A;  2AUV A;  5COH A;  4LMV A;  3Q18 A;  1QXH A;  4I2U A;  2WFC A;  5ECQ B;  4YQM A;  3WGX A;  2FWE A;  5DCH A;  4LA1 A;  4AJ8 A;  2IMK A;  2HZE B;  4F82 A;  2GT6 A;  5ABR A;  5F0G A;  2VIM A;  1E6B A;  1TK0 B;  2YZH A;  3TGZ A;  2CAI A;  4KGI A;  3V1W A;  5B6M A;  1PQN A;  4TW5 A;  1ML6 A;  1BX9 A;  2RM6 A;  1GP1 A;  3NOF A;  2IWT A;  1AAZ A;  4QL7 A;  3C1R A;  1O6J A;  10GS A;  2F8A A;  4ML6 A;  2R5G A;  1SYX A;  3MWH A;  5HFI A;  1T4Y A;  2K8V A;  4F0C A;  4ECB A;  3HZ4 A;  1WP0 A;  3TJG A;  1NW2 A;  2DIZ A;  3VPT A;  3EYT A;  3F4R A;  3D21 A;  3FKF A;  4JBB A;  2L4Q A;  3UBL A;  5JWQ B;  3IPZ A;  1XW9 A;  2GZP A;  2HSY A;  4LMW A;  4MH2 A;  1I5G A;  1YKA A;  1TW9 A;  2E2M A;  3LJR A;  3MSZ A;  1URM A;  2DJ3 A;  1PRX A;  4IS0 A;  2L59 A;  1XW5 A;  3L9S A;  4Q5N A;  1TK8 B;  2GVP A;  3HVV A;  1E2Y A;  2LV3 A;  2TIR A;  2WUL A;  1N8J A;  1U6T A;  4KB3 A; 
#chains in the Genus database with same CATH topology
 2LNT A;  2X99 A;  3GH6 A;  3EIN A;  4WBR D;  1M3J A;  1OKD A;  3IHG A;  1JZW A;  3MYD A;  4MA9 A;  4A5P A;  3FMW A;  6GST A;  3D22 A;  4Z2R A;  4PXO A;  1RQM A;  1OE8 A;  1OC3 A;  1GSE A;  4NV2 A;  1GTA A;  1JLV A;  3VUR A;  1O8X A;  3KH7 A;  3G7Y A;  2K18 A;  2EC4 A;  1FOV A;  5ECO B;  1GUM A;  3GKX A;  3P7X A;  4GCI A;  1XFL A;  4YH2 A;  1GLQ A;  1O85 A;  5CYY A;  1AQV A;  3UVT A;  2VL2 A;  5KN3 A;  2PUK C;  3C7M A;  1XXU A;  4JR6 A;  1QGV A;  1VF1 A;  3UBK A;  4GRF A;  3IOS A;  5KOW A;  1A2M A;  5G30 A;  1SJ6 A;  1Q4J A;  4TVE A;  2ES7 A;  5HFG A;  2YWO A;  1GLP A;  3ZRE A;  1F6M C;  3Q74 A;  3IXR A;  3F63 A;  2IN3 A;  3TRX A;  1W4V A;  1A0F A;  2IMI A;  1FOH A;  2H8L A;  2LEG A;  4O5R A;  3L9U A;  3A2V A;  2AHE A;  3KZQ A;  3KP9 A;  2ALB A;  3GUS A;  5KEJ A;  1TI3 A;  4ID0 A;  5D9T A;  1QMV A;  2TRX A;  4P3Y B;  2FLS A;  2CZ2 A;  3H4K A;  1R5P A;  1VGL A;  3GL5 A;  3M9K A;  5CRD A;  3VI7 A;  1O7U A;  3EE2 A;  2F3M A;  2R0P A;  4G2E A;  4BL7 A;  1ZYQ B;  2I9H A;  3WGD A;  5ECR B;  2GQM A;  3GRX A;  5DCG A;  4X43 A;  4I6X A;  2KOK A;  4YKF A;  4HQS A;  2AB6 A;  5HR3 A;  1B48 A;  2LQQ A;  2HSH A;  4D73 B;  3BOA A;  5HQP A;  3LYK A;  1PA3 A;  2IFQ B;  5J9C A;  1GUH A;  1FHE A;  4IKH A;  3UAR A;  3K8N A;  3CSI A;  2B1K A;  4FO5 A;  3GTU A;  2HRA A;  2V6O A;  3IV4 A;  2JU5 A;  2HZF A;  5EVO A;  1GTU A;  4BVX A;  2OE1 A;  3KMO A;  2O85 A;  4DSQ A;  2P0G A;  4L5O A;  2B7K A;  2FHE A;  5AIS A;  3EC3 A;  4NHZ A;  3HYP A;  4N0Z A;  1UC7 A;  3I43 A;  1AUC A;  1GL8 A;  4YQV A;  3BJ5 A;  2OE3 A;  2DIY A;  4FYU A;  3UMA A;  3DML A;  1V9W A;  4DSS A;  1XVQ A;  4POB A;  1YEP A;  5B7C A;  4EC0 A;  2F8F A;  5F07 A;  5EY6 A;  3HJP A;  2RII A;  1OE7 A;  3FY7 A;  5IMF A;  2DKH A;  3EWL A;  1V58 A;  4Q5Q A;  5BRT A;  1XWK A;  2QKE A;  1ON4 A;  3AY8 A;  1XIY A;  1BJX A;  5DAK A;  3J7Y b;  2H1G A;  4FIW A;  2YWM A;  1ERT A;  2CV4 A;  4MPG A;  1PL2 A;  2PVO C;  3Q19 A;  3LW9 A;  1T8E B;  2CA8 A;  5ECI B;  1AQW A;  13GS A;  2YOI A;  2PWJ A;  4JU5 A;  2YN1 A;  2MMN A;  2O7K A;  4WF5 A;  5KN0 A;  3BCI A;  1F37 A;  3IC8 A;  1XBS A;  1ZYP A;  4WXT A;  3GN3 A;  1S3R A;  6GSS A;  5CRW A;  2REM A;  2VCZ A;  3GH9 A;  2KLX A;  3HA9 A;  1M99 A;  4V2M A;  2O89 A;  1PGT A;  1MDJ A;  4MF7 A;  2H66 A;  2VCV A;  1X9S B;  5FT3 A;  5J41 A;  3LXT A;  1PFO A;  2XPE A;  3HHV A;  3IAM 2;  1V57 A;  4G9H A;  2WS2 A;  4PGT A;  2AV4 A;  4PQH A;  3I9V 2;  4PUF C;  4HSC X;  4HS1 A;  3ZYW A;  2H6Z A;  4TR1 A;  3GSS A;  4L8E A;  5J3R A;  3ZL5 A;  3MIX A;  1X9W B;  1TK5 B;  1LU4 A;  2C0G A;  1XZO A;  1J9B A;  1GUL A;  3R2Q A;  5ECH B;  4O5U A;  3TKS E;  1DUG A;  4MJA A;  4XS1 A;  2GQL A;  1K0M A;  1OC9 A;  3KD0 A;  1X0R A;  3IAS 2;  2OE0 A;  4WEY A;  3VWV A;  8GSS A;  1ZZY A;  3HDC A;  4OWY A;  1K0C A;  1GRX A;  1V98 A;  5EL8 A;  2OJL A;  4KDX A;  2YV9 A;  3DGQ A;  3QDN A;  4OCE A;  2V1M A;  2VCX A;  2CX3 A;  1WE0 A;  1R5A A;  4MPF A;  4EXJ A;  3GIX A;  4ZL8 A;  5GAP D;  4GSN A;  5F05 A;  4K7I A;  4ACS A;  5HR2 A;  3H1N A;  1YQ1 A;  4KH7 A;  3CRT A;  4TR4 A;  3UOM A;  3RPN A;  5J4U A;  1M7T A;  3BBY A;  2MMO A;  1AXD A;  5IPG A;  3HVX A;  2DKI A;  4NAX A;  2H74 A;  3HVS A;  1DE1 A;  3KEB A;  1SD8 A;  5B8A A;  4TOP A;  2LNS A;  1TDI A;  5IQY A;  2X8C A;  1FG4 A;  3ME7 A;  4PNF A;  1ERV A;  2D2Z A;  3CYN A;  4GST A;  2H1B A;  4DVC A;  5HR0 A;  3RHB A;  3VLN A;  1GSD A;  2KHP A;  3WGE A;  4N10 A;  1U87 A;  4AJ6 A;  4OCF A;  3ISO A;  4ZBB A;  4XCS A;  1TJD A;  3HZ8 A;  2NVL A;  2LJR A;  1SL1 B;  1UVZ A;  1VF3 A;  2OKA A;  1T4Z A;  4G10 A;  5GAN D;  6GSX A;  1A23 A;  3GST A;  3GA4 A;  2L4C A;  1K0D A;  3UJ1 A;  1U3I A;  1B9Y C;  3P2A A;  2V32 A;  4POK A;  4K0G A;  4X1U A;  2FWF A;  2GTU A;  1HQO A;  5DAL A;  2V41 A;  2KUC A;  1OC8 A;  2OA7 A;  1EP7 A;  4I8B A;  5J5N A;  3FRC A;  3ZML A;  3RDW A;  4KX4 A;  2H6X A;  3LQ7 A;  1C72 A;  2GGT A;  4XS4 B;  2PU9 C;  3G7J A;  2WCI A;  2IJY A;  2GSQ A;  3WT1 A;  2O8V B;  3C8E A;  2C0D A;  2HLS A;  4Q5R A;  4GWR A;  1M3I A;  3D4M A;  1FB0 A;  2QA2 A;  3HCZ A;  3GL3 A;  1USB A;  2FNO A;  4Z2U A;  1JHB A;  1TXX A;  1YJ6 A;  5DQS A;  4JRR A;  3ZIT A;  4EDZ A;  5GZZ B;  3TRQ A;  2HE3 A;  1XG8 A;  4BIK A;  2F9S A;  5IMA A;  1EOG A;  2H76 A;  4K2D A;  2CVB A;  3VFI A;  2L5L A;  3KTB A;  2FWH A;  1K0O A;  4O92 A;  2MMZ A;  4GSS A;  1GWC A;  1G6Y A;  3O76 A;  5D9V A;  3H79 A;  2IMD A;  3IE3 A;  1QFN A;  4KCA A;  5INY A;  4KA0 A;  5A5K A;  4HDE A;  3DXB A;  2F51 A;  1DE2 A;  4TXV A;  5CRE A;  14GS A;  3GX8 A;  4PQ1 A;  4OFT A;  5ECS A;  4KDY A;  3IRA A;  3EMP A;  4RQR A;  1PN0 A;  3FR9 A;  3PGT A;  4L0U A;  1Z6M A;  3ZIJ A;  2JL4 A;  2CVK A;  4CHS A;  3Q6O A;  2NDO A;  5CP1 A;  4Z7X A;  4GXZ A;  4MH3 A;  2C8U A;  4ECC A;  1T7P B;  5G31 A;  1RW1 A;  2HT9 A;  3J7Y k;  2JSY A;  1A2J A;  5GST A;  5ID2 A;  1AW9 A;  4WKW A;  4BL7 B;  4MP4 A;  2B5Y A;  5G2Z A;  4USS A;  5JCU A;  5AIX A;  2VL9 A;  3DKS A;  4HU9 A;  3FR6 A;  1EEJ A;  2LST A;  3TCO A;  1GNW A;  2CT6 A;  4FQU A;  2HSM A;  2PPT A;  2I4A A;  2OAC A;  1XW6 A;  4V2N A;  2GS3 A;  4MLY A;  4QQ7 A;  1BAY A;  1QUW A;  2LJK A;  2G2Q A;  1JFU A;  3US3 A;  4BVY A;  1PKZ A;  4KDU A;  5ECP B;  1B4P A;  2A4V A;  4FH8 A;  3GTU B;  4G0L A;  4ML1 A;  3P8W A;  4K8M A;  2DC5 A;  1N2A A;  4NMU A;  4ZXG A;  5IOW A;  5IMC A;  4J2F A;  1Y25 A;  3WT2 A;  1B9X C;  3F0I A;  5FWG A;  1J0F A;  2I1U A;  4DSS B;  1I9D A;  2C3Q A;  1HNA A;  2GSR A;  3DVX A;  3TOT A;  4HQZ A;  1X5D A;  4GQF A;  4IQ1 A;  2C80 A;  1VF2 A;  5G1L A;  4CW9 A;  2RLI A;  1YF1 A;  4LLR A;  3TJJ A;  1ABA A;  1ACV A;  4HI7 A;  4EO3 A;  1M2B A;  2B3S A;  3ZFL A;  2VM2 A;  4ECI A;  5DJL A;  3W8S A;  3TKR A;  2L6C A;  1EEM A;  4O7H A;  5DAK B;  5DQY A;  1MTC A;  4HEA 2;  1Z6N A;  3FZ4 A;  3E9J B;  4HJ2 A;  4PUA A;  4F0B A;  4EKZ A;  2QA1 A;  1B4Q A;  2HYX A;  2G0F A;  1ZYE A;  2RUF A;  1O8W A;  3F4T A;  4IBP A;  1SK0 A;  3EVI A;  1K3O A;  2R37 A;  3TKP A;  4O5Q A;  5J9B A;  1EV4 A;  3OR5 A;  2AAW A;  4J57 E;  3LOR A;  1EZK A;  3WYW A;  1R26 A;  4XTS A;  4F2I A;  3FZ5 A;  1PX6 A;  3IBH A;  3SWL A;  3ZMK A;  4POM A;  2OBK A;  4K9Z A;  3G9B A;  2WB9 A;  5IPH A;  3MDK A;  1QK8 A;  2N5F A;  1ZGN A;  1YZX A;  2QC7 A;  4O32 A;  1PD2 1;  3TUE A;  2IPA A;  5G5F A;  1IYI A;  4KAE A;  5F8B A;  5IM9 A;  2VCW A;  1TKD B;  2J9H A;  3HVN A;  1EWX A;  5ECN B;  2GQK A;  1EGR A;  1ERW A;  4G19 A;  3GUR A;  4TXO A;  4NHW A;  2VO4 A;  3PH9 A;  1Z7R A;  2DJ0 A;  3GV1 A;  1KBN A;  2A4H A;  3D5J A;  1A24 A;  2LTK A;  1MDI A;  1SYR A;  2QGV A;  4OFN A;  1OC9 B;  1S3C A;  1SL0 B;  4MJC A;  3EU4 A;  5B6N A;  1PX7 A;  4CDO A;  5D73 A;  4KSM A;  1TTZ A;  2WJU A;  5KN1 A;  3TKS C;  5B8B A;  3L9V A;  3F3Q A;  4K5R A;  4J56 E;  2BJX A;  5DBQ A;  2FWG A;  2DSA A;  4HUA A;  4MF5 A;  5ENU A;  2GZY A;  5AGY A;  1F2E A;  5DDL A;  9GSS A;  5FHI A;  2ZUP A;  2R0C A;  3FW2 A;  2PMT A;  1V2A A;  2M80 A;  1YKC A;  3TJF A;  3N9J A;  4NPB A;  2VL2 C;  1QQ2 A;  1SJI A;  5IIZ A;  3VPQ A;  1WJK A;  1G6W A;  4IP6 A;  2WGR A;  1THX A;  2AJQ B;  2B5X A;  2IFQ A;  3FEU A;  3I6A A;  3LG6 A;  4MZC A;  1BED A;  1TU7 A;  1FAA A;  4KUN A;  3IDV A;  2L5O A;  3GFK A;  4N0V A;  3ERW A;  1U88 A;  1CQG A;  3MAK A;  3QAG A;  1H75 A;  1FVK A;  2DJ2 A;  2VLU A;  2H19 A;  4Q5F A;  4RI7 A;  1JZD A;  2EIQ A;  2M72 A;  1VF4 A;  2XBI A;  4TKY A;  1SKR B;  1XPV A;  5IMZ A;  3FK8 A;  5DVB A;  2H70 A;  2PGT A;  1JZR A;  3KMN A;  2LKU A;  4BWQ A;  4ZL9 A;  1AIU A;  3CBU A;  3DIE A;  2EIO A;  1HNB A;  1SK1 A;  2DJJ A;  7GSS A;  1OAZ A;  5EPF A;  1CQH A;  2R3X A;  1PL1 A;  3KXO A;  1GH2 A;  2VLT A;  2B7J A;  3QOU A;  4MAB A;  2RM5 A;  3N5O A;  4RQX A;  4KSO A;  1ILO A;  4XRD A;  5DAL B;  5LCZ A;  22GS A;  4ZIL A;  2CX4 A;  3W8J A;  2FD3 A;  1SL2 B;  3GNJ A;  1YY7 A;  2C3N A;  1XWA A;  3GMF A;  3ZRD A;  4XHM A;  2GLR A;  2HRK A;  2WDU A;  2X8G A;  4YKG A;  4ZIJ A;  1ZMA A;  4GQC A;  2B1L A;  2ZNM A;  4MZW A;  2B6M A;  2C0E A;  2YP6 A;  5JWO B;  2R4V A;  1TRW A;  18GS A;  5ECK B;  1RK4 A;  2E0Q A;  1SD9 A;  5D8I A;  4RUV A;  3UAP A;  1UA5 A;  5JWR B;  1A8L A;  1JLW A;  1PMT A;  4IJI A;  1MD4 A;  1EOH A;  1TRS A;  4GF0 A;  1YEX A;  1K0N A;  4I5Q A;  3HD5 A;  6GSU A;  2CQ9 A;  3HJO A;  2FA8 A;  3GKN A;  1PN9 A;  4YAP A;  4HU7 A;  4YAV A;  1HNC A;  4K0N A;  5C00 A;  2H73 A;  3GKM A;  3TJB A;  3TJK A;  3DEX A;  3APO A;  4OD7 A;  4G0I A;  4MJE A;  1XVW A;  3IA1 A;  2X8H A;  3KH9 A;  4I2T A;  3E3E A;  3HY2 A;  1TOF A;  2IME A;  3HJM A;  3O6T A;  2BMX A;  1SU9 A;  12GS A;  3A3T A;  5L71 A;  20GS A;  2H72 A;  1K3Y A;  3UEM A;  5D9X A;  1AQX A;  5C04 A;  4F9Z A;  4ZB6 A;  3LYP A;  1K3L A;  3TOU A;  4K1F A;  5A4W A;  4MMM A;  4ZB9 A;  3F4S A;  1S3D A;  4WF4 A;  1G7E A;  2P31 A;  3S9F A;  3CQF A;  3TKQ A;  5ID2 B;  2GZZ A;  2A2S A;  1M9B A;  2LRN A;  2MZC A;  1Q98 A;  2FA4 A;  3ZVJ D;  5IOX A;  2VM1 A;  4JR4 A;  4OMV A;  4X0X A;  4JE1 A;  3LWA A;  5E4W A;  2LRC A;  3F6D A;  3HKR A;  1DSB A;  2PN8 A;  4MDC A;  2LQO A;  3APQ A;  2JAD A;  5CRG A;  3QR6 A;  1FO5 A;  1THO A;  4ULX A;  2XPD A;  4BVY B;  1SK2 A;  4CY8 A;  1NHY A;  1O73 A;  2NTO A;  2N5B A;  4PNG A;  2R2J A;  1A0R P;  4OO4 A;  3L0H A;  4K7O A;  3F3R A;  5G5E A;  1PSQ A;  3EMX A;  3QD9 A;  2V6K A;  1ST9 A;  5CAX A;  5D96 A;  4K2X A;  5KOX A;  5AIV A;  5H5R A;  1TRU A;  2YAN A;  3C71 A;  3CSH A;  1S3A A;  2FCH A;  3DVW A;  3WD6 A;  2YJH A;  2H0H A;  3CXG A;  1WOU A;  3E0U A;  1Z9H A;  3LXZ A;  2E2G A;  2H01 A;  2VD1 A;  1WMJ A;  1HYU A;  3G7I A;  2MBS A;  1A2L A;  2A2R A;  19GS A;  4MK3 A;  3TB2 A;  3ME8 A;  3QFA C;  5DJM A;  1TRV A;  3CRU A;  3U5R E;  2XC2 A;  3QCP A;  1XOA A;  2J23 A;  4PQI A;  4AJ7 A;  1UN2 A;  1K0A A;  3KP8 A;  3ZZX A;  1OYJ A;  5BMU A;  2IMF A;  3PIN A;  2HZE A;  4AF2 A;  2AYT A;  2L6D A;  3DYR A;  2VCQ A;  1LJR A;  5HR1 A;  3EUR A;  2RUE A;  2JZT A;  2B5E A;  4XIH A;  2N5A A;  3P90 A;  4XS4 A;  5A4U A;  1XWC A;  2DLX A;  4BWS A;  3F6F A;  4PTS A;  3L4N A;  1BQ7 A;  4V1A g;  4IEL A;  4KCE A;  4NV5 A;  4E8H A;  1X9M B;  3A2X A;  4EF0 A;  4TN8 A;  1M2A A;  5IMD A;  1FB6 A;  4TR3 A;  1T1V A;  3GHA A;  2PER A;  1K0B A;  4ZBA A;  3TKS A;  2IIY A;  2Z9S A;  4EL1 A;  1KNG A;  3GX0 A;  4EDY A;  4V2L A;  1F3A A;  3LSZ A;  2H71 A;  4BVX B;  2C3T A;  16GS A;  1M9A A;  5ELA A;  4IHU A;  3VWU A;  1NSW A;  2I81 A;  3BCK A;  3ZFB A;  1B8X A;  2PBJ A;  1G0T A;  3VWX A;  4KW6 A;  2HRN A;  1G7O A;  3F9U A;  3H93 A;  1W89 A;  3RAZ A;  5G1K A;  4I97 A;  2YZU A;  2UZ8 A;  3FR3 A;  1XOB A;  1WWJ A;  1YF0 A;  4TXO B;  1U3A A;  2GT5 A;  2K6V A;  5H5Q A;  4YQU A;  2EIR A;  3FHK A;  4F03 A;  1TI1 A;  4L5L A;  4K5S A;  4LL4 B;  3VI5 A;  1A8Y A;  3A2W A;  2L57 A;  6GSV A;  2V2G A;  3M1G A;  4NXI A;  1PKW A;  3QFB C;  3M0F A;  4LL1 B;  1XCC A;  4H86 A;  4KE3 A;  1HD2 A;  1OKT A;  5JCG A;  2ON5 A;  4MJB A;  4KND A;  4IQA A;  3DWV A;  3FZ9 A;  4IJ3 A;  1TU8 A;  1ZYN A;  1T00 A;  3D0Z A;  3VK9 A;  2CVD A;  1KTE A;  3H8Q A;  4K6X A;  2MMA A;  1BG5 A;  2M46 A;  1NM3 A;  3KTL A;  3GYK A;  2JZS A;  3R3E A;  2YWI A;  1WIK A;  1T3B A;  1SKS B;  4L0W A;  3IHQ A;  1EGO A;  1MEK A;  3M3M A;  1LBK A;  2VL3 A;  4XS6 A;  4ECJ A;  3SBC A;  1XWG A;  4MCU A;  2GDR A;  1Z5Y E;  4EUY A;  1TP9 A;  2GSS A;  4WET A;  4PUR A;  4DSR A;  4EVM A;  2HNL A;  2KP1 A;  4HJM A;  3I69 A;  3QAV A;  3ERF A;  3KCM A;  2VD0 A;  3IR4 A;  1WPI A;  3UIW A;  5CO3 A;  4IVF A;  2OAD A;  2YNX A;  17GS A;  2FGX A;  5A4V A;  1GSY A;  2YV7 A;  4RI6 A;  3DD3 A;  1DBY A;  3LEF A;  2HRF A;  3CSJ A;  1FW1 A;  3VWW A;  3IC4 A;  3RPP A;  4TR1 B;  3QPM A;  2K9F A;  2HXK A;  1ZCP A;  3JCM L;  2I3Y A;  4EE0 A;  3FYG A;  3LGC A;  5GSS A;  5IO0 A;  4GLT A;  1M0U A;  5H5S A;  3RBT A;  3M9J A;  5E59 A;  3DRN A;  1R4W A;  3NZN A;  3IK9 A;  5ECL B;  3U6V A;  3A5W A;  2LUS A;  4AGS A;  2VUP A;  4K7N A;  3F8U A;  1KEB A;  3ED3 A;  2DBC A;  3APS A;  5D9W A;  2PVQ A;  2NPB A;  2H75 A;  3LFL A;  1Z7P A;  2QSI A;  2O87 A;  3KJY A;  2XBQ A;  2LRT A;  5CNW A;  1OVN A;  5LNK e;  1ZOF A;  4ISD A;  11GS A;  2YWN A;  1MDK A;  2R6K A;  4IW9 A;  4WBJ A;  4EIQ A;  5IO2 A;  4WR4 A;  5IMV A;  1XWB A;  2P5R A;  2C1Y A;  2E7P A;  2MBT A;  2C4J A;  3EPT A;  4OFM A;  2DJ1 A;  3NIV A;  4ZL7 A;  2CAQ A;  3CMI A;  4HOJ A;  2YJ7 A;  2C0F A;  4D73 A;  3TRP A;  2JSZ A;  2P5Q A;  1Z3E A;  3IK7 A;  2DJK A;  1EV9 A;  1IYH A;  4TRX A;  3UL3 A;  4IN0 A;  1O81 A;  3D4T A;  3CTF A;  4FYB A;  4GTU A;  3ZIV A;  5ELG A;  2HFD A;  2LJA A;  1YDK A;  1V40 A;  1ERU A;  5HFK A;  6GSW A;  4OO5 A;  2DMM A;  2VOC A;  4N30 A;  4E8E A;  2DML A;  2FY6 A;  4POL A;  1SJZ A;  1FVJ A;  1SEN A;  1F3B A;  2H6Y A;  2ON7 A;  3GKK A;  1R7H A;  4ZB8 A;  1Y6E A;  1JZO A;  3EU3 A;  1MD3 A;  5KN2 A;  1GSF A;  2YCD A;  2VAF A;  5AN1 A;  4ZBD A;  1M2D A;  4TR0 A;  3KGK A;  3CTG A;  4PX1 A;  3ERG A;  4MZB A;  4JED A;  2H30 A;  2NBS A;  1EP8 A;  1GSQ A;  4FYC A;  4N11 A;  5F06 A;  3C73 A;  2KP2 A;  2ZCT A;  5D93 A;  2JAC A;  1VRS D;  5JCW A;  1NHO A;  2FUG 2;  2TRC P;  2VCT A;  2R0G A;  3ZLP A;  1GNE A;  4NWY A;  1J08 A;  1ZL9 A;  5CRH A;  2XHF A;  4XRA A;  2MYG A;  2HI7 A;  1WRY A;  3HXS A;  4HZ2 A;  4V1A p;  4IP1 A;  2H1A A;  4JZQ A;  3W6G A;  4HZ4 A;  2A2P A;  1H4O A;  4IGJ A;  3RHC A;  4KF9 A;  2VLV A;  6GSY A;  3KIJ A;  4G0K A;  4MNN A;  4BA7 A;  4BPY A;  1GTB A;  2WZ9 A;  3ZVJ A;  2CZ3 A;  2LS5 A;  3MNG A;  2BTO T;  3KM6 A;  3L78 A;  5ECM B;  2H0I A;  3O3T A;  1GSU A;  4MF6 A;  2OBI A;  2IL3 A;  2X64 A;  1X5E A;  1GUK A;  4ILF A;  4Z2T A;  4DEJ A;  2H1D A;  1X5C A;  2YPM A;  3TDG A;  1SKW B;  4X4J A;  4QL9 A;  1GTI A;  2GST A;  3PR8 A;  4EIP A;  3D6I A;  2H0G A;  2JZR A;  1AC1 A;  4CY6 A;  2K8S A;  3UVH A;  2WRT A;  3BD2 A;  3QAW A;  3M8N A;  2X49 A;  3FZA A;  3QMX A;  5LD0 A;  1BYE A;  3ZTL A;  4WR5 A;  1GSS A;  3C1S A;  1F9M A;  2AUV A;  5COH A;  4LMV A;  3Q18 A;  1QXH A;  4I2U A;  2WFC A;  5ECQ B;  4YQM A;  3WGX A;  2FWE A;  5DCH A;  4LA1 A;  4AJ8 A;  2IMK A;  2HZE B;  3PPU A;  4F82 A;  2X4A A;  2GT6 A;  5ABR A;  5F0G A;  2VIM A;  1E6B A;  1TK0 B;  2YZH A;  3TGZ A;  2CAI A;  4KGI A;  3V1W A;  5B6M A;  1PQN A;  4TW5 A;  1ML6 A;  1BX9 A;  2RM6 A;  1GP1 A;  3NOF A;  2IWT A;  1AAZ A;  4QL7 A;  3C1R A;  4ICY A;  1O6J A;  10GS A;  2F8A A;  4ML6 A;  2R5G A;  1SYX A;  3MWH A;  5HFI A;  1T4Y A;  2K8V A;  4F0C A;  4ECB A;  3HZ4 A;  1WP0 A;  3TJG A;  1NW2 A;  2DIZ A;  3VPT A;  3EYT A;  3F4R A;  3D21 A;  3FKF A;  4JBB A;  2L4Q A;  3UBL A;  5JWQ B;  3IPZ A;  1XW9 A;  2GZP A;  2HSY A;  4LMW A;  4MH2 A;  1I5G A;  1YKA A;  1TW9 A;  2E2M A;  3LJR A;  3MSZ A;  1URM A;  3A5I A;  2DJ3 A;  1PRX A;  4IS0 A;  2L59 A;  1XW5 A;  3L9S A;  4Q5N A;  1TK8 B;  2GVP A;  3HVV A;  1E2Y A;  2LV3 A;  2TIR A;  2WUL A;  1N8J A;  1U6T A;  4KB3 A; 
#chains in the Genus database with same CATH homology
 2LNT A;  2X99 A;  3GH6 A;  3EIN A;  4WBR D;  1OKD A;  3IHG A;  1JZW A;  3MYD A;  4MA9 A;  4A5P A;  3FMW A;  6GST A;  3D22 A;  4Z2R A;  4PXO A;  1RQM A;  1OE8 A;  1OC3 A;  1GSE A;  4NV2 A;  1GTA A;  1JLV A;  3VUR A;  1O8X A;  3KH7 A;  3G7Y A;  2K18 A;  2EC4 A;  1FOV A;  5ECO B;  1GUM A;  3GKX A;  3P7X A;  4GCI A;  1XFL A;  4YH2 A;  1GLQ A;  1O85 A;  5CYY A;  1AQV A;  3UVT A;  2VL2 A;  5KN3 A;  2PUK C;  3C7M A;  1XXU A;  4JR6 A;  1QGV A;  1VF1 A;  3UBK A;  4GRF A;  3IOS A;  5KOW A;  1A2M A;  5G30 A;  1SJ6 A;  1Q4J A;  4TVE A;  2ES7 A;  5HFG A;  2YWO A;  1GLP A;  3ZRE A;  1F6M C;  3Q74 A;  3IXR A;  3F63 A;  2IN3 A;  3TRX A;  1W4V A;  1A0F A;  2IMI A;  1FOH A;  2H8L A;  2LEG A;  4O5R A;  3L9U A;  3A2V A;  2AHE A;  3KZQ A;  3KP9 A;  2ALB A;  3GUS A;  5KEJ A;  1TI3 A;  4ID0 A;  5D9T A;  1QMV A;  2TRX A;  4P3Y B;  2FLS A;  2CZ2 A;  3H4K A;  1R5P A;  1VGL A;  3GL5 A;  3M9K A;  5CRD A;  3VI7 A;  1O7U A;  3EE2 A;  2F3M A;  2R0P A;  4G2E A;  4BL7 A;  1ZYQ B;  2I9H A;  3WGD A;  5ECR B;  2GQM A;  3GRX A;  5DCG A;  4X43 A;  4I6X A;  2KOK A;  4YKF A;  4HQS A;  2AB6 A;  5HR3 A;  1B48 A;  2LQQ A;  2HSH A;  4D73 B;  3BOA A;  5HQP A;  3LYK A;  1PA3 A;  2IFQ B;  5J9C A;  1GUH A;  1FHE A;  4IKH A;  3UAR A;  3K8N A;  3CSI A;  2B1K A;  4FO5 A;  3GTU A;  2HRA A;  2V6O A;  3IV4 A;  2JU5 A;  2HZF A;  5EVO A;  1GTU A;  4BVX A;  2OE1 A;  3KMO A;  2O85 A;  4DSQ A;  2P0G A;  4L5O A;  2B7K A;  2FHE A;  5AIS A;  3EC3 A;  4NHZ A;  3HYP A;  4N0Z A;  1UC7 A;  3I43 A;  1AUC A;  1GL8 A;  4YQV A;  3BJ5 A;  2OE3 A;  2DIY A;  4FYU A;  3UMA A;  3DML A;  1V9W A;  4DSS A;  1XVQ A;  4POB A;  1YEP A;  5B7C A;  4EC0 A;  2F8F A;  5F07 A;  5EY6 A;  3HJP A;  2RII A;  1OE7 A;  3FY7 A;  5IMF A;  2DKH A;  3EWL A;  1V58 A;  4Q5Q A;  5BRT A;  1XWK A;  2QKE A;  1ON4 A;  3AY8 A;  1XIY A;  1BJX A;  5DAK A;  3J7Y b;  2H1G A;  4FIW A;  2YWM A;  1ERT A;  2CV4 A;  4MPG A;  1PL2 A;  2PVO C;  3Q19 A;  3LW9 A;  1T8E B;  2CA8 A;  5ECI B;  1AQW A;  13GS A;  2YOI A;  2PWJ A;  4JU5 A;  2YN1 A;  2MMN A;  2O7K A;  4WF5 A;  5KN0 A;  3BCI A;  1F37 A;  3IC8 A;  1XBS A;  1ZYP A;  4WXT A;  3GN3 A;  6GSS A;  5CRW A;  2REM A;  2VCZ A;  3GH9 A;  2KLX A;  3HA9 A;  1M99 A;  4V2M A;  2O89 A;  1PGT A;  1MDJ A;  4MF7 A;  2H66 A;  2VCV A;  1X9S B;  5FT3 A;  5J41 A;  3LXT A;  4G9H A;  2XPE A;  3HHV A;  3IAM 2;  1V57 A;  2WS2 A;  4PGT A;  2AV4 A;  4PQH A;  3I9V 2;  4PUF C;  4HS1 A;  3ZYW A;  2H6Z A;  4TR1 A;  3GSS A;  4L8E A;  5J3R A;  3ZL5 A;  3MIX A;  1X9W B;  1TK5 B;  1LU4 A;  2C0G A;  1XZO A;  1J9B A;  1GUL A;  3R2Q A;  5ECH B;  4O5U A;  3TKS E;  1DUG A;  4MJA A;  4XS1 A;  2GQL A;  1K0M A;  1OC9 A;  3KD0 A;  1X0R A;  3IAS 2;  2OE0 A;  4WEY A;  3VWV A;  8GSS A;  1ZZY A;  3HDC A;  4OWY A;  1K0C A;  1GRX A;  1V98 A;  5EL8 A;  2OJL A;  4KDX A;  2YV9 A;  3DGQ A;  3QDN A;  4OCE A;  2V1M A;  2VCX A;  2CX3 A;  1WE0 A;  1R5A A;  4MPF A;  4EXJ A;  3GIX A;  4ZL8 A;  5GAP D;  4GSN A;  5F05 A;  4K7I A;  4ACS A;  5HR2 A;  3H1N A;  1YQ1 A;  4KH7 A;  3CRT A;  4TR4 A;  3UOM A;  3RPN A;  5J4U A;  1M7T A;  3BBY A;  2MMO A;  1AXD A;  5IPG A;  3HVX A;  2DKI A;  4NAX A;  2H74 A;  3HVS A;  1DE1 A;  3KEB A;  1SD8 A;  5B8A A;  4TOP A;  2LNS A;  1TDI A;  5IQY A;  2X8C A;  1FG4 A;  3ME7 A;  4PNF A;  1ERV A;  2D2Z A;  3CYN A;  4GST A;  2H1B A;  4DVC A;  5HR0 A;  3RHB A;  3VLN A;  1GSD A;  2KHP A;  3WGE A;  4N10 A;  1U87 A;  4AJ6 A;  4OCF A;  3ISO A;  4ZBB A;  4XCS A;  1TJD A;  3HZ8 A;  2NVL A;  2LJR A;  1SL1 B;  1UVZ A;  1VF3 A;  2OKA A;  1T4Z A;  4G10 A;  5GAN D;  6GSX A;  1A23 A;  3GST A;  3GA4 A;  2L4C A;  1K0D A;  3UJ1 A;  1U3I A;  1B9Y C;  3P2A A;  2V32 A;  4POK A;  4K0G A;  4X1U A;  2FWF A;  2GTU A;  1HQO A;  5DAL A;  2V41 A;  2KUC A;  1OC8 A;  2OA7 A;  1EP7 A;  4I8B A;  5J5N A;  3FRC A;  3ZML A;  3RDW A;  4KX4 A;  2H6X A;  3LQ7 A;  1C72 A;  2GGT A;  4XS4 B;  2PU9 C;  3G7J A;  2WCI A;  2IJY A;  2GSQ A;  3WT1 A;  2O8V B;  3C8E A;  2C0D A;  2HLS A;  4Q5R A;  4GWR A;  3D4M A;  1FB0 A;  2QA2 A;  3HCZ A;  3GL3 A;  1USB A;  2FNO A;  4Z2U A;  1JHB A;  1TXX A;  1YJ6 A;  5DQS A;  4JRR A;  3ZIT A;  4EDZ A;  5GZZ B;  3TRQ A;  2HE3 A;  2F9S A;  5IMA A;  1EOG A;  2H76 A;  4K2D A;  2CVB A;  3VFI A;  2L5L A;  3KTB A;  2FWH A;  1K0O A;  4O92 A;  2MMZ A;  4GSS A;  1GWC A;  1G6Y A;  3O76 A;  5D9V A;  3H79 A;  2IMD A;  3IE3 A;  1QFN A;  4KCA A;  5INY A;  4KA0 A;  5A5K A;  4HDE A;  3DXB A;  2F51 A;  1DE2 A;  4TXV A;  5CRE A;  14GS A;  3GX8 A;  4PQ1 A;  4OFT A;  5ECS A;  4KDY A;  3IRA A;  3EMP A;  4RQR A;  1PN0 A;  3FR9 A;  3PGT A;  4L0U A;  1Z6M A;  3ZIJ A;  2JL4 A;  2CVK A;  4CHS A;  3Q6O A;  2NDO A;  5CP1 A;  4Z7X A;  4GXZ A;  4MH3 A;  2C8U A;  4ECC A;  1T7P B;  5G31 A;  1RW1 A;  2HT9 A;  3J7Y k;  2JSY A;  1A2J A;  5GST A;  5ID2 A;  1AW9 A;  4WKW A;  4BL7 B;  4MP4 A;  2B5Y A;  5G2Z A;  4USS A;  5JCU A;  5AIX A;  2VL9 A;  3DKS A;  4HU9 A;  3FR6 A;  1EEJ A;  2LST A;  3TCO A;  1GNW A;  2CT6 A;  4FQU A;  2HSM A;  2PPT A;  2I4A A;  2OAC A;  1XW6 A;  4V2N A;  2GS3 A;  4MLY A;  4QQ7 A;  1BAY A;  1QUW A;  2LJK A;  2G2Q A;  1JFU A;  3US3 A;  4BVY A;  1PKZ A;  4KDU A;  5ECP B;  1B4P A;  2A4V A;  4FH8 A;  3GTU B;  4G0L A;  4ML1 A;  3P8W A;  4K8M A;  2DC5 A;  1N2A A;  4NMU A;  4ZXG A;  5IOW A;  5IMC A;  4J2F A;  1Y25 A;  3WT2 A;  1B9X C;  3F0I A;  5FWG A;  1J0F A;  2I1U A;  4DSS B;  1I9D A;  2C3Q A;  1HNA A;  2GSR A;  3DVX A;  3TOT A;  4HQZ A;  1X5D A;  4GQF A;  4IQ1 A;  2C80 A;  1VF2 A;  5G1L A;  4CW9 A;  2RLI A;  1YF1 A;  4LLR A;  3TJJ A;  1ABA A;  1ACV A;  4HI7 A;  4EO3 A;  1M2B A;  2B3S A;  3ZFL A;  2VM2 A;  4ECI A;  5DJL A;  3W8S A;  3TKR A;  2L6C A;  1EEM A;  4O7H A;  5DAK B;  5DQY A;  1MTC A;  4HEA 2;  1Z6N A;  3FZ4 A;  3E9J B;  4HJ2 A;  4PUA A;  4F0B A;  4EKZ A;  2QA1 A;  1B4Q A;  2HYX A;  2G0F A;  1ZYE A;  2RUF A;  1O8W A;  3F4T A;  4IBP A;  1SK0 A;  3EVI A;  1K3O A;  2R37 A;  3TKP A;  4O5Q A;  5J9B A;  1EV4 A;  3OR5 A;  2AAW A;  4J57 E;  3LOR A;  1EZK A;  3WYW A;  1R26 A;  4XTS A;  4F2I A;  3FZ5 A;  1PX6 A;  3IBH A;  3SWL A;  3ZMK A;  4POM A;  2OBK A;  4K9Z A;  3G9B A;  2WB9 A;  5IPH A;  3MDK A;  1QK8 A;  2N5F A;  1ZGN A;  1YZX A;  2QC7 A;  4O32 A;  1PD2 1;  3TUE A;  2IPA A;  5G5F A;  1IYI A;  4KAE A;  5F8B A;  5IM9 A;  2VCW A;  1TKD B;  2J9H A;  1EWX A;  5ECN B;  2GQK A;  1EGR A;  1ERW A;  4G19 A;  3GUR A;  4TXO A;  4NHW A;  2VO4 A;  3PH9 A;  1Z7R A;  2DJ0 A;  3GV1 A;  1KBN A;  2A4H A;  3D5J A;  1A24 A;  2LTK A;  1MDI A;  1SYR A;  2QGV A;  4OFN A;  1OC9 B;  1S3C A;  1SL0 B;  4MJC A;  3EU4 A;  5B6N A;  1PX7 A;  4CDO A;  5D73 A;  4KSM A;  1TTZ A;  2WJU A;  5KN1 A;  3TKS C;  5B8B A;  3L9V A;  3F3Q A;  4K5R A;  4J56 E;  2BJX A;  5DBQ A;  2FWG A;  2DSA A;  4HUA A;  4MF5 A;  5ENU A;  2GZY A;  5AGY A;  1F2E A;  5DDL A;  9GSS A;  5FHI A;  2ZUP A;  2R0C A;  3FW2 A;  2PMT A;  1V2A A;  2M80 A;  1YKC A;  3TJF A;  3N9J A;  4NPB A;  2VL2 C;  1QQ2 A;  1SJI A;  5IIZ A;  3VPQ A;  1WJK A;  1G6W A;  4IP6 A;  2WGR A;  1THX A;  2AJQ B;  2B5X A;  2IFQ A;  3FEU A;  3I6A A;  3LG6 A;  4MZC A;  1BED A;  1TU7 A;  1FAA A;  4KUN A;  3IDV A;  2L5O A;  3GFK A;  4N0V A;  3ERW A;  1U88 A;  1CQG A;  3MAK A;  3QAG A;  1H75 A;  1FVK A;  2DJ2 A;  2VLU A;  2H19 A;  4Q5F A;  4RI7 A;  1JZD A;  2EIQ A;  2M72 A;  1VF4 A;  2XBI A;  4TKY A;  1SKR B;  1XPV A;  5IMZ A;  3FK8 A;  5DVB A;  2H70 A;  2PGT A;  1JZR A;  3KMN A;  2LKU A;  4BWQ A;  4ZL9 A;  1AIU A;  3CBU A;  3DIE A;  2EIO A;  1HNB A;  1SK1 A;  2DJJ A;  7GSS A;  1OAZ A;  5EPF A;  1CQH A;  2R3X A;  1PL1 A;  3KXO A;  1GH2 A;  2VLT A;  2B7J A;  3QOU A;  4MAB A;  2RM5 A;  3N5O A;  4RQX A;  4KSO A;  1ILO A;  4XRD A;  5DAL B;  5LCZ A;  22GS A;  4ZIL A;  2CX4 A;  3W8J A;  2FD3 A;  1SL2 B;  3GNJ A;  1YY7 A;  2C3N A;  1XWA A;  3GMF A;  3ZRD A;  4XHM A;  2GLR A;  2HRK A;  2WDU A;  2X8G A;  4YKG A;  4ZIJ A;  1ZMA A;  4GQC A;  2B1L A;  2ZNM A;  4MZW A;  2B6M A;  2C0E A;  2YP6 A;  5JWO B;  2R4V A;  1TRW A;  18GS A;  5ECK B;  1RK4 A;  2E0Q A;  1SD9 A;  5D8I A;  4RUV A;  3UAP A;  1UA5 A;  5JWR B;  1A8L A;  1JLW A;  1PMT A;  4IJI A;  1MD4 A;  1EOH A;  1TRS A;  4GF0 A;  1YEX A;  1K0N A;  4I5Q A;  3HD5 A;  6GSU A;  2CQ9 A;  3HJO A;  2FA8 A;  3GKN A;  1PN9 A;  4YAP A;  4HU7 A;  4YAV A;  1HNC A;  4K0N A;  5C00 A;  2H73 A;  3GKM A;  3TJB A;  3TJK A;  3DEX A;  3APO A;  4OD7 A;  4G0I A;  4MJE A;  1XVW A;  3IA1 A;  2X8H A;  3KH9 A;  4I2T A;  3E3E A;  3HY2 A;  1TOF A;  2IME A;  3HJM A;  3O6T A;  2BMX A;  1SU9 A;  12GS A;  3A3T A;  5L71 A;  20GS A;  2H72 A;  1K3Y A;  3UEM A;  5D9X A;  1AQX A;  5C04 A;  4F9Z A;  4ZB6 A;  3LYP A;  1K3L A;  3TOU A;  4K1F A;  5A4W A;  4MMM A;  4ZB9 A;  3F4S A;  1S3D A;  4WF4 A;  1G7E A;  2P31 A;  3S9F A;  3TKQ A;  5ID2 B;  2GZZ A;  2A2S A;  1M9B A;  2LRN A;  2MZC A;  1Q98 A;  2FA4 A;  3ZVJ D;  5IOX A;  2VM1 A;  4JR4 A;  4OMV A;  4X0X A;  4JE1 A;  3LWA A;  5E4W A;  2LRC A;  3F6D A;  3HKR A;  1DSB A;  2PN8 A;  4MDC A;  2LQO A;  3APQ A;  2JAD A;  5CRG A;  3QR6 A;  1FO5 A;  1THO A;  4ULX A;  2XPD A;  4BVY B;  1SK2 A;  4CY8 A;  1NHY A;  1O73 A;  2NTO A;  2N5B A;  4PNG A;  2R2J A;  1A0R P;  4OO4 A;  3L0H A;  4K7O A;  3F3R A;  5G5E A;  1PSQ A;  3EMX A;  3QD9 A;  2V6K A;  1ST9 A;  5CAX A;  5D96 A;  4K2X A;  5KOX A;  5AIV A;  5H5R A;  1TRU A;  2YAN A;  3C71 A;  3CSH A;  1S3A A;  2FCH A;  3DVW A;  3WD6 A;  2YJH A;  2H0H A;  3CXG A;  1WOU A;  3E0U A;  1Z9H A;  3LXZ A;  2E2G A;  2H01 A;  2VD1 A;  1WMJ A;  1HYU A;  3G7I A;  2MBS A;  1A2L A;  2A2R A;  19GS A;  4MK3 A;  3TB2 A;  3ME8 A;  3QFA C;  5DJM A;  1TRV A;  3CRU A;  3U5R E;  2XC2 A;  3QCP A;  1XOA A;  2J23 A;  4PQI A;  4AJ7 A;  1UN2 A;  1K0A A;  3KP8 A;  3ZZX A;  1OYJ A;  5BMU A;  2IMF A;  3PIN A;  2HZE A;  4AF2 A;  2AYT A;  2L6D A;  3DYR A;  2VCQ A;  1LJR A;  5HR1 A;  3EUR A;  2RUE A;  2JZT A;  2B5E A;  4XIH A;  2N5A A;  3P90 A;  4XS4 A;  5A4U A;  1XWC A;  2DLX A;  4BWS A;  3F6F A;  4PTS A;  3L4N A;  1BQ7 A;  4V1A g;  4IEL A;  4KCE A;  4NV5 A;  4E8H A;  1X9M B;  3A2X A;  4EF0 A;  4TN8 A;  1M2A A;  5IMD A;  1FB6 A;  4TR3 A;  1T1V A;  3GHA A;  2PER A;  1K0B A;  4ZBA A;  3TKS A;  2IIY A;  2Z9S A;  4EL1 A;  1KNG A;  3GX0 A;  4EDY A;  4V2L A;  1F3A A;  3LSZ A;  2H71 A;  4BVX B;  2C3T A;  16GS A;  1M9A A;  5ELA A;  4IHU A;  3VWU A;  1NSW A;  2I81 A;  3BCK A;  3ZFB A;  1B8X A;  2PBJ A;  1G0T A;  3VWX A;  4KW6 A;  2HRN A;  1G7O A;  3F9U A;  3H93 A;  1W89 A;  3RAZ A;  5G1K A;  4I97 A;  2YZU A;  2UZ8 A;  3FR3 A;  1XOB A;  1WWJ A;  1YF0 A;  4TXO B;  1U3A A;  2GT5 A;  2K6V A;  5H5Q A;  4YQU A;  2EIR A;  3FHK A;  4F03 A;  1TI1 A;  4L5L A;  4K5S A;  4LL4 B;  3VI5 A;  1A8Y A;  3A2W A;  2L57 A;  6GSV A;  2V2G A;  3M1G A;  4NXI A;  1PKW A;  3QFB C;  3M0F A;  4LL1 B;  1XCC A;  4H86 A;  4KE3 A;  1HD2 A;  1OKT A;  5JCG A;  2ON5 A;  4MJB A;  4KND A;  4IQA A;  3DWV A;  3FZ9 A;  4IJ3 A;  1TU8 A;  1ZYN A;  1T00 A;  3D0Z A;  3VK9 A;  2CVD A;  1KTE A;  3H8Q A;  4K6X A;  2MMA A;  1BG5 A;  2M46 A;  1NM3 A;  3KTL A;  3GYK A;  2JZS A;  3R3E A;  2YWI A;  1WIK A;  1T3B A;  1SKS B;  4L0W A;  3IHQ A;  1EGO A;  1MEK A;  3M3M A;  1LBK A;  2VL3 A;  4XS6 A;  4ECJ A;  3SBC A;  1XWG A;  4MCU A;  2GDR A;  1Z5Y E;  4EUY A;  1TP9 A;  2GSS A;  4WET A;  4PUR A;  4DSR A;  4EVM A;  2HNL A;  2KP1 A;  4HJM A;  3I69 A;  3QAV A;  3ERF A;  3KCM A;  2VD0 A;  3IR4 A;  1WPI A;  3UIW A;  5CO3 A;  4IVF A;  2OAD A;  2YNX A;  17GS A;  2FGX A;  5A4V A;  1GSY A;  2YV7 A;  4RI6 A;  3DD3 A;  1DBY A;  3LEF A;  2HRF A;  3CSJ A;  1FW1 A;  3VWW A;  3IC4 A;  3RPP A;  4TR1 B;  3QPM A;  2K9F A;  2HXK A;  1ZCP A;  3JCM L;  2I3Y A;  4EE0 A;  3FYG A;  3LGC A;  5GSS A;  5IO0 A;  4GLT A;  1M0U A;  5H5S A;  3RBT A;  3M9J A;  5E59 A;  3DRN A;  1R4W A;  3NZN A;  3IK9 A;  5ECL B;  3U6V A;  3A5W A;  2LUS A;  4AGS A;  2VUP A;  4K7N A;  3F8U A;  1KEB A;  3ED3 A;  2DBC A;  3APS A;  5D9W A;  2PVQ A;  2NPB A;  2H75 A;  3LFL A;  1Z7P A;  2QSI A;  2O87 A;  3KJY A;  2XBQ A;  2LRT A;  5CNW A;  1OVN A;  5LNK e;  1ZOF A;  4ISD A;  11GS A;  2YWN A;  1MDK A;  2R6K A;  4IW9 A;  4WBJ A;  4EIQ A;  5IO2 A;  4WR4 A;  5IMV A;  1XWB A;  2P5R A;  2C1Y A;  2E7P A;  2MBT A;  2C4J A;  3EPT A;  4OFM A;  2DJ1 A;  3NIV A;  4ZL7 A;  2CAQ A;  3CMI A;  4HOJ A;  2YJ7 A;  2C0F A;  4D73 A;  3TRP A;  2JSZ A;  2P5Q A;  1Z3E A;  3IK7 A;  2DJK A;  1EV9 A;  1IYH A;  4TRX A;  3UL3 A;  4IN0 A;  1O81 A;  3D4T A;  3CTF A;  4FYB A;  4GTU A;  3ZIV A;  5ELG A;  2HFD A;  2LJA A;  1YDK A;  1V40 A;  1ERU A;  5HFK A;  6GSW A;  4OO5 A;  2DMM A;  2VOC A;  4N30 A;  4E8E A;  2DML A;  2FY6 A;  4POL A;  1SJZ A;  1FVJ A;  1SEN A;  1F3B A;  2H6Y A;  2ON7 A;  3GKK A;  1R7H A;  4ZB8 A;  1Y6E A;  1JZO A;  3EU3 A;  1MD3 A;  5KN2 A;  1GSF A;  2YCD A;  2VAF A;  5AN1 A;  4ZBD A;  1M2D A;  4TR0 A;  3KGK A;  3CTG A;  4PX1 A;  3ERG A;  4MZB A;  4JED A;  2H30 A;  2NBS A;  1EP8 A;  1GSQ A;  4FYC A;  4N11 A;  5F06 A;  3C73 A;  2KP2 A;  2ZCT A;  5D93 A;  2JAC A;  1VRS D;  5JCW A;  1NHO A;  2FUG 2;  2TRC P;  2VCT A;  2R0G A;  3ZLP A;  1GNE A;  4NWY A;  1J08 A;  1ZL9 A;  5CRH A;  2XHF A;  4XRA A;  2MYG A;  2HI7 A;  1WRY A;  3HXS A;  4HZ2 A;  4V1A p;  4IP1 A;  2H1A A;  4JZQ A;  3W6G A;  4HZ4 A;  2A2P A;  1H4O A;  4IGJ A;  3RHC A;  4KF9 A;  2VLV A;  6GSY A;  3KIJ A;  4G0K A;  4MNN A;  4BA7 A;  4BPY A;  1GTB A;  2WZ9 A;  3ZVJ A;  2CZ3 A;  2LS5 A;  3MNG A;  2BTO T;  3KM6 A;  3L78 A;  5ECM B;  2H0I A;  3O3T A;  1GSU A;  4MF6 A;  2OBI A;  2IL3 A;  2X64 A;  1X5E A;  1GUK A;  4ILF A;  4Z2T A;  4DEJ A;  2H1D A;  1X5C A;  2YPM A;  3TDG A;  1SKW B;  4X4J A;  4QL9 A;  1GTI A;  2GST A;  3PR8 A;  4EIP A;  3D6I A;  2H0G A;  2JZR A;  1AC1 A;  4CY6 A;  2K8S A;  3UVH A;  2WRT A;  3BD2 A;  3QAW A;  3M8N A;  2X49 A;  3FZA A;  3QMX A;  5LD0 A;  1BYE A;  3ZTL A;  4WR5 A;  1GSS A;  3C1S A;  1F9M A;  2AUV A;  5COH A;  4LMV A;  3Q18 A;  1QXH A;  4I2U A;  2WFC A;  5ECQ B;  4YQM A;  3WGX A;  2FWE A;  5DCH A;  4LA1 A;  4AJ8 A;  2IMK A;  2HZE B;  3PPU A;  4F82 A;  2X4A A;  2GT6 A;  5ABR A;  5F0G A;  2VIM A;  1E6B A;  1TK0 B;  2YZH A;  3TGZ A;  2CAI A;  4KGI A;  3V1W A;  5B6M A;  1PQN A;  4TW5 A;  1ML6 A;  1BX9 A;  2RM6 A;  1GP1 A;  3NOF A;  2IWT A;  1AAZ A;  4QL7 A;  3C1R A;  4ICY A;  1O6J A;  10GS A;  2F8A A;  4ML6 A;  2R5G A;  1SYX A;  3MWH A;  5HFI A;  1T4Y A;  2K8V A;  4F0C A;  4ECB A;  3HZ4 A;  1WP0 A;  3TJG A;  1NW2 A;  2DIZ A;  3VPT A;  3EYT A;  3F4R A;  3D21 A;  3FKF A;  4JBB A;  2L4Q A;  3UBL A;  5JWQ B;  3IPZ A;  1XW9 A;  2GZP A;  2HSY A;  4LMW A;  4MH2 A;  1I5G A;  1YKA A;  1TW9 A;  2E2M A;  3LJR A;  3MSZ A;  1URM A;  3A5I A;  2DJ3 A;  1PRX A;  4IS0 A;  2L59 A;  1XW5 A;  3L9S A;  4Q5N A;  1TK8 B;  2GVP A;  3HVV A;  1E2Y A;  2LV3 A;  2TIR A;  2WUL A;  1N8J A;  1U6T A;  4KB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...