1I9DA

Arsenate reductase from e. coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
138
structure length
138
Chain Sequence
NITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLRKNVEPYEQLGLAEDKFTDDQLIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ARSENATE REDUCTASE
publication title Insights into the structure, solvation, and mechanism of ArsC arsenate reductase, a novel arsenic detoxification enzyme.
pubmed doi rcsb
source organism Escherichia coli
total genus 38
structure length 138
sequence length 138
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03960 ArsC ArsC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1i9dA00
3G7JA 2IIYA 4J56E 5HFGA 3IAS2 3GV1A 5LCZA 4H86A 4TR0A 2H70A 3IAM2 2GQMA 2HLSA 3A2XA 3Q19A 3NIVA 4F9ZA 2IWTA 5D9VA 3D5JA 2JU5A 3ZIJA 3ZIVA 2BTOT 4ZXGA 4GSSA 2GZPA 1Z5YE 2LJAA 1F3AA 3FHKA 3UAPA 4FYUA 2LRTA 4MJCA 4NHZA 1OKTA 1M99A 3IXRA 2R2JA 1THOA 3TOTA 2NTOA 1XOBA 5DBQA 1N8JA 2ALBA 3EU4A 5GZZB 4TN8A 4KE3A 3RBTA 4G2EA 2P5RA 1TRWA 2K9FA 2CQ9A 5C04A 4MF6A 5GSTA 3JCML 2PU9C 1B9YC 4POLA 3FW2A 1IYHA 2CVDA 2MMNA 3D4TA 3EMPA 1V9WA 5D96A 2LUSA 3C7MA 4IJIA 2OJLA 2V41A 5J5NA 2VUPA 3DIEA 3DYRA 4BL7A 2IMIA 2H0GA 3IRAA 4MF5A 5B7CA 3ZLPA 4JBBA 1XW6A 2FGXA 3FKFA 2GT6A 3KIJA 1HQOA 4F0BA 4GRFA 2C0EA 4RI7A 1JZWA 1MDIA 1O73A 4GXZA 5GAPD 4TKYA 1Q4JA 1X9SB 4LMWA 3H79A 3KM6A 1OVNA 4K7IA 1HD2A 3TKSC 3VI5A 5ECRB 1N2AA 2OE3A 2ES7A 1EV9A 3DD3A 4JE1A 4YH2A 1YF0A 3A2VA 1TKDB 5DALB 2H19A 2VOCA 5D73A 3UBKA 2NDOA 3VPTA 4HOJA 4LA1A 2P31A 1YKCA 1OC9B 1TRSA 6GSYA 3UIWA 5COHA 4O92A 2XPEA 1JLVA 2HE3A 3GURA 1YKAA 5A5KA 1IYIA 2VIMA 4QL9A 2OKAA 2AHEA 4KUNA 1GRXA 2GLRA 2X99A 3HA9A 1PA3A 1KTEA 1FO5A 3GKXA 4NWYA 1M9AA 4GQCA 2OBKA 2VLVA 1AQWA 2B5EA 4IN0A 2KUCA 5J4UA 4YQUA 1RK4A 4WF4A 1B4QA 2AUVA 2O7KA 2ON5A 2VLUA 3LEFA 5AN1A 2J23A 2OE0A 3GKNA 1KNGA 4HEA2 3RHBA 3HKRA 5DALA 1ZYEA 1GSSA 3F3QA 5IOXA 2HFDA 3C73A 2H0HA 1YDKA 4XIHA 1T4YA 2HSYA 2GSQA 3P8WA 2QGVA 1OC9A 5DCHA 3WGEA 1Y6EA 2V6OA 5ECQB 2A4VA 4RUVA 5D9WA 2FY6A 4JEDA 2RM5A 3EVIA 2OBIA 3RDWA 1NW2A 4ZL7A 16GSA 1SL1B 1TK0B 4EUYA 5E4WA 3WGXA 1A0FA 1GNWA 4MDCA 2B6MA 3GKMA 2X64A 2PBJA 4N0ZA 3W8JA 3BCKA 2VCVA 1WIKA 1Z3EA 2LV3A 4O7HA 3H8QA 4IQAA 1K3OA 3CXGA 1LU4A 3IPZA 4WEYA 2FWEA 4ISDA 2B7KA 1ERWA 3GSSA 4PUAA 1GUHA 2R37A 5CAXA 1PX6A 1K0OA 2MMOA 1I9DA 1YJ6A 2QC7A 2GT5A 2REMA 3L9VA 2MZCA 1EEMA 4ML1A 3ISOA 5E59A 3GX0A 3EMXA 1TJDA 4OFNA 1XWCA 4V1Ag 3Q6OA 5AIXA 1U88A 2IL3A 2Z9SA 3QCPA 4G10A 2HYXA 2C0FA 4GCIA 1XIYA 2ON7A 1BQ7A 2DJJA 4K9ZA 1JZDA 3F6FA 2CVKA 2VCZA 2CZ2A 5CREA 2H74A 4MZBA 2IFQA 5D9TA 2KLXA 1X0RA 3F4SA 3TKSA 4E8EA 1DSBA 2WZ9A 4AJ7A 4POMA 2XC2A 3D22A 1QMVA 1XWAA 5FWGA 2AAWA 14GSA 3G7IA 2JZSA 3HYPA 2CX4A 5IIZA 3DRNA 3ZREA 1ABAA 5F0GA 1UC7A 4RI6A 4XS1A 1G7OA 5B8BA 4F03A 2PERA 3GSTA 3MNGA 3TRQA 3PGTA 4JR4A 4L0UA 1AQVA 1THXA 5B6NA 1EGOA 5JWOB 5IMVA 4O32A 5EY6A 3KTBA 5HR3A 1O8WA 4IP1A 4WF5A 3DVWA 3E0UA 4BWQA 3UVTA 4F82A 3QD9A 3TOUA 1R7HA 2KP2A 3DVXA 3QMXA 1MD3A 3L4NA 1WJKA 1K0MA 4MJEA 3CSJA 3UMAA 3RPPA 5KN2A 1ERUA 1TK5B 2FHEA 4BVXA 2FUG2 4EE0A 1GL8A 1B48A 1YQ1A 3FK8A 2HZFA 1K0BA 4MJAA 1VF1A 4KSOA 1A0RP 3WT1A 4KNDA 1DE2A 4MMMA 5GAND 4YQMA 1WMJA 1FB0A 5J9BA 2YN1A 2AB6A 2B3SA 5JCWA 2LNSA 2DBCA 3U5RE 3DEXA 1H75A 4MPGA 1TTZA 2VM1A 4ZBAA 1A24A 3RAZA 4PXOA 5ECSA 5ECNB 4K7NA 3CBUA 2ZUPA 2WB9A 5D8IA 3IDVA 2LKUA 2VL9A 2GZYA 3FZAA 3SWLA 5HR2A 2LRNA 1BJXA 13GSA 4XTSA 2NPBA 1LBKA 1PKWA 1EV4A 1EP8A 2C3TA 3BOAA 4X1UA 4BPYA 1QUWA 1YF1A 2V6KA 1V57A 2YOIA 1GWCA 1SKRB 4AJ8A 2PVOC 5IOWA 3KMOA 3TCOA 4FIWA 2JL4A 3H4KA 4TRXA 1GP1A 3QFBC 1TI3A 3LYPA 3KCMA 2LJRA 18GSA 3C1SA 3DXBA 3W8SA 5G5FA 5INYA 1FVJA 5AISA 1FB6A 1B4PA 3IA1A 3VLNA 1FAAA 4I2UA 3TB2A 3FR9A 5ECIB 1MEKA 1QQ2A 4EKZA 4PGTA 1VF3A 3DGQA 2LEGA 1CQHA 2GVPA 2FWGA 3F8UA 4KCAA 2HXKA 2YNXA 4DVCA 2FCHA 2K8VA 1T3BA 1ON4A 4FO5A 2R3XA 1U6TA 1GNEA 4PUFC 3O76A 1ZYQB 5GSSA 2GS3A 2H1BA 4N30A 3O3TA 4ECJA 3I69A 4KDXA 2C3NA 2CA8A 4LL1B 2LS5A 4WR5A 4V2LA 5ID2B 5F06A 1HYUA 1SK2A 4QQ7A 4ECCA 2GSSA 1GSUA 4HZ4A 5ELGA 1SYRA 1SD8A 1V40A 3WGDA 4KAEA 2M80A 3L9UA 2AJQB 2C1YA 2VCQA 5KN1A 5HR0A 3IR4A 1GTIA 2WDUA 2YZHA 2PPTA 2B7JA 1K3LA 4ZIJA 5DAKB 4OO4A 1JZRA 4P3YB 4PURA 2X8GA 1Y25A 3C71A 4F2IA 4GWRA 2FD3A 1SJZA 1XZOA 1T4ZA 1FHEA 4I97A 5CNWA 1EOGA 1M2AA 1WPIA 2DIZA 3TDGA 3V1WA 3C8EA 3RHCA 3EURA 4HS1A 2GQKA 1T7PB 3LXZA 3GHAA 3TJFA 1GSYA 1GTAA 3EINA 4GSTA 4WETA 4BA7A 1A8YA 4N11A 1DE1A 2PVQA 3HVSA 5ID2A 3KMNA 4KDYA 3GFKA 1OAZA 3FZ4A 1G6YA 4PQIA 1R26A 6GSTA 5D9XA 2YV7A 1WOUA 3VFIA 1K0CA 2GGTA 5JWQB 10GSA 1SD9A 3KEBA 3L0HA 3NOFA 3E9JB 1OE7A 2CZ3A 3FY7A 4IQ1A 4D73B 1X5EA 4MA9A 4AF2A 4Q5FA 4EXJA 5DDLA 5DAKA 2H0IA 2H8LA 2TIRA 1J9BA 3CTGA 3KTLA 1WRYA 1X5CA 1QFNA 3L9SA 4MJBA 3MAKA 4N10A 2WRTA 1XWKA 2F3MA 1OKDA 1OC3A 5IQYA 3KH9A 5J9CA 3VWXA 2C0GA 2XBIA 4GQFA 4LLRA 4POBA 3IHQA 3QOUA 4WBRD 3AY8A 1U87A 3BJ5A 3GH6A 1AQXA 4JR6A 1NHYA 5ENUA 3QFAC 4ZBDA 1TOFA 3TUEA 4GF0A 12GSA 2VL2A 3UOMA 2HI7A 1F2EA 1EGRA 2GDRA 2YCDA 4D73A 1UVZA 1B9XC 2LSTA 3TKQA 4V2MA 1DBYA 4OCEA 4ZBBA 2OACA 1YZXA 3TGZA 4PQ1A 4KA0A 5H5RA 1T8EB 3K8NA 2MYGA 1GUMA 1W89A 1U3AA 2A2SA 3HHVA 2H75A 2YP6A 2VCTA 3I43A 3CYNA 3NZNA 4IHUA 4FH8A 1VF4A 1A2MA 3GMFA 1USBA 4TXOB 3SBCA 3HJPA 5CRWA 5CRDA 2VL3A 1NHOA 1K0DA 4F0CA 2E7PA 2B1LA 3TKRA 1GTBA 1AW9A 2IPAA 5G1KA 3TJKA 5HFIA 1TRVA 4J2FA 2YJHA 5F8BA 2LRCA 3ED3A 2J9HA 4KB3A 2OA7A 1VRSD 3BD2A 1GH2A 4POKA 2HRFA 2B5XA 4EDYA 4G19A 5F07A 4CW9A 2PMTA 1O8XA 1MD4A 1BG5A 3FYGA 1F6MC 3ERGA 2NBSA 3UBLA 2NVLA 3H93A 4K7OA 2WCIA 3ZMLA 1OC8A 4KCEA 4TXOA 5B8AA 3US3A 3LG6A 1MTCA 4XS4B 4AGSA 2WGRA 4G9HA 5IO2A 1A8LA 1EP7A 1TU7A 6GSVA 2XHFA 1S3AA 3QAGA 2MBTA 6GSSA 4XRAA 1HNAA 3CMIA 5ELAA 2A2RA 3M3MA 4IP6A 1ERTA 2DIYA 4EL1A 3KGKA 2C8UA 3APOA 3ZL5A 1S3DA 3VWUA 1SJIA 3EYTA 1ZCPA 1ERVA 1SYXA 4MABA 1AUCA 1M9BA 2GZZA 5ECMB 2OE1A 4L8EA 2C80A 1O81A 3F63A 4CHSA 2GQLA 2I9HA 2MBSA 4MZCA 1X5DA 4HQZA 5DVBA 4ZB9A 1R4WA 4TVEA 3ZZXA 2GSRA 3RPNA 5A4WA 6GSXA 4PQHA 3MWHA 1WE0A 3LQ7A 4NAXA 1PRXA 2PUKC 2IMDA 1SK0A 4XS4A 4KW6A 4O5RA 3P90A 2TRXA 1UN2A 2KP1A 3LWAA 1TW9A 2MMZA 1F9MA 3M8NA 2H6ZA 1CQGA 2JACA 4K0GA 5ECHB 1A2LA 3E3EA 1S3CA 4OWYA 4NPBA 3VPQA 1ZOFA 3Q18A 4DSSB 1J0FA 1T00A 3GIXA 3TKSE 2F8AA 1GTUA 1G7EA 2RUFA 2DMMA 4TOPA 4X0XA 1XVQA 2JZTA 3EE2A 3QR6A 1ILOA 1XBSA 2H1GA 3QAVA 3GKKA 3HXSA 2I4AA 1K0AA 6GSUA 2FWHA 3TJBA 1TDIA 4JZQA 4E8HA 4K0NA 4I2TA 1TK8B 1G0TA 3MSZA 3IK9A 3GA4A 5DCGA 3DKSA 2E0QA 1AC1A 5DJMA 2M46A 2V1MA 8GSSA 4NV2A 7GSSA 5L71A 5DQYA 4EO3A 1ZGNA 1TI1A 3VURA 3A2WA 4KGIA 4WR4A 20GSA 4I5QA 5B6MA 3LYKA 4YAVA 3VK9A 4MPFA 4GTUA 2FWFA 2H72A 2PWJA 1ST9A 5IMZA 5G31A 5JCGA 4LMVA 5KN3A 4Z7XA 3HJOA 2CX3A 3FR6A 1E2YA 5H5QA 1PX7A 3S9FA 2JSYA 2HZEB 4MF7A 5EPFA 1JHBA 1EEJA 2RLIA 1YEPA 4MLYA 2XBQA 3FZ9A 1RQMA 2YJ7A 3HZ8A 3UARA 1QK8A 1ZL9A 3KH7A 2H71A 3CSIA 4ACSA 1G6WA 1MDKA 1WWJA 1XPVA 2LJKA 3I9V2 4NMUA 2O8VB 1M2DA 2VO4A 1T1VA 3P7XA 1JLWA 3O6TA 4EF0A 4KH7A 3GRXA 1A2JA 5KN0A 2JSZA 2B1KA 3CTFA 5A4UA 1YEXA 5DQSA 4OCFA 2YV9A 2DLXA 4MP4A 2I3YA 4XRDA 5LD0A 3VWWA 2RIIA 2VCXA 5G30A 3F6DA 3A5WA 3GYKA 3HDCA 3DWVA 2IN3A 2K8SA 1KEBA 5CO3A 3PINA 3D0ZA 2O87A 2CT6A 4PX1A 2DJ1A 2MMAA 4HJMA 5G5EA 11GSA 2C4JA 1NM3A 4TR1B 3TRPA 2HZEA 2YANA 1XVWA 5A4VA 2DC5A 2FA4A 2VM2A 1V58A 4IVFA 4IS0A 4XS6A 1Z7RA 1EZKA 3GUSA 5CRHA 2HNLA 5IMFA 1TP9A 3P2AA 1OYJA 1I5GA 4FYCA 1PSQA 2DJ3A 2HRNA 3GN3A 1HNBA 2YWMA 1FOVA 3BCIA 3UJ1A 1NSWA 4HU7A 1BAYA 2L59A 2F51A 3ZVJA 1PL1A 2H01A 17GSA 4I6XA 2WFCA 3I6AA 4YQVA 3M1GA 3A3TA 3UEMA 5HR1A 2P5QA 4KDUA 4ZL9A 3G9BA 1EOHA 5D93A 5H5SA 5IMCA 1FVKA 4OFTA 4TR1A 3ZVJD 3HJMA 2H30A 2F8FA 1PL2A 1WP0A 1GSDA 2XPDA 3KZQA 5F05A 4EVMA 4HI7A 2K18A 4K1FA 5ECOB 3TRXA 2CV4A 2KHPA 4IW9A 4WKWA 1F3BA 2DSAA 2IMKA 1O7UA 4TR4A 1BEDA 4MZWA 1Z6MA 4ZL8A 3DMLA 2C3QA 3W6GA 3TJJA 4XHMA 3KP8A 1PN9A 1A23A 4RQXA 3ZTLA 1GLPA 1JZOA 3ERFA 4EDZA 1AAZA 2RUEA 1PGTA 4EC0A 4ML6A 4RQRA 1X9WB 2I81A 5CRGA 4IELA 2H73A 1JFUA 2CAIA 1XW5A 2HSHA 2O85A 2H6XA 4K8MA 2B5YA 2GTUA 2I1UA 5LNKe 1GSFA 2AV4A 3U6VA 2WS2A 2IJYA 4TW5A 3LJRA 5J3RA 3LFLA 1SJ6A 3QAWA 1XOAA 3IV4A 2E2MA 4L5LA 1LJRA 4BWSA 2PGTA 2EC4A 3HZ4A 2VAFA 3ME7A 2H66A 3TKPA 3N5OA 5CYYA 1SL0B 1ZMAA 2DMLA 1U3IA 2JZRA 3FR3A 3L78A 2BMXA 2H1AA 1KBNA 2YWNA 2CVBA 1FW1A 4L0WA 2L6DA 3N9JA 1GLQA 2X8HA 3UL3A 1MDJA 2WJUA 2L5OA 4TXVA 4OO5A 1TU8A 1FG4A 3EC3A 4CDOA 1C72A 4ILFA 1RW1A 4IBPA 3C1RA 3ZMKA 3KP9A 5HQPA 1TXXA 3ZFLA 2BJXA 3FZ5A 3D21A 4QL7A 4BVYA 4WXTA 3D4MA 3IC4A 4HQSA 4PNFA 2G0FA 5ECKB 3OR5A 3VI7A 1VGLA 3ZITA 1VF2A 3ERWA 4OD7A 4KX4A 4ECIA 2L5LA 4ZB6A 4V1Ap 2L4QA 5IMAA 4HZ2A 3LORA 4DSQA 1B8XA 1BX9A 2LNTA 1PQNA 3EWLA 4ZILA 5IO0A 3IE3A 2IFQB 1Q98A 1EWXA 5AGYA 5G1LA 3HVXA 1GSQA 2GSTA 3J7Yb 2E2GA 3FEUA 1AIUA 2P0GA 2PN8A 5C00A 4ULXA 2R4VA 2H76A 3LXTA 5G2ZA 1Z6NA 2FA8A 3GL5A 4PNGA 2FNOA 3M0FA 4GLTA 1AXDA 1E6BA 3GNJA 4FYBA 5AIVA 2L6CA 1XWBA 2JADA 1M0UA 3HD5A 2F9SA 4Q5NA 2X8CA 3D6IA 4HDEA 3PR8A 3WD6A 1J08A 3H1NA 3IBHA 3F0IA 1OE8A 2L4CA 1TRUA 4HJ2A 2V32A 1R5AA 5EL8A 4IKHA 1V98A 4LL4B 1SENA 3R2QA 3F4RA 2RM6A 4IGJA 4MH3A 2AYTA 2N5BA 2R6KA 3FRCA 22GSA 1QXHA 2VD1A 3M9KA 1R5PA 5IMDA 3M9JA 2ZNMA 4ECBA 3UVHA 2VD0A 3F3RA 1K3YA 4Q5RA 4WBJA 4KSMA 1PMTA 4AJ6A 1URMA 4K6XA 1Z7PA 5FHIA 1M2BA 5EVOA 3GX8A 1ML6A 5J41A 4N0VA 2EIRA 3CRUA 2G2QA 1UA5A 1GSEA 2V2GA 4NV5A 4ID0A 1XW9A 2C0DA 4HUAA 1XCCA 4DSRA 3ZRDA 1BYEA 2LQQA 4MK3A 5HFKA 2R5GA 2D2ZA 2N5AA 6GSWA 4YAPA 3HCZA 5ABRA 3KXOA 3TJGA 3BBYA 1SK1A 4MH2A 4JRRA 1ACVA 3VWVA 4IJ3A 1SKWB 3GTUB 1QGVA 1F37A 2YWOA 5JWRB 2N5FA 2M72A 1V2AA 1Z9HA 3ME8A 4TR3A 5ECLB 2YZUA 2YPMA 1GUKA 2DJ2A 4ZB8A 1XXUA 2IMFA 3HY2A 2IMEA 5IPHA 3WYWA 3G7YA 1O6JA 4OFMA 4DSSA 5IPGA 1H4OA 5KEJA 1K0NA 3Q74A 4NHWA 2DJKA 2FLSA 1O85A 3APSA 3KD0A 1SKSB 2LTKA 3ZFBA 2TRCP 4X43A 1SU9A 3F9UA 3KJYA 3IK7A 3EU3A 4NXIA 4K2DA 4L5OA 3QDNA 2OADA 4OMVA 3CSHA 3WT2A 3PH9A 3F4TA 1PD21 4MCUA 3GH9A 4GSNA 1ZZYA 2WULA 1XWGA 3MDKA 3CRTA 1PKZA 3GTUA 1M7TA 1SL2B 2CAQA 4HU9A 2EIQA 2O89A 4J57E 2QKEA 2YWIA 2DJ0A 3GL3A 1YY7A 2KOKA 19GSA 1XFLA 5FT3A 2H6YA 3J7Yk 5JCUA 2VL2C 4DEJA 3HVVA 1W4VA 4I8BA 2K6VA 1HNCA 2VCWA 3QPMA 2QSIA 1DUGA 3IOSA 5IM9A 3LSZA 1GULA 4V2NA 2H1DA 4Q5QA 2L57A 2ZCTA 2VLTA 9GSSA 1X9MB 3ZYWA 2LQOA 3APQA 5DJLA 3LGCA 2EIOA 5CP1A 2HT9A 4XCSA 5ECPB 4JU5A
chains in the Genus database with same CATH superfamily
3G7JA 2IIYA 4J56E 5HFGA 3IAS2 3GV1A 5LCZA 4H86A 4TR0A 2H70A 3IAM2 2GQMA 2HLSA 3A2XA 4BL7B 3Q19A 3NIVA 4F9ZA 2IWTA 4K5RA 5D9VA 3D5JA 2JU5A 3ZIJA 3ZIVA 2BTOT 4ZXGA 4K5SA 4GSSA 2GZPA 1Z5YE 2LJAA 1F3AA 3FHKA 3UAPA 4FYUA 2LRTA 4MJCA 4NHZA 1OKTA 1M99A 3IXRA 2R2JA 1THOA 3TOTA 2NTOA 1XOBA 5DBQA 1N8JA 2ALBA 3EU4A 5GZZB 4TN8A 4KE3A 3RBTA 4G2EA 2P5RA 1TRWA 2K9FA 2CQ9A 5C04A 4MF6A 5GSTA 3JCML 2PU9C 1B9YC 4POLA 3FW2A 1IYHA 2CVDA 2MMNA 3D4TA 3EMPA 1V9WA 5D96A 2LUSA 3C7MA 4IJIA 2OJLA 2V41A 5J5NA 2VUPA 3DIEA 3DYRA 4BL7A 2IMIA 2H0GA 3IRAA 4MF5A 5B7CA 3ZLPA 4JBBA 1XW6A 2FGXA 3FKFA 2GT6A 3KIJA 1HQOA 4F0BA 4GRFA 2C0EA 4RI7A 1JZWA 1MDIA 1O73A 4GXZA 5GAPD 4TKYA 3A5IA 1Q4JA 1X9SB 3IC8A 4LMWA 3H79A 3KM6A 1OVNA 4K7IA 1HD2A 3TKSC 3VI5A 4YKFA 5ECRB 1N2AA 2OE3A 5BMUA 2ES7A 1EV9A 3DD3A 4JE1A 4YH2A 1YF0A 3A2VA 4KF9A 1TKDB 5DALB 2H19A 2VOCA 5D73A 3UBKA 2NDOA 3VPTA 4HOJA 4LA1A 2P31A 1YKCA 1OC9B 1TRSA 6GSYA 3UIWA 5COHA 4O92A 2XPEA 2DKIA 1JLVA 2HE3A 3GURA 1YKAA 2X49A 5A5KA 1IYIA 2VIMA 4QL9A 2OKAA 2AHEA 4KUNA 1GRXA 2GLRA 2X99A 3HA9A 1PA3A 1KTEA 1FO5A 3GKXA 4NWYA 1M9AA 4GQCA 2OBKA 2VLVA 1AQWA 2B5EA 4IN0A 2KUCA 3EPTA 5J4UA 4YQUA 1RK4A 4WF4A 1B4QA 2AUVA 2O7KA 2ON5A 2VLUA 3LEFA 5AN1A 2J23A 2OE0A 3GKNA 1KNGA 4HEA2 3RHBA 3HKRA 1XG8A 5DALA 1ZYEA 1GSSA 3F3QA 5IOXA 2HFDA 3C73A 2H0HA 1YDKA 4XIHA 1T4YA 2HSYA 2GSQA 2DKHA 3P8WA 2QGVA 1OC9A 5DCHA 3WGEA 1Y6EA 2V6OA 5ECQB 2A4VA 4RUVA 5D9WA 2FY6A 4JEDA 2RM5A 3EVIA 2OBIA 3RDWA 1NW2A 4ZL7A 16GSA 1SL1B 1TK0B 4EUYA 5E4WA 3WGXA 1A0FA 1GNWA 4MDCA 2B6MA 3GKMA 3CQFA 2X64A 2PBJA 4N0ZA 3W8JA 3BCKA 2VCVA 1WIKA 1Z3EA 2LV3A 4O7HA 3H8QA 4IQAA 1K3OA 3CXGA 1LU4A 3IPZA 4WEYA 2FWEA 4ISDA 2B7KA 1ERWA 4K2XA 3GSSA 4PUAA 1GUHA 2R37A 5CAXA 1PX6A 1K0OA 2MMOA 1I9DA 1YJ6A 2QC7A 2GT5A 2REMA 3L9VA 2MZCA 1EEMA 4ML1A 3ISOA 5E59A 3GX0A 3EMXA 1TJDA 4OFNA 1XWCA 4V1Ag 3Q6OA 5AIXA 1U88A 2IL3A 2Z9SA 3QCPA 4G10A 4G0KA 2HYXA 2C0FA 4GCIA 1XIYA 2ON7A 1BQ7A 2DJJA 4K9ZA 4Z2UA 1JZDA 3F6FA 4FQUA 2CVKA 2VCZA 2CZ2A 5CREA 2H74A 4MZBA 2IFQA 5D9TA 2KLXA 1X0RA 3F4SA 3TKSA 4BVXB 4E8EA 1DSBA 2WZ9A 4AJ7A 4POMA 2XC2A 3D22A 1QMVA 1XWAA 5FWGA 2AAWA 14GSA 3G7IA 2JZSA 3HYPA 2CX4A 5IIZA 3DRNA 3ZREA 1ABAA 5F0GA 1UC7A 4RI6A 4XS1A 1G7OA 5B8BA 4F03A 2PERA 3GSTA 3MNGA 3TRQA 3PGTA 4JR4A 4L0UA 1AQVA 1THXA 5B6NA 1EGOA 5JWOB 5IMVA 4O32A 5EY6A 3KTBA 5HR3A 1O8WA 4IP1A 4WF5A 3DVWA 3E0UA 4BWQA 3UVTA 4F82A 3QD9A 3LW9A 3TOUA 1R7HA 2KP2A 3DVXA 4BIKA 3QMXA 1MD3A 3L4NA 1WJKA 1K0MA 4MJEA 3CSJA 3UMAA 4MNNA 3RPPA 5KN2A 1ERUA 1TK5B 2FHEA 4BVXA 2FUG2 4PTSA 4EE0A 1GL8A 1B48A 1YQ1A 3FK8A 2HZFA 1K0BA 4MJAA 1VF1A 4KSOA 1A0RP 3WT1A 4KNDA 1DE2A 4MMMA 5GAND 4YQMA 1WMJA 1FB0A 5J9BA 2YN1A 2AB6A 2B3SA 5JCWA 2LNSA 2DBCA 3U5RE 3DEXA 1H75A 4MPGA 1TTZA 3IHGA 2VM1A 4ZBAA 1A24A 3RAZA 4PXOA 5ECSA 5ECNB 4K7NA 3CBUA 2ZUPA 2WB9A 5D8IA 3IDVA 2LKUA 2VL9A 2GZYA 3FZAA 3SWLA 5HR2A 2LRNA 1BJXA 13GSA 4XTSA 2NPBA 1LBKA 1PKWA 1EV4A 1EP8A 2C3TA 3BOAA 4X1UA 4BPYA 1QUWA 1YF1A 2V6KA 1V57A 2YOIA 1GWCA 1SKRB 4AJ8A 2PVOC 5IOWA 3KMOA 4ICYA 3TCOA 4FIWA 2JL4A 3H4KA 2QA1A 4TRXA 1GP1A 3QFBC 1TI3A 3LYPA 3KCMA 2LJRA 18GSA 3C1SA 3DXBA 3W8SA 5G5FA 5INYA 1FVJA 5AISA 1FB6A 1B4PA 3IA1A 3VLNA 1FAAA 4I2UA 3TB2A 3FR9A 5ECIB 1MEKA 1QQ2A 4EKZA 4PGTA 1VF3A 3DGQA 2LEGA 1CQHA 2GVPA 2FWGA 2R0CA 3F8UA 4KCAA 2HXKA 2YNXA 4DVCA 2FCHA 2K8VA 1T3BA 1ON4A 4FO5A 2R3XA 1U6TA 1GNEA 4PUFC 3O76A 1ZYQB 5GSSA 1PN0A 2GS3A 2H1BA 4A5PA 4YKGA 4N30A 3O3TA 4ECJA 3I69A 4KDXA 2C3NA 2CA8A 4LL1B 2LS5A 4WR5A 4V2LA 5ID2B 5F06A 1HYUA 1SK2A 4QQ7A 4ECCA 2GSSA 1GSUA 4HZ4A 5ELGA 1SYRA 5KOWA 1SD8A 1V40A 3WGDA 4KAEA 2M80A 3L9UA 2AJQB 2C1YA 2VCQA 5KN1A 5HR0A 3IR4A 1GTIA 2WDUA 4HSCX 2YZHA 2PPTA 2B7JA 1K3LA 4ZIJA 5DAKB 4OO4A 1JZRA 4P3YB 4PURA 2X8GA 1Y25A 3C71A 4F2IA 4GWRA 2FD3A 1SJZA 1XZOA 1T4ZA 1FHEA 4I97A 5CNWA 1EOGA 1M2AA 1WPIA 2DIZA 3TDGA 3V1WA 3C8EA 1FOHA 3HVNA 3RHCA 3EURA 4HS1A 2GQKA 4O5QA 2R0GA 1T7PB 3LXZA 1ZYPA 3GHAA 2A4HA 3TJFA 1GSYA 1GTAA 3EINA 4GSTA 4WETA 4BA7A 1A8YA 4N11A 1DE1A 2PVQA 4Z2TA 3HVSA 5ID2A 3KMNA 4KDYA 3GFKA 1OAZA 2HRKA 3FZ4A 1G6YA 4PQIA 1R26A 6GSTA 5D9XA 2YV7A 1WOUA 3VFIA 1K0CA 4CY8A 2GGTA 5JWQB 10GSA 1SD9A 3KEBA 3L0HA 4O5UA 3NOFA 3E9JB 1OE7A 2CZ3A 3FY7A 4IQ1A 4D73B 1X5EA 4MA9A 4AF2A 4Q5FA 4EXJA 5DDLA 3R3EA 5DAKA 2H0IA 2H8LA 3CTGA 2TIRA 1J9BA 3KTLA 1WRYA 1X5CA 1QFNA 3L9SA 4MJBA 3MAKA 4N10A 2WRTA 1XWKA 2F3MA 1OKDA 1OC3A 5IQYA 3KH9A 5J9CA 3VWXA 2C0GA 2XBIA 4GQFA 4LLRA 4POBA 3IHQA 3QOUA 4WBRD 3AY8A 1U87A 3BJ5A 3GH6A 1AQXA 3FMWA 4JR6A 1NHYA 5ENUA 1PFOA 3QFAC 4ZBDA 1TOFA 3TUEA 4GF0A 12GSA 2VL2A 3UOMA 2HI7A 1F2EA 1EGRA 2GDRA 2YCDA 4D73A 1UVZA 1B9XC 2LSTA 3TKQA 4V2MA 1DBYA 4OCEA 4ZBBA 2OACA 1YZXA 3TGZA 4PQ1A 4KA0A 5H5RA 1T8EB 3K8NA 2MYGA 1GUMA 1W89A 1U3AA 2A2SA 3HHVA 2QA2A 2H75A 2YP6A 2VCTA 3I43A 3CYNA 3NZNA 4IHUA 4FH8A 1VF4A 1A2MA 3GMFA 1USBA 4TXOB 3SBCA 3HJPA 5CRWA 5CRDA 2VL3A 1NHOA 1K0DA 4F0CA 2E7PA 2B1LA 4G0IA 3TKRA 1GTBA 1AW9A 2IPAA 5G1KA 3TJKA 5HFIA 1TRVA 4J2FA 2YJHA 5F8BA 2LRCA 3ED3A 2J9HA 4KB3A 2OA7A 2HRAA 1VRSD 3BD2A 1GH2A 4POKA 2HRFA 2B5XA 4EDYA 4G19A 5F07A 4CW9A 2PMTA 1O8XA 1MD4A 1BG5A 3FYGA 1F6MC 3ERGA 2NBSA 3UBLA 2NVLA 3H93A 4K7OA 2WCIA 3ZMLA 1OC8A 4KCEA 4TXOA 5B8AA 3US3A 3LG6A 1MTCA 4XS4B 4AGSA 2WGRA 4G9HA 5IO2A 1A8LA 1EP7A 1TU7A 6GSVA 2XHFA 1S3AA 3QAGA 2MBTA 6GSSA 4XRAA 1HNAA 3CMIA 5ELAA 2A2RA 3M3MA 4IP6A 1ERTA 2DIYA 4EL1A 3KGKA 2C8UA 3APOA 3ZL5A 1S3DA 3VWUA 1SJIA 3EYTA 1ZCPA 1ERVA 1SYXA 5KOXA 4MABA 1AUCA 1M9BA 2GZZA 5ECMB 2OE1A 4L8EA 2C80A 1O81A 3F63A 4CHSA 2GQLA 2I9HA 2MBSA 4MZCA 1X5DA 4HQZA 5DVBA 4ZB9A 1R4WA 4TVEA 3ZZXA 2GSRA 3RPNA 5A4WA 6GSXA 4PQHA 3MWHA 1WE0A 3LQ7A 4NAXA 1PRXA 3PPUA 2PUKC 2IMDA 1SK0A 4XS4A 4KW6A 4O5RA 3P90A 2TRXA 1UN2A 2KP1A 3LWAA 1TW9A 2MMZA 1F9MA 3M8NA 2H6ZA 1CQGA 2JACA 4K0GA 5ECHB 1A2LA 3E3EA 1S3CA 4OWYA 4NPBA 3VPQA 1ZOFA 3Q18A 4DSSB 1J0FA 1T00A 3GIXA 3TKSE 2F8AA 1GTUA 1G7EA 2RUFA 2DMMA 1M3IA 4TOPA 4X0XA 1XVQA 2JZTA 3EE2A 3QR6A 1ILOA 1XBSA 2H1GA 3QAVA 3GKKA 3HXSA 2I4AA 1K0AA 6GSUA 2FWHA 4CY6A 3TJBA 1TDIA 4JZQA 4E8HA 4K0NA 4I2TA 1ZYNA 1G0TA 1TK8B 3MSZA 3IK9A 3GA4A 5DCGA 3DKSA 2E0QA 1AC1A 5DJMA 2M46A 2V1MA 8GSSA 4NV2A 7GSSA 5L71A 5DQYA 4EO3A 1ZGNA 1TI1A 3VURA 3A2WA 4KGIA 4WR4A 20GSA 4I5QA 5B6MA 1M3JA 3LYKA 4YAVA 3VK9A 4MPFA 4GTUA 2FWFA 2H72A 2PWJA 1ST9A 5IMZA 5G31A 5JCGA 4LMVA 5KN3A 4Z7XA 3HJOA 2CX3A 3FR6A 1E2YA 5H5QA 1PX7A 3S9FA 2JSYA 2HZEB 4MF7A 5EPFA 1JHBA 1EEJA 2RLIA 1YEPA 4MLYA 2XBQA 3FZ9A 1RQMA 4Z2RA 2YJ7A 3HZ8A 3UARA 1QK8A 1ZL9A 3KH7A 2H71A 3CSIA 4ACSA 1G6WA 1MDKA 1WWJA 1XPVA 2LJKA 3I9V2 4NMUA 2O8VB 1M2DA 2VO4A 1T1VA 3P7XA 1JLWA 3O6TA 4EF0A 4KH7A 3GRXA 1A2JA 5KN0A 2JSZA 2B1KA 3CTFA 5A4UA 1YEXA 5DQSA 4OCFA 2YV9A 2DLXA 4MP4A 2I3YA 4XRDA 5LD0A 4G0LA 3VWWA 2RIIA 2VCXA 5G30A 3F6DA 3A5WA 3GYKA 3HDCA 3DWVA 2IN3A 2K8SA 1KEBA 5CO3A 3PINA 3D0ZA 2O87A 2CT6A 4PX1A 2DJ1A 2MMAA 4HJMA 5G5EA 11GSA 2C4JA 1NM3A 4TR1B 3TRPA 2HZEA 2YANA 1XVWA 5A4VA 2DC5A 2FA4A 2VM2A 1V58A 4IVFA 4IS0A 4XS6A 1Z7RA 1EZKA 3GUSA 5CRHA 2HNLA 5IMFA 1TP9A 3P2AA 1OYJA 1I5GA 4FYCA 1PSQA 2DJ3A 2HRNA 3GN3A 1HNBA 2YWMA 1FOVA 3BCIA 3UJ1A 1NSWA 4HU7A 1BAYA 2L59A 2F51A 3ZVJA 1PL1A 2H01A 17GSA 4I6XA 2WFCA 3I6AA 4YQVA 3M1GA 3A3TA 3UEMA 5HR1A 2P5QA 4KDUA 4ZL9A 3G9BA 1EOHA 5D93A 5H5SA 5IMCA 1FVKA 4OFTA 4TR1A 3ZVJD 3HJMA 2H30A 2F8FA 1PL2A 1WP0A 1GSDA 1S3RA 2XPDA 3KZQA 5F05A 4EVMA 4HI7A 2K18A 4K1FA 5ECOB 3TRXA 2CV4A 2KHPA 4IW9A 4WKWA 1F3BA 2DSAA 2IMKA 1O7UA 4TR4A 1BEDA 4MZWA 1Z6MA 4ZL8A 3DMLA 2C3QA 3W6GA 3TJJA 4XHMA 3KP8A 1PN9A 1A23A 4RQXA 3ZTLA 1GLPA 1JZOA 3ERFA 4EDZA 1AAZA 2RUEA 1PGTA 4EC0A 4ML6A 4RQRA 1X9WB 2I81A 5CRGA 4IELA 2H73A 4EIQA 1JFUA 2X4AA 2CAIA 1XW5A 2HSHA 2O85A 2H6XA 4K8MA 2B5YA 2GTUA 2I1UA 5LNKe 1GSFA 2AV4A 3U6VA 4BVYB 2WS2A 2IJYA 4TW5A 3LJRA 5J3RA 3LFLA 1SJ6A 3QAWA 1XOAA 3IV4A 3MIXA 2E2MA 4L5LA 1LJRA 4BWSA 2PGTA 2EC4A 3HZ4A 2VAFA 3ME7A 2H66A 3TKPA 3N5OA 5CYYA 1SL0B 1ZMAA 2DMLA 1U3IA 2JZRA 3FR3A 3L78A 2BMXA 2H1AA 1KBNA 2YWNA 2CVBA 1FW1A 4L0WA 2L6DA 3N9JA 1GLQA 2X8HA 3UL3A 1MDJA 2WJUA 2L5OA 4TXVA 4OO5A 1TU8A 1FG4A 3EC3A 4CDOA 1C72A 4ILFA 1RW1A 4IBPA 3C1RA 3ZMKA 3KP9A 5HQPA 1TXXA 3ZFLA 2BJXA 3FZ5A 3D21A 4QL7A 4BVYA 4WXTA 3D4MA 3IC4A 4HQSA 4PNFA 2G0FA 5ECKB 3OR5A 3VI7A 1VGLA 3ZITA 1VF2A 3ERWA 4OD7A 4KX4A 4ECIA 2L5LA 4ZB6A 4V1Ap 2L4QA 5IMAA 4HZ2A 3LORA 4DSQA 1B8XA 1BX9A 2LNTA 1PQNA 3EWLA 4ZILA 5IO0A 3IE3A 2IFQB 1Q98A 1EWXA 5AGYA 5G1LA 3HVXA 1GSQA 2HSMA 2GSTA 3J7Yb 2E2GA 3FEUA 1AIUA 2P0GA 2PN8A 5C00A 4ULXA 2R4VA 2H76A 3LXTA 5G2ZA 1Z6NA 2FA8A 3GL5A 4PNGA 2FNOA 3M0FA 4GLTA 1AXDA 1E6BA 3GNJA 4FYBA 5AIVA 2L6CA 1XWBA 2A2PA 2JADA 1M0UA 3HD5A 2F9SA 4Q5NA 2X8CA 3D6IA 4HDEA 3PR8A 3WD6A 1J08A 3H1NA 3IBHA 3F0IA 1OE8A 2L4CA 1TRUA 4HJ2A 2V32A 1R5AA 5EL8A 4IKHA 1V98A 4LL4B 1SENA 3R2QA 3F4RA 2RM6A 4IGJA 4MH3A 2AYTA 2N5BA 2R6KA 3FRCA 22GSA 1QXHA 2VD1A 3M9KA 1R5PA 5IMDA 3M9JA 2ZNMA 4ECBA 3UVHA 2VD0A 3F3RA 1K3YA 4Q5RA 4WBJA 4KSMA 1PMTA 4AJ6A 1URMA 4K6XA 1Z7PA 5FHIA 1M2BA 5EVOA 3GX8A 1ML6A 5J41A 4N0VA 2EIRA 4X4JA 3CRUA 2G2QA 1UA5A 1GSEA 2V2GA 4NV5A 4ID0A 1XW9A 2C0DA 4HUAA 1XCCA 4DSRA 3ZRDA 1BYEA 2LQQA 3MYDA 4MK3A 5HFKA 2R5GA 2D2ZA 2N5AA 6GSWA 4YAPA 3HCZA 5ABRA 3KXOA 3TJGA 3BBYA 1SK1A 4MH2A 4JRRA 1ACVA 3VWVA 4IJ3A 1SKWB 3GTUB 1QGVA 1F37A 2YWOA 5JWRB 5BRTA 2N5FA 2M72A 1V2AA 1Z9HA 3ME8A 4TR3A 2YZUA 5ECLB 2YPMA 1GUKA 2UZ8A 2DJ2A 4ZB8A 1XXUA 2IMFA 3HY2A 2IMEA 5IPHA 3WYWA 3G7YA 1O6JA 4OFMA 4DSSA 5IPGA 1H4OA 2R0PA 5KEJA 1K0NA 3Q74A 4NHWA 2DJKA 2FLSA 1O85A 3APSA 3KD0A 1SKSB 2LTKA 3ZFBA 2TRCP 4X43A 1SU9A 3F9UA 3KJYA 3IK7A 3EU3A 4NXIA 4K2DA 4L5OA 3QDNA 2OADA 4OMVA 3CSHA 3WT2A 3PH9A 3F4TA 1PD21 4MCUA 3GH9A 4EIPA 4GSNA 1ZZYA 2WULA 1XWGA 3MDKA 3CRTA 1PKZA 3GTUA 1M7TA 1SL2B 2CAQA 4HU9A 2EIQA 2O89A 4J57E 2QKEA 2YWIA 2DJ0A 3GL3A 1YY7A 2KOKA 19GSA 1XFLA 5FT3A 2H6YA 3J7Yk 5JCUA 2VL2C 4DEJA 3HVVA 1W4VA 4I8BA 2K6VA 1HNCA 2VCWA 3QPMA 2QSIA 1DUGA 3IOSA 5IM9A 3LSZA 1GULA 4V2NA 4USSA 2H1DA 4Q5QA 2L57A 2ZCTA 2VLTA 9GSSA 1X9MB 3ZYWA 2LQOA 3APQA 5DJLA 3LGCA 2EIOA 5CP1A 2HT9A 4XCSA 5ECPB 4JU5A
chains in the Genus database with same CATH topology
3G7JA 2IIYA 4J56E 5HFGA 3IAS2 3GV1A 5LCZA 4H86A 4TR0A 2H70A 3IAM2 2GQMA 2HLSA 3A2XA 4BL7B 3Q19A 3NIVA 4F9ZA 2IWTA 4K5RA 5D9VA 3D5JA 2JU5A 3ZIJA 3ZIVA 2BTOT 4ZXGA 4K5SA 4GSSA 2GZPA 1Z5YE 2LJAA 1F3AA 3FHKA 3UAPA 4FYUA 2LRTA 4MJCA 4NHZA 1OKTA 1M99A 3IXRA 2R2JA 1THOA 3TOTA 2NTOA 1XOBA 5DBQA 1N8JA 2ALBA 3EU4A 5GZZB 4TN8A 4KE3A 3RBTA 4G2EA 2P5RA 1TRWA 2K9FA 2CQ9A 5C04A 4MF6A 5GSTA 3JCML 2PU9C 1B9YC 4POLA 3FW2A 1IYHA 2CVDA 2MMNA 3D4TA 3EMPA 1V9WA 5D96A 2LUSA 3C7MA 4IJIA 2OJLA 2V41A 5J5NA 2VUPA 3DIEA 3DYRA 4BL7A 2IMIA 2H0GA 3IRAA 4MF5A 5B7CA 3ZLPA 4JBBA 1XW6A 2FGXA 3FKFA 2GT6A 3KIJA 1HQOA 4F0BA 4GRFA 2C0EA 4RI7A 1JZWA 1MDIA 1O73A 4GXZA 5GAPD 4TKYA 3A5IA 1Q4JA 1X9SB 3IC8A 4LMWA 3H79A 3KM6A 1OVNA 4K7IA 1HD2A 3TKSC 3VI5A 4YKFA 5ECRB 1N2AA 2OE3A 5BMUA 2ES7A 1EV9A 3DD3A 4JE1A 4YH2A 1YF0A 3A2VA 4KF9A 1TKDB 5DALB 2H19A 2VOCA 5D73A 3UBKA 2NDOA 3VPTA 4HOJA 4LA1A 2P31A 1YKCA 1OC9B 1TRSA 6GSYA 3UIWA 5COHA 4O92A 2XPEA 2DKIA 1JLVA 2HE3A 3GURA 1YKAA 2X49A 5A5KA 1IYIA 2VIMA 4QL9A 2OKAA 2AHEA 4KUNA 1GRXA 2GLRA 2X99A 3HA9A 1PA3A 1KTEA 1FO5A 3GKXA 4NWYA 1M9AA 4GQCA 2OBKA 2VLVA 1AQWA 2B5EA 4IN0A 2KUCA 3EPTA 5J4UA 4YQUA 1RK4A 4WF4A 1B4QA 2AUVA 2O7KA 2ON5A 2VLUA 3LEFA 5AN1A 2J23A 2OE0A 3GKNA 1KNGA 4HEA2 3RHBA 3HKRA 5DALA 1ZYEA 1GSSA 3F3QA 5IOXA 2HFDA 3C73A 2H0HA 1YDKA 4XIHA 1T4YA 2HSYA 2GSQA 2DKHA 3P8WA 2QGVA 1OC9A 5DCHA 3WGEA 1Y6EA 2V6OA 5ECQB 2A4VA 4RUVA 5D9WA 2FY6A 4JEDA 2RM5A 3EVIA 2OBIA 3RDWA 1NW2A 4ZL7A 16GSA 1SL1B 1TK0B 4EUYA 5E4WA 3WGXA 1A0FA 1GNWA 4MDCA 2B6MA 3GKMA 2X64A 2PBJA 4N0ZA 3W8JA 3BCKA 2VCVA 1WIKA 1Z3EA 2LV3A 4O7HA 3H8QA 4IQAA 1K3OA 3CXGA 1LU4A 3IPZA 4WEYA 2FWEA 4ISDA 2B7KA 1ERWA 4K2XA 3GSSA 4PUAA 1GUHA 2R37A 5CAXA 1PX6A 1K0OA 2MMOA 1I9DA 1YJ6A 2QC7A 2GT5A 2REMA 3L9VA 2MZCA 1EEMA 4ML1A 3ISOA 5E59A 3GX0A 3EMXA 1TJDA 4OFNA 1XWCA 4V1Ag 3Q6OA 5AIXA 1U88A 2IL3A 2Z9SA 3QCPA 4G10A 4G0KA 2HYXA 2C0FA 4GCIA 1XIYA 2ON7A 1BQ7A 2DJJA 4K9ZA 4Z2UA 1JZDA 3F6FA 4FQUA 2CVKA 2VCZA 2CZ2A 5CREA 2H74A 4MZBA 2IFQA 5D9TA 2KLXA 1X0RA 3F4SA 3TKSA 4BVXB 4E8EA 1DSBA 2WZ9A 4AJ7A 4POMA 2XC2A 3D22A 1QMVA 1XWAA 5FWGA 2AAWA 14GSA 3G7IA 2JZSA 3HYPA 2CX4A 5IIZA 3DRNA 3ZREA 1ABAA 5F0GA 1UC7A 4RI6A 4XS1A 1G7OA 5B8BA 4F03A 2PERA 3GSTA 3MNGA 3TRQA 3PGTA 4JR4A 4L0UA 1AQVA 1THXA 5B6NA 1EGOA 5JWOB 5IMVA 4O32A 5EY6A 3KTBA 5HR3A 1O8WA 4IP1A 4WF5A 3DVWA 3E0UA 4BWQA 3UVTA 4F82A 3QD9A 3LW9A 3TOUA 1R7HA 2KP2A 3DVXA 3QMXA 1MD3A 3L4NA 1WJKA 1K0MA 4MJEA 3CSJA 3UMAA 4MNNA 3RPPA 5KN2A 1ERUA 1TK5B 2FHEA 4BVXA 2FUG2 4PTSA 4EE0A 1GL8A 1B48A 1YQ1A 3FK8A 2HZFA 1K0BA 4MJAA 1VF1A 4KSOA 1A0RP 3WT1A 4KNDA 1DE2A 4MMMA 5GAND 4YQMA 1WMJA 1FB0A 5J9BA 2YN1A 2AB6A 2B3SA 5JCWA 2LNSA 2DBCA 3U5RE 3DEXA 1H75A 4MPGA 1TTZA 3IHGA 2VM1A 4ZBAA 1A24A 3RAZA 4PXOA 5ECSA 5ECNB 4K7NA 3CBUA 2ZUPA 2WB9A 5D8IA 3IDVA 2LKUA 2VL9A 2GZYA 3FZAA 3SWLA 5HR2A 2LRNA 1BJXA 13GSA 4XTSA 2NPBA 1LBKA 1PKWA 1EV4A 1EP8A 2C3TA 3BOAA 4X1UA 4BPYA 1QUWA 1YF1A 2V6KA 1V57A 2YOIA 1GWCA 1SKRB 4AJ8A 2PVOC 5IOWA 3KMOA 4ICYA 3TCOA 4FIWA 2JL4A 3H4KA 2QA1A 4TRXA 1GP1A 3QFBC 1TI3A 3LYPA 3KCMA 2LJRA 18GSA 3C1SA 3DXBA 3W8SA 5G5FA 5INYA 1FVJA 5AISA 1FB6A 1B4PA 3IA1A 3VLNA 1FAAA 4I2UA 3TB2A 3FR9A 5ECIB 1MEKA 1QQ2A 4EKZA 4PGTA 1VF3A 3DGQA 2LEGA 1CQHA 2GVPA 2FWGA 2R0CA 3F8UA 4KCAA 2HXKA 2YNXA 4DVCA 2FCHA 2K8VA 1T3BA 1ON4A 4FO5A 2R3XA 1U6TA 1GNEA 4PUFC 3O76A 1ZYQB 5GSSA 1PN0A 2GS3A 2H1BA 4A5PA 4YKGA 4N30A 3O3TA 4ECJA 3I69A 4KDXA 2C3NA 2CA8A 4LL1B 2LS5A 4WR5A 4V2LA 5ID2B 5F06A 1HYUA 1SK2A 4QQ7A 4ECCA 2GSSA 1GSUA 4HZ4A 5ELGA 1SYRA 5KOWA 1SD8A 1V40A 3WGDA 4KAEA 2M80A 3L9UA 2AJQB 2C1YA 2VCQA 5KN1A 5HR0A 3IR4A 1GTIA 2WDUA 2YZHA 2PPTA 2B7JA 1K3LA 4ZIJA 5DAKB 4OO4A 1JZRA 4P3YB 4PURA 2X8GA 1Y25A 3C71A 4F2IA 4GWRA 2FD3A 1SJZA 1XZOA 1T4ZA 1FHEA 4I97A 5CNWA 1EOGA 1M2AA 1WPIA 2DIZA 3TDGA 3V1WA 3C8EA 1FOHA 3RHCA 3EURA 4HS1A 2GQKA 4O5QA 2R0GA 1T7PB 3LXZA 1ZYPA 3GHAA 2A4HA 3TJFA 1GSYA 1GTAA 3EINA 4GSTA 4WETA 4BA7A 1A8YA 4N11A 1DE1A 2PVQA 4Z2TA 3HVSA 5ID2A 3KMNA 4KDYA 3GFKA 1OAZA 2HRKA 3FZ4A 1G6YA 4PQIA 1R26A 6GSTA 5D9XA 2YV7A 1WOUA 3VFIA 1K0CA 4CY8A 2GGTA 5JWQB 10GSA 1SD9A 3KEBA 3L0HA 4O5UA 3NOFA 3E9JB 1OE7A 2CZ3A 3FY7A 4IQ1A 4D73B 1X5EA 4MA9A 4AF2A 4Q5FA 4EXJA 5DDLA 3R3EA 5DAKA 2H0IA 2H8LA 2TIRA 1J9BA 3CTGA 3KTLA 1WRYA 1X5CA 1QFNA 3L9SA 4MJBA 3MAKA 4N10A 2WRTA 1XWKA 2F3MA 1OKDA 1OC3A 5IQYA 3KH9A 5J9CA 3VWXA 2C0GA 2XBIA 4GQFA 4LLRA 4POBA 3IHQA 3QOUA 4WBRD 3AY8A 1U87A 3BJ5A 3GH6A 1AQXA 3FMWA 4JR6A 1NHYA 5ENUA 3QFAC 4ZBDA 1TOFA 3TUEA 4GF0A 12GSA 2VL2A 3UOMA 2HI7A 1F2EA 1EGRA 2GDRA 2YCDA 4D73A 1UVZA 1B9XC 2LSTA 3TKQA 4V2MA 1DBYA 4OCEA 4ZBBA 2OACA 1YZXA 3TGZA 4PQ1A 4KA0A 5H5RA 1T8EB 3K8NA 2MYGA 1GUMA 1W89A 1U3AA 2A2SA 3HHVA 2QA2A 2H75A 2YP6A 2VCTA 3I43A 3CYNA 3NZNA 4IHUA 4FH8A 1VF4A 1A2MA 3GMFA 1USBA 4TXOB 3SBCA 3HJPA 5CRWA 5CRDA 2VL3A 1NHOA 1K0DA 4F0CA 2E7PA 2B1LA 4G0IA 3TKRA 1GTBA 1AW9A 2IPAA 5G1KA 3TJKA 5HFIA 1TRVA 4J2FA 2YJHA 5F8BA 2LRCA 3ED3A 2J9HA 4KB3A 2OA7A 2HRAA 1VRSD 3BD2A 1GH2A 4POKA 2HRFA 2B5XA 4EDYA 4G19A 5F07A 4CW9A 2PMTA 1O8XA 1MD4A 1BG5A 3FYGA 1F6MC 3ERGA 2NBSA 3UBLA 2NVLA 3H93A 4K7OA 2WCIA 3ZMLA 1OC8A 4KCEA 4TXOA 5B8AA 3US3A 3LG6A 1MTCA 4XS4B 4AGSA 2WGRA 4G9HA 5IO2A 1A8LA 1EP7A 1TU7A 6GSVA 2XHFA 1S3AA 3QAGA 2MBTA 6GSSA 4XRAA 1HNAA 3CMIA 5ELAA 2A2RA 3M3MA 4IP6A 1ERTA 2DIYA 4EL1A 3KGKA 2C8UA 3APOA 3ZL5A 1S3DA 3VWUA 1SJIA 3EYTA 1ZCPA 1ERVA 1SYXA 5KOXA 4MABA 1AUCA 1M9BA 2GZZA 5ECMB 2OE1A 4L8EA 2C80A 1O81A 3F63A 4CHSA 2GQLA 2I9HA 2MBSA 4MZCA 1X5DA 4HQZA 5DVBA 4ZB9A 1R4WA 4TVEA 3ZZXA 2GSRA 3RPNA 5A4WA 6GSXA 4PQHA 3MWHA 1WE0A 3LQ7A 4NAXA 1PRXA 3PPUA 2PUKC 2IMDA 1SK0A 4XS4A 4KW6A 4O5RA 3P90A 2TRXA 1UN2A 2KP1A 3LWAA 1TW9A 2MMZA 1F9MA 3M8NA 2H6ZA 1CQGA 2JACA 4K0GA 5ECHB 1A2LA 3E3EA 1S3CA 4OWYA 4NPBA 3VPQA 1ZOFA 3Q18A 4DSSB 1J0FA 1T00A 3GIXA 3TKSE 2F8AA 1GTUA 1G7EA 2RUFA 2DMMA 4TOPA 4X0XA 1XVQA 2JZTA 3EE2A 3QR6A 1ILOA 1XBSA 2H1GA 3QAVA 3GKKA 3HXSA 2I4AA 1K0AA 6GSUA 2FWHA 4CY6A 3TJBA 1TDIA 4JZQA 4E8HA 4K0NA 4I2TA 1ZYNA 1G0TA 1TK8B 3MSZA 3IK9A 3GA4A 5DCGA 3DKSA 2E0QA 1AC1A 5DJMA 2M46A 2V1MA 8GSSA 4NV2A 7GSSA 5L71A 5DQYA 4EO3A 1ZGNA 1TI1A 3VURA 3A2WA 4KGIA 4WR4A 20GSA 4I5QA 5B6MA 3LYKA 4YAVA 3VK9A 4MPFA 4GTUA 2FWFA 2H72A 2PWJA 1ST9A 5IMZA 5G31A 5JCGA 4LMVA 5KN3A 4Z7XA 3HJOA 2CX3A 3FR6A 1E2YA 5H5QA 1PX7A 3S9FA 2JSYA 2HZEB 4MF7A 5EPFA 1JHBA 1EEJA 2RLIA 1YEPA 4MLYA 2XBQA 3FZ9A 1RQMA 4Z2RA 2YJ7A 3HZ8A 3UARA 1QK8A 1ZL9A 3KH7A 2H71A 3CSIA 4ACSA 1G6WA 1MDKA 1WWJA 1XPVA 2LJKA 3I9V2 4NMUA 2O8VB 1M2DA 2VO4A 1T1VA 3P7XA 1JLWA 3O6TA 4EF0A 4KH7A 3GRXA 1A2JA 5KN0A 2JSZA 2B1KA 3CTFA 5A4UA 1YEXA 5DQSA 4OCFA 2YV9A 2DLXA 4MP4A 2I3YA 4XRDA 5LD0A 4G0LA 3VWWA 2RIIA 2VCXA 5G30A 3F6DA 3A5WA 3GYKA 3HDCA 3DWVA 2IN3A 2K8SA 1KEBA 5CO3A 3PINA 3D0ZA 2O87A 2CT6A 4PX1A 2DJ1A 2MMAA 4HJMA 5G5EA 11GSA 2C4JA 1NM3A 4TR1B 3TRPA 2HZEA 2YANA 1XVWA 5A4VA 2DC5A 2FA4A 2VM2A 1V58A 4IVFA 4IS0A 4XS6A 1Z7RA 1EZKA 3GUSA 5CRHA 2HNLA 5IMFA 1TP9A 3P2AA 1OYJA 1I5GA 4FYCA 1PSQA 2DJ3A 2HRNA 3GN3A 1HNBA 2YWMA 1FOVA 3BCIA 3UJ1A 1NSWA 4HU7A 1BAYA 2L59A 2F51A 3ZVJA 1PL1A 2H01A 17GSA 4I6XA 2WFCA 3I6AA 4YQVA 3M1GA 3A3TA 3UEMA 5HR1A 2P5QA 4KDUA 4ZL9A 3G9BA 1EOHA 5D93A 5H5SA 5IMCA 1FVKA 4OFTA 4TR1A 3ZVJD 3HJMA 2H30A 2F8FA 1PL2A 1WP0A 1GSDA 2XPDA 3KZQA 5F05A 4EVMA 4HI7A 2K18A 4K1FA 5ECOB 3TRXA 2CV4A 2KHPA 4IW9A 4WKWA 1F3BA 2DSAA 2IMKA 1O7UA 4TR4A 1BEDA 4MZWA 1Z6MA 4ZL8A 3DMLA 2C3QA 3W6GA 3TJJA 4XHMA 3KP8A 1PN9A 1A23A 4RQXA 3ZTLA 1GLPA 1JZOA 3ERFA 4EDZA 1AAZA 2RUEA 1PGTA 4EC0A 4ML6A 4RQRA 1X9WB 2I81A 5CRGA 4IELA 2H73A 4EIQA 1JFUA 2X4AA 2CAIA 1XW5A 2HSHA 2O85A 2H6XA 4K8MA 2B5YA 2GTUA 2I1UA 5LNKe 1GSFA 2AV4A 3U6VA 4BVYB 2WS2A 2IJYA 4TW5A 3LJRA 5J3RA 3LFLA 1SJ6A 3QAWA 1XOAA 3IV4A 3MIXA 2E2MA 4L5LA 1LJRA 4BWSA 2PGTA 2EC4A 3HZ4A 2VAFA 3ME7A 2H66A 3TKPA 3N5OA 5CYYA 1SL0B 1ZMAA 2DMLA 1U3IA 2JZRA 3FR3A 3L78A 2BMXA 2H1AA 1KBNA 2YWNA 2CVBA 1FW1A 4L0WA 2L6DA 3N9JA 1GLQA 2X8HA 3UL3A 1MDJA 2WJUA 2L5OA 4TXVA 4OO5A 1TU8A 1FG4A 3EC3A 4CDOA 1C72A 4ILFA 1RW1A 4IBPA 3C1RA 3ZMKA 3KP9A 5HQPA 1TXXA 3ZFLA 2BJXA 3FZ5A 3D21A 4QL7A 4BVYA 4WXTA 3D4MA 3IC4A 4HQSA 4PNFA 2G0FA 5ECKB 3OR5A 3VI7A 1VGLA 3ZITA 1VF2A 3ERWA 4OD7A 4KX4A 4ECIA 2L5LA 4ZB6A 4V1Ap 2L4QA 5IMAA 4HZ2A 3LORA 4DSQA 1B8XA 1BX9A 2LNTA 1PQNA 3EWLA 4ZILA 5IO0A 3IE3A 2IFQB 1Q98A 1EWXA 5AGYA 5G1LA 3HVXA 1GSQA 2HSMA 2GSTA 3J7Yb 2E2GA 3FEUA 1AIUA 2P0GA 2PN8A 5C00A 4ULXA 2R4VA 2H76A 3LXTA 5G2ZA 1Z6NA 2FA8A 3GL5A 4PNGA 2FNOA 3M0FA 4GLTA 1AXDA 1E6BA 3GNJA 4FYBA 5AIVA 2L6CA 1XWBA 2A2PA 2JADA 1M0UA 3HD5A 2F9SA 4Q5NA 2X8CA 3D6IA 4HDEA 3PR8A 3WD6A 1J08A 3H1NA 3IBHA 3F0IA 1OE8A 2L4CA 1TRUA 4HJ2A 2V32A 1R5AA 5EL8A 4IKHA 1V98A 4LL4B 1SENA 3R2QA 3F4RA 2RM6A 4IGJA 4MH3A 2AYTA 2N5BA 2R6KA 3FRCA 22GSA 1QXHA 2VD1A 3M9KA 1R5PA 5IMDA 3M9JA 2ZNMA 4ECBA 3UVHA 2VD0A 3F3RA 1K3YA 4Q5RA 4WBJA 4KSMA 1PMTA 4AJ6A 1URMA 4K6XA 1Z7PA 5FHIA 1M2BA 5EVOA 3GX8A 1ML6A 5J41A 4N0VA 2EIRA 4X4JA 3CRUA 2G2QA 1UA5A 1GSEA 2V2GA 4NV5A 4ID0A 1XW9A 2C0DA 4HUAA 1XCCA 4DSRA 3ZRDA 1BYEA 2LQQA 3MYDA 4MK3A 5HFKA 2R5GA 2D2ZA 2N5AA 6GSWA 4YAPA 3HCZA 5ABRA 3KXOA 3TJGA 3BBYA 1SK1A 4MH2A 4JRRA 1ACVA 3VWVA 4IJ3A 1SKWB 3GTUB 1QGVA 1F37A 2YWOA 5JWRB 5BRTA 2N5FA 2M72A 1V2AA 1Z9HA 3ME8A 4TR3A 2YZUA 5ECLB 2YPMA 1GUKA 2UZ8A 2DJ2A 4ZB8A 1XXUA 2IMFA 3HY2A 2IMEA 5IPHA 3WYWA 3G7YA 1O6JA 4OFMA 4DSSA 5IPGA 1H4OA 2R0PA 5KEJA 1K0NA 3Q74A 4NHWA 2DJKA 2FLSA 1O85A 3APSA 3KD0A 1SKSB 2LTKA 3ZFBA 2TRCP 4X43A 1SU9A 3F9UA 3KJYA 3IK7A 3EU3A 4NXIA 4K2DA 4L5OA 3QDNA 2OADA 4OMVA 3CSHA 3WT2A 3PH9A 3F4TA 1PD21 4MCUA 3GH9A 4EIPA 4GSNA 1ZZYA 2WULA 1XWGA 3MDKA 3CRTA 1PKZA 3GTUA 1M7TA 1SL2B 2CAQA 4HU9A 2EIQA 2O89A 4J57E 2QKEA 2YWIA 2DJ0A 3GL3A 1YY7A 2KOKA 19GSA 1XFLA 5FT3A 2H6YA 3J7Yk 5JCUA 2VL2C 4DEJA 3HVVA 1W4VA 4I8BA 2K6VA 1HNCA 2VCWA 3QPMA 2QSIA 1DUGA 3IOSA 5IM9A 3LSZA 1GULA 4V2NA 4USSA 2H1DA 4Q5QA 2L57A 2ZCTA 2VLTA 9GSSA 1X9MB 3ZYWA 2LQOA 3APQA 5DJLA 3LGCA 2EIOA 5CP1A 2HT9A 4XCSA 5ECPB 4JU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G7J A;  2IIY A;  4J56 E;  5HFG A;  3IAS 2;  3GV1 A;  5LCZ A;  4H86 A;  4TR0 A;  2H70 A;  3IAM 2;  2GQM A;  2HLS A;  3A2X A;  3Q19 A;  3NIV A;  4F9Z A;  2IWT A;  5D9V A;  3D5J A;  2JU5 A;  3ZIJ A;  3ZIV A;  2BTO T;  4ZXG A;  4GSS A;  2GZP A;  1Z5Y E;  2LJA A;  1F3A A;  3FHK A;  3UAP A;  4FYU A;  2LRT A;  4MJC A;  4NHZ A;  1OKT A;  1M99 A;  3IXR A;  2R2J A;  1THO A;  3TOT A;  2NTO A;  1XOB A;  5DBQ A;  1N8J A;  2ALB A;  3EU4 A;  5GZZ B;  4TN8 A;  4KE3 A;  3RBT A;  4G2E A;  2P5R A;  1TRW A;  2K9F A;  2CQ9 A;  5C04 A;  4MF6 A;  5GST A;  3JCM L;  2PU9 C;  1B9Y C;  4POL A;  3FW2 A;  1IYH A;  2CVD A;  2MMN A;  3D4T A;  3EMP A;  1V9W A;  5D96 A;  2LUS A;  3C7M A;  4IJI A;  2OJL A;  2V41 A;  5J5N A;  2VUP A;  3DIE A;  3DYR A;  4BL7 A;  2IMI A;  2H0G A;  3IRA A;  4MF5 A;  5B7C A;  3ZLP A;  4JBB A;  1XW6 A;  2FGX A;  3FKF A;  2GT6 A;  3KIJ A;  1HQO A;  4F0B A;  4GRF A;  2C0E A;  4RI7 A;  1JZW A;  1MDI A;  1O73 A;  4GXZ A;  5GAP D;  4TKY A;  1Q4J A;  1X9S B;  4LMW A;  3H79 A;  3KM6 A;  1OVN A;  4K7I A;  1HD2 A;  3TKS C;  3VI5 A;  5ECR B;  1N2A A;  2OE3 A;  2ES7 A;  1EV9 A;  3DD3 A;  4JE1 A;  4YH2 A;  1YF0 A;  3A2V A;  1TKD B;  5DAL B;  2H19 A;  2VOC A;  5D73 A;  3UBK A;  2NDO A;  3VPT A;  4HOJ A;  4LA1 A;  2P31 A;  1YKC A;  1OC9 B;  1TRS A;  6GSY A;  3UIW A;  5COH A;  4O92 A;  2XPE A;  1JLV A;  2HE3 A;  3GUR A;  1YKA A;  5A5K A;  1IYI A;  2VIM A;  4QL9 A;  2OKA A;  2AHE A;  4KUN A;  1GRX A;  2GLR A;  2X99 A;  3HA9 A;  1PA3 A;  1KTE A;  1FO5 A;  3GKX A;  4NWY A;  1M9A A;  4GQC A;  2OBK A;  2VLV A;  1AQW A;  2B5E A;  4IN0 A;  2KUC A;  5J4U A;  4YQU A;  1RK4 A;  4WF4 A;  1B4Q A;  2AUV A;  2O7K A;  2ON5 A;  2VLU A;  3LEF A;  5AN1 A;  2J23 A;  2OE0 A;  3GKN A;  1KNG A;  4HEA 2;  3RHB A;  3HKR A;  5DAL A;  1ZYE A;  1GSS A;  3F3Q A;  5IOX A;  2HFD A;  3C73 A;  2H0H A;  1YDK A;  4XIH A;  1T4Y A;  2HSY A;  2GSQ A;  3P8W A;  2QGV A;  1OC9 A;  5DCH A;  3WGE A;  1Y6E A;  2V6O A;  5ECQ B;  2A4V A;  4RUV A;  5D9W A;  2FY6 A;  4JED A;  2RM5 A;  3EVI A;  2OBI A;  3RDW A;  1NW2 A;  4ZL7 A;  16GS A;  1SL1 B;  1TK0 B;  4EUY A;  5E4W A;  3WGX A;  1A0F A;  1GNW A;  4MDC A;  2B6M A;  3GKM A;  2X64 A;  2PBJ A;  4N0Z A;  3W8J A;  3BCK A;  2VCV A;  1WIK A;  1Z3E A;  2LV3 A;  4O7H A;  3H8Q A;  4IQA A;  1K3O A;  3CXG A;  1LU4 A;  3IPZ A;  4WEY A;  2FWE A;  4ISD A;  2B7K A;  1ERW A;  3GSS A;  4PUA A;  1GUH A;  2R37 A;  5CAX A;  1PX6 A;  1K0O A;  2MMO A;  1I9D A;  1YJ6 A;  2QC7 A;  2GT5 A;  2REM A;  3L9V A;  2MZC A;  1EEM A;  4ML1 A;  3ISO A;  5E59 A;  3GX0 A;  3EMX A;  1TJD A;  4OFN A;  1XWC A;  4V1A g;  3Q6O A;  5AIX A;  1U88 A;  2IL3 A;  2Z9S A;  3QCP A;  4G10 A;  2HYX A;  2C0F A;  4GCI A;  1XIY A;  2ON7 A;  1BQ7 A;  2DJJ A;  4K9Z A;  1JZD A;  3F6F A;  2CVK A;  2VCZ A;  2CZ2 A;  5CRE A;  2H74 A;  4MZB A;  2IFQ A;  5D9T A;  2KLX A;  1X0R A;  3F4S A;  3TKS A;  4E8E A;  1DSB A;  2WZ9 A;  4AJ7 A;  4POM A;  2XC2 A;  3D22 A;  1QMV A;  1XWA A;  5FWG A;  2AAW A;  14GS A;  3G7I A;  2JZS A;  3HYP A;  2CX4 A;  5IIZ A;  3DRN A;  3ZRE A;  1ABA A;  5F0G A;  1UC7 A;  4RI6 A;  4XS1 A;  1G7O A;  5B8B A;  4F03 A;  2PER A;  3GST A;  3MNG A;  3TRQ A;  3PGT A;  4JR4 A;  4L0U A;  1AQV A;  1THX A;  5B6N A;  1EGO A;  5JWO B;  5IMV A;  4O32 A;  5EY6 A;  3KTB A;  5HR3 A;  1O8W A;  4IP1 A;  4WF5 A;  3DVW A;  3E0U A;  4BWQ A;  3UVT A;  4F82 A;  3QD9 A;  3TOU A;  1R7H A;  2KP2 A;  3DVX A;  3QMX A;  1MD3 A;  3L4N A;  1WJK A;  1K0M A;  4MJE A;  3CSJ A;  3UMA A;  3RPP A;  5KN2 A;  1ERU A;  1TK5 B;  2FHE A;  4BVX A;  2FUG 2;  4EE0 A;  1GL8 A;  1B48 A;  1YQ1 A;  3FK8 A;  2HZF A;  1K0B A;  4MJA A;  1VF1 A;  4KSO A;  1A0R P;  3WT1 A;  4KND A;  1DE2 A;  4MMM A;  5GAN D;  4YQM A;  1WMJ A;  1FB0 A;  5J9B A;  2YN1 A;  2AB6 A;  2B3S A;  5JCW A;  2LNS A;  2DBC A;  3U5R E;  3DEX A;  1H75 A;  4MPG A;  1TTZ A;  2VM1 A;  4ZBA A;  1A24 A;  3RAZ A;  4PXO A;  5ECS A;  5ECN B;  4K7N A;  3CBU A;  2ZUP A;  2WB9 A;  5D8I A;  3IDV A;  2LKU A;  2VL9 A;  2GZY A;  3FZA A;  3SWL A;  5HR2 A;  2LRN A;  1BJX A;  13GS A;  4XTS A;  2NPB A;  1LBK A;  1PKW A;  1EV4 A;  1EP8 A;  2C3T A;  3BOA A;  4X1U A;  4BPY A;  1QUW A;  1YF1 A;  2V6K A;  1V57 A;  2YOI A;  1GWC A;  1SKR B;  4AJ8 A;  2PVO C;  5IOW A;  3KMO A;  3TCO A;  4FIW A;  2JL4 A;  3H4K A;  4TRX A;  1GP1 A;  3QFB C;  1TI3 A;  3LYP A;  3KCM A;  2LJR A;  18GS A;  3C1S A;  3DXB A;  3W8S A;  5G5F A;  5INY A;  1FVJ A;  5AIS A;  1FB6 A;  1B4P A;  3IA1 A;  3VLN A;  1FAA A;  4I2U A;  3TB2 A;  3FR9 A;  5ECI B;  1MEK A;  1QQ2 A;  4EKZ A;  4PGT A;  1VF3 A;  3DGQ A;  2LEG A;  1CQH A;  2GVP A;  2FWG A;  3F8U A;  4KCA A;  2HXK A;  2YNX A;  4DVC A;  2FCH A;  2K8V A;  1T3B A;  1ON4 A;  4FO5 A;  2R3X A;  1U6T A;  1GNE A;  4PUF C;  3O76 A;  1ZYQ B;  5GSS A;  2GS3 A;  2H1B A;  4N30 A;  3O3T A;  4ECJ A;  3I69 A;  4KDX A;  2C3N A;  2CA8 A;  4LL1 B;  2LS5 A;  4WR5 A;  4V2L A;  5ID2 B;  5F06 A;  1HYU A;  1SK2 A;  4QQ7 A;  4ECC A;  2GSS A;  1GSU A;  4HZ4 A;  5ELG A;  1SYR A;  1SD8 A;  1V40 A;  3WGD A;  4KAE A;  2M80 A;  3L9U A;  2AJQ B;  2C1Y A;  2VCQ A;  5KN1 A;  5HR0 A;  3IR4 A;  1GTI A;  2WDU A;  2YZH A;  2PPT A;  2B7J A;  1K3L A;  4ZIJ A;  5DAK B;  4OO4 A;  1JZR A;  4P3Y B;  4PUR A;  2X8G A;  1Y25 A;  3C71 A;  4F2I A;  4GWR A;  2FD3 A;  1SJZ A;  1XZO A;  1T4Z A;  1FHE A;  4I97 A;  5CNW A;  1EOG A;  1M2A A;  1WPI A;  2DIZ A;  3TDG A;  3V1W A;  3C8E A;  3RHC A;  3EUR A;  4HS1 A;  2GQK A;  1T7P B;  3LXZ A;  3GHA A;  3TJF A;  1GSY A;  1GTA A;  3EIN A;  4GST A;  4WET A;  4BA7 A;  1A8Y A;  4N11 A;  1DE1 A;  2PVQ A;  3HVS A;  5ID2 A;  3KMN A;  4KDY A;  3GFK A;  1OAZ A;  3FZ4 A;  1G6Y A;  4PQI A;  1R26 A;  6GST A;  5D9X A;  2YV7 A;  1WOU A;  3VFI A;  1K0C A;  2GGT A;  5JWQ B;  10GS A;  1SD9 A;  3KEB A;  3L0H A;  3NOF A;  3E9J B;  1OE7 A;  2CZ3 A;  3FY7 A;  4IQ1 A;  4D73 B;  1X5E A;  4MA9 A;  4AF2 A;  4Q5F A;  4EXJ A;  5DDL A;  5DAK A;  2H0I A;  2H8L A;  2TIR A;  1J9B A;  3CTG A;  3KTL A;  1WRY A;  1X5C A;  1QFN A;  3L9S A;  4MJB A;  3MAK A;  4N10 A;  2WRT A;  1XWK A;  2F3M A;  1OKD A;  1OC3 A;  5IQY A;  3KH9 A;  5J9C A;  3VWX A;  2C0G A;  2XBI A;  4GQF A;  4LLR A;  4POB A;  3IHQ A;  3QOU A;  4WBR D;  3AY8 A;  1U87 A;  3BJ5 A;  3GH6 A;  1AQX A;  4JR6 A;  1NHY A;  5ENU A;  3QFA C;  4ZBD A;  1TOF A;  3TUE A;  4GF0 A;  12GS A;  2VL2 A;  3UOM A;  2HI7 A;  1F2E A;  1EGR A;  2GDR A;  2YCD A;  4D73 A;  1UVZ A;  1B9X C;  2LST A;  3TKQ A;  4V2M A;  1DBY A;  4OCE A;  4ZBB A;  2OAC A;  1YZX A;  3TGZ A;  4PQ1 A;  4KA0 A;  5H5R A;  1T8E B;  3K8N A;  2MYG A;  1GUM A;  1W89 A;  1U3A A;  2A2S A;  3HHV A;  2H75 A;  2YP6 A;  2VCT A;  3I43 A;  3CYN A;  3NZN A;  4IHU A;  4FH8 A;  1VF4 A;  1A2M A;  3GMF A;  1USB A;  4TXO B;  3SBC A;  3HJP A;  5CRW A;  5CRD A;  2VL3 A;  1NHO A;  1K0D A;  4F0C A;  2E7P A;  2B1L A;  3TKR A;  1GTB A;  1AW9 A;  2IPA A;  5G1K A;  3TJK A;  5HFI A;  1TRV A;  4J2F A;  2YJH A;  5F8B A;  2LRC A;  3ED3 A;  2J9H A;  4KB3 A;  2OA7 A;  1VRS D;  3BD2 A;  1GH2 A;  4POK A;  2HRF A;  2B5X A;  4EDY A;  4G19 A;  5F07 A;  4CW9 A;  2PMT A;  1O8X A;  1MD4 A;  1BG5 A;  3FYG A;  1F6M C;  3ERG A;  2NBS A;  3UBL A;  2NVL A;  3H93 A;  4K7O A;  2WCI A;  3ZML A;  1OC8 A;  4KCE A;  4TXO A;  5B8A A;  3US3 A;  3LG6 A;  1MTC A;  4XS4 B;  4AGS A;  2WGR A;  4G9H A;  5IO2 A;  1A8L A;  1EP7 A;  1TU7 A;  6GSV A;  2XHF A;  1S3A A;  3QAG A;  2MBT A;  6GSS A;  4XRA A;  1HNA A;  3CMI A;  5ELA A;  2A2R A;  3M3M A;  4IP6 A;  1ERT A;  2DIY A;  4EL1 A;  3KGK A;  2C8U A;  3APO A;  3ZL5 A;  1S3D A;  3VWU A;  1SJI A;  3EYT A;  1ZCP A;  1ERV A;  1SYX A;  4MAB A;  1AUC A;  1M9B A;  2GZZ A;  5ECM B;  2OE1 A;  4L8E A;  2C80 A;  1O81 A;  3F63 A;  4CHS A;  2GQL A;  2I9H A;  2MBS A;  4MZC A;  1X5D A;  4HQZ A;  5DVB A;  4ZB9 A;  1R4W A;  4TVE A;  3ZZX A;  2GSR A;  3RPN A;  5A4W A;  6GSX A;  4PQH A;  3MWH A;  1WE0 A;  3LQ7 A;  4NAX A;  1PRX A;  2PUK C;  2IMD A;  1SK0 A;  4XS4 A;  4KW6 A;  4O5R A;  3P90 A;  2TRX A;  1UN2 A;  2KP1 A;  3LWA A;  1TW9 A;  2MMZ A;  1F9M A;  3M8N A;  2H6Z A;  1CQG A;  2JAC A;  4K0G A;  5ECH B;  1A2L A;  3E3E A;  1S3C A;  4OWY A;  4NPB A;  3VPQ A;  1ZOF A;  3Q18 A;  4DSS B;  1J0F A;  1T00 A;  3GIX A;  3TKS E;  2F8A A;  1GTU A;  1G7E A;  2RUF A;  2DMM A;  4TOP A;  4X0X A;  1XVQ A;  2JZT A;  3EE2 A;  3QR6 A;  1ILO A;  1XBS A;  2H1G A;  3QAV A;  3GKK A;  3HXS A;  2I4A A;  1K0A A;  6GSU A;  2FWH A;  3TJB A;  1TDI A;  4JZQ A;  4E8H A;  4K0N A;  4I2T A;  1TK8 B;  1G0T A;  3MSZ A;  3IK9 A;  3GA4 A;  5DCG A;  3DKS A;  2E0Q A;  1AC1 A;  5DJM A;  2M46 A;  2V1M A;  8GSS A;  4NV2 A;  7GSS A;  5L71 A;  5DQY A;  4EO3 A;  1ZGN A;  1TI1 A;  3VUR A;  3A2W A;  4KGI A;  4WR4 A;  20GS A;  4I5Q A;  5B6M A;  3LYK A;  4YAV A;  3VK9 A;  4MPF A;  4GTU A;  2FWF A;  2H72 A;  2PWJ A;  1ST9 A;  5IMZ A;  5G31 A;  5JCG A;  4LMV A;  5KN3 A;  4Z7X A;  3HJO A;  2CX3 A;  3FR6 A;  1E2Y A;  5H5Q A;  1PX7 A;  3S9F A;  2JSY A;  2HZE B;  4MF7 A;  5EPF A;  1JHB A;  1EEJ A;  2RLI A;  1YEP A;  4MLY A;  2XBQ A;  3FZ9 A;  1RQM A;  2YJ7 A;  3HZ8 A;  3UAR A;  1QK8 A;  1ZL9 A;  3KH7 A;  2H71 A;  3CSI A;  4ACS A;  1G6W A;  1MDK A;  1WWJ A;  1XPV A;  2LJK A;  3I9V 2;  4NMU A;  2O8V B;  1M2D A;  2VO4 A;  1T1V A;  3P7X A;  1JLW A;  3O6T A;  4EF0 A;  4KH7 A;  3GRX A;  1A2J A;  5KN0 A;  2JSZ A;  2B1K A;  3CTF A;  5A4U A;  1YEX A;  5DQS A;  4OCF A;  2YV9 A;  2DLX A;  4MP4 A;  2I3Y A;  4XRD A;  5LD0 A;  3VWW A;  2RII A;  2VCX A;  5G30 A;  3F6D A;  3A5W A;  3GYK A;  3HDC A;  3DWV A;  2IN3 A;  2K8S A;  1KEB A;  5CO3 A;  3PIN A;  3D0Z A;  2O87 A;  2CT6 A;  4PX1 A;  2DJ1 A;  2MMA A;  4HJM A;  5G5E A;  11GS A;  2C4J A;  1NM3 A;  4TR1 B;  3TRP A;  2HZE A;  2YAN A;  1XVW A;  5A4V A;  2DC5 A;  2FA4 A;  2VM2 A;  1V58 A;  4IVF A;  4IS0 A;  4XS6 A;  1Z7R A;  1EZK A;  3GUS A;  5CRH A;  2HNL A;  5IMF A;  1TP9 A;  3P2A A;  1OYJ A;  1I5G A;  4FYC A;  1PSQ A;  2DJ3 A;  2HRN A;  3GN3 A;  1HNB A;  2YWM A;  1FOV A;  3BCI A;  3UJ1 A;  1NSW A;  4HU7 A;  1BAY A;  2L59 A;  2F51 A;  3ZVJ A;  1PL1 A;  2H01 A;  17GS A;  4I6X A;  2WFC A;  3I6A A;  4YQV A;  3M1G A;  3A3T A;  3UEM A;  5HR1 A;  2P5Q A;  4KDU A;  4ZL9 A;  3G9B A;  1EOH A;  5D93 A;  5H5S A;  5IMC A;  1FVK A;  4OFT A;  4TR1 A;  3ZVJ D;  3HJM A;  2H30 A;  2F8F A;  1PL2 A;  1WP0 A;  1GSD A;  2XPD A;  3KZQ A;  5F05 A;  4EVM A;  4HI7 A;  2K18 A;  4K1F A;  5ECO B;  3TRX A;  2CV4 A;  2KHP A;  4IW9 A;  4WKW A;  1F3B A;  2DSA A;  2IMK A;  1O7U A;  4TR4 A;  1BED A;  4MZW A;  1Z6M A;  4ZL8 A;  3DML A;  2C3Q A;  3W6G A;  3TJJ A;  4XHM A;  3KP8 A;  1PN9 A;  1A23 A;  4RQX A;  3ZTL A;  1GLP A;  1JZO A;  3ERF A;  4EDZ A;  1AAZ A;  2RUE A;  1PGT A;  4EC0 A;  4ML6 A;  4RQR A;  1X9W B;  2I81 A;  5CRG A;  4IEL A;  2H73 A;  1JFU A;  2CAI A;  1XW5 A;  2HSH A;  2O85 A;  2H6X A;  4K8M A;  2B5Y A;  2GTU A;  2I1U A;  5LNK e;  1GSF A;  2AV4 A;  3U6V A;  2WS2 A;  2IJY A;  4TW5 A;  3LJR A;  5J3R A;  3LFL A;  1SJ6 A;  3QAW A;  1XOA A;  3IV4 A;  2E2M A;  4L5L A;  1LJR A;  4BWS A;  2PGT A;  2EC4 A;  3HZ4 A;  2VAF A;  3ME7 A;  2H66 A;  3TKP A;  3N5O A;  5CYY A;  1SL0 B;  1ZMA A;  2DML A;  1U3I A;  2JZR A;  3FR3 A;  3L78 A;  2BMX A;  2H1A A;  1KBN A;  2YWN A;  2CVB A;  1FW1 A;  4L0W A;  2L6D A;  3N9J A;  1GLQ A;  2X8H A;  3UL3 A;  1MDJ A;  2WJU A;  2L5O A;  4TXV A;  4OO5 A;  1TU8 A;  1FG4 A;  3EC3 A;  4CDO A;  1C72 A;  4ILF A;  1RW1 A;  4IBP A;  3C1R A;  3ZMK A;  3KP9 A;  5HQP A;  1TXX A;  3ZFL A;  2BJX A;  3FZ5 A;  3D21 A;  4QL7 A;  4BVY A;  4WXT A;  3D4M A;  3IC4 A;  4HQS A;  4PNF A;  2G0F A;  5ECK B;  3OR5 A;  3VI7 A;  1VGL A;  3ZIT A;  1VF2 A;  3ERW A;  4OD7 A;  4KX4 A;  4ECI A;  2L5L A;  4ZB6 A;  4V1A p;  2L4Q A;  5IMA A;  4HZ2 A;  3LOR A;  4DSQ A;  1B8X A;  1BX9 A;  2LNT A;  1PQN A;  3EWL A;  4ZIL A;  5IO0 A;  3IE3 A;  2IFQ B;  1Q98 A;  1EWX A;  5AGY A;  5G1L A;  3HVX A;  1GSQ A;  2GST A;  3J7Y b;  2E2G A;  3FEU A;  1AIU A;  2P0G A;  2PN8 A;  5C00 A;  4ULX A;  2R4V A;  2H76 A;  3LXT A;  5G2Z A;  1Z6N A;  2FA8 A;  3GL5 A;  4PNG A;  2FNO A;  3M0F A;  4GLT A;  1AXD A;  1E6B A;  3GNJ A;  4FYB A;  5AIV A;  2L6C A;  1XWB A;  2JAD A;  1M0U A;  3HD5 A;  2F9S A;  4Q5N A;  2X8C A;  3D6I A;  4HDE A;  3PR8 A;  3WD6 A;  1J08 A;  3H1N A;  3IBH A;  3F0I A;  1OE8 A;  2L4C A;  1TRU A;  4HJ2 A;  2V32 A;  1R5A A;  5EL8 A;  4IKH A;  1V98 A;  4LL4 B;  1SEN A;  3R2Q A;  3F4R A;  2RM6 A;  4IGJ A;  4MH3 A;  2AYT A;  2N5B A;  2R6K A;  3FRC A;  22GS A;  1QXH A;  2VD1 A;  3M9K A;  1R5P A;  5IMD A;  3M9J A;  2ZNM A;  4ECB A;  3UVH A;  2VD0 A;  3F3R A;  1K3Y A;  4Q5R A;  4WBJ A;  4KSM A;  1PMT A;  4AJ6 A;  1URM A;  4K6X A;  1Z7P A;  5FHI A;  1M2B A;  5EVO A;  3GX8 A;  1ML6 A;  5J41 A;  4N0V A;  2EIR A;  3CRU A;  2G2Q A;  1UA5 A;  1GSE A;  2V2G A;  4NV5 A;  4ID0 A;  1XW9 A;  2C0D A;  4HUA A;  1XCC A;  4DSR A;  3ZRD A;  1BYE A;  2LQQ A;  4MK3 A;  5HFK A;  2R5G A;  2D2Z A;  2N5A A;  6GSW A;  4YAP A;  3HCZ A;  5ABR A;  3KXO A;  3TJG A;  3BBY A;  1SK1 A;  4MH2 A;  4JRR A;  1ACV A;  3VWV A;  4IJ3 A;  1SKW B;  3GTU B;  1QGV A;  1F37 A;  2YWO A;  5JWR B;  2N5F A;  2M72 A;  1V2A A;  1Z9H A;  3ME8 A;  4TR3 A;  5ECL B;  2YZU A;  2YPM A;  1GUK A;  2DJ2 A;  4ZB8 A;  1XXU A;  2IMF A;  3HY2 A;  2IME A;  5IPH A;  3WYW A;  3G7Y A;  1O6J A;  4OFM A;  4DSS A;  5IPG A;  1H4O A;  5KEJ A;  1K0N A;  3Q74 A;  4NHW A;  2DJK A;  2FLS A;  1O85 A;  3APS A;  3KD0 A;  1SKS B;  2LTK A;  3ZFB A;  2TRC P;  4X43 A;  1SU9 A;  3F9U A;  3KJY A;  3IK7 A;  3EU3 A;  4NXI A;  4K2D A;  4L5O A;  3QDN A;  2OAD A;  4OMV A;  3CSH A;  3WT2 A;  3PH9 A;  3F4T A;  1PD2 1;  4MCU A;  3GH9 A;  4GSN A;  1ZZY A;  2WUL A;  1XWG A;  3MDK A;  3CRT A;  1PKZ A;  3GTU A;  1M7T A;  1SL2 B;  2CAQ A;  4HU9 A;  2EIQ A;  2O89 A;  4J57 E;  2QKE A;  2YWI A;  2DJ0 A;  3GL3 A;  1YY7 A;  2KOK A;  19GS A;  1XFL A;  5FT3 A;  2H6Y A;  3J7Y k;  5JCU A;  2VL2 C;  4DEJ A;  3HVV A;  1W4V A;  4I8B A;  2K6V A;  1HNC A;  2VCW A;  3QPM A;  2QSI A;  1DUG A;  3IOS A;  5IM9 A;  3LSZ A;  1GUL A;  4V2N A;  2H1D A;  4Q5Q A;  2L57 A;  2ZCT A;  2VLT A;  9GSS A;  1X9M B;  3ZYW A;  2LQO A;  3APQ A;  5DJL A;  3LGC A;  2EIO A;  5CP1 A;  2HT9 A;  4XCS A;  5ECP B;  4JU5 A; 
#chains in the Genus database with same CATH topology
 3G7J A;  2IIY A;  4J56 E;  5HFG A;  3IAS 2;  3GV1 A;  5LCZ A;  4H86 A;  4TR0 A;  2H70 A;  3IAM 2;  2GQM A;  2HLS A;  3A2X A;  4BL7 B;  3Q19 A;  3NIV A;  4F9Z A;  2IWT A;  4K5R A;  5D9V A;  3D5J A;  2JU5 A;  3ZIJ A;  3ZIV A;  2BTO T;  4ZXG A;  4K5S A;  4GSS A;  2GZP A;  1Z5Y E;  2LJA A;  1F3A A;  3FHK A;  3UAP A;  4FYU A;  2LRT A;  4MJC A;  4NHZ A;  1OKT A;  1M99 A;  3IXR A;  2R2J A;  1THO A;  3TOT A;  2NTO A;  1XOB A;  5DBQ A;  1N8J A;  2ALB A;  3EU4 A;  5GZZ B;  4TN8 A;  4KE3 A;  3RBT A;  4G2E A;  2P5R A;  1TRW A;  2K9F A;  2CQ9 A;  5C04 A;  4MF6 A;  5GST A;  3JCM L;  2PU9 C;  1B9Y C;  4POL A;  3FW2 A;  1IYH A;  2CVD A;  2MMN A;  3D4T A;  3EMP A;  1V9W A;  5D96 A;  2LUS A;  3C7M A;  4IJI A;  2OJL A;  2V41 A;  5J5N A;  2VUP A;  3DIE A;  3DYR A;  4BL7 A;  2IMI A;  2H0G A;  3IRA A;  4MF5 A;  5B7C A;  3ZLP A;  4JBB A;  1XW6 A;  2FGX A;  3FKF A;  2GT6 A;  3KIJ A;  1HQO A;  4F0B A;  4GRF A;  2C0E A;  4RI7 A;  1JZW A;  1MDI A;  1O73 A;  4GXZ A;  5GAP D;  4TKY A;  3A5I A;  1Q4J A;  1X9S B;  3IC8 A;  4LMW A;  3H79 A;  3KM6 A;  1OVN A;  4K7I A;  1HD2 A;  3TKS C;  3VI5 A;  4YKF A;  5ECR B;  1N2A A;  2OE3 A;  5BMU A;  2ES7 A;  1EV9 A;  3DD3 A;  4JE1 A;  4YH2 A;  1YF0 A;  3A2V A;  4KF9 A;  1TKD B;  5DAL B;  2H19 A;  2VOC A;  5D73 A;  3UBK A;  2NDO A;  3VPT A;  4HOJ A;  4LA1 A;  2P31 A;  1YKC A;  1OC9 B;  1TRS A;  6GSY A;  3UIW A;  5COH A;  4O92 A;  2XPE A;  2DKI A;  1JLV A;  2HE3 A;  3GUR A;  1YKA A;  2X49 A;  5A5K A;  1IYI A;  2VIM A;  4QL9 A;  2OKA A;  2AHE A;  4KUN A;  1GRX A;  2GLR A;  2X99 A;  3HA9 A;  1PA3 A;  1KTE A;  1FO5 A;  3GKX A;  4NWY A;  1M9A A;  4GQC A;  2OBK A;  2VLV A;  1AQW A;  2B5E A;  4IN0 A;  2KUC A;  3EPT A;  5J4U A;  4YQU A;  1RK4 A;  4WF4 A;  1B4Q A;  2AUV A;  2O7K A;  2ON5 A;  2VLU A;  3LEF A;  5AN1 A;  2J23 A;  2OE0 A;  3GKN A;  1KNG A;  4HEA 2;  3RHB A;  3HKR A;  1XG8 A;  5DAL A;  1ZYE A;  1GSS A;  3F3Q A;  5IOX A;  2HFD A;  3C73 A;  2H0H A;  1YDK A;  4XIH A;  1T4Y A;  2HSY A;  2GSQ A;  2DKH A;  3P8W A;  2QGV A;  1OC9 A;  5DCH A;  3WGE A;  1Y6E A;  2V6O A;  5ECQ B;  2A4V A;  4RUV A;  5D9W A;  2FY6 A;  4JED A;  2RM5 A;  3EVI A;  2OBI A;  3RDW A;  1NW2 A;  4ZL7 A;  16GS A;  1SL1 B;  1TK0 B;  4EUY A;  5E4W A;  3WGX A;  1A0F A;  1GNW A;  4MDC A;  2B6M A;  3GKM A;  3CQF A;  2X64 A;  2PBJ A;  4N0Z A;  3W8J A;  3BCK A;  2VCV A;  1WIK A;  1Z3E A;  2LV3 A;  4O7H A;  3H8Q A;  4IQA A;  1K3O A;  3CXG A;  1LU4 A;  3IPZ A;  4WEY A;  2FWE A;  4ISD A;  2B7K A;  1ERW A;  4K2X A;  3GSS A;  4PUA A;  1GUH A;  2R37 A;  5CAX A;  1PX6 A;  1K0O A;  2MMO A;  1I9D A;  1YJ6 A;  2QC7 A;  2GT5 A;  2REM A;  3L9V A;  2MZC A;  1EEM A;  4ML1 A;  3ISO A;  5E59 A;  3GX0 A;  3EMX A;  1TJD A;  4OFN A;  1XWC A;  4V1A g;  3Q6O A;  5AIX A;  1U88 A;  2IL3 A;  2Z9S A;  3QCP A;  4G10 A;  4G0K A;  2HYX A;  2C0F A;  4GCI A;  1XIY A;  2ON7 A;  1BQ7 A;  2DJJ A;  4K9Z A;  4Z2U A;  1JZD A;  3F6F A;  4FQU A;  2CVK A;  2VCZ A;  2CZ2 A;  5CRE A;  2H74 A;  4MZB A;  2IFQ A;  5D9T A;  2KLX A;  1X0R A;  3F4S A;  3TKS A;  4BVX B;  4E8E A;  1DSB A;  2WZ9 A;  4AJ7 A;  4POM A;  2XC2 A;  3D22 A;  1QMV A;  1XWA A;  5FWG A;  2AAW A;  14GS A;  3G7I A;  2JZS A;  3HYP A;  2CX4 A;  5IIZ A;  3DRN A;  3ZRE A;  1ABA A;  5F0G A;  1UC7 A;  4RI6 A;  4XS1 A;  1G7O A;  5B8B A;  4F03 A;  2PER A;  3GST A;  3MNG A;  3TRQ A;  3PGT A;  4JR4 A;  4L0U A;  1AQV A;  1THX A;  5B6N A;  1EGO A;  5JWO B;  5IMV A;  4O32 A;  5EY6 A;  3KTB A;  5HR3 A;  1O8W A;  4IP1 A;  4WF5 A;  3DVW A;  3E0U A;  4BWQ A;  3UVT A;  4F82 A;  3QD9 A;  3LW9 A;  3TOU A;  1R7H A;  2KP2 A;  3DVX A;  4BIK A;  3QMX A;  1MD3 A;  3L4N A;  1WJK A;  1K0M A;  4MJE A;  3CSJ A;  3UMA A;  4MNN A;  3RPP A;  5KN2 A;  1ERU A;  1TK5 B;  2FHE A;  4BVX A;  2FUG 2;  4PTS A;  4EE0 A;  1GL8 A;  1B48 A;  1YQ1 A;  3FK8 A;  2HZF A;  1K0B A;  4MJA A;  1VF1 A;  4KSO A;  1A0R P;  3WT1 A;  4KND A;  1DE2 A;  4MMM A;  5GAN D;  4YQM A;  1WMJ A;  1FB0 A;  5J9B A;  2YN1 A;  2AB6 A;  2B3S A;  5JCW A;  2LNS A;  2DBC A;  3U5R E;  3DEX A;  1H75 A;  4MPG A;  1TTZ A;  3IHG A;  2VM1 A;  4ZBA A;  1A24 A;  3RAZ A;  4PXO A;  5ECS A;  5ECN B;  4K7N A;  3CBU A;  2ZUP A;  2WB9 A;  5D8I A;  3IDV A;  2LKU A;  2VL9 A;  2GZY A;  3FZA A;  3SWL A;  5HR2 A;  2LRN A;  1BJX A;  13GS A;  4XTS A;  2NPB A;  1LBK A;  1PKW A;  1EV4 A;  1EP8 A;  2C3T A;  3BOA A;  4X1U A;  4BPY A;  1QUW A;  1YF1 A;  2V6K A;  1V57 A;  2YOI A;  1GWC A;  1SKR B;  4AJ8 A;  2PVO C;  5IOW A;  3KMO A;  4ICY A;  3TCO A;  4FIW A;  2JL4 A;  3H4K A;  2QA1 A;  4TRX A;  1GP1 A;  3QFB C;  1TI3 A;  3LYP A;  3KCM A;  2LJR A;  18GS A;  3C1S A;  3DXB A;  3W8S A;  5G5F A;  5INY A;  1FVJ A;  5AIS A;  1FB6 A;  1B4P A;  3IA1 A;  3VLN A;  1FAA A;  4I2U A;  3TB2 A;  3FR9 A;  5ECI B;  1MEK A;  1QQ2 A;  4EKZ A;  4PGT A;  1VF3 A;  3DGQ A;  2LEG A;  1CQH A;  2GVP A;  2FWG A;  2R0C A;  3F8U A;  4KCA A;  2HXK A;  2YNX A;  4DVC A;  2FCH A;  2K8V A;  1T3B A;  1ON4 A;  4FO5 A;  2R3X A;  1U6T A;  1GNE A;  4PUF C;  3O76 A;  1ZYQ B;  5GSS A;  1PN0 A;  2GS3 A;  2H1B A;  4A5P A;  4YKG A;  4N30 A;  3O3T A;  4ECJ A;  3I69 A;  4KDX A;  2C3N A;  2CA8 A;  4LL1 B;  2LS5 A;  4WR5 A;  4V2L A;  5ID2 B;  5F06 A;  1HYU A;  1SK2 A;  4QQ7 A;  4ECC A;  2GSS A;  1GSU A;  4HZ4 A;  5ELG A;  1SYR A;  5KOW A;  1SD8 A;  1V40 A;  3WGD A;  4KAE A;  2M80 A;  3L9U A;  2AJQ B;  2C1Y A;  2VCQ A;  5KN1 A;  5HR0 A;  3IR4 A;  1GTI A;  2WDU A;  4HSC X;  2YZH A;  2PPT A;  2B7J A;  1K3L A;  4ZIJ A;  5DAK B;  4OO4 A;  1JZR A;  4P3Y B;  4PUR A;  2X8G A;  1Y25 A;  3C71 A;  4F2I A;  4GWR A;  2FD3 A;  1SJZ A;  1XZO A;  1T4Z A;  1FHE A;  4I97 A;  5CNW A;  1EOG A;  1M2A A;  1WPI A;  2DIZ A;  3TDG A;  3V1W A;  3C8E A;  1FOH A;  3HVN A;  3RHC A;  3EUR A;  4HS1 A;  2GQK A;  4O5Q A;  2R0G A;  1T7P B;  3LXZ A;  1ZYP A;  3GHA A;  2A4H A;  3TJF A;  1GSY A;  1GTA A;  3EIN A;  4GST A;  4WET A;  4BA7 A;  1A8Y A;  4N11 A;  1DE1 A;  2PVQ A;  4Z2T A;  3HVS A;  5ID2 A;  3KMN A;  4KDY A;  3GFK A;  1OAZ A;  2HRK A;  3FZ4 A;  1G6Y A;  4PQI A;  1R26 A;  6GST A;  5D9X A;  2YV7 A;  1WOU A;  3VFI A;  1K0C A;  4CY8 A;  2GGT A;  5JWQ B;  10GS A;  1SD9 A;  3KEB A;  3L0H A;  4O5U A;  3NOF A;  3E9J B;  1OE7 A;  2CZ3 A;  3FY7 A;  4IQ1 A;  4D73 B;  1X5E A;  4MA9 A;  4AF2 A;  4Q5F A;  4EXJ A;  5DDL A;  3R3E A;  5DAK A;  2H0I A;  2H8L A;  3CTG A;  2TIR A;  1J9B A;  3KTL A;  1WRY A;  1X5C A;  1QFN A;  3L9S A;  4MJB A;  3MAK A;  4N10 A;  2WRT A;  1XWK A;  2F3M A;  1OKD A;  1OC3 A;  5IQY A;  3KH9 A;  5J9C A;  3VWX A;  2C0G A;  2XBI A;  4GQF A;  4LLR A;  4POB A;  3IHQ A;  3QOU A;  4WBR D;  3AY8 A;  1U87 A;  3BJ5 A;  3GH6 A;  1AQX A;  3FMW A;  4JR6 A;  1NHY A;  5ENU A;  1PFO A;  3QFA C;  4ZBD A;  1TOF A;  3TUE A;  4GF0 A;  12GS A;  2VL2 A;  3UOM A;  2HI7 A;  1F2E A;  1EGR A;  2GDR A;  2YCD A;  4D73 A;  1UVZ A;  1B9X C;  2LST A;  3TKQ A;  4V2M A;  1DBY A;  4OCE A;  4ZBB A;  2OAC A;  1YZX A;  3TGZ A;  4PQ1 A;  4KA0 A;  5H5R A;  1T8E B;  3K8N A;  2MYG A;  1GUM A;  1W89 A;  1U3A A;  2A2S A;  3HHV A;  2QA2 A;  2H75 A;  2YP6 A;  2VCT A;  3I43 A;  3CYN A;  3NZN A;  4IHU A;  4FH8 A;  1VF4 A;  1A2M A;  3GMF A;  1USB A;  4TXO B;  3SBC A;  3HJP A;  5CRW A;  5CRD A;  2VL3 A;  1NHO A;  1K0D A;  4F0C A;  2E7P A;  2B1L A;  4G0I A;  3TKR A;  1GTB A;  1AW9 A;  2IPA A;  5G1K A;  3TJK A;  5HFI A;  1TRV A;  4J2F A;  2YJH A;  5F8B A;  2LRC A;  3ED3 A;  2J9H A;  4KB3 A;  2OA7 A;  2HRA A;  1VRS D;  3BD2 A;  1GH2 A;  4POK A;  2HRF A;  2B5X A;  4EDY A;  4G19 A;  5F07 A;  4CW9 A;  2PMT A;  1O8X A;  1MD4 A;  1BG5 A;  3FYG A;  1F6M C;  3ERG A;  2NBS A;  3UBL A;  2NVL A;  3H93 A;  4K7O A;  2WCI A;  3ZML A;  1OC8 A;  4KCE A;  4TXO A;  5B8A A;  3US3 A;  3LG6 A;  1MTC A;  4XS4 B;  4AGS A;  2WGR A;  4G9H A;  5IO2 A;  1A8L A;  1EP7 A;  1TU7 A;  6GSV A;  2XHF A;  1S3A A;  3QAG A;  2MBT A;  6GSS A;  4XRA A;  1HNA A;  3CMI A;  5ELA A;  2A2R A;  3M3M A;  4IP6 A;  1ERT A;  2DIY A;  4EL1 A;  3KGK A;  2C8U A;  3APO A;  3ZL5 A;  1S3D A;  3VWU A;  1SJI A;  3EYT A;  1ZCP A;  1ERV A;  1SYX A;  5KOX A;  4MAB A;  1AUC A;  1M9B A;  2GZZ A;  5ECM B;  2OE1 A;  4L8E A;  2C80 A;  1O81 A;  3F63 A;  4CHS A;  2GQL A;  2I9H A;  2MBS A;  4MZC A;  1X5D A;  4HQZ A;  5DVB A;  4ZB9 A;  1R4W A;  4TVE A;  3ZZX A;  2GSR A;  3RPN A;  5A4W A;  6GSX A;  4PQH A;  3MWH A;  1WE0 A;  3LQ7 A;  4NAX A;  1PRX A;  3PPU A;  2PUK C;  2IMD A;  1SK0 A;  4XS4 A;  4KW6 A;  4O5R A;  3P90 A;  2TRX A;  1UN2 A;  2KP1 A;  3LWA A;  1TW9 A;  2MMZ A;  1F9M A;  3M8N A;  2H6Z A;  1CQG A;  2JAC A;  4K0G A;  5ECH B;  1A2L A;  3E3E A;  1S3C A;  4OWY A;  4NPB A;  3VPQ A;  1ZOF A;  3Q18 A;  4DSS B;  1J0F A;  1T00 A;  3GIX A;  3TKS E;  2F8A A;  1GTU A;  1G7E A;  2RUF A;  2DMM A;  1M3I A;  4TOP A;  4X0X A;  1XVQ A;  2JZT A;  3EE2 A;  3QR6 A;  1ILO A;  1XBS A;  2H1G A;  3QAV A;  3GKK A;  3HXS A;  2I4A A;  1K0A A;  6GSU A;  2FWH A;  4CY6 A;  3TJB A;  1TDI A;  4JZQ A;  4E8H A;  4K0N A;  4I2T A;  1ZYN A;  1G0T A;  1TK8 B;  3MSZ A;  3IK9 A;  3GA4 A;  5DCG A;  3DKS A;  2E0Q A;  1AC1 A;  5DJM A;  2M46 A;  2V1M A;  8GSS A;  4NV2 A;  7GSS A;  5L71 A;  5DQY A;  4EO3 A;  1ZGN A;  1TI1 A;  3VUR A;  3A2W A;  4KGI A;  4WR4 A;  20GS A;  4I5Q A;  5B6M A;  1M3J A;  3LYK A;  4YAV A;  3VK9 A;  4MPF A;  4GTU A;  2FWF A;  2H72 A;  2PWJ A;  1ST9 A;  5IMZ A;  5G31 A;  5JCG A;  4LMV A;  5KN3 A;  4Z7X A;  3HJO A;  2CX3 A;  3FR6 A;  1E2Y A;  5H5Q A;  1PX7 A;  3S9F A;  2JSY A;  2HZE B;  4MF7 A;  5EPF A;  1JHB A;  1EEJ A;  2RLI A;  1YEP A;  4MLY A;  2XBQ A;  3FZ9 A;  1RQM A;  4Z2R A;  2YJ7 A;  3HZ8 A;  3UAR A;  1QK8 A;  1ZL9 A;  3KH7 A;  2H71 A;  3CSI A;  4ACS A;  1G6W A;  1MDK A;  1WWJ A;  1XPV A;  2LJK A;  3I9V 2;  4NMU A;  2O8V B;  1M2D A;  2VO4 A;  1T1V A;  3P7X A;  1JLW A;  3O6T A;  4EF0 A;  4KH7 A;  3GRX A;  1A2J A;  5KN0 A;  2JSZ A;  2B1K A;  3CTF A;  5A4U A;  1YEX A;  5DQS A;  4OCF A;  2YV9 A;  2DLX A;  4MP4 A;  2I3Y A;  4XRD A;  5LD0 A;  4G0L A;  3VWW A;  2RII A;  2VCX A;  5G30 A;  3F6D A;  3A5W A;  3GYK A;  3HDC A;  3DWV A;  2IN3 A;  2K8S A;  1KEB A;  5CO3 A;  3PIN A;  3D0Z A;  2O87 A;  2CT6 A;  4PX1 A;  2DJ1 A;  2MMA A;  4HJM A;  5G5E A;  11GS A;  2C4J A;  1NM3 A;  4TR1 B;  3TRP A;  2HZE A;  2YAN A;  1XVW A;  5A4V A;  2DC5 A;  2FA4 A;  2VM2 A;  1V58 A;  4IVF A;  4IS0 A;  4XS6 A;  1Z7R A;  1EZK A;  3GUS A;  5CRH A;  2HNL A;  5IMF A;  1TP9 A;  3P2A A;  1OYJ A;  1I5G A;  4FYC A;  1PSQ A;  2DJ3 A;  2HRN A;  3GN3 A;  1HNB A;  2YWM A;  1FOV A;  3BCI A;  3UJ1 A;  1NSW A;  4HU7 A;  1BAY A;  2L59 A;  2F51 A;  3ZVJ A;  1PL1 A;  2H01 A;  17GS A;  4I6X A;  2WFC A;  3I6A A;  4YQV A;  3M1G A;  3A3T A;  3UEM A;  5HR1 A;  2P5Q A;  4KDU A;  4ZL9 A;  3G9B A;  1EOH A;  5D93 A;  5H5S A;  5IMC A;  1FVK A;  4OFT A;  4TR1 A;  3ZVJ D;  3HJM A;  2H30 A;  2F8F A;  1PL2 A;  1WP0 A;  1GSD A;  1S3R A;  2XPD A;  3KZQ A;  5F05 A;  4EVM A;  4HI7 A;  2K18 A;  4K1F A;  5ECO B;  3TRX A;  2CV4 A;  2KHP A;  4IW9 A;  4WKW A;  1F3B A;  2DSA A;  2IMK A;  1O7U A;  4TR4 A;  1BED A;  4MZW A;  1Z6M A;  4ZL8 A;  3DML A;  2C3Q A;  3W6G A;  3TJJ A;  4XHM A;  3KP8 A;  1PN9 A;  1A23 A;  4RQX A;  3ZTL A;  1GLP A;  1JZO A;  3ERF A;  4EDZ A;  1AAZ A;  2RUE A;  1PGT A;  4EC0 A;  4ML6 A;  4RQR A;  1X9W B;  2I81 A;  5CRG A;  4IEL A;  2H73 A;  4EIQ A;  1JFU A;  2X4A A;  2CAI A;  1XW5 A;  2HSH A;  2O85 A;  2H6X A;  4K8M A;  2B5Y A;  2GTU A;  2I1U A;  5LNK e;  1GSF A;  2AV4 A;  3U6V A;  4BVY B;  2WS2 A;  2IJY A;  4TW5 A;  3LJR A;  5J3R A;  3LFL A;  1SJ6 A;  3QAW A;  1XOA A;  3IV4 A;  3MIX A;  2E2M A;  4L5L A;  1LJR A;  4BWS A;  2PGT A;  2EC4 A;  3HZ4 A;  2VAF A;  3ME7 A;  2H66 A;  3TKP A;  3N5O A;  5CYY A;  1SL0 B;  1ZMA A;  2DML A;  1U3I A;  2JZR A;  3FR3 A;  3L78 A;  2BMX A;  2H1A A;  1KBN A;  2YWN A;  2CVB A;  1FW1 A;  4L0W A;  2L6D A;  3N9J A;  1GLQ A;  2X8H A;  3UL3 A;  1MDJ A;  2WJU A;  2L5O A;  4TXV A;  4OO5 A;  1TU8 A;  1FG4 A;  3EC3 A;  4CDO A;  1C72 A;  4ILF A;  1RW1 A;  4IBP A;  3C1R A;  3ZMK A;  3KP9 A;  5HQP A;  1TXX A;  3ZFL A;  2BJX A;  3FZ5 A;  3D21 A;  4QL7 A;  4BVY A;  4WXT A;  3D4M A;  3IC4 A;  4HQS A;  4PNF A;  2G0F A;  5ECK B;  3OR5 A;  3VI7 A;  1VGL A;  3ZIT A;  1VF2 A;  3ERW A;  4OD7 A;  4KX4 A;  4ECI A;  2L5L A;  4ZB6 A;  4V1A p;  2L4Q A;  5IMA A;  4HZ2 A;  3LOR A;  4DSQ A;  1B8X A;  1BX9 A;  2LNT A;  1PQN A;  3EWL A;  4ZIL A;  5IO0 A;  3IE3 A;  2IFQ B;  1Q98 A;  1EWX A;  5AGY A;  5G1L A;  3HVX A;  1GSQ A;  2HSM A;  2GST A;  3J7Y b;  2E2G A;  3FEU A;  1AIU A;  2P0G A;  2PN8 A;  5C00 A;  4ULX A;  2R4V A;  2H76 A;  3LXT A;  5G2Z A;  1Z6N A;  2FA8 A;  3GL5 A;  4PNG A;  2FNO A;  3M0F A;  4GLT A;  1AXD A;  1E6B A;  3GNJ A;  4FYB A;  5AIV A;  2L6C A;  1XWB A;  2A2P A;  2JAD A;  1M0U A;  3HD5 A;  2F9S A;  4Q5N A;  2X8C A;  3D6I A;  4HDE A;  3PR8 A;  3WD6 A;  1J08 A;  3H1N A;  3IBH A;  3F0I A;  1OE8 A;  2L4C A;  1TRU A;  4HJ2 A;  2V32 A;  1R5A A;  5EL8 A;  4IKH A;  1V98 A;  4LL4 B;  1SEN A;  3R2Q A;  3F4R A;  2RM6 A;  4IGJ A;  4MH3 A;  2AYT A;  2N5B A;  2R6K A;  3FRC A;  22GS A;  1QXH A;  2VD1 A;  3M9K A;  1R5P A;  5IMD A;  3M9J A;  2ZNM A;  4ECB A;  3UVH A;  2VD0 A;  3F3R A;  1K3Y A;  4Q5R A;  4WBJ A;  4KSM A;  1PMT A;  4AJ6 A;  1URM A;  4K6X A;  1Z7P A;  5FHI A;  1M2B A;  5EVO A;  3GX8 A;  1ML6 A;  5J41 A;  4N0V A;  2EIR A;  4X4J A;  3CRU A;  2G2Q A;  1UA5 A;  1GSE A;  2V2G A;  4NV5 A;  4ID0 A;  1XW9 A;  2C0D A;  4HUA A;  1XCC A;  4DSR A;  3ZRD A;  1BYE A;  2LQQ A;  3MYD A;  4MK3 A;  5HFK A;  2R5G A;  2D2Z A;  2N5A A;  6GSW A;  4YAP A;  3HCZ A;  5ABR A;  3KXO A;  3TJG A;  3BBY A;  1SK1 A;  4MH2 A;  4JRR A;  1ACV A;  3VWV A;  4IJ3 A;  1SKW B;  3GTU B;  1QGV A;  1F37 A;  2YWO A;  5JWR B;  5BRT A;  2N5F A;  2M72 A;  1V2A A;  1Z9H A;  3ME8 A;  4TR3 A;  2YZU A;  5ECL B;  2YPM A;  1GUK A;  2UZ8 A;  2DJ2 A;  4ZB8 A;  1XXU A;  2IMF A;  3HY2 A;  2IME A;  5IPH A;  3WYW A;  3G7Y A;  1O6J A;  4OFM A;  4DSS A;  5IPG A;  1H4O A;  2R0P A;  5KEJ A;  1K0N A;  3Q74 A;  4NHW A;  2DJK A;  2FLS A;  1O85 A;  3APS A;  3KD0 A;  1SKS B;  2LTK A;  3ZFB A;  2TRC P;  4X43 A;  1SU9 A;  3F9U A;  3KJY A;  3IK7 A;  3EU3 A;  4NXI A;  4K2D A;  4L5O A;  3QDN A;  2OAD A;  4OMV A;  3CSH A;  3WT2 A;  3PH9 A;  3F4T A;  1PD2 1;  4MCU A;  3GH9 A;  4EIP A;  4GSN A;  1ZZY A;  2WUL A;  1XWG A;  3MDK A;  3CRT A;  1PKZ A;  3GTU A;  1M7T A;  1SL2 B;  2CAQ A;  4HU9 A;  2EIQ A;  2O89 A;  4J57 E;  2QKE A;  2YWI A;  2DJ0 A;  3GL3 A;  1YY7 A;  2KOK A;  19GS A;  1XFL A;  5FT3 A;  2H6Y A;  3J7Y k;  5JCU A;  2VL2 C;  4DEJ A;  3HVV A;  1W4V A;  4I8B A;  2K6V A;  1HNC A;  2VCW A;  3QPM A;  2QSI A;  1DUG A;  3IOS A;  5IM9 A;  3LSZ A;  1GUL A;  4V2N A;  4USS A;  2H1D A;  4Q5Q A;  2L57 A;  2ZCT A;  2VLT A;  9GSS A;  1X9M B;  3ZYW A;  2LQO A;  3APQ A;  5DJL A;  3LGC A;  2EIO A;  5CP1 A;  2HT9 A;  4XCS A;  5ECP B;  4JU5 A; 
#chains in the Genus database with same CATH homology
 3G7J A;  2IIY A;  4J56 E;  5HFG A;  3IAS 2;  3GV1 A;  5LCZ A;  4H86 A;  4TR0 A;  2H70 A;  3IAM 2;  2GQM A;  2HLS A;  3A2X A;  4BL7 B;  3Q19 A;  3NIV A;  4F9Z A;  2IWT A;  4K5R A;  5D9V A;  3D5J A;  2JU5 A;  3ZIJ A;  3ZIV A;  2BTO T;  4ZXG A;  4K5S A;  4GSS A;  2GZP A;  1Z5Y E;  2LJA A;  1F3A A;  3FHK A;  3UAP A;  4FYU A;  2LRT A;  4MJC A;  4NHZ A;  1OKT A;  1M99 A;  3IXR A;  2R2J A;  1THO A;  3TOT A;  2NTO A;  1XOB A;  5DBQ A;  1N8J A;  2ALB A;  3EU4 A;  5GZZ B;  4TN8 A;  4KE3 A;  3RBT A;  4G2E A;  2P5R A;  1TRW A;  2K9F A;  2CQ9 A;  5C04 A;  4MF6 A;  5GST A;  3JCM L;  2PU9 C;  1B9Y C;  4POL A;  3FW2 A;  1IYH A;  2CVD A;  2MMN A;  3D4T A;  3EMP A;  1V9W A;  5D96 A;  2LUS A;  3C7M A;  4IJI A;  2OJL A;  2V41 A;  5J5N A;  2VUP A;  3DIE A;  3DYR A;  4BL7 A;  2IMI A;  2H0G A;  3IRA A;  4MF5 A;  5B7C A;  3ZLP A;  4JBB A;  1XW6 A;  2FGX A;  3FKF A;  2GT6 A;  3KIJ A;  1HQO A;  4F0B A;  4GRF A;  2C0E A;  4RI7 A;  1JZW A;  1MDI A;  1O73 A;  4GXZ A;  5GAP D;  4TKY A;  3A5I A;  1Q4J A;  1X9S B;  3IC8 A;  4LMW A;  3H79 A;  3KM6 A;  1OVN A;  4K7I A;  1HD2 A;  3TKS C;  3VI5 A;  4YKF A;  5ECR B;  1N2A A;  2OE3 A;  5BMU A;  2ES7 A;  1EV9 A;  3DD3 A;  4JE1 A;  4YH2 A;  1YF0 A;  3A2V A;  4KF9 A;  1TKD B;  5DAL B;  2H19 A;  2VOC A;  5D73 A;  3UBK A;  2NDO A;  3VPT A;  4HOJ A;  4LA1 A;  2P31 A;  1YKC A;  1OC9 B;  1TRS A;  6GSY A;  3UIW A;  5COH A;  4O92 A;  2XPE A;  2DKI A;  1JLV A;  2HE3 A;  3GUR A;  1YKA A;  2X49 A;  5A5K A;  1IYI A;  2VIM A;  4QL9 A;  2OKA A;  2AHE A;  4KUN A;  1GRX A;  2GLR A;  2X99 A;  3HA9 A;  1PA3 A;  1KTE A;  1FO5 A;  3GKX A;  4NWY A;  1M9A A;  4GQC A;  2OBK A;  2VLV A;  1AQW A;  2B5E A;  4IN0 A;  2KUC A;  3EPT A;  5J4U A;  4YQU A;  1RK4 A;  4WF4 A;  1B4Q A;  2AUV A;  2O7K A;  2ON5 A;  2VLU A;  3LEF A;  5AN1 A;  2J23 A;  2OE0 A;  3GKN A;  1KNG A;  4HEA 2;  3RHB A;  3HKR A;  5DAL A;  1ZYE A;  1GSS A;  3F3Q A;  5IOX A;  2HFD A;  3C73 A;  2H0H A;  1YDK A;  4XIH A;  1T4Y A;  2HSY A;  2GSQ A;  2DKH A;  3P8W A;  2QGV A;  1OC9 A;  5DCH A;  3WGE A;  1Y6E A;  2V6O A;  5ECQ B;  2A4V A;  4RUV A;  5D9W A;  2FY6 A;  4JED A;  2RM5 A;  3EVI A;  2OBI A;  3RDW A;  1NW2 A;  4ZL7 A;  16GS A;  1SL1 B;  1TK0 B;  4EUY A;  5E4W A;  3WGX A;  1A0F A;  1GNW A;  4MDC A;  2B6M A;  3GKM A;  2X64 A;  2PBJ A;  4N0Z A;  3W8J A;  3BCK A;  2VCV A;  1WIK A;  1Z3E A;  2LV3 A;  4O7H A;  3H8Q A;  4IQA A;  1K3O A;  3CXG A;  1LU4 A;  3IPZ A;  4WEY A;  2FWE A;  4ISD A;  2B7K A;  1ERW A;  4K2X A;  3GSS A;  4PUA A;  1GUH A;  2R37 A;  5CAX A;  1PX6 A;  1K0O A;  2MMO A;  1I9D A;  1YJ6 A;  2QC7 A;  2GT5 A;  2REM A;  3L9V A;  2MZC A;  1EEM A;  4ML1 A;  3ISO A;  5E59 A;  3GX0 A;  3EMX A;  1TJD A;  4OFN A;  1XWC A;  4V1A g;  3Q6O A;  5AIX A;  1U88 A;  2IL3 A;  2Z9S A;  3QCP A;  4G10 A;  4G0K A;  2HYX A;  2C0F A;  4GCI A;  1XIY A;  2ON7 A;  1BQ7 A;  2DJJ A;  4K9Z A;  4Z2U A;  1JZD A;  3F6F A;  4FQU A;  2CVK A;  2VCZ A;  2CZ2 A;  5CRE A;  2H74 A;  4MZB A;  2IFQ A;  5D9T A;  2KLX A;  1X0R A;  3F4S A;  3TKS A;  4BVX B;  4E8E A;  1DSB A;  2WZ9 A;  4AJ7 A;  4POM A;  2XC2 A;  3D22 A;  1QMV A;  1XWA A;  5FWG A;  2AAW A;  14GS A;  3G7I A;  2JZS A;  3HYP A;  2CX4 A;  5IIZ A;  3DRN A;  3ZRE A;  1ABA A;  5F0G A;  1UC7 A;  4RI6 A;  4XS1 A;  1G7O A;  5B8B A;  4F03 A;  2PER A;  3GST A;  3MNG A;  3TRQ A;  3PGT A;  4JR4 A;  4L0U A;  1AQV A;  1THX A;  5B6N A;  1EGO A;  5JWO B;  5IMV A;  4O32 A;  5EY6 A;  3KTB A;  5HR3 A;  1O8W A;  4IP1 A;  4WF5 A;  3DVW A;  3E0U A;  4BWQ A;  3UVT A;  4F82 A;  3QD9 A;  3LW9 A;  3TOU A;  1R7H A;  2KP2 A;  3DVX A;  3QMX A;  1MD3 A;  3L4N A;  1WJK A;  1K0M A;  4MJE A;  3CSJ A;  3UMA A;  4MNN A;  3RPP A;  5KN2 A;  1ERU A;  1TK5 B;  2FHE A;  4BVX A;  2FUG 2;  4PTS A;  4EE0 A;  1GL8 A;  1B48 A;  1YQ1 A;  3FK8 A;  2HZF A;  1K0B A;  4MJA A;  1VF1 A;  4KSO A;  1A0R P;  3WT1 A;  4KND A;  1DE2 A;  4MMM A;  5GAN D;  4YQM A;  1WMJ A;  1FB0 A;  5J9B A;  2YN1 A;  2AB6 A;  2B3S A;  5JCW A;  2LNS A;  2DBC A;  3U5R E;  3DEX A;  1H75 A;  4MPG A;  1TTZ A;  3IHG A;  2VM1 A;  4ZBA A;  1A24 A;  3RAZ A;  4PXO A;  5ECS A;  5ECN B;  4K7N A;  3CBU A;  2ZUP A;  2WB9 A;  5D8I A;  3IDV A;  2LKU A;  2VL9 A;  2GZY A;  3FZA A;  3SWL A;  5HR2 A;  2LRN A;  1BJX A;  13GS A;  4XTS A;  2NPB A;  1LBK A;  1PKW A;  1EV4 A;  1EP8 A;  2C3T A;  3BOA A;  4X1U A;  4BPY A;  1QUW A;  1YF1 A;  2V6K A;  1V57 A;  2YOI A;  1GWC A;  1SKR B;  4AJ8 A;  2PVO C;  5IOW A;  3KMO A;  4ICY A;  3TCO A;  4FIW A;  2JL4 A;  3H4K A;  2QA1 A;  4TRX A;  1GP1 A;  3QFB C;  1TI3 A;  3LYP A;  3KCM A;  2LJR A;  18GS A;  3C1S A;  3DXB A;  3W8S A;  5G5F A;  5INY A;  1FVJ A;  5AIS A;  1FB6 A;  1B4P A;  3IA1 A;  3VLN A;  1FAA A;  4I2U A;  3TB2 A;  3FR9 A;  5ECI B;  1MEK A;  1QQ2 A;  4EKZ A;  4PGT A;  1VF3 A;  3DGQ A;  2LEG A;  1CQH A;  2GVP A;  2FWG A;  2R0C A;  3F8U A;  4KCA A;  2HXK A;  2YNX A;  4DVC A;  2FCH A;  2K8V A;  1T3B A;  1ON4 A;  4FO5 A;  2R3X A;  1U6T A;  1GNE A;  4PUF C;  3O76 A;  1ZYQ B;  5GSS A;  1PN0 A;  2GS3 A;  2H1B A;  4A5P A;  4YKG A;  4N30 A;  3O3T A;  4ECJ A;  3I69 A;  4KDX A;  2C3N A;  2CA8 A;  4LL1 B;  2LS5 A;  4WR5 A;  4V2L A;  5ID2 B;  5F06 A;  1HYU A;  1SK2 A;  4QQ7 A;  4ECC A;  2GSS A;  1GSU A;  4HZ4 A;  5ELG A;  1SYR A;  5KOW A;  1SD8 A;  1V40 A;  3WGD A;  4KAE A;  2M80 A;  3L9U A;  2AJQ B;  2C1Y A;  2VCQ A;  5KN1 A;  5HR0 A;  3IR4 A;  1GTI A;  2WDU A;  2YZH A;  2PPT A;  2B7J A;  1K3L A;  4ZIJ A;  5DAK B;  4OO4 A;  1JZR A;  4P3Y B;  4PUR A;  2X8G A;  1Y25 A;  3C71 A;  4F2I A;  4GWR A;  2FD3 A;  1SJZ A;  1XZO A;  1T4Z A;  1FHE A;  4I97 A;  5CNW A;  1EOG A;  1M2A A;  1WPI A;  2DIZ A;  3TDG A;  3V1W A;  3C8E A;  1FOH A;  3RHC A;  3EUR A;  4HS1 A;  2GQK A;  4O5Q A;  2R0G A;  1T7P B;  3LXZ A;  1ZYP A;  3GHA A;  2A4H A;  3TJF A;  1GSY A;  1GTA A;  3EIN A;  4GST A;  4WET A;  4BA7 A;  1A8Y A;  4N11 A;  1DE1 A;  2PVQ A;  4Z2T A;  3HVS A;  5ID2 A;  3KMN A;  4KDY A;  3GFK A;  1OAZ A;  2HRK A;  3FZ4 A;  1G6Y A;  4PQI A;  1R26 A;  6GST A;  5D9X A;  2YV7 A;  1WOU A;  3VFI A;  1K0C A;  4CY8 A;  2GGT A;  5JWQ B;  10GS A;  1SD9 A;  3KEB A;  3L0H A;  4O5U A;  3NOF A;  3E9J B;  1OE7 A;  2CZ3 A;  3FY7 A;  4IQ1 A;  4D73 B;  1X5E A;  4MA9 A;  4AF2 A;  4Q5F A;  4EXJ A;  5DDL A;  3R3E A;  5DAK A;  2H0I A;  2H8L A;  2TIR A;  1J9B A;  3CTG A;  3KTL A;  1WRY A;  1X5C A;  1QFN A;  3L9S A;  4MJB A;  3MAK A;  4N10 A;  2WRT A;  1XWK A;  2F3M A;  1OKD A;  1OC3 A;  5IQY A;  3KH9 A;  5J9C A;  3VWX A;  2C0G A;  2XBI A;  4GQF A;  4LLR A;  4POB A;  3IHQ A;  3QOU A;  4WBR D;  3AY8 A;  1U87 A;  3BJ5 A;  3GH6 A;  1AQX A;  3FMW A;  4JR6 A;  1NHY A;  5ENU A;  3QFA C;  4ZBD A;  1TOF A;  3TUE A;  4GF0 A;  12GS A;  2VL2 A;  3UOM A;  2HI7 A;  1F2E A;  1EGR A;  2GDR A;  2YCD A;  4D73 A;  1UVZ A;  1B9X C;  2LST A;  3TKQ A;  4V2M A;  1DBY A;  4OCE A;  4ZBB A;  2OAC A;  1YZX A;  3TGZ A;  4PQ1 A;  4KA0 A;  5H5R A;  1T8E B;  3K8N A;  2MYG A;  1GUM A;  1W89 A;  1U3A A;  2A2S A;  3HHV A;  2QA2 A;  2H75 A;  2YP6 A;  2VCT A;  3I43 A;  3CYN A;  3NZN A;  4IHU A;  4FH8 A;  1VF4 A;  1A2M A;  3GMF A;  1USB A;  4TXO B;  3SBC A;  3HJP A;  5CRW A;  5CRD A;  2VL3 A;  1NHO A;  1K0D A;  4F0C A;  2E7P A;  2B1L A;  4G0I A;  3TKR A;  1GTB A;  1AW9 A;  2IPA A;  5G1K A;  3TJK A;  5HFI A;  1TRV A;  4J2F A;  2YJH A;  5F8B A;  2LRC A;  3ED3 A;  2J9H A;  4KB3 A;  2OA7 A;  2HRA A;  1VRS D;  3BD2 A;  1GH2 A;  4POK A;  2HRF A;  2B5X A;  4EDY A;  4G19 A;  5F07 A;  4CW9 A;  2PMT A;  1O8X A;  1MD4 A;  1BG5 A;  3FYG A;  1F6M C;  3ERG A;  2NBS A;  3UBL A;  2NVL A;  3H93 A;  4K7O A;  2WCI A;  3ZML A;  1OC8 A;  4KCE A;  4TXO A;  5B8A A;  3US3 A;  3LG6 A;  1MTC A;  4XS4 B;  4AGS A;  2WGR A;  4G9H A;  5IO2 A;  1A8L A;  1EP7 A;  1TU7 A;  6GSV A;  2XHF A;  1S3A A;  3QAG A;  2MBT A;  6GSS A;  4XRA A;  1HNA A;  3CMI A;  5ELA A;  2A2R A;  3M3M A;  4IP6 A;  1ERT A;  2DIY A;  4EL1 A;  3KGK A;  2C8U A;  3APO A;  3ZL5 A;  1S3D A;  3VWU A;  1SJI A;  3EYT A;  1ZCP A;  1ERV A;  1SYX A;  5KOX A;  4MAB A;  1AUC A;  1M9B A;  2GZZ A;  5ECM B;  2OE1 A;  4L8E A;  2C80 A;  1O81 A;  3F63 A;  4CHS A;  2GQL A;  2I9H A;  2MBS A;  4MZC A;  1X5D A;  4HQZ A;  5DVB A;  4ZB9 A;  1R4W A;  4TVE A;  3ZZX A;  2GSR A;  3RPN A;  5A4W A;  6GSX A;  4PQH A;  3MWH A;  1WE0 A;  3LQ7 A;  4NAX A;  1PRX A;  3PPU A;  2PUK C;  2IMD A;  1SK0 A;  4XS4 A;  4KW6 A;  4O5R A;  3P90 A;  2TRX A;  1UN2 A;  2KP1 A;  3LWA A;  1TW9 A;  2MMZ A;  1F9M A;  3M8N A;  2H6Z A;  1CQG A;  2JAC A;  4K0G A;  5ECH B;  1A2L A;  3E3E A;  1S3C A;  4OWY A;  4NPB A;  3VPQ A;  1ZOF A;  3Q18 A;  4DSS B;  1J0F A;  1T00 A;  3GIX A;  3TKS E;  2F8A A;  1GTU A;  1G7E A;  2RUF A;  2DMM A;  4TOP A;  4X0X A;  1XVQ A;  2JZT A;  3EE2 A;  3QR6 A;  1ILO A;  1XBS A;  2H1G A;  3QAV A;  3GKK A;  3HXS A;  2I4A A;  1K0A A;  6GSU A;  2FWH A;  4CY6 A;  3TJB A;  1TDI A;  4JZQ A;  4E8H A;  4K0N A;  4I2T A;  1ZYN A;  1G0T A;  1TK8 B;  3MSZ A;  3IK9 A;  3GA4 A;  5DCG A;  3DKS A;  2E0Q A;  1AC1 A;  5DJM A;  2M46 A;  2V1M A;  8GSS A;  4NV2 A;  7GSS A;  5L71 A;  5DQY A;  4EO3 A;  1ZGN A;  1TI1 A;  3VUR A;  3A2W A;  4KGI A;  4WR4 A;  20GS A;  4I5Q A;  5B6M A;  3LYK A;  4YAV A;  3VK9 A;  4MPF A;  4GTU A;  2FWF A;  2H72 A;  2PWJ A;  1ST9 A;  5IMZ A;  5G31 A;  5JCG A;  4LMV A;  5KN3 A;  4Z7X A;  3HJO A;  2CX3 A;  3FR6 A;  1E2Y A;  5H5Q A;  1PX7 A;  3S9F A;  2JSY A;  2HZE B;  4MF7 A;  5EPF A;  1JHB A;  1EEJ A;  2RLI A;  1YEP A;  4MLY A;  2XBQ A;  3FZ9 A;  1RQM A;  4Z2R A;  2YJ7 A;  3HZ8 A;  3UAR A;  1QK8 A;  1ZL9 A;  3KH7 A;  2H71 A;  3CSI A;  4ACS A;  1G6W A;  1MDK A;  1WWJ A;  1XPV A;  2LJK A;  3I9V 2;  4NMU A;  2O8V B;  1M2D A;  2VO4 A;  1T1V A;  3P7X A;  1JLW A;  3O6T A;  4EF0 A;  4KH7 A;  3GRX A;  1A2J A;  5KN0 A;  2JSZ A;  2B1K A;  3CTF A;  5A4U A;  1YEX A;  5DQS A;  4OCF A;  2YV9 A;  2DLX A;  4MP4 A;  2I3Y A;  4XRD A;  5LD0 A;  4G0L A;  3VWW A;  2RII A;  2VCX A;  5G30 A;  3F6D A;  3A5W A;  3GYK A;  3HDC A;  3DWV A;  2IN3 A;  2K8S A;  1KEB A;  5CO3 A;  3PIN A;  3D0Z A;  2O87 A;  2CT6 A;  4PX1 A;  2DJ1 A;  2MMA A;  4HJM A;  5G5E A;  11GS A;  2C4J A;  1NM3 A;  4TR1 B;  3TRP A;  2HZE A;  2YAN A;  1XVW A;  5A4V A;  2DC5 A;  2FA4 A;  2VM2 A;  1V58 A;  4IVF A;  4IS0 A;  4XS6 A;  1Z7R A;  1EZK A;  3GUS A;  5CRH A;  2HNL A;  5IMF A;  1TP9 A;  3P2A A;  1OYJ A;  1I5G A;  4FYC A;  1PSQ A;  2DJ3 A;  2HRN A;  3GN3 A;  1HNB A;  2YWM A;  1FOV A;  3BCI A;  3UJ1 A;  1NSW A;  4HU7 A;  1BAY A;  2L59 A;  2F51 A;  3ZVJ A;  1PL1 A;  2H01 A;  17GS A;  4I6X A;  2WFC A;  3I6A A;  4YQV A;  3M1G A;  3A3T A;  3UEM A;  5HR1 A;  2P5Q A;  4KDU A;  4ZL9 A;  3G9B A;  1EOH A;  5D93 A;  5H5S A;  5IMC A;  1FVK A;  4OFT A;  4TR1 A;  3ZVJ D;  3HJM A;  2H30 A;  2F8F A;  1PL2 A;  1WP0 A;  1GSD A;  2XPD A;  3KZQ A;  5F05 A;  4EVM A;  4HI7 A;  2K18 A;  4K1F A;  5ECO B;  3TRX A;  2CV4 A;  2KHP A;  4IW9 A;  4WKW A;  1F3B A;  2DSA A;  2IMK A;  1O7U A;  4TR4 A;  1BED A;  4MZW A;  1Z6M A;  4ZL8 A;  3DML A;  2C3Q A;  3W6G A;  3TJJ A;  4XHM A;  3KP8 A;  1PN9 A;  1A23 A;  4RQX A;  3ZTL A;  1GLP A;  1JZO A;  3ERF A;  4EDZ A;  1AAZ A;  2RUE A;  1PGT A;  4EC0 A;  4ML6 A;  4RQR A;  1X9W B;  2I81 A;  5CRG A;  4IEL A;  2H73 A;  4EIQ A;  1JFU A;  2X4A A;  2CAI A;  1XW5 A;  2HSH A;  2O85 A;  2H6X A;  4K8M A;  2B5Y A;  2GTU A;  2I1U A;  5LNK e;  1GSF A;  2AV4 A;  3U6V A;  4BVY B;  2WS2 A;  2IJY A;  4TW5 A;  3LJR A;  5J3R A;  3LFL A;  1SJ6 A;  3QAW A;  1XOA A;  3IV4 A;  3MIX A;  2E2M A;  4L5L A;  1LJR A;  4BWS A;  2PGT A;  2EC4 A;  3HZ4 A;  2VAF A;  3ME7 A;  2H66 A;  3TKP A;  3N5O A;  5CYY A;  1SL0 B;  1ZMA A;  2DML A;  1U3I A;  2JZR A;  3FR3 A;  3L78 A;  2BMX A;  2H1A A;  1KBN A;  2YWN A;  2CVB A;  1FW1 A;  4L0W A;  2L6D A;  3N9J A;  1GLQ A;  2X8H A;  3UL3 A;  1MDJ A;  2WJU A;  2L5O A;  4TXV A;  4OO5 A;  1TU8 A;  1FG4 A;  3EC3 A;  4CDO A;  1C72 A;  4ILF A;  1RW1 A;  4IBP A;  3C1R A;  3ZMK A;  3KP9 A;  5HQP A;  1TXX A;  3ZFL A;  2BJX A;  3FZ5 A;  3D21 A;  4QL7 A;  4BVY A;  4WXT A;  3D4M A;  3IC4 A;  4HQS A;  4PNF A;  2G0F A;  5ECK B;  3OR5 A;  3VI7 A;  1VGL A;  3ZIT A;  1VF2 A;  3ERW A;  4OD7 A;  4KX4 A;  4ECI A;  2L5L A;  4ZB6 A;  4V1A p;  2L4Q A;  5IMA A;  4HZ2 A;  3LOR A;  4DSQ A;  1B8X A;  1BX9 A;  2LNT A;  1PQN A;  3EWL A;  4ZIL A;  5IO0 A;  3IE3 A;  2IFQ B;  1Q98 A;  1EWX A;  5AGY A;  5G1L A;  3HVX A;  1GSQ A;  2HSM A;  2GST A;  3J7Y b;  2E2G A;  3FEU A;  1AIU A;  2P0G A;  2PN8 A;  5C00 A;  4ULX A;  2R4V A;  2H76 A;  3LXT A;  5G2Z A;  1Z6N A;  2FA8 A;  3GL5 A;  4PNG A;  2FNO A;  3M0F A;  4GLT A;  1AXD A;  1E6B A;  3GNJ A;  4FYB A;  5AIV A;  2L6C A;  1XWB A;  2A2P A;  2JAD A;  1M0U A;  3HD5 A;  2F9S A;  4Q5N A;  2X8C A;  3D6I A;  4HDE A;  3PR8 A;  3WD6 A;  1J08 A;  3H1N A;  3IBH A;  3F0I A;  1OE8 A;  2L4C A;  1TRU A;  4HJ2 A;  2V32 A;  1R5A A;  5EL8 A;  4IKH A;  1V98 A;  4LL4 B;  1SEN A;  3R2Q A;  3F4R A;  2RM6 A;  4IGJ A;  4MH3 A;  2AYT A;  2N5B A;  2R6K A;  3FRC A;  22GS A;  1QXH A;  2VD1 A;  3M9K A;  1R5P A;  5IMD A;  3M9J A;  2ZNM A;  4ECB A;  3UVH A;  2VD0 A;  3F3R A;  1K3Y A;  4Q5R A;  4WBJ A;  4KSM A;  1PMT A;  4AJ6 A;  1URM A;  4K6X A;  1Z7P A;  5FHI A;  1M2B A;  5EVO A;  3GX8 A;  1ML6 A;  5J41 A;  4N0V A;  2EIR A;  4X4J A;  3CRU A;  2G2Q A;  1UA5 A;  1GSE A;  2V2G A;  4NV5 A;  4ID0 A;  1XW9 A;  2C0D A;  4HUA A;  1XCC A;  4DSR A;  3ZRD A;  1BYE A;  2LQQ A;  3MYD A;  4MK3 A;  5HFK A;  2R5G A;  2D2Z A;  2N5A A;  6GSW A;  4YAP A;  3HCZ A;  5ABR A;  3KXO A;  3TJG A;  3BBY A;  1SK1 A;  4MH2 A;  4JRR A;  1ACV A;  3VWV A;  4IJ3 A;  1SKW B;  3GTU B;  1QGV A;  1F37 A;  2YWO A;  5JWR B;  5BRT A;  2N5F A;  2M72 A;  1V2A A;  1Z9H A;  3ME8 A;  4TR3 A;  2YZU A;  5ECL B;  2YPM A;  1GUK A;  2UZ8 A;  2DJ2 A;  4ZB8 A;  1XXU A;  2IMF A;  3HY2 A;  2IME A;  5IPH A;  3WYW A;  3G7Y A;  1O6J A;  4OFM A;  4DSS A;  5IPG A;  1H4O A;  2R0P A;  5KEJ A;  1K0N A;  3Q74 A;  4NHW A;  2DJK A;  2FLS A;  1O85 A;  3APS A;  3KD0 A;  1SKS B;  2LTK A;  3ZFB A;  2TRC P;  4X43 A;  1SU9 A;  3F9U A;  3KJY A;  3IK7 A;  3EU3 A;  4NXI A;  4K2D A;  4L5O A;  3QDN A;  2OAD A;  4OMV A;  3CSH A;  3WT2 A;  3PH9 A;  3F4T A;  1PD2 1;  4MCU A;  3GH9 A;  4EIP A;  4GSN A;  1ZZY A;  2WUL A;  1XWG A;  3MDK A;  3CRT A;  1PKZ A;  3GTU A;  1M7T A;  1SL2 B;  2CAQ A;  4HU9 A;  2EIQ A;  2O89 A;  4J57 E;  2QKE A;  2YWI A;  2DJ0 A;  3GL3 A;  1YY7 A;  2KOK A;  19GS A;  1XFL A;  5FT3 A;  2H6Y A;  3J7Y k;  5JCU A;  2VL2 C;  4DEJ A;  3HVV A;  1W4V A;  4I8B A;  2K6V A;  1HNC A;  2VCW A;  3QPM A;  2QSI A;  1DUG A;  3IOS A;  5IM9 A;  3LSZ A;  1GUL A;  4V2N A;  4USS A;  2H1D A;  4Q5Q A;  2L57 A;  2ZCT A;  2VLT A;  9GSS A;  1X9M B;  3ZYW A;  2LQO A;  3APQ A;  5DJL A;  3LGC A;  2EIO A;  5CP1 A;  2HT9 A;  4XCS A;  5ECP B;  4JU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...