1I9DA

Arsenate reductase from e. coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
138
structure length
138
Chain Sequence
NITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLRKNVEPYEQLGLAEDKFTDDQLIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARSENATE REDUCTASE
publication title Insights into the structure, solvation, and mechanism of ArsC arsenate reductase, a novel arsenic detoxification enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 38
structure length 138
sequence length 138
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03960 ArsC ArsC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1i9dA00
4EO3A 3BJ5A 1FVJA 4LLRA 2ZNMA 4NXIA 1F2EA 2H19A 1EGRA 2KOKA 4XRDA 5KN3A 3CBUA 2LEGA 2OACA 1EZKA 2F8FA 2PU9C 4GXZA 4JE1A 4V2NA 4OFMA 4KDYA 1YEXA 4QQ7A 2VCVA 5B8BA 2FUG2 2J9HA 1J9BA 2CT6A 3KTLA 4E8HA 1GSEA 3KH9A 4YAVA 4ECCA 2TRCP 4ZB6A 2L6DA 2GZZA 3H8QA 2K18A 5ECRB 2VD0A 3WGDA 1A8LA 4NMUA 2LKUA 2YWNA 2FA4A 4LA1A 2YWOA 2FGXA 3Q74A 3BCIA 4MZBA 2VLTA 4F2IA 3A5WA 1Z9HA 3ME7A 4O32A 2IWTA 2C0FA 3LFLA 1MTCA 2RM5A 1XFLA 4MJBA 1A24A 5F06A 2AUVA 2GT6A 2K8VA 3D4TA 1O7UA 3L4NA 5IM9A 4V1Ap 2CA8A 3TOUA 5IOXA 5F8BA 1MDJA 2P5QA 4IBPA 1K0DA 2VCXA 1LJRA 4RI6A 5KN0A 3EVIA 5HR3A 4E8EA 2LTKA 1OC9B 3CSHA 1W4VA 4HJMA 5G31A 5D93A 2H74A 3F6DA 3ZIVA 4ML6A 1HNBA 1AC1A 1TI3A 1AXDA 4AJ6A 2CVKA 2TIRA 3LXZA 5F07A 4TN8A 1V57A 3TRPA 3GL5A 3TJKA 4G19A 5G1KA 2DLXA 3VK9A 5A4UA 1ABAA 1SJZA 5G5FA 4O92A 3C1SA 2FWFA 2VO4A 1DBYA 2ZUPA 4OWYA 5HFIA 4WF4A 2WS2A 2B5XA 4XS4A 4JBBA 2J23A 2K6VA 1T00A 4O7HA 4IW9A 1K3YA 3EC3A 1TRUA 2TRXA 2V2GA 3EU4A 2C1YA 4YQUA 3TKSA 1TKDB 3MSZA 3W8JA 2HXKA 3GMFA 2B5YA 4MH3A 1BQ7A 1Z3EA 4OMVA 2AJQB 4MCUA 2CAIA 3TB2A 3CSIA 2H75A 4XTSA 1EEJA 2KP1A 2PVQA 1OC8A 3EYTA 2BTOT 4N11A 2RIIA 2C3TA 3QCPA 2OADA 3H79A 4PURA 4TRXA 2HRFA 1SENA 3QFBC 3HXSA 4MZWA 4MLYA 3PINA 4WR5A 1SJ6A 3EMPA 2C80A 3IHQA 3KH7A 5DAKB 3TJGA 2M80A 2XPDA 2E7PA 3U6VA 2FHEA 4YAPA 7GSSA 5ABRA 2XBIA 1YDKA 2CV4A 2NPBA 1A2MA 3HVSA 1OC9A 1PMTA 3ERFA 2DJ0A 3IE3A 1UVZA 5CRWA 3GH6A 2H30A 3F4TA 3M9KA 1JFUA 4Q5FA 5GSSA 3D5JA 5JWOB 3BBYA 2R5GA 3ZITA 4V2MA 4IS0A 1G7EA 1X5EA 2E2GA 2C0EA 4HZ2A 1ILOA 4RQRA 2EC4A 4GQFA 3EE2A 4TR3A 4HOJA 6GSUA 1O8WA 4BWSA 14GSA 4WF5A 4F0BA 2X8GA 4FYUA 3GRXA 4KNDA 1MD4A 1VF4A 5KN1A 4Z7XA 5DCHA 4I5QA 5D9VA 3WGXA 3H1NA 4HI7A 3F9UA 4HJ2A 2FNOA 2IMDA 1M2BA 3HYPA 2GQKA 4TW5A 2A2SA 1AUCA 1ZMAA 2AAWA 2O89A 5ECOB 3UAPA 3ZYWA 1R26A 2YWIA 2FA8A 4TXVA 1N8JA 3FK8A 1BYEA 4GRFA 2IPAA 2C8UA 2DBCA 3SWLA 4K0GA 2HRNA 3G7YA 3KGKA 2RM6A 3Q18A 3I69A 3H93A 4KSOA 1QXHA 3I9V2 3F63A 5DAKA 3HJOA 2I3YA 4PGTA 4I6XA 1SK2A 3F3RA 2LJAA 1T4ZA 2P0GA 4HU7A 3F4RA 1HNAA 3ZREA 3M0FA 1TU8A 4MF6A 2H73A 1GH2A 5B7CA 2OKAA 2DMLA 3DRNA 3C1RA 3UBLA 1EWXA 4EF0A 2RUFA 5JWQB 3IR4A 2MMNA 3O6TA 4L5LA 2O8VB 2A4VA 1T7PB 4I2TA 3J7Yk 1PL1A 3TKSC 3PH9A 5IPHA 3GTUA 2WULA 3TRXA 4MJCA 1VF2A 3DWVA 3BCKA 5G30A 3UVHA 4AF2A 2VL3A 1TXXA 1JHBA 1XIYA 3U5RE 3GKXA 2MMZA 1F3AA 1JZOA 5HR0A 1OVNA 5G5EA 5IMFA 1W89A 2H01A 4CHSA 3CTGA 2HZEB 5CNWA 2DSAA 5CRGA 4KAEA 3ZVJD 1AQWA 2HNLA 2XPEA 2WCIA 1URMA 1V40A 4TVEA 4G10A 1K0CA 1PKZA 3LQ7A 5ECIB 1ERVA 2V1MA 1BG5A 1MD3A 4LMWA 5ECNB 1TW9A 4ZXGA 11GSA 1XOAA 4XHMA 4PUAA 3P2AA 2HZFA 3ZFLA 3K8NA 4WKWA 2PBJA 3WT2A 4KX4A 5IO0A 2GDRA 3BD2A 1FOVA 3RDWA 1GP1A 2R2JA 2G2QA 4NAXA 4KE3A 1O8XA 4O5RA 5DALB 3P8WA 4K1FA 4IHUA 4HEA2 2LNTA 2YP6A 1GLQA 2OE3A 4X1UA 1FAAA 5DJMA 1EP8A 2H72A 2IIYA 2NDOA 3G9BA 5CREA 1CQHA 4NWYA 4KUNA 2H76A 5E59A 3LYPA 3GSTA 1K3LA 1M9AA 1V98A 3QAVA 2HI7A 5COHA 4OCEA 4MABA 1ZYEA 3DMLA 5KEJA 4MMMA 3APQA 1OAZA 3NZNA 2GT5A 1JZWA 1QUWA 2JSYA 4J56E 1YY7A 3VWWA 4LL1B 4EDYA 4FYBA 2C3QA 4PX1A 2IMEA 1G0TA 1USBA 4EL1A 1JLVA 5H5RA 2XC2A 4ZL9A 4MA9A 4GF0A 1V2AA 3P7XA 4ZBDA 3HDCA 3QPMA 3APSA 4HQZA 4TXOA 1UN2A 3F0IA 5HR2A 3UEMA 6GSSA 2HZEA 4F9ZA 5G1LA 4IP6A 4WETA 4DVCA 4N0VA 1PSQA 3DEXA 5D9XA 3N9JA 5ECQB 4K7IA 4I97A 3D6IA 1A2LA 3RPPA 4GQCA 2GVPA 6GSWA 3DXBA 3KJYA 3OR5A 1XCCA 3TKSE 3IDVA 3KZQA 5J5NA 3EU3A 1NSWA 4L0UA 2E2MA 3A2VA 5EY6A 3TKRA 5HFGA 4KCAA 3RBTA 2WJUA 4DSQA 3HD5A 2X8HA 2IMFA 2YJ7A 2F8AA 3GV1A 1AQVA 2LSTA 4J2FA 4WXTA 3H4KA 3FZAA 5CAXA 1U88A 2FCHA 3KMOA 4JEDA 4PNFA 2DC5A 3F6FA 2G0FA 2OJLA 4N30A 4IJIA 2F9SA 4ECJA 3GSSA 5DALA 4G2EA 4NV5A 4DSRA 1A23A 4WEYA 2GTUA 2O87A 5HR1A 2I9HA 4ZIJA 1R4WA 3HZ8A 3EWLA 1HNCA 3ERWA 3N5OA 2H0IA 3LWAA 4I8BA 1WP0A 5ELAA 4GSSA 2FWEA 1DE2A 1SKSB 3CMIA 3WD6A 3RPNA 2AHEA 5AISA 1XW9A 3FZ5A 4BVXA 2YCDA 3G7IA 3KP8A 2HE3A 4IELA 3TKPA 2RLIA 5B6MA 4PQ1A 1TK0B 5L71A 3O76A 1EGOA 1PN9A 1GSQA 2YV9A 2M46A 6GSTA 3M1GA 4TKYA 1YKCA 5CYYA 2PGTA 5IMAA 1IYHA 2JL4A 3GNJA 2H66A 1Z6NA 4JU5A 3D22A 1PQNA 4GCIA 2H70A 1K0NA 4DEJA 3S9FA 4WBRD 4FH8A 4KDXA 1WMJA 2FD3A 5CRDA 3KP9A 3TUEA 2FWGA 5D9WA 4XS1A 3WT1A 3L9UA 1ERTA 1TRVA 4X43A 1XZOA 3E3EA 2JACA 2JZRA 3GFKA 2F51A 4PQIA 2LJKA 3ZTLA 4YH2A 1B4PA 2ON5A 4FYCA 3ED3A 3J7Yb 4ZBBA 1G6WA 5AIXA 2LRCA 17GSA 1U3AA 1TRSA 2R3XA 13GSA 2FY6A 3TJBA 3EURA 4MPGA 2DJ2A 3W6GA 2GSQA 3GX0A 4XCSA 3A3TA 2JZTA 3G7JA 4ILFA 4ZB9A 1ERUA 2GSTA 1TP9A 3HA9A 1KEBA 3L9SA 2M72A 2VLUA 2DJJA 4EC0A 3TJJA 4XS6A 1XWAA 2NBSA 4MPFA 3TRQA 3KXOA 2K9FA 1X9WB 5J4UA 4PXOA 3RHCA 4BWQA 1XWBA 2V32A 1T1VA 4L5OA 4HU9A 1GUMA 2IMIA 5IMCA 5F05A 3M3MA 1TTZA 4XIHA 1J08A 3MDKA 4WBJA 2HSHA 3M8NA 4ZB8A 4ISDA 2LQOA 1UC7A 1AIUA 5AIVA 3HKRA 5DBQA 5GAPD 1RW1A 3R2QA 5JCGA 1K0AA 1EOHA 19GSA 2C4JA 5INYA 1X5CA 2QGVA 3ZMKA 1G7OA 3QAWA 3ZIJA 1K0MA 2WDUA 4ZL7A 6GSVA 3GKKA 1BAYA 3KEBA 2B1LA 3UMAA 2CAQA 3EINA 1M2AA 4JR6A 4K2DA 1YQ1A 3QAGA 1M2DA 1PD21 3KIJA 5DJLA 2BJXA 4FIWA 2CVBA 1TRWA 1X9MB 2KUCA 3HCZA 1B9XC 1NM3A 4ECIA 3UJ1A 1GUKA 1RQMA 1VF1A 4H86A 2VM1A 3O3TA 1JZRA 1TJDA 2B6MA 2OBKA 3LYKA 3IBHA 1XBSA 2B7KA 3QFAC 1ZOFA 5F0GA 1QGVA 5GSTA 1SL0B 4N10A 3GN3A 4NPBA 2NVLA 2HLSA 5ID2B 3D21A 2XHFA 5GZZB 4BVYA 3I6AA 2VCZA 3FRCA 3V1WA 2LQQA 3FEUA 3PR8A 1X5DA 3MNGA 1NW2A 1V9WA 2PUKC 3LEFA 4HQSA 5EL8A 2H8LA 5ECLB 1EV4A 1YJ6A 3L78A 3JCML 2VAFA 1EV9A 2IFQB 2MMOA 2OBIA 2GS3A 4MF7A 1FW1A 3FR9A 1SKWB 2HYXA 1K0OA 3A2XA 1U3IA 1FO5A 1I9DA 4F82A 1GWCA 2FLSA 1U6TA 3VLNA 2FWHA 4IVFA 4POMA 2V41A 2ES7A 2PERA 2N5BA 1CQGA 1PGTA 2BMXA 2VOCA 3GX8A 2I4AA 2WRTA 1SL2B 4P3YB 1F9MA 3ZFBA 2HT9A 3LG6A 1I5GA 1PKWA 4OCFA 3GA4A 4GWRA 5D96A 4IKHA 1WRYA 1ZZYA 3VWVA 1A2JA 3SBCA 5ENUA 4QL7A 2PWJA 5J9BA 5H5SA 3VPQA 3F4SA 2IJYA 1DE1A 4EXJA 4FO5A 1ML6A 4ECBA 2LRTA 2VCTA 5G2ZA 2DJ3A 1QFNA 2H1DA 5IO2A 2C0DA 2KLXA 1M99A 3ISOA 2DMMA 1SKRB 2V6KA 1VF3A 3DVWA 1OC3A 2L5OA 2MYGA 4NHZA 2JSZA 2H71A 2N5AA 4IQAA 3GIXA 4MK3A 1XPVA 4TR4A 3NOFA 4MJEA 1MEKA 2WZ9A 5ID2A 1OKTA 1WPIA 4N0ZA 3UVTA 3WYWA 3F8UA 2H6XA 5AN1A 6GSXA 3NIVA 2I1UA 2VUPA 1XVWA 1TU7A 4G9HA 1A8YA 3IC4A 5J41A 2GSSA 2DJKA 5DVBA 3VI7A 1U87A 3MWHA 4KA0A 4ACSA 3KTBA 4KW6A 1O85A 2AB6A 3TDGA 4TR0A 4IQ1A 1BX9A 2PVOC 3FHKA 1K0BA 1FHEA 2B3SA 5AGYA 3TOTA 1SK1A 4NHWA 1M9BA 3ZL5A 1V58A 1YZXA 4D73B 4MH2A 3LXTA 5IMVA 2L4CA 1MDKA 3DD3A 3IA1A 4TR1B 4EE0A 3WGEA 1NHOA 2L59A 1M7TA 1R7HA 5C00A 4HS1A 1O73A 5D73A 4OO4A 3CRUA 1TI1A 1Z5YE 1GTAA 3HY2A 2YN1A 3GUSA 4OFNA 1N2AA 1TK5B 1Z7PA 1GLPA 2H6YA 4K8MA 3IV4A 2GZYA 2C0GA 1SD9A 1GULA 1SD8A 4JR4A 1R5AA 3IOSA 4L8EA 3FW2A 1XVQA 1NHYA 3GHAA 3CTFA 1GL8A 2O85A 1T8EB 1TK8B 2HSYA 1XWKA 4MZCA 3ME8A 4KSMA 5C04A 2VD1A 1FB6A 3ZZXA 4J57E 3UARA 2VCQA 1OE8A 4YQMA 4ZBAA 3ZVJA 4EUYA 4K9ZA 3C8EA 5IPGA 5DQSA 3DKSA 1GTIA 4KH7A 3IRAA 3UOMA 5GAND 1HQOA 2VL2C 1XWGA 1QMVA 2CX3A 5CP1A 4GSNA 4JRRA 2I81A 2X64A 3AY8A 2WB9A 5ECHB 2L57A 3TGZA 1B9YC 3Q6OA 1GTBA 4EDZA 1EOGA 3IAM2 3RHBA 5IMDA 5FT3A 4LMVA 2K8SA 4IN0A 2CX4A 2MMAA 3I43A 1XW5A 1KNGA 1Z6MA 3KMNA 4JZQA 1PX7A 2VM2A 3DGQA 3MAKA 3P90A 4HZ4A 1WWJA 4OO5A 4GSTA 2JZSA 2VLVA 2IL3A 1AW9A 1TDIA 3D0ZA 1J0FA 2HFDA 5HFKA 1X0RA 5CRHA 4MDCA 2OE1A 2H1GA 1XWCA 1YKAA 2R37A 4F03A 3UIWA 1G6YA 3QDNA 4D73A 1QK8A 1O6JA 4MF5A 4BL7A 5A4WA 1AQXA 2MBTA 4TR1A 2RUEA 3CYNA 1LBKA 4NV2A 1OKDA 4EVMA 3GL3A 1XW6A 3IPZA 6GSYA 4KGIA 1B48A 4DSSB 2YWMA 5DCGA 1X9SB 1WJKA 1B8XA 3CXGA 3KCMA 2D2ZA 4POBA 1GNEA 3GURA 3UL3A 5IQYA 3FYGA 2GGTA 5ECSA 5EVOA 2B1KA 1JLWA 2CZ2A 2GSRA 2PPTA 3QR6A 1SYRA 2H0HA 4XRAA 4QL9A 4YQVA 4MP4A 8GSSA 1EP7A 1C72A 2YPMA 4GTUA 4AJ8A 2REMA 3BOAA 12GSA 3W8SA 1YEPA 1YF1A 2YZUA 1XOBA 3ERGA 1T4YA 2R4VA 5EPFA 1PA3A 3LJRA 1MDIA 1QQ2A 3LGCA 5DDLA 2MBSA 3FY7A 4BPYA 1ON4A 1Q4JA 1AAZA 3DIEA 2LUSA 1GSFA 5ECPB 2B7JA 2L5LA 2H6ZA 4ZL8A 4K0NA 4RUVA 2KP2A 4WR4A 4RQXA 4AGSA 1ZYQB 1Q98A 2PN8A 5JWRB 2YZHA 2PMTA 4F0CA 2X8CA 2DIYA 2WFCA 2CVDA 2WGRA 3FR3A 1H4OA 1SL1B 2LNSA 2JADA 5FHIA 5B8AA 4I2UA 3E9JB 3GTUB 1GSDA 3FZ4A 2O7KA 3PGTA 2LJRA 1DSBA 1JZDA 1IYIA 2KHPA 2CZ3A 5IOWA 2ZCTA 2YOIA 1F3BA 1PX6A 2JU5A 5ECMB 16GSA 3GKNA 4DSSA 1H75A 2V6OA 3FKFA 1PRXA 4X0XA 3VURA 1LU4A 4IP1A 4K6XA 3FZ9A 2IN3A 4EKZA 1GTUA 2H1BA 3ZLPA 1E6BA 2MZCA 5E4WA 2YANA 4PQHA 1A0RP 5J3RA 2OE0A 1WE0A 4V2LA 2VIMA 1Y25A 2EIOA 2H1AA 2OA7A 5J9CA 3CRTA 2DJ1A 3GYKA 3IK9A 2GQLA 4AJ7A 3TKQA 3VWXA 2NTOA 2P5RA 2VL2A 2ALBA 1PL2A 20GSA 2VCWA 4L0WA 3VPTA 2Z9SA 3DYRA 4HDEA 1R5PA 2ON7A 4KB3A 9GSSA 2VL9A 2CQ9A 5CO3A 1BJXA 3L0HA 1GSSA 1ZCPA 3HJMA 3ZRDA 5KN2A 1A0FA 1HYUA 2X99A 2YJHA 5H5QA 2GZPA 3TJFA 1VRSD 4CW9A 2B5EA 1F6MC 2L4QA 3HJPA 2DIZA 1YF0A 2LS5A 2AYTA 5JCUA 3TCOA 2R6KA 4POKA 5HQPA 3F3QA 1E2YA 3EMXA 2AV4A 2YNXA 4OFTA 3IK7A 1OYJA 4RI7A 4ID0A 3E0UA 1KBNA 3UBKA 4BA7A 3GH9A 1Z7RA 5D8IA 2A2RA 1ST9A 4HUAA 2F3MA 3KD0A 3Q19A 4ULXA 4ML1A 2GQMA 4Q5RA 4KCEA 1T3BA 2YV7A 1XXUA 1M0UA 4KDUA 5LD0A 2LV3A 1ACVA 5DQYA 4PUFC 4LL4B 4MJAA 1EEMA 2QSIA 3QD9A 2N5FA 3D4MA 3DVXA 4POLA 4Q5QA 1SK0A 1GSYA 4TXOB 3HHVA 2IMKA 3QMXA 1SYXA 1WOUA 4K7NA 5ELGA 1GRXA 1RK4A 5FWGA 3HVXA 1FG4A 5A5KA 5D9TA 3RAZA 1FVKA 3IAS2 1GNWA 4IGJA 3C71A 4ZILA 5A4VA 5LCZA 3A2WA 2C3NA 4K7OA 5ECKB 1WIKA 3M9JA 1KTEA 2P31A 1Y6EA 1SJIA 3HVVA 3FR6A 4TOPA 1S3AA 3LSZA 3VWUA 3IXRA 3CSJA 3QOUA 4Q5NA 3C73A 1FB0A 3APOA 4CDOA 3HZ4A 1ZL9A 1THXA 1BEDA 1S3CA 1S3DA 1K3OA 1F37A 2GLRA 2EIQA 2QKEA 1B4QA 2XBQA 2IFQA 1OE7A 5IMZA 2EIRA 4OD7A 4GLTA 4V1Ag 3LORA 1DUGA 3KM6A 2QC7A 2H0GA 3C7MA 1HD2A 1TOFA 1THOA 5B6NA 2E0QA 1ERWA 10GSA 1O81A 1UA5A 3US3A 3VI5A 3VFIA 3ZMLA 5IIZA 22GSA 3L9VA 2L6CA 1GSUA 1VGLA 5JCWA 18GSA 2LRNA 1ZGNA 4IJ3A 4PNGA 1SU9A 4XS4B 3GKMA 5LNKe 1GUHA
chains in the Genus database with same CATH superfamily
4EO3A 3BJ5A 1FVJA 4LLRA 2ZNMA 4NXIA 1F2EA 2H19A 1EGRA 2KOKA 4XRDA 5BRTA 5KN3A 3CBUA 2LEGA 2OACA 1EZKA 2F8FA 1XG8A 2PU9C 4GXZA 4JE1A 4V2NA 4OFMA 4KDYA 1YEXA 4QQ7A 2QA2A 2VCVA 5B8BA 2FUG2 2J9HA 1J9BA 2CT6A 3IHGA 3KTLA 4E8HA 1GSEA 3KH9A 4YAVA 4ECCA 2TRCP 4ZB6A 2L6DA 2GZZA 3H8QA 2K18A 5ECRB 2VD0A 3WGDA 1A8LA 4NMUA 2LKUA 2YWNA 2FA4A 4LA1A 2YWOA 2FGXA 3Q74A 3BCIA 4MZBA 2VLTA 4F2IA 3A5WA 1Z9HA 3ME7A 4O32A 2IWTA 2C0FA 3LFLA 1MTCA 2RM5A 1XFLA 4MJBA 1A24A 5F06A 2AUVA 2GT6A 2K8VA 3D4TA 1O7UA 3L4NA 5IM9A 4V1Ap 2CA8A 3TOUA 5IOXA 5F8BA 1MDJA 2P5QA 4IBPA 1K0DA 2VCXA 1LJRA 4RI6A 5KN0A 3EVIA 5HR3A 4E8EA 2LTKA 1OC9B 3CSHA 1W4VA 3A5IA 4HJMA 5G31A 5D93A 2H74A 3F6DA 3ZIVA 4ML6A 1HNBA 1AC1A 1TI3A 1AXDA 4AJ6A 2CVKA 2TIRA 3LXZA 5F07A 4TN8A 1V57A 3TRPA 3GL5A 3TJKA 4G19A 5G1KA 2DLXA 3VK9A 5A4UA 1ABAA 1SJZA 5G5FA 4O92A 3C1SA 2FWFA 2VO4A 1DBYA 2ZUPA 4OWYA 5HFIA 4WF4A 2WS2A 2B5XA 4XS4A 4JBBA 2J23A 2K6VA 1T00A 4O7HA 4IW9A 1K3YA 3EC3A 1TRUA 2TRXA 2V2GA 3EU4A 2C1YA 4YQUA 3TKSA 1TKDB 3MSZA 3IC8A 3W8JA 2HXKA 3GMFA 2B5YA 4MH3A 1BQ7A 4K5SA 1Z3EA 4OMVA 2AJQB 4MCUA 2CAIA 3TB2A 3CSIA 2H75A 4XTSA 1EEJA 2KP1A 2PVQA 1OC8A 3EYTA 2BTOT 4N11A 2RIIA 2C3TA 3QCPA 2OADA 4BVYB 3H79A 4PURA 4TRXA 2HRFA 1SENA 3QFBC 3HXSA 4MZWA 4MLYA 3PINA 4WR5A 1SJ6A 3EMPA 2C80A 3IHQA 3KH7A 5DAKB 3TJGA 2M80A 2XPDA 2E7PA 3U6VA 2FHEA 4YAPA 7GSSA 5ABRA 2XBIA 1YDKA 2CV4A 2NPBA 1A2MA 3HVSA 1OC9A 1PMTA 3ERFA 2DJ0A 3IE3A 1UVZA 5CRWA 3GH6A 2H30A 3F4TA 3M9KA 1JFUA 4Q5FA 5GSSA 3D5JA 5JWOB 4YKFA 3BBYA 2R5GA 3ZITA 4G0LA 4V2MA 4IS0A 1G7EA 1X5EA 2E2GA 2C0EA 4HZ2A 1ILOA 4RQRA 2EC4A 4GQFA 3EE2A 4TR3A 4HOJA 6GSUA 1O8WA 4BWSA 14GSA 4WF5A 4F0BA 2X8GA 4FYUA 3GRXA 2X4AA 4KNDA 1MD4A 1VF4A 5KN1A 4Z7XA 5DCHA 4I5QA 5D9VA 3WGXA 3H1NA 4HI7A 3F9UA 4HJ2A 2FNOA 2IMDA 1M2BA 3HYPA 2GQKA 4TW5A 2A2SA 1AUCA 1ZMAA 2AAWA 2O89A 1PN0A 5ECOB 3UAPA 3ZYWA 1R26A 2YWIA 2FA8A 4TXVA 1M3IA 1N8JA 3FK8A 1BYEA 4GRFA 2IPAA 4K5RA 2C8UA 4USSA 2DBCA 3SWLA 4K0GA 2HRNA 3G7YA 3KGKA 2RM6A 3Q18A 3I69A 3H93A 4KSOA 1QXHA 3I9V2 3F63A 5DAKA 3HJOA 2I3YA 4PGTA 4I6XA 1SK2A 3F3RA 2LJAA 1T4ZA 2P0GA 4HU7A 3F4RA 1HNAA 4EIQA 3ZREA 3M0FA 1TU8A 4MF6A 2H73A 1PFOA 1GH2A 5B7CA 2OKAA 2DMLA 3DRNA 3C1RA 3UBLA 1M3JA 1EWXA 4EF0A 2RUFA 5JWQB 3IR4A 2MMNA 3O6TA 4L5LA 2O8VB 2A4VA 1T7PB 4I2TA 3J7Yk 1PL1A 3TKSC 1FOHA 3PH9A 5IPHA 3GTUA 2WULA 3TRXA 4MJCA 1VF2A 3DWVA 3BCKA 5G30A 3UVHA 4AF2A 2VL3A 1TXXA 1JHBA 1XIYA 3U5RE 3GKXA 2MMZA 1F3AA 1JZOA 5HR0A 1OVNA 5G5EA 5IMFA 1W89A 2H01A 4CHSA 3CTGA 2HZEB 5CNWA 2DSAA 5CRGA 4KAEA 3ZVJD 3PPUA 1AQWA 2HNLA 2XPEA 2WCIA 1URMA 1V40A 4TVEA 4G10A 1K0CA 1PKZA 3LQ7A 5ECIB 1ERVA 2V1MA 1BG5A 1MD3A 4LMWA 5ECNB 1TW9A 4ZXGA 11GSA 1XOAA 4XHMA 4PUAA 3P2AA 2HZFA 4FQUA 3ZFLA 3K8NA 4WKWA 2PBJA 3WT2A 4KX4A 5IO0A 2GDRA 3BD2A 1FOVA 3RDWA 1GP1A 4ICYA 2R2JA 2G2QA 4NAXA 4KE3A 1O8XA 4O5RA 5DALB 3P8WA 4K1FA 3EPTA 4IHUA 4HEA2 2LNTA 2YP6A 1GLQA 2OE3A 4X1UA 1FAAA 5DJMA 1EP8A 2H72A 2IIYA 2NDOA 3G9BA 5CREA 1CQHA 4NWYA 4KUNA 2H76A 5E59A 3LYPA 3GSTA 1K3LA 1M9AA 1V98A 3QAVA 2HI7A 4BVXB 5COHA 4OCEA 4MABA 1ZYEA 3DMLA 5KEJA 4MMMA 3APQA 1OAZA 3NZNA 2GT5A 1JZWA 1QUWA 2JSYA 4J56E 1YY7A 3VWWA 4LL1B 4EDYA 4FYBA 2C3QA 4PX1A 4MNNA 2IMEA 1G0TA 1USBA 4EL1A 1JLVA 5H5RA 2XC2A 4ZL9A 4MA9A 4GF0A 1V2AA 2A2PA 3P7XA 4ZBDA 3HDCA 3QPMA 3APSA 4HQZA 4TXOA 1UN2A 3F0IA 5HR2A 3UEMA 6GSSA 2HZEA 4F9ZA 5G1LA 4IP6A 4WETA 4DVCA 4N0VA 1PSQA 3DEXA 5D9XA 5KOWA 3N9JA 5ECQB 4K7IA 4I97A 3D6IA 1A2LA 3RPPA 4GQCA 2GVPA 6GSWA 3DXBA 3KJYA 3OR5A 1XCCA 3TKSE 3IDVA 3KZQA 5J5NA 3EU3A 1NSWA 4L0UA 2E2MA 3A2VA 5EY6A 3TKRA 5HFGA 4KCAA 3RBTA 2WJUA 4DSQA 3HD5A 2X8HA 2IMFA 2YJ7A 2F8AA 3GV1A 1AQVA 2LSTA 4J2FA 4WXTA 4YKGA 3H4KA 3FZAA 5CAXA 1U88A 2FCHA 3KMOA 4JEDA 4PNFA 4X4JA 2DC5A 3F6FA 2G0FA 2OJLA 4N30A 4IJIA 2F9SA 4ECJA 3GSSA 5DALA 4G2EA 4NV5A 4DSRA 1A23A 4WEYA 2GTUA 2O87A 5HR1A 2I9HA 4ZIJA 1R4WA 3HZ8A 3EWLA 1HNCA 3ERWA 3N5OA 2H0IA 3LWAA 4I8BA 1WP0A 5ELAA 4GSSA 2FWEA 1DE2A 1SKSB 3CMIA 3WD6A 3RPNA 2AHEA 5AISA 1XW9A 2HRAA 3FZ5A 4BVXA 2YCDA 3G7IA 3KP8A 2HE3A 4IELA 3TKPA 2RLIA 5B6MA 4PQ1A 1TK0B 5L71A 3O76A 1EGOA 1PN9A 1GSQA 2YV9A 2M46A 6GSTA 3M1GA 4TKYA 2R0GA 1YKCA 5CYYA 2PGTA 5IMAA 1IYHA 2JL4A 3GNJA 2H66A 1Z6NA 4JU5A 3D22A 1PQNA 4GCIA 2H70A 1K0NA 4DEJA 3S9FA 4WBRD 4FH8A 4KDXA 1WMJA 2FD3A 5CRDA 3KP9A 3TUEA 2FWGA 5D9WA 4XS1A 3WT1A 3L9UA 1ERTA 1TRVA 4X43A 1XZOA 3HVNA 3E3EA 2JACA 2JZRA 3GFKA 2F51A 4PQIA 2LJKA 3ZTLA 4YH2A 1B4PA 2ON5A 4FYCA 3ED3A 3J7Yb 4ZBBA 1G6WA 5AIXA 2LRCA 17GSA 1U3AA 1TRSA 2R3XA 13GSA 2FY6A 3TJBA 2X49A 3EURA 4MPGA 2DJ2A 3W6GA 2GSQA 3GX0A 4XCSA 3A3TA 2JZTA 3G7JA 4ILFA 4ZB9A 1ERUA 2GSTA 1TP9A 3HA9A 1KEBA 3L9SA 2M72A 2VLUA 2HRKA 2DJJA 4EC0A 3TJJA 4XS6A 1XWAA 2NBSA 4MPFA 3TRQA 3KXOA 2K9FA 1X9WB 5J4UA 4PXOA 4O5UA 3RHCA 4BWQA 1XWBA 2V32A 1T1VA 4L5OA 4HU9A 1GUMA 2IMIA 5IMCA 5F05A 3M3MA 1TTZA 4XIHA 1J08A 3MDKA 4WBJA 2HSHA 3M8NA 4ZB8A 4ISDA 2LQOA 4BIKA 2HSMA 1UC7A 1AIUA 5AIVA 3HKRA 5DBQA 5GAPD 1RW1A 3R2QA 5JCGA 1K0AA 1EOHA 19GSA 2C4JA 5INYA 1X5CA 2QGVA 3ZMKA 1G7OA 3QAWA 3ZIJA 1K0MA 2WDUA 4A5PA 4ZL7A 6GSVA 3GKKA 1BAYA 3KEBA 2B1LA 3UMAA 2CAQA 3EINA 1M2AA 4JR6A 4K2DA 1YQ1A 3QAGA 1M2DA 1PD21 3KIJA 5DJLA 2BJXA 4FIWA 2CVBA 1TRWA 1X9MB 2KUCA 3HCZA 1B9XC 3MYDA 1NM3A 4ECIA 3UJ1A 1GUKA 1RQMA 1VF1A 4H86A 2VM1A 3O3TA 1JZRA 1TJDA 2B6MA 2OBKA 3LYKA 3IBHA 1XBSA 2B7KA 3QFAC 1ZOFA 5F0GA 1QGVA 5GSTA 1SL0B 4N10A 3GN3A 4NPBA 2NVLA 2HLSA 5ID2B 3D21A 2QA1A 2XHFA 5GZZB 4BVYA 3I6AA 2VCZA 3FRCA 3V1WA 2LQQA 3FEUA 3PR8A 1X5DA 3MNGA 1NW2A 1V9WA 2PUKC 3LEFA 4HQSA 5EL8A 2H8LA 5ECLB 1EV4A 1YJ6A 3L78A 3JCML 2VAFA 1EV9A 4PTSA 2IFQB 2MMOA 2OBIA 2GS3A 4MF7A 3R3EA 1FW1A 3FR9A 1SKWB 2HYXA 1K0OA 3A2XA 2DKHA 1U3IA 1FO5A 1I9DA 4F82A 1GWCA 2FLSA 1U6TA 3VLNA 2FWHA 4IVFA 4POMA 2V41A 2ES7A 2PERA 2N5BA 1CQGA 1PGTA 2BMXA 2VOCA 3GX8A 2I4AA 2WRTA 1SL2B 4P3YB 1F9MA 3ZFBA 2HT9A 3LG6A 1I5GA 1PKWA 4OCFA 3GA4A 4GWRA 5D96A 4IKHA 1WRYA 1ZZYA 3VWVA 1A2JA 3SBCA 5ENUA 4QL7A 4EIPA 2PWJA 5J9BA 5H5SA 3VPQA 5BMUA 3F4SA 2IJYA 1DE1A 4EXJA 4FO5A 1ML6A 4ECBA 2LRTA 2VCTA 5G2ZA 2DJ3A 1QFNA 2H1DA 5IO2A 2C0DA 2KLXA 1M99A 3ISOA 2DMMA 1SKRB 2V6KA 1VF3A 3DVWA 1OC3A 2L5OA 2MYGA 4NHZA 2JSZA 2H71A 2N5AA 4IQAA 3GIXA 4MK3A 1XPVA 4TR4A 3NOFA 4MJEA 1MEKA 2WZ9A 5ID2A 1OKTA 1WPIA 4N0ZA 3UVTA 3WYWA 3F8UA 2H6XA 5AN1A 6GSXA 3NIVA 2I1UA 2VUPA 1XVWA 1TU7A 4G9HA 1A8YA 3IC4A 5J41A 4HSCX 2GSSA 2DJKA 5DVBA 3VI7A 1U87A 3MWHA 4KA0A 4ACSA 3KTBA 4KW6A 1O85A 2AB6A 3TDGA 4TR0A 4IQ1A 1BX9A 2PVOC 3FHKA 1K0BA 1FHEA 2B3SA 5AGYA 3TOTA 1SK1A 4NHWA 1M9BA 2R0PA 3ZL5A 1V58A 1YZXA 4D73B 4MH2A 3LXTA 4BL7B 5IMVA 2L4CA 1MDKA 3DD3A 3IA1A 4TR1B 4EE0A 3WGEA 1NHOA 2L59A 1M7TA 1R7HA 5C00A 4HS1A 1O73A 5D73A 4OO4A 3CRUA 1TI1A 1Z5YE 4G0KA 1GTAA 3HY2A 2YN1A 3GUSA 4OFNA 1N2AA 1TK5B 1Z7PA 1GLPA 2H6YA 4K8MA 1ZYPA 3IV4A 2GZYA 2C0GA 1SD9A 1GULA 1SD8A 4JR4A 1R5AA 3IOSA 4L8EA 3FW2A 1XVQA 1NHYA 3GHAA 3CTFA 1GL8A 2O85A 1T8EB 1TK8B 2HSYA 1XWKA 4MZCA 3ME8A 4KSMA 5C04A 2VD1A 1FB6A 3ZZXA 4J57E 3UARA 2VCQA 1OE8A 4YQMA 4ZBAA 3ZVJA 4EUYA 4K9ZA 3C8EA 5IPGA 5DQSA 3DKSA 1GTIA 4KH7A 3IRAA 3UOMA 5GAND 1HQOA 2VL2C 1XWGA 1QMVA 2CX3A 5CP1A 4GSNA 4JRRA 2I81A 2X64A 3AY8A 2WB9A 5ECHB 2L57A 3TGZA 1B9YC 3Q6OA 1GTBA 4EDZA 1EOGA 3IAM2 3RHBA 5IMDA 5FT3A 4LMVA 2K8SA 4IN0A 2CX4A 3MIXA 2MMAA 3I43A 1XW5A 1KNGA 1Z6MA 3KMNA 4JZQA 1PX7A 2VM2A 3DGQA 3MAKA 3P90A 4HZ4A 1WWJA 4Z2UA 4OO5A 4GSTA 2JZSA 2VLVA 2IL3A 1AW9A 1TDIA 3D0ZA 1J0FA 2HFDA 5HFKA 1X0RA 5CRHA 4MDCA 2OE1A 2H1GA 1XWCA 5KOXA 1YKAA 2R37A 4F03A 3UIWA 1G6YA 3QDNA 4D73A 1QK8A 1O6JA 4MF5A 4BL7A 5A4WA 1AQXA 2MBTA 4TR1A 2RUEA 3CYNA 1LBKA 4NV2A 1OKDA 4EVMA 3GL3A 1XW6A 3IPZA 6GSYA 4KGIA 1B48A 4DSSB 2YWMA 5DCGA 1X9SB 1WJKA 1B8XA 3CXGA 3KCMA 2D2ZA 4POBA 1GNEA 3GURA 3UL3A 5IQYA 3FYGA 2GGTA 5ECSA 5EVOA 2B1KA 1JLWA 2CZ2A 2GSRA 2PPTA 3QR6A 4O5QA 1SYRA 2H0HA 4XRAA 4QL9A 4YQVA 4MP4A 8GSSA 2UZ8A 1EP7A 1C72A 2YPMA 4GTUA 4AJ8A 2REMA 3BOAA 12GSA 3W8SA 1YEPA 1YF1A 2YZUA 1XOBA 3ERGA 1T4YA 2R4VA 5EPFA 1PA3A 3LJRA 1MDIA 1QQ2A 3LGCA 5DDLA 2MBSA 3FY7A 4BPYA 1ON4A 1Q4JA 1AAZA 1ZYNA 3DIEA 2LUSA 1GSFA 5ECPB 2B7JA 2L5LA 2H6ZA 4ZL8A 4K0NA 4RUVA 4KF9A 2KP2A 4WR4A 4RQXA 4AGSA 1ZYQB 1Q98A 2PN8A 5JWRB 2YZHA 2PMTA 4F0CA 2X8CA 2DIYA 2WFCA 2CVDA 2WGRA 3FR3A 1H4OA 1SL1B 2LNSA 2JADA 5FHIA 5B8AA 4I2UA 3E9JB 3GTUB 1GSDA 3FZ4A 2O7KA 3PGTA 2LJRA 1DSBA 1JZDA 1IYIA 2KHPA 2CZ3A 5IOWA 2ZCTA 2YOIA 1F3BA 1PX6A 2JU5A 5ECMB 16GSA 3GKNA 4DSSA 1H75A 2V6OA 3FKFA 1PRXA 4X0XA 4CY6A 3VURA 1LU4A 4IP1A 4K6XA 3FZ9A 2IN3A 4EKZA 1GTUA 2H1BA 2R0CA 3ZLPA 1E6BA 2MZCA 2A4HA 5E4WA 2YANA 4PQHA 1A0RP 3FMWA 5J3RA 2OE0A 1WE0A 4V2LA 2VIMA 1Y25A 2EIOA 2H1AA 2OA7A 5J9CA 3CRTA 2DJ1A 3GYKA 3IK9A 2GQLA 4AJ7A 3TKQA 3VWXA 2NTOA 2P5RA 2VL2A 2ALBA 1PL2A 20GSA 2VCWA 4L0WA 3VPTA 2Z9SA 3DYRA 4HDEA 1R5PA 2ON7A 4KB3A 9GSSA 2VL9A 2CQ9A 5CO3A 1BJXA 3L0HA 1GSSA 2DKIA 1ZCPA 3HJMA 3ZRDA 5KN2A 1A0FA 1HYUA 2X99A 2YJHA 5H5QA 2GZPA 3TJFA 1VRSD 4CW9A 2B5EA 1F6MC 2L4QA 3HJPA 3LW9A 2DIZA 1YF0A 2LS5A 2AYTA 5JCUA 3TCOA 2R6KA 4POKA 5HQPA 3F3QA 1E2YA 3EMXA 2AV4A 2YNXA 4OFTA 3IK7A 1OYJA 4RI7A 4ID0A 3E0UA 4K2XA 1KBNA 3UBKA 4BA7A 3GH9A 1Z7RA 5D8IA 2A2RA 1ST9A 4HUAA 2F3MA 3KD0A 3Q19A 4ULXA 4ML1A 2GQMA 4Q5RA 4KCEA 1T3BA 2YV7A 1XXUA 1M0UA 4KDUA 5LD0A 2LV3A 1ACVA 4PUFC 5DQYA 4LL4B 4MJAA 1EEMA 2QSIA 3QD9A 2N5FA 3D4MA 3DVXA 4POLA 4Q5QA 1SK0A 1GSYA 4TXOB 3HHVA 2IMKA 3QMXA 1SYXA 4CY8A 1WOUA 4K7NA 5ELGA 1GRXA 1RK4A 3CQFA 5FWGA 3HVXA 1FG4A 5A5KA 5D9TA 3RAZA 1FVKA 3IAS2 1GNWA 4IGJA 3C71A 4ZILA 5A4VA 5LCZA 3A2WA 2C3NA 4K7OA 5ECKB 1WIKA 3M9JA 1KTEA 2P31A 1Y6EA 1SJIA 3HVVA 3FR6A 4TOPA 1S3AA 3LSZA 3VWUA 3IXRA 3CSJA 3QOUA 4Q5NA 3C73A 4Z2TA 1FB0A 3APOA 4CDOA 3HZ4A 1ZL9A 1THXA 1BEDA 1S3CA 1S3DA 1K3OA 1F37A 2GLRA 2EIQA 2QKEA 1B4QA 2XBQA 4Z2RA 2IFQA 1OE7A 5IMZA 1S3RA 2EIRA 4OD7A 4GLTA 4V1Ag 3LORA 1DUGA 3KM6A 4G0IA 2QC7A 2H0GA 3C7MA 1HD2A 1TOFA 1THOA 5B6NA 2E0QA 1ERWA 10GSA 1O81A 1UA5A 3US3A 3VI5A 3VFIA 3ZMLA 5IIZA 22GSA 3L9VA 2L6CA 1GSUA 1VGLA 5JCWA 18GSA 2LRNA 1ZGNA 4IJ3A 4PNGA 1SU9A 4XS4B 3GKMA 5LNKe 1GUHA
chains in the Genus database with same CATH topology
4EO3A 3BJ5A 1FVJA 4LLRA 2ZNMA 4NXIA 1F2EA 2H19A 1EGRA 2KOKA 4XRDA 5BRTA 5KN3A 3CBUA 2LEGA 2OACA 1EZKA 2F8FA 2PU9C 4GXZA 4JE1A 4V2NA 4OFMA 4KDYA 1YEXA 4QQ7A 2QA2A 2VCVA 5B8BA 2FUG2 2J9HA 1J9BA 2CT6A 3IHGA 3KTLA 4E8HA 1GSEA 3KH9A 4YAVA 4ECCA 2TRCP 4ZB6A 2L6DA 2GZZA 3H8QA 2K18A 5ECRB 2VD0A 3WGDA 1A8LA 4NMUA 2LKUA 2YWNA 2FA4A 4LA1A 2YWOA 2FGXA 3Q74A 3BCIA 4MZBA 2VLTA 4F2IA 3A5WA 1Z9HA 3ME7A 4O32A 2IWTA 2C0FA 3LFLA 1MTCA 2RM5A 1XFLA 4MJBA 1A24A 5F06A 2AUVA 2GT6A 2K8VA 3D4TA 1O7UA 3L4NA 5IM9A 4V1Ap 2CA8A 3TOUA 5IOXA 5F8BA 1MDJA 2P5QA 4IBPA 1K0DA 2VCXA 1LJRA 4RI6A 5KN0A 3EVIA 5HR3A 4E8EA 2LTKA 1OC9B 3CSHA 1W4VA 3A5IA 4HJMA 5G31A 5D93A 2H74A 3F6DA 3ZIVA 4ML6A 1HNBA 1AC1A 1TI3A 1AXDA 4AJ6A 2CVKA 2TIRA 3LXZA 5F07A 4TN8A 1V57A 3TRPA 3GL5A 3TJKA 4G19A 5G1KA 2DLXA 3VK9A 5A4UA 1ABAA 1SJZA 5G5FA 4O92A 3C1SA 2FWFA 2VO4A 1DBYA 2ZUPA 4OWYA 5HFIA 4WF4A 2WS2A 2B5XA 4XS4A 4JBBA 2J23A 2K6VA 1T00A 4O7HA 4IW9A 1K3YA 3EC3A 1TRUA 2TRXA 2V2GA 3EU4A 2C1YA 4YQUA 3TKSA 1TKDB 3MSZA 3IC8A 3W8JA 2HXKA 3GMFA 2B5YA 4MH3A 1BQ7A 4K5SA 1Z3EA 4OMVA 2AJQB 4MCUA 2CAIA 3TB2A 3CSIA 2H75A 4XTSA 1EEJA 2KP1A 2PVQA 1OC8A 3EYTA 2BTOT 4N11A 2RIIA 2C3TA 3QCPA 2OADA 4BVYB 3H79A 4PURA 4TRXA 2HRFA 1SENA 3QFBC 3HXSA 4MZWA 4MLYA 3PINA 4WR5A 1SJ6A 3EMPA 2C80A 3IHQA 3KH7A 5DAKB 3TJGA 2M80A 2XPDA 2E7PA 3U6VA 2FHEA 4YAPA 7GSSA 5ABRA 2XBIA 1YDKA 2CV4A 2NPBA 1A2MA 3HVSA 1OC9A 1PMTA 3ERFA 2DJ0A 3IE3A 1UVZA 5CRWA 3GH6A 2H30A 3F4TA 3M9KA 1JFUA 4Q5FA 5GSSA 3D5JA 5JWOB 4YKFA 3BBYA 2R5GA 3ZITA 4G0LA 4V2MA 4IS0A 1G7EA 1X5EA 2E2GA 2C0EA 4HZ2A 1ILOA 4RQRA 2EC4A 4GQFA 3EE2A 4TR3A 4HOJA 6GSUA 1O8WA 4BWSA 14GSA 4WF5A 4F0BA 2X8GA 4FYUA 3GRXA 2X4AA 4KNDA 1MD4A 1VF4A 5KN1A 4Z7XA 5DCHA 4I5QA 5D9VA 3WGXA 3H1NA 4HI7A 3F9UA 4HJ2A 2FNOA 2IMDA 1M2BA 3HYPA 2GQKA 4TW5A 2A2SA 1AUCA 1ZMAA 2AAWA 2O89A 1PN0A 5ECOB 3UAPA 3ZYWA 1R26A 2YWIA 2FA8A 4TXVA 1N8JA 3FK8A 1BYEA 4GRFA 2IPAA 4K5RA 2C8UA 4USSA 2DBCA 3SWLA 4K0GA 2HRNA 3G7YA 3KGKA 2RM6A 3Q18A 3I69A 3H93A 4KSOA 1QXHA 3I9V2 3F63A 5DAKA 3HJOA 2I3YA 4PGTA 4I6XA 1SK2A 3F3RA 2LJAA 1T4ZA 2P0GA 4HU7A 3F4RA 1HNAA 4EIQA 3ZREA 3M0FA 1TU8A 4MF6A 2H73A 1GH2A 5B7CA 2OKAA 2DMLA 3DRNA 3C1RA 3UBLA 1EWXA 4EF0A 2RUFA 5JWQB 3IR4A 2MMNA 3O6TA 4L5LA 2O8VB 2A4VA 1T7PB 4I2TA 3J7Yk 1PL1A 3TKSC 1FOHA 3PH9A 5IPHA 3GTUA 2WULA 3TRXA 4MJCA 1VF2A 3DWVA 3BCKA 5G30A 3UVHA 4AF2A 2VL3A 1TXXA 1JHBA 1XIYA 3U5RE 3GKXA 2MMZA 1F3AA 1JZOA 5HR0A 1OVNA 5G5EA 5IMFA 1W89A 2H01A 4CHSA 3CTGA 2HZEB 5CNWA 2DSAA 5CRGA 4KAEA 3ZVJD 3PPUA 1AQWA 2HNLA 2XPEA 2WCIA 1URMA 1V40A 4TVEA 4G10A 1K0CA 1PKZA 3LQ7A 5ECIB 1ERVA 2V1MA 1BG5A 1MD3A 4LMWA 5ECNB 1TW9A 4ZXGA 11GSA 1XOAA 4XHMA 4PUAA 3P2AA 2HZFA 4FQUA 3ZFLA 3K8NA 4WKWA 2PBJA 3WT2A 4KX4A 5IO0A 2GDRA 3BD2A 1FOVA 3RDWA 1GP1A 4ICYA 2R2JA 2G2QA 4NAXA 4KE3A 1O8XA 4O5RA 5DALB 3P8WA 4K1FA 3EPTA 4IHUA 4HEA2 2LNTA 2YP6A 1GLQA 2OE3A 4X1UA 1FAAA 5DJMA 1EP8A 2H72A 2IIYA 2NDOA 3G9BA 5CREA 1CQHA 4NWYA 4KUNA 2H76A 5E59A 3LYPA 3GSTA 1K3LA 1M9AA 1V98A 3QAVA 2HI7A 4BVXB 5COHA 4OCEA 4MABA 1ZYEA 3DMLA 5KEJA 4MMMA 3APQA 1OAZA 3NZNA 2GT5A 1JZWA 1QUWA 2JSYA 4J56E 1YY7A 3VWWA 4LL1B 4EDYA 4FYBA 2C3QA 4PX1A 4MNNA 2IMEA 1G0TA 1USBA 4EL1A 1JLVA 5H5RA 2XC2A 4ZL9A 4MA9A 4GF0A 1V2AA 2A2PA 3P7XA 4ZBDA 3HDCA 3QPMA 3APSA 4HQZA 4TXOA 1UN2A 3F0IA 5HR2A 3UEMA 6GSSA 2HZEA 4F9ZA 5G1LA 4IP6A 4WETA 4DVCA 4N0VA 1PSQA 3DEXA 5D9XA 5KOWA 3N9JA 5ECQB 4K7IA 4I97A 3D6IA 1A2LA 3RPPA 4GQCA 2GVPA 6GSWA 3DXBA 3KJYA 3OR5A 1XCCA 3TKSE 3IDVA 3KZQA 5J5NA 3EU3A 1NSWA 4L0UA 2E2MA 3A2VA 5EY6A 3TKRA 5HFGA 4KCAA 3RBTA 2WJUA 4DSQA 3HD5A 2X8HA 2IMFA 2YJ7A 2F8AA 3GV1A 1AQVA 2LSTA 4J2FA 4WXTA 4YKGA 3H4KA 3FZAA 5CAXA 1U88A 2FCHA 3KMOA 4JEDA 4PNFA 4X4JA 2DC5A 3F6FA 2G0FA 2OJLA 4N30A 4IJIA 2F9SA 4ECJA 3GSSA 5DALA 4G2EA 4NV5A 4DSRA 1A23A 4WEYA 2GTUA 2O87A 5HR1A 2I9HA 4ZIJA 1R4WA 3HZ8A 3EWLA 1HNCA 3ERWA 3N5OA 2H0IA 3LWAA 4I8BA 1WP0A 5ELAA 4GSSA 2FWEA 1DE2A 1SKSB 3CMIA 3WD6A 3RPNA 2AHEA 5AISA 1XW9A 2HRAA 3FZ5A 4BVXA 2YCDA 3G7IA 3KP8A 2HE3A 4IELA 3TKPA 2RLIA 5B6MA 4PQ1A 1TK0B 5L71A 3O76A 1EGOA 1PN9A 1GSQA 2YV9A 2M46A 6GSTA 3M1GA 4TKYA 2R0GA 1YKCA 5CYYA 2PGTA 5IMAA 1IYHA 2JL4A 3GNJA 2H66A 1Z6NA 4JU5A 3D22A 1PQNA 4GCIA 2H70A 1K0NA 4DEJA 3S9FA 4WBRD 4FH8A 4KDXA 1WMJA 2FD3A 5CRDA 3KP9A 3TUEA 2FWGA 5D9WA 4XS1A 3WT1A 3L9UA 1ERTA 1TRVA 4X43A 1XZOA 3E3EA 2JACA 2JZRA 3GFKA 2F51A 4PQIA 2LJKA 3ZTLA 4YH2A 1B4PA 2ON5A 4FYCA 3ED3A 3J7Yb 4ZBBA 1G6WA 5AIXA 2LRCA 17GSA 1U3AA 1TRSA 2R3XA 13GSA 2FY6A 3TJBA 2X49A 3EURA 4MPGA 2DJ2A 3W6GA 2GSQA 3GX0A 4XCSA 3A3TA 2JZTA 3G7JA 4ILFA 4ZB9A 1ERUA 2GSTA 1TP9A 3HA9A 1KEBA 3L9SA 2M72A 2VLUA 2HRKA 2DJJA 4EC0A 3TJJA 4XS6A 1XWAA 2NBSA 4MPFA 3TRQA 3KXOA 2K9FA 1X9WB 5J4UA 4PXOA 4O5UA 3RHCA 4BWQA 1XWBA 2V32A 1T1VA 4L5OA 4HU9A 1GUMA 2IMIA 5IMCA 5F05A 3M3MA 1TTZA 4XIHA 1J08A 3MDKA 4WBJA 2HSHA 3M8NA 4ZB8A 4ISDA 2LQOA 2HSMA 1UC7A 1AIUA 5AIVA 3HKRA 5DBQA 5GAPD 1RW1A 3R2QA 5JCGA 1K0AA 1EOHA 19GSA 2C4JA 5INYA 1X5CA 2QGVA 3ZMKA 1G7OA 3QAWA 3ZIJA 1K0MA 2WDUA 4A5PA 4ZL7A 6GSVA 3GKKA 1BAYA 3KEBA 2B1LA 3UMAA 2CAQA 3EINA 1M2AA 4JR6A 4K2DA 1YQ1A 3QAGA 1M2DA 1PD21 3KIJA 5DJLA 2BJXA 4FIWA 2CVBA 1TRWA 1X9MB 2KUCA 3HCZA 1B9XC 3MYDA 1NM3A 4ECIA 3UJ1A 1GUKA 1RQMA 1VF1A 4H86A 2VM1A 3O3TA 1JZRA 1TJDA 2B6MA 2OBKA 3LYKA 3IBHA 1XBSA 2B7KA 3QFAC 1ZOFA 5F0GA 1QGVA 5GSTA 1SL0B 4N10A 3GN3A 4NPBA 2NVLA 2HLSA 5ID2B 3D21A 2QA1A 2XHFA 5GZZB 4BVYA 3I6AA 2VCZA 3FRCA 3V1WA 2LQQA 3FEUA 3PR8A 1X5DA 3MNGA 1NW2A 1V9WA 2PUKC 3LEFA 4HQSA 5EL8A 2H8LA 5ECLB 1EV4A 1YJ6A 3L78A 3JCML 2VAFA 1EV9A 4PTSA 2IFQB 2MMOA 2OBIA 2GS3A 4MF7A 3R3EA 1FW1A 3FR9A 1SKWB 2HYXA 1K0OA 3A2XA 2DKHA 1U3IA 1FO5A 1I9DA 4F82A 1GWCA 2FLSA 1U6TA 3VLNA 2FWHA 4IVFA 4POMA 2V41A 2ES7A 2PERA 2N5BA 1CQGA 1PGTA 2BMXA 2VOCA 3GX8A 2I4AA 2WRTA 1SL2B 4P3YB 1F9MA 3ZFBA 2HT9A 3LG6A 1I5GA 1PKWA 4OCFA 3GA4A 4GWRA 5D96A 4IKHA 1WRYA 1ZZYA 3VWVA 1A2JA 3SBCA 5ENUA 4QL7A 4EIPA 2PWJA 5J9BA 5H5SA 3VPQA 5BMUA 3F4SA 2IJYA 1DE1A 4EXJA 4FO5A 1ML6A 4ECBA 2LRTA 2VCTA 5G2ZA 2DJ3A 1QFNA 2H1DA 5IO2A 2C0DA 2KLXA 1M99A 3ISOA 2DMMA 1SKRB 2V6KA 1VF3A 3DVWA 1OC3A 2L5OA 2MYGA 4NHZA 2JSZA 2H71A 2N5AA 4IQAA 3GIXA 4MK3A 1XPVA 4TR4A 3NOFA 4MJEA 1MEKA 2WZ9A 5ID2A 1OKTA 1WPIA 4N0ZA 3UVTA 3WYWA 3F8UA 2H6XA 5AN1A 6GSXA 3NIVA 2I1UA 2VUPA 1XVWA 1TU7A 4G9HA 1A8YA 3IC4A 5J41A 2GSSA 2DJKA 5DVBA 3VI7A 1U87A 3MWHA 4KA0A 4ACSA 3KTBA 4KW6A 1O85A 2AB6A 3TDGA 4TR0A 4IQ1A 1BX9A 2PVOC 3FHKA 1K0BA 1FHEA 2B3SA 5AGYA 3TOTA 1SK1A 4NHWA 1M9BA 2R0PA 3ZL5A 1V58A 1YZXA 4D73B 4MH2A 3LXTA 4BL7B 5IMVA 2L4CA 1MDKA 3DD3A 3IA1A 4TR1B 4EE0A 3WGEA 1NHOA 2L59A 1M7TA 1R7HA 5C00A 4HS1A 1O73A 5D73A 4OO4A 3CRUA 1TI1A 1Z5YE 4G0KA 1GTAA 3HY2A 2YN1A 3GUSA 4OFNA 1N2AA 1TK5B 1Z7PA 1GLPA 2H6YA 4K8MA 1ZYPA 3IV4A 2GZYA 2C0GA 1SD9A 1GULA 1SD8A 4JR4A 1R5AA 3IOSA 4L8EA 3FW2A 1XVQA 1NHYA 3GHAA 3CTFA 1GL8A 2O85A 1T8EB 1TK8B 2HSYA 1XWKA 4MZCA 3ME8A 4KSMA 5C04A 2VD1A 1FB6A 3ZZXA 4J57E 3UARA 2VCQA 1OE8A 4YQMA 4ZBAA 3ZVJA 4EUYA 4K9ZA 3C8EA 5IPGA 5DQSA 3DKSA 1GTIA 4KH7A 3IRAA 3UOMA 5GAND 1HQOA 2VL2C 1XWGA 1QMVA 2CX3A 5CP1A 4GSNA 4JRRA 2I81A 2X64A 3AY8A 2WB9A 5ECHB 2L57A 3TGZA 1B9YC 3Q6OA 1GTBA 4EDZA 1EOGA 3IAM2 3RHBA 5IMDA 5FT3A 4LMVA 2K8SA 4IN0A 2CX4A 3MIXA 2MMAA 3I43A 1XW5A 1KNGA 1Z6MA 3KMNA 4JZQA 1PX7A 2VM2A 3DGQA 3MAKA 3P90A 4HZ4A 1WWJA 4Z2UA 4OO5A 4GSTA 2JZSA 2VLVA 2IL3A 1AW9A 1TDIA 3D0ZA 1J0FA 2HFDA 5HFKA 1X0RA 5CRHA 4MDCA 2OE1A 2H1GA 1XWCA 5KOXA 1YKAA 2R37A 4F03A 3UIWA 1G6YA 3QDNA 4D73A 1QK8A 1O6JA 4MF5A 4BL7A 5A4WA 1AQXA 2MBTA 4TR1A 2RUEA 3CYNA 1LBKA 4NV2A 1OKDA 4EVMA 3GL3A 1XW6A 3IPZA 6GSYA 4KGIA 1B48A 4DSSB 2YWMA 5DCGA 1X9SB 1WJKA 1B8XA 3CXGA 3KCMA 2D2ZA 4POBA 1GNEA 3GURA 3UL3A 5IQYA 3FYGA 2GGTA 5ECSA 5EVOA 2B1KA 1JLWA 2CZ2A 2GSRA 2PPTA 3QR6A 4O5QA 1SYRA 2H0HA 4XRAA 4QL9A 4YQVA 4MP4A 8GSSA 2UZ8A 1EP7A 1C72A 2YPMA 4GTUA 4AJ8A 2REMA 3BOAA 12GSA 3W8SA 1YEPA 1YF1A 2YZUA 1XOBA 3ERGA 1T4YA 2R4VA 5EPFA 1PA3A 3LJRA 1MDIA 1QQ2A 3LGCA 5DDLA 2MBSA 3FY7A 4BPYA 1ON4A 1Q4JA 1AAZA 1ZYNA 3DIEA 2LUSA 1GSFA 5ECPB 2B7JA 2L5LA 2H6ZA 4ZL8A 4K0NA 4RUVA 4KF9A 2KP2A 4WR4A 4RQXA 4AGSA 1ZYQB 1Q98A 2PN8A 5JWRB 2YZHA 2PMTA 4F0CA 2X8CA 2DIYA 2WFCA 2CVDA 2WGRA 3FR3A 1H4OA 1SL1B 2LNSA 2JADA 5FHIA 5B8AA 4I2UA 3E9JB 3GTUB 1GSDA 3FZ4A 2O7KA 3PGTA 2LJRA 1DSBA 1JZDA 1IYIA 2KHPA 2CZ3A 5IOWA 2ZCTA 2YOIA 1F3BA 1PX6A 2JU5A 5ECMB 16GSA 3GKNA 4DSSA 1H75A 2V6OA 3FKFA 1PRXA 4X0XA 4CY6A 3VURA 1LU4A 4IP1A 4K6XA 3FZ9A 2IN3A 4EKZA 1GTUA 2H1BA 2R0CA 3ZLPA 1E6BA 2MZCA 2A4HA 5E4WA 2YANA 4PQHA 1A0RP 3FMWA 5J3RA 2OE0A 1WE0A 4V2LA 2VIMA 1Y25A 2EIOA 2H1AA 2OA7A 5J9CA 3CRTA 2DJ1A 3GYKA 3IK9A 2GQLA 4AJ7A 3TKQA 3VWXA 2NTOA 2P5RA 2VL2A 2ALBA 1PL2A 20GSA 2VCWA 4L0WA 3VPTA 2Z9SA 3DYRA 4HDEA 1R5PA 2ON7A 4KB3A 9GSSA 2VL9A 2CQ9A 5CO3A 1BJXA 3L0HA 1GSSA 2DKIA 1ZCPA 3HJMA 3ZRDA 5KN2A 1A0FA 1HYUA 2X99A 2YJHA 5H5QA 2GZPA 3TJFA 1VRSD 4CW9A 2B5EA 1F6MC 2L4QA 3HJPA 3LW9A 2DIZA 1YF0A 2LS5A 2AYTA 5JCUA 3TCOA 2R6KA 4POKA 5HQPA 3F3QA 1E2YA 3EMXA 2AV4A 2YNXA 4OFTA 3IK7A 1OYJA 4RI7A 4ID0A 3E0UA 4K2XA 1KBNA 3UBKA 4BA7A 3GH9A 1Z7RA 5D8IA 2A2RA 1ST9A 4HUAA 2F3MA 3KD0A 3Q19A 4ULXA 4ML1A 2GQMA 4Q5RA 4KCEA 1T3BA 2YV7A 1XXUA 1M0UA 4KDUA 5LD0A 2LV3A 1ACVA 4PUFC 5DQYA 4LL4B 4MJAA 1EEMA 2QSIA 3QD9A 2N5FA 3D4MA 3DVXA 4POLA 4Q5QA 1SK0A 1GSYA 4TXOB 3HHVA 2IMKA 3QMXA 1SYXA 4CY8A 1WOUA 4K7NA 5ELGA 1GRXA 1RK4A 5FWGA 3HVXA 1FG4A 5A5KA 5D9TA 3RAZA 1FVKA 3IAS2 1GNWA 4IGJA 3C71A 4ZILA 5A4VA 5LCZA 3A2WA 2C3NA 4K7OA 5ECKB 1WIKA 3M9JA 1KTEA 2P31A 1Y6EA 1SJIA 3HVVA 3FR6A 4TOPA 1S3AA 3LSZA 3VWUA 3IXRA 3CSJA 3QOUA 4Q5NA 3C73A 4Z2TA 1FB0A 3APOA 4CDOA 3HZ4A 1ZL9A 1THXA 1BEDA 1S3CA 1S3DA 1K3OA 1F37A 2GLRA 2EIQA 2QKEA 1B4QA 2XBQA 4Z2RA 2IFQA 1OE7A 5IMZA 2EIRA 4OD7A 4GLTA 4V1Ag 3LORA 1DUGA 3KM6A 4G0IA 2QC7A 2H0GA 3C7MA 1HD2A 1TOFA 1THOA 5B6NA 2E0QA 1ERWA 10GSA 1O81A 1UA5A 3US3A 3VI5A 3VFIA 3ZMLA 5IIZA 22GSA 3L9VA 2L6CA 1GSUA 1VGLA 5JCWA 18GSA 2LRNA 1ZGNA 4IJ3A 4PNGA 1SU9A 4XS4B 3GKMA 5LNKe 1GUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EO3 A;  3BJ5 A;  1FVJ A;  4LLR A;  2ZNM A;  4NXI A;  1F2E A;  2H19 A;  1EGR A;  2KOK A;  4XRD A;  5KN3 A;  3CBU A;  2LEG A;  2OAC A;  1EZK A;  2F8F A;  2PU9 C;  4GXZ A;  4JE1 A;  4V2N A;  4OFM A;  4KDY A;  1YEX A;  4QQ7 A;  2VCV A;  5B8B A;  2FUG 2;  2J9H A;  1J9B A;  2CT6 A;  3KTL A;  4E8H A;  1GSE A;  3KH9 A;  4YAV A;  4ECC A;  2TRC P;  4ZB6 A;  2L6D A;  2GZZ A;  3H8Q A;  2K18 A;  5ECR B;  2VD0 A;  3WGD A;  1A8L A;  4NMU A;  2LKU A;  2YWN A;  2FA4 A;  4LA1 A;  2YWO A;  2FGX A;  3Q74 A;  3BCI A;  4MZB A;  2VLT A;  4F2I A;  3A5W A;  1Z9H A;  3ME7 A;  4O32 A;  2IWT A;  2C0F A;  3LFL A;  1MTC A;  2RM5 A;  1XFL A;  4MJB A;  1A24 A;  5F06 A;  2AUV A;  2GT6 A;  2K8V A;  3D4T A;  1O7U A;  3L4N A;  5IM9 A;  4V1A p;  2CA8 A;  3TOU A;  5IOX A;  5F8B A;  1MDJ A;  2P5Q A;  4IBP A;  1K0D A;  2VCX A;  1LJR A;  4RI6 A;  5KN0 A;  3EVI A;  5HR3 A;  4E8E A;  2LTK A;  1OC9 B;  3CSH A;  1W4V A;  4HJM A;  5G31 A;  5D93 A;  2H74 A;  3F6D A;  3ZIV A;  4ML6 A;  1HNB A;  1AC1 A;  1TI3 A;  1AXD A;  4AJ6 A;  2CVK A;  2TIR A;  3LXZ A;  5F07 A;  4TN8 A;  1V57 A;  3TRP A;  3GL5 A;  3TJK A;  4G19 A;  5G1K A;  2DLX A;  3VK9 A;  5A4U A;  1ABA A;  1SJZ A;  5G5F A;  4O92 A;  3C1S A;  2FWF A;  2VO4 A;  1DBY A;  2ZUP A;  4OWY A;  5HFI A;  4WF4 A;  2WS2 A;  2B5X A;  4XS4 A;  4JBB A;  2J23 A;  2K6V A;  1T00 A;  4O7H A;  4IW9 A;  1K3Y A;  3EC3 A;  1TRU A;  2TRX A;  2V2G A;  3EU4 A;  2C1Y A;  4YQU A;  3TKS A;  1TKD B;  3MSZ A;  3W8J A;  2HXK A;  3GMF A;  2B5Y A;  4MH3 A;  1BQ7 A;  1Z3E A;  4OMV A;  2AJQ B;  4MCU A;  2CAI A;  3TB2 A;  3CSI A;  2H75 A;  4XTS A;  1EEJ A;  2KP1 A;  2PVQ A;  1OC8 A;  3EYT A;  2BTO T;  4N11 A;  2RII A;  2C3T A;  3QCP A;  2OAD A;  3H79 A;  4PUR A;  4TRX A;  2HRF A;  1SEN A;  3QFB C;  3HXS A;  4MZW A;  4MLY A;  3PIN A;  4WR5 A;  1SJ6 A;  3EMP A;  2C80 A;  3IHQ A;  3KH7 A;  5DAK B;  3TJG A;  2M80 A;  2XPD A;  2E7P A;  3U6V A;  2FHE A;  4YAP A;  7GSS A;  5ABR A;  2XBI A;  1YDK A;  2CV4 A;  2NPB A;  1A2M A;  3HVS A;  1OC9 A;  1PMT A;  3ERF A;  2DJ0 A;  3IE3 A;  1UVZ A;  5CRW A;  3GH6 A;  2H30 A;  3F4T A;  3M9K A;  1JFU A;  4Q5F A;  5GSS A;  3D5J A;  5JWO B;  3BBY A;  2R5G A;  3ZIT A;  4V2M A;  4IS0 A;  1G7E A;  1X5E A;  2E2G A;  2C0E A;  4HZ2 A;  1ILO A;  4RQR A;  2EC4 A;  4GQF A;  3EE2 A;  4TR3 A;  4HOJ A;  6GSU A;  1O8W A;  4BWS A;  14GS A;  4WF5 A;  4F0B A;  2X8G A;  4FYU A;  3GRX A;  4KND A;  1MD4 A;  1VF4 A;  5KN1 A;  4Z7X A;  5DCH A;  4I5Q A;  5D9V A;  3WGX A;  3H1N A;  4HI7 A;  3F9U A;  4HJ2 A;  2FNO A;  2IMD A;  1M2B A;  3HYP A;  2GQK A;  4TW5 A;  2A2S A;  1AUC A;  1ZMA A;  2AAW A;  2O89 A;  5ECO B;  3UAP A;  3ZYW A;  1R26 A;  2YWI A;  2FA8 A;  4TXV A;  1N8J A;  3FK8 A;  1BYE A;  4GRF A;  2IPA A;  2C8U A;  2DBC A;  3SWL A;  4K0G A;  2HRN A;  3G7Y A;  3KGK A;  2RM6 A;  3Q18 A;  3I69 A;  3H93 A;  4KSO A;  1QXH A;  3I9V 2;  3F63 A;  5DAK A;  3HJO A;  2I3Y A;  4PGT A;  4I6X A;  1SK2 A;  3F3R A;  2LJA A;  1T4Z A;  2P0G A;  4HU7 A;  3F4R A;  1HNA A;  3ZRE A;  3M0F A;  1TU8 A;  4MF6 A;  2H73 A;  1GH2 A;  5B7C A;  2OKA A;  2DML A;  3DRN A;  3C1R A;  3UBL A;  1EWX A;  4EF0 A;  2RUF A;  5JWQ B;  3IR4 A;  2MMN A;  3O6T A;  4L5L A;  2O8V B;  2A4V A;  1T7P B;  4I2T A;  3J7Y k;  1PL1 A;  3TKS C;  3PH9 A;  5IPH A;  3GTU A;  2WUL A;  3TRX A;  4MJC A;  1VF2 A;  3DWV A;  3BCK A;  5G30 A;  3UVH A;  4AF2 A;  2VL3 A;  1TXX A;  1JHB A;  1XIY A;  3U5R E;  3GKX A;  2MMZ A;  1F3A A;  1JZO A;  5HR0 A;  1OVN A;  5G5E A;  5IMF A;  1W89 A;  2H01 A;  4CHS A;  3CTG A;  2HZE B;  5CNW A;  2DSA A;  5CRG A;  4KAE A;  3ZVJ D;  1AQW A;  2HNL A;  2XPE A;  2WCI A;  1URM A;  1V40 A;  4TVE A;  4G10 A;  1K0C A;  1PKZ A;  3LQ7 A;  5ECI B;  1ERV A;  2V1M A;  1BG5 A;  1MD3 A;  4LMW A;  5ECN B;  1TW9 A;  4ZXG A;  11GS A;  1XOA A;  4XHM A;  4PUA A;  3P2A A;  2HZF A;  3ZFL A;  3K8N A;  4WKW A;  2PBJ A;  3WT2 A;  4KX4 A;  5IO0 A;  2GDR A;  3BD2 A;  1FOV A;  3RDW A;  1GP1 A;  2R2J A;  2G2Q A;  4NAX A;  4KE3 A;  1O8X A;  4O5R A;  5DAL B;  3P8W A;  4K1F A;  4IHU A;  4HEA 2;  2LNT A;  2YP6 A;  1GLQ A;  2OE3 A;  4X1U A;  1FAA A;  5DJM A;  1EP8 A;  2H72 A;  2IIY A;  2NDO A;  3G9B A;  5CRE A;  1CQH A;  4NWY A;  4KUN A;  2H76 A;  5E59 A;  3LYP A;  3GST A;  1K3L A;  1M9A A;  1V98 A;  3QAV A;  2HI7 A;  5COH A;  4OCE A;  4MAB A;  1ZYE A;  3DML A;  5KEJ A;  4MMM A;  3APQ A;  1OAZ A;  3NZN A;  2GT5 A;  1JZW A;  1QUW A;  2JSY A;  4J56 E;  1YY7 A;  3VWW A;  4LL1 B;  4EDY A;  4FYB A;  2C3Q A;  4PX1 A;  2IME A;  1G0T A;  1USB A;  4EL1 A;  1JLV A;  5H5R A;  2XC2 A;  4ZL9 A;  4MA9 A;  4GF0 A;  1V2A A;  3P7X A;  4ZBD A;  3HDC A;  3QPM A;  3APS A;  4HQZ A;  4TXO A;  1UN2 A;  3F0I A;  5HR2 A;  3UEM A;  6GSS A;  2HZE A;  4F9Z A;  5G1L A;  4IP6 A;  4WET A;  4DVC A;  4N0V A;  1PSQ A;  3DEX A;  5D9X A;  3N9J A;  5ECQ B;  4K7I A;  4I97 A;  3D6I A;  1A2L A;  3RPP A;  4GQC A;  2GVP A;  6GSW A;  3DXB A;  3KJY A;  3OR5 A;  1XCC A;  3TKS E;  3IDV A;  3KZQ A;  5J5N A;  3EU3 A;  1NSW A;  4L0U A;  2E2M A;  3A2V A;  5EY6 A;  3TKR A;  5HFG A;  4KCA A;  3RBT A;  2WJU A;  4DSQ A;  3HD5 A;  2X8H A;  2IMF A;  2YJ7 A;  2F8A A;  3GV1 A;  1AQV A;  2LST A;  4J2F A;  4WXT A;  3H4K A;  3FZA A;  5CAX A;  1U88 A;  2FCH A;  3KMO A;  4JED A;  4PNF A;  2DC5 A;  3F6F A;  2G0F A;  2OJL A;  4N30 A;  4IJI A;  2F9S A;  4ECJ A;  3GSS A;  5DAL A;  4G2E A;  4NV5 A;  4DSR A;  1A23 A;  4WEY A;  2GTU A;  2O87 A;  5HR1 A;  2I9H A;  4ZIJ A;  1R4W A;  3HZ8 A;  3EWL A;  1HNC A;  3ERW A;  3N5O A;  2H0I A;  3LWA A;  4I8B A;  1WP0 A;  5ELA A;  4GSS A;  2FWE A;  1DE2 A;  1SKS B;  3CMI A;  3WD6 A;  3RPN A;  2AHE A;  5AIS A;  1XW9 A;  3FZ5 A;  4BVX A;  2YCD A;  3G7I A;  3KP8 A;  2HE3 A;  4IEL A;  3TKP A;  2RLI A;  5B6M A;  4PQ1 A;  1TK0 B;  5L71 A;  3O76 A;  1EGO A;  1PN9 A;  1GSQ A;  2YV9 A;  2M46 A;  6GST A;  3M1G A;  4TKY A;  1YKC A;  5CYY A;  2PGT A;  5IMA A;  1IYH A;  2JL4 A;  3GNJ A;  2H66 A;  1Z6N A;  4JU5 A;  3D22 A;  1PQN A;  4GCI A;  2H70 A;  1K0N A;  4DEJ A;  3S9F A;  4WBR D;  4FH8 A;  4KDX A;  1WMJ A;  2FD3 A;  5CRD A;  3KP9 A;  3TUE A;  2FWG A;  5D9W A;  4XS1 A;  3WT1 A;  3L9U A;  1ERT A;  1TRV A;  4X43 A;  1XZO A;  3E3E A;  2JAC A;  2JZR A;  3GFK A;  2F51 A;  4PQI A;  2LJK A;  3ZTL A;  4YH2 A;  1B4P A;  2ON5 A;  4FYC A;  3ED3 A;  3J7Y b;  4ZBB A;  1G6W A;  5AIX A;  2LRC A;  17GS A;  1U3A A;  1TRS A;  2R3X A;  13GS A;  2FY6 A;  3TJB A;  3EUR A;  4MPG A;  2DJ2 A;  3W6G A;  2GSQ A;  3GX0 A;  4XCS A;  3A3T A;  2JZT A;  3G7J A;  4ILF A;  4ZB9 A;  1ERU A;  2GST A;  1TP9 A;  3HA9 A;  1KEB A;  3L9S A;  2M72 A;  2VLU A;  2DJJ A;  4EC0 A;  3TJJ A;  4XS6 A;  1XWA A;  2NBS A;  4MPF A;  3TRQ A;  3KXO A;  2K9F A;  1X9W B;  5J4U A;  4PXO A;  3RHC A;  4BWQ A;  1XWB A;  2V32 A;  1T1V A;  4L5O A;  4HU9 A;  1GUM A;  2IMI A;  5IMC A;  5F05 A;  3M3M A;  1TTZ A;  4XIH A;  1J08 A;  3MDK A;  4WBJ A;  2HSH A;  3M8N A;  4ZB8 A;  4ISD A;  2LQO A;  1UC7 A;  1AIU A;  5AIV A;  3HKR A;  5DBQ A;  5GAP D;  1RW1 A;  3R2Q A;  5JCG A;  1K0A A;  1EOH A;  19GS A;  2C4J A;  5INY A;  1X5C A;  2QGV A;  3ZMK A;  1G7O A;  3QAW A;  3ZIJ A;  1K0M A;  2WDU A;  4ZL7 A;  6GSV A;  3GKK A;  1BAY A;  3KEB A;  2B1L A;  3UMA A;  2CAQ A;  3EIN A;  1M2A A;  4JR6 A;  4K2D A;  1YQ1 A;  3QAG A;  1M2D A;  1PD2 1;  3KIJ A;  5DJL A;  2BJX A;  4FIW A;  2CVB A;  1TRW A;  1X9M B;  2KUC A;  3HCZ A;  1B9X C;  1NM3 A;  4ECI A;  3UJ1 A;  1GUK A;  1RQM A;  1VF1 A;  4H86 A;  2VM1 A;  3O3T A;  1JZR A;  1TJD A;  2B6M A;  2OBK A;  3LYK A;  3IBH A;  1XBS A;  2B7K A;  3QFA C;  1ZOF A;  5F0G A;  1QGV A;  5GST A;  1SL0 B;  4N10 A;  3GN3 A;  4NPB A;  2NVL A;  2HLS A;  5ID2 B;  3D21 A;  2XHF A;  5GZZ B;  4BVY A;  3I6A A;  2VCZ A;  3FRC A;  3V1W A;  2LQQ A;  3FEU A;  3PR8 A;  1X5D A;  3MNG A;  1NW2 A;  1V9W A;  2PUK C;  3LEF A;  4HQS A;  5EL8 A;  2H8L A;  5ECL B;  1EV4 A;  1YJ6 A;  3L78 A;  3JCM L;  2VAF A;  1EV9 A;  2IFQ B;  2MMO A;  2OBI A;  2GS3 A;  4MF7 A;  1FW1 A;  3FR9 A;  1SKW B;  2HYX A;  1K0O A;  3A2X A;  1U3I A;  1FO5 A;  1I9D A;  4F82 A;  1GWC A;  2FLS A;  1U6T A;  3VLN A;  2FWH A;  4IVF A;  4POM A;  2V41 A;  2ES7 A;  2PER A;  2N5B A;  1CQG A;  1PGT A;  2BMX A;  2VOC A;  3GX8 A;  2I4A A;  2WRT A;  1SL2 B;  4P3Y B;  1F9M A;  3ZFB A;  2HT9 A;  3LG6 A;  1I5G A;  1PKW A;  4OCF A;  3GA4 A;  4GWR A;  5D96 A;  4IKH A;  1WRY A;  1ZZY A;  3VWV A;  1A2J A;  3SBC A;  5ENU A;  4QL7 A;  2PWJ A;  5J9B A;  5H5S A;  3VPQ A;  3F4S A;  2IJY A;  1DE1 A;  4EXJ A;  4FO5 A;  1ML6 A;  4ECB A;  2LRT A;  2VCT A;  5G2Z A;  2DJ3 A;  1QFN A;  2H1D A;  5IO2 A;  2C0D A;  2KLX A;  1M99 A;  3ISO A;  2DMM A;  1SKR B;  2V6K A;  1VF3 A;  3DVW A;  1OC3 A;  2L5O A;  2MYG A;  4NHZ A;  2JSZ A;  2H71 A;  2N5A A;  4IQA A;  3GIX A;  4MK3 A;  1XPV A;  4TR4 A;  3NOF A;  4MJE A;  1MEK A;  2WZ9 A;  5ID2 A;  1OKT A;  1WPI A;  4N0Z A;  3UVT A;  3WYW A;  3F8U A;  2H6X A;  5AN1 A;  6GSX A;  3NIV A;  2I1U A;  2VUP A;  1XVW A;  1TU7 A;  4G9H A;  1A8Y A;  3IC4 A;  5J41 A;  2GSS A;  2DJK A;  5DVB A;  3VI7 A;  1U87 A;  3MWH A;  4KA0 A;  4ACS A;  3KTB A;  4KW6 A;  1O85 A;  2AB6 A;  3TDG A;  4TR0 A;  4IQ1 A;  1BX9 A;  2PVO C;  3FHK A;  1K0B A;  1FHE A;  2B3S A;  5AGY A;  3TOT A;  1SK1 A;  4NHW A;  1M9B A;  3ZL5 A;  1V58 A;  1YZX A;  4D73 B;  4MH2 A;  3LXT A;  5IMV A;  2L4C A;  1MDK A;  3DD3 A;  3IA1 A;  4TR1 B;  4EE0 A;  3WGE A;  1NHO A;  2L59 A;  1M7T A;  1R7H A;  5C00 A;  4HS1 A;  1O73 A;  5D73 A;  4OO4 A;  3CRU A;  1TI1 A;  1Z5Y E;  1GTA A;  3HY2 A;  2YN1 A;  3GUS A;  4OFN A;  1N2A A;  1TK5 B;  1Z7P A;  1GLP A;  2H6Y A;  4K8M A;  3IV4 A;  2GZY A;  2C0G A;  1SD9 A;  1GUL A;  1SD8 A;  4JR4 A;  1R5A A;  3IOS A;  4L8E A;  3FW2 A;  1XVQ A;  1NHY A;  3GHA A;  3CTF A;  1GL8 A;  2O85 A;  1T8E B;  1TK8 B;  2HSY A;  1XWK A;  4MZC A;  3ME8 A;  4KSM A;  5C04 A;  2VD1 A;  1FB6 A;  3ZZX A;  4J57 E;  3UAR A;  2VCQ A;  1OE8 A;  4YQM A;  4ZBA A;  3ZVJ A;  4EUY A;  4K9Z A;  3C8E A;  5IPG A;  5DQS A;  3DKS A;  1GTI A;  4KH7 A;  3IRA A;  3UOM A;  5GAN D;  1HQO A;  2VL2 C;  1XWG A;  1QMV A;  2CX3 A;  5CP1 A;  4GSN A;  4JRR A;  2I81 A;  2X64 A;  3AY8 A;  2WB9 A;  5ECH B;  2L57 A;  3TGZ A;  1B9Y C;  3Q6O A;  1GTB A;  4EDZ A;  1EOG A;  3IAM 2;  3RHB A;  5IMD A;  5FT3 A;  4LMV A;  2K8S A;  4IN0 A;  2CX4 A;  2MMA A;  3I43 A;  1XW5 A;  1KNG A;  1Z6M A;  3KMN A;  4JZQ A;  1PX7 A;  2VM2 A;  3DGQ A;  3MAK A;  3P90 A;  4HZ4 A;  1WWJ A;  4OO5 A;  4GST A;  2JZS A;  2VLV A;  2IL3 A;  1AW9 A;  1TDI A;  3D0Z A;  1J0F A;  2HFD A;  5HFK A;  1X0R A;  5CRH A;  4MDC A;  2OE1 A;  2H1G A;  1XWC A;  1YKA A;  2R37 A;  4F03 A;  3UIW A;  1G6Y A;  3QDN A;  4D73 A;  1QK8 A;  1O6J A;  4MF5 A;  4BL7 A;  5A4W A;  1AQX A;  2MBT A;  4TR1 A;  2RUE A;  3CYN A;  1LBK A;  4NV2 A;  1OKD A;  4EVM A;  3GL3 A;  1XW6 A;  3IPZ A;  6GSY A;  4KGI A;  1B48 A;  4DSS B;  2YWM A;  5DCG A;  1X9S B;  1WJK A;  1B8X A;  3CXG A;  3KCM A;  2D2Z A;  4POB A;  1GNE A;  3GUR A;  3UL3 A;  5IQY A;  3FYG A;  2GGT A;  5ECS A;  5EVO A;  2B1K A;  1JLW A;  2CZ2 A;  2GSR A;  2PPT A;  3QR6 A;  1SYR A;  2H0H A;  4XRA A;  4QL9 A;  4YQV A;  4MP4 A;  8GSS A;  1EP7 A;  1C72 A;  2YPM A;  4GTU A;  4AJ8 A;  2REM A;  3BOA A;  12GS A;  3W8S A;  1YEP A;  1YF1 A;  2YZU A;  1XOB A;  3ERG A;  1T4Y A;  2R4V A;  5EPF A;  1PA3 A;  3LJR A;  1MDI A;  1QQ2 A;  3LGC A;  5DDL A;  2MBS A;  3FY7 A;  4BPY A;  1ON4 A;  1Q4J A;  1AAZ A;  3DIE A;  2LUS A;  1GSF A;  5ECP B;  2B7J A;  2L5L A;  2H6Z A;  4ZL8 A;  4K0N A;  4RUV A;  2KP2 A;  4WR4 A;  4RQX A;  4AGS A;  1ZYQ B;  1Q98 A;  2PN8 A;  5JWR B;  2YZH A;  2PMT A;  4F0C A;  2X8C A;  2DIY A;  2WFC A;  2CVD A;  2WGR A;  3FR3 A;  1H4O A;  1SL1 B;  2LNS A;  2JAD A;  5FHI A;  5B8A A;  4I2U A;  3E9J B;  3GTU B;  1GSD A;  3FZ4 A;  2O7K A;  3PGT A;  2LJR A;  1DSB A;  1JZD A;  1IYI A;  2KHP A;  2CZ3 A;  5IOW A;  2ZCT A;  2YOI A;  1F3B A;  1PX6 A;  2JU5 A;  5ECM B;  16GS A;  3GKN A;  4DSS A;  1H75 A;  2V6O A;  3FKF A;  1PRX A;  4X0X A;  3VUR A;  1LU4 A;  4IP1 A;  4K6X A;  3FZ9 A;  2IN3 A;  4EKZ A;  1GTU A;  2H1B A;  3ZLP A;  1E6B A;  2MZC A;  5E4W A;  2YAN A;  4PQH A;  1A0R P;  5J3R A;  2OE0 A;  1WE0 A;  4V2L A;  2VIM A;  1Y25 A;  2EIO A;  2H1A A;  2OA7 A;  5J9C A;  3CRT A;  2DJ1 A;  3GYK A;  3IK9 A;  2GQL A;  4AJ7 A;  3TKQ A;  3VWX A;  2NTO A;  2P5R A;  2VL2 A;  2ALB A;  1PL2 A;  20GS A;  2VCW A;  4L0W A;  3VPT A;  2Z9S A;  3DYR A;  4HDE A;  1R5P A;  2ON7 A;  4KB3 A;  9GSS A;  2VL9 A;  2CQ9 A;  5CO3 A;  1BJX A;  3L0H A;  1GSS A;  1ZCP A;  3HJM A;  3ZRD A;  5KN2 A;  1A0F A;  1HYU A;  2X99 A;  2YJH A;  5H5Q A;  2GZP A;  3TJF A;  1VRS D;  4CW9 A;  2B5E A;  1F6M C;  2L4Q A;  3HJP A;  2DIZ A;  1YF0 A;  2LS5 A;  2AYT A;  5JCU A;  3TCO A;  2R6K A;  4POK A;  5HQP A;  3F3Q A;  1E2Y A;  3EMX A;  2AV4 A;  2YNX A;  4OFT A;  3IK7 A;  1OYJ A;  4RI7 A;  4ID0 A;  3E0U A;  1KBN A;  3UBK A;  4BA7 A;  3GH9 A;  1Z7R A;  5D8I A;  2A2R A;  1ST9 A;  4HUA A;  2F3M A;  3KD0 A;  3Q19 A;  4ULX A;  4ML1 A;  2GQM A;  4Q5R A;  4KCE A;  1T3B A;  2YV7 A;  1XXU A;  1M0U A;  4KDU A;  5LD0 A;  2LV3 A;  1ACV A;  5DQY A;  4PUF C;  4LL4 B;  4MJA A;  1EEM A;  2QSI A;  3QD9 A;  2N5F A;  3D4M A;  3DVX A;  4POL A;  4Q5Q A;  1SK0 A;  1GSY A;  4TXO B;  3HHV A;  2IMK A;  3QMX A;  1SYX A;  1WOU A;  4K7N A;  5ELG A;  1GRX A;  1RK4 A;  5FWG A;  3HVX A;  1FG4 A;  5A5K A;  5D9T A;  3RAZ A;  1FVK A;  3IAS 2;  1GNW A;  4IGJ A;  3C71 A;  4ZIL A;  5A4V A;  5LCZ A;  3A2W A;  2C3N A;  4K7O A;  5ECK B;  1WIK A;  3M9J A;  1KTE A;  2P31 A;  1Y6E A;  1SJI A;  3HVV A;  3FR6 A;  4TOP A;  1S3A A;  3LSZ A;  3VWU A;  3IXR A;  3CSJ A;  3QOU A;  4Q5N A;  3C73 A;  1FB0 A;  3APO A;  4CDO A;  3HZ4 A;  1ZL9 A;  1THX A;  1BED A;  1S3C A;  1S3D A;  1K3O A;  1F37 A;  2GLR A;  2EIQ A;  2QKE A;  1B4Q A;  2XBQ A;  2IFQ A;  1OE7 A;  5IMZ A;  2EIR A;  4OD7 A;  4GLT A;  4V1A g;  3LOR A;  1DUG A;  3KM6 A;  2QC7 A;  2H0G A;  3C7M A;  1HD2 A;  1TOF A;  1THO A;  5B6N A;  2E0Q A;  1ERW A;  10GS A;  1O81 A;  1UA5 A;  3US3 A;  3VI5 A;  3VFI A;  3ZML A;  5IIZ A;  22GS A;  3L9V A;  2L6C A;  1GSU A;  1VGL A;  5JCW A;  18GS A;  2LRN A;  1ZGN A;  4IJ3 A;  4PNG A;  1SU9 A;  4XS4 B;  3GKM A;  5LNK e;  1GUH A; 
#chains in the Genus database with same CATH topology
 4EO3 A;  3BJ5 A;  1FVJ A;  4LLR A;  2ZNM A;  4NXI A;  1F2E A;  2H19 A;  1EGR A;  2KOK A;  4XRD A;  5BRT A;  5KN3 A;  3CBU A;  2LEG A;  2OAC A;  1EZK A;  2F8F A;  1XG8 A;  2PU9 C;  4GXZ A;  4JE1 A;  4V2N A;  4OFM A;  4KDY A;  1YEX A;  4QQ7 A;  2QA2 A;  2VCV A;  5B8B A;  2FUG 2;  2J9H A;  1J9B A;  2CT6 A;  3IHG A;  3KTL A;  4E8H A;  1GSE A;  3KH9 A;  4YAV A;  4ECC A;  2TRC P;  4ZB6 A;  2L6D A;  2GZZ A;  3H8Q A;  2K18 A;  5ECR B;  2VD0 A;  3WGD A;  1A8L A;  4NMU A;  2LKU A;  2YWN A;  2FA4 A;  4LA1 A;  2YWO A;  2FGX A;  3Q74 A;  3BCI A;  4MZB A;  2VLT A;  4F2I A;  3A5W A;  1Z9H A;  3ME7 A;  4O32 A;  2IWT A;  2C0F A;  3LFL A;  1MTC A;  2RM5 A;  1XFL A;  4MJB A;  1A24 A;  5F06 A;  2AUV A;  2GT6 A;  2K8V A;  3D4T A;  1O7U A;  3L4N A;  5IM9 A;  4V1A p;  2CA8 A;  3TOU A;  5IOX A;  5F8B A;  1MDJ A;  2P5Q A;  4IBP A;  1K0D A;  2VCX A;  1LJR A;  4RI6 A;  5KN0 A;  3EVI A;  5HR3 A;  4E8E A;  2LTK A;  1OC9 B;  3CSH A;  1W4V A;  3A5I A;  4HJM A;  5G31 A;  5D93 A;  2H74 A;  3F6D A;  3ZIV A;  4ML6 A;  1HNB A;  1AC1 A;  1TI3 A;  1AXD A;  4AJ6 A;  2CVK A;  2TIR A;  3LXZ A;  5F07 A;  4TN8 A;  1V57 A;  3TRP A;  3GL5 A;  3TJK A;  4G19 A;  5G1K A;  2DLX A;  3VK9 A;  5A4U A;  1ABA A;  1SJZ A;  5G5F A;  4O92 A;  3C1S A;  2FWF A;  2VO4 A;  1DBY A;  2ZUP A;  4OWY A;  5HFI A;  4WF4 A;  2WS2 A;  2B5X A;  4XS4 A;  4JBB A;  2J23 A;  2K6V A;  1T00 A;  4O7H A;  4IW9 A;  1K3Y A;  3EC3 A;  1TRU A;  2TRX A;  2V2G A;  3EU4 A;  2C1Y A;  4YQU A;  3TKS A;  1TKD B;  3MSZ A;  3IC8 A;  3W8J A;  2HXK A;  3GMF A;  2B5Y A;  4MH3 A;  1BQ7 A;  4K5S A;  1Z3E A;  4OMV A;  2AJQ B;  4MCU A;  2CAI A;  3TB2 A;  3CSI A;  2H75 A;  4XTS A;  1EEJ A;  2KP1 A;  2PVQ A;  1OC8 A;  3EYT A;  2BTO T;  4N11 A;  2RII A;  2C3T A;  3QCP A;  2OAD A;  4BVY B;  3H79 A;  4PUR A;  4TRX A;  2HRF A;  1SEN A;  3QFB C;  3HXS A;  4MZW A;  4MLY A;  3PIN A;  4WR5 A;  1SJ6 A;  3EMP A;  2C80 A;  3IHQ A;  3KH7 A;  5DAK B;  3TJG A;  2M80 A;  2XPD A;  2E7P A;  3U6V A;  2FHE A;  4YAP A;  7GSS A;  5ABR A;  2XBI A;  1YDK A;  2CV4 A;  2NPB A;  1A2M A;  3HVS A;  1OC9 A;  1PMT A;  3ERF A;  2DJ0 A;  3IE3 A;  1UVZ A;  5CRW A;  3GH6 A;  2H30 A;  3F4T A;  3M9K A;  1JFU A;  4Q5F A;  5GSS A;  3D5J A;  5JWO B;  4YKF A;  3BBY A;  2R5G A;  3ZIT A;  4G0L A;  4V2M A;  4IS0 A;  1G7E A;  1X5E A;  2E2G A;  2C0E A;  4HZ2 A;  1ILO A;  4RQR A;  2EC4 A;  4GQF A;  3EE2 A;  4TR3 A;  4HOJ A;  6GSU A;  1O8W A;  4BWS A;  14GS A;  4WF5 A;  4F0B A;  2X8G A;  4FYU A;  3GRX A;  2X4A A;  4KND A;  1MD4 A;  1VF4 A;  5KN1 A;  4Z7X A;  5DCH A;  4I5Q A;  5D9V A;  3WGX A;  3H1N A;  4HI7 A;  3F9U A;  4HJ2 A;  2FNO A;  2IMD A;  1M2B A;  3HYP A;  2GQK A;  4TW5 A;  2A2S A;  1AUC A;  1ZMA A;  2AAW A;  2O89 A;  1PN0 A;  5ECO B;  3UAP A;  3ZYW A;  1R26 A;  2YWI A;  2FA8 A;  4TXV A;  1M3I A;  1N8J A;  3FK8 A;  1BYE A;  4GRF A;  2IPA A;  4K5R A;  2C8U A;  4USS A;  2DBC A;  3SWL A;  4K0G A;  2HRN A;  3G7Y A;  3KGK A;  2RM6 A;  3Q18 A;  3I69 A;  3H93 A;  4KSO A;  1QXH A;  3I9V 2;  3F63 A;  5DAK A;  3HJO A;  2I3Y A;  4PGT A;  4I6X A;  1SK2 A;  3F3R A;  2LJA A;  1T4Z A;  2P0G A;  4HU7 A;  3F4R A;  1HNA A;  4EIQ A;  3ZRE A;  3M0F A;  1TU8 A;  4MF6 A;  2H73 A;  1PFO A;  1GH2 A;  5B7C A;  2OKA A;  2DML A;  3DRN A;  3C1R A;  3UBL A;  1M3J A;  1EWX A;  4EF0 A;  2RUF A;  5JWQ B;  3IR4 A;  2MMN A;  3O6T A;  4L5L A;  2O8V B;  2A4V A;  1T7P B;  4I2T A;  3J7Y k;  1PL1 A;  3TKS C;  1FOH A;  3PH9 A;  5IPH A;  3GTU A;  2WUL A;  3TRX A;  4MJC A;  1VF2 A;  3DWV A;  3BCK A;  5G30 A;  3UVH A;  4AF2 A;  2VL3 A;  1TXX A;  1JHB A;  1XIY A;  3U5R E;  3GKX A;  2MMZ A;  1F3A A;  1JZO A;  5HR0 A;  1OVN A;  5G5E A;  5IMF A;  1W89 A;  2H01 A;  4CHS A;  3CTG A;  2HZE B;  5CNW A;  2DSA A;  5CRG A;  4KAE A;  3ZVJ D;  3PPU A;  1AQW A;  2HNL A;  2XPE A;  2WCI A;  1URM A;  1V40 A;  4TVE A;  4G10 A;  1K0C A;  1PKZ A;  3LQ7 A;  5ECI B;  1ERV A;  2V1M A;  1BG5 A;  1MD3 A;  4LMW A;  5ECN B;  1TW9 A;  4ZXG A;  11GS A;  1XOA A;  4XHM A;  4PUA A;  3P2A A;  2HZF A;  4FQU A;  3ZFL A;  3K8N A;  4WKW A;  2PBJ A;  3WT2 A;  4KX4 A;  5IO0 A;  2GDR A;  3BD2 A;  1FOV A;  3RDW A;  1GP1 A;  4ICY A;  2R2J A;  2G2Q A;  4NAX A;  4KE3 A;  1O8X A;  4O5R A;  5DAL B;  3P8W A;  4K1F A;  3EPT A;  4IHU A;  4HEA 2;  2LNT A;  2YP6 A;  1GLQ A;  2OE3 A;  4X1U A;  1FAA A;  5DJM A;  1EP8 A;  2H72 A;  2IIY A;  2NDO A;  3G9B A;  5CRE A;  1CQH A;  4NWY A;  4KUN A;  2H76 A;  5E59 A;  3LYP A;  3GST A;  1K3L A;  1M9A A;  1V98 A;  3QAV A;  2HI7 A;  4BVX B;  5COH A;  4OCE A;  4MAB A;  1ZYE A;  3DML A;  5KEJ A;  4MMM A;  3APQ A;  1OAZ A;  3NZN A;  2GT5 A;  1JZW A;  1QUW A;  2JSY A;  4J56 E;  1YY7 A;  3VWW A;  4LL1 B;  4EDY A;  4FYB A;  2C3Q A;  4PX1 A;  4MNN A;  2IME A;  1G0T A;  1USB A;  4EL1 A;  1JLV A;  5H5R A;  2XC2 A;  4ZL9 A;  4MA9 A;  4GF0 A;  1V2A A;  2A2P A;  3P7X A;  4ZBD A;  3HDC A;  3QPM A;  3APS A;  4HQZ A;  4TXO A;  1UN2 A;  3F0I A;  5HR2 A;  3UEM A;  6GSS A;  2HZE A;  4F9Z A;  5G1L A;  4IP6 A;  4WET A;  4DVC A;  4N0V A;  1PSQ A;  3DEX A;  5D9X A;  5KOW A;  3N9J A;  5ECQ B;  4K7I A;  4I97 A;  3D6I A;  1A2L A;  3RPP A;  4GQC A;  2GVP A;  6GSW A;  3DXB A;  3KJY A;  3OR5 A;  1XCC A;  3TKS E;  3IDV A;  3KZQ A;  5J5N A;  3EU3 A;  1NSW A;  4L0U A;  2E2M A;  3A2V A;  5EY6 A;  3TKR A;  5HFG A;  4KCA A;  3RBT A;  2WJU A;  4DSQ A;  3HD5 A;  2X8H A;  2IMF A;  2YJ7 A;  2F8A A;  3GV1 A;  1AQV A;  2LST A;  4J2F A;  4WXT A;  4YKG A;  3H4K A;  3FZA A;  5CAX A;  1U88 A;  2FCH A;  3KMO A;  4JED A;  4PNF A;  4X4J A;  2DC5 A;  3F6F A;  2G0F A;  2OJL A;  4N30 A;  4IJI A;  2F9S A;  4ECJ A;  3GSS A;  5DAL A;  4G2E A;  4NV5 A;  4DSR A;  1A23 A;  4WEY A;  2GTU A;  2O87 A;  5HR1 A;  2I9H A;  4ZIJ A;  1R4W A;  3HZ8 A;  3EWL A;  1HNC A;  3ERW A;  3N5O A;  2H0I A;  3LWA A;  4I8B A;  1WP0 A;  5ELA A;  4GSS A;  2FWE A;  1DE2 A;  1SKS B;  3CMI A;  3WD6 A;  3RPN A;  2AHE A;  5AIS A;  1XW9 A;  2HRA A;  3FZ5 A;  4BVX A;  2YCD A;  3G7I A;  3KP8 A;  2HE3 A;  4IEL A;  3TKP A;  2RLI A;  5B6M A;  4PQ1 A;  1TK0 B;  5L71 A;  3O76 A;  1EGO A;  1PN9 A;  1GSQ A;  2YV9 A;  2M46 A;  6GST A;  3M1G A;  4TKY A;  2R0G A;  1YKC A;  5CYY A;  2PGT A;  5IMA A;  1IYH A;  2JL4 A;  3GNJ A;  2H66 A;  1Z6N A;  4JU5 A;  3D22 A;  1PQN A;  4GCI A;  2H70 A;  1K0N A;  4DEJ A;  3S9F A;  4WBR D;  4FH8 A;  4KDX A;  1WMJ A;  2FD3 A;  5CRD A;  3KP9 A;  3TUE A;  2FWG A;  5D9W A;  4XS1 A;  3WT1 A;  3L9U A;  1ERT A;  1TRV A;  4X43 A;  1XZO A;  3HVN A;  3E3E A;  2JAC A;  2JZR A;  3GFK A;  2F51 A;  4PQI A;  2LJK A;  3ZTL A;  4YH2 A;  1B4P A;  2ON5 A;  4FYC A;  3ED3 A;  3J7Y b;  4ZBB A;  1G6W A;  5AIX A;  2LRC A;  17GS A;  1U3A A;  1TRS A;  2R3X A;  13GS A;  2FY6 A;  3TJB A;  2X49 A;  3EUR A;  4MPG A;  2DJ2 A;  3W6G A;  2GSQ A;  3GX0 A;  4XCS A;  3A3T A;  2JZT A;  3G7J A;  4ILF A;  4ZB9 A;  1ERU A;  2GST A;  1TP9 A;  3HA9 A;  1KEB A;  3L9S A;  2M72 A;  2VLU A;  2HRK A;  2DJJ A;  4EC0 A;  3TJJ A;  4XS6 A;  1XWA A;  2NBS A;  4MPF A;  3TRQ A;  3KXO A;  2K9F A;  1X9W B;  5J4U A;  4PXO A;  4O5U A;  3RHC A;  4BWQ A;  1XWB A;  2V32 A;  1T1V A;  4L5O A;  4HU9 A;  1GUM A;  2IMI A;  5IMC A;  5F05 A;  3M3M A;  1TTZ A;  4XIH A;  1J08 A;  3MDK A;  4WBJ A;  2HSH A;  3M8N A;  4ZB8 A;  4ISD A;  2LQO A;  4BIK A;  2HSM A;  1UC7 A;  1AIU A;  5AIV A;  3HKR A;  5DBQ A;  5GAP D;  1RW1 A;  3R2Q A;  5JCG A;  1K0A A;  1EOH A;  19GS A;  2C4J A;  5INY A;  1X5C A;  2QGV A;  3ZMK A;  1G7O A;  3QAW A;  3ZIJ A;  1K0M A;  2WDU A;  4A5P A;  4ZL7 A;  6GSV A;  3GKK A;  1BAY A;  3KEB A;  2B1L A;  3UMA A;  2CAQ A;  3EIN A;  1M2A A;  4JR6 A;  4K2D A;  1YQ1 A;  3QAG A;  1M2D A;  1PD2 1;  3KIJ A;  5DJL A;  2BJX A;  4FIW A;  2CVB A;  1TRW A;  1X9M B;  2KUC A;  3HCZ A;  1B9X C;  3MYD A;  1NM3 A;  4ECI A;  3UJ1 A;  1GUK A;  1RQM A;  1VF1 A;  4H86 A;  2VM1 A;  3O3T A;  1JZR A;  1TJD A;  2B6M A;  2OBK A;  3LYK A;  3IBH A;  1XBS A;  2B7K A;  3QFA C;  1ZOF A;  5F0G A;  1QGV A;  5GST A;  1SL0 B;  4N10 A;  3GN3 A;  4NPB A;  2NVL A;  2HLS A;  5ID2 B;  3D21 A;  2QA1 A;  2XHF A;  5GZZ B;  4BVY A;  3I6A A;  2VCZ A;  3FRC A;  3V1W A;  2LQQ A;  3FEU A;  3PR8 A;  1X5D A;  3MNG A;  1NW2 A;  1V9W A;  2PUK C;  3LEF A;  4HQS A;  5EL8 A;  2H8L A;  5ECL B;  1EV4 A;  1YJ6 A;  3L78 A;  3JCM L;  2VAF A;  1EV9 A;  4PTS A;  2IFQ B;  2MMO A;  2OBI A;  2GS3 A;  4MF7 A;  3R3E A;  1FW1 A;  3FR9 A;  1SKW B;  2HYX A;  1K0O A;  3A2X A;  2DKH A;  1U3I A;  1FO5 A;  1I9D A;  4F82 A;  1GWC A;  2FLS A;  1U6T A;  3VLN A;  2FWH A;  4IVF A;  4POM A;  2V41 A;  2ES7 A;  2PER A;  2N5B A;  1CQG A;  1PGT A;  2BMX A;  2VOC A;  3GX8 A;  2I4A A;  2WRT A;  1SL2 B;  4P3Y B;  1F9M A;  3ZFB A;  2HT9 A;  3LG6 A;  1I5G A;  1PKW A;  4OCF A;  3GA4 A;  4GWR A;  5D96 A;  4IKH A;  1WRY A;  1ZZY A;  3VWV A;  1A2J A;  3SBC A;  5ENU A;  4QL7 A;  4EIP A;  2PWJ A;  5J9B A;  5H5S A;  3VPQ A;  5BMU A;  3F4S A;  2IJY A;  1DE1 A;  4EXJ A;  4FO5 A;  1ML6 A;  4ECB A;  2LRT A;  2VCT A;  5G2Z A;  2DJ3 A;  1QFN A;  2H1D A;  5IO2 A;  2C0D A;  2KLX A;  1M99 A;  3ISO A;  2DMM A;  1SKR B;  2V6K A;  1VF3 A;  3DVW A;  1OC3 A;  2L5O A;  2MYG A;  4NHZ A;  2JSZ A;  2H71 A;  2N5A A;  4IQA A;  3GIX A;  4MK3 A;  1XPV A;  4TR4 A;  3NOF A;  4MJE A;  1MEK A;  2WZ9 A;  5ID2 A;  1OKT A;  1WPI A;  4N0Z A;  3UVT A;  3WYW A;  3F8U A;  2H6X A;  5AN1 A;  6GSX A;  3NIV A;  2I1U A;  2VUP A;  1XVW A;  1TU7 A;  4G9H A;  1A8Y A;  3IC4 A;  5J41 A;  4HSC X;  2GSS A;  2DJK A;  5DVB A;  3VI7 A;  1U87 A;  3MWH A;  4KA0 A;  4ACS A;  3KTB A;  4KW6 A;  1O85 A;  2AB6 A;  3TDG A;  4TR0 A;  4IQ1 A;  1BX9 A;  2PVO C;  3FHK A;  1K0B A;  1FHE A;  2B3S A;  5AGY A;  3TOT A;  1SK1 A;  4NHW A;  1M9B A;  2R0P A;  3ZL5 A;  1V58 A;  1YZX A;  4D73 B;  4MH2 A;  3LXT A;  4BL7 B;  5IMV A;  2L4C A;  1MDK A;  3DD3 A;  3IA1 A;  4TR1 B;  4EE0 A;  3WGE A;  1NHO A;  2L59 A;  1M7T A;  1R7H A;  5C00 A;  4HS1 A;  1O73 A;  5D73 A;  4OO4 A;  3CRU A;  1TI1 A;  1Z5Y E;  4G0K A;  1GTA A;  3HY2 A;  2YN1 A;  3GUS A;  4OFN A;  1N2A A;  1TK5 B;  1Z7P A;  1GLP A;  2H6Y A;  4K8M A;  1ZYP A;  3IV4 A;  2GZY A;  2C0G A;  1SD9 A;  1GUL A;  1SD8 A;  4JR4 A;  1R5A A;  3IOS A;  4L8E A;  3FW2 A;  1XVQ A;  1NHY A;  3GHA A;  3CTF A;  1GL8 A;  2O85 A;  1T8E B;  1TK8 B;  2HSY A;  1XWK A;  4MZC A;  3ME8 A;  4KSM A;  5C04 A;  2VD1 A;  1FB6 A;  3ZZX A;  4J57 E;  3UAR A;  2VCQ A;  1OE8 A;  4YQM A;  4ZBA A;  3ZVJ A;  4EUY A;  4K9Z A;  3C8E A;  5IPG A;  5DQS A;  3DKS A;  1GTI A;  4KH7 A;  3IRA A;  3UOM A;  5GAN D;  1HQO A;  2VL2 C;  1XWG A;  1QMV A;  2CX3 A;  5CP1 A;  4GSN A;  4JRR A;  2I81 A;  2X64 A;  3AY8 A;  2WB9 A;  5ECH B;  2L57 A;  3TGZ A;  1B9Y C;  3Q6O A;  1GTB A;  4EDZ A;  1EOG A;  3IAM 2;  3RHB A;  5IMD A;  5FT3 A;  4LMV A;  2K8S A;  4IN0 A;  2CX4 A;  3MIX A;  2MMA A;  3I43 A;  1XW5 A;  1KNG A;  1Z6M A;  3KMN A;  4JZQ A;  1PX7 A;  2VM2 A;  3DGQ A;  3MAK A;  3P90 A;  4HZ4 A;  1WWJ A;  4Z2U A;  4OO5 A;  4GST A;  2JZS A;  2VLV A;  2IL3 A;  1AW9 A;  1TDI A;  3D0Z A;  1J0F A;  2HFD A;  5HFK A;  1X0R A;  5CRH A;  4MDC A;  2OE1 A;  2H1G A;  1XWC A;  5KOX A;  1YKA A;  2R37 A;  4F03 A;  3UIW A;  1G6Y A;  3QDN A;  4D73 A;  1QK8 A;  1O6J A;  4MF5 A;  4BL7 A;  5A4W A;  1AQX A;  2MBT A;  4TR1 A;  2RUE A;  3CYN A;  1LBK A;  4NV2 A;  1OKD A;  4EVM A;  3GL3 A;  1XW6 A;  3IPZ A;  6GSY A;  4KGI A;  1B48 A;  4DSS B;  2YWM A;  5DCG A;  1X9S B;  1WJK A;  1B8X A;  3CXG A;  3KCM A;  2D2Z A;  4POB A;  1GNE A;  3GUR A;  3UL3 A;  5IQY A;  3FYG A;  2GGT A;  5ECS A;  5EVO A;  2B1K A;  1JLW A;  2CZ2 A;  2GSR A;  2PPT A;  3QR6 A;  4O5Q A;  1SYR A;  2H0H A;  4XRA A;  4QL9 A;  4YQV A;  4MP4 A;  8GSS A;  2UZ8 A;  1EP7 A;  1C72 A;  2YPM A;  4GTU A;  4AJ8 A;  2REM A;  3BOA A;  12GS A;  3W8S A;  1YEP A;  1YF1 A;  2YZU A;  1XOB A;  3ERG A;  1T4Y A;  2R4V A;  5EPF A;  1PA3 A;  3LJR A;  1MDI A;  1QQ2 A;  3LGC A;  5DDL A;  2MBS A;  3FY7 A;  4BPY A;  1ON4 A;  1Q4J A;  1AAZ A;  1ZYN A;  3DIE A;  2LUS A;  1GSF A;  5ECP B;  2B7J A;  2L5L A;  2H6Z A;  4ZL8 A;  4K0N A;  4RUV A;  4KF9 A;  2KP2 A;  4WR4 A;  4RQX A;  4AGS A;  1ZYQ B;  1Q98 A;  2PN8 A;  5JWR B;  2YZH A;  2PMT A;  4F0C A;  2X8C A;  2DIY A;  2WFC A;  2CVD A;  2WGR A;  3FR3 A;  1H4O A;  1SL1 B;  2LNS A;  2JAD A;  5FHI A;  5B8A A;  4I2U A;  3E9J B;  3GTU B;  1GSD A;  3FZ4 A;  2O7K A;  3PGT A;  2LJR A;  1DSB A;  1JZD A;  1IYI A;  2KHP A;  2CZ3 A;  5IOW A;  2ZCT A;  2YOI A;  1F3B A;  1PX6 A;  2JU5 A;  5ECM B;  16GS A;  3GKN A;  4DSS A;  1H75 A;  2V6O A;  3FKF A;  1PRX A;  4X0X A;  4CY6 A;  3VUR A;  1LU4 A;  4IP1 A;  4K6X A;  3FZ9 A;  2IN3 A;  4EKZ A;  1GTU A;  2H1B A;  2R0C A;  3ZLP A;  1E6B A;  2MZC A;  2A4H A;  5E4W A;  2YAN A;  4PQH A;  1A0R P;  3FMW A;  5J3R A;  2OE0 A;  1WE0 A;  4V2L A;  2VIM A;  1Y25 A;  2EIO A;  2H1A A;  2OA7 A;  5J9C A;  3CRT A;  2DJ1 A;  3GYK A;  3IK9 A;  2GQL A;  4AJ7 A;  3TKQ A;  3VWX A;  2NTO A;  2P5R A;  2VL2 A;  2ALB A;  1PL2 A;  20GS A;  2VCW A;  4L0W A;  3VPT A;  2Z9S A;  3DYR A;  4HDE A;  1R5P A;  2ON7 A;  4KB3 A;  9GSS A;  2VL9 A;  2CQ9 A;  5CO3 A;  1BJX A;  3L0H A;  1GSS A;  2DKI A;  1ZCP A;  3HJM A;  3ZRD A;  5KN2 A;  1A0F A;  1HYU A;  2X99 A;  2YJH A;  5H5Q A;  2GZP A;  3TJF A;  1VRS D;  4CW9 A;  2B5E A;  1F6M C;  2L4Q A;  3HJP A;  3LW9 A;  2DIZ A;  1YF0 A;  2LS5 A;  2AYT A;  5JCU A;  3TCO A;  2R6K A;  4POK A;  5HQP A;  3F3Q A;  1E2Y A;  3EMX A;  2AV4 A;  2YNX A;  4OFT A;  3IK7 A;  1OYJ A;  4RI7 A;  4ID0 A;  3E0U A;  4K2X A;  1KBN A;  3UBK A;  4BA7 A;  3GH9 A;  1Z7R A;  5D8I A;  2A2R A;  1ST9 A;  4HUA A;  2F3M A;  3KD0 A;  3Q19 A;  4ULX A;  4ML1 A;  2GQM A;  4Q5R A;  4KCE A;  1T3B A;  2YV7 A;  1XXU A;  1M0U A;  4KDU A;  5LD0 A;  2LV3 A;  1ACV A;  4PUF C;  5DQY A;  4LL4 B;  4MJA A;  1EEM A;  2QSI A;  3QD9 A;  2N5F A;  3D4M A;  3DVX A;  4POL A;  4Q5Q A;  1SK0 A;  1GSY A;  4TXO B;  3HHV A;  2IMK A;  3QMX A;  1SYX A;  4CY8 A;  1WOU A;  4K7N A;  5ELG A;  1GRX A;  1RK4 A;  3CQF A;  5FWG A;  3HVX A;  1FG4 A;  5A5K A;  5D9T A;  3RAZ A;  1FVK A;  3IAS 2;  1GNW A;  4IGJ A;  3C71 A;  4ZIL A;  5A4V A;  5LCZ A;  3A2W A;  2C3N A;  4K7O A;  5ECK B;  1WIK A;  3M9J A;  1KTE A;  2P31 A;  1Y6E A;  1SJI A;  3HVV A;  3FR6 A;  4TOP A;  1S3A A;  3LSZ A;  3VWU A;  3IXR A;  3CSJ A;  3QOU A;  4Q5N A;  3C73 A;  4Z2T A;  1FB0 A;  3APO A;  4CDO A;  3HZ4 A;  1ZL9 A;  1THX A;  1BED A;  1S3C A;  1S3D A;  1K3O A;  1F37 A;  2GLR A;  2EIQ A;  2QKE A;  1B4Q A;  2XBQ A;  4Z2R A;  2IFQ A;  1OE7 A;  5IMZ A;  1S3R A;  2EIR A;  4OD7 A;  4GLT A;  4V1A g;  3LOR A;  1DUG A;  3KM6 A;  4G0I A;  2QC7 A;  2H0G A;  3C7M A;  1HD2 A;  1TOF A;  1THO A;  5B6N A;  2E0Q A;  1ERW A;  10GS A;  1O81 A;  1UA5 A;  3US3 A;  3VI5 A;  3VFI A;  3ZML A;  5IIZ A;  22GS A;  3L9V A;  2L6C A;  1GSU A;  1VGL A;  5JCW A;  18GS A;  2LRN A;  1ZGN A;  4IJ3 A;  4PNG A;  1SU9 A;  4XS4 B;  3GKM A;  5LNK e;  1GUH A; 
#chains in the Genus database with same CATH homology
 4EO3 A;  3BJ5 A;  1FVJ A;  4LLR A;  2ZNM A;  4NXI A;  1F2E A;  2H19 A;  1EGR A;  2KOK A;  4XRD A;  5BRT A;  5KN3 A;  3CBU A;  2LEG A;  2OAC A;  1EZK A;  2F8F A;  2PU9 C;  4GXZ A;  4JE1 A;  4V2N A;  4OFM A;  4KDY A;  1YEX A;  4QQ7 A;  2QA2 A;  2VCV A;  5B8B A;  2FUG 2;  2J9H A;  1J9B A;  2CT6 A;  3IHG A;  3KTL A;  4E8H A;  1GSE A;  3KH9 A;  4YAV A;  4ECC A;  2TRC P;  4ZB6 A;  2L6D A;  2GZZ A;  3H8Q A;  2K18 A;  5ECR B;  2VD0 A;  3WGD A;  1A8L A;  4NMU A;  2LKU A;  2YWN A;  2FA4 A;  4LA1 A;  2YWO A;  2FGX A;  3Q74 A;  3BCI A;  4MZB A;  2VLT A;  4F2I A;  3A5W A;  1Z9H A;  3ME7 A;  4O32 A;  2IWT A;  2C0F A;  3LFL A;  1MTC A;  2RM5 A;  1XFL A;  4MJB A;  1A24 A;  5F06 A;  2AUV A;  2GT6 A;  2K8V A;  3D4T A;  1O7U A;  3L4N A;  5IM9 A;  4V1A p;  2CA8 A;  3TOU A;  5IOX A;  5F8B A;  1MDJ A;  2P5Q A;  4IBP A;  1K0D A;  2VCX A;  1LJR A;  4RI6 A;  5KN0 A;  3EVI A;  5HR3 A;  4E8E A;  2LTK A;  1OC9 B;  3CSH A;  1W4V A;  3A5I A;  4HJM A;  5G31 A;  5D93 A;  2H74 A;  3F6D A;  3ZIV A;  4ML6 A;  1HNB A;  1AC1 A;  1TI3 A;  1AXD A;  4AJ6 A;  2CVK A;  2TIR A;  3LXZ A;  5F07 A;  4TN8 A;  1V57 A;  3TRP A;  3GL5 A;  3TJK A;  4G19 A;  5G1K A;  2DLX A;  3VK9 A;  5A4U A;  1ABA A;  1SJZ A;  5G5F A;  4O92 A;  3C1S A;  2FWF A;  2VO4 A;  1DBY A;  2ZUP A;  4OWY A;  5HFI A;  4WF4 A;  2WS2 A;  2B5X A;  4XS4 A;  4JBB A;  2J23 A;  2K6V A;  1T00 A;  4O7H A;  4IW9 A;  1K3Y A;  3EC3 A;  1TRU A;  2TRX A;  2V2G A;  3EU4 A;  2C1Y A;  4YQU A;  3TKS A;  1TKD B;  3MSZ A;  3IC8 A;  3W8J A;  2HXK A;  3GMF A;  2B5Y A;  4MH3 A;  1BQ7 A;  4K5S A;  1Z3E A;  4OMV A;  2AJQ B;  4MCU A;  2CAI A;  3TB2 A;  3CSI A;  2H75 A;  4XTS A;  1EEJ A;  2KP1 A;  2PVQ A;  1OC8 A;  3EYT A;  2BTO T;  4N11 A;  2RII A;  2C3T A;  3QCP A;  2OAD A;  4BVY B;  3H79 A;  4PUR A;  4TRX A;  2HRF A;  1SEN A;  3QFB C;  3HXS A;  4MZW A;  4MLY A;  3PIN A;  4WR5 A;  1SJ6 A;  3EMP A;  2C80 A;  3IHQ A;  3KH7 A;  5DAK B;  3TJG A;  2M80 A;  2XPD A;  2E7P A;  3U6V A;  2FHE A;  4YAP A;  7GSS A;  5ABR A;  2XBI A;  1YDK A;  2CV4 A;  2NPB A;  1A2M A;  3HVS A;  1OC9 A;  1PMT A;  3ERF A;  2DJ0 A;  3IE3 A;  1UVZ A;  5CRW A;  3GH6 A;  2H30 A;  3F4T A;  3M9K A;  1JFU A;  4Q5F A;  5GSS A;  3D5J A;  5JWO B;  4YKF A;  3BBY A;  2R5G A;  3ZIT A;  4G0L A;  4V2M A;  4IS0 A;  1G7E A;  1X5E A;  2E2G A;  2C0E A;  4HZ2 A;  1ILO A;  4RQR A;  2EC4 A;  4GQF A;  3EE2 A;  4TR3 A;  4HOJ A;  6GSU A;  1O8W A;  4BWS A;  14GS A;  4WF5 A;  4F0B A;  2X8G A;  4FYU A;  3GRX A;  2X4A A;  4KND A;  1MD4 A;  1VF4 A;  5KN1 A;  4Z7X A;  5DCH A;  4I5Q A;  5D9V A;  3WGX A;  3H1N A;  4HI7 A;  3F9U A;  4HJ2 A;  2FNO A;  2IMD A;  1M2B A;  3HYP A;  2GQK A;  4TW5 A;  2A2S A;  1AUC A;  1ZMA A;  2AAW A;  2O89 A;  1PN0 A;  5ECO B;  3UAP A;  3ZYW A;  1R26 A;  2YWI A;  2FA8 A;  4TXV A;  1N8J A;  3FK8 A;  1BYE A;  4GRF A;  2IPA A;  4K5R A;  2C8U A;  4USS A;  2DBC A;  3SWL A;  4K0G A;  2HRN A;  3G7Y A;  3KGK A;  2RM6 A;  3Q18 A;  3I69 A;  3H93 A;  4KSO A;  1QXH A;  3I9V 2;  3F63 A;  5DAK A;  3HJO A;  2I3Y A;  4PGT A;  4I6X A;  1SK2 A;  3F3R A;  2LJA A;  1T4Z A;  2P0G A;  4HU7 A;  3F4R A;  1HNA A;  4EIQ A;  3ZRE A;  3M0F A;  1TU8 A;  4MF6 A;  2H73 A;  1GH2 A;  5B7C A;  2OKA A;  2DML A;  3DRN A;  3C1R A;  3UBL A;  1EWX A;  4EF0 A;  2RUF A;  5JWQ B;  3IR4 A;  2MMN A;  3O6T A;  4L5L A;  2O8V B;  2A4V A;  1T7P B;  4I2T A;  3J7Y k;  1PL1 A;  3TKS C;  1FOH A;  3PH9 A;  5IPH A;  3GTU A;  2WUL A;  3TRX A;  4MJC A;  1VF2 A;  3DWV A;  3BCK A;  5G30 A;  3UVH A;  4AF2 A;  2VL3 A;  1TXX A;  1JHB A;  1XIY A;  3U5R E;  3GKX A;  2MMZ A;  1F3A A;  1JZO A;  5HR0 A;  1OVN A;  5G5E A;  5IMF A;  1W89 A;  2H01 A;  4CHS A;  3CTG A;  2HZE B;  5CNW A;  2DSA A;  5CRG A;  4KAE A;  3ZVJ D;  3PPU A;  1AQW A;  2HNL A;  2XPE A;  2WCI A;  1URM A;  1V40 A;  4TVE A;  4G10 A;  1K0C A;  1PKZ A;  3LQ7 A;  5ECI B;  1ERV A;  2V1M A;  1BG5 A;  1MD3 A;  4LMW A;  5ECN B;  1TW9 A;  4ZXG A;  11GS A;  1XOA A;  4XHM A;  4PUA A;  3P2A A;  2HZF A;  4FQU A;  3ZFL A;  3K8N A;  4WKW A;  2PBJ A;  3WT2 A;  4KX4 A;  5IO0 A;  2GDR A;  3BD2 A;  1FOV A;  3RDW A;  1GP1 A;  4ICY A;  2R2J A;  2G2Q A;  4NAX A;  4KE3 A;  1O8X A;  4O5R A;  5DAL B;  3P8W A;  4K1F A;  3EPT A;  4IHU A;  4HEA 2;  2LNT A;  2YP6 A;  1GLQ A;  2OE3 A;  4X1U A;  1FAA A;  5DJM A;  1EP8 A;  2H72 A;  2IIY A;  2NDO A;  3G9B A;  5CRE A;  1CQH A;  4NWY A;  4KUN A;  2H76 A;  5E59 A;  3LYP A;  3GST A;  1K3L A;  1M9A A;  1V98 A;  3QAV A;  2HI7 A;  4BVX B;  5COH A;  4OCE A;  4MAB A;  1ZYE A;  3DML A;  5KEJ A;  4MMM A;  3APQ A;  1OAZ A;  3NZN A;  2GT5 A;  1JZW A;  1QUW A;  2JSY A;  4J56 E;  1YY7 A;  3VWW A;  4LL1 B;  4EDY A;  4FYB A;  2C3Q A;  4PX1 A;  4MNN A;  2IME A;  1G0T A;  1USB A;  4EL1 A;  1JLV A;  5H5R A;  2XC2 A;  4ZL9 A;  4MA9 A;  4GF0 A;  1V2A A;  2A2P A;  3P7X A;  4ZBD A;  3HDC A;  3QPM A;  3APS A;  4HQZ A;  4TXO A;  1UN2 A;  3F0I A;  5HR2 A;  3UEM A;  6GSS A;  2HZE A;  4F9Z A;  5G1L A;  4IP6 A;  4WET A;  4DVC A;  4N0V A;  1PSQ A;  3DEX A;  5D9X A;  5KOW A;  3N9J A;  5ECQ B;  4K7I A;  4I97 A;  3D6I A;  1A2L A;  3RPP A;  4GQC A;  2GVP A;  6GSW A;  3DXB A;  3KJY A;  3OR5 A;  1XCC A;  3TKS E;  3IDV A;  3KZQ A;  5J5N A;  3EU3 A;  1NSW A;  4L0U A;  2E2M A;  3A2V A;  5EY6 A;  3TKR A;  5HFG A;  4KCA A;  3RBT A;  2WJU A;  4DSQ A;  3HD5 A;  2X8H A;  2IMF A;  2YJ7 A;  2F8A A;  3GV1 A;  1AQV A;  2LST A;  4J2F A;  4WXT A;  4YKG A;  3H4K A;  3FZA A;  5CAX A;  1U88 A;  2FCH A;  3KMO A;  4JED A;  4PNF A;  4X4J A;  2DC5 A;  3F6F A;  2G0F A;  2OJL A;  4N30 A;  4IJI A;  2F9S A;  4ECJ A;  3GSS A;  5DAL A;  4G2E A;  4NV5 A;  4DSR A;  1A23 A;  4WEY A;  2GTU A;  2O87 A;  5HR1 A;  2I9H A;  4ZIJ A;  1R4W A;  3HZ8 A;  3EWL A;  1HNC A;  3ERW A;  3N5O A;  2H0I A;  3LWA A;  4I8B A;  1WP0 A;  5ELA A;  4GSS A;  2FWE A;  1DE2 A;  1SKS B;  3CMI A;  3WD6 A;  3RPN A;  2AHE A;  5AIS A;  1XW9 A;  2HRA A;  3FZ5 A;  4BVX A;  2YCD A;  3G7I A;  3KP8 A;  2HE3 A;  4IEL A;  3TKP A;  2RLI A;  5B6M A;  4PQ1 A;  1TK0 B;  5L71 A;  3O76 A;  1EGO A;  1PN9 A;  1GSQ A;  2YV9 A;  2M46 A;  6GST A;  3M1G A;  4TKY A;  2R0G A;  1YKC A;  5CYY A;  2PGT A;  5IMA A;  1IYH A;  2JL4 A;  3GNJ A;  2H66 A;  1Z6N A;  4JU5 A;  3D22 A;  1PQN A;  4GCI A;  2H70 A;  1K0N A;  4DEJ A;  3S9F A;  4WBR D;  4FH8 A;  4KDX A;  1WMJ A;  2FD3 A;  5CRD A;  3KP9 A;  3TUE A;  2FWG A;  5D9W A;  4XS1 A;  3WT1 A;  3L9U A;  1ERT A;  1TRV A;  4X43 A;  1XZO A;  3E3E A;  2JAC A;  2JZR A;  3GFK A;  2F51 A;  4PQI A;  2LJK A;  3ZTL A;  4YH2 A;  1B4P A;  2ON5 A;  4FYC A;  3ED3 A;  3J7Y b;  4ZBB A;  1G6W A;  5AIX A;  2LRC A;  17GS A;  1U3A A;  1TRS A;  2R3X A;  13GS A;  2FY6 A;  3TJB A;  2X49 A;  3EUR A;  4MPG A;  2DJ2 A;  3W6G A;  2GSQ A;  3GX0 A;  4XCS A;  3A3T A;  2JZT A;  3G7J A;  4ILF A;  4ZB9 A;  1ERU A;  2GST A;  1TP9 A;  3HA9 A;  1KEB A;  3L9S A;  2M72 A;  2VLU A;  2HRK A;  2DJJ A;  4EC0 A;  3TJJ A;  4XS6 A;  1XWA A;  2NBS A;  4MPF A;  3TRQ A;  3KXO A;  2K9F A;  1X9W B;  5J4U A;  4PXO A;  4O5U A;  3RHC A;  4BWQ A;  1XWB A;  2V32 A;  1T1V A;  4L5O A;  4HU9 A;  1GUM A;  2IMI A;  5IMC A;  5F05 A;  3M3M A;  1TTZ A;  4XIH A;  1J08 A;  3MDK A;  4WBJ A;  2HSH A;  3M8N A;  4ZB8 A;  4ISD A;  2LQO A;  2HSM A;  1UC7 A;  1AIU A;  5AIV A;  3HKR A;  5DBQ A;  5GAP D;  1RW1 A;  3R2Q A;  5JCG A;  1K0A A;  1EOH A;  19GS A;  2C4J A;  5INY A;  1X5C A;  2QGV A;  3ZMK A;  1G7O A;  3QAW A;  3ZIJ A;  1K0M A;  2WDU A;  4A5P A;  4ZL7 A;  6GSV A;  3GKK A;  1BAY A;  3KEB A;  2B1L A;  3UMA A;  2CAQ A;  3EIN A;  1M2A A;  4JR6 A;  4K2D A;  1YQ1 A;  3QAG A;  1M2D A;  1PD2 1;  3KIJ A;  5DJL A;  2BJX A;  4FIW A;  2CVB A;  1TRW A;  1X9M B;  2KUC A;  3HCZ A;  1B9X C;  3MYD A;  1NM3 A;  4ECI A;  3UJ1 A;  1GUK A;  1RQM A;  1VF1 A;  4H86 A;  2VM1 A;  3O3T A;  1JZR A;  1TJD A;  2B6M A;  2OBK A;  3LYK A;  3IBH A;  1XBS A;  2B7K A;  3QFA C;  1ZOF A;  5F0G A;  1QGV A;  5GST A;  1SL0 B;  4N10 A;  3GN3 A;  4NPB A;  2NVL A;  2HLS A;  5ID2 B;  3D21 A;  2QA1 A;  2XHF A;  5GZZ B;  4BVY A;  3I6A A;  2VCZ A;  3FRC A;  3V1W A;  2LQQ A;  3FEU A;  3PR8 A;  1X5D A;  3MNG A;  1NW2 A;  1V9W A;  2PUK C;  3LEF A;  4HQS A;  5EL8 A;  2H8L A;  5ECL B;  1EV4 A;  1YJ6 A;  3L78 A;  3JCM L;  2VAF A;  1EV9 A;  4PTS A;  2IFQ B;  2MMO A;  2OBI A;  2GS3 A;  4MF7 A;  3R3E A;  1FW1 A;  3FR9 A;  1SKW B;  2HYX A;  1K0O A;  3A2X A;  2DKH A;  1U3I A;  1FO5 A;  1I9D A;  4F82 A;  1GWC A;  2FLS A;  1U6T A;  3VLN A;  2FWH A;  4IVF A;  4POM A;  2V41 A;  2ES7 A;  2PER A;  2N5B A;  1CQG A;  1PGT A;  2BMX A;  2VOC A;  3GX8 A;  2I4A A;  2WRT A;  1SL2 B;  4P3Y B;  1F9M A;  3ZFB A;  2HT9 A;  3LG6 A;  1I5G A;  1PKW A;  4OCF A;  3GA4 A;  4GWR A;  5D96 A;  4IKH A;  1WRY A;  1ZZY A;  3VWV A;  1A2J A;  3SBC A;  5ENU A;  4QL7 A;  4EIP A;  2PWJ A;  5J9B A;  5H5S A;  3VPQ A;  5BMU A;  3F4S A;  2IJY A;  1DE1 A;  4EXJ A;  4FO5 A;  1ML6 A;  4ECB A;  2LRT A;  2VCT A;  5G2Z A;  2DJ3 A;  1QFN A;  2H1D A;  5IO2 A;  2C0D A;  2KLX A;  1M99 A;  3ISO A;  2DMM A;  1SKR B;  2V6K A;  1VF3 A;  3DVW A;  1OC3 A;  2L5O A;  2MYG A;  4NHZ A;  2JSZ A;  2H71 A;  2N5A A;  4IQA A;  3GIX A;  4MK3 A;  1XPV A;  4TR4 A;  3NOF A;  4MJE A;  1MEK A;  2WZ9 A;  5ID2 A;  1OKT A;  1WPI A;  4N0Z A;  3UVT A;  3WYW A;  3F8U A;  2H6X A;  5AN1 A;  6GSX A;  3NIV A;  2I1U A;  2VUP A;  1XVW A;  1TU7 A;  4G9H A;  1A8Y A;  3IC4 A;  5J41 A;  2GSS A;  2DJK A;  5DVB A;  3VI7 A;  1U87 A;  3MWH A;  4KA0 A;  4ACS A;  3KTB A;  4KW6 A;  1O85 A;  2AB6 A;  3TDG A;  4TR0 A;  4IQ1 A;  1BX9 A;  2PVO C;  3FHK A;  1K0B A;  1FHE A;  2B3S A;  5AGY A;  3TOT A;  1SK1 A;  4NHW A;  1M9B A;  2R0P A;  3ZL5 A;  1V58 A;  1YZX A;  4D73 B;  4MH2 A;  3LXT A;  4BL7 B;  5IMV A;  2L4C A;  1MDK A;  3DD3 A;  3IA1 A;  4TR1 B;  4EE0 A;  3WGE A;  1NHO A;  2L59 A;  1M7T A;  1R7H A;  5C00 A;  4HS1 A;  1O73 A;  5D73 A;  4OO4 A;  3CRU A;  1TI1 A;  1Z5Y E;  4G0K A;  1GTA A;  3HY2 A;  2YN1 A;  3GUS A;  4OFN A;  1N2A A;  1TK5 B;  1Z7P A;  1GLP A;  2H6Y A;  4K8M A;  1ZYP A;  3IV4 A;  2GZY A;  2C0G A;  1SD9 A;  1GUL A;  1SD8 A;  4JR4 A;  1R5A A;  3IOS A;  4L8E A;  3FW2 A;  1XVQ A;  1NHY A;  3GHA A;  3CTF A;  1GL8 A;  2O85 A;  1T8E B;  1TK8 B;  2HSY A;  1XWK A;  4MZC A;  3ME8 A;  4KSM A;  5C04 A;  2VD1 A;  1FB6 A;  3ZZX A;  4J57 E;  3UAR A;  2VCQ A;  1OE8 A;  4YQM A;  4ZBA A;  3ZVJ A;  4EUY A;  4K9Z A;  3C8E A;  5IPG A;  5DQS A;  3DKS A;  1GTI A;  4KH7 A;  3IRA A;  3UOM A;  5GAN D;  1HQO A;  2VL2 C;  1XWG A;  1QMV A;  2CX3 A;  5CP1 A;  4GSN A;  4JRR A;  2I81 A;  2X64 A;  3AY8 A;  2WB9 A;  5ECH B;  2L57 A;  3TGZ A;  1B9Y C;  3Q6O A;  1GTB A;  4EDZ A;  1EOG A;  3IAM 2;  3RHB A;  5IMD A;  5FT3 A;  4LMV A;  2K8S A;  4IN0 A;  2CX4 A;  3MIX A;  2MMA A;  3I43 A;  1XW5 A;  1KNG A;  1Z6M A;  3KMN A;  4JZQ A;  1PX7 A;  2VM2 A;  3DGQ A;  3MAK A;  3P90 A;  4HZ4 A;  1WWJ A;  4Z2U A;  4OO5 A;  4GST A;  2JZS A;  2VLV A;  2IL3 A;  1AW9 A;  1TDI A;  3D0Z A;  1J0F A;  2HFD A;  5HFK A;  1X0R A;  5CRH A;  4MDC A;  2OE1 A;  2H1G A;  1XWC A;  5KOX A;  1YKA A;  2R37 A;  4F03 A;  3UIW A;  1G6Y A;  3QDN A;  4D73 A;  1QK8 A;  1O6J A;  4MF5 A;  4BL7 A;  5A4W A;  1AQX A;  2MBT A;  4TR1 A;  2RUE A;  3CYN A;  1LBK A;  4NV2 A;  1OKD A;  4EVM A;  3GL3 A;  1XW6 A;  3IPZ A;  6GSY A;  4KGI A;  1B48 A;  4DSS B;  2YWM A;  5DCG A;  1X9S B;  1WJK A;  1B8X A;  3CXG A;  3KCM A;  2D2Z A;  4POB A;  1GNE A;  3GUR A;  3UL3 A;  5IQY A;  3FYG A;  2GGT A;  5ECS A;  5EVO A;  2B1K A;  1JLW A;  2CZ2 A;  2GSR A;  2PPT A;  3QR6 A;  4O5Q A;  1SYR A;  2H0H A;  4XRA A;  4QL9 A;  4YQV A;  4MP4 A;  8GSS A;  2UZ8 A;  1EP7 A;  1C72 A;  2YPM A;  4GTU A;  4AJ8 A;  2REM A;  3BOA A;  12GS A;  3W8S A;  1YEP A;  1YF1 A;  2YZU A;  1XOB A;  3ERG A;  1T4Y A;  2R4V A;  5EPF A;  1PA3 A;  3LJR A;  1MDI A;  1QQ2 A;  3LGC A;  5DDL A;  2MBS A;  3FY7 A;  4BPY A;  1ON4 A;  1Q4J A;  1AAZ A;  1ZYN A;  3DIE A;  2LUS A;  1GSF A;  5ECP B;  2B7J A;  2L5L A;  2H6Z A;  4ZL8 A;  4K0N A;  4RUV A;  4KF9 A;  2KP2 A;  4WR4 A;  4RQX A;  4AGS A;  1ZYQ B;  1Q98 A;  2PN8 A;  5JWR B;  2YZH A;  2PMT A;  4F0C A;  2X8C A;  2DIY A;  2WFC A;  2CVD A;  2WGR A;  3FR3 A;  1H4O A;  1SL1 B;  2LNS A;  2JAD A;  5FHI A;  5B8A A;  4I2U A;  3E9J B;  3GTU B;  1GSD A;  3FZ4 A;  2O7K A;  3PGT A;  2LJR A;  1DSB A;  1JZD A;  1IYI A;  2KHP A;  2CZ3 A;  5IOW A;  2ZCT A;  2YOI A;  1F3B A;  1PX6 A;  2JU5 A;  5ECM B;  16GS A;  3GKN A;  4DSS A;  1H75 A;  2V6O A;  3FKF A;  1PRX A;  4X0X A;  4CY6 A;  3VUR A;  1LU4 A;  4IP1 A;  4K6X A;  3FZ9 A;  2IN3 A;  4EKZ A;  1GTU A;  2H1B A;  2R0C A;  3ZLP A;  1E6B A;  2MZC A;  2A4H A;  5E4W A;  2YAN A;  4PQH A;  1A0R P;  3FMW A;  5J3R A;  2OE0 A;  1WE0 A;  4V2L A;  2VIM A;  1Y25 A;  2EIO A;  2H1A A;  2OA7 A;  5J9C A;  3CRT A;  2DJ1 A;  3GYK A;  3IK9 A;  2GQL A;  4AJ7 A;  3TKQ A;  3VWX A;  2NTO A;  2P5R A;  2VL2 A;  2ALB A;  1PL2 A;  20GS A;  2VCW A;  4L0W A;  3VPT A;  2Z9S A;  3DYR A;  4HDE A;  1R5P A;  2ON7 A;  4KB3 A;  9GSS A;  2VL9 A;  2CQ9 A;  5CO3 A;  1BJX A;  3L0H A;  1GSS A;  2DKI A;  1ZCP A;  3HJM A;  3ZRD A;  5KN2 A;  1A0F A;  1HYU A;  2X99 A;  2YJH A;  5H5Q A;  2GZP A;  3TJF A;  1VRS D;  4CW9 A;  2B5E A;  1F6M C;  2L4Q A;  3HJP A;  3LW9 A;  2DIZ A;  1YF0 A;  2LS5 A;  2AYT A;  5JCU A;  3TCO A;  2R6K A;  4POK A;  5HQP A;  3F3Q A;  1E2Y A;  3EMX A;  2AV4 A;  2YNX A;  4OFT A;  3IK7 A;  1OYJ A;  4RI7 A;  4ID0 A;  3E0U A;  4K2X A;  1KBN A;  3UBK A;  4BA7 A;  3GH9 A;  1Z7R A;  5D8I A;  2A2R A;  1ST9 A;  4HUA A;  2F3M A;  3KD0 A;  3Q19 A;  4ULX A;  4ML1 A;  2GQM A;  4Q5R A;  4KCE A;  1T3B A;  2YV7 A;  1XXU A;  1M0U A;  4KDU A;  5LD0 A;  2LV3 A;  1ACV A;  4PUF C;  5DQY A;  4LL4 B;  4MJA A;  1EEM A;  2QSI A;  3QD9 A;  2N5F A;  3D4M A;  3DVX A;  4POL A;  4Q5Q A;  1SK0 A;  1GSY A;  4TXO B;  3HHV A;  2IMK A;  3QMX A;  1SYX A;  4CY8 A;  1WOU A;  4K7N A;  5ELG A;  1GRX A;  1RK4 A;  5FWG A;  3HVX A;  1FG4 A;  5A5K A;  5D9T A;  3RAZ A;  1FVK A;  3IAS 2;  1GNW A;  4IGJ A;  3C71 A;  4ZIL A;  5A4V A;  5LCZ A;  3A2W A;  2C3N A;  4K7O A;  5ECK B;  1WIK A;  3M9J A;  1KTE A;  2P31 A;  1Y6E A;  1SJI A;  3HVV A;  3FR6 A;  4TOP A;  1S3A A;  3LSZ A;  3VWU A;  3IXR A;  3CSJ A;  3QOU A;  4Q5N A;  3C73 A;  4Z2T A;  1FB0 A;  3APO A;  4CDO A;  3HZ4 A;  1ZL9 A;  1THX A;  1BED A;  1S3C A;  1S3D A;  1K3O A;  1F37 A;  2GLR A;  2EIQ A;  2QKE A;  1B4Q A;  2XBQ A;  4Z2R A;  2IFQ A;  1OE7 A;  5IMZ A;  2EIR A;  4OD7 A;  4GLT A;  4V1A g;  3LOR A;  1DUG A;  3KM6 A;  4G0I A;  2QC7 A;  2H0G A;  3C7M A;  1HD2 A;  1TOF A;  1THO A;  5B6N A;  2E0Q A;  1ERW A;  10GS A;  1O81 A;  1UA5 A;  3US3 A;  3VI5 A;  3VFI A;  3ZML A;  5IIZ A;  22GS A;  3L9V A;  2L6C A;  1GSU A;  1VGL A;  5JCW A;  18GS A;  2LRN A;  1ZGN A;  4IJ3 A;  4PNG A;  1SU9 A;  4XS4 B;  3GKM A;  5LNK e;  1GUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...