2WULA

Crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
109
structure length
109
Chain Sequence
SAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GLUTAREDOXIN RELATED PROTEIN 5
publication title The Crystal Structure of Human Glrx5: Iron Sulphur Cluster Coordination, Tetrameric Assembly and Monomer Activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2wulA01
2XBIA 2QGVA 1A2LA 2GZYA 2VD0A 1Z9HA 1SK0A 1WPIA 5INYA 2V6KA 4JR4A 2P0GA 4ID0A 4K9ZA 2GQMA 2GS3A 2H70A 4X43A 1GTIA 1YF1A 4YQVA 2K18A 4JU5A 4EXJA 4DSSA 2RUFA 3IBHA 4F03A 4FIWA 4HDEA 3IPZA 1VRSD 2NTOA 2C0DA 3IDVA 4WEYA 5ECQB 4PX1A 2VCWA 5C04A 3CMIA 2F3MA 1QUWA 1EV4A 4PQHA 1GL8A 1ABAA 3M9KA 1T8EB 5DBQA 3KIJA 3F63A 3L4NA 2DIYA 1YDKA 5D9WA 2CX4A 2V6OA 1EOHA 3E9JB 3F4RA 4TXOB 4KAEA 1LJRA 1ML6A 2MMAA 3M1GA 5HFGA 3GX8A 3DEXA 4WBRD 2RLIA 4TOPA 1TRVA 3LXZA 2PERA 5HFKA 2MBSA 1XWKA 3FYGA 1Z5YE 6GSTA 4GSNA 3F4SA 3EU3A 1TRSA 2CA8A 4IP6A 1M7TA 1WOUA 5H5QA 1K0MA 5IIZA 2PVQA 4GWRA 4OCFA 2OE1A 1M2DA 2G0FA 1O7UA 2VM1A 3IC4A 1SL0B 4CDOA 1Z7RA 3GKMA 1O81A 4TXVA 12GSA 4XS4B 3HA9A 2ON5A 4YAVA 2VD1A 4PUAA 4ZL8A 2IPAA 1JZWA 2MMNA 1XOBA 3D4MA 1BG5A 1T00A 1T4ZA 2DMLA 3HHVA 5JCWA 4FH8A 1MDIA 3F3RA 1SL1B 5CNWA 1N2AA 1F3AA 4ULXA 1OC3A 2FHEA 2GSSA 4I6XA 3DGQA 1RK4A 1T4YA 2KHPA 3PGTA 4MP4A 1BAYA 3IR4A 1GULA 5LNKe 2YANA 2H66A 3FEUA 5AIVA 4P3YB 4DSRA 4NV5A 4PXOA 1GTAA 5G1KA 2WS2A 2AAWA 4ECJA 3HYPA 1Q98A 2LRTA 20GSA 3WT2A 2VCZA 1WJKA 3ZLPA 1V58A 1EGOA 1WMJA 2E2MA 2PVOC 3HXSA 2ZCTA 1RW1A 2H0HA 2MMZA 1TRWA 2JADA 3HJMA 4LL4B 5ABRA 9GSSA 1F6MC 3W8SA 2OKAA 3D6IA 2VCTA 1ZCPA 4XS1A 3IXRA 1M2AA 4ZBAA 3IV4A 1H75A 4ZB6A 3HJPA 3BJ5A 3HJOA 5IO2A 3DD3A 1G7OA 2K6VA 1O85A 2IJYA 1XVWA 1VF3A 2A4VA 5H5RA 5J5NA 2VIMA 3P90A 3ZVJA 2OBKA 2OE3A 5B6MA 5AGYA 3FZAA 4MJAA 1I5GA 5FWGA 1EWXA 3GH6A 2HI7A 3VWUA 2FUG2 5IMZA 1X0RA 4DVCA 1NSWA 1TRUA 1FB6A 5CRHA 4HJ2A 2LTKA 1IYIA 4JEDA 4MCUA 4OFNA 1AAZA 4PNGA 3VPTA 4MLYA 2RM6A 3KEBA 2C4JA 4TR3A 2F9SA 2LQOA 3L9VA 3TB2A 3ZFBA 1TDIA 1JLWA 3RDWA 5D96A 3VI7A 3QOUA 5AIXA 4GXZA 4YQMA 1SJZA 3QR6A 1PN9A 2BJXA 2HT9A 1M9AA 4FYUA 3DYRA 3P7XA 1X5CA 5IQYA 4K7OA 1FVJA 2C0GA 1TU8A 2H74A 3ZFLA 2OJLA 4GQFA 3S9FA 3UVTA 2LNSA 4K1FA 4NWYA 3HY2A 4MK3A 1S3AA 1WP0A 4FO5A 2LJRA 5DJMA 1EOGA 4MZBA 3FK8A 4BL7A 5J9BA 2F8AA 3SWLA 4MF5A 4KDUA 3W6GA 5G2ZA 2YWMA 4K6XA 4EKZA 2WDUA 3H1NA 4ZB8A 4ZXGA 4FYBA 2YV9A 1FO5A 1TW9A 3F3QA 4TR4A 1F9MA 3ZITA 4ZIJA 2N5FA 2VLTA 2PUKC 3DRNA 1A23A 3LXTA 1SKSB 2GT5A 3TJKA 5A4WA 5IO0A 4EC0A 3TGZA 1IYHA 5DALB 5IM9A 4MJEA 5A4UA 3IRAA 4E8HA 3QMXA 5IMAA 4TRXA 2MYGA 1SKRB 2JACA 5COHA 4IBPA 4POBA 1HNAA 1ZYQB 2HFDA 4OWYA 5ID2B 2L6CA 2XPEA 1DE1A 2LRNA 2R37A 1DE2A 2LV3A 1KBNA 1XOAA 3KMNA 1THOA 2GQKA 3NIVA 1JLVA 4YH2A 4MZCA 1FHEA 4XCSA 2NPBA 2JL4A 4TXOA 5DJLA 3C8EA 2YV7A 3G7YA 1RQMA 3EINA 1PL1A 3Q18A 4EO3A 5JCUA 3ZMKA 3D0ZA 3UBKA 1GUHA 3HCZA 3PR8A 4LMVA 2H73A 2V41A 2CT6A 2F8FA 4Q5FA 4D73B 4JRRA 6GSYA 1NW2A 1XWCA 1AXDA 3ZYWA 5LD0A 4IJ3A 3HVXA 14GSA 3APOA 4N0ZA 2H0IA 3TRPA 2FA8A 2PBJA 1XFLA 2HRNA 4K7IA 4X1UA 1BEDA 4XS4A 3VFIA 2MZCA 5ENUA 1X5EA 2VM2A 4OFTA 4Q5NA 1CQHA 4JE1A 3EMXA 4K0NA 4K0GA 4X0XA 1V9WA 3UOMA 2M46A 1TXXA 2X8CA 2B1KA 3RHBA 3APQA 4CHSA 1UC7A 3TKSC 3ME8A 3MWHA 3CTGA 1GSYA 1GH2A 3ZZXA 3MSZA 2V2GA 3C7MA 2B5EA 5ECIB 5ECLB 1QMVA 2LJAA 4PQ1A 1AQVA 2CV4A 2VUPA 1YZXA 3GA4A 4MMMA 5DQYA 2VCXA 4BPYA 4BA7A 2IWTA 2C0FA 5ECPB 5D9TA 1G6WA 2YZHA 2LSTA 1XW6A 2KP1A 4IHUA 4MDCA 3LJRA 3VWVA 1UN2A 1EEJA 1PKWA 3WGDA 4V2NA 3VWWA 1GSUA 3TKSA 3EC3A 2FWEA 3GHAA 2I3YA 3GFKA 5FT3A 1Z7PA 2GSTA 4OMVA 3CRUA 4IVFA 11GSA 3ZIVA 4GQCA 1GNWA 1S3DA 2DJ2A 1OKDA 1OE8A 3GN3A 4CW9A 3KH9A 2FD3A 4HJMA 4NHZA 1U88A 2YCDA 1AC1A 1TP9A 2XC2A 3P2AA 2FCHA 3M9JA 1B4QA 2DJ0A 3CRTA 3QFAC 5F07A 2X8GA 4OFMA 3I69A 3VURA 2AUVA 4POMA 1G7EA 2ON7A 4TR1B 2K8SA 2YN1A 2DLXA 1ZMAA 5H5SA 3TOUA 4G10A 5CRWA 3FHKA 3CBUA 3LSZA 2NBSA 1HNBA 4N30A 4V1Ag 2FNOA 3UIWA 4MF6A 5CREA 1XWBA 4KB3A 1SKWB 1Y6EA 4E8EA 4EL1A 2JSZA 4HZ2A 3GTUB 3KCMA 4OCEA 2I4AA 4O92A 3KXOA 1TTZA 4POKA 3C1SA 3ME7A 3GYKA 5AN1A 3UMAA 1A8YA 1M9BA 1PX7A 4ZB9A 4ZBDA 1GLPA 2FWHA 1XVQA 5ECMB 4ZILA 2H75A 2IMIA 5CRGA 4WETA 4LLRA 5E4WA 2E0QA 2KLXA 5B8AA 2H6YA 2GZPA 2G2QA 1J9BA 5KN0A 4KA0A 3PH9A 1K0AA 4J2FA 4EDYA 4LL1B 3F8UA 3GSTA 3TKSE 3HD5A 1DSBA 3L9UA 3K8NA 2IN3A 4ZL7A 1K0OA 2OACA 4G19A 4F0BA 4I5QA 4Q5QA 1AQWA 2RM5A 4BWQA 3FZ5A 5CYYA 2H72A 5DAKB 2IFQA 3L0HA 2L5LA 4N0VA 3GIXA 2EIRA 1QFNA 1TK8B 3IHQA 5JWOB 1GSSA 3C71A 3HKRA 5ECNB 4G9HA 4GSTA 5ID2A 1KNGA 1SL2B 1MEKA 3J7Yb 1A0FA 4GF0A 4BWSA 3H4KA 1MD3A 1TK0B 4IQAA 1OE7A 3RAZA 1GNEA 1C72A 4IP1A 7GSSA 5G5EA 3ZVJD 4ACSA 1Q4JA 1PRXA 1M2BA 2HXKA 3US3A 3QPMA 2HSYA 3EURA 1WE0A 1MDJA 5EL8A 3F4TA 2JSYA 2O8VB 4O32A 4HEA2 4JZQA 5G31A 3QAGA 1B4PA 3TRQA 2HYXA 4D73A 3BCKA 3GMFA 4F9ZA 1B8XA 1GSDA 1OKTA 1SD9A 2R3XA 4PURA 4KW6A 3RBTA 2ZNMA 1O73A 3TCOA 2YWNA 1YKCA 4MH2A 1M99A 3R2QA 6GSUA 1HYUA 1XIYA 3WGXA 1E6BA 1FVKA 4IW9A 3W8JA 3GL3A 2QSIA 4F0CA 1OC9B 1USBA 4RQRA 5IPGA 2HRFA 5IOWA 3ZL5A 1SYXA 1ZZYA 3M3MA 2R2JA 4MABA 3Q19A 2X8HA 2PGTA 3MDKA 3WGEA 3QCPA 3QFBC 5DCHA 4I2UA 1J0FA 1B9YC 5HR3A 4NXIA 1VF4A 3FR9A 4HQZA 1ZGNA 4L0WA 2C0EA 3QDNA 1ZL9A 2LUSA 2YPMA 3F9UA 3SBCA 2AV4A 2C80A 1ERTA 2H1DA 2PMTA 4ECCA 1XW5A 1SK1A 3BOAA 2C3TA 1GLQA 3LYKA 4IELA 1Y25A 3LG6A 3ISOA 3A2VA 5CO3A 4TKYA 2A2SA 4AJ6A 1B48A 5EY6A 4XRAA 3BBYA 4TVEA 5LCZA 2HZEA 4HU9A 2C3QA 1SYRA 2KP2A 2FWFA 4G2EA 1UA5A 1PX6A 2FGXA 2L57A 1GRXA 4ECBA 5AISA 4F82A 1ST9A 2NVLA 1JZOA 4O7HA 4Z7XA 2H30A 2IMKA 3TKPA 2XBQA 1QGVA 2E2GA 1ILOA 3EU4A 3HDCA 4IN0A 3I43A 4KUNA 1K0CA 3KD0A 2YP6A 2H6XA 3FR6A 3H8QA 1XPVA 1FW1A 2OE0A 1YEXA 2HLSA 2DJ3A 2P31A 2CQ9A 1EV9A 2GQLA 3CSHA 1YF0A 2GT6A 2WULA 2A2RA 3CXGA 1HD2A 3I6AA 4L5LA 1SJ6A 4MPGA 2YJHA 1NM3A 1CQGA 3O76A 3UARA 3LEFA 2I81A 3OR5A 4HI7A 2VOCA 2VLVA 1YJ6A 4MPFA 4HS1A 3GKKA 1MD4A 5FHIA 3KTBA 1HQOA 2HSHA 2YZUA 1SK2A 2TRXA 5KEJA 2WRTA 2CVKA 3IA1A 4I8BA 3MNGA 4TW5A 2YOIA 2K9FA 4ISDA 1OAZA 1K3LA 1A0RP 2EIQA 3GKNA 1T7PB 5GAPD 3LYPA 3I9V2 1V98A 3VPQA 5GAND 1F2EA 1B9XC 3QAVA 2KOKA 2ES7A 1LU4A 3HVVA 1GUMA 1PA3A 4JR6A 2CVDA 2F51A 3CTFA 2HE3A 2FLSA 4IQ1A 1QK8A 2DMMA 5D93A 5D9VA 4RI7A 3TUEA 5DVBA 2DIZA 2B5YA 2PPTA 5F8BA 2GGTA 1QQ2A 4KH7A 1S3CA 3AY8A 1G6YA 3C1RA 4XIHA 3FW2A 2PU9C 2D2ZA 5HFIA 3JCML 2L4QA 5DDLA 3KH7A 2WFCA 18GSA 2WJUA 19GSA 4HQSA 3F6DA 4L5OA 4RQXA 4YAPA 2IMFA 3CSJA 2EIOA 3L78A 1JHBA 2V32A 2FA4A 2IMEA 3A3TA 4WF4A 3EVIA 3IK7A 2J23A 4I2TA 1WWJA 1W4VA 5A5KA 2FY6A 6GSVA 1MTCA 2H1AA 3FZ4A 1EGRA 1R26A 3FZ9A 1DUGA 4QL7A 1LBKA 1VF2A 5IOXA 1GUKA 4POLA 4XTSA 2VL2C 3DKSA 2B7KA 2CAQA 2KUCA 1UVZA 4GLTA 1GSFA 1E2YA 4V2MA 4OD7A 1N8JA 4MF7A 5L71A 1K0BA 1SU9A 1U87A 1K3YA 5HR1A 1NHYA 2P5QA 5F0GA 4DSQA 1X9MB 2DBCA 4PGTA 1A2MA 3A5WA 2LNTA 4GSSA 4QL9A 5G30A 1F37A 3QAWA 4J57E 1KEBA 3LFLA 2QKEA 4KNDA 2OBIA 4GCIA 1TU7A 1BQ7A 1OC9A 1R5AA 1XBSA 3ED3A 2VL2A 3ERGA 1PKZA 3DVWA 2I1UA 2DJ1A 5A4VA 1PQNA 1V40A 2B5XA 5CRDA 17GSA 2B3SA 3LGCA 3APSA 1O6JA 1X5DA 4J56E 1M0UA 3J7Yk 4IGJA 4QQ7A 3FKFA 1U6TA 4F2IA 2BTOT 2E7PA 5IMVA 5JCGA 16GSA 3ERFA 3IAM2 5KN3A 2C1YA 4KCAA 1K0DA 1MDKA 4EVMA 4OO5A 2LS5A 4PUFC 2I9HA 3GH9A 4K7NA 3VK9A 2RUEA 5ECOB 3IAS2 3HVSA 1PSQA 2WZ9A 5D73A 1XZOA 1ACVA 3Q74A 1SD8A 3F0IA 3WD6A 4N10A 13GSA 2X99A 3DMLA 4RI6A 1X9WB 2YWIA 5EPFA 5B8BA 2NDOA 1THXA 3LWAA 5HR2A 1HNCA 3H79A 2JU5A 2C8UA 1GSQA 1OYJA 1A8LA 4WR4A 1VF1A 4MH3A 3VWXA 2H1GA 4BVYA 6GSWA 5F06A 1EP7A 2K8VA 3ZTLA 3DIEA 3RPNA 4KGIA 3DWVA 3ZMLA 3KP8A 3GURA 5E59A 1FG4A 2YWOA 2HNLA 2LRCA 1TJDA 5KN2A 4KSOA 2RIIA 3G7JA 3KTLA 1Z6NA 2O89A 1V57A 2LKUA 2H6ZA 3TOTA 3GX0A 1FB0A 3RPPA 4KSMA 4K8MA 1T1VA 4MJCA 1YEPA 2WCIA 5IMFA 3UJ1A 5DALA 2CZ2A 1PMTA 3EE2A 2O87A 2J9HA 2L4CA 3GKXA 3M0FA 2L5OA 1KTEA 2CAIA 4KE3A 3TJBA 3EYTA 1O8WA 5DCGA 4ZL9A 3CSIA 5GZZB 1ON4A 2B7JA 1WIKA 1H4OA 2CVBA 4JBBA 2AJQB 3D5JA 1XWGA 1ZOFA 5J4UA 1QXHA 1J08A 4EE0A 2PN8A 1EEMA 2FWGA 3O6TA 2DC5A 2GZZA 3UL3A 3D22A 2H8LA 5GSSA 4AGSA 4H86A 1A2JA 3VI5A 2L6DA 4AJ7A 2H0GA 4NHWA 5IMCA 3BD2A 5JWQB 3FY7A 1XWAA 1F3BA 4IKHA 2DSAA 4IJIA 4XRDA 2AHEA 3HZ8A 2XPDA 2R6KA 1XCCA 2JZSA 2ZUPA 1EP8A 3U6VA 2GVPA 4GRFA 3G7IA 1NHOA 1ERUA 4KCEA 3KJYA 3V1WA 4WF5A 4ML1A 3GRXA 1A24A 2MBTA 2BMXA 5IMDA 5J41A 5DQSA 3TJJA 4EUYA 5ELGA 3G9BA 3F6FA 3D4TA 5J3RA 3IK9A 2TRCP 3EWLA 4TN8A 1YY7A 1PD21 2LJKA 4DSSB 2H1BA 3H93A 2GSQA 3UBLA 4HZ4A 3TKRA 4ZBBA 4ECIA 3LQ7A 4XHMA 1GTBA 2OA7A 1ZYEA 1EZKA 3N9JA 2IMDA 5JWRB 4HUAA 1PL2A 2GLRA 3FR3A 1X9SB 2DJKA 2VO4A 1TOFA 4WR5A 2QC7A 1DBYA 2O85A 5HR0A 3D21A 2M80A 3UVHA 3TJGA 1T3BA 1GWCA 5ECKB 5IPHA 5CAXA 1GTUA 4ML6A 2JZRA 1BJXA 2X64A 1VGLA 3ZREA 5B6NA 1G0TA 1URMA 1U3AA 2YNXA 1TI3A 5G5FA 22GSA 5CP1A 5ECRB 1I9DA 3TRXA 2GSRA 4MZWA 4OO4A 3ZRDA 2LQQA 1WRYA 4AJ8A 4TR0A 1XXUA 4L8EA 4RUVA 2PWJA 2JZTA 4TR1A 4FYCA 2OADA 1Z3EA 5ECSA 1ERVA 3P8WA 2R4VA 2B6MA 3FRCA 3WYWA 10GSA 1AIUA 1TKDB 3NOFA 1YQ1A 3C73A 4V2LA 6GSXA 1Z6MA 3EMPA 4KDXA 3KZQA 3BCIA 1W89A 2IFQB 2CX3A 2GDRA 3TJFA 3LORA 3E3EA 3GTUA 6GSSA 2C3NA 3TKQA 3CYNA 5ECHB 3ZIJA 2H19A 4LA1A 2N5AA 4KDYA 3GNJA 1V2AA 3GV1A 1TK5B 2ALBA 1K3OA 2XHFA 4PNFA 5HQPA 4AF2A 5ELAA 1O8XA 2P5RA 4MJBA 3L9SA 4V1Ap 3DVXA 1BX9A 1FOVA 4EF0A 2N5BA 3A2WA 4MA9A 4HU7A 4NPBA 3GL5A 1SENA 5F05A 5EVOA 4WXTA 1GSEA 4HOJA 3E0UA 4WBJA 2WB9A 3QD9A 1PGTA 2EC4A 3PINA 2VCQA 3IE3A 2O7KA 5B7CA 3DXBA 2AYTA 2DJJA 3GSSA 4WKWA 3KGKA 2B1LA 2HZFA 1JZDA 3U5RE 1FAAA 3M8NA 5J9CA 3A2XA 2H76A 1R7HA 1XW9A 4XS6A 3KP9A 1AW9A 4L0UA 5KN1A 5DAKA 1AQXA 4DEJA 2VLUA 2MMOA 1BYEA 1SJIA 5D9XA 1JZRA 1K0NA 2H71A 3RHCA 4GTUA 2V1MA 1OC8A 3IOSA 2TIRA 3TDGA 2CZ3A 2Z9SA 1TI1A 2GTUA 2VAFA 3GUSA 4NAXA 1U3IA 3MAKA 2VCVA 1R4WA 4EDZA 2IL3A 3Q6OA 4O5RA 2VL9A 5D8IA 2YJ7A 4Q5RA 8GSSA 3N5OA 1GP1A 2WGRA 5GSTA 4I97A 3O3TA 1JFUA 3KMOA 2R5GA 4KX4A 2L59A 4NV2A 1YKAA 5C00A 4N11A 2VL3A 2AB6A 4IS0A 3KM6A 4PQIA 3UAPA 3ERWA 1R5PA 2M72A 4ILFA 2LEGA 1OVNA 4K2DA 3VLNA 2IIYA 4YQUA 4NMUA 3HZ4A 5G1LA 3UEMA 2HZEB 4BVXA 1AUCA 2REMA 3WT1A 1ERWA 3NZNA 2H01A 4LMWA
chains in the Genus database with same CATH superfamily
2XBIA 2QGVA 1A2LA 2GZYA 2VD0A 1Z9HA 1SK0A 1WPIA 5INYA 2V6KA 4JR4A 2P0GA 4ID0A 4K9ZA 2GQMA 2GS3A 2H70A 1M3IA 4X43A 1GTIA 1YF1A 4YQVA 2K18A 4JU5A 4EXJA 4DSSA 2RUFA 3IBHA 4F03A 5KOWA 4FIWA 4HDEA 3IPZA 1VRSD 2NTOA 2C0DA 3IDVA 4WEYA 5ECQB 4PX1A 2VCWA 5C04A 3CMIA 2F3MA 1QUWA 1EV4A 4PQHA 1GL8A 1ABAA 3M9KA 1T8EB 5DBQA 3KIJA 3F63A 3L4NA 2DIYA 1YDKA 1ZYNA 5D9WA 2CX4A 2V6OA 1EOHA 3E9JB 3F4RA 4TXOB 4KAEA 1LJRA 1ML6A 2MMAA 3M1GA 5HFGA 3GX8A 3DEXA 4WBRD 2RLIA 4TOPA 1TRVA 3LXZA 2PERA 5HFKA 2MBSA 1XWKA 3FYGA 3MYDA 1Z5YE 6GSTA 4GSNA 3F4SA 3EU3A 1TRSA 2CA8A 4IP6A 1M7TA 1WOUA 4ICYA 5H5QA 1K0MA 5IIZA 2HRKA 2PVQA 4GWRA 4OCFA 2OE1A 1M2DA 2G0FA 1O7UA 2VM1A 3IC4A 1SL0B 4CDOA 1Z7RA 3GKMA 1O81A 4TXVA 12GSA 4XS4B 3HA9A 2ON5A 4YAVA 2VD1A 4PUAA 4ZL8A 2IPAA 1JZWA 2MMNA 1XOBA 3D4MA 1BG5A 1T00A 1T4ZA 2DMLA 3HHVA 5JCWA 4FH8A 1MDIA 3F3RA 1SL1B 5CNWA 1N2AA 1F3AA 4ULXA 1OC3A 2FHEA 2GSSA 4I6XA 3DGQA 1RK4A 1T4YA 2KHPA 3PGTA 4MP4A 1BAYA 3IR4A 1GULA 5LNKe 2YANA 2H66A 3FEUA 5AIVA 4P3YB 4DSRA 4NV5A 4PXOA 1GTAA 5G1KA 2WS2A 2AAWA 4ECJA 3HYPA 1Q98A 2LRTA 20GSA 3WT2A 2VCZA 1WJKA 3ZLPA 1V58A 1EGOA 1WMJA 2E2MA 2PVOC 3HXSA 2ZCTA 1RW1A 2H0HA 2MMZA 1TRWA 2JADA 3HJMA 4LL4B 5ABRA 9GSSA 1F6MC 3W8SA 2OKAA 3D6IA 2VCTA 1ZCPA 4XS1A 3IXRA 1M2AA 4K2XA 4ZBAA 3IV4A 1H75A 4ZB6A 3HJPA 3LW9A 3BJ5A 3HJOA 5IO2A 3DD3A 1G7OA 2K6VA 1O85A 2IJYA 1XVWA 1VF3A 2A4VA 5H5RA 5J5NA 2VIMA 3P90A 3ZVJA 2OBKA 2OE3A 5B6MA 5AGYA 3FZAA 4MJAA 1I5GA 5FWGA 1EWXA 3GH6A 2HI7A 3VWUA 2FUG2 5IMZA 1X0RA 4DVCA 1NSWA 4X4JA 1TRUA 1FB6A 5CRHA 4HSCX 4HJ2A 2LTKA 1IYIA 4JEDA 4MCUA 4OFNA 1AAZA 4PNGA 3VPTA 4MLYA 2RM6A 3KEBA 2C4JA 4TR3A 2F9SA 2LQOA 3L9VA 3TB2A 3ZFBA 1TDIA 1JLWA 3RDWA 5D96A 3VI7A 3QOUA 5AIXA 4GXZA 4YQMA 4O5QA 1SJZA 3QR6A 1PN9A 2BJXA 2HT9A 1M9AA 4FYUA 3DYRA 3P7XA 1X5CA 5IQYA 4K7OA 1FVJA 2C0GA 1TU8A 2H74A 3ZFLA 2OJLA 4GQFA 3S9FA 3UVTA 2LNSA 4K1FA 3MIXA 4NWYA 3HY2A 4MK3A 1S3AA 1WP0A 4FO5A 2LJRA 5DJMA 1EOGA 4MZBA 4BVYB 3FK8A 4BL7A 5J9BA 2F8AA 3SWLA 4MF5A 4KDUA 3W6GA 5G2ZA 2YWMA 4K6XA 4EKZA 2WDUA 3H1NA 4ZB8A 4ZXGA 4FYBA 4USSA 2YV9A 1FO5A 1TW9A 2A4HA 3F3QA 4TR4A 1F9MA 3ZITA 4ZIJA 2N5FA 2VLTA 2PUKC 3DRNA 1A23A 3LXTA 1SKSB 2GT5A 3TJKA 5A4WA 5IO0A 4EC0A 3TGZA 1IYHA 5DALB 5IM9A 4MJEA 5A4UA 3IRAA 4E8HA 3QMXA 5IMAA 4TRXA 2MYGA 1SKRB 2JACA 5COHA 4IBPA 4POBA 1HNAA 1ZYQB 2HFDA 4OWYA 5ID2B 2L6CA 2XPEA 1DE1A 2LRNA 2R37A 1DE2A 2LV3A 1KBNA 1XOAA 2X4AA 3KMNA 1THOA 2GQKA 3NIVA 1JLVA 4YH2A 4MZCA 1FHEA 4XCSA 2NPBA 2JL4A 4TXOA 5DJLA 3C8EA 2YV7A 3G7YA 1RQMA 5BRTA 3EINA 1PL1A 3Q18A 4EO3A 5JCUA 3ZMKA 3D0ZA 3UBKA 1GUHA 3HCZA 3PR8A 4LMVA 2H73A 2V41A 2CT6A 2F8FA 4Q5FA 4D73B 4JRRA 6GSYA 1NW2A 1XWCA 1AXDA 3ZYWA 1S3RA 5LD0A 4IJ3A 3HVXA 14GSA 3APOA 4N0ZA 2H0IA 3TRPA 2FA8A 2PBJA 1XFLA 2HRNA 4K7IA 4X1UA 1BEDA 4XS4A 3VFIA 2MZCA 5ENUA 1X5EA 2VM2A 4OFTA 4Q5NA 1CQHA 4JE1A 3EMXA 4K0NA 4K0GA 4X0XA 1V9WA 3UOMA 2M46A 1TXXA 2X8CA 2B1KA 3RHBA 3APQA 4CHSA 1UC7A 3TKSC 3ME8A 3MWHA 3CTGA 1GSYA 4Z2RA 1GH2A 3ZZXA 3MSZA 2QA1A 2V2GA 3C7MA 2B5EA 5ECIB 5ECLB 1QMVA 2LJAA 4PQ1A 2DKHA 1AQVA 2CV4A 2VUPA 1YZXA 3GA4A 4MMMA 5DQYA 2VCXA 4BPYA 4BA7A 2IWTA 2C0FA 5ECPB 5D9TA 1G6WA 2YZHA 2LSTA 1XW6A 2KP1A 4IHUA 4MDCA 3LJRA 3VWVA 1UN2A 1EEJA 1PKWA 3WGDA 4V2NA 3VWWA 1GSUA 3TKSA 3EC3A 2FWEA 3GHAA 2I3YA 3GFKA 5FT3A 1Z7PA 2GSTA 4OMVA 3CRUA 4IVFA 11GSA 3ZIVA 4GQCA 1GNWA 1S3DA 2DJ2A 1OKDA 1OE8A 3GN3A 4CW9A 3KH9A 2FD3A 4HJMA 4NHZA 1U88A 2YCDA 1AC1A 4BIKA 1TP9A 2XC2A 3P2AA 2FCHA 3M9JA 1B4QA 2DJ0A 3CRTA 5KOXA 3QFAC 5F07A 2X8GA 4OFMA 3I69A 3VURA 2AUVA 4POMA 1G7EA 2ON7A 4TR1B 2K8SA 2YN1A 2DLXA 1ZMAA 4K5RA 5H5SA 3TOUA 4G10A 5CRWA 3FHKA 3CBUA 3LSZA 2NBSA 2R0PA 1HNBA 4N30A 4V1Ag 2FNOA 3UIWA 4MF6A 5CREA 1XWBA 4KB3A 1SKWB 3IHGA 1Y6EA 4E8EA 4EL1A 2JSZA 4HZ2A 3GTUB 3KCMA 4OCEA 2I4AA 4O92A 3KXOA 1TTZA 4POKA 3C1SA 3ME7A 3GYKA 5AN1A 3UMAA 1A8YA 1M9BA 1PX7A 4ZB9A 4ZBDA 1GLPA 2FWHA 1XVQA 5ECMB 2HSMA 4ZILA 2H75A 2IMIA 5CRGA 4WETA 4LLRA 5E4WA 2E0QA 2KLXA 5B8AA 2H6YA 2GZPA 2G2QA 1J9BA 5KN0A 4KA0A 3PH9A 1K0AA 4J2FA 4EDYA 4LL1B 3F8UA 3GSTA 3TKSE 3HD5A 1DSBA 3L9UA 3K8NA 2IN3A 4ZL7A 1K0OA 2OACA 4G19A 4F0BA 4I5QA 4Q5QA 1AQWA 2RM5A 4BWQA 3FZ5A 5CYYA 2H72A 5DAKB 2IFQA 3L0HA 2L5LA 4N0VA 3GIXA 2EIRA 1QFNA 2R0CA 1TK8B 3IHQA 5JWOB 1GSSA 3C71A 3HKRA 5ECNB 4G9HA 4GSTA 5ID2A 1KNGA 1SL2B 1MEKA 3J7Yb 1A0FA 4GF0A 4BWSA 3H4KA 1MD3A 1TK0B 4IQAA 1OE7A 3RAZA 1GNEA 1C72A 4IP1A 7GSSA 5G5EA 3ZVJD 4ACSA 1Q4JA 1PRXA 1M2BA 2HXKA 3US3A 3QPMA 2HSYA 3EURA 1WE0A 1MDJA 5EL8A 3F4TA 2JSYA 2O8VB 4O32A 4HEA2 4JZQA 5G31A 3QAGA 1B4PA 3TRQA 2HYXA 4D73A 3BCKA 3GMFA 4F9ZA 1B8XA 1GSDA 1OKTA 1SD9A 2R3XA 4PURA 4KW6A 3RBTA 2ZNMA 1O73A 3TCOA 2YWNA 1YKCA 4CY8A 4MH2A 1M99A 4BVXB 3R2QA 6GSUA 1HYUA 1XIYA 3WGXA 1E6BA 1FVKA 4IW9A 3W8JA 3GL3A 2QSIA 4F0CA 1OC9B 2X49A 1USBA 4RQRA 5IPGA 2HRFA 5IOWA 3ZL5A 1SYXA 1ZZYA 3M3MA 2R2JA 4MABA 3Q19A 2X8HA 2PGTA 3MDKA 3WGEA 3QCPA 3QFBC 5DCHA 4I2UA 3FMWA 1J0FA 1B9YC 5HR3A 4NXIA 1VF4A 3FR9A 4HQZA 1ZGNA 4L0WA 2C0EA 3QDNA 1ZL9A 2LUSA 2YPMA 3F9UA 3SBCA 2AV4A 2C80A 1ERTA 2H1DA 2PMTA 4ECCA 1XW5A 1SK1A 3BOAA 2C3TA 1GLQA 3LYKA 4IELA 1Y25A 3LG6A 3ISOA 3A2VA 5CO3A 4TKYA 2A2SA 4AJ6A 1B48A 5EY6A 4XRAA 3BBYA 4TVEA 5LCZA 2HZEA 4HU9A 2C3QA 1SYRA 2KP2A 2FWFA 4G2EA 3R3EA 1UA5A 1PX6A 2FGXA 2L57A 1GRXA 4ECBA 5AISA 4F82A 1ST9A 2NVLA 1JZOA 4O7HA 4Z7XA 2H30A 2IMKA 3TKPA 2XBQA 1QGVA 2E2GA 1ILOA 3EU4A 3HDCA 4IN0A 3I43A 4KUNA 1K0CA 3KD0A 2YP6A 2H6XA 3FR6A 3H8QA 1XPVA 1FW1A 2OE0A 1YEXA 2HLSA 2DJ3A 2P31A 2CQ9A 1EV9A 2GQLA 3IC8A 3CSHA 1YF0A 2GT6A 2WULA 2A2RA 3CXGA 1HD2A 3I6AA 4L5LA 1SJ6A 4MPGA 2YJHA 1NM3A 1CQGA 3O76A 3UARA 3LEFA 2I81A 3OR5A 4HI7A 4MNNA 2VOCA 2VLVA 1YJ6A 4MPFA 4HS1A 3GKKA 1MD4A 5FHIA 3KTBA 1HQOA 2HSHA 2YZUA 1SK2A 2TRXA 2UZ8A 5KEJA 2WRTA 2CVKA 3IA1A 4I8BA 3MNGA 4TW5A 2YOIA 2K9FA 4ISDA 1OAZA 1K3LA 1A0RP 2EIQA 3GKNA 1T7PB 5GAPD 3LYPA 3I9V2 1V98A 3VPQA 5GAND 1F2EA 1B9XC 3QAVA 2KOKA 2ES7A 1LU4A 3HVVA 1GUMA 3HVNA 1PA3A 4YKFA 4JR6A 2CVDA 2F51A 3CTFA 2HE3A 2FLSA 4IQ1A 1QK8A 2DMMA 5D93A 5D9VA 4RI7A 3TUEA 5DVBA 2DIZA 2B5YA 2PPTA 5F8BA 2GGTA 1QQ2A 4KH7A 1S3CA 3AY8A 1G6YA 3C1RA 4XIHA 3FW2A 2PU9C 2D2ZA 5HFIA 3JCML 2L4QA 5DDLA 3KH7A 4G0KA 2WFCA 18GSA 2WJUA 19GSA 4HQSA 3F6DA 4L5OA 4RQXA 4YAPA 2IMFA 3CSJA 2EIOA 3L78A 1JHBA 2V32A 2FA4A 4G0IA 4KF9A 3A5IA 2IMEA 3A3TA 4WF4A 4K5SA 3EVIA 3IK7A 2J23A 4I2TA 1WWJA 1W4VA 5A5KA 2FY6A 6GSVA 1MTCA 2H1AA 3FZ4A 1EGRA 1R26A 3FZ9A 1DUGA 4QL7A 1LBKA 1VF2A 3CQFA 5IOXA 1GUKA 4POLA 4XTSA 2VL2C 3DKSA 2B7KA 2CAQA 2KUCA 1UVZA 4GLTA 1GSFA 1E2YA 4V2MA 4OD7A 1N8JA 4MF7A 5L71A 1K0BA 1SU9A 1U87A 1K3YA 5HR1A 1NHYA 2P5QA 5F0GA 4DSQA 1X9MB 2DBCA 4PGTA 1A2MA 3A5WA 2LNTA 4GSSA 4QL9A 5G30A 1F37A 3QAWA 4J57E 1KEBA 3LFLA 4BL7B 2QKEA 4KNDA 2OBIA 4GCIA 1TU7A 1BQ7A 1OC9A 1R5AA 1XBSA 3ED3A 2VL2A 3ERGA 1PKZA 3DVWA 2I1UA 2DJ1A 5A4VA 1PQNA 1V40A 2B5XA 5CRDA 17GSA 2B3SA 3LGCA 3APSA 1O6JA 1X5DA 4J56E 1M0UA 3J7Yk 4IGJA 4QQ7A 2HRAA 3FKFA 1U6TA 4F2IA 2BTOT 2E7PA 5IMVA 5JCGA 16GSA 3ERFA 3IAM2 5KN3A 2C1YA 4KCAA 1K0DA 1MDKA 4EVMA 4OO5A 2LS5A 4PUFC 2I9HA 3GH9A 4K7NA 3VK9A 2RUEA 5ECOB 4YKGA 3IAS2 3HVSA 1PSQA 2WZ9A 5D73A 1XZOA 1ACVA 3Q74A 2QA2A 1SD8A 3F0IA 3WD6A 4N10A 13GSA 2X99A 3DMLA 4RI6A 1X9WB 2YWIA 5EPFA 5B8BA 2NDOA 1THXA 3LWAA 5HR2A 1HNCA 3H79A 2JU5A 2C8UA 1GSQA 1OYJA 1A8LA 4WR4A 1VF1A 4MH3A 3VWXA 2H1GA 4BVYA 6GSWA 5F06A 1EP7A 2K8VA 3ZTLA 3DIEA 3RPNA 4KGIA 3DWVA 3ZMLA 3KP8A 3GURA 5E59A 1FG4A 2YWOA 2HNLA 4Z2TA 2LRCA 1TJDA 5KN2A 4KSOA 2RIIA 3G7JA 3KTLA 1Z6NA 4PTSA 2O89A 1V57A 2LKUA 2H6ZA 3TOTA 3GX0A 1FB0A 3RPPA 4KSMA 4K8MA 1T1VA 4MJCA 1YEPA 2WCIA 5IMFA 3UJ1A 5DALA 2CZ2A 1PMTA 3EE2A 2O87A 2DKIA 2J9HA 2L4CA 3GKXA 3M0FA 2L5OA 1KTEA 2CAIA 4KE3A 3TJBA 3EYTA 1O8WA 5DCGA 4ZL9A 3CSIA 5GZZB 1ON4A 2B7JA 1WIKA 1H4OA 2CVBA 4JBBA 2AJQB 3PPUA 3D5JA 1XWGA 1ZOFA 5J4UA 1QXHA 1J08A 4EE0A 2PN8A 1EEMA 2FWGA 3O6TA 2DC5A 2GZZA 3UL3A 3D22A 2H8LA 4Z2UA 5GSSA 4AGSA 4H86A 1PN0A 1A2JA 3VI5A 2L6DA 4AJ7A 2H0GA 4NHWA 5IMCA 3BD2A 5JWQB 3FY7A 1XWAA 1F3BA 4IKHA 2DSAA 4IJIA 4XRDA 2AHEA 3HZ8A 2XPDA 2R6KA 1XCCA 2JZSA 2ZUPA 1FOHA 1EP8A 3U6VA 2GVPA 4GRFA 3G7IA 1NHOA 1ERUA 4KCEA 3KJYA 3V1WA 4WF5A 4ML1A 3GRXA 1A24A 2MBTA 2BMXA 5IMDA 4CY6A 5J41A 5DQSA 3TJJA 4EUYA 5ELGA 3G9BA 3F6FA 3D4TA 5J3RA 3IK9A 2TRCP 1M3JA 3EWLA 4TN8A 1YY7A 1PD21 2LJKA 4DSSB 2H1BA 3H93A 2GSQA 3UBLA 4HZ4A 3TKRA 4ZBBA 4ECIA 3LQ7A 4XHMA 1GTBA 2OA7A 1ZYEA 1EZKA 3N9JA 2IMDA 5JWRB 4HUAA 1ZYPA 1PL2A 2GLRA 3FR3A 1X9SB 2DJKA 2VO4A 1TOFA 4WR5A 2QC7A 1DBYA 2O85A 5HR0A 3D21A 2M80A 3UVHA 3TJGA 1T3BA 1GWCA 5ECKB 5IPHA 5CAXA 1GTUA 4ML6A 2JZRA 1BJXA 2X64A 1VGLA 3ZREA 5B6NA 1G0TA 1URMA 1U3AA 2YNXA 1TI3A 5G5FA 22GSA 1PFOA 5CP1A 5ECRB 1I9DA 3TRXA 2GSRA 4MZWA 4OO4A 3ZRDA 2LQQA 1WRYA 4AJ8A 4TR0A 1XXUA 4L8EA 4RUVA 2PWJA 2JZTA 4TR1A 4FYCA 2OADA 1Z3EA 5ECSA 1ERVA 3P8WA 2R4VA 2B6MA 3FRCA 3WYWA 10GSA 1AIUA 1TKDB 3NOFA 1YQ1A 3C73A 4V2LA 6GSXA 1Z6MA 3EMPA 4KDXA 3KZQA 3BCIA 4EIQA 1W89A 2IFQB 2CX3A 2GDRA 3TJFA 3LORA 3E3EA 3GTUA 6GSSA 2C3NA 3TKQA 3CYNA 5ECHB 3ZIJA 2H19A 4LA1A 2N5AA 4KDYA 3GNJA 1V2AA 3GV1A 1TK5B 2ALBA 1K3OA 2XHFA 4PNFA 5HQPA 4AF2A 5ELAA 1O8XA 2P5RA 4MJBA 3L9SA 4V1Ap 3DVXA 1BX9A 4FQUA 1FOVA 4EF0A 2N5BA 3A2WA 4MA9A 4HU7A 4NPBA 3GL5A 1SENA 5F05A 4WXTA 5EVOA 2R0GA 1GSEA 4HOJA 3E0UA 4WBJA 2WB9A 3QD9A 1PGTA 2EC4A 3PINA 2VCQA 3IE3A 2O7KA 5B7CA 3DXBA 2AYTA 2DJJA 3GSSA 4WKWA 3KGKA 2B1LA 2HZFA 1JZDA 3U5RE 1FAAA 3M8NA 5J9CA 3A2XA 4O5UA 2H76A 4G0LA 1R7HA 1XW9A 4XS6A 3KP9A 1AW9A 4L0UA 5KN1A 5DAKA 1AQXA 4DEJA 2VLUA 2MMOA 1BYEA 1SJIA 3EPTA 5D9XA 4EIPA 1JZRA 1K0NA 2H71A 3RHCA 4GTUA 2V1MA 1OC8A 3IOSA 2TIRA 3TDGA 1XG8A 4A5PA 2CZ3A 2Z9SA 1TI1A 2GTUA 2VAFA 3GUSA 4NAXA 1U3IA 3MAKA 2VCVA 1R4WA 4EDZA 2IL3A 3Q6OA 4O5RA 2VL9A 5D8IA 2YJ7A 4Q5RA 8GSSA 3N5OA 1GP1A 2WGRA 5GSTA 4I97A 3O3TA 1JFUA 3KMOA 5BMUA 2R5GA 4KX4A 2L59A 4NV2A 1YKAA 5C00A 2A2PA 2VL3A 4N11A 2AB6A 4IS0A 3KM6A 4PQIA 3UAPA 3ERWA 1R5PA 2M72A 4ILFA 2LEGA 1OVNA 4K2DA 3VLNA 2IIYA 4YQUA 4NMUA 3HZ4A 5G1LA 3UEMA 2HZEB 4BVXA 1AUCA 2REMA 3WT1A 1ERWA 3NZNA 2H01A 4LMWA
chains in the Genus database with same CATH topology
2XBIA 2QGVA 1A2LA 2GZYA 2VD0A 1Z9HA 1SK0A 1WPIA 5INYA 2V6KA 4JR4A 2P0GA 4ID0A 4K9ZA 2GQMA 2GS3A 2H70A 4X43A 1GTIA 1YF1A 4YQVA 2K18A 4JU5A 4EXJA 4DSSA 2RUFA 3IBHA 4F03A 5KOWA 4FIWA 4HDEA 3IPZA 1VRSD 2NTOA 2C0DA 3IDVA 4WEYA 5ECQB 4PX1A 2VCWA 5C04A 3CMIA 2F3MA 1QUWA 1EV4A 4PQHA 1GL8A 1ABAA 3M9KA 1T8EB 5DBQA 3KIJA 3F63A 3L4NA 2DIYA 1YDKA 1ZYNA 5D9WA 2CX4A 2V6OA 1EOHA 3E9JB 3F4RA 4TXOB 4KAEA 1LJRA 1ML6A 2MMAA 3M1GA 5HFGA 3GX8A 3DEXA 4WBRD 2RLIA 4TOPA 1TRVA 3LXZA 2PERA 5HFKA 2MBSA 1XWKA 3FYGA 3MYDA 1Z5YE 6GSTA 4GSNA 3F4SA 3EU3A 1TRSA 2CA8A 4IP6A 1M7TA 1WOUA 4ICYA 5H5QA 1K0MA 5IIZA 2HRKA 2PVQA 4GWRA 4OCFA 2OE1A 1M2DA 2G0FA 1O7UA 2VM1A 3IC4A 1SL0B 4CDOA 1Z7RA 3GKMA 1O81A 4TXVA 12GSA 4XS4B 3HA9A 2ON5A 4YAVA 2VD1A 4PUAA 4ZL8A 2IPAA 1JZWA 2MMNA 1XOBA 3D4MA 1BG5A 1T00A 1T4ZA 2DMLA 3HHVA 5JCWA 4FH8A 1MDIA 3F3RA 1SL1B 5CNWA 1N2AA 1F3AA 4ULXA 1OC3A 2FHEA 2GSSA 4I6XA 3DGQA 1RK4A 1T4YA 2KHPA 3PGTA 4MP4A 1BAYA 3IR4A 1GULA 5LNKe 2YANA 2H66A 3FEUA 5AIVA 4P3YB 4DSRA 4NV5A 4PXOA 1GTAA 5G1KA 2WS2A 2AAWA 4ECJA 3HYPA 1Q98A 2LRTA 20GSA 3WT2A 2VCZA 1WJKA 3ZLPA 1V58A 1EGOA 1WMJA 2E2MA 2PVOC 3HXSA 2ZCTA 1RW1A 2H0HA 2MMZA 1TRWA 2JADA 3HJMA 4LL4B 5ABRA 9GSSA 1F6MC 3W8SA 2OKAA 3D6IA 2VCTA 1ZCPA 4XS1A 3IXRA 1M2AA 4K2XA 4ZBAA 3IV4A 1H75A 4ZB6A 3HJPA 3LW9A 3BJ5A 3HJOA 5IO2A 3DD3A 1G7OA 2K6VA 1O85A 2IJYA 1XVWA 1VF3A 2A4VA 5H5RA 5J5NA 2VIMA 3P90A 3ZVJA 2OBKA 2OE3A 5B6MA 5AGYA 3FZAA 4MJAA 1I5GA 5FWGA 1EWXA 3GH6A 2HI7A 3VWUA 2FUG2 5IMZA 1X0RA 4DVCA 1NSWA 4X4JA 1TRUA 1FB6A 5CRHA 4HJ2A 2LTKA 1IYIA 4JEDA 4MCUA 4OFNA 1AAZA 4PNGA 3VPTA 4MLYA 2RM6A 3KEBA 2C4JA 4TR3A 2F9SA 2LQOA 3L9VA 3TB2A 3ZFBA 1TDIA 1JLWA 3RDWA 5D96A 3VI7A 3QOUA 5AIXA 4GXZA 4YQMA 4O5QA 1SJZA 3QR6A 1PN9A 2BJXA 2HT9A 1M9AA 4FYUA 3DYRA 3P7XA 1X5CA 5IQYA 4K7OA 1FVJA 2C0GA 1TU8A 2H74A 3ZFLA 2OJLA 4GQFA 3S9FA 3UVTA 2LNSA 4K1FA 3MIXA 4NWYA 3HY2A 4MK3A 1S3AA 1WP0A 4FO5A 2LJRA 5DJMA 1EOGA 4MZBA 4BVYB 3FK8A 4BL7A 5J9BA 2F8AA 3SWLA 4MF5A 4KDUA 3W6GA 5G2ZA 2YWMA 4K6XA 4EKZA 2WDUA 3H1NA 4ZB8A 4ZXGA 4FYBA 4USSA 2YV9A 1FO5A 1TW9A 2A4HA 3F3QA 4TR4A 1F9MA 3ZITA 4ZIJA 2N5FA 2VLTA 2PUKC 3DRNA 1A23A 3LXTA 1SKSB 2GT5A 3TJKA 5A4WA 5IO0A 4EC0A 3TGZA 1IYHA 5DALB 5IM9A 4MJEA 5A4UA 3IRAA 4E8HA 3QMXA 5IMAA 4TRXA 2MYGA 1SKRB 2JACA 5COHA 4IBPA 4POBA 1HNAA 1ZYQB 2HFDA 4OWYA 5ID2B 2L6CA 2XPEA 1DE1A 2LRNA 2R37A 1DE2A 2LV3A 1KBNA 1XOAA 2X4AA 3KMNA 1THOA 2GQKA 3NIVA 1JLVA 4YH2A 4MZCA 1FHEA 4XCSA 2NPBA 2JL4A 4TXOA 5DJLA 3C8EA 2YV7A 3G7YA 1RQMA 5BRTA 3EINA 1PL1A 3Q18A 4EO3A 5JCUA 3ZMKA 3D0ZA 3UBKA 1GUHA 3HCZA 3PR8A 4LMVA 2H73A 2V41A 2CT6A 2F8FA 4Q5FA 4D73B 4JRRA 6GSYA 1NW2A 1XWCA 1AXDA 3ZYWA 5LD0A 4IJ3A 3HVXA 14GSA 3APOA 4N0ZA 2H0IA 3TRPA 2FA8A 2PBJA 1XFLA 2HRNA 4K7IA 4X1UA 1BEDA 4XS4A 3VFIA 2MZCA 5ENUA 1X5EA 2VM2A 4OFTA 4Q5NA 1CQHA 4JE1A 3EMXA 4K0NA 4K0GA 4X0XA 1V9WA 3UOMA 2M46A 1TXXA 2X8CA 2B1KA 3RHBA 3APQA 4CHSA 1UC7A 3TKSC 3ME8A 3MWHA 3CTGA 1GSYA 4Z2RA 1GH2A 3ZZXA 3MSZA 2QA1A 2V2GA 3C7MA 2B5EA 5ECIB 5ECLB 1QMVA 2LJAA 4PQ1A 2DKHA 1AQVA 2CV4A 2VUPA 1YZXA 3GA4A 4MMMA 5DQYA 2VCXA 4BPYA 4BA7A 2IWTA 2C0FA 5ECPB 5D9TA 1G6WA 2YZHA 2LSTA 1XW6A 2KP1A 4IHUA 4MDCA 3LJRA 3VWVA 1UN2A 1EEJA 1PKWA 3WGDA 4V2NA 3VWWA 1GSUA 3TKSA 3EC3A 2FWEA 3GHAA 2I3YA 3GFKA 5FT3A 1Z7PA 2GSTA 4OMVA 3CRUA 4IVFA 11GSA 3ZIVA 4GQCA 1GNWA 1S3DA 2DJ2A 1OKDA 1OE8A 3GN3A 4CW9A 3KH9A 2FD3A 4HJMA 4NHZA 1U88A 2YCDA 1AC1A 1TP9A 2XC2A 3P2AA 2FCHA 3M9JA 1B4QA 2DJ0A 3CRTA 5KOXA 3QFAC 5F07A 2X8GA 4OFMA 3I69A 3VURA 2AUVA 4POMA 1G7EA 2ON7A 4TR1B 2K8SA 2YN1A 2DLXA 1ZMAA 4K5RA 5H5SA 3TOUA 4G10A 5CRWA 3FHKA 3CBUA 3LSZA 2NBSA 2R0PA 1HNBA 4N30A 4V1Ag 2FNOA 3UIWA 4MF6A 5CREA 1XWBA 4KB3A 1SKWB 3IHGA 1Y6EA 4E8EA 4EL1A 2JSZA 4HZ2A 3GTUB 3KCMA 4OCEA 2I4AA 4O92A 3KXOA 1TTZA 4POKA 3C1SA 3ME7A 3GYKA 5AN1A 3UMAA 1A8YA 1M9BA 1PX7A 4ZB9A 4ZBDA 1GLPA 2FWHA 1XVQA 5ECMB 2HSMA 4ZILA 2H75A 2IMIA 5CRGA 4WETA 4LLRA 5E4WA 2E0QA 2KLXA 5B8AA 2H6YA 2GZPA 2G2QA 1J9BA 5KN0A 4KA0A 3PH9A 1K0AA 4J2FA 4EDYA 4LL1B 3F8UA 3GSTA 3TKSE 3HD5A 1DSBA 3L9UA 3K8NA 2IN3A 4ZL7A 1K0OA 2OACA 4G19A 4F0BA 4I5QA 4Q5QA 1AQWA 2RM5A 4BWQA 3FZ5A 5CYYA 2H72A 5DAKB 2IFQA 3L0HA 2L5LA 4N0VA 3GIXA 2EIRA 1QFNA 2R0CA 1TK8B 3IHQA 5JWOB 1GSSA 3C71A 3HKRA 5ECNB 4G9HA 4GSTA 5ID2A 1KNGA 1SL2B 1MEKA 3J7Yb 1A0FA 4GF0A 4BWSA 3H4KA 1MD3A 1TK0B 4IQAA 1OE7A 3RAZA 1GNEA 1C72A 4IP1A 7GSSA 5G5EA 3ZVJD 4ACSA 1Q4JA 1PRXA 1M2BA 2HXKA 3US3A 3QPMA 2HSYA 3EURA 1WE0A 1MDJA 5EL8A 3F4TA 2JSYA 2O8VB 4O32A 4HEA2 4JZQA 5G31A 3QAGA 1B4PA 3TRQA 2HYXA 4D73A 3BCKA 3GMFA 4F9ZA 1B8XA 1GSDA 1OKTA 1SD9A 2R3XA 4PURA 4KW6A 3RBTA 2ZNMA 1O73A 3TCOA 2YWNA 1YKCA 4CY8A 4MH2A 1M99A 4BVXB 3R2QA 6GSUA 1HYUA 1XIYA 3WGXA 1E6BA 1FVKA 4IW9A 3W8JA 3GL3A 2QSIA 4F0CA 1OC9B 2X49A 1USBA 4RQRA 5IPGA 2HRFA 5IOWA 3ZL5A 1SYXA 1ZZYA 3M3MA 2R2JA 4MABA 3Q19A 2X8HA 2PGTA 3MDKA 3WGEA 3QCPA 3QFBC 5DCHA 4I2UA 3FMWA 1J0FA 1B9YC 5HR3A 4NXIA 1VF4A 3FR9A 4HQZA 1ZGNA 4L0WA 2C0EA 3QDNA 1ZL9A 2LUSA 2YPMA 3F9UA 3SBCA 2AV4A 2C80A 1ERTA 2H1DA 2PMTA 4ECCA 1XW5A 1SK1A 3BOAA 2C3TA 1GLQA 3LYKA 4IELA 1Y25A 3LG6A 3ISOA 3A2VA 5CO3A 4TKYA 2A2SA 4AJ6A 1B48A 5EY6A 4XRAA 3BBYA 4TVEA 5LCZA 2HZEA 4HU9A 2C3QA 1SYRA 2KP2A 2FWFA 4G2EA 3R3EA 1UA5A 1PX6A 2FGXA 2L57A 1GRXA 4ECBA 5AISA 4F82A 1ST9A 2NVLA 1JZOA 4O7HA 4Z7XA 2H30A 2IMKA 3TKPA 2XBQA 1QGVA 2E2GA 1ILOA 3EU4A 3HDCA 4IN0A 3I43A 4KUNA 1K0CA 3KD0A 2YP6A 2H6XA 3FR6A 3H8QA 1XPVA 1FW1A 2OE0A 1YEXA 2HLSA 2DJ3A 2P31A 2CQ9A 1EV9A 2GQLA 3IC8A 3CSHA 1YF0A 2GT6A 2WULA 2A2RA 3CXGA 1HD2A 3I6AA 4L5LA 1SJ6A 4MPGA 2YJHA 1NM3A 1CQGA 3O76A 3UARA 3LEFA 2I81A 3OR5A 4HI7A 4MNNA 2VOCA 2VLVA 1YJ6A 4MPFA 4HS1A 3GKKA 1MD4A 5FHIA 3KTBA 1HQOA 2HSHA 2YZUA 1SK2A 2TRXA 2UZ8A 5KEJA 2WRTA 2CVKA 3IA1A 4I8BA 3MNGA 4TW5A 2YOIA 2K9FA 4ISDA 1OAZA 1K3LA 1A0RP 2EIQA 3GKNA 1T7PB 5GAPD 3LYPA 3I9V2 1V98A 3VPQA 5GAND 1F2EA 1B9XC 3QAVA 2KOKA 2ES7A 1LU4A 3HVVA 1GUMA 1PA3A 4YKFA 4JR6A 2CVDA 2F51A 3CTFA 2HE3A 2FLSA 4IQ1A 1QK8A 2DMMA 5D93A 5D9VA 4RI7A 3TUEA 5DVBA 2DIZA 2B5YA 2PPTA 5F8BA 2GGTA 1QQ2A 4KH7A 1S3CA 3AY8A 1G6YA 3C1RA 4XIHA 3FW2A 2PU9C 2D2ZA 5HFIA 3JCML 2L4QA 5DDLA 3KH7A 4G0KA 2WFCA 18GSA 2WJUA 19GSA 4HQSA 3F6DA 4L5OA 4RQXA 4YAPA 2IMFA 3CSJA 2EIOA 3L78A 1JHBA 2V32A 2FA4A 4G0IA 4KF9A 3A5IA 2IMEA 3A3TA 4WF4A 4K5SA 3EVIA 3IK7A 2J23A 4I2TA 1WWJA 1W4VA 5A5KA 2FY6A 6GSVA 1MTCA 2H1AA 3FZ4A 1EGRA 1R26A 3FZ9A 1DUGA 4QL7A 1LBKA 1VF2A 5IOXA 1GUKA 4POLA 4XTSA 2VL2C 3DKSA 2B7KA 2CAQA 2KUCA 1UVZA 4GLTA 1GSFA 1E2YA 4V2MA 4OD7A 1N8JA 4MF7A 5L71A 1K0BA 1SU9A 1U87A 1K3YA 5HR1A 1NHYA 2P5QA 5F0GA 4DSQA 1X9MB 2DBCA 4PGTA 1A2MA 3A5WA 2LNTA 4GSSA 4QL9A 5G30A 1F37A 3QAWA 4J57E 1KEBA 3LFLA 4BL7B 2QKEA 4KNDA 2OBIA 4GCIA 1TU7A 1BQ7A 1OC9A 1R5AA 1XBSA 3ED3A 2VL2A 3ERGA 1PKZA 3DVWA 2I1UA 2DJ1A 5A4VA 1PQNA 1V40A 2B5XA 5CRDA 17GSA 2B3SA 3LGCA 3APSA 1O6JA 1X5DA 4J56E 1M0UA 3J7Yk 4IGJA 4QQ7A 2HRAA 3FKFA 1U6TA 4F2IA 2BTOT 2E7PA 5IMVA 5JCGA 16GSA 3ERFA 3IAM2 5KN3A 2C1YA 4KCAA 1K0DA 1MDKA 4EVMA 4OO5A 2LS5A 4PUFC 2I9HA 3GH9A 4K7NA 3VK9A 2RUEA 5ECOB 4YKGA 3IAS2 3HVSA 1PSQA 2WZ9A 5D73A 1XZOA 1ACVA 3Q74A 2QA2A 1SD8A 3F0IA 3WD6A 4N10A 13GSA 2X99A 3DMLA 4RI6A 1X9WB 2YWIA 5EPFA 5B8BA 2NDOA 1THXA 3LWAA 5HR2A 1HNCA 3H79A 2JU5A 2C8UA 1GSQA 1OYJA 1A8LA 4WR4A 1VF1A 4MH3A 3VWXA 2H1GA 4BVYA 6GSWA 5F06A 1EP7A 2K8VA 3ZTLA 3DIEA 3RPNA 4KGIA 3DWVA 3ZMLA 3KP8A 3GURA 5E59A 1FG4A 2YWOA 2HNLA 4Z2TA 2LRCA 1TJDA 5KN2A 4KSOA 2RIIA 3G7JA 3KTLA 1Z6NA 4PTSA 2O89A 1V57A 2LKUA 2H6ZA 3TOTA 3GX0A 1FB0A 3RPPA 4KSMA 4K8MA 1T1VA 4MJCA 1YEPA 2WCIA 5IMFA 3UJ1A 5DALA 2CZ2A 1PMTA 3EE2A 2O87A 2DKIA 2J9HA 2L4CA 3GKXA 3M0FA 2L5OA 1KTEA 2CAIA 4KE3A 3TJBA 3EYTA 1O8WA 5DCGA 4ZL9A 3CSIA 5GZZB 1ON4A 2B7JA 1WIKA 1H4OA 2CVBA 4JBBA 2AJQB 3PPUA 3D5JA 1XWGA 1ZOFA 5J4UA 1QXHA 1J08A 4EE0A 2PN8A 1EEMA 2FWGA 3O6TA 2DC5A 2GZZA 3UL3A 3D22A 2H8LA 4Z2UA 5GSSA 4AGSA 4H86A 1PN0A 1A2JA 3VI5A 2L6DA 4AJ7A 2H0GA 4NHWA 5IMCA 3BD2A 5JWQB 3FY7A 1XWAA 1F3BA 4IKHA 2DSAA 4IJIA 4XRDA 2AHEA 3HZ8A 2XPDA 2R6KA 1XCCA 2JZSA 2ZUPA 1FOHA 1EP8A 3U6VA 2GVPA 4GRFA 3G7IA 1NHOA 1ERUA 4KCEA 3KJYA 3V1WA 4WF5A 4ML1A 3GRXA 1A24A 2MBTA 2BMXA 5IMDA 4CY6A 5J41A 5DQSA 3TJJA 4EUYA 5ELGA 3G9BA 3F6FA 3D4TA 5J3RA 3IK9A 2TRCP 3EWLA 4TN8A 1YY7A 1PD21 2LJKA 4DSSB 2H1BA 3H93A 2GSQA 3UBLA 4HZ4A 3TKRA 4ZBBA 4ECIA 3LQ7A 4XHMA 1GTBA 2OA7A 1ZYEA 1EZKA 3N9JA 2IMDA 5JWRB 4HUAA 1ZYPA 1PL2A 2GLRA 3FR3A 1X9SB 2DJKA 2VO4A 1TOFA 4WR5A 2QC7A 1DBYA 2O85A 5HR0A 3D21A 2M80A 3UVHA 3TJGA 1T3BA 1GWCA 5ECKB 5IPHA 5CAXA 1GTUA 4ML6A 2JZRA 1BJXA 2X64A 1VGLA 3ZREA 5B6NA 1G0TA 1URMA 1U3AA 2YNXA 1TI3A 5G5FA 22GSA 5CP1A 5ECRB 1I9DA 3TRXA 2GSRA 4MZWA 4OO4A 3ZRDA 2LQQA 1WRYA 4AJ8A 4TR0A 1XXUA 4L8EA 4RUVA 2PWJA 2JZTA 4TR1A 4FYCA 2OADA 1Z3EA 5ECSA 1ERVA 3P8WA 2R4VA 2B6MA 3FRCA 3WYWA 10GSA 1AIUA 1TKDB 3NOFA 1YQ1A 3C73A 4V2LA 6GSXA 1Z6MA 3EMPA 4KDXA 3KZQA 3BCIA 4EIQA 1W89A 2IFQB 2CX3A 2GDRA 3TJFA 3LORA 3E3EA 3GTUA 6GSSA 2C3NA 3TKQA 3CYNA 5ECHB 3ZIJA 2H19A 4LA1A 2N5AA 4KDYA 3GNJA 1V2AA 3GV1A 1TK5B 2ALBA 1K3OA 2XHFA 4PNFA 5HQPA 4AF2A 5ELAA 1O8XA 2P5RA 4MJBA 3L9SA 4V1Ap 3DVXA 1BX9A 4FQUA 1FOVA 4EF0A 2N5BA 3A2WA 4MA9A 4HU7A 4NPBA 3GL5A 1SENA 5F05A 4WXTA 5EVOA 2R0GA 1GSEA 4HOJA 3E0UA 4WBJA 2WB9A 3QD9A 1PGTA 2EC4A 3PINA 2VCQA 3IE3A 2O7KA 5B7CA 3DXBA 2AYTA 2DJJA 3GSSA 4WKWA 3KGKA 2B1LA 2HZFA 1JZDA 3U5RE 1FAAA 3M8NA 5J9CA 3A2XA 4O5UA 2H76A 4G0LA 1R7HA 1XW9A 4XS6A 3KP9A 1AW9A 4L0UA 5KN1A 5DAKA 1AQXA 4DEJA 2VLUA 2MMOA 1BYEA 1SJIA 3EPTA 5D9XA 4EIPA 1JZRA 1K0NA 2H71A 3RHCA 4GTUA 2V1MA 1OC8A 3IOSA 2TIRA 3TDGA 4A5PA 2CZ3A 2Z9SA 1TI1A 2GTUA 2VAFA 3GUSA 4NAXA 1U3IA 3MAKA 2VCVA 1R4WA 4EDZA 2IL3A 3Q6OA 4O5RA 2VL9A 5D8IA 2YJ7A 4Q5RA 8GSSA 3N5OA 1GP1A 2WGRA 5GSTA 4I97A 3O3TA 1JFUA 3KMOA 5BMUA 2R5GA 4KX4A 2L59A 4NV2A 1YKAA 5C00A 2A2PA 2VL3A 4N11A 2AB6A 4IS0A 3KM6A 4PQIA 3UAPA 3ERWA 1R5PA 2M72A 4ILFA 2LEGA 1OVNA 4K2DA 3VLNA 2IIYA 4YQUA 4NMUA 3HZ4A 5G1LA 3UEMA 2HZEB 4BVXA 1AUCA 2REMA 3WT1A 1ERWA 3NZNA 2H01A 4LMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XBI A;  2QGV A;  1A2L A;  2GZY A;  2VD0 A;  1Z9H A;  1SK0 A;  1WPI A;  5INY A;  2V6K A;  4JR4 A;  2P0G A;  4ID0 A;  4K9Z A;  2GQM A;  2GS3 A;  2H70 A;  4X43 A;  1GTI A;  1YF1 A;  4YQV A;  2K18 A;  4JU5 A;  4EXJ A;  4DSS A;  2RUF A;  3IBH A;  4F03 A;  4FIW A;  4HDE A;  3IPZ A;  1VRS D;  2NTO A;  2C0D A;  3IDV A;  4WEY A;  5ECQ B;  4PX1 A;  2VCW A;  5C04 A;  3CMI A;  2F3M A;  1QUW A;  1EV4 A;  4PQH A;  1GL8 A;  1ABA A;  3M9K A;  1T8E B;  5DBQ A;  3KIJ A;  3F63 A;  3L4N A;  2DIY A;  1YDK A;  5D9W A;  2CX4 A;  2V6O A;  1EOH A;  3E9J B;  3F4R A;  4TXO B;  4KAE A;  1LJR A;  1ML6 A;  2MMA A;  3M1G A;  5HFG A;  3GX8 A;  3DEX A;  4WBR D;  2RLI A;  4TOP A;  1TRV A;  3LXZ A;  2PER A;  5HFK A;  2MBS A;  1XWK A;  3FYG A;  1Z5Y E;  6GST A;  4GSN A;  3F4S A;  3EU3 A;  1TRS A;  2CA8 A;  4IP6 A;  1M7T A;  1WOU A;  5H5Q A;  1K0M A;  5IIZ A;  2PVQ A;  4GWR A;  4OCF A;  2OE1 A;  1M2D A;  2G0F A;  1O7U A;  2VM1 A;  3IC4 A;  1SL0 B;  4CDO A;  1Z7R A;  3GKM A;  1O81 A;  4TXV A;  12GS A;  4XS4 B;  3HA9 A;  2ON5 A;  4YAV A;  2VD1 A;  4PUA A;  4ZL8 A;  2IPA A;  1JZW A;  2MMN A;  1XOB A;  3D4M A;  1BG5 A;  1T00 A;  1T4Z A;  2DML A;  3HHV A;  5JCW A;  4FH8 A;  1MDI A;  3F3R A;  1SL1 B;  5CNW A;  1N2A A;  1F3A A;  4ULX A;  1OC3 A;  2FHE A;  2GSS A;  4I6X A;  3DGQ A;  1RK4 A;  1T4Y A;  2KHP A;  3PGT A;  4MP4 A;  1BAY A;  3IR4 A;  1GUL A;  5LNK e;  2YAN A;  2H66 A;  3FEU A;  5AIV A;  4P3Y B;  4DSR A;  4NV5 A;  4PXO A;  1GTA A;  5G1K A;  2WS2 A;  2AAW A;  4ECJ A;  3HYP A;  1Q98 A;  2LRT A;  20GS A;  3WT2 A;  2VCZ A;  1WJK A;  3ZLP A;  1V58 A;  1EGO A;  1WMJ A;  2E2M A;  2PVO C;  3HXS A;  2ZCT A;  1RW1 A;  2H0H A;  2MMZ A;  1TRW A;  2JAD A;  3HJM A;  4LL4 B;  5ABR A;  9GSS A;  1F6M C;  3W8S A;  2OKA A;  3D6I A;  2VCT A;  1ZCP A;  4XS1 A;  3IXR A;  1M2A A;  4ZBA A;  3IV4 A;  1H75 A;  4ZB6 A;  3HJP A;  3BJ5 A;  3HJO A;  5IO2 A;  3DD3 A;  1G7O A;  2K6V A;  1O85 A;  2IJY A;  1XVW A;  1VF3 A;  2A4V A;  5H5R A;  5J5N A;  2VIM A;  3P90 A;  3ZVJ A;  2OBK A;  2OE3 A;  5B6M A;  5AGY A;  3FZA A;  4MJA A;  1I5G A;  5FWG A;  1EWX A;  3GH6 A;  2HI7 A;  3VWU A;  2FUG 2;  5IMZ A;  1X0R A;  4DVC A;  1NSW A;  1TRU A;  1FB6 A;  5CRH A;  4HJ2 A;  2LTK A;  1IYI A;  4JED A;  4MCU A;  4OFN A;  1AAZ A;  4PNG A;  3VPT A;  4MLY A;  2RM6 A;  3KEB A;  2C4J A;  4TR3 A;  2F9S A;  2LQO A;  3L9V A;  3TB2 A;  3ZFB A;  1TDI A;  1JLW A;  3RDW A;  5D96 A;  3VI7 A;  3QOU A;  5AIX A;  4GXZ A;  4YQM A;  1SJZ A;  3QR6 A;  1PN9 A;  2BJX A;  2HT9 A;  1M9A A;  4FYU A;  3DYR A;  3P7X A;  1X5C A;  5IQY A;  4K7O A;  1FVJ A;  2C0G A;  1TU8 A;  2H74 A;  3ZFL A;  2OJL A;  4GQF A;  3S9F A;  3UVT A;  2LNS A;  4K1F A;  4NWY A;  3HY2 A;  4MK3 A;  1S3A A;  1WP0 A;  4FO5 A;  2LJR A;  5DJM A;  1EOG A;  4MZB A;  3FK8 A;  4BL7 A;  5J9B A;  2F8A A;  3SWL A;  4MF5 A;  4KDU A;  3W6G A;  5G2Z A;  2YWM A;  4K6X A;  4EKZ A;  2WDU A;  3H1N A;  4ZB8 A;  4ZXG A;  4FYB A;  2YV9 A;  1FO5 A;  1TW9 A;  3F3Q A;  4TR4 A;  1F9M A;  3ZIT A;  4ZIJ A;  2N5F A;  2VLT A;  2PUK C;  3DRN A;  1A23 A;  3LXT A;  1SKS B;  2GT5 A;  3TJK A;  5A4W A;  5IO0 A;  4EC0 A;  3TGZ A;  1IYH A;  5DAL B;  5IM9 A;  4MJE A;  5A4U A;  3IRA A;  4E8H A;  3QMX A;  5IMA A;  4TRX A;  2MYG A;  1SKR B;  2JAC A;  5COH A;  4IBP A;  4POB A;  1HNA A;  1ZYQ B;  2HFD A;  4OWY A;  5ID2 B;  2L6C A;  2XPE A;  1DE1 A;  2LRN A;  2R37 A;  1DE2 A;  2LV3 A;  1KBN A;  1XOA A;  3KMN A;  1THO A;  2GQK A;  3NIV A;  1JLV A;  4YH2 A;  4MZC A;  1FHE A;  4XCS A;  2NPB A;  2JL4 A;  4TXO A;  5DJL A;  3C8E A;  2YV7 A;  3G7Y A;  1RQM A;  3EIN A;  1PL1 A;  3Q18 A;  4EO3 A;  5JCU A;  3ZMK A;  3D0Z A;  3UBK A;  1GUH A;  3HCZ A;  3PR8 A;  4LMV A;  2H73 A;  2V41 A;  2CT6 A;  2F8F A;  4Q5F A;  4D73 B;  4JRR A;  6GSY A;  1NW2 A;  1XWC A;  1AXD A;  3ZYW A;  5LD0 A;  4IJ3 A;  3HVX A;  14GS A;  3APO A;  4N0Z A;  2H0I A;  3TRP A;  2FA8 A;  2PBJ A;  1XFL A;  2HRN A;  4K7I A;  4X1U A;  1BED A;  4XS4 A;  3VFI A;  2MZC A;  5ENU A;  1X5E A;  2VM2 A;  4OFT A;  4Q5N A;  1CQH A;  4JE1 A;  3EMX A;  4K0N A;  4K0G A;  4X0X A;  1V9W A;  3UOM A;  2M46 A;  1TXX A;  2X8C A;  2B1K A;  3RHB A;  3APQ A;  4CHS A;  1UC7 A;  3TKS C;  3ME8 A;  3MWH A;  3CTG A;  1GSY A;  1GH2 A;  3ZZX A;  3MSZ A;  2V2G A;  3C7M A;  2B5E A;  5ECI B;  5ECL B;  1QMV A;  2LJA A;  4PQ1 A;  1AQV A;  2CV4 A;  2VUP A;  1YZX A;  3GA4 A;  4MMM A;  5DQY A;  2VCX A;  4BPY A;  4BA7 A;  2IWT A;  2C0F A;  5ECP B;  5D9T A;  1G6W A;  2YZH A;  2LST A;  1XW6 A;  2KP1 A;  4IHU A;  4MDC A;  3LJR A;  3VWV A;  1UN2 A;  1EEJ A;  1PKW A;  3WGD A;  4V2N A;  3VWW A;  1GSU A;  3TKS A;  3EC3 A;  2FWE A;  3GHA A;  2I3Y A;  3GFK A;  5FT3 A;  1Z7P A;  2GST A;  4OMV A;  3CRU A;  4IVF A;  11GS A;  3ZIV A;  4GQC A;  1GNW A;  1S3D A;  2DJ2 A;  1OKD A;  1OE8 A;  3GN3 A;  4CW9 A;  3KH9 A;  2FD3 A;  4HJM A;  4NHZ A;  1U88 A;  2YCD A;  1AC1 A;  1TP9 A;  2XC2 A;  3P2A A;  2FCH A;  3M9J A;  1B4Q A;  2DJ0 A;  3CRT A;  3QFA C;  5F07 A;  2X8G A;  4OFM A;  3I69 A;  3VUR A;  2AUV A;  4POM A;  1G7E A;  2ON7 A;  4TR1 B;  2K8S A;  2YN1 A;  2DLX A;  1ZMA A;  5H5S A;  3TOU A;  4G10 A;  5CRW A;  3FHK A;  3CBU A;  3LSZ A;  2NBS A;  1HNB A;  4N30 A;  4V1A g;  2FNO A;  3UIW A;  4MF6 A;  5CRE A;  1XWB A;  4KB3 A;  1SKW B;  1Y6E A;  4E8E A;  4EL1 A;  2JSZ A;  4HZ2 A;  3GTU B;  3KCM A;  4OCE A;  2I4A A;  4O92 A;  3KXO A;  1TTZ A;  4POK A;  3C1S A;  3ME7 A;  3GYK A;  5AN1 A;  3UMA A;  1A8Y A;  1M9B A;  1PX7 A;  4ZB9 A;  4ZBD A;  1GLP A;  2FWH A;  1XVQ A;  5ECM B;  4ZIL A;  2H75 A;  2IMI A;  5CRG A;  4WET A;  4LLR A;  5E4W A;  2E0Q A;  2KLX A;  5B8A A;  2H6Y A;  2GZP A;  2G2Q A;  1J9B A;  5KN0 A;  4KA0 A;  3PH9 A;  1K0A A;  4J2F A;  4EDY A;  4LL1 B;  3F8U A;  3GST A;  3TKS E;  3HD5 A;  1DSB A;  3L9U A;  3K8N A;  2IN3 A;  4ZL7 A;  1K0O A;  2OAC A;  4G19 A;  4F0B A;  4I5Q A;  4Q5Q A;  1AQW A;  2RM5 A;  4BWQ A;  3FZ5 A;  5CYY A;  2H72 A;  5DAK B;  2IFQ A;  3L0H A;  2L5L A;  4N0V A;  3GIX A;  2EIR A;  1QFN A;  1TK8 B;  3IHQ A;  5JWO B;  1GSS A;  3C71 A;  3HKR A;  5ECN B;  4G9H A;  4GST A;  5ID2 A;  1KNG A;  1SL2 B;  1MEK A;  3J7Y b;  1A0F A;  4GF0 A;  4BWS A;  3H4K A;  1MD3 A;  1TK0 B;  4IQA A;  1OE7 A;  3RAZ A;  1GNE A;  1C72 A;  4IP1 A;  7GSS A;  5G5E A;  3ZVJ D;  4ACS A;  1Q4J A;  1PRX A;  1M2B A;  2HXK A;  3US3 A;  3QPM A;  2HSY A;  3EUR A;  1WE0 A;  1MDJ A;  5EL8 A;  3F4T A;  2JSY A;  2O8V B;  4O32 A;  4HEA 2;  4JZQ A;  5G31 A;  3QAG A;  1B4P A;  3TRQ A;  2HYX A;  4D73 A;  3BCK A;  3GMF A;  4F9Z A;  1B8X A;  1GSD A;  1OKT A;  1SD9 A;  2R3X A;  4PUR A;  4KW6 A;  3RBT A;  2ZNM A;  1O73 A;  3TCO A;  2YWN A;  1YKC A;  4MH2 A;  1M99 A;  3R2Q A;  6GSU A;  1HYU A;  1XIY A;  3WGX A;  1E6B A;  1FVK A;  4IW9 A;  3W8J A;  3GL3 A;  2QSI A;  4F0C A;  1OC9 B;  1USB A;  4RQR A;  5IPG A;  2HRF A;  5IOW A;  3ZL5 A;  1SYX A;  1ZZY A;  3M3M A;  2R2J A;  4MAB A;  3Q19 A;  2X8H A;  2PGT A;  3MDK A;  3WGE A;  3QCP A;  3QFB C;  5DCH A;  4I2U A;  1J0F A;  1B9Y C;  5HR3 A;  4NXI A;  1VF4 A;  3FR9 A;  4HQZ A;  1ZGN A;  4L0W A;  2C0E A;  3QDN A;  1ZL9 A;  2LUS A;  2YPM A;  3F9U A;  3SBC A;  2AV4 A;  2C80 A;  1ERT A;  2H1D A;  2PMT A;  4ECC A;  1XW5 A;  1SK1 A;  3BOA A;  2C3T A;  1GLQ A;  3LYK A;  4IEL A;  1Y25 A;  3LG6 A;  3ISO A;  3A2V A;  5CO3 A;  4TKY A;  2A2S A;  4AJ6 A;  1B48 A;  5EY6 A;  4XRA A;  3BBY A;  4TVE A;  5LCZ A;  2HZE A;  4HU9 A;  2C3Q A;  1SYR A;  2KP2 A;  2FWF A;  4G2E A;  1UA5 A;  1PX6 A;  2FGX A;  2L57 A;  1GRX A;  4ECB A;  5AIS A;  4F82 A;  1ST9 A;  2NVL A;  1JZO A;  4O7H A;  4Z7X A;  2H30 A;  2IMK A;  3TKP A;  2XBQ A;  1QGV A;  2E2G A;  1ILO A;  3EU4 A;  3HDC A;  4IN0 A;  3I43 A;  4KUN A;  1K0C A;  3KD0 A;  2YP6 A;  2H6X A;  3FR6 A;  3H8Q A;  1XPV A;  1FW1 A;  2OE0 A;  1YEX A;  2HLS A;  2DJ3 A;  2P31 A;  2CQ9 A;  1EV9 A;  2GQL A;  3CSH A;  1YF0 A;  2GT6 A;  2WUL A;  2A2R A;  3CXG A;  1HD2 A;  3I6A A;  4L5L A;  1SJ6 A;  4MPG A;  2YJH A;  1NM3 A;  1CQG A;  3O76 A;  3UAR A;  3LEF A;  2I81 A;  3OR5 A;  4HI7 A;  2VOC A;  2VLV A;  1YJ6 A;  4MPF A;  4HS1 A;  3GKK A;  1MD4 A;  5FHI A;  3KTB A;  1HQO A;  2HSH A;  2YZU A;  1SK2 A;  2TRX A;  5KEJ A;  2WRT A;  2CVK A;  3IA1 A;  4I8B A;  3MNG A;  4TW5 A;  2YOI A;  2K9F A;  4ISD A;  1OAZ A;  1K3L A;  1A0R P;  2EIQ A;  3GKN A;  1T7P B;  5GAP D;  3LYP A;  3I9V 2;  1V98 A;  3VPQ A;  5GAN D;  1F2E A;  1B9X C;  3QAV A;  2KOK A;  2ES7 A;  1LU4 A;  3HVV A;  1GUM A;  1PA3 A;  4JR6 A;  2CVD A;  2F51 A;  3CTF A;  2HE3 A;  2FLS A;  4IQ1 A;  1QK8 A;  2DMM A;  5D93 A;  5D9V A;  4RI7 A;  3TUE A;  5DVB A;  2DIZ A;  2B5Y A;  2PPT A;  5F8B A;  2GGT A;  1QQ2 A;  4KH7 A;  1S3C A;  3AY8 A;  1G6Y A;  3C1R A;  4XIH A;  3FW2 A;  2PU9 C;  2D2Z A;  5HFI A;  3JCM L;  2L4Q A;  5DDL A;  3KH7 A;  2WFC A;  18GS A;  2WJU A;  19GS A;  4HQS A;  3F6D A;  4L5O A;  4RQX A;  4YAP A;  2IMF A;  3CSJ A;  2EIO A;  3L78 A;  1JHB A;  2V32 A;  2FA4 A;  2IME A;  3A3T A;  4WF4 A;  3EVI A;  3IK7 A;  2J23 A;  4I2T A;  1WWJ A;  1W4V A;  5A5K A;  2FY6 A;  6GSV A;  1MTC A;  2H1A A;  3FZ4 A;  1EGR A;  1R26 A;  3FZ9 A;  1DUG A;  4QL7 A;  1LBK A;  1VF2 A;  5IOX A;  1GUK A;  4POL A;  4XTS A;  2VL2 C;  3DKS A;  2B7K A;  2CAQ A;  2KUC A;  1UVZ A;  4GLT A;  1GSF A;  1E2Y A;  4V2M A;  4OD7 A;  1N8J A;  4MF7 A;  5L71 A;  1K0B A;  1SU9 A;  1U87 A;  1K3Y A;  5HR1 A;  1NHY A;  2P5Q A;  5F0G A;  4DSQ A;  1X9M B;  2DBC A;  4PGT A;  1A2M A;  3A5W A;  2LNT A;  4GSS A;  4QL9 A;  5G30 A;  1F37 A;  3QAW A;  4J57 E;  1KEB A;  3LFL A;  2QKE A;  4KND A;  2OBI A;  4GCI A;  1TU7 A;  1BQ7 A;  1OC9 A;  1R5A A;  1XBS A;  3ED3 A;  2VL2 A;  3ERG A;  1PKZ A;  3DVW A;  2I1U A;  2DJ1 A;  5A4V A;  1PQN A;  1V40 A;  2B5X A;  5CRD A;  17GS A;  2B3S A;  3LGC A;  3APS A;  1O6J A;  1X5D A;  4J56 E;  1M0U A;  3J7Y k;  4IGJ A;  4QQ7 A;  3FKF A;  1U6T A;  4F2I A;  2BTO T;  2E7P A;  5IMV A;  5JCG A;  16GS A;  3ERF A;  3IAM 2;  5KN3 A;  2C1Y A;  4KCA A;  1K0D A;  1MDK A;  4EVM A;  4OO5 A;  2LS5 A;  4PUF C;  2I9H A;  3GH9 A;  4K7N A;  3VK9 A;  2RUE A;  5ECO B;  3IAS 2;  3HVS A;  1PSQ A;  2WZ9 A;  5D73 A;  1XZO A;  1ACV A;  3Q74 A;  1SD8 A;  3F0I A;  3WD6 A;  4N10 A;  13GS A;  2X99 A;  3DML A;  4RI6 A;  1X9W B;  2YWI A;  5EPF A;  5B8B A;  2NDO A;  1THX A;  3LWA A;  5HR2 A;  1HNC A;  3H79 A;  2JU5 A;  2C8U A;  1GSQ A;  1OYJ A;  1A8L A;  4WR4 A;  1VF1 A;  4MH3 A;  3VWX A;  2H1G A;  4BVY A;  6GSW A;  5F06 A;  1EP7 A;  2K8V A;  3ZTL A;  3DIE A;  3RPN A;  4KGI A;  3DWV A;  3ZML A;  3KP8 A;  3GUR A;  5E59 A;  1FG4 A;  2YWO A;  2HNL A;  2LRC A;  1TJD A;  5KN2 A;  4KSO A;  2RII A;  3G7J A;  3KTL A;  1Z6N A;  2O89 A;  1V57 A;  2LKU A;  2H6Z A;  3TOT A;  3GX0 A;  1FB0 A;  3RPP A;  4KSM A;  4K8M A;  1T1V A;  4MJC A;  1YEP A;  2WCI A;  5IMF A;  3UJ1 A;  5DAL A;  2CZ2 A;  1PMT A;  3EE2 A;  2O87 A;  2J9H A;  2L4C A;  3GKX A;  3M0F A;  2L5O A;  1KTE A;  2CAI A;  4KE3 A;  3TJB A;  3EYT A;  1O8W A;  5DCG A;  4ZL9 A;  3CSI A;  5GZZ B;  1ON4 A;  2B7J A;  1WIK A;  1H4O A;  2CVB A;  4JBB A;  2AJQ B;  3D5J A;  1XWG A;  1ZOF A;  5J4U A;  1QXH A;  1J08 A;  4EE0 A;  2PN8 A;  1EEM A;  2FWG A;  3O6T A;  2DC5 A;  2GZZ A;  3UL3 A;  3D22 A;  2H8L A;  5GSS A;  4AGS A;  4H86 A;  1A2J A;  3VI5 A;  2L6D A;  4AJ7 A;  2H0G A;  4NHW A;  5IMC A;  3BD2 A;  5JWQ B;  3FY7 A;  1XWA A;  1F3B A;  4IKH A;  2DSA A;  4IJI A;  4XRD A;  2AHE A;  3HZ8 A;  2XPD A;  2R6K A;  1XCC A;  2JZS A;  2ZUP A;  1EP8 A;  3U6V A;  2GVP A;  4GRF A;  3G7I A;  1NHO A;  1ERU A;  4KCE A;  3KJY A;  3V1W A;  4WF5 A;  4ML1 A;  3GRX A;  1A24 A;  2MBT A;  2BMX A;  5IMD A;  5J41 A;  5DQS A;  3TJJ A;  4EUY A;  5ELG A;  3G9B A;  3F6F A;  3D4T A;  5J3R A;  3IK9 A;  2TRC P;  3EWL A;  4TN8 A;  1YY7 A;  1PD2 1;  2LJK A;  4DSS B;  2H1B A;  3H93 A;  2GSQ A;  3UBL A;  4HZ4 A;  3TKR A;  4ZBB A;  4ECI A;  3LQ7 A;  4XHM A;  1GTB A;  2OA7 A;  1ZYE A;  1EZK A;  3N9J A;  2IMD A;  5JWR B;  4HUA A;  1PL2 A;  2GLR A;  3FR3 A;  1X9S B;  2DJK A;  2VO4 A;  1TOF A;  4WR5 A;  2QC7 A;  1DBY A;  2O85 A;  5HR0 A;  3D21 A;  2M80 A;  3UVH A;  3TJG A;  1T3B A;  1GWC A;  5ECK B;  5IPH A;  5CAX A;  1GTU A;  4ML6 A;  2JZR A;  1BJX A;  2X64 A;  1VGL A;  3ZRE A;  5B6N A;  1G0T A;  1URM A;  1U3A A;  2YNX A;  1TI3 A;  5G5F A;  22GS A;  5CP1 A;  5ECR B;  1I9D A;  3TRX A;  2GSR A;  4MZW A;  4OO4 A;  3ZRD A;  2LQQ A;  1WRY A;  4AJ8 A;  4TR0 A;  1XXU A;  4L8E A;  4RUV A;  2PWJ A;  2JZT A;  4TR1 A;  4FYC A;  2OAD A;  1Z3E A;  5ECS A;  1ERV A;  3P8W A;  2R4V A;  2B6M A;  3FRC A;  3WYW A;  10GS A;  1AIU A;  1TKD B;  3NOF A;  1YQ1 A;  3C73 A;  4V2L A;  6GSX A;  1Z6M A;  3EMP A;  4KDX A;  3KZQ A;  3BCI A;  1W89 A;  2IFQ B;  2CX3 A;  2GDR A;  3TJF A;  3LOR A;  3E3E A;  3GTU A;  6GSS A;  2C3N A;  3TKQ A;  3CYN A;  5ECH B;  3ZIJ A;  2H19 A;  4LA1 A;  2N5A A;  4KDY A;  3GNJ A;  1V2A A;  3GV1 A;  1TK5 B;  2ALB A;  1K3O A;  2XHF A;  4PNF A;  5HQP A;  4AF2 A;  5ELA A;  1O8X A;  2P5R A;  4MJB A;  3L9S A;  4V1A p;  3DVX A;  1BX9 A;  1FOV A;  4EF0 A;  2N5B A;  3A2W A;  4MA9 A;  4HU7 A;  4NPB A;  3GL5 A;  1SEN A;  5F05 A;  5EVO A;  4WXT A;  1GSE A;  4HOJ A;  3E0U A;  4WBJ A;  2WB9 A;  3QD9 A;  1PGT A;  2EC4 A;  3PIN A;  2VCQ A;  3IE3 A;  2O7K A;  5B7C A;  3DXB A;  2AYT A;  2DJJ A;  3GSS A;  4WKW A;  3KGK A;  2B1L A;  2HZF A;  1JZD A;  3U5R E;  1FAA A;  3M8N A;  5J9C A;  3A2X A;  2H76 A;  1R7H A;  1XW9 A;  4XS6 A;  3KP9 A;  1AW9 A;  4L0U A;  5KN1 A;  5DAK A;  1AQX A;  4DEJ A;  2VLU A;  2MMO A;  1BYE A;  1SJI A;  5D9X A;  1JZR A;  1K0N A;  2H71 A;  3RHC A;  4GTU A;  2V1M A;  1OC8 A;  3IOS A;  2TIR A;  3TDG A;  2CZ3 A;  2Z9S A;  1TI1 A;  2GTU A;  2VAF A;  3GUS A;  4NAX A;  1U3I A;  3MAK A;  2VCV A;  1R4W A;  4EDZ A;  2IL3 A;  3Q6O A;  4O5R A;  2VL9 A;  5D8I A;  2YJ7 A;  4Q5R A;  8GSS A;  3N5O A;  1GP1 A;  2WGR A;  5GST A;  4I97 A;  3O3T A;  1JFU A;  3KMO A;  2R5G A;  4KX4 A;  2L59 A;  4NV2 A;  1YKA A;  5C00 A;  4N11 A;  2VL3 A;  2AB6 A;  4IS0 A;  3KM6 A;  4PQI A;  3UAP A;  3ERW A;  1R5P A;  2M72 A;  4ILF A;  2LEG A;  1OVN A;  4K2D A;  3VLN A;  2IIY A;  4YQU A;  4NMU A;  3HZ4 A;  5G1L A;  3UEM A;  2HZE B;  4BVX A;  1AUC A;  2REM A;  3WT1 A;  1ERW A;  3NZN A;  2H01 A;  4LMW A; 
#chains in the Genus database with same CATH topology
 2XBI A;  2QGV A;  1A2L A;  2GZY A;  2VD0 A;  1Z9H A;  1SK0 A;  1WPI A;  5INY A;  2V6K A;  4JR4 A;  2P0G A;  4ID0 A;  4K9Z A;  2GQM A;  2GS3 A;  2H70 A;  1M3I A;  4X43 A;  1GTI A;  1YF1 A;  4YQV A;  2K18 A;  4JU5 A;  4EXJ A;  4DSS A;  2RUF A;  3IBH A;  4F03 A;  5KOW A;  4FIW A;  4HDE A;  3IPZ A;  1VRS D;  2NTO A;  2C0D A;  3IDV A;  4WEY A;  5ECQ B;  4PX1 A;  2VCW A;  5C04 A;  3CMI A;  2F3M A;  1QUW A;  1EV4 A;  4PQH A;  1GL8 A;  1ABA A;  3M9K A;  1T8E B;  5DBQ A;  3KIJ A;  3F63 A;  3L4N A;  2DIY A;  1YDK A;  1ZYN A;  5D9W A;  2CX4 A;  2V6O A;  1EOH A;  3E9J B;  3F4R A;  4TXO B;  4KAE A;  1LJR A;  1ML6 A;  2MMA A;  3M1G A;  5HFG A;  3GX8 A;  3DEX A;  4WBR D;  2RLI A;  4TOP A;  1TRV A;  3LXZ A;  2PER A;  5HFK A;  2MBS A;  1XWK A;  3FYG A;  3MYD A;  1Z5Y E;  6GST A;  4GSN A;  3F4S A;  3EU3 A;  1TRS A;  2CA8 A;  4IP6 A;  1M7T A;  1WOU A;  4ICY A;  5H5Q A;  1K0M A;  5IIZ A;  2HRK A;  2PVQ A;  4GWR A;  4OCF A;  2OE1 A;  1M2D A;  2G0F A;  1O7U A;  2VM1 A;  3IC4 A;  1SL0 B;  4CDO A;  1Z7R A;  3GKM A;  1O81 A;  4TXV A;  12GS A;  4XS4 B;  3HA9 A;  2ON5 A;  4YAV A;  2VD1 A;  4PUA A;  4ZL8 A;  2IPA A;  1JZW A;  2MMN A;  1XOB A;  3D4M A;  1BG5 A;  1T00 A;  1T4Z A;  2DML A;  3HHV A;  5JCW A;  4FH8 A;  1MDI A;  3F3R A;  1SL1 B;  5CNW A;  1N2A A;  1F3A A;  4ULX A;  1OC3 A;  2FHE A;  2GSS A;  4I6X A;  3DGQ A;  1RK4 A;  1T4Y A;  2KHP A;  3PGT A;  4MP4 A;  1BAY A;  3IR4 A;  1GUL A;  5LNK e;  2YAN A;  2H66 A;  3FEU A;  5AIV A;  4P3Y B;  4DSR A;  4NV5 A;  4PXO A;  1GTA A;  5G1K A;  2WS2 A;  2AAW A;  4ECJ A;  3HYP A;  1Q98 A;  2LRT A;  20GS A;  3WT2 A;  2VCZ A;  1WJK A;  3ZLP A;  1V58 A;  1EGO A;  1WMJ A;  2E2M A;  2PVO C;  3HXS A;  2ZCT A;  1RW1 A;  2H0H A;  2MMZ A;  1TRW A;  2JAD A;  3HJM A;  4LL4 B;  5ABR A;  9GSS A;  1F6M C;  3W8S A;  2OKA A;  3D6I A;  2VCT A;  1ZCP A;  4XS1 A;  3IXR A;  1M2A A;  4K2X A;  4ZBA A;  3IV4 A;  1H75 A;  4ZB6 A;  3HJP A;  3LW9 A;  3BJ5 A;  3HJO A;  5IO2 A;  3DD3 A;  1G7O A;  2K6V A;  1O85 A;  2IJY A;  1XVW A;  1VF3 A;  2A4V A;  5H5R A;  5J5N A;  2VIM A;  3P90 A;  3ZVJ A;  2OBK A;  2OE3 A;  5B6M A;  5AGY A;  3FZA A;  4MJA A;  1I5G A;  5FWG A;  1EWX A;  3GH6 A;  2HI7 A;  3VWU A;  2FUG 2;  5IMZ A;  1X0R A;  4DVC A;  1NSW A;  4X4J A;  1TRU A;  1FB6 A;  5CRH A;  4HSC X;  4HJ2 A;  2LTK A;  1IYI A;  4JED A;  4MCU A;  4OFN A;  1AAZ A;  4PNG A;  3VPT A;  4MLY A;  2RM6 A;  3KEB A;  2C4J A;  4TR3 A;  2F9S A;  2LQO A;  3L9V A;  3TB2 A;  3ZFB A;  1TDI A;  1JLW A;  3RDW A;  5D96 A;  3VI7 A;  3QOU A;  5AIX A;  4GXZ A;  4YQM A;  4O5Q A;  1SJZ A;  3QR6 A;  1PN9 A;  2BJX A;  2HT9 A;  1M9A A;  4FYU A;  3DYR A;  3P7X A;  1X5C A;  5IQY A;  4K7O A;  1FVJ A;  2C0G A;  1TU8 A;  2H74 A;  3ZFL A;  2OJL A;  4GQF A;  3S9F A;  3UVT A;  2LNS A;  4K1F A;  3MIX A;  4NWY A;  3HY2 A;  4MK3 A;  1S3A A;  1WP0 A;  4FO5 A;  2LJR A;  5DJM A;  1EOG A;  4MZB A;  4BVY B;  3FK8 A;  4BL7 A;  5J9B A;  2F8A A;  3SWL A;  4MF5 A;  4KDU A;  3W6G A;  5G2Z A;  2YWM A;  4K6X A;  4EKZ A;  2WDU A;  3H1N A;  4ZB8 A;  4ZXG A;  4FYB A;  4USS A;  2YV9 A;  1FO5 A;  1TW9 A;  2A4H A;  3F3Q A;  4TR4 A;  1F9M A;  3ZIT A;  4ZIJ A;  2N5F A;  2VLT A;  2PUK C;  3DRN A;  1A23 A;  3LXT A;  1SKS B;  2GT5 A;  3TJK A;  5A4W A;  5IO0 A;  4EC0 A;  3TGZ A;  1IYH A;  5DAL B;  5IM9 A;  4MJE A;  5A4U A;  3IRA A;  4E8H A;  3QMX A;  5IMA A;  4TRX A;  2MYG A;  1SKR B;  2JAC A;  5COH A;  4IBP A;  4POB A;  1HNA A;  1ZYQ B;  2HFD A;  4OWY A;  5ID2 B;  2L6C A;  2XPE A;  1DE1 A;  2LRN A;  2R37 A;  1DE2 A;  2LV3 A;  1KBN A;  1XOA A;  2X4A A;  3KMN A;  1THO A;  2GQK A;  3NIV A;  1JLV A;  4YH2 A;  4MZC A;  1FHE A;  4XCS A;  2NPB A;  2JL4 A;  4TXO A;  5DJL A;  3C8E A;  2YV7 A;  3G7Y A;  1RQM A;  5BRT A;  3EIN A;  1PL1 A;  3Q18 A;  4EO3 A;  5JCU A;  3ZMK A;  3D0Z A;  3UBK A;  1GUH A;  3HCZ A;  3PR8 A;  4LMV A;  2H73 A;  2V41 A;  2CT6 A;  2F8F A;  4Q5F A;  4D73 B;  4JRR A;  6GSY A;  1NW2 A;  1XWC A;  1AXD A;  3ZYW A;  1S3R A;  5LD0 A;  4IJ3 A;  3HVX A;  14GS A;  3APO A;  4N0Z A;  2H0I A;  3TRP A;  2FA8 A;  2PBJ A;  1XFL A;  2HRN A;  4K7I A;  4X1U A;  1BED A;  4XS4 A;  3VFI A;  2MZC A;  5ENU A;  1X5E A;  2VM2 A;  4OFT A;  4Q5N A;  1CQH A;  4JE1 A;  3EMX A;  4K0N A;  4K0G A;  4X0X A;  1V9W A;  3UOM A;  2M46 A;  1TXX A;  2X8C A;  2B1K A;  3RHB A;  3APQ A;  4CHS A;  1UC7 A;  3TKS C;  3ME8 A;  3MWH A;  3CTG A;  1GSY A;  4Z2R A;  1GH2 A;  3ZZX A;  3MSZ A;  2QA1 A;  2V2G A;  3C7M A;  2B5E A;  5ECI B;  5ECL B;  1QMV A;  2LJA A;  4PQ1 A;  2DKH A;  1AQV A;  2CV4 A;  2VUP A;  1YZX A;  3GA4 A;  4MMM A;  5DQY A;  2VCX A;  4BPY A;  4BA7 A;  2IWT A;  2C0F A;  5ECP B;  5D9T A;  1G6W A;  2YZH A;  2LST A;  1XW6 A;  2KP1 A;  4IHU A;  4MDC A;  3LJR A;  3VWV A;  1UN2 A;  1EEJ A;  1PKW A;  3WGD A;  4V2N A;  3VWW A;  1GSU A;  3TKS A;  3EC3 A;  2FWE A;  3GHA A;  2I3Y A;  3GFK A;  5FT3 A;  1Z7P A;  2GST A;  4OMV A;  3CRU A;  4IVF A;  11GS A;  3ZIV A;  4GQC A;  1GNW A;  1S3D A;  2DJ2 A;  1OKD A;  1OE8 A;  3GN3 A;  4CW9 A;  3KH9 A;  2FD3 A;  4HJM A;  4NHZ A;  1U88 A;  2YCD A;  1AC1 A;  4BIK A;  1TP9 A;  2XC2 A;  3P2A A;  2FCH A;  3M9J A;  1B4Q A;  2DJ0 A;  3CRT A;  5KOX A;  3QFA C;  5F07 A;  2X8G A;  4OFM A;  3I69 A;  3VUR A;  2AUV A;  4POM A;  1G7E A;  2ON7 A;  4TR1 B;  2K8S A;  2YN1 A;  2DLX A;  1ZMA A;  4K5R A;  5H5S A;  3TOU A;  4G10 A;  5CRW A;  3FHK A;  3CBU A;  3LSZ A;  2NBS A;  2R0P A;  1HNB A;  4N30 A;  4V1A g;  2FNO A;  3UIW A;  4MF6 A;  5CRE A;  1XWB A;  4KB3 A;  1SKW B;  3IHG A;  1Y6E A;  4E8E A;  4EL1 A;  2JSZ A;  4HZ2 A;  3GTU B;  3KCM A;  4OCE A;  2I4A A;  4O92 A;  3KXO A;  1TTZ A;  4POK A;  3C1S A;  3ME7 A;  3GYK A;  5AN1 A;  3UMA A;  1A8Y A;  1M9B A;  1PX7 A;  4ZB9 A;  4ZBD A;  1GLP A;  2FWH A;  1XVQ A;  5ECM B;  2HSM A;  4ZIL A;  2H75 A;  2IMI A;  5CRG A;  4WET A;  4LLR A;  5E4W A;  2E0Q A;  2KLX A;  5B8A A;  2H6Y A;  2GZP A;  2G2Q A;  1J9B A;  5KN0 A;  4KA0 A;  3PH9 A;  1K0A A;  4J2F A;  4EDY A;  4LL1 B;  3F8U A;  3GST A;  3TKS E;  3HD5 A;  1DSB A;  3L9U A;  3K8N A;  2IN3 A;  4ZL7 A;  1K0O A;  2OAC A;  4G19 A;  4F0B A;  4I5Q A;  4Q5Q A;  1AQW A;  2RM5 A;  4BWQ A;  3FZ5 A;  5CYY A;  2H72 A;  5DAK B;  2IFQ A;  3L0H A;  2L5L A;  4N0V A;  3GIX A;  2EIR A;  1QFN A;  2R0C A;  1TK8 B;  3IHQ A;  5JWO B;  1GSS A;  3C71 A;  3HKR A;  5ECN B;  4G9H A;  4GST A;  5ID2 A;  1KNG A;  1SL2 B;  1MEK A;  3J7Y b;  1A0F A;  4GF0 A;  4BWS A;  3H4K A;  1MD3 A;  1TK0 B;  4IQA A;  1OE7 A;  3RAZ A;  1GNE A;  1C72 A;  4IP1 A;  7GSS A;  5G5E A;  3ZVJ D;  4ACS A;  1Q4J A;  1PRX A;  1M2B A;  2HXK A;  3US3 A;  3QPM A;  2HSY A;  3EUR A;  1WE0 A;  1MDJ A;  5EL8 A;  3F4T A;  2JSY A;  2O8V B;  4O32 A;  4HEA 2;  4JZQ A;  5G31 A;  3QAG A;  1B4P A;  3TRQ A;  2HYX A;  4D73 A;  3BCK A;  3GMF A;  4F9Z A;  1B8X A;  1GSD A;  1OKT A;  1SD9 A;  2R3X A;  4PUR A;  4KW6 A;  3RBT A;  2ZNM A;  1O73 A;  3TCO A;  2YWN A;  1YKC A;  4CY8 A;  4MH2 A;  1M99 A;  4BVX B;  3R2Q A;  6GSU A;  1HYU A;  1XIY A;  3WGX A;  1E6B A;  1FVK A;  4IW9 A;  3W8J A;  3GL3 A;  2QSI A;  4F0C A;  1OC9 B;  2X49 A;  1USB A;  4RQR A;  5IPG A;  2HRF A;  5IOW A;  3ZL5 A;  1SYX A;  1ZZY A;  3M3M A;  2R2J A;  4MAB A;  3Q19 A;  2X8H A;  2PGT A;  3MDK A;  3WGE A;  3QCP A;  3QFB C;  5DCH A;  4I2U A;  3FMW A;  1J0F A;  1B9Y C;  5HR3 A;  4NXI A;  1VF4 A;  3FR9 A;  4HQZ A;  1ZGN A;  4L0W A;  2C0E A;  3QDN A;  1ZL9 A;  2LUS A;  2YPM A;  3F9U A;  3SBC A;  2AV4 A;  2C80 A;  1ERT A;  2H1D A;  2PMT A;  4ECC A;  1XW5 A;  1SK1 A;  3BOA A;  2C3T A;  1GLQ A;  3LYK A;  4IEL A;  1Y25 A;  3LG6 A;  3ISO A;  3A2V A;  5CO3 A;  4TKY A;  2A2S A;  4AJ6 A;  1B48 A;  5EY6 A;  4XRA A;  3BBY A;  4TVE A;  5LCZ A;  2HZE A;  4HU9 A;  2C3Q A;  1SYR A;  2KP2 A;  2FWF A;  4G2E A;  3R3E A;  1UA5 A;  1PX6 A;  2FGX A;  2L57 A;  1GRX A;  4ECB A;  5AIS A;  4F82 A;  1ST9 A;  2NVL A;  1JZO A;  4O7H A;  4Z7X A;  2H30 A;  2IMK A;  3TKP A;  2XBQ A;  1QGV A;  2E2G A;  1ILO A;  3EU4 A;  3HDC A;  4IN0 A;  3I43 A;  4KUN A;  1K0C A;  3KD0 A;  2YP6 A;  2H6X A;  3FR6 A;  3H8Q A;  1XPV A;  1FW1 A;  2OE0 A;  1YEX A;  2HLS A;  2DJ3 A;  2P31 A;  2CQ9 A;  1EV9 A;  2GQL A;  3IC8 A;  3CSH A;  1YF0 A;  2GT6 A;  2WUL A;  2A2R A;  3CXG A;  1HD2 A;  3I6A A;  4L5L A;  1SJ6 A;  4MPG A;  2YJH A;  1NM3 A;  1CQG A;  3O76 A;  3UAR A;  3LEF A;  2I81 A;  3OR5 A;  4HI7 A;  4MNN A;  2VOC A;  2VLV A;  1YJ6 A;  4MPF A;  4HS1 A;  3GKK A;  1MD4 A;  5FHI A;  3KTB A;  1HQO A;  2HSH A;  2YZU A;  1SK2 A;  2TRX A;  2UZ8 A;  5KEJ A;  2WRT A;  2CVK A;  3IA1 A;  4I8B A;  3MNG A;  4TW5 A;  2YOI A;  2K9F A;  4ISD A;  1OAZ A;  1K3L A;  1A0R P;  2EIQ A;  3GKN A;  1T7P B;  5GAP D;  3LYP A;  3I9V 2;  1V98 A;  3VPQ A;  5GAN D;  1F2E A;  1B9X C;  3QAV A;  2KOK A;  2ES7 A;  1LU4 A;  3HVV A;  1GUM A;  3HVN A;  1PA3 A;  4YKF A;  4JR6 A;  2CVD A;  2F51 A;  3CTF A;  2HE3 A;  2FLS A;  4IQ1 A;  1QK8 A;  2DMM A;  5D93 A;  5D9V A;  4RI7 A;  3TUE A;  5DVB A;  2DIZ A;  2B5Y A;  2PPT A;  5F8B A;  2GGT A;  1QQ2 A;  4KH7 A;  1S3C A;  3AY8 A;  1G6Y A;  3C1R A;  4XIH A;  3FW2 A;  2PU9 C;  2D2Z A;  5HFI A;  3JCM L;  2L4Q A;  5DDL A;  3KH7 A;  4G0K A;  2WFC A;  18GS A;  2WJU A;  19GS A;  4HQS A;  3F6D A;  4L5O A;  4RQX A;  4YAP A;  2IMF A;  3CSJ A;  2EIO A;  3L78 A;  1JHB A;  2V32 A;  2FA4 A;  4G0I A;  4KF9 A;  3A5I A;  2IME A;  3A3T A;  4WF4 A;  4K5S A;  3EVI A;  3IK7 A;  2J23 A;  4I2T A;  1WWJ A;  1W4V A;  5A5K A;  2FY6 A;  6GSV A;  1MTC A;  2H1A A;  3FZ4 A;  1EGR A;  1R26 A;  3FZ9 A;  1DUG A;  4QL7 A;  1LBK A;  1VF2 A;  3CQF A;  5IOX A;  1GUK A;  4POL A;  4XTS A;  2VL2 C;  3DKS A;  2B7K A;  2CAQ A;  2KUC A;  1UVZ A;  4GLT A;  1GSF A;  1E2Y A;  4V2M A;  4OD7 A;  1N8J A;  4MF7 A;  5L71 A;  1K0B A;  1SU9 A;  1U87 A;  1K3Y A;  5HR1 A;  1NHY A;  2P5Q A;  5F0G A;  4DSQ A;  1X9M B;  2DBC A;  4PGT A;  1A2M A;  3A5W A;  2LNT A;  4GSS A;  4QL9 A;  5G30 A;  1F37 A;  3QAW A;  4J57 E;  1KEB A;  3LFL A;  4BL7 B;  2QKE A;  4KND A;  2OBI A;  4GCI A;  1TU7 A;  1BQ7 A;  1OC9 A;  1R5A A;  1XBS A;  3ED3 A;  2VL2 A;  3ERG A;  1PKZ A;  3DVW A;  2I1U A;  2DJ1 A;  5A4V A;  1PQN A;  1V40 A;  2B5X A;  5CRD A;  17GS A;  2B3S A;  3LGC A;  3APS A;  1O6J A;  1X5D A;  4J56 E;  1M0U A;  3J7Y k;  4IGJ A;  4QQ7 A;  2HRA A;  3FKF A;  1U6T A;  4F2I A;  2BTO T;  2E7P A;  5IMV A;  5JCG A;  16GS A;  3ERF A;  3IAM 2;  5KN3 A;  2C1Y A;  4KCA A;  1K0D A;  1MDK A;  4EVM A;  4OO5 A;  2LS5 A;  4PUF C;  2I9H A;  3GH9 A;  4K7N A;  3VK9 A;  2RUE A;  5ECO B;  4YKG A;  3IAS 2;  3HVS A;  1PSQ A;  2WZ9 A;  5D73 A;  1XZO A;  1ACV A;  3Q74 A;  2QA2 A;  1SD8 A;  3F0I A;  3WD6 A;  4N10 A;  13GS A;  2X99 A;  3DML A;  4RI6 A;  1X9W B;  2YWI A;  5EPF A;  5B8B A;  2NDO A;  1THX A;  3LWA A;  5HR2 A;  1HNC A;  3H79 A;  2JU5 A;  2C8U A;  1GSQ A;  1OYJ A;  1A8L A;  4WR4 A;  1VF1 A;  4MH3 A;  3VWX A;  2H1G A;  4BVY A;  6GSW A;  5F06 A;  1EP7 A;  2K8V A;  3ZTL A;  3DIE A;  3RPN A;  4KGI A;  3DWV A;  3ZML A;  3KP8 A;  3GUR A;  5E59 A;  1FG4 A;  2YWO A;  2HNL A;  4Z2T A;  2LRC A;  1TJD A;  5KN2 A;  4KSO A;  2RII A;  3G7J A;  3KTL A;  1Z6N A;  4PTS A;  2O89 A;  1V57 A;  2LKU A;  2H6Z A;  3TOT A;  3GX0 A;  1FB0 A;  3RPP A;  4KSM A;  4K8M A;  1T1V A;  4MJC A;  1YEP A;  2WCI A;  5IMF A;  3UJ1 A;  5DAL A;  2CZ2 A;  1PMT A;  3EE2 A;  2O87 A;  2DKI A;  2J9H A;  2L4C A;  3GKX A;  3M0F A;  2L5O A;  1KTE A;  2CAI A;  4KE3 A;  3TJB A;  3EYT A;  1O8W A;  5DCG A;  4ZL9 A;  3CSI A;  5GZZ B;  1ON4 A;  2B7J A;  1WIK A;  1H4O A;  2CVB A;  4JBB A;  2AJQ B;  3PPU A;  3D5J A;  1XWG A;  1ZOF A;  5J4U A;  1QXH A;  1J08 A;  4EE0 A;  2PN8 A;  1EEM A;  2FWG A;  3O6T A;  2DC5 A;  2GZZ A;  3UL3 A;  3D22 A;  2H8L A;  4Z2U A;  5GSS A;  4AGS A;  4H86 A;  1PN0 A;  1A2J A;  3VI5 A;  2L6D A;  4AJ7 A;  2H0G A;  4NHW A;  5IMC A;  3BD2 A;  5JWQ B;  3FY7 A;  1XWA A;  1F3B A;  4IKH A;  2DSA A;  4IJI A;  4XRD A;  2AHE A;  3HZ8 A;  2XPD A;  2R6K A;  1XCC A;  2JZS A;  2ZUP A;  1FOH A;  1EP8 A;  3U6V A;  2GVP A;  4GRF A;  3G7I A;  1NHO A;  1ERU A;  4KCE A;  3KJY A;  3V1W A;  4WF5 A;  4ML1 A;  3GRX A;  1A24 A;  2MBT A;  2BMX A;  5IMD A;  4CY6 A;  5J41 A;  5DQS A;  3TJJ A;  4EUY A;  5ELG A;  3G9B A;  3F6F A;  3D4T A;  5J3R A;  3IK9 A;  2TRC P;  1M3J A;  3EWL A;  4TN8 A;  1YY7 A;  1PD2 1;  2LJK A;  4DSS B;  2H1B A;  3H93 A;  2GSQ A;  3UBL A;  4HZ4 A;  3TKR A;  4ZBB A;  4ECI A;  3LQ7 A;  4XHM A;  1GTB A;  2OA7 A;  1ZYE A;  1EZK A;  3N9J A;  2IMD A;  5JWR B;  4HUA A;  1ZYP A;  1PL2 A;  2GLR A;  3FR3 A;  1X9S B;  2DJK A;  2VO4 A;  1TOF A;  4WR5 A;  2QC7 A;  1DBY A;  2O85 A;  5HR0 A;  3D21 A;  2M80 A;  3UVH A;  3TJG A;  1T3B A;  1GWC A;  5ECK B;  5IPH A;  5CAX A;  1GTU A;  4ML6 A;  2JZR A;  1BJX A;  2X64 A;  1VGL A;  3ZRE A;  5B6N A;  1G0T A;  1URM A;  1U3A A;  2YNX A;  1TI3 A;  5G5F A;  22GS A;  1PFO A;  5CP1 A;  5ECR B;  1I9D A;  3TRX A;  2GSR A;  4MZW A;  4OO4 A;  3ZRD A;  2LQQ A;  1WRY A;  4AJ8 A;  4TR0 A;  1XXU A;  4L8E A;  4RUV A;  2PWJ A;  2JZT A;  4TR1 A;  4FYC A;  2OAD A;  1Z3E A;  5ECS A;  1ERV A;  3P8W A;  2R4V A;  2B6M A;  3FRC A;  3WYW A;  10GS A;  1AIU A;  1TKD B;  3NOF A;  1YQ1 A;  3C73 A;  4V2L A;  6GSX A;  1Z6M A;  3EMP A;  4KDX A;  3KZQ A;  3BCI A;  4EIQ A;  1W89 A;  2IFQ B;  2CX3 A;  2GDR A;  3TJF A;  3LOR A;  3E3E A;  3GTU A;  6GSS A;  2C3N A;  3TKQ A;  3CYN A;  5ECH B;  3ZIJ A;  2H19 A;  4LA1 A;  2N5A A;  4KDY A;  3GNJ A;  1V2A A;  3GV1 A;  1TK5 B;  2ALB A;  1K3O A;  2XHF A;  4PNF A;  5HQP A;  4AF2 A;  5ELA A;  1O8X A;  2P5R A;  4MJB A;  3L9S A;  4V1A p;  3DVX A;  1BX9 A;  4FQU A;  1FOV A;  4EF0 A;  2N5B A;  3A2W A;  4MA9 A;  4HU7 A;  4NPB A;  3GL5 A;  1SEN A;  5F05 A;  4WXT A;  5EVO A;  2R0G A;  1GSE A;  4HOJ A;  3E0U A;  4WBJ A;  2WB9 A;  3QD9 A;  1PGT A;  2EC4 A;  3PIN A;  2VCQ A;  3IE3 A;  2O7K A;  5B7C A;  3DXB A;  2AYT A;  2DJJ A;  3GSS A;  4WKW A;  3KGK A;  2B1L A;  2HZF A;  1JZD A;  3U5R E;  1FAA A;  3M8N A;  5J9C A;  3A2X A;  4O5U A;  2H76 A;  4G0L A;  1R7H A;  1XW9 A;  4XS6 A;  3KP9 A;  1AW9 A;  4L0U A;  5KN1 A;  5DAK A;  1AQX A;  4DEJ A;  2VLU A;  2MMO A;  1BYE A;  1SJI A;  3EPT A;  5D9X A;  4EIP A;  1JZR A;  1K0N A;  2H71 A;  3RHC A;  4GTU A;  2V1M A;  1OC8 A;  3IOS A;  2TIR A;  3TDG A;  1XG8 A;  4A5P A;  2CZ3 A;  2Z9S A;  1TI1 A;  2GTU A;  2VAF A;  3GUS A;  4NAX A;  1U3I A;  3MAK A;  2VCV A;  1R4W A;  4EDZ A;  2IL3 A;  3Q6O A;  4O5R A;  2VL9 A;  5D8I A;  2YJ7 A;  4Q5R A;  8GSS A;  3N5O A;  1GP1 A;  2WGR A;  5GST A;  4I97 A;  3O3T A;  1JFU A;  3KMO A;  5BMU A;  2R5G A;  4KX4 A;  2L59 A;  4NV2 A;  1YKA A;  5C00 A;  2A2P A;  2VL3 A;  4N11 A;  2AB6 A;  4IS0 A;  3KM6 A;  4PQI A;  3UAP A;  3ERW A;  1R5P A;  2M72 A;  4ILF A;  2LEG A;  1OVN A;  4K2D A;  3VLN A;  2IIY A;  4YQU A;  4NMU A;  3HZ4 A;  5G1L A;  3UEM A;  2HZE B;  4BVX A;  1AUC A;  2REM A;  3WT1 A;  1ERW A;  3NZN A;  2H01 A;  4LMW A; 
#chains in the Genus database with same CATH homology
 2XBI A;  2QGV A;  1A2L A;  2GZY A;  2VD0 A;  1Z9H A;  1SK0 A;  1WPI A;  5INY A;  2V6K A;  4JR4 A;  2P0G A;  4ID0 A;  4K9Z A;  2GQM A;  2GS3 A;  2H70 A;  4X43 A;  1GTI A;  1YF1 A;  4YQV A;  2K18 A;  4JU5 A;  4EXJ A;  4DSS A;  2RUF A;  3IBH A;  4F03 A;  5KOW A;  4FIW A;  4HDE A;  3IPZ A;  1VRS D;  2NTO A;  2C0D A;  3IDV A;  4WEY A;  5ECQ B;  4PX1 A;  2VCW A;  5C04 A;  3CMI A;  2F3M A;  1QUW A;  1EV4 A;  4PQH A;  1GL8 A;  1ABA A;  3M9K A;  1T8E B;  5DBQ A;  3KIJ A;  3F63 A;  3L4N A;  2DIY A;  1YDK A;  1ZYN A;  5D9W A;  2CX4 A;  2V6O A;  1EOH A;  3E9J B;  3F4R A;  4TXO B;  4KAE A;  1LJR A;  1ML6 A;  2MMA A;  3M1G A;  5HFG A;  3GX8 A;  3DEX A;  4WBR D;  2RLI A;  4TOP A;  1TRV A;  3LXZ A;  2PER A;  5HFK A;  2MBS A;  1XWK A;  3FYG A;  3MYD A;  1Z5Y E;  6GST A;  4GSN A;  3F4S A;  3EU3 A;  1TRS A;  2CA8 A;  4IP6 A;  1M7T A;  1WOU A;  4ICY A;  5H5Q A;  1K0M A;  5IIZ A;  2HRK A;  2PVQ A;  4GWR A;  4OCF A;  2OE1 A;  1M2D A;  2G0F A;  1O7U A;  2VM1 A;  3IC4 A;  1SL0 B;  4CDO A;  1Z7R A;  3GKM A;  1O81 A;  4TXV A;  12GS A;  4XS4 B;  3HA9 A;  2ON5 A;  4YAV A;  2VD1 A;  4PUA A;  4ZL8 A;  2IPA A;  1JZW A;  2MMN A;  1XOB A;  3D4M A;  1BG5 A;  1T00 A;  1T4Z A;  2DML A;  3HHV A;  5JCW A;  4FH8 A;  1MDI A;  3F3R A;  1SL1 B;  5CNW A;  1N2A A;  1F3A A;  4ULX A;  1OC3 A;  2FHE A;  2GSS A;  4I6X A;  3DGQ A;  1RK4 A;  1T4Y A;  2KHP A;  3PGT A;  4MP4 A;  1BAY A;  3IR4 A;  1GUL A;  5LNK e;  2YAN A;  2H66 A;  3FEU A;  5AIV A;  4P3Y B;  4DSR A;  4NV5 A;  4PXO A;  1GTA A;  5G1K A;  2WS2 A;  2AAW A;  4ECJ A;  3HYP A;  1Q98 A;  2LRT A;  20GS A;  3WT2 A;  2VCZ A;  1WJK A;  3ZLP A;  1V58 A;  1EGO A;  1WMJ A;  2E2M A;  2PVO C;  3HXS A;  2ZCT A;  1RW1 A;  2H0H A;  2MMZ A;  1TRW A;  2JAD A;  3HJM A;  4LL4 B;  5ABR A;  9GSS A;  1F6M C;  3W8S A;  2OKA A;  3D6I A;  2VCT A;  1ZCP A;  4XS1 A;  3IXR A;  1M2A A;  4K2X A;  4ZBA A;  3IV4 A;  1H75 A;  4ZB6 A;  3HJP A;  3LW9 A;  3BJ5 A;  3HJO A;  5IO2 A;  3DD3 A;  1G7O A;  2K6V A;  1O85 A;  2IJY A;  1XVW A;  1VF3 A;  2A4V A;  5H5R A;  5J5N A;  2VIM A;  3P90 A;  3ZVJ A;  2OBK A;  2OE3 A;  5B6M A;  5AGY A;  3FZA A;  4MJA A;  1I5G A;  5FWG A;  1EWX A;  3GH6 A;  2HI7 A;  3VWU A;  2FUG 2;  5IMZ A;  1X0R A;  4DVC A;  1NSW A;  4X4J A;  1TRU A;  1FB6 A;  5CRH A;  4HJ2 A;  2LTK A;  1IYI A;  4JED A;  4MCU A;  4OFN A;  1AAZ A;  4PNG A;  3VPT A;  4MLY A;  2RM6 A;  3KEB A;  2C4J A;  4TR3 A;  2F9S A;  2LQO A;  3L9V A;  3TB2 A;  3ZFB A;  1TDI A;  1JLW A;  3RDW A;  5D96 A;  3VI7 A;  3QOU A;  5AIX A;  4GXZ A;  4YQM A;  4O5Q A;  1SJZ A;  3QR6 A;  1PN9 A;  2BJX A;  2HT9 A;  1M9A A;  4FYU A;  3DYR A;  3P7X A;  1X5C A;  5IQY A;  4K7O A;  1FVJ A;  2C0G A;  1TU8 A;  2H74 A;  3ZFL A;  2OJL A;  4GQF A;  3S9F A;  3UVT A;  2LNS A;  4K1F A;  3MIX A;  4NWY A;  3HY2 A;  4MK3 A;  1S3A A;  1WP0 A;  4FO5 A;  2LJR A;  5DJM A;  1EOG A;  4MZB A;  4BVY B;  3FK8 A;  4BL7 A;  5J9B A;  2F8A A;  3SWL A;  4MF5 A;  4KDU A;  3W6G A;  5G2Z A;  2YWM A;  4K6X A;  4EKZ A;  2WDU A;  3H1N A;  4ZB8 A;  4ZXG A;  4FYB A;  4USS A;  2YV9 A;  1FO5 A;  1TW9 A;  2A4H A;  3F3Q A;  4TR4 A;  1F9M A;  3ZIT A;  4ZIJ A;  2N5F A;  2VLT A;  2PUK C;  3DRN A;  1A23 A;  3LXT A;  1SKS B;  2GT5 A;  3TJK A;  5A4W A;  5IO0 A;  4EC0 A;  3TGZ A;  1IYH A;  5DAL B;  5IM9 A;  4MJE A;  5A4U A;  3IRA A;  4E8H A;  3QMX A;  5IMA A;  4TRX A;  2MYG A;  1SKR B;  2JAC A;  5COH A;  4IBP A;  4POB A;  1HNA A;  1ZYQ B;  2HFD A;  4OWY A;  5ID2 B;  2L6C A;  2XPE A;  1DE1 A;  2LRN A;  2R37 A;  1DE2 A;  2LV3 A;  1KBN A;  1XOA A;  2X4A A;  3KMN A;  1THO A;  2GQK A;  3NIV A;  1JLV A;  4YH2 A;  4MZC A;  1FHE A;  4XCS A;  2NPB A;  2JL4 A;  4TXO A;  5DJL A;  3C8E A;  2YV7 A;  3G7Y A;  1RQM A;  5BRT A;  3EIN A;  1PL1 A;  3Q18 A;  4EO3 A;  5JCU A;  3ZMK A;  3D0Z A;  3UBK A;  1GUH A;  3HCZ A;  3PR8 A;  4LMV A;  2H73 A;  2V41 A;  2CT6 A;  2F8F A;  4Q5F A;  4D73 B;  4JRR A;  6GSY A;  1NW2 A;  1XWC A;  1AXD A;  3ZYW A;  5LD0 A;  4IJ3 A;  3HVX A;  14GS A;  3APO A;  4N0Z A;  2H0I A;  3TRP A;  2FA8 A;  2PBJ A;  1XFL A;  2HRN A;  4K7I A;  4X1U A;  1BED A;  4XS4 A;  3VFI A;  2MZC A;  5ENU A;  1X5E A;  2VM2 A;  4OFT A;  4Q5N A;  1CQH A;  4JE1 A;  3EMX A;  4K0N A;  4K0G A;  4X0X A;  1V9W A;  3UOM A;  2M46 A;  1TXX A;  2X8C A;  2B1K A;  3RHB A;  3APQ A;  4CHS A;  1UC7 A;  3TKS C;  3ME8 A;  3MWH A;  3CTG A;  1GSY A;  4Z2R A;  1GH2 A;  3ZZX A;  3MSZ A;  2QA1 A;  2V2G A;  3C7M A;  2B5E A;  5ECI B;  5ECL B;  1QMV A;  2LJA A;  4PQ1 A;  2DKH A;  1AQV A;  2CV4 A;  2VUP A;  1YZX A;  3GA4 A;  4MMM A;  5DQY A;  2VCX A;  4BPY A;  4BA7 A;  2IWT A;  2C0F A;  5ECP B;  5D9T A;  1G6W A;  2YZH A;  2LST A;  1XW6 A;  2KP1 A;  4IHU A;  4MDC A;  3LJR A;  3VWV A;  1UN2 A;  1EEJ A;  1PKW A;  3WGD A;  4V2N A;  3VWW A;  1GSU A;  3TKS A;  3EC3 A;  2FWE A;  3GHA A;  2I3Y A;  3GFK A;  5FT3 A;  1Z7P A;  2GST A;  4OMV A;  3CRU A;  4IVF A;  11GS A;  3ZIV A;  4GQC A;  1GNW A;  1S3D A;  2DJ2 A;  1OKD A;  1OE8 A;  3GN3 A;  4CW9 A;  3KH9 A;  2FD3 A;  4HJM A;  4NHZ A;  1U88 A;  2YCD A;  1AC1 A;  1TP9 A;  2XC2 A;  3P2A A;  2FCH A;  3M9J A;  1B4Q A;  2DJ0 A;  3CRT A;  5KOX A;  3QFA C;  5F07 A;  2X8G A;  4OFM A;  3I69 A;  3VUR A;  2AUV A;  4POM A;  1G7E A;  2ON7 A;  4TR1 B;  2K8S A;  2YN1 A;  2DLX A;  1ZMA A;  4K5R A;  5H5S A;  3TOU A;  4G10 A;  5CRW A;  3FHK A;  3CBU A;  3LSZ A;  2NBS A;  2R0P A;  1HNB A;  4N30 A;  4V1A g;  2FNO A;  3UIW A;  4MF6 A;  5CRE A;  1XWB A;  4KB3 A;  1SKW B;  3IHG A;  1Y6E A;  4E8E A;  4EL1 A;  2JSZ A;  4HZ2 A;  3GTU B;  3KCM A;  4OCE A;  2I4A A;  4O92 A;  3KXO A;  1TTZ A;  4POK A;  3C1S A;  3ME7 A;  3GYK A;  5AN1 A;  3UMA A;  1A8Y A;  1M9B A;  1PX7 A;  4ZB9 A;  4ZBD A;  1GLP A;  2FWH A;  1XVQ A;  5ECM B;  2HSM A;  4ZIL A;  2H75 A;  2IMI A;  5CRG A;  4WET A;  4LLR A;  5E4W A;  2E0Q A;  2KLX A;  5B8A A;  2H6Y A;  2GZP A;  2G2Q A;  1J9B A;  5KN0 A;  4KA0 A;  3PH9 A;  1K0A A;  4J2F A;  4EDY A;  4LL1 B;  3F8U A;  3GST A;  3TKS E;  3HD5 A;  1DSB A;  3L9U A;  3K8N A;  2IN3 A;  4ZL7 A;  1K0O A;  2OAC A;  4G19 A;  4F0B A;  4I5Q A;  4Q5Q A;  1AQW A;  2RM5 A;  4BWQ A;  3FZ5 A;  5CYY A;  2H72 A;  5DAK B;  2IFQ A;  3L0H A;  2L5L A;  4N0V A;  3GIX A;  2EIR A;  1QFN A;  2R0C A;  1TK8 B;  3IHQ A;  5JWO B;  1GSS A;  3C71 A;  3HKR A;  5ECN B;  4G9H A;  4GST A;  5ID2 A;  1KNG A;  1SL2 B;  1MEK A;  3J7Y b;  1A0F A;  4GF0 A;  4BWS A;  3H4K A;  1MD3 A;  1TK0 B;  4IQA A;  1OE7 A;  3RAZ A;  1GNE A;  1C72 A;  4IP1 A;  7GSS A;  5G5E A;  3ZVJ D;  4ACS A;  1Q4J A;  1PRX A;  1M2B A;  2HXK A;  3US3 A;  3QPM A;  2HSY A;  3EUR A;  1WE0 A;  1MDJ A;  5EL8 A;  3F4T A;  2JSY A;  2O8V B;  4O32 A;  4HEA 2;  4JZQ A;  5G31 A;  3QAG A;  1B4P A;  3TRQ A;  2HYX A;  4D73 A;  3BCK A;  3GMF A;  4F9Z A;  1B8X A;  1GSD A;  1OKT A;  1SD9 A;  2R3X A;  4PUR A;  4KW6 A;  3RBT A;  2ZNM A;  1O73 A;  3TCO A;  2YWN A;  1YKC A;  4CY8 A;  4MH2 A;  1M99 A;  4BVX B;  3R2Q A;  6GSU A;  1HYU A;  1XIY A;  3WGX A;  1E6B A;  1FVK A;  4IW9 A;  3W8J A;  3GL3 A;  2QSI A;  4F0C A;  1OC9 B;  2X49 A;  1USB A;  4RQR A;  5IPG A;  2HRF A;  5IOW A;  3ZL5 A;  1SYX A;  1ZZY A;  3M3M A;  2R2J A;  4MAB A;  3Q19 A;  2X8H A;  2PGT A;  3MDK A;  3WGE A;  3QCP A;  3QFB C;  5DCH A;  4I2U A;  3FMW A;  1J0F A;  1B9Y C;  5HR3 A;  4NXI A;  1VF4 A;  3FR9 A;  4HQZ A;  1ZGN A;  4L0W A;  2C0E A;  3QDN A;  1ZL9 A;  2LUS A;  2YPM A;  3F9U A;  3SBC A;  2AV4 A;  2C80 A;  1ERT A;  2H1D A;  2PMT A;  4ECC A;  1XW5 A;  1SK1 A;  3BOA A;  2C3T A;  1GLQ A;  3LYK A;  4IEL A;  1Y25 A;  3LG6 A;  3ISO A;  3A2V A;  5CO3 A;  4TKY A;  2A2S A;  4AJ6 A;  1B48 A;  5EY6 A;  4XRA A;  3BBY A;  4TVE A;  5LCZ A;  2HZE A;  4HU9 A;  2C3Q A;  1SYR A;  2KP2 A;  2FWF A;  4G2E A;  3R3E A;  1UA5 A;  1PX6 A;  2FGX A;  2L57 A;  1GRX A;  4ECB A;  5AIS A;  4F82 A;  1ST9 A;  2NVL A;  1JZO A;  4O7H A;  4Z7X A;  2H30 A;  2IMK A;  3TKP A;  2XBQ A;  1QGV A;  2E2G A;  1ILO A;  3EU4 A;  3HDC A;  4IN0 A;  3I43 A;  4KUN A;  1K0C A;  3KD0 A;  2YP6 A;  2H6X A;  3FR6 A;  3H8Q A;  1XPV A;  1FW1 A;  2OE0 A;  1YEX A;  2HLS A;  2DJ3 A;  2P31 A;  2CQ9 A;  1EV9 A;  2GQL A;  3IC8 A;  3CSH A;  1YF0 A;  2GT6 A;  2WUL A;  2A2R A;  3CXG A;  1HD2 A;  3I6A A;  4L5L A;  1SJ6 A;  4MPG A;  2YJH A;  1NM3 A;  1CQG A;  3O76 A;  3UAR A;  3LEF A;  2I81 A;  3OR5 A;  4HI7 A;  4MNN A;  2VOC A;  2VLV A;  1YJ6 A;  4MPF A;  4HS1 A;  3GKK A;  1MD4 A;  5FHI A;  3KTB A;  1HQO A;  2HSH A;  2YZU A;  1SK2 A;  2TRX A;  2UZ8 A;  5KEJ A;  2WRT A;  2CVK A;  3IA1 A;  4I8B A;  3MNG A;  4TW5 A;  2YOI A;  2K9F A;  4ISD A;  1OAZ A;  1K3L A;  1A0R P;  2EIQ A;  3GKN A;  1T7P B;  5GAP D;  3LYP A;  3I9V 2;  1V98 A;  3VPQ A;  5GAN D;  1F2E A;  1B9X C;  3QAV A;  2KOK A;  2ES7 A;  1LU4 A;  3HVV A;  1GUM A;  1PA3 A;  4YKF A;  4JR6 A;  2CVD A;  2F51 A;  3CTF A;  2HE3 A;  2FLS A;  4IQ1 A;  1QK8 A;  2DMM A;  5D93 A;  5D9V A;  4RI7 A;  3TUE A;  5DVB A;  2DIZ A;  2B5Y A;  2PPT A;  5F8B A;  2GGT A;  1QQ2 A;  4KH7 A;  1S3C A;  3AY8 A;  1G6Y A;  3C1R A;  4XIH A;  3FW2 A;  2PU9 C;  2D2Z A;  5HFI A;  3JCM L;  2L4Q A;  5DDL A;  3KH7 A;  4G0K A;  2WFC A;  18GS A;  2WJU A;  19GS A;  4HQS A;  3F6D A;  4L5O A;  4RQX A;  4YAP A;  2IMF A;  3CSJ A;  2EIO A;  3L78 A;  1JHB A;  2V32 A;  2FA4 A;  4G0I A;  4KF9 A;  3A5I A;  2IME A;  3A3T A;  4WF4 A;  4K5S A;  3EVI A;  3IK7 A;  2J23 A;  4I2T A;  1WWJ A;  1W4V A;  5A5K A;  2FY6 A;  6GSV A;  1MTC A;  2H1A A;  3FZ4 A;  1EGR A;  1R26 A;  3FZ9 A;  1DUG A;  4QL7 A;  1LBK A;  1VF2 A;  5IOX A;  1GUK A;  4POL A;  4XTS A;  2VL2 C;  3DKS A;  2B7K A;  2CAQ A;  2KUC A;  1UVZ A;  4GLT A;  1GSF A;  1E2Y A;  4V2M A;  4OD7 A;  1N8J A;  4MF7 A;  5L71 A;  1K0B A;  1SU9 A;  1U87 A;  1K3Y A;  5HR1 A;  1NHY A;  2P5Q A;  5F0G A;  4DSQ A;  1X9M B;  2DBC A;  4PGT A;  1A2M A;  3A5W A;  2LNT A;  4GSS A;  4QL9 A;  5G30 A;  1F37 A;  3QAW A;  4J57 E;  1KEB A;  3LFL A;  4BL7 B;  2QKE A;  4KND A;  2OBI A;  4GCI A;  1TU7 A;  1BQ7 A;  1OC9 A;  1R5A A;  1XBS A;  3ED3 A;  2VL2 A;  3ERG A;  1PKZ A;  3DVW A;  2I1U A;  2DJ1 A;  5A4V A;  1PQN A;  1V40 A;  2B5X A;  5CRD A;  17GS A;  2B3S A;  3LGC A;  3APS A;  1O6J A;  1X5D A;  4J56 E;  1M0U A;  3J7Y k;  4IGJ A;  4QQ7 A;  2HRA A;  3FKF A;  1U6T A;  4F2I A;  2BTO T;  2E7P A;  5IMV A;  5JCG A;  16GS A;  3ERF A;  3IAM 2;  5KN3 A;  2C1Y A;  4KCA A;  1K0D A;  1MDK A;  4EVM A;  4OO5 A;  2LS5 A;  4PUF C;  2I9H A;  3GH9 A;  4K7N A;  3VK9 A;  2RUE A;  5ECO B;  4YKG A;  3IAS 2;  3HVS A;  1PSQ A;  2WZ9 A;  5D73 A;  1XZO A;  1ACV A;  3Q74 A;  2QA2 A;  1SD8 A;  3F0I A;  3WD6 A;  4N10 A;  13GS A;  2X99 A;  3DML A;  4RI6 A;  1X9W B;  2YWI A;  5EPF A;  5B8B A;  2NDO A;  1THX A;  3LWA A;  5HR2 A;  1HNC A;  3H79 A;  2JU5 A;  2C8U A;  1GSQ A;  1OYJ A;  1A8L A;  4WR4 A;  1VF1 A;  4MH3 A;  3VWX A;  2H1G A;  4BVY A;  6GSW A;  5F06 A;  1EP7 A;  2K8V A;  3ZTL A;  3DIE A;  3RPN A;  4KGI A;  3DWV A;  3ZML A;  3KP8 A;  3GUR A;  5E59 A;  1FG4 A;  2YWO A;  2HNL A;  4Z2T A;  2LRC A;  1TJD A;  5KN2 A;  4KSO A;  2RII A;  3G7J A;  3KTL A;  1Z6N A;  4PTS A;  2O89 A;  1V57 A;  2LKU A;  2H6Z A;  3TOT A;  3GX0 A;  1FB0 A;  3RPP A;  4KSM A;  4K8M A;  1T1V A;  4MJC A;  1YEP A;  2WCI A;  5IMF A;  3UJ1 A;  5DAL A;  2CZ2 A;  1PMT A;  3EE2 A;  2O87 A;  2DKI A;  2J9H A;  2L4C A;  3GKX A;  3M0F A;  2L5O A;  1KTE A;  2CAI A;  4KE3 A;  3TJB A;  3EYT A;  1O8W A;  5DCG A;  4ZL9 A;  3CSI A;  5GZZ B;  1ON4 A;  2B7J A;  1WIK A;  1H4O A;  2CVB A;  4JBB A;  2AJQ B;  3PPU A;  3D5J A;  1XWG A;  1ZOF A;  5J4U A;  1QXH A;  1J08 A;  4EE0 A;  2PN8 A;  1EEM A;  2FWG A;  3O6T A;  2DC5 A;  2GZZ A;  3UL3 A;  3D22 A;  2H8L A;  4Z2U A;  5GSS A;  4AGS A;  4H86 A;  1PN0 A;  1A2J A;  3VI5 A;  2L6D A;  4AJ7 A;  2H0G A;  4NHW A;  5IMC A;  3BD2 A;  5JWQ B;  3FY7 A;  1XWA A;  1F3B A;  4IKH A;  2DSA A;  4IJI A;  4XRD A;  2AHE A;  3HZ8 A;  2XPD A;  2R6K A;  1XCC A;  2JZS A;  2ZUP A;  1FOH A;  1EP8 A;  3U6V A;  2GVP A;  4GRF A;  3G7I A;  1NHO A;  1ERU A;  4KCE A;  3KJY A;  3V1W A;  4WF5 A;  4ML1 A;  3GRX A;  1A24 A;  2MBT A;  2BMX A;  5IMD A;  4CY6 A;  5J41 A;  5DQS A;  3TJJ A;  4EUY A;  5ELG A;  3G9B A;  3F6F A;  3D4T A;  5J3R A;  3IK9 A;  2TRC P;  3EWL A;  4TN8 A;  1YY7 A;  1PD2 1;  2LJK A;  4DSS B;  2H1B A;  3H93 A;  2GSQ A;  3UBL A;  4HZ4 A;  3TKR A;  4ZBB A;  4ECI A;  3LQ7 A;  4XHM A;  1GTB A;  2OA7 A;  1ZYE A;  1EZK A;  3N9J A;  2IMD A;  5JWR B;  4HUA A;  1ZYP A;  1PL2 A;  2GLR A;  3FR3 A;  1X9S B;  2DJK A;  2VO4 A;  1TOF A;  4WR5 A;  2QC7 A;  1DBY A;  2O85 A;  5HR0 A;  3D21 A;  2M80 A;  3UVH A;  3TJG A;  1T3B A;  1GWC A;  5ECK B;  5IPH A;  5CAX A;  1GTU A;  4ML6 A;  2JZR A;  1BJX A;  2X64 A;  1VGL A;  3ZRE A;  5B6N A;  1G0T A;  1URM A;  1U3A A;  2YNX A;  1TI3 A;  5G5F A;  22GS A;  5CP1 A;  5ECR B;  1I9D A;  3TRX A;  2GSR A;  4MZW A;  4OO4 A;  3ZRD A;  2LQQ A;  1WRY A;  4AJ8 A;  4TR0 A;  1XXU A;  4L8E A;  4RUV A;  2PWJ A;  2JZT A;  4TR1 A;  4FYC A;  2OAD A;  1Z3E A;  5ECS A;  1ERV A;  3P8W A;  2R4V A;  2B6M A;  3FRC A;  3WYW A;  10GS A;  1AIU A;  1TKD B;  3NOF A;  1YQ1 A;  3C73 A;  4V2L A;  6GSX A;  1Z6M A;  3EMP A;  4KDX A;  3KZQ A;  3BCI A;  4EIQ A;  1W89 A;  2IFQ B;  2CX3 A;  2GDR A;  3TJF A;  3LOR A;  3E3E A;  3GTU A;  6GSS A;  2C3N A;  3TKQ A;  3CYN A;  5ECH B;  3ZIJ A;  2H19 A;  4LA1 A;  2N5A A;  4KDY A;  3GNJ A;  1V2A A;  3GV1 A;  1TK5 B;  2ALB A;  1K3O A;  2XHF A;  4PNF A;  5HQP A;  4AF2 A;  5ELA A;  1O8X A;  2P5R A;  4MJB A;  3L9S A;  4V1A p;  3DVX A;  1BX9 A;  4FQU A;  1FOV A;  4EF0 A;  2N5B A;  3A2W A;  4MA9 A;  4HU7 A;  4NPB A;  3GL5 A;  1SEN A;  5F05 A;  4WXT A;  5EVO A;  2R0G A;  1GSE A;  4HOJ A;  3E0U A;  4WBJ A;  2WB9 A;  3QD9 A;  1PGT A;  2EC4 A;  3PIN A;  2VCQ A;  3IE3 A;  2O7K A;  5B7C A;  3DXB A;  2AYT A;  2DJJ A;  3GSS A;  4WKW A;  3KGK A;  2B1L A;  2HZF A;  1JZD A;  3U5R E;  1FAA A;  3M8N A;  5J9C A;  3A2X A;  4O5U A;  2H76 A;  4G0L A;  1R7H A;  1XW9 A;  4XS6 A;  3KP9 A;  1AW9 A;  4L0U A;  5KN1 A;  5DAK A;  1AQX A;  4DEJ A;  2VLU A;  2MMO A;  1BYE A;  1SJI A;  3EPT A;  5D9X A;  4EIP A;  1JZR A;  1K0N A;  2H71 A;  3RHC A;  4GTU A;  2V1M A;  1OC8 A;  3IOS A;  2TIR A;  3TDG A;  4A5P A;  2CZ3 A;  2Z9S A;  1TI1 A;  2GTU A;  2VAF A;  3GUS A;  4NAX A;  1U3I A;  3MAK A;  2VCV A;  1R4W A;  4EDZ A;  2IL3 A;  3Q6O A;  4O5R A;  2VL9 A;  5D8I A;  2YJ7 A;  4Q5R A;  8GSS A;  3N5O A;  1GP1 A;  2WGR A;  5GST A;  4I97 A;  3O3T A;  1JFU A;  3KMO A;  5BMU A;  2R5G A;  4KX4 A;  2L59 A;  4NV2 A;  1YKA A;  5C00 A;  2A2P A;  2VL3 A;  4N11 A;  2AB6 A;  4IS0 A;  3KM6 A;  4PQI A;  3UAP A;  3ERW A;  1R5P A;  2M72 A;  4ILF A;  2LEG A;  1OVN A;  4K2D A;  3VLN A;  2IIY A;  4YQU A;  4NMU A;  3HZ4 A;  5G1L A;  3UEM A;  2HZE B;  4BVX A;  1AUC A;  2REM A;  3WT1 A;  1ERW A;  3NZN A;  2H01 A;  4LMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...