3FK8A

The crystal structure of disulphide isomerase from xylella fastidiosa temecula1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
131
structure length
131
Chain Sequence
ALNLPYDEHADAWTQVKKALAAGKRTHKPTLLVFGANWCTDCRALDKSLRNQKNTALIAKHFEVVKIDVGNFDRNLELSQAYGDPIQDGIPAVVVVNSDGKVRYTTKGGELANARKMSDQGIYDFFAKITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Disulphide isomerase
publication title The crystal structure of disulphide isomerase from Xylella fastidiosa Temecula1
rcsb
source organism Xylella fastidiosa
total genus 51
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3fk8A00
3CBUA 2DJJA 1LU4A 3APQA 14GSA 1FW1A 3G7JA 1Y25A 4WR4A 1V40A 3WT2A 1S3DA 1YJ6A 1AC1A 2H6XA 3EU3A 4JZQA 4ISDA 1YEXA 13GSA 3P7XA 2CA8A 3FK8A 3MWHA 2X8CA 3CTGA 5HR0A 4XS4A 2LTKA 3HD5A 1SD9A 1GTAA 2P31A 1GNWA 1J08A 4NXIA 1NM3A 4LA1A 3VLNA 1TK0B 3TJJA 3APSA 4EKZA 1QQ2A 2OKAA 2B1LA 3A3TA 2WULA 3ZLPA 5J41A 5G1LA 4ZL8A 3GKXA 4K2DA 4N0ZA 2KHPA 5DJMA 5KN1A 1O6JA 3QFBC 2OACA 1R5AA 2REMA 4ZBBA 2ALBA 2N5BA 4Q5FA 4MK3A 4I5QA 4IGJA 1SKRB 3SBCA 1GTIA 2LNTA 4XRAA 1Z6NA 1XWCA 2R3XA 2M46A 3HJOA 2FLSA 20GSA 1Z9HA 3EE2A 2K8VA 4WBRD 4HQSA 3IHQA 3J7Yb 3LXTA 2I81A 5H5SA 3ERWA 4YQUA 5CRGA 1JHBA 1QUWA 4ULXA 2VIMA 3LXZA 4DSRA 5AN1A 1N8JA 3GL5A 4PNFA 2GS3A 4ILFA 3CYNA 3KD0A 2VM1A 3GMFA 5CO3A 3HY2A 5H5RA 2GTUA 1GP1A 2J9HA 3TKSE 5G31A 2X8HA 2WDUA 3QR6A 2ZUPA 2OE1A 4GTUA 3U6VA 5CP1A 4MH2A 5ECLB 3VFIA 2QKEA 2EC4A 2C0GA 4QL9A 3QCPA 5G5FA 2AV4A 4BWQA 4TR4A 2V1MA 3EINA 1M2BA 5A4UA 1PMTA 1FG4A 3HVVA 2FWGA 3D0ZA 3N9JA 5E4WA 2F8AA 2VLUA 4GSTA 1GWCA 2R4VA 5HQPA 2OA7A 1J0FA 4I2UA 1W89A 5IQYA 2LRTA 1M2AA 2CVBA 2HYXA 1MDKA 1OYJA 3TRQA 1HNCA 1GULA 4GF0A 4HDEA 5F05A 3O3TA 1BQ7A 1YQ1A 3LG6A 5IOWA 2KLXA 4HOJA 2YV9A 4AJ6A 2JACA 3KP9A 3ERGA 1DE1A 1FVKA 1R5PA 4CW9A 3C1RA 1DUGA 3QFAC 1SJ6A 2F9SA 3KTLA 2IMKA 4V2NA 4P3YB 1XWKA 2IIYA 1B9YC 4I8BA 2OJLA 3IRAA 1CQHA 2TRCP 3VURA 1OKDA 4O7HA 5CYYA 2LQOA 4PX1A 1GRXA 4EXJA 3CSJA 1H4OA 4WXTA 4X0XA 2CVDA 2VCTA 3WYWA 2O85A 1TKDB 3L9VA 1M99A 1T4ZA 4GQCA 4HU7A 1T1VA 2BTOT 1MTCA 3C71A 2PWJA 2N5FA 1JLVA 4AGSA 1AUCA 3ED3A 1ZYQB 1XVQA 1YKCA 3HKRA 2H75A 5L71A 1Q4JA 3DKSA 4Q5QA 2YN1A 1M2DA 5KN0A 4ECJA 3F9UA 1LBKA 1E6BA 2C80A 3C8EA 1SJIA 3FHKA 3VWXA 3DD3A 6GSYA 2GDRA 2HRFA 2GZPA 2LRNA 1EZKA 1QXHA 4HJ2A 5IOXA 5IMZA 1VRSD 4K6XA 2B5XA 2L6DA 1GSYA 1GSFA 2VL2C 2H30A 2V2GA 3MNGA 1VF4A 5B6NA 5JCWA 1PKWA 3KH9A 4LMWA 2V32A 4JR6A 1C72A 4K0NA 1WE0A 5ECOB 2CZ3A 1Z5YE 1EOGA 2GT5A 1OE7A 22GSA 2HLSA 4KCEA 1O73A 2DBCA 2E7PA 4I2TA 2VLTA 3RPNA 3F4SA 5EL8A 3ZIJA 4MJCA 4ACSA 2AYTA 1SU9A 5EVOA 3GHAA 4BA7A 2VUPA 3UBKA 5H5QA 2BMXA 2R5GA 1PGTA 4I97A 3FRCA 1K3LA 1ILOA 1F2EA 5CAXA 4LL4B 3RAZA 1SL0B 3HJPA 3ZIVA 2YP6A 2DMLA 3RHCA 2X8GA 4J57E 2YCDA 3DVXA 1DSBA 2LJKA 1YF0A 1TU7A 2OBIA 4N11A 1WP0A 1M9BA 5JWRB 3L4NA 3MDKA 4TW5A 3GA4A 3PH9A 3Q74A 1PX7A 3UEMA 3HA9A 3CTFA 2VL9A 3VWUA 3EC3A 1UVZA 2WJUA 1EV4A 1U3IA 2XPDA 3BCKA 5B6MA 3TGZA 1GTUA 3A2XA 2B7KA 1R7HA 2MBSA 1SYRA 1JZOA 3LYPA 3J7Yk 1O7UA 3A5WA 2MMAA 3E3EA 3F6DA 2HZEB 4RQRA 1BG5A 4AF2A 2L4CA 2HFDA 4XS1A 4XS6A 3ZL5A 1SKWB 3LSZA 2L57A 5HFKA 3HVXA 3KM6A 3ME7A 4OD7A 2PPTA 1EV9A 2FA4A 1SK2A 3IV4A 4HZ2A 1RK4A 2C4JA 2LUSA 2YNXA 4XTSA 2H19A 2H6YA 4KH7A 1PL1A 1GSQA 3HZ4A 3VWVA 3QAGA 5GSTA 3K8NA 1B9XC 2CX3A 3BBYA 3P8WA 4G9HA 5INYA 1K0OA 3M8NA 18GSA 3F3RA 3KP8A 4GCIA 3IR4A 4O32A 1G7OA 4XRDA 1B4PA 3D4MA 6GSVA 2YZUA 3JCML 2GSSA 6GSXA 1T7PB 4QL7A 2I9HA 3KH7A 4BPYA 4RQXA 3IC4A 1GSDA 2VL2A 3KXOA 4EO3A 4IBPA 1ZZYA 3M3MA 4NPBA 1X5CA 5CRHA 3IDVA 4OCEA 4G2EA 1MDJA 4KCAA 4TR1A 2GVPA 2H1AA 4NMUA 3TB2A 1X9SB 3UARA 5J3RA 5D9XA 5IMDA 4TR1B 2LJRA 2DJ2A 3ZZXA 1S3CA 5GAPD 1OAZA 1QFNA 3GFKA 4GQFA 2H0HA 2DMMA 1PA3A 4TKYA 3LJRA 3CRUA 1BX9A 3FZ9A 4J56E 3LYKA 3WGXA 1R4WA 2PERA 4HUAA 1H75A 4BVYA 2R37A 1O8XA 1PRXA 4TVEA 1G6YA 4HQZA 1I5GA 2P5RA 3LGCA 4TRXA 4OFMA 4OFNA 4FO5A 3GKNA 1AQXA 2G2QA 3RBTA 3FR9A 4V2LA 1XBSA 2FHEA 3ME8A 1GUHA 4ZL7A 2AB6A 2FGXA 3G7YA 1E2YA 4KA0A 2PBJA 2C8UA 1WOUA 1ERWA 5ECSA 3IE3A 4CHSA 1XOBA 1FO5A 3D21A 3GX8A 4K9ZA 2YWIA 3FY7A 3F0IA 1GLPA 4NHZA 1XZOA 3GV1A 2J23A 4MZCA 2JSYA 4E8EA 4F82A 2I3YA 4PURA 3ERFA 5JWOB 2G0FA 4PQHA 1XWGA 2BJXA 4IKHA 2CAQA 2DJ3A 1XWAA 4MP4A 3IAM2 2DSAA 3BOAA 3IA1A 4OMVA 2XHFA 5HFGA 1FOVA 3R2QA 3EMPA 1Z7RA 5ECMB 1O81A 4LMVA 2MMOA 4WEYA 3UJ1A 1WWJA 3ZFLA 2HT9A 1K0CA 4KB3A 2B3SA 2H6ZA 1BEDA 2LV3A 4POBA 1EP8A 4MLYA 1TK5B 5AGYA 3FZAA 5IPHA 2IMIA 3FEUA 2LKUA 1NHOA 3QMXA 1JFUA 3M1GA 4ZBDA 1KEBA 1MDIA 2D2ZA 3ZMLA 16GSA 6GSUA 4G19A 4DEJA 3H4KA 3H8QA 3EURA 1ZL9A 3TCOA 3MSZA 2IJYA 3GKKA 3NIVA 1X0RA 5ENUA 3CRTA 4IJ3A 2VD1A 3H93A 5C04A 2FWEA 4K1FA 3HXSA 3LQ7A 4GSSA 5FHIA 3Q18A 3DEXA 2HI7A 2QC7A 3F4TA 1G0TA 2RUEA 4KE3A 4Z7XA 4GXZA 1Q98A 2PVOC 1MD3A 4V2MA 2IFQA 4HS1A 3DWVA 3IK9A 4ID0A 4IHUA 1WRYA 5IMVA 1SJZA 1WMJA 1XOAA 1AAZA 2H1DA 2MMNA 4ML1A 5E59A 2IFQB 3GKMA 5DQSA 1BAYA 3EU4A 1K0DA 2TRXA 1A0FA 1UA5A 3D6IA 2RM5A 5CREA 4ECIA 2H1GA 2B7JA 4MJEA 1Z6MA 3TKPA 4POKA 2HXKA 5C00A 3TJGA 4ECBA 3IOSA 5D73A 4MJBA 2WCIA 4ZXGA 2X64A 2I4AA 5IMAA 2O7KA 2WGRA 3QPMA 2YANA 4EUYA 3ZYWA 1TW9A 1JLWA 2EIOA 3UOMA 3EVIA 2WS2A 2KP1A 1ABAA 3ZMKA 2K18A 5FWGA 2GSRA 1GLQA 3GSSA 1XW6A 3DRNA 2R6KA 2XPEA 4IQAA 3DGQA 1TK8B 4XHMA 4MZWA 4LLRA 2E2MA 3VK9A 2FWFA 2LSTA 5AISA 1YY7A 4NV2A 2FY6A 3FYGA 5ECNB 3FZ4A 3CSIA 3LFLA 2CT6A 1A8LA 3E0UA 2VAFA 1HYUA 3KCMA 2H76A 3UVHA 4TN8A 3LORA 2CQ9A 1NHYA 1URMA 5KN2A 3PR8A 3FKFA 1B8XA 2RLIA 2H70A 5KEJA 2M72A 1QMVA 3ZRDA 1F37A 1A0RP 3QOUA 4N0VA 1X9MB 1SENA 4PXOA 5LCZA 1THXA 4F0BA 3H79A 3LEFA 1U87A 4HEA2 4OWYA 5ID2B 5IM9A 1FAAA 1G7EA 4NV5A 1X5EA 1SL1B 5EY6A 2L4QA 1FB0A 3Q19A 2LRCA 1JZRA 4MPGA 4ZILA 4MABA 3DYRA 3VI7A 5A4WA 1XPVA 3N5OA 1OC3A 4E8HA 2KOKA 4BWSA 1HNAA 1ZOFA 3WGEA 3FW2A 2O8VB 1TRVA 4X1UA 3Q6OA 2V6OA 5GSSA 2H66A 4DSQA 3IXRA 4IJIA 2WFCA 4WF4A 1OC8A 1XVWA 1ON4A 1XXUA 4L8EA 3D22A 4FYBA 2E0QA 1J9BA 1WIKA 2IN3A 3VI5A 2VL3A 4TXOB 1Z7PA 3D4TA 3WD6A 2OE0A 2AUVA 1YF1A 2MBTA 1K3YA 3PGTA 1W4VA 2VD0A 1N2AA 2X99A 4Q5RA 3I9V2 1F3BA 2H8LA 3IPZA 1PQNA 3HYPA 1AQWA 3VWWA 1SD8A 2YZHA 1Y6EA 5LNKe 1V98A 1XCCA 2RIIA 3P90A 4K7OA 5EPFA 2HZEA 4IP1A 2PN8A 4KUNA 2GQKA 3C7MA 5ECIB 2VCQA 1NSWA 2GQLA 5B8AA 5CRDA 3GTUA 3L9UA 1K0BA 6GSSA 3C1SA 4JRRA 5IPGA 2C1YA 3OR5A 5FT3A 4OO4A 4HJMA 2FD3A 4JR4A 3GTUB 4FYCA 4NHWA 3KIJA 1V2AA 3DXBA 2QGVA 1T8EB 5D9VA 2HSYA 4ZB9A 4YAVA 5DALA 1OE8A 2C0EA 1AIUA 3GH6A 4EVMA 4PQIA 2OBKA 1T4YA 3HHVA 4PNGA 1YKAA 4F0CA 2LS5A 2NVLA 4NAXA 1M7TA 4F2IA 5DALB 3KJYA 1ZMAA 3F3QA 2H01A 1PKZA 3E9JB 1GH2A 3APOA 3TJBA 2FA8A 4ZB6A 4GRFA 2K8SA 2DC5A 4IP6A 5D96A 4FIWA 2JL4A 5AIXA 2MMZA 3IAS2 1DBYA 4POMA 3TKSA 1THOA 4MH3A 2Z9SA 3I6AA 4HZ4A 1TU8A 4CDOA 4ML6A 2H0IA 5D9WA 3HCZA 3EWLA 5HR2A 2IMFA 3GNJA 1TI3A 3FR3A 4GWRA 2GGTA 2H1BA 2VOCA 3ZVJA 2C0FA 4HU9A 3QAWA 3KGKA 4Q5NA 5B8BA 2A4VA 2GT6A 4ZB8A 5HFIA 3GIXA 4TXVA 3TOUA 4K7IA 4EDYA 4MZBA 5IIZA 1A23A 5G2ZA 1I9DA 9GSSA 2C0DA 2FNOA 5IMFA 3KMNA 4WF5A 1OC9A 2VCZA 8GSSA 2IMDA 2XBQA 3F8UA 1XIYA 1TP9A 3RDWA 1SKSB 4QQ7A 4IQ1A 3W6GA 2M80A 3F4RA 2YWOA 4K7NA 4LL1B 1TI1A 1OC9B 1FHEA 2K9FA 4TR0A 3ZREA 2CVKA 2ON5A 1GL8A 4D73A 1AXDA 2ZNMA 4MMMA 2L5OA 4RUVA 3TKQA 3ZVJD 4HI7A 3G7IA 4D73B 1M0UA 2B5YA 1PD21 2VM2A 5CRWA 2P5QA 2AJQB 1AW9A 1KNGA 1EGOA 2LQQA 2PUKC 3MAKA 3KMOA 1V57A 1PX6A 2DLXA 4F03A 4XS4B 3QD9A 3HVSA 3TJFA 2B6MA 1BJXA 3AY8A 4KGIA 4JU5A 2R2JA 3NOFA 11GSA 1ERTA 2K6VA 1VF2A 5ECPB 2JZTA 1CQGA 3FR6A 2F8FA 4X43A 4EL1A 5DJLA 4MF6A 5D8IA 4BVXA 1KTEA 4V1Ap 1OVNA 1KBNA 4IN0A 4OO5A 4O92A 3TRPA 2JSZA 3UMAA 2MYGA 2KP2A 1AQVA 1NW2A 5A5KA 2C3NA 1MEKA 4FYUA 2YWNA 1T00A 3P2AA 4GLTA 2DIYA 2HRNA 1JZDA 2H71A 6GSWA 1F9MA 5ECQB 5IMCA 2VCVA 1LJRA 4KAEA 5ELGA 5F06A 2A2RA 3RPPA 2GSTA 3UBLA 5G1KA 4WBJA 3A2WA 3DIEA 3W8SA 3GN3A 5COHA 2H72A 5F0GA 4K8MA 1B48A 2HNLA 1WJKA 2GLRA 3CXGA 1HNBA 3GX0A 1EGRA 1IYHA 3US3A 4IW9A 7GSSA 4KDXA 3V1WA 5G30A 4MJAA 1F3AA 1EWXA 3TKRA 2YV7A 5KN3A 5A4VA 1GSUA 5J5NA 5D9TA 4ZBAA 3TOTA 1GUMA 1U6TA 2JZRA 1QGVA 4IELA 2LNSA 5HR3A 3BD2A 1U88A 5JWQB 4AJ7A 2NDOA 2YOIA 2FCHA 3L9SA 4EF0A 4FH8A 1A2LA 4N30A 4ECCA 1MD4A 1O8WA 4YAPA 2EIRA 3ZFBA 4POLA 1A24A 4GSNA 3QAVA 4NWYA 2N5AA 3EYTA 5DDLA 2B5EA 1PL2A 1FVJA 2XC2A 3WGDA 4JEDA 2ZCTA 2L59A 3L78A 1WPIA 3FZ5A 5J9BA 3SWLA 2YJHA 4J2FA 3BJ5A 3GSTA 1X9WB 1A2MA 4JBBA 4KSMA 1F6MC 3GH9A 1VF1A 3UVTA 2OADA 2JZSA 2HE3A 3UAPA 3VPTA 2CAIA 5J4UA 5JCGA 3A2VA 2V6KA 3ISOA 3HZ8A 4KX4A 3EMXA 2F3MA 4L5LA 2H0GA 2NBSA 5GAND 4AJ8A 4OFTA 5HR1A 5ECKB 12GSA 4N10A 1TRWA 2PMTA 2CX4A 2GZZA 3D5JA 1TDIA 4MPFA 3M9JA 3RHBA 3I43A 3GYKA 4G10A 2YPMA 5DQYA 2GZYA 1RW1A 1PSQA 4K0GA 2DJKA 1SYXA 1GSEA 1A2JA 3W8JA 1T3BA 2L6CA 3NZNA 2ON7A 1YZXA 3QDNA 3DVWA 2P0GA 4DSSA 3LWAA 1GSSA 3GUSA 1X5DA 2OE3A 2VO4A 2HSHA 3M0FA 3KZQA 1UC7A 3DMLA 5F8BA 3TKSC 5ABRA 5ID2A 3GRXA 4XCSA 4DSSB 4YH2A 1XFLA 2O89A 2CZ2A 5CNWA 1OKTA 4MF5A 1ERUA 1QK8A 1ML6A 1TTZA 2O87A 2B1KA 10GSA 1HD2A 2KUCA 4MDCA 1EEJA 2HZFA 4H86A 4TR3A 2A2SA 1YEPA 1TJDA 2AHEA 2JU5A 5DAKA 3GURA 2LEGA 4YQVA 1XW5A 4DVCA 3BCIA 2E2GA 5LD0A 3G9BA 4PQ1A 4EDZA 4ZL9A 1HQOA 3HJMA 3UIWA 5DAKB 1EOHA 2MZCA 3H1NA 3VPQA 1XWBA 1GNEA 1G6WA 2QSIA 4TXOA 1V58A 2ES7A 2WRTA 3L0HA 2GSQA 2IMEA 2C3TA 3WT1A 4KNDA 3M9KA 3TJKA 3HDCA 4IVFA 5DBQA 1TXXA 5ELAA 1R26A 5DCHA 2PVQA 1K3OA 4PUAA 2LJAA 19GSA 3IBHA 2XBIA 4KDYA 1ZCPA 1ZGNA 5JCUA 1XW9A 4WKWA 1TRUA 1GTBA 2IPAA 1O85A 2IWTA 2CV4A 5J9CA 1K0AA 4KW6A 2VCWA 4MCUA 2YJ7A 2IL3A 5DCGA 1IYIA 4WR5A 1M9AA 1EP7A 1Z3EA 3O6TA 5DVBA 5AIVA 4I6XA 4KSOA 1TRSA 1EEMA 6GSTA 2FUG2 2DJ1A 4OCFA 4EC0A 4F9ZA 2DIZA 2PU9C 1K0MA 4IS0A 3TDGA 2JADA 4RI7A 2WZ9A 1UN2A 4JE1A 3ZTLA 1JZWA 3GL3A 2V41A 2YWMA 1BYEA 4YQMA 2RUFA 5D93A 1VF3A 3O76A 1SL2B 2VCXA 4V1Ag 4WETA 3TUEA 1ST9A 1USBA 4L0WA 1B4QA 4RI6A 2H74A 2WB9A 1K0NA 1RQMA 2H73A 2PGTA 4ZIJA 3C73A 4MF7A 5IO0A 1V9WA 5B7CA 3KEBA 4L0UA 2DJ0A 2I1UA 2F51A 2L5LA 3CSHA 1ZYEA 4O5RA 1TOFA 3F6FA 3UL3A 1FB6A 2FWHA 3IK7A 2VLVA 4EE0A 4MA9A 1YDKA 2RM6A 2EIQA 5GZZB 4KDUA 3TRXA 2TIRA 4XIHA 1VGLA 1A8YA 1ERVA 3I69A 2AAWA 1U3AA 2NTOA 3CMIA 3F63A 1DE2A 5IO2A 3KTBA 2C3QA 5F07A 4PGTA 17GSA 3PINA 4L5OA 1S3AA 5ECHB 5ECRB 3U5RE 1GUKA 3ZITA 1SK0A 4PUFC 1SK1A 3S9FA 5G5EA 2NPBA 4TOPA 2GQMA 1PN9A 1ACVA 4BL7A
chains in the Genus database with same CATH superfamily
3CBUA 2DJJA 1LU4A 3APQA 14GSA 1FW1A 3G7JA 1Y25A 4WR4A 4BL7B 1V40A 3WT2A 1S3DA 1YJ6A 1AC1A 2H6XA 3EU3A 4JZQA 4ISDA 1YEXA 13GSA 3P7XA 4YKFA 2CA8A 3FK8A 3MWHA 2X8CA 3CTGA 5HR0A 4XS4A 2LTKA 3HD5A 1SD9A 1GTAA 2P31A 1GNWA 1J08A 4NXIA 1NM3A 4LA1A 3VLNA 1TK0B 3TJJA 3APSA 4EKZA 1QQ2A 2OKAA 2B1LA 3A3TA 2WULA 2QA2A 3ZLPA 5J41A 5G1LA 4ZL8A 3GKXA 4K2DA 4N0ZA 2KHPA 5DJMA 5KN1A 1O6JA 3QFBC 2OACA 1R5AA 2REMA 4ZBBA 2ALBA 2N5BA 4Q5FA 4MK3A 4I5QA 4IGJA 1SKRB 3SBCA 1GTIA 2LNTA 4XRAA 1Z6NA 1XWCA 2R3XA 2M46A 3HJOA 2FLSA 20GSA 1Z9HA 3EE2A 2K8VA 4WBRD 4HQSA 3IHQA 3J7Yb 3LXTA 2I81A 5H5SA 3ERWA 4YQUA 5CRGA 1JHBA 1QUWA 4ULXA 2VIMA 3LXZA 4DSRA 5AN1A 1N8JA 3GL5A 4PNFA 2GS3A 4ILFA 3CYNA 3KD0A 2VM1A 3GMFA 5CO3A 3HY2A 5H5RA 2GTUA 1GP1A 2J9HA 3TKSE 5G31A 2X8HA 2WDUA 3QR6A 2ZUPA 2OE1A 4GTUA 3U6VA 5CP1A 4MH2A 5ECLB 3VFIA 2R0PA 2QKEA 2EC4A 2C0GA 4QL9A 3QCPA 5G5FA 2AV4A 4BWQA 4TR4A 2V1MA 3EINA 1M2BA 5A4UA 1PMTA 1FG4A 3HVVA 4PTSA 2FWGA 3D0ZA 3N9JA 5E4WA 2F8AA 2VLUA 4GSTA 1GWCA 2R4VA 5HQPA 2OA7A 3A5IA 1J0FA 4I2UA 1W89A 5IQYA 2LRTA 1M2AA 2CVBA 2HYXA 1MDKA 1OYJA 3TRQA 1HNCA 1GULA 4GF0A 4HDEA 5F05A 3O3TA 1BQ7A 1YQ1A 3LG6A 5IOWA 2KLXA 4HOJA 2YV9A 4AJ6A 2JACA 3KP9A 3ERGA 1DE1A 1FVKA 1FOHA 1R5PA 4CW9A 3C1RA 1DUGA 3QFAC 1SJ6A 2F9SA 3KTLA 2IMKA 4V2NA 4P3YB 1XWKA 2IIYA 1B9YC 4I8BA 2OJLA 3IRAA 1CQHA 2TRCP 3VURA 1OKDA 4O7HA 5CYYA 2LQOA 4PX1A 1GRXA 4EXJA 3CSJA 1H4OA 4WXTA 4X0XA 2CVDA 2VCTA 3WYWA 2O85A 1TKDB 3L9VA 1M99A 1T4ZA 4GQCA 4HU7A 1T1VA 2BTOT 1MTCA 3C71A 2PWJA 2N5FA 1JLVA 4AGSA 1AUCA 3ED3A 1ZYQB 1XVQA 1YKCA 3HKRA 2H75A 5L71A 1Q4JA 3DKSA 4Q5QA 2YN1A 1M2DA 5KN0A 4ECJA 3F9UA 1LBKA 1E6BA 2C80A 3C8EA 1SJIA 3FHKA 3VWXA 3DD3A 6GSYA 2GDRA 2HRFA 2GZPA 2LRNA 1EZKA 1QXHA 4K2XA 4HJ2A 5IOXA 5IMZA 1VRSD 4K6XA 2B5XA 2L6DA 1GSYA 1GSFA 2VL2C 2H30A 2V2GA 3MNGA 1VF4A 5B6NA 5JCWA 1PKWA 3KH9A 4LMWA 2V32A 4JR6A 1C72A 4K0NA 1WE0A 2CZ3A 5ECOB 1Z5YE 1EOGA 2GT5A 1OE7A 22GSA 2HLSA 4KCEA 1O73A 2DBCA 2E7PA 4I2TA 2VLTA 3RPNA 3F4SA 2DKIA 5EL8A 3ZIJA 4MJCA 4ACSA 2AYTA 1ZYNA 1SU9A 5EVOA 3GHAA 4BA7A 2VUPA 3UBKA 5H5QA 2BMXA 2R5GA 1PGTA 4I97A 3FRCA 1K3LA 2X4AA 1ILOA 4KF9A 1F2EA 5CAXA 4LL4B 3RAZA 1SL0B 3HJPA 3ZIVA 2YP6A 2DMLA 3RHCA 2X8GA 4J57E 2YCDA 3DVXA 1DSBA 2LJKA 1ZYPA 1YF0A 1TU7A 2OBIA 4N11A 1WP0A 1M9BA 5KOWA 5JWRB 3L4NA 3MDKA 4TW5A 3GA4A 3PH9A 3Q74A 1PX7A 3UEMA 3HA9A 3CTFA 2VL9A 3VWUA 3EC3A 1UVZA 2WJUA 1EV4A 1U3IA 2XPDA 3BCKA 4K5RA 5B6MA 3TGZA 1GTUA 3A2XA 2B7KA 1R7HA 2MBSA 1SYRA 1JZOA 3LYPA 3J7Yk 4EIQA 1O7UA 3A5WA 2MMAA 3E3EA 4FQUA 3F6DA 2HZEB 4RQRA 1BG5A 4AF2A 2L4CA 2HFDA 4XS1A 4XS6A 3ZL5A 3CQFA 1SKWB 3LSZA 2L57A 5HFKA 3HVXA 3KM6A 3ME7A 4OD7A 2PPTA 1EV9A 2FA4A 1SK2A 3IV4A 4HZ2A 1RK4A 2C4JA 2LUSA 2YNXA 4XTSA 2H19A 2H6YA 4KH7A 1PL1A 1GSQA 3HZ4A 3VWVA 3QAGA 5GSTA 3K8NA 1B9XC 2CX3A 3BBYA 3P8WA 4G9HA 5INYA 1K0OA 3M8NA 18GSA 3F3RA 3KP8A 4GCIA 3IR4A 4O32A 1G7OA 4XRDA 1B4PA 3D4MA 6GSVA 2YZUA 3JCML 2GSSA 6GSXA 1T7PB 4QL7A 2A2PA 2I9HA 3KH7A 4BPYA 4RQXA 3IC4A 1GSDA 2VL2A 3KXOA 4EO3A 4IBPA 1ZZYA 3M3MA 4NPBA 1X5CA 5CRHA 3IDVA 4OCEA 4G2EA 1MDJA 4KCAA 4TR1A 2GVPA 2H1AA 4NMUA 3TB2A 1X9SB 3UARA 3R3EA 5J3RA 5D9XA 5IMDA 4TR1B 2LJRA 2DJ2A 3ZZXA 1S3CA 5GAPD 1OAZA 4G0LA 1QFNA 3GFKA 4GQFA 2H0HA 2DMMA 1PA3A 4TKYA 3LJRA 3CRUA 1BX9A 3FZ9A 4Z2UA 4J56E 3LYKA 3WGXA 1R4WA 2PERA 4HUAA 1H75A 4BVYA 2R37A 1O8XA 1PRXA 4TVEA 1G6YA 4HQZA 1I5GA 2P5RA 3LGCA 4TRXA 4OFMA 4OFNA 4FO5A 3GKNA 1AQXA 2G2QA 3RBTA 3FR9A 4V2LA 1XBSA 4K5SA 4BVYB 2FHEA 3ME8A 1GUHA 4ZL7A 2AB6A 1PFOA 2FGXA 3G7YA 1E2YA 4CY8A 4KA0A 2PBJA 2C8UA 1WOUA 1ERWA 5ECSA 3IE3A 4CHSA 1XOBA 1FO5A 3D21A 3GX8A 4K9ZA 4X4JA 2YWIA 3FY7A 3F0IA 3LW9A 1GLPA 4NHZA 1XZOA 3GV1A 2J23A 4MZCA 2JSYA 4E8EA 4F82A 2I3YA 4PURA 3ERFA 5JWOB 2G0FA 4PQHA 1XWGA 2BJXA 4IKHA 2CAQA 2DJ3A 1XWAA 4MP4A 3IAM2 2DSAA 3BOAA 3IA1A 4OMVA 2XHFA 5HFGA 1FOVA 3R2QA 3EMPA 1Z7RA 5ECMB 1O81A 4LMVA 2MMOA 4WEYA 3UJ1A 1WWJA 3ZFLA 2HT9A 1K0CA 4KB3A 2B3SA 2H6ZA 1BEDA 2LV3A 4POBA 1EP8A 4MLYA 1TK5B 5AGYA 3FZAA 5IPHA 5KOXA 2IMIA 3FEUA 2LKUA 1NHOA 3QMXA 1JFUA 3M1GA 4ZBDA 1KEBA 1MDIA 2D2ZA 2A4HA 3ZMLA 16GSA 6GSUA 4G19A 4DEJA 5BMUA 3H4KA 3H8QA 3EURA 1ZL9A 3TCOA 3MSZA 2IJYA 3GKKA 3NIVA 1X0RA 5ENUA 3CRTA 4IJ3A 2VD1A 3H93A 5C04A 2FWEA 4K1FA 3HXSA 3LQ7A 4GSSA 5FHIA 3Q18A 3DEXA 2HI7A 2QC7A 3F4TA 1G0TA 2RUEA 4KE3A 4Z7XA 4GXZA 1Q98A 2PVOC 1MD3A 4V2MA 2IFQA 4HS1A 3DWVA 3IK9A 4ID0A 4IHUA 1WRYA 5IMVA 1SJZA 1WMJA 1XOAA 1AAZA 2H1DA 2MMNA 4ML1A 2IFQB 5E59A 3GKMA 5DQSA 1BAYA 3HVNA 3EU4A 1K0DA 2TRXA 1A0FA 1UA5A 3D6IA 3PPUA 2RM5A 5CREA 4ECIA 2H1GA 2B7JA 4MJEA 1Z6MA 3TKPA 4POKA 2HXKA 5C00A 3TJGA 4ECBA 3IOSA 5D73A 4MJBA 2WCIA 4ZXGA 2X64A 2I4AA 5IMAA 2O7KA 2WGRA 3QPMA 2YANA 4EUYA 3ZYWA 1TW9A 1JLWA 2EIOA 1M3IA 3UOMA 3EVIA 2WS2A 2KP1A 1ABAA 3ZMKA 2K18A 5BRTA 5FWGA 2GSRA 1GLQA 3GSSA 1XW6A 3DRNA 4O5QA 2R6KA 2XPEA 4IQAA 3DGQA 1TK8B 4XHMA 4MZWA 4LLRA 2E2MA 1M3JA 3VK9A 3FMWA 2FWFA 2LSTA 5AISA 1YY7A 4NV2A 2FY6A 3FYGA 5ECNB 3FZ4A 3CSIA 3LFLA 2CT6A 1A8LA 4A5PA 3E0UA 2VAFA 1HYUA 3KCMA 2H76A 3UVHA 3MIXA 4TN8A 3LORA 2CQ9A 1NHYA 1URMA 5KN2A 3PR8A 3FKFA 1B8XA 2RLIA 2H70A 5KEJA 2M72A 1QMVA 3ZRDA 1F37A 1A0RP 3QOUA 4N0VA 1X9MB 1SENA 4PXOA 5LCZA 1THXA 4F0BA 3H79A 3LEFA 1U87A 4HEA2 4OWYA 5ID2B 5IM9A 1FAAA 1G7EA 4NV5A 1X5EA 1SL1B 5EY6A 2L4QA 1FB0A 3Q19A 2LRCA 1JZRA 4MPGA 2DKHA 4ZILA 4MABA 3DYRA 3VI7A 5A4WA 1XPVA 4ICYA 3N5OA 1OC3A 4E8HA 2KOKA 4BWSA 1HNAA 1ZOFA 3WGEA 3FW2A 2O8VB 1TRVA 4X1UA 3Q6OA 2V6OA 5GSSA 2H66A 4DSQA 3IXRA 4IJIA 2WFCA 4WF4A 1OC8A 1XVWA 1ON4A 1XXUA 4L8EA 3D22A 4FYBA 2E0QA 1J9BA 1WIKA 2IN3A 3VI5A 2VL3A 4TXOB 1Z7PA 3D4TA 3WD6A 2OE0A 4YKGA 2AUVA 3EPTA 1YF1A 2MBTA 1K3YA 3PGTA 1W4VA 2VD0A 1N2AA 2X99A 4Q5RA 3I9V2 1F3BA 2H8LA 3IPZA 1PQNA 3HYPA 1AQWA 3VWWA 1SD8A 2YZHA 1Y6EA 5LNKe 1V98A 1XCCA 2RIIA 3P90A 4K7OA 5EPFA 2HZEA 4IP1A 2PN8A 4KUNA 2GQKA 3C7MA 5ECIB 2VCQA 1NSWA 4CY6A 2GQLA 5B8AA 5CRDA 3GTUA 3L9UA 1K0BA 6GSSA 3C1SA 4JRRA 5IPGA 4Z2TA 2C1YA 3OR5A 5FT3A 4OO4A 4HJMA 2FD3A 4JR4A 3GTUB 4FYCA 4NHWA 3KIJA 1V2AA 3DXBA 2QGVA 1T8EB 5D9VA 2HSYA 4ZB9A 4YAVA 5DALA 1OE8A 2C0EA 1AIUA 3GH6A 4EVMA 4PQIA 2OBKA 1T4YA 3HHVA 4PNGA 1YKAA 4F0CA 2LS5A 2NVLA 4NAXA 1M7TA 4F2IA 5DALB 3KJYA 1ZMAA 3F3QA 2H01A 1PKZA 3E9JB 1GH2A 2HRKA 3APOA 3TJBA 2FA8A 4ZB6A 4GRFA 2K8SA 2DC5A 4IP6A 5D96A 4FIWA 2JL4A 2MMZA 5AIXA 3IAS2 1DBYA 4POMA 3TKSA 1THOA 4MH3A 2Z9SA 3I6AA 4HZ4A 1TU8A 4CDOA 4ML6A 2H0IA 5D9WA 3HCZA 3EWLA 5HR2A 2IMFA 3GNJA 1TI3A 3FR3A 4GWRA 2GGTA 2H1BA 2VOCA 3ZVJA 2C0FA 4Z2RA 4HU9A 3QAWA 3KGKA 4Q5NA 5B8BA 2A4VA 2GT6A 4ZB8A 2R0CA 5HFIA 3GIXA 4TXVA 3TOUA 4K7IA 4EDYA 4MZBA 5IIZA 1A23A 5G2ZA 1I9DA 2X49A 9GSSA 2C0DA 2FNOA 5IMFA 3KMNA 4WF5A 1OC9A 2VCZA 8GSSA 2IMDA 2XBQA 3F8UA 1XIYA 4BIKA 1TP9A 3RDWA 1SKSB 4QQ7A 4IQ1A 3W6GA 2M80A 3F4RA 2YWOA 4K7NA 4LL1B 1TI1A 1OC9B 1FHEA 2K9FA 4TR0A 3ZREA 2CVKA 2ON5A 1GL8A 4D73A 2QA1A 1AXDA 1S3RA 2ZNMA 4MMMA 2L5OA 4RUVA 3TKQA 3ZVJD 4HI7A 3G7IA 4D73B 1M0UA 2B5YA 1PD21 2VM2A 5CRWA 2P5QA 2AJQB 1AW9A 1KNGA 1EGOA 2LQQA 1PN0A 2PUKC 3MAKA 3KMOA 1V57A 1PX6A 2DLXA 4F03A 4XS4B 3QD9A 3HVSA 3TJFA 2B6MA 1BJXA 3AY8A 4KGIA 4JU5A 2R2JA 3NOFA 11GSA 1ERTA 2K6VA 1VF2A 4G0IA 5ECPB 2JZTA 2HSMA 1CQGA 3FR6A 2F8FA 4X43A 4EL1A 5DJLA 4MF6A 5D8IA 4BVXA 1KTEA 4V1Ap 1OVNA 1KBNA 4IN0A 4OO5A 4O92A 3TRPA 2JSZA 3UMAA 2MYGA 2KP2A 1AQVA 1NW2A 5A5KA 2C3NA 1MEKA 4FYUA 2YWNA 4BVXB 1T00A 3P2AA 4GLTA 2DIYA 2HRNA 1JZDA 2H71A 6GSWA 1F9MA 5ECQB 5IMCA 2VCVA 1LJRA 4KAEA 5ELGA 5F06A 2A2RA 3RPPA 2GSTA 3UBLA 5G1KA 4WBJA 3A2WA 3DIEA 3W8SA 3GN3A 5COHA 2H72A 5F0GA 4K8MA 1B48A 2HNLA 1WJKA 2GLRA 3CXGA 1HNBA 3GX0A 1EGRA 1IYHA 3US3A 4IW9A 7GSSA 4KDXA 3V1WA 5G30A 4MJAA 4MNNA 1F3AA 1EWXA 3TKRA 2YV7A 5KN3A 5A4VA 1GSUA 5J5NA 5D9TA 4ZBAA 3TOTA 1GUMA 1U6TA 2JZRA 1QGVA 4IELA 2LNSA 5HR3A 3BD2A 1U88A 5JWQB 4AJ7A 2NDOA 2YOIA 2FCHA 3L9SA 4EF0A 4FH8A 1A2LA 4N30A 4ECCA 1MD4A 1O8WA 4YAPA 2EIRA 3ZFBA 4POLA 1A24A 4GSNA 3QAVA 4NWYA 2N5AA 3EYTA 5DDLA 2B5EA 4USSA 1PL2A 1FVJA 2XC2A 3WGDA 4JEDA 2ZCTA 2L59A 3L78A 1WPIA 3FZ5A 5J9BA 3SWLA 2YJHA 4J2FA 3BJ5A 3GSTA 1X9WB 1A2MA 4JBBA 4KSMA 1F6MC 3GH9A 1VF1A 3UVTA 2OADA 2JZSA 2HE3A 3UAPA 3VPTA 2CAIA 5J4UA 5JCGA 3A2VA 2V6KA 3ISOA 3HZ8A 4KX4A 3EMXA 2F3MA 4L5LA 2H0GA 2NBSA 5GAND 4AJ8A 4OFTA 5HR1A 5ECKB 12GSA 4N10A 1TRWA 2PMTA 2CX4A 2GZZA 3D5JA 1TDIA 4MPFA 3M9JA 3RHBA 3I43A 3GYKA 4G10A 2YPMA 5DQYA 2GZYA 1RW1A 1PSQA 4K0GA 2DJKA 1SYXA 4HSCX 1GSEA 1A2JA 3W8JA 1T3BA 2L6CA 3NZNA 2ON7A 1YZXA 3QDNA 3DVWA 2P0GA 4DSSA 3LWAA 1GSSA 3GUSA 1X5DA 2OE3A 2VO4A 2HSHA 3M0FA 3KZQA 4EIPA 1UC7A 3DMLA 5F8BA 3TKSC 5ABRA 5ID2A 3GRXA 4XCSA 4DSSB 2UZ8A 4YH2A 1XFLA 2O89A 2CZ2A 5CNWA 1OKTA 4MF5A 1ERUA 1QK8A 1ML6A 1TTZA 2O87A 2B1KA 10GSA 1HD2A 2KUCA 4MDCA 1EEJA 2HZFA 4H86A 4TR3A 2A2SA 1YEPA 1TJDA 2AHEA 2JU5A 1XG8A 5DAKA 3GURA 2LEGA 4YQVA 1XW5A 3MYDA 4DVCA 3BCIA 2E2GA 5LD0A 3G9BA 4PQ1A 4EDZA 4ZL9A 1HQOA 3HJMA 3UIWA 5DAKB 1EOHA 2MZCA 3H1NA 3VPQA 1XWBA 1GNEA 1G6WA 2QSIA 4TXOA 1V58A 2ES7A 3IHGA 2WRTA 3L0HA 2GSQA 2IMEA 2C3TA 3WT1A 4KNDA 3M9KA 3TJKA 3HDCA 4IVFA 5DBQA 1TXXA 5ELAA 1R26A 5DCHA 4G0KA 2PVQA 1K3OA 4PUAA 2LJAA 19GSA 3IBHA 2XBIA 4KDYA 1ZCPA 1ZGNA 5JCUA 1XW9A 2R0GA 4WKWA 1TRUA 1GTBA 2IPAA 1O85A 2IWTA 2CV4A 5J9CA 1K0AA 4KW6A 2VCWA 4MCUA 2YJ7A 2IL3A 5DCGA 1IYIA 4WR5A 1M9AA 1EP7A 1Z3EA 3O6TA 5DVBA 5AIVA 4I6XA 4KSOA 1TRSA 1EEMA 6GSTA 2FUG2 2DJ1A 2HRAA 4OCFA 4EC0A 4F9ZA 2DIZA 2PU9C 1K0MA 4IS0A 3TDGA 2JADA 4RI7A 2WZ9A 1UN2A 4JE1A 3ZTLA 1JZWA 3GL3A 2V41A 2YWMA 1BYEA 4YQMA 2RUFA 5D93A 1VF3A 3O76A 1SL2B 2VCXA 4V1Ag 4WETA 3TUEA 1ST9A 1USBA 4L0WA 1B4QA 4RI6A 2H74A 2WB9A 1K0NA 1RQMA 2H73A 2PGTA 4ZIJA 3C73A 4MF7A 5IO0A 1V9WA 5B7CA 3KEBA 4L0UA 2DJ0A 2I1UA 2F51A 2L5LA 3CSHA 1ZYEA 4O5RA 1TOFA 3F6FA 3UL3A 1FB6A 2FWHA 3IK7A 2VLVA 4EE0A 4MA9A 1YDKA 2RM6A 2EIQA 5GZZB 4KDUA 3TRXA 2TIRA 4XIHA 1VGLA 1A8YA 1ERVA 3I69A 4O5UA 2AAWA 1U3AA 2NTOA 3CMIA 3F63A 3IC8A 1DE2A 5IO2A 3KTBA 2C3QA 5F07A 4PGTA 17GSA 3PINA 4L5OA 1S3AA 5ECHB 5ECRB 3U5RE 1GUKA 3ZITA 1SK0A 4PUFC 1SK1A 3S9FA 5G5EA 2NPBA 4TOPA 2GQMA 1PN9A 1ACVA 4BL7A
chains in the Genus database with same CATH topology
3CBUA 2DJJA 1LU4A 3APQA 14GSA 1FW1A 3G7JA 1Y25A 4WR4A 4BL7B 1V40A 3WT2A 1S3DA 1YJ6A 1AC1A 2H6XA 3EU3A 4JZQA 4ISDA 1YEXA 13GSA 3P7XA 4YKFA 2CA8A 3FK8A 3MWHA 2X8CA 3CTGA 5HR0A 4XS4A 2LTKA 3HD5A 1SD9A 1GTAA 2P31A 1GNWA 1J08A 4NXIA 1NM3A 4LA1A 3VLNA 1TK0B 3TJJA 3APSA 4EKZA 1QQ2A 2OKAA 2B1LA 3A3TA 2WULA 2QA2A 3ZLPA 5J41A 5G1LA 4ZL8A 3GKXA 4K2DA 4N0ZA 2KHPA 5DJMA 5KN1A 1O6JA 3QFBC 2OACA 1R5AA 2REMA 4ZBBA 2ALBA 2N5BA 4Q5FA 4MK3A 4I5QA 4IGJA 1SKRB 3SBCA 1GTIA 2LNTA 4XRAA 1Z6NA 1XWCA 2R3XA 2M46A 3HJOA 2FLSA 20GSA 1Z9HA 3EE2A 2K8VA 4WBRD 4HQSA 3IHQA 3J7Yb 3LXTA 2I81A 5H5SA 3ERWA 4YQUA 5CRGA 1JHBA 1QUWA 4ULXA 2VIMA 3LXZA 4DSRA 5AN1A 1N8JA 3GL5A 4PNFA 2GS3A 4ILFA 3CYNA 3KD0A 2VM1A 3GMFA 5CO3A 3HY2A 5H5RA 2GTUA 1GP1A 2J9HA 3TKSE 5G31A 2X8HA 2WDUA 3QR6A 2ZUPA 2OE1A 4GTUA 3U6VA 5CP1A 4MH2A 5ECLB 3VFIA 2R0PA 2QKEA 2EC4A 2C0GA 4QL9A 3QCPA 5G5FA 2AV4A 4BWQA 4TR4A 2V1MA 3EINA 1M2BA 5A4UA 1PMTA 1FG4A 3HVVA 4PTSA 2FWGA 3D0ZA 3N9JA 5E4WA 2F8AA 2VLUA 4GSTA 1GWCA 2R4VA 5HQPA 2OA7A 3A5IA 1J0FA 4I2UA 1W89A 5IQYA 2LRTA 1M2AA 2CVBA 2HYXA 1MDKA 1OYJA 3TRQA 1HNCA 1GULA 4GF0A 4HDEA 5F05A 3O3TA 1BQ7A 1YQ1A 3LG6A 5IOWA 2KLXA 4HOJA 2YV9A 4AJ6A 2JACA 3KP9A 3ERGA 1DE1A 1FVKA 1FOHA 1R5PA 4CW9A 3C1RA 1DUGA 3QFAC 1SJ6A 2F9SA 3KTLA 2IMKA 4V2NA 4P3YB 1XWKA 2IIYA 1B9YC 4I8BA 2OJLA 3IRAA 1CQHA 2TRCP 3VURA 1OKDA 4O7HA 5CYYA 2LQOA 4PX1A 1GRXA 4EXJA 3CSJA 1H4OA 4WXTA 4X0XA 2CVDA 2VCTA 3WYWA 2O85A 1TKDB 3L9VA 1M99A 1T4ZA 4GQCA 4HU7A 1T1VA 2BTOT 1MTCA 3C71A 2PWJA 2N5FA 1JLVA 4AGSA 1AUCA 3ED3A 1ZYQB 1XVQA 1YKCA 3HKRA 2H75A 5L71A 1Q4JA 3DKSA 4Q5QA 2YN1A 1M2DA 5KN0A 4ECJA 3F9UA 1LBKA 1E6BA 2C80A 3C8EA 1SJIA 3FHKA 3VWXA 3DD3A 6GSYA 2GDRA 2HRFA 2GZPA 2LRNA 1EZKA 1QXHA 4K2XA 4HJ2A 5IOXA 5IMZA 1VRSD 4K6XA 2B5XA 2L6DA 1GSYA 1GSFA 2VL2C 2H30A 2V2GA 3MNGA 1VF4A 5B6NA 5JCWA 1PKWA 3KH9A 4LMWA 2V32A 4JR6A 1C72A 4K0NA 1WE0A 2CZ3A 5ECOB 1Z5YE 1EOGA 2GT5A 1OE7A 22GSA 2HLSA 4KCEA 1O73A 2DBCA 2E7PA 4I2TA 2VLTA 3RPNA 3F4SA 2DKIA 5EL8A 3ZIJA 4MJCA 4ACSA 2AYTA 1ZYNA 1SU9A 5EVOA 3GHAA 4BA7A 2VUPA 3UBKA 5H5QA 2BMXA 2R5GA 1PGTA 4I97A 3FRCA 1K3LA 2X4AA 1ILOA 4KF9A 1F2EA 5CAXA 4LL4B 3RAZA 1SL0B 3HJPA 3ZIVA 2YP6A 2DMLA 3RHCA 2X8GA 4J57E 2YCDA 3DVXA 1DSBA 2LJKA 1ZYPA 1YF0A 1TU7A 2OBIA 4N11A 1WP0A 1M9BA 5KOWA 5JWRB 3L4NA 3MDKA 4TW5A 3GA4A 3PH9A 3Q74A 1PX7A 3UEMA 3HA9A 3CTFA 2VL9A 3VWUA 3EC3A 1UVZA 2WJUA 1EV4A 1U3IA 2XPDA 3BCKA 4K5RA 5B6MA 3TGZA 1GTUA 3A2XA 2B7KA 1R7HA 2MBSA 1SYRA 1JZOA 3LYPA 3J7Yk 4EIQA 1O7UA 3A5WA 2MMAA 3E3EA 4FQUA 3F6DA 2HZEB 4RQRA 1BG5A 4AF2A 2L4CA 2HFDA 4XS1A 4XS6A 3ZL5A 1SKWB 3LSZA 2L57A 5HFKA 3HVXA 3KM6A 3ME7A 4OD7A 2PPTA 1EV9A 2FA4A 1SK2A 3IV4A 4HZ2A 1RK4A 2C4JA 2LUSA 2YNXA 4XTSA 2H19A 2H6YA 4KH7A 1PL1A 1GSQA 3HZ4A 3VWVA 3QAGA 5GSTA 3K8NA 1B9XC 2CX3A 3BBYA 3P8WA 4G9HA 5INYA 1K0OA 3M8NA 18GSA 3F3RA 3KP8A 4GCIA 3IR4A 4O32A 1G7OA 4XRDA 1B4PA 3D4MA 6GSVA 2YZUA 3JCML 2GSSA 6GSXA 1T7PB 4QL7A 2A2PA 2I9HA 3KH7A 4BPYA 4RQXA 3IC4A 1GSDA 2VL2A 3KXOA 4EO3A 4IBPA 1ZZYA 3M3MA 4NPBA 1X5CA 5CRHA 3IDVA 4OCEA 4G2EA 1MDJA 4KCAA 4TR1A 2GVPA 2H1AA 4NMUA 3TB2A 1X9SB 3UARA 3R3EA 5J3RA 5D9XA 5IMDA 4TR1B 2LJRA 2DJ2A 3ZZXA 1S3CA 5GAPD 1OAZA 4G0LA 1QFNA 3GFKA 4GQFA 2H0HA 2DMMA 1PA3A 4TKYA 3LJRA 3CRUA 1BX9A 3FZ9A 4Z2UA 4J56E 3LYKA 3WGXA 1R4WA 2PERA 4HUAA 1H75A 4BVYA 2R37A 1O8XA 1PRXA 4TVEA 1G6YA 4HQZA 1I5GA 2P5RA 3LGCA 4TRXA 4OFMA 4OFNA 4FO5A 3GKNA 1AQXA 2G2QA 3RBTA 3FR9A 4V2LA 1XBSA 4K5SA 4BVYB 2FHEA 3ME8A 1GUHA 4ZL7A 2AB6A 2FGXA 3G7YA 1E2YA 4CY8A 4KA0A 2PBJA 2C8UA 1WOUA 1ERWA 5ECSA 3IE3A 4CHSA 1XOBA 1FO5A 3D21A 3GX8A 4K9ZA 4X4JA 2YWIA 3FY7A 3F0IA 3LW9A 1GLPA 4NHZA 1XZOA 3GV1A 2J23A 4MZCA 2JSYA 4E8EA 4F82A 2I3YA 4PURA 3ERFA 5JWOB 2G0FA 4PQHA 1XWGA 2BJXA 4IKHA 2CAQA 2DJ3A 1XWAA 4MP4A 3IAM2 2DSAA 3BOAA 3IA1A 4OMVA 2XHFA 5HFGA 1FOVA 3R2QA 3EMPA 1Z7RA 5ECMB 1O81A 4LMVA 2MMOA 4WEYA 3UJ1A 1WWJA 3ZFLA 2HT9A 1K0CA 4KB3A 2B3SA 2H6ZA 1BEDA 2LV3A 4POBA 1EP8A 4MLYA 1TK5B 5AGYA 3FZAA 5IPHA 5KOXA 2IMIA 3FEUA 2LKUA 1NHOA 3QMXA 1JFUA 3M1GA 4ZBDA 1KEBA 1MDIA 2D2ZA 2A4HA 3ZMLA 16GSA 6GSUA 4G19A 4DEJA 5BMUA 3H4KA 3H8QA 3EURA 1ZL9A 3TCOA 3MSZA 2IJYA 3GKKA 3NIVA 1X0RA 5ENUA 3CRTA 4IJ3A 2VD1A 3H93A 5C04A 2FWEA 4K1FA 3HXSA 3LQ7A 4GSSA 5FHIA 3Q18A 3DEXA 2HI7A 2QC7A 3F4TA 1G0TA 2RUEA 4KE3A 4Z7XA 4GXZA 1Q98A 2PVOC 1MD3A 4V2MA 2IFQA 4HS1A 3DWVA 3IK9A 4ID0A 4IHUA 1WRYA 5IMVA 1SJZA 1WMJA 1XOAA 1AAZA 2H1DA 2MMNA 4ML1A 2IFQB 5E59A 3GKMA 5DQSA 1BAYA 3EU4A 1K0DA 2TRXA 1A0FA 1UA5A 3D6IA 3PPUA 2RM5A 5CREA 4ECIA 2H1GA 2B7JA 4MJEA 1Z6MA 3TKPA 4POKA 2HXKA 5C00A 3TJGA 4ECBA 3IOSA 5D73A 4MJBA 2WCIA 4ZXGA 2X64A 2I4AA 5IMAA 2O7KA 2WGRA 3QPMA 2YANA 4EUYA 3ZYWA 1TW9A 1JLWA 2EIOA 3UOMA 3EVIA 2WS2A 2KP1A 1ABAA 3ZMKA 2K18A 5BRTA 5FWGA 2GSRA 1GLQA 3GSSA 1XW6A 3DRNA 4O5QA 2R6KA 2XPEA 4IQAA 3DGQA 1TK8B 4XHMA 4MZWA 4LLRA 2E2MA 3VK9A 3FMWA 2FWFA 2LSTA 5AISA 1YY7A 4NV2A 2FY6A 3FYGA 5ECNB 3FZ4A 3CSIA 3LFLA 2CT6A 1A8LA 4A5PA 3E0UA 2VAFA 1HYUA 3KCMA 2H76A 3UVHA 3MIXA 4TN8A 3LORA 2CQ9A 1NHYA 1URMA 5KN2A 3PR8A 3FKFA 1B8XA 2RLIA 2H70A 5KEJA 2M72A 1QMVA 3ZRDA 1F37A 1A0RP 3QOUA 4N0VA 1X9MB 1SENA 4PXOA 5LCZA 1THXA 4F0BA 3H79A 3LEFA 1U87A 4HEA2 4OWYA 5ID2B 5IM9A 1FAAA 1G7EA 4NV5A 1X5EA 1SL1B 5EY6A 2L4QA 1FB0A 3Q19A 2LRCA 1JZRA 4MPGA 2DKHA 4ZILA 4MABA 3DYRA 3VI7A 5A4WA 1XPVA 4ICYA 3N5OA 1OC3A 4E8HA 2KOKA 4BWSA 1HNAA 1ZOFA 3WGEA 3FW2A 2O8VB 1TRVA 4X1UA 3Q6OA 2V6OA 5GSSA 2H66A 4DSQA 3IXRA 4IJIA 2WFCA 4WF4A 1OC8A 1XVWA 1ON4A 1XXUA 4L8EA 3D22A 4FYBA 2E0QA 1J9BA 1WIKA 2IN3A 3VI5A 2VL3A 4TXOB 1Z7PA 3D4TA 3WD6A 2OE0A 4YKGA 2AUVA 3EPTA 1YF1A 2MBTA 1K3YA 3PGTA 1W4VA 2VD0A 1N2AA 2X99A 4Q5RA 3I9V2 1F3BA 2H8LA 3IPZA 1PQNA 3HYPA 1AQWA 3VWWA 1SD8A 2YZHA 1Y6EA 5LNKe 1V98A 1XCCA 2RIIA 3P90A 4K7OA 5EPFA 2HZEA 4IP1A 2PN8A 4KUNA 2GQKA 3C7MA 5ECIB 2VCQA 1NSWA 4CY6A 2GQLA 5B8AA 5CRDA 3GTUA 3L9UA 1K0BA 6GSSA 3C1SA 4JRRA 5IPGA 4Z2TA 2C1YA 3OR5A 5FT3A 4OO4A 4HJMA 2FD3A 4JR4A 3GTUB 4FYCA 4NHWA 3KIJA 1V2AA 3DXBA 2QGVA 1T8EB 5D9VA 2HSYA 4ZB9A 4YAVA 5DALA 1OE8A 2C0EA 1AIUA 3GH6A 4EVMA 4PQIA 2OBKA 1T4YA 3HHVA 4PNGA 1YKAA 4F0CA 2LS5A 2NVLA 4NAXA 1M7TA 4F2IA 5DALB 3KJYA 1ZMAA 3F3QA 2H01A 1PKZA 3E9JB 1GH2A 2HRKA 3APOA 3TJBA 2FA8A 4ZB6A 4GRFA 2K8SA 2DC5A 4IP6A 5D96A 4FIWA 2JL4A 5AIXA 2MMZA 3IAS2 1DBYA 4POMA 3TKSA 1THOA 4MH3A 2Z9SA 3I6AA 4HZ4A 1TU8A 4CDOA 4ML6A 2H0IA 5D9WA 3HCZA 3EWLA 5HR2A 2IMFA 3GNJA 1TI3A 3FR3A 4GWRA 2GGTA 2H1BA 2VOCA 3ZVJA 2C0FA 4Z2RA 4HU9A 3QAWA 3KGKA 4Q5NA 5B8BA 2A4VA 2GT6A 4ZB8A 2R0CA 5HFIA 3GIXA 4TXVA 3TOUA 4K7IA 4EDYA 4MZBA 5IIZA 1A23A 5G2ZA 1I9DA 2X49A 9GSSA 2C0DA 2FNOA 5IMFA 3KMNA 4WF5A 1OC9A 2VCZA 8GSSA 2IMDA 2XBQA 3F8UA 1XIYA 1TP9A 3RDWA 1SKSB 4QQ7A 4IQ1A 3W6GA 2M80A 3F4RA 2YWOA 4K7NA 4LL1B 1TI1A 1OC9B 1FHEA 2K9FA 4TR0A 3ZREA 2CVKA 2ON5A 1GL8A 4D73A 2QA1A 1AXDA 2ZNMA 4MMMA 2L5OA 4RUVA 3TKQA 3ZVJD 4HI7A 3G7IA 4D73B 1M0UA 2B5YA 1PD21 2VM2A 5CRWA 2P5QA 2AJQB 1AW9A 1KNGA 1EGOA 2LQQA 1PN0A 2PUKC 3MAKA 3KMOA 1V57A 1PX6A 2DLXA 4F03A 4XS4B 3QD9A 3HVSA 3TJFA 2B6MA 1BJXA 3AY8A 4KGIA 4JU5A 2R2JA 3NOFA 11GSA 1ERTA 2K6VA 1VF2A 4G0IA 5ECPB 2JZTA 2HSMA 1CQGA 3FR6A 2F8FA 4X43A 4EL1A 5DJLA 4MF6A 5D8IA 4BVXA 1KTEA 4V1Ap 1OVNA 1KBNA 4IN0A 4OO5A 4O92A 3TRPA 2JSZA 3UMAA 2MYGA 2KP2A 1AQVA 1NW2A 5A5KA 2C3NA 1MEKA 4FYUA 2YWNA 4BVXB 1T00A 3P2AA 4GLTA 2DIYA 2HRNA 1JZDA 2H71A 6GSWA 1F9MA 5ECQB 5IMCA 2VCVA 1LJRA 4KAEA 5ELGA 5F06A 2A2RA 3RPPA 2GSTA 3UBLA 5G1KA 4WBJA 3A2WA 3DIEA 3W8SA 3GN3A 5COHA 2H72A 5F0GA 4K8MA 1B48A 2HNLA 1WJKA 2GLRA 3CXGA 1HNBA 3GX0A 1EGRA 1IYHA 3US3A 4IW9A 7GSSA 4KDXA 3V1WA 5G30A 4MJAA 4MNNA 1F3AA 1EWXA 3TKRA 2YV7A 5KN3A 5A4VA 1GSUA 5J5NA 5D9TA 4ZBAA 3TOTA 1GUMA 1U6TA 2JZRA 1QGVA 4IELA 2LNSA 5HR3A 3BD2A 1U88A 5JWQB 4AJ7A 2NDOA 2YOIA 2FCHA 3L9SA 4EF0A 4FH8A 1A2LA 4N30A 4ECCA 1MD4A 1O8WA 4YAPA 2EIRA 3ZFBA 4POLA 1A24A 4GSNA 3QAVA 4NWYA 2N5AA 3EYTA 5DDLA 2B5EA 4USSA 1PL2A 1FVJA 2XC2A 3WGDA 4JEDA 2ZCTA 2L59A 3L78A 1WPIA 3FZ5A 5J9BA 3SWLA 2YJHA 4J2FA 3BJ5A 3GSTA 1X9WB 1A2MA 4JBBA 4KSMA 1F6MC 3GH9A 1VF1A 3UVTA 2OADA 2JZSA 2HE3A 3UAPA 3VPTA 2CAIA 5J4UA 5JCGA 3A2VA 2V6KA 3ISOA 3HZ8A 4KX4A 3EMXA 2F3MA 4L5LA 2H0GA 2NBSA 5GAND 4AJ8A 4OFTA 5HR1A 5ECKB 12GSA 4N10A 1TRWA 2PMTA 2CX4A 2GZZA 3D5JA 1TDIA 4MPFA 3M9JA 3RHBA 3I43A 3GYKA 4G10A 2YPMA 5DQYA 2GZYA 1RW1A 1PSQA 4K0GA 2DJKA 1SYXA 1GSEA 1A2JA 3W8JA 1T3BA 2L6CA 3NZNA 2ON7A 1YZXA 3QDNA 3DVWA 2P0GA 4DSSA 3LWAA 1GSSA 3GUSA 1X5DA 2OE3A 2VO4A 2HSHA 3M0FA 3KZQA 4EIPA 1UC7A 3DMLA 5F8BA 3TKSC 5ABRA 5ID2A 3GRXA 4XCSA 4DSSB 2UZ8A 4YH2A 1XFLA 2O89A 2CZ2A 5CNWA 1OKTA 4MF5A 1ERUA 1QK8A 1ML6A 1TTZA 2O87A 2B1KA 10GSA 1HD2A 2KUCA 4MDCA 1EEJA 2HZFA 4H86A 4TR3A 2A2SA 1YEPA 1TJDA 2AHEA 2JU5A 5DAKA 3GURA 2LEGA 4YQVA 1XW5A 3MYDA 4DVCA 3BCIA 2E2GA 5LD0A 3G9BA 4PQ1A 4EDZA 4ZL9A 1HQOA 3HJMA 3UIWA 5DAKB 1EOHA 2MZCA 3H1NA 3VPQA 1XWBA 1GNEA 1G6WA 2QSIA 4TXOA 1V58A 2ES7A 3IHGA 2WRTA 3L0HA 2GSQA 2IMEA 2C3TA 3WT1A 4KNDA 3M9KA 3TJKA 3HDCA 4IVFA 5DBQA 1TXXA 5ELAA 1R26A 5DCHA 4G0KA 2PVQA 1K3OA 4PUAA 2LJAA 19GSA 3IBHA 2XBIA 4KDYA 1ZCPA 1ZGNA 5JCUA 1XW9A 2R0GA 4WKWA 1TRUA 1GTBA 2IPAA 1O85A 2IWTA 2CV4A 5J9CA 1K0AA 4KW6A 2VCWA 4MCUA 2YJ7A 2IL3A 5DCGA 1IYIA 4WR5A 1M9AA 1EP7A 1Z3EA 3O6TA 5DVBA 5AIVA 4I6XA 4KSOA 1TRSA 1EEMA 6GSTA 2FUG2 2DJ1A 2HRAA 4OCFA 4EC0A 4F9ZA 2DIZA 2PU9C 1K0MA 4IS0A 3TDGA 2JADA 4RI7A 2WZ9A 1UN2A 4JE1A 3ZTLA 1JZWA 3GL3A 2V41A 2YWMA 1BYEA 4YQMA 2RUFA 5D93A 1VF3A 3O76A 1SL2B 2VCXA 4V1Ag 4WETA 3TUEA 1ST9A 1USBA 4L0WA 1B4QA 4RI6A 2H74A 2WB9A 1K0NA 1RQMA 2H73A 2PGTA 4ZIJA 3C73A 4MF7A 5IO0A 1V9WA 5B7CA 3KEBA 4L0UA 2DJ0A 2I1UA 2F51A 2L5LA 3CSHA 1ZYEA 4O5RA 1TOFA 3F6FA 3UL3A 1FB6A 2FWHA 3IK7A 2VLVA 4EE0A 4MA9A 1YDKA 2RM6A 2EIQA 5GZZB 4KDUA 3TRXA 2TIRA 4XIHA 1VGLA 1A8YA 1ERVA 3I69A 4O5UA 2AAWA 1U3AA 2NTOA 3CMIA 3F63A 3IC8A 1DE2A 5IO2A 3KTBA 2C3QA 5F07A 4PGTA 17GSA 3PINA 4L5OA 1S3AA 5ECHB 5ECRB 3U5RE 1GUKA 3ZITA 1SK0A 4PUFC 1SK1A 3S9FA 5G5EA 2NPBA 4TOPA 2GQMA 1PN9A 1ACVA 4BL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CBU A;  2DJJ A;  1LU4 A;  3APQ A;  14GS A;  1FW1 A;  3G7J A;  1Y25 A;  4WR4 A;  1V40 A;  3WT2 A;  1S3D A;  1YJ6 A;  1AC1 A;  2H6X A;  3EU3 A;  4JZQ A;  4ISD A;  1YEX A;  13GS A;  3P7X A;  2CA8 A;  3FK8 A;  3MWH A;  2X8C A;  3CTG A;  5HR0 A;  4XS4 A;  2LTK A;  3HD5 A;  1SD9 A;  1GTA A;  2P31 A;  1GNW A;  1J08 A;  4NXI A;  1NM3 A;  4LA1 A;  3VLN A;  1TK0 B;  3TJJ A;  3APS A;  4EKZ A;  1QQ2 A;  2OKA A;  2B1L A;  3A3T A;  2WUL A;  3ZLP A;  5J41 A;  5G1L A;  4ZL8 A;  3GKX A;  4K2D A;  4N0Z A;  2KHP A;  5DJM A;  5KN1 A;  1O6J A;  3QFB C;  2OAC A;  1R5A A;  2REM A;  4ZBB A;  2ALB A;  2N5B A;  4Q5F A;  4MK3 A;  4I5Q A;  4IGJ A;  1SKR B;  3SBC A;  1GTI A;  2LNT A;  4XRA A;  1Z6N A;  1XWC A;  2R3X A;  2M46 A;  3HJO A;  2FLS A;  20GS A;  1Z9H A;  3EE2 A;  2K8V A;  4WBR D;  4HQS A;  3IHQ A;  3J7Y b;  3LXT A;  2I81 A;  5H5S A;  3ERW A;  4YQU A;  5CRG A;  1JHB A;  1QUW A;  4ULX A;  2VIM A;  3LXZ A;  4DSR A;  5AN1 A;  1N8J A;  3GL5 A;  4PNF A;  2GS3 A;  4ILF A;  3CYN A;  3KD0 A;  2VM1 A;  3GMF A;  5CO3 A;  3HY2 A;  5H5R A;  2GTU A;  1GP1 A;  2J9H A;  3TKS E;  5G31 A;  2X8H A;  2WDU A;  3QR6 A;  2ZUP A;  2OE1 A;  4GTU A;  3U6V A;  5CP1 A;  4MH2 A;  5ECL B;  3VFI A;  2QKE A;  2EC4 A;  2C0G A;  4QL9 A;  3QCP A;  5G5F A;  2AV4 A;  4BWQ A;  4TR4 A;  2V1M A;  3EIN A;  1M2B A;  5A4U A;  1PMT A;  1FG4 A;  3HVV A;  2FWG A;  3D0Z A;  3N9J A;  5E4W A;  2F8A A;  2VLU A;  4GST A;  1GWC A;  2R4V A;  5HQP A;  2OA7 A;  1J0F A;  4I2U A;  1W89 A;  5IQY A;  2LRT A;  1M2A A;  2CVB A;  2HYX A;  1MDK A;  1OYJ A;  3TRQ A;  1HNC A;  1GUL A;  4GF0 A;  4HDE A;  5F05 A;  3O3T A;  1BQ7 A;  1YQ1 A;  3LG6 A;  5IOW A;  2KLX A;  4HOJ A;  2YV9 A;  4AJ6 A;  2JAC A;  3KP9 A;  3ERG A;  1DE1 A;  1FVK A;  1R5P A;  4CW9 A;  3C1R A;  1DUG A;  3QFA C;  1SJ6 A;  2F9S A;  3KTL A;  2IMK A;  4V2N A;  4P3Y B;  1XWK A;  2IIY A;  1B9Y C;  4I8B A;  2OJL A;  3IRA A;  1CQH A;  2TRC P;  3VUR A;  1OKD A;  4O7H A;  5CYY A;  2LQO A;  4PX1 A;  1GRX A;  4EXJ A;  3CSJ A;  1H4O A;  4WXT A;  4X0X A;  2CVD A;  2VCT A;  3WYW A;  2O85 A;  1TKD B;  3L9V A;  1M99 A;  1T4Z A;  4GQC A;  4HU7 A;  1T1V A;  2BTO T;  1MTC A;  3C71 A;  2PWJ A;  2N5F A;  1JLV A;  4AGS A;  1AUC A;  3ED3 A;  1ZYQ B;  1XVQ A;  1YKC A;  3HKR A;  2H75 A;  5L71 A;  1Q4J A;  3DKS A;  4Q5Q A;  2YN1 A;  1M2D A;  5KN0 A;  4ECJ A;  3F9U A;  1LBK A;  1E6B A;  2C80 A;  3C8E A;  1SJI A;  3FHK A;  3VWX A;  3DD3 A;  6GSY A;  2GDR A;  2HRF A;  2GZP A;  2LRN A;  1EZK A;  1QXH A;  4HJ2 A;  5IOX A;  5IMZ A;  1VRS D;  4K6X A;  2B5X A;  2L6D A;  1GSY A;  1GSF A;  2VL2 C;  2H30 A;  2V2G A;  3MNG A;  1VF4 A;  5B6N A;  5JCW A;  1PKW A;  3KH9 A;  4LMW A;  2V32 A;  4JR6 A;  1C72 A;  4K0N A;  1WE0 A;  5ECO B;  2CZ3 A;  1Z5Y E;  1EOG A;  2GT5 A;  1OE7 A;  22GS A;  2HLS A;  4KCE A;  1O73 A;  2DBC A;  2E7P A;  4I2T A;  2VLT A;  3RPN A;  3F4S A;  5EL8 A;  3ZIJ A;  4MJC A;  4ACS A;  2AYT A;  1SU9 A;  5EVO A;  3GHA A;  4BA7 A;  2VUP A;  3UBK A;  5H5Q A;  2BMX A;  2R5G A;  1PGT A;  4I97 A;  3FRC A;  1K3L A;  1ILO A;  1F2E A;  5CAX A;  4LL4 B;  3RAZ A;  1SL0 B;  3HJP A;  3ZIV A;  2YP6 A;  2DML A;  3RHC A;  2X8G A;  4J57 E;  2YCD A;  3DVX A;  1DSB A;  2LJK A;  1YF0 A;  1TU7 A;  2OBI A;  4N11 A;  1WP0 A;  1M9B A;  5JWR B;  3L4N A;  3MDK A;  4TW5 A;  3GA4 A;  3PH9 A;  3Q74 A;  1PX7 A;  3UEM A;  3HA9 A;  3CTF A;  2VL9 A;  3VWU A;  3EC3 A;  1UVZ A;  2WJU A;  1EV4 A;  1U3I A;  2XPD A;  3BCK A;  5B6M A;  3TGZ A;  1GTU A;  3A2X A;  2B7K A;  1R7H A;  2MBS A;  1SYR A;  1JZO A;  3LYP A;  3J7Y k;  1O7U A;  3A5W A;  2MMA A;  3E3E A;  3F6D A;  2HZE B;  4RQR A;  1BG5 A;  4AF2 A;  2L4C A;  2HFD A;  4XS1 A;  4XS6 A;  3ZL5 A;  1SKW B;  3LSZ A;  2L57 A;  5HFK A;  3HVX A;  3KM6 A;  3ME7 A;  4OD7 A;  2PPT A;  1EV9 A;  2FA4 A;  1SK2 A;  3IV4 A;  4HZ2 A;  1RK4 A;  2C4J A;  2LUS A;  2YNX A;  4XTS A;  2H19 A;  2H6Y A;  4KH7 A;  1PL1 A;  1GSQ A;  3HZ4 A;  3VWV A;  3QAG A;  5GST A;  3K8N A;  1B9X C;  2CX3 A;  3BBY A;  3P8W A;  4G9H A;  5INY A;  1K0O A;  3M8N A;  18GS A;  3F3R A;  3KP8 A;  4GCI A;  3IR4 A;  4O32 A;  1G7O A;  4XRD A;  1B4P A;  3D4M A;  6GSV A;  2YZU A;  3JCM L;  2GSS A;  6GSX A;  1T7P B;  4QL7 A;  2I9H A;  3KH7 A;  4BPY A;  4RQX A;  3IC4 A;  1GSD A;  2VL2 A;  3KXO A;  4EO3 A;  4IBP A;  1ZZY A;  3M3M A;  4NPB A;  1X5C A;  5CRH A;  3IDV A;  4OCE A;  4G2E A;  1MDJ A;  4KCA A;  4TR1 A;  2GVP A;  2H1A A;  4NMU A;  3TB2 A;  1X9S B;  3UAR A;  5J3R A;  5D9X A;  5IMD A;  4TR1 B;  2LJR A;  2DJ2 A;  3ZZX A;  1S3C A;  5GAP D;  1OAZ A;  1QFN A;  3GFK A;  4GQF A;  2H0H A;  2DMM A;  1PA3 A;  4TKY A;  3LJR A;  3CRU A;  1BX9 A;  3FZ9 A;  4J56 E;  3LYK A;  3WGX A;  1R4W A;  2PER A;  4HUA A;  1H75 A;  4BVY A;  2R37 A;  1O8X A;  1PRX A;  4TVE A;  1G6Y A;  4HQZ A;  1I5G A;  2P5R A;  3LGC A;  4TRX A;  4OFM A;  4OFN A;  4FO5 A;  3GKN A;  1AQX A;  2G2Q A;  3RBT A;  3FR9 A;  4V2L A;  1XBS A;  2FHE A;  3ME8 A;  1GUH A;  4ZL7 A;  2AB6 A;  2FGX A;  3G7Y A;  1E2Y A;  4KA0 A;  2PBJ A;  2C8U A;  1WOU A;  1ERW A;  5ECS A;  3IE3 A;  4CHS A;  1XOB A;  1FO5 A;  3D21 A;  3GX8 A;  4K9Z A;  2YWI A;  3FY7 A;  3F0I A;  1GLP A;  4NHZ A;  1XZO A;  3GV1 A;  2J23 A;  4MZC A;  2JSY A;  4E8E A;  4F82 A;  2I3Y A;  4PUR A;  3ERF A;  5JWO B;  2G0F A;  4PQH A;  1XWG A;  2BJX A;  4IKH A;  2CAQ A;  2DJ3 A;  1XWA A;  4MP4 A;  3IAM 2;  2DSA A;  3BOA A;  3IA1 A;  4OMV A;  2XHF A;  5HFG A;  1FOV A;  3R2Q A;  3EMP A;  1Z7R A;  5ECM B;  1O81 A;  4LMV A;  2MMO A;  4WEY A;  3UJ1 A;  1WWJ A;  3ZFL A;  2HT9 A;  1K0C A;  4KB3 A;  2B3S A;  2H6Z A;  1BED A;  2LV3 A;  4POB A;  1EP8 A;  4MLY A;  1TK5 B;  5AGY A;  3FZA A;  5IPH A;  2IMI A;  3FEU A;  2LKU A;  1NHO A;  3QMX A;  1JFU A;  3M1G A;  4ZBD A;  1KEB A;  1MDI A;  2D2Z A;  3ZML A;  16GS A;  6GSU A;  4G19 A;  4DEJ A;  3H4K A;  3H8Q A;  3EUR A;  1ZL9 A;  3TCO A;  3MSZ A;  2IJY A;  3GKK A;  3NIV A;  1X0R A;  5ENU A;  3CRT A;  4IJ3 A;  2VD1 A;  3H93 A;  5C04 A;  2FWE A;  4K1F A;  3HXS A;  3LQ7 A;  4GSS A;  5FHI A;  3Q18 A;  3DEX A;  2HI7 A;  2QC7 A;  3F4T A;  1G0T A;  2RUE A;  4KE3 A;  4Z7X A;  4GXZ A;  1Q98 A;  2PVO C;  1MD3 A;  4V2M A;  2IFQ A;  4HS1 A;  3DWV A;  3IK9 A;  4ID0 A;  4IHU A;  1WRY A;  5IMV A;  1SJZ A;  1WMJ A;  1XOA A;  1AAZ A;  2H1D A;  2MMN A;  4ML1 A;  5E59 A;  2IFQ B;  3GKM A;  5DQS A;  1BAY A;  3EU4 A;  1K0D A;  2TRX A;  1A0F A;  1UA5 A;  3D6I A;  2RM5 A;  5CRE A;  4ECI A;  2H1G A;  2B7J A;  4MJE A;  1Z6M A;  3TKP A;  4POK A;  2HXK A;  5C00 A;  3TJG A;  4ECB A;  3IOS A;  5D73 A;  4MJB A;  2WCI A;  4ZXG A;  2X64 A;  2I4A A;  5IMA A;  2O7K A;  2WGR A;  3QPM A;  2YAN A;  4EUY A;  3ZYW A;  1TW9 A;  1JLW A;  2EIO A;  3UOM A;  3EVI A;  2WS2 A;  2KP1 A;  1ABA A;  3ZMK A;  2K18 A;  5FWG A;  2GSR A;  1GLQ A;  3GSS A;  1XW6 A;  3DRN A;  2R6K A;  2XPE A;  4IQA A;  3DGQ A;  1TK8 B;  4XHM A;  4MZW A;  4LLR A;  2E2M A;  3VK9 A;  2FWF A;  2LST A;  5AIS A;  1YY7 A;  4NV2 A;  2FY6 A;  3FYG A;  5ECN B;  3FZ4 A;  3CSI A;  3LFL A;  2CT6 A;  1A8L A;  3E0U A;  2VAF A;  1HYU A;  3KCM A;  2H76 A;  3UVH A;  4TN8 A;  3LOR A;  2CQ9 A;  1NHY A;  1URM A;  5KN2 A;  3PR8 A;  3FKF A;  1B8X A;  2RLI A;  2H70 A;  5KEJ A;  2M72 A;  1QMV A;  3ZRD A;  1F37 A;  1A0R P;  3QOU A;  4N0V A;  1X9M B;  1SEN A;  4PXO A;  5LCZ A;  1THX A;  4F0B A;  3H79 A;  3LEF A;  1U87 A;  4HEA 2;  4OWY A;  5ID2 B;  5IM9 A;  1FAA A;  1G7E A;  4NV5 A;  1X5E A;  1SL1 B;  5EY6 A;  2L4Q A;  1FB0 A;  3Q19 A;  2LRC A;  1JZR A;  4MPG A;  4ZIL A;  4MAB A;  3DYR A;  3VI7 A;  5A4W A;  1XPV A;  3N5O A;  1OC3 A;  4E8H A;  2KOK A;  4BWS A;  1HNA A;  1ZOF A;  3WGE A;  3FW2 A;  2O8V B;  1TRV A;  4X1U A;  3Q6O A;  2V6O A;  5GSS A;  2H66 A;  4DSQ A;  3IXR A;  4IJI A;  2WFC A;  4WF4 A;  1OC8 A;  1XVW A;  1ON4 A;  1XXU A;  4L8E A;  3D22 A;  4FYB A;  2E0Q A;  1J9B A;  1WIK A;  2IN3 A;  3VI5 A;  2VL3 A;  4TXO B;  1Z7P A;  3D4T A;  3WD6 A;  2OE0 A;  2AUV A;  1YF1 A;  2MBT A;  1K3Y A;  3PGT A;  1W4V A;  2VD0 A;  1N2A A;  2X99 A;  4Q5R A;  3I9V 2;  1F3B A;  2H8L A;  3IPZ A;  1PQN A;  3HYP A;  1AQW A;  3VWW A;  1SD8 A;  2YZH A;  1Y6E A;  5LNK e;  1V98 A;  1XCC A;  2RII A;  3P90 A;  4K7O A;  5EPF A;  2HZE A;  4IP1 A;  2PN8 A;  4KUN A;  2GQK A;  3C7M A;  5ECI B;  2VCQ A;  1NSW A;  2GQL A;  5B8A A;  5CRD A;  3GTU A;  3L9U A;  1K0B A;  6GSS A;  3C1S A;  4JRR A;  5IPG A;  2C1Y A;  3OR5 A;  5FT3 A;  4OO4 A;  4HJM A;  2FD3 A;  4JR4 A;  3GTU B;  4FYC A;  4NHW A;  3KIJ A;  1V2A A;  3DXB A;  2QGV A;  1T8E B;  5D9V A;  2HSY A;  4ZB9 A;  4YAV A;  5DAL A;  1OE8 A;  2C0E A;  1AIU A;  3GH6 A;  4EVM A;  4PQI A;  2OBK A;  1T4Y A;  3HHV A;  4PNG A;  1YKA A;  4F0C A;  2LS5 A;  2NVL A;  4NAX A;  1M7T A;  4F2I A;  5DAL B;  3KJY A;  1ZMA A;  3F3Q A;  2H01 A;  1PKZ A;  3E9J B;  1GH2 A;  3APO A;  3TJB A;  2FA8 A;  4ZB6 A;  4GRF A;  2K8S A;  2DC5 A;  4IP6 A;  5D96 A;  4FIW A;  2JL4 A;  5AIX A;  2MMZ A;  3IAS 2;  1DBY A;  4POM A;  3TKS A;  1THO A;  4MH3 A;  2Z9S A;  3I6A A;  4HZ4 A;  1TU8 A;  4CDO A;  4ML6 A;  2H0I A;  5D9W A;  3HCZ A;  3EWL A;  5HR2 A;  2IMF A;  3GNJ A;  1TI3 A;  3FR3 A;  4GWR A;  2GGT A;  2H1B A;  2VOC A;  3ZVJ A;  2C0F A;  4HU9 A;  3QAW A;  3KGK A;  4Q5N A;  5B8B A;  2A4V A;  2GT6 A;  4ZB8 A;  5HFI A;  3GIX A;  4TXV A;  3TOU A;  4K7I A;  4EDY A;  4MZB A;  5IIZ A;  1A23 A;  5G2Z A;  1I9D A;  9GSS A;  2C0D A;  2FNO A;  5IMF A;  3KMN A;  4WF5 A;  1OC9 A;  2VCZ A;  8GSS A;  2IMD A;  2XBQ A;  3F8U A;  1XIY A;  1TP9 A;  3RDW A;  1SKS B;  4QQ7 A;  4IQ1 A;  3W6G A;  2M80 A;  3F4R A;  2YWO A;  4K7N A;  4LL1 B;  1TI1 A;  1OC9 B;  1FHE A;  2K9F A;  4TR0 A;  3ZRE A;  2CVK A;  2ON5 A;  1GL8 A;  4D73 A;  1AXD A;  2ZNM A;  4MMM A;  2L5O A;  4RUV A;  3TKQ A;  3ZVJ D;  4HI7 A;  3G7I A;  4D73 B;  1M0U A;  2B5Y A;  1PD2 1;  2VM2 A;  5CRW A;  2P5Q A;  2AJQ B;  1AW9 A;  1KNG A;  1EGO A;  2LQQ A;  2PUK C;  3MAK A;  3KMO A;  1V57 A;  1PX6 A;  2DLX A;  4F03 A;  4XS4 B;  3QD9 A;  3HVS A;  3TJF A;  2B6M A;  1BJX A;  3AY8 A;  4KGI A;  4JU5 A;  2R2J A;  3NOF A;  11GS A;  1ERT A;  2K6V A;  1VF2 A;  5ECP B;  2JZT A;  1CQG A;  3FR6 A;  2F8F A;  4X43 A;  4EL1 A;  5DJL A;  4MF6 A;  5D8I A;  4BVX A;  1KTE A;  4V1A p;  1OVN A;  1KBN A;  4IN0 A;  4OO5 A;  4O92 A;  3TRP A;  2JSZ A;  3UMA A;  2MYG A;  2KP2 A;  1AQV A;  1NW2 A;  5A5K A;  2C3N A;  1MEK A;  4FYU A;  2YWN A;  1T00 A;  3P2A A;  4GLT A;  2DIY A;  2HRN A;  1JZD A;  2H71 A;  6GSW A;  1F9M A;  5ECQ B;  5IMC A;  2VCV A;  1LJR A;  4KAE A;  5ELG A;  5F06 A;  2A2R A;  3RPP A;  2GST A;  3UBL A;  5G1K A;  4WBJ A;  3A2W A;  3DIE A;  3W8S A;  3GN3 A;  5COH A;  2H72 A;  5F0G A;  4K8M A;  1B48 A;  2HNL A;  1WJK A;  2GLR A;  3CXG A;  1HNB A;  3GX0 A;  1EGR A;  1IYH A;  3US3 A;  4IW9 A;  7GSS A;  4KDX A;  3V1W A;  5G30 A;  4MJA A;  1F3A A;  1EWX A;  3TKR A;  2YV7 A;  5KN3 A;  5A4V A;  1GSU A;  5J5N A;  5D9T A;  4ZBA A;  3TOT A;  1GUM A;  1U6T A;  2JZR A;  1QGV A;  4IEL A;  2LNS A;  5HR3 A;  3BD2 A;  1U88 A;  5JWQ B;  4AJ7 A;  2NDO A;  2YOI A;  2FCH A;  3L9S A;  4EF0 A;  4FH8 A;  1A2L A;  4N30 A;  4ECC A;  1MD4 A;  1O8W A;  4YAP A;  2EIR A;  3ZFB A;  4POL A;  1A24 A;  4GSN A;  3QAV A;  4NWY A;  2N5A A;  3EYT A;  5DDL A;  2B5E A;  1PL2 A;  1FVJ A;  2XC2 A;  3WGD A;  4JED A;  2ZCT A;  2L59 A;  3L78 A;  1WPI A;  3FZ5 A;  5J9B A;  3SWL A;  2YJH A;  4J2F A;  3BJ5 A;  3GST A;  1X9W B;  1A2M A;  4JBB A;  4KSM A;  1F6M C;  3GH9 A;  1VF1 A;  3UVT A;  2OAD A;  2JZS A;  2HE3 A;  3UAP A;  3VPT A;  2CAI A;  5J4U A;  5JCG A;  3A2V A;  2V6K A;  3ISO A;  3HZ8 A;  4KX4 A;  3EMX A;  2F3M A;  4L5L A;  2H0G A;  2NBS A;  5GAN D;  4AJ8 A;  4OFT A;  5HR1 A;  5ECK B;  12GS A;  4N10 A;  1TRW A;  2PMT A;  2CX4 A;  2GZZ A;  3D5J A;  1TDI A;  4MPF A;  3M9J A;  3RHB A;  3I43 A;  3GYK A;  4G10 A;  2YPM A;  5DQY A;  2GZY A;  1RW1 A;  1PSQ A;  4K0G A;  2DJK A;  1SYX A;  1GSE A;  1A2J A;  3W8J A;  1T3B A;  2L6C A;  3NZN A;  2ON7 A;  1YZX A;  3QDN A;  3DVW A;  2P0G A;  4DSS A;  3LWA A;  1GSS A;  3GUS A;  1X5D A;  2OE3 A;  2VO4 A;  2HSH A;  3M0F A;  3KZQ A;  1UC7 A;  3DML A;  5F8B A;  3TKS C;  5ABR A;  5ID2 A;  3GRX A;  4XCS A;  4DSS B;  4YH2 A;  1XFL A;  2O89 A;  2CZ2 A;  5CNW A;  1OKT A;  4MF5 A;  1ERU A;  1QK8 A;  1ML6 A;  1TTZ A;  2O87 A;  2B1K A;  10GS A;  1HD2 A;  2KUC A;  4MDC A;  1EEJ A;  2HZF A;  4H86 A;  4TR3 A;  2A2S A;  1YEP A;  1TJD A;  2AHE A;  2JU5 A;  5DAK A;  3GUR A;  2LEG A;  4YQV A;  1XW5 A;  4DVC A;  3BCI A;  2E2G A;  5LD0 A;  3G9B A;  4PQ1 A;  4EDZ A;  4ZL9 A;  1HQO A;  3HJM A;  3UIW A;  5DAK B;  1EOH A;  2MZC A;  3H1N A;  3VPQ A;  1XWB A;  1GNE A;  1G6W A;  2QSI A;  4TXO A;  1V58 A;  2ES7 A;  2WRT A;  3L0H A;  2GSQ A;  2IME A;  2C3T A;  3WT1 A;  4KND A;  3M9K A;  3TJK A;  3HDC A;  4IVF A;  5DBQ A;  1TXX A;  5ELA A;  1R26 A;  5DCH A;  2PVQ A;  1K3O A;  4PUA A;  2LJA A;  19GS A;  3IBH A;  2XBI A;  4KDY A;  1ZCP A;  1ZGN A;  5JCU A;  1XW9 A;  4WKW A;  1TRU A;  1GTB A;  2IPA A;  1O85 A;  2IWT A;  2CV4 A;  5J9C A;  1K0A A;  4KW6 A;  2VCW A;  4MCU A;  2YJ7 A;  2IL3 A;  5DCG A;  1IYI A;  4WR5 A;  1M9A A;  1EP7 A;  1Z3E A;  3O6T A;  5DVB A;  5AIV A;  4I6X A;  4KSO A;  1TRS A;  1EEM A;  6GST A;  2FUG 2;  2DJ1 A;  4OCF A;  4EC0 A;  4F9Z A;  2DIZ A;  2PU9 C;  1K0M A;  4IS0 A;  3TDG A;  2JAD A;  4RI7 A;  2WZ9 A;  1UN2 A;  4JE1 A;  3ZTL A;  1JZW A;  3GL3 A;  2V41 A;  2YWM A;  1BYE A;  4YQM A;  2RUF A;  5D93 A;  1VF3 A;  3O76 A;  1SL2 B;  2VCX A;  4V1A g;  4WET A;  3TUE A;  1ST9 A;  1USB A;  4L0W A;  1B4Q A;  4RI6 A;  2H74 A;  2WB9 A;  1K0N A;  1RQM A;  2H73 A;  2PGT A;  4ZIJ A;  3C73 A;  4MF7 A;  5IO0 A;  1V9W A;  5B7C A;  3KEB A;  4L0U A;  2DJ0 A;  2I1U A;  2F51 A;  2L5L A;  3CSH A;  1ZYE A;  4O5R A;  1TOF A;  3F6F A;  3UL3 A;  1FB6 A;  2FWH A;  3IK7 A;  2VLV A;  4EE0 A;  4MA9 A;  1YDK A;  2RM6 A;  2EIQ A;  5GZZ B;  4KDU A;  3TRX A;  2TIR A;  4XIH A;  1VGL A;  1A8Y A;  1ERV A;  3I69 A;  2AAW A;  1U3A A;  2NTO A;  3CMI A;  3F63 A;  1DE2 A;  5IO2 A;  3KTB A;  2C3Q A;  5F07 A;  4PGT A;  17GS A;  3PIN A;  4L5O A;  1S3A A;  5ECH B;  5ECR B;  3U5R E;  1GUK A;  3ZIT A;  1SK0 A;  4PUF C;  1SK1 A;  3S9F A;  5G5E A;  2NPB A;  4TOP A;  2GQM A;  1PN9 A;  1ACV A;  4BL7 A; 
#chains in the Genus database with same CATH topology
 3CBU A;  2DJJ A;  1LU4 A;  3APQ A;  14GS A;  1FW1 A;  3G7J A;  1Y25 A;  4WR4 A;  4BL7 B;  1V40 A;  3WT2 A;  1S3D A;  1YJ6 A;  1AC1 A;  2H6X A;  3EU3 A;  4JZQ A;  4ISD A;  1YEX A;  13GS A;  3P7X A;  4YKF A;  2CA8 A;  3FK8 A;  3MWH A;  2X8C A;  3CTG A;  5HR0 A;  4XS4 A;  2LTK A;  3HD5 A;  1SD9 A;  1GTA A;  2P31 A;  1GNW A;  1J08 A;  4NXI A;  1NM3 A;  4LA1 A;  3VLN A;  1TK0 B;  3TJJ A;  3APS A;  4EKZ A;  1QQ2 A;  2OKA A;  2B1L A;  3A3T A;  2WUL A;  2QA2 A;  3ZLP A;  5J41 A;  5G1L A;  4ZL8 A;  3GKX A;  4K2D A;  4N0Z A;  2KHP A;  5DJM A;  5KN1 A;  1O6J A;  3QFB C;  2OAC A;  1R5A A;  2REM A;  4ZBB A;  2ALB A;  2N5B A;  4Q5F A;  4MK3 A;  4I5Q A;  4IGJ A;  1SKR B;  3SBC A;  1GTI A;  2LNT A;  4XRA A;  1Z6N A;  1XWC A;  2R3X A;  2M46 A;  3HJO A;  2FLS A;  20GS A;  1Z9H A;  3EE2 A;  2K8V A;  4WBR D;  4HQS A;  3IHQ A;  3J7Y b;  3LXT A;  2I81 A;  5H5S A;  3ERW A;  4YQU A;  5CRG A;  1JHB A;  1QUW A;  4ULX A;  2VIM A;  3LXZ A;  4DSR A;  5AN1 A;  1N8J A;  3GL5 A;  4PNF A;  2GS3 A;  4ILF A;  3CYN A;  3KD0 A;  2VM1 A;  3GMF A;  5CO3 A;  3HY2 A;  5H5R A;  2GTU A;  1GP1 A;  2J9H A;  3TKS E;  5G31 A;  2X8H A;  2WDU A;  3QR6 A;  2ZUP A;  2OE1 A;  4GTU A;  3U6V A;  5CP1 A;  4MH2 A;  5ECL B;  3VFI A;  2R0P A;  2QKE A;  2EC4 A;  2C0G A;  4QL9 A;  3QCP A;  5G5F A;  2AV4 A;  4BWQ A;  4TR4 A;  2V1M A;  3EIN A;  1M2B A;  5A4U A;  1PMT A;  1FG4 A;  3HVV A;  4PTS A;  2FWG A;  3D0Z A;  3N9J A;  5E4W A;  2F8A A;  2VLU A;  4GST A;  1GWC A;  2R4V A;  5HQP A;  2OA7 A;  3A5I A;  1J0F A;  4I2U A;  1W89 A;  5IQY A;  2LRT A;  1M2A A;  2CVB A;  2HYX A;  1MDK A;  1OYJ A;  3TRQ A;  1HNC A;  1GUL A;  4GF0 A;  4HDE A;  5F05 A;  3O3T A;  1BQ7 A;  1YQ1 A;  3LG6 A;  5IOW A;  2KLX A;  4HOJ A;  2YV9 A;  4AJ6 A;  2JAC A;  3KP9 A;  3ERG A;  1DE1 A;  1FVK A;  1FOH A;  1R5P A;  4CW9 A;  3C1R A;  1DUG A;  3QFA C;  1SJ6 A;  2F9S A;  3KTL A;  2IMK A;  4V2N A;  4P3Y B;  1XWK A;  2IIY A;  1B9Y C;  4I8B A;  2OJL A;  3IRA A;  1CQH A;  2TRC P;  3VUR A;  1OKD A;  4O7H A;  5CYY A;  2LQO A;  4PX1 A;  1GRX A;  4EXJ A;  3CSJ A;  1H4O A;  4WXT A;  4X0X A;  2CVD A;  2VCT A;  3WYW A;  2O85 A;  1TKD B;  3L9V A;  1M99 A;  1T4Z A;  4GQC A;  4HU7 A;  1T1V A;  2BTO T;  1MTC A;  3C71 A;  2PWJ A;  2N5F A;  1JLV A;  4AGS A;  1AUC A;  3ED3 A;  1ZYQ B;  1XVQ A;  1YKC A;  3HKR A;  2H75 A;  5L71 A;  1Q4J A;  3DKS A;  4Q5Q A;  2YN1 A;  1M2D A;  5KN0 A;  4ECJ A;  3F9U A;  1LBK A;  1E6B A;  2C80 A;  3C8E A;  1SJI A;  3FHK A;  3VWX A;  3DD3 A;  6GSY A;  2GDR A;  2HRF A;  2GZP A;  2LRN A;  1EZK A;  1QXH A;  4K2X A;  4HJ2 A;  5IOX A;  5IMZ A;  1VRS D;  4K6X A;  2B5X A;  2L6D A;  1GSY A;  1GSF A;  2VL2 C;  2H30 A;  2V2G A;  3MNG A;  1VF4 A;  5B6N A;  5JCW A;  1PKW A;  3KH9 A;  4LMW A;  2V32 A;  4JR6 A;  1C72 A;  4K0N A;  1WE0 A;  2CZ3 A;  5ECO B;  1Z5Y E;  1EOG A;  2GT5 A;  1OE7 A;  22GS A;  2HLS A;  4KCE A;  1O73 A;  2DBC A;  2E7P A;  4I2T A;  2VLT A;  3RPN A;  3F4S A;  2DKI A;  5EL8 A;  3ZIJ A;  4MJC A;  4ACS A;  2AYT A;  1ZYN A;  1SU9 A;  5EVO A;  3GHA A;  4BA7 A;  2VUP A;  3UBK A;  5H5Q A;  2BMX A;  2R5G A;  1PGT A;  4I97 A;  3FRC A;  1K3L A;  2X4A A;  1ILO A;  4KF9 A;  1F2E A;  5CAX A;  4LL4 B;  3RAZ A;  1SL0 B;  3HJP A;  3ZIV A;  2YP6 A;  2DML A;  3RHC A;  2X8G A;  4J57 E;  2YCD A;  3DVX A;  1DSB A;  2LJK A;  1ZYP A;  1YF0 A;  1TU7 A;  2OBI A;  4N11 A;  1WP0 A;  1M9B A;  5KOW A;  5JWR B;  3L4N A;  3MDK A;  4TW5 A;  3GA4 A;  3PH9 A;  3Q74 A;  1PX7 A;  3UEM A;  3HA9 A;  3CTF A;  2VL9 A;  3VWU A;  3EC3 A;  1UVZ A;  2WJU A;  1EV4 A;  1U3I A;  2XPD A;  3BCK A;  4K5R A;  5B6M A;  3TGZ A;  1GTU A;  3A2X A;  2B7K A;  1R7H A;  2MBS A;  1SYR A;  1JZO A;  3LYP A;  3J7Y k;  4EIQ A;  1O7U A;  3A5W A;  2MMA A;  3E3E A;  4FQU A;  3F6D A;  2HZE B;  4RQR A;  1BG5 A;  4AF2 A;  2L4C A;  2HFD A;  4XS1 A;  4XS6 A;  3ZL5 A;  3CQF A;  1SKW B;  3LSZ A;  2L57 A;  5HFK A;  3HVX A;  3KM6 A;  3ME7 A;  4OD7 A;  2PPT A;  1EV9 A;  2FA4 A;  1SK2 A;  3IV4 A;  4HZ2 A;  1RK4 A;  2C4J A;  2LUS A;  2YNX A;  4XTS A;  2H19 A;  2H6Y A;  4KH7 A;  1PL1 A;  1GSQ A;  3HZ4 A;  3VWV A;  3QAG A;  5GST A;  3K8N A;  1B9X C;  2CX3 A;  3BBY A;  3P8W A;  4G9H A;  5INY A;  1K0O A;  3M8N A;  18GS A;  3F3R A;  3KP8 A;  4GCI A;  3IR4 A;  4O32 A;  1G7O A;  4XRD A;  1B4P A;  3D4M A;  6GSV A;  2YZU A;  3JCM L;  2GSS A;  6GSX A;  1T7P B;  4QL7 A;  2A2P A;  2I9H A;  3KH7 A;  4BPY A;  4RQX A;  3IC4 A;  1GSD A;  2VL2 A;  3KXO A;  4EO3 A;  4IBP A;  1ZZY A;  3M3M A;  4NPB A;  1X5C A;  5CRH A;  3IDV A;  4OCE A;  4G2E A;  1MDJ A;  4KCA A;  4TR1 A;  2GVP A;  2H1A A;  4NMU A;  3TB2 A;  1X9S B;  3UAR A;  3R3E A;  5J3R A;  5D9X A;  5IMD A;  4TR1 B;  2LJR A;  2DJ2 A;  3ZZX A;  1S3C A;  5GAP D;  1OAZ A;  4G0L A;  1QFN A;  3GFK A;  4GQF A;  2H0H A;  2DMM A;  1PA3 A;  4TKY A;  3LJR A;  3CRU A;  1BX9 A;  3FZ9 A;  4Z2U A;  4J56 E;  3LYK A;  3WGX A;  1R4W A;  2PER A;  4HUA A;  1H75 A;  4BVY A;  2R37 A;  1O8X A;  1PRX A;  4TVE A;  1G6Y A;  4HQZ A;  1I5G A;  2P5R A;  3LGC A;  4TRX A;  4OFM A;  4OFN A;  4FO5 A;  3GKN A;  1AQX A;  2G2Q A;  3RBT A;  3FR9 A;  4V2L A;  1XBS A;  4K5S A;  4BVY B;  2FHE A;  3ME8 A;  1GUH A;  4ZL7 A;  2AB6 A;  1PFO A;  2FGX A;  3G7Y A;  1E2Y A;  4CY8 A;  4KA0 A;  2PBJ A;  2C8U A;  1WOU A;  1ERW A;  5ECS A;  3IE3 A;  4CHS A;  1XOB A;  1FO5 A;  3D21 A;  3GX8 A;  4K9Z A;  4X4J A;  2YWI A;  3FY7 A;  3F0I A;  3LW9 A;  1GLP A;  4NHZ A;  1XZO A;  3GV1 A;  2J23 A;  4MZC A;  2JSY A;  4E8E A;  4F82 A;  2I3Y A;  4PUR A;  3ERF A;  5JWO B;  2G0F A;  4PQH A;  1XWG A;  2BJX A;  4IKH A;  2CAQ A;  2DJ3 A;  1XWA A;  4MP4 A;  3IAM 2;  2DSA A;  3BOA A;  3IA1 A;  4OMV A;  2XHF A;  5HFG A;  1FOV A;  3R2Q A;  3EMP A;  1Z7R A;  5ECM B;  1O81 A;  4LMV A;  2MMO A;  4WEY A;  3UJ1 A;  1WWJ A;  3ZFL A;  2HT9 A;  1K0C A;  4KB3 A;  2B3S A;  2H6Z A;  1BED A;  2LV3 A;  4POB A;  1EP8 A;  4MLY A;  1TK5 B;  5AGY A;  3FZA A;  5IPH A;  5KOX A;  2IMI A;  3FEU A;  2LKU A;  1NHO A;  3QMX A;  1JFU A;  3M1G A;  4ZBD A;  1KEB A;  1MDI A;  2D2Z A;  2A4H A;  3ZML A;  16GS A;  6GSU A;  4G19 A;  4DEJ A;  5BMU A;  3H4K A;  3H8Q A;  3EUR A;  1ZL9 A;  3TCO A;  3MSZ A;  2IJY A;  3GKK A;  3NIV A;  1X0R A;  5ENU A;  3CRT A;  4IJ3 A;  2VD1 A;  3H93 A;  5C04 A;  2FWE A;  4K1F A;  3HXS A;  3LQ7 A;  4GSS A;  5FHI A;  3Q18 A;  3DEX A;  2HI7 A;  2QC7 A;  3F4T A;  1G0T A;  2RUE A;  4KE3 A;  4Z7X A;  4GXZ A;  1Q98 A;  2PVO C;  1MD3 A;  4V2M A;  2IFQ A;  4HS1 A;  3DWV A;  3IK9 A;  4ID0 A;  4IHU A;  1WRY A;  5IMV A;  1SJZ A;  1WMJ A;  1XOA A;  1AAZ A;  2H1D A;  2MMN A;  4ML1 A;  2IFQ B;  5E59 A;  3GKM A;  5DQS A;  1BAY A;  3HVN A;  3EU4 A;  1K0D A;  2TRX A;  1A0F A;  1UA5 A;  3D6I A;  3PPU A;  2RM5 A;  5CRE A;  4ECI A;  2H1G A;  2B7J A;  4MJE A;  1Z6M A;  3TKP A;  4POK A;  2HXK A;  5C00 A;  3TJG A;  4ECB A;  3IOS A;  5D73 A;  4MJB A;  2WCI A;  4ZXG A;  2X64 A;  2I4A A;  5IMA A;  2O7K A;  2WGR A;  3QPM A;  2YAN A;  4EUY A;  3ZYW A;  1TW9 A;  1JLW A;  2EIO A;  1M3I A;  3UOM A;  3EVI A;  2WS2 A;  2KP1 A;  1ABA A;  3ZMK A;  2K18 A;  5BRT A;  5FWG A;  2GSR A;  1GLQ A;  3GSS A;  1XW6 A;  3DRN A;  4O5Q A;  2R6K A;  2XPE A;  4IQA A;  3DGQ A;  1TK8 B;  4XHM A;  4MZW A;  4LLR A;  2E2M A;  1M3J A;  3VK9 A;  3FMW A;  2FWF A;  2LST A;  5AIS A;  1YY7 A;  4NV2 A;  2FY6 A;  3FYG A;  5ECN B;  3FZ4 A;  3CSI A;  3LFL A;  2CT6 A;  1A8L A;  4A5P A;  3E0U A;  2VAF A;  1HYU A;  3KCM A;  2H76 A;  3UVH A;  3MIX A;  4TN8 A;  3LOR A;  2CQ9 A;  1NHY A;  1URM A;  5KN2 A;  3PR8 A;  3FKF A;  1B8X A;  2RLI A;  2H70 A;  5KEJ A;  2M72 A;  1QMV A;  3ZRD A;  1F37 A;  1A0R P;  3QOU A;  4N0V A;  1X9M B;  1SEN A;  4PXO A;  5LCZ A;  1THX A;  4F0B A;  3H79 A;  3LEF A;  1U87 A;  4HEA 2;  4OWY A;  5ID2 B;  5IM9 A;  1FAA A;  1G7E A;  4NV5 A;  1X5E A;  1SL1 B;  5EY6 A;  2L4Q A;  1FB0 A;  3Q19 A;  2LRC A;  1JZR A;  4MPG A;  2DKH A;  4ZIL A;  4MAB A;  3DYR A;  3VI7 A;  5A4W A;  1XPV A;  4ICY A;  3N5O A;  1OC3 A;  4E8H A;  2KOK A;  4BWS A;  1HNA A;  1ZOF A;  3WGE A;  3FW2 A;  2O8V B;  1TRV A;  4X1U A;  3Q6O A;  2V6O A;  5GSS A;  2H66 A;  4DSQ A;  3IXR A;  4IJI A;  2WFC A;  4WF4 A;  1OC8 A;  1XVW A;  1ON4 A;  1XXU A;  4L8E A;  3D22 A;  4FYB A;  2E0Q A;  1J9B A;  1WIK A;  2IN3 A;  3VI5 A;  2VL3 A;  4TXO B;  1Z7P A;  3D4T A;  3WD6 A;  2OE0 A;  4YKG A;  2AUV A;  3EPT A;  1YF1 A;  2MBT A;  1K3Y A;  3PGT A;  1W4V A;  2VD0 A;  1N2A A;  2X99 A;  4Q5R A;  3I9V 2;  1F3B A;  2H8L A;  3IPZ A;  1PQN A;  3HYP A;  1AQW A;  3VWW A;  1SD8 A;  2YZH A;  1Y6E A;  5LNK e;  1V98 A;  1XCC A;  2RII A;  3P90 A;  4K7O A;  5EPF A;  2HZE A;  4IP1 A;  2PN8 A;  4KUN A;  2GQK A;  3C7M A;  5ECI B;  2VCQ A;  1NSW A;  4CY6 A;  2GQL A;  5B8A A;  5CRD A;  3GTU A;  3L9U A;  1K0B A;  6GSS A;  3C1S A;  4JRR A;  5IPG A;  4Z2T A;  2C1Y A;  3OR5 A;  5FT3 A;  4OO4 A;  4HJM A;  2FD3 A;  4JR4 A;  3GTU B;  4FYC A;  4NHW A;  3KIJ A;  1V2A A;  3DXB A;  2QGV A;  1T8E B;  5D9V A;  2HSY A;  4ZB9 A;  4YAV A;  5DAL A;  1OE8 A;  2C0E A;  1AIU A;  3GH6 A;  4EVM A;  4PQI A;  2OBK A;  1T4Y A;  3HHV A;  4PNG A;  1YKA A;  4F0C A;  2LS5 A;  2NVL A;  4NAX A;  1M7T A;  4F2I A;  5DAL B;  3KJY A;  1ZMA A;  3F3Q A;  2H01 A;  1PKZ A;  3E9J B;  1GH2 A;  2HRK A;  3APO A;  3TJB A;  2FA8 A;  4ZB6 A;  4GRF A;  2K8S A;  2DC5 A;  4IP6 A;  5D96 A;  4FIW A;  2JL4 A;  2MMZ A;  5AIX A;  3IAS 2;  1DBY A;  4POM A;  3TKS A;  1THO A;  4MH3 A;  2Z9S A;  3I6A A;  4HZ4 A;  1TU8 A;  4CDO A;  4ML6 A;  2H0I A;  5D9W A;  3HCZ A;  3EWL A;  5HR2 A;  2IMF A;  3GNJ A;  1TI3 A;  3FR3 A;  4GWR A;  2GGT A;  2H1B A;  2VOC A;  3ZVJ A;  2C0F A;  4Z2R A;  4HU9 A;  3QAW A;  3KGK A;  4Q5N A;  5B8B A;  2A4V A;  2GT6 A;  4ZB8 A;  2R0C A;  5HFI A;  3GIX A;  4TXV A;  3TOU A;  4K7I A;  4EDY A;  4MZB A;  5IIZ A;  1A23 A;  5G2Z A;  1I9D A;  2X49 A;  9GSS A;  2C0D A;  2FNO A;  5IMF A;  3KMN A;  4WF5 A;  1OC9 A;  2VCZ A;  8GSS A;  2IMD A;  2XBQ A;  3F8U A;  1XIY A;  4BIK A;  1TP9 A;  3RDW A;  1SKS B;  4QQ7 A;  4IQ1 A;  3W6G A;  2M80 A;  3F4R A;  2YWO A;  4K7N A;  4LL1 B;  1TI1 A;  1OC9 B;  1FHE A;  2K9F A;  4TR0 A;  3ZRE A;  2CVK A;  2ON5 A;  1GL8 A;  4D73 A;  2QA1 A;  1AXD A;  1S3R A;  2ZNM A;  4MMM A;  2L5O A;  4RUV A;  3TKQ A;  3ZVJ D;  4HI7 A;  3G7I A;  4D73 B;  1M0U A;  2B5Y A;  1PD2 1;  2VM2 A;  5CRW A;  2P5Q A;  2AJQ B;  1AW9 A;  1KNG A;  1EGO A;  2LQQ A;  1PN0 A;  2PUK C;  3MAK A;  3KMO A;  1V57 A;  1PX6 A;  2DLX A;  4F03 A;  4XS4 B;  3QD9 A;  3HVS A;  3TJF A;  2B6M A;  1BJX A;  3AY8 A;  4KGI A;  4JU5 A;  2R2J A;  3NOF A;  11GS A;  1ERT A;  2K6V A;  1VF2 A;  4G0I A;  5ECP B;  2JZT A;  2HSM A;  1CQG A;  3FR6 A;  2F8F A;  4X43 A;  4EL1 A;  5DJL A;  4MF6 A;  5D8I A;  4BVX A;  1KTE A;  4V1A p;  1OVN A;  1KBN A;  4IN0 A;  4OO5 A;  4O92 A;  3TRP A;  2JSZ A;  3UMA A;  2MYG A;  2KP2 A;  1AQV A;  1NW2 A;  5A5K A;  2C3N A;  1MEK A;  4FYU A;  2YWN A;  4BVX B;  1T00 A;  3P2A A;  4GLT A;  2DIY A;  2HRN A;  1JZD A;  2H71 A;  6GSW A;  1F9M A;  5ECQ B;  5IMC A;  2VCV A;  1LJR A;  4KAE A;  5ELG A;  5F06 A;  2A2R A;  3RPP A;  2GST A;  3UBL A;  5G1K A;  4WBJ A;  3A2W A;  3DIE A;  3W8S A;  3GN3 A;  5COH A;  2H72 A;  5F0G A;  4K8M A;  1B48 A;  2HNL A;  1WJK A;  2GLR A;  3CXG A;  1HNB A;  3GX0 A;  1EGR A;  1IYH A;  3US3 A;  4IW9 A;  7GSS A;  4KDX A;  3V1W A;  5G30 A;  4MJA A;  4MNN A;  1F3A A;  1EWX A;  3TKR A;  2YV7 A;  5KN3 A;  5A4V A;  1GSU A;  5J5N A;  5D9T A;  4ZBA A;  3TOT A;  1GUM A;  1U6T A;  2JZR A;  1QGV A;  4IEL A;  2LNS A;  5HR3 A;  3BD2 A;  1U88 A;  5JWQ B;  4AJ7 A;  2NDO A;  2YOI A;  2FCH A;  3L9S A;  4EF0 A;  4FH8 A;  1A2L A;  4N30 A;  4ECC A;  1MD4 A;  1O8W A;  4YAP A;  2EIR A;  3ZFB A;  4POL A;  1A24 A;  4GSN A;  3QAV A;  4NWY A;  2N5A A;  3EYT A;  5DDL A;  2B5E A;  4USS A;  1PL2 A;  1FVJ A;  2XC2 A;  3WGD A;  4JED A;  2ZCT A;  2L59 A;  3L78 A;  1WPI A;  3FZ5 A;  5J9B A;  3SWL A;  2YJH A;  4J2F A;  3BJ5 A;  3GST A;  1X9W B;  1A2M A;  4JBB A;  4KSM A;  1F6M C;  3GH9 A;  1VF1 A;  3UVT A;  2OAD A;  2JZS A;  2HE3 A;  3UAP A;  3VPT A;  2CAI A;  5J4U A;  5JCG A;  3A2V A;  2V6K A;  3ISO A;  3HZ8 A;  4KX4 A;  3EMX A;  2F3M A;  4L5L A;  2H0G A;  2NBS A;  5GAN D;  4AJ8 A;  4OFT A;  5HR1 A;  5ECK B;  12GS A;  4N10 A;  1TRW A;  2PMT A;  2CX4 A;  2GZZ A;  3D5J A;  1TDI A;  4MPF A;  3M9J A;  3RHB A;  3I43 A;  3GYK A;  4G10 A;  2YPM A;  5DQY A;  2GZY A;  1RW1 A;  1PSQ A;  4K0G A;  2DJK A;  1SYX A;  4HSC X;  1GSE A;  1A2J A;  3W8J A;  1T3B A;  2L6C A;  3NZN A;  2ON7 A;  1YZX A;  3QDN A;  3DVW A;  2P0G A;  4DSS A;  3LWA A;  1GSS A;  3GUS A;  1X5D A;  2OE3 A;  2VO4 A;  2HSH A;  3M0F A;  3KZQ A;  4EIP A;  1UC7 A;  3DML A;  5F8B A;  3TKS C;  5ABR A;  5ID2 A;  3GRX A;  4XCS A;  4DSS B;  2UZ8 A;  4YH2 A;  1XFL A;  2O89 A;  2CZ2 A;  5CNW A;  1OKT A;  4MF5 A;  1ERU A;  1QK8 A;  1ML6 A;  1TTZ A;  2O87 A;  2B1K A;  10GS A;  1HD2 A;  2KUC A;  4MDC A;  1EEJ A;  2HZF A;  4H86 A;  4TR3 A;  2A2S A;  1YEP A;  1TJD A;  2AHE A;  2JU5 A;  1XG8 A;  5DAK A;  3GUR A;  2LEG A;  4YQV A;  1XW5 A;  3MYD A;  4DVC A;  3BCI A;  2E2G A;  5LD0 A;  3G9B A;  4PQ1 A;  4EDZ A;  4ZL9 A;  1HQO A;  3HJM A;  3UIW A;  5DAK B;  1EOH A;  2MZC A;  3H1N A;  3VPQ A;  1XWB A;  1GNE A;  1G6W A;  2QSI A;  4TXO A;  1V58 A;  2ES7 A;  3IHG A;  2WRT A;  3L0H A;  2GSQ A;  2IME A;  2C3T A;  3WT1 A;  4KND A;  3M9K A;  3TJK A;  3HDC A;  4IVF A;  5DBQ A;  1TXX A;  5ELA A;  1R26 A;  5DCH A;  4G0K A;  2PVQ A;  1K3O A;  4PUA A;  2LJA A;  19GS A;  3IBH A;  2XBI A;  4KDY A;  1ZCP A;  1ZGN A;  5JCU A;  1XW9 A;  2R0G A;  4WKW A;  1TRU A;  1GTB A;  2IPA A;  1O85 A;  2IWT A;  2CV4 A;  5J9C A;  1K0A A;  4KW6 A;  2VCW A;  4MCU A;  2YJ7 A;  2IL3 A;  5DCG A;  1IYI A;  4WR5 A;  1M9A A;  1EP7 A;  1Z3E A;  3O6T A;  5DVB A;  5AIV A;  4I6X A;  4KSO A;  1TRS A;  1EEM A;  6GST A;  2FUG 2;  2DJ1 A;  2HRA A;  4OCF A;  4EC0 A;  4F9Z A;  2DIZ A;  2PU9 C;  1K0M A;  4IS0 A;  3TDG A;  2JAD A;  4RI7 A;  2WZ9 A;  1UN2 A;  4JE1 A;  3ZTL A;  1JZW A;  3GL3 A;  2V41 A;  2YWM A;  1BYE A;  4YQM A;  2RUF A;  5D93 A;  1VF3 A;  3O76 A;  1SL2 B;  2VCX A;  4V1A g;  4WET A;  3TUE A;  1ST9 A;  1USB A;  4L0W A;  1B4Q A;  4RI6 A;  2H74 A;  2WB9 A;  1K0N A;  1RQM A;  2H73 A;  2PGT A;  4ZIJ A;  3C73 A;  4MF7 A;  5IO0 A;  1V9W A;  5B7C A;  3KEB A;  4L0U A;  2DJ0 A;  2I1U A;  2F51 A;  2L5L A;  3CSH A;  1ZYE A;  4O5R A;  1TOF A;  3F6F A;  3UL3 A;  1FB6 A;  2FWH A;  3IK7 A;  2VLV A;  4EE0 A;  4MA9 A;  1YDK A;  2RM6 A;  2EIQ A;  5GZZ B;  4KDU A;  3TRX A;  2TIR A;  4XIH A;  1VGL A;  1A8Y A;  1ERV A;  3I69 A;  4O5U A;  2AAW A;  1U3A A;  2NTO A;  3CMI A;  3F63 A;  3IC8 A;  1DE2 A;  5IO2 A;  3KTB A;  2C3Q A;  5F07 A;  4PGT A;  17GS A;  3PIN A;  4L5O A;  1S3A A;  5ECH B;  5ECR B;  3U5R E;  1GUK A;  3ZIT A;  1SK0 A;  4PUF C;  1SK1 A;  3S9F A;  5G5E A;  2NPB A;  4TOP A;  2GQM A;  1PN9 A;  1ACV A;  4BL7 A; 
#chains in the Genus database with same CATH homology
 3CBU A;  2DJJ A;  1LU4 A;  3APQ A;  14GS A;  1FW1 A;  3G7J A;  1Y25 A;  4WR4 A;  4BL7 B;  1V40 A;  3WT2 A;  1S3D A;  1YJ6 A;  1AC1 A;  2H6X A;  3EU3 A;  4JZQ A;  4ISD A;  1YEX A;  13GS A;  3P7X A;  4YKF A;  2CA8 A;  3FK8 A;  3MWH A;  2X8C A;  3CTG A;  5HR0 A;  4XS4 A;  2LTK A;  3HD5 A;  1SD9 A;  1GTA A;  2P31 A;  1GNW A;  1J08 A;  4NXI A;  1NM3 A;  4LA1 A;  3VLN A;  1TK0 B;  3TJJ A;  3APS A;  4EKZ A;  1QQ2 A;  2OKA A;  2B1L A;  3A3T A;  2WUL A;  2QA2 A;  3ZLP A;  5J41 A;  5G1L A;  4ZL8 A;  3GKX A;  4K2D A;  4N0Z A;  2KHP A;  5DJM A;  5KN1 A;  1O6J A;  3QFB C;  2OAC A;  1R5A A;  2REM A;  4ZBB A;  2ALB A;  2N5B A;  4Q5F A;  4MK3 A;  4I5Q A;  4IGJ A;  1SKR B;  3SBC A;  1GTI A;  2LNT A;  4XRA A;  1Z6N A;  1XWC A;  2R3X A;  2M46 A;  3HJO A;  2FLS A;  20GS A;  1Z9H A;  3EE2 A;  2K8V A;  4WBR D;  4HQS A;  3IHQ A;  3J7Y b;  3LXT A;  2I81 A;  5H5S A;  3ERW A;  4YQU A;  5CRG A;  1JHB A;  1QUW A;  4ULX A;  2VIM A;  3LXZ A;  4DSR A;  5AN1 A;  1N8J A;  3GL5 A;  4PNF A;  2GS3 A;  4ILF A;  3CYN A;  3KD0 A;  2VM1 A;  3GMF A;  5CO3 A;  3HY2 A;  5H5R A;  2GTU A;  1GP1 A;  2J9H A;  3TKS E;  5G31 A;  2X8H A;  2WDU A;  3QR6 A;  2ZUP A;  2OE1 A;  4GTU A;  3U6V A;  5CP1 A;  4MH2 A;  5ECL B;  3VFI A;  2R0P A;  2QKE A;  2EC4 A;  2C0G A;  4QL9 A;  3QCP A;  5G5F A;  2AV4 A;  4BWQ A;  4TR4 A;  2V1M A;  3EIN A;  1M2B A;  5A4U A;  1PMT A;  1FG4 A;  3HVV A;  4PTS A;  2FWG A;  3D0Z A;  3N9J A;  5E4W A;  2F8A A;  2VLU A;  4GST A;  1GWC A;  2R4V A;  5HQP A;  2OA7 A;  3A5I A;  1J0F A;  4I2U A;  1W89 A;  5IQY A;  2LRT A;  1M2A A;  2CVB A;  2HYX A;  1MDK A;  1OYJ A;  3TRQ A;  1HNC A;  1GUL A;  4GF0 A;  4HDE A;  5F05 A;  3O3T A;  1BQ7 A;  1YQ1 A;  3LG6 A;  5IOW A;  2KLX A;  4HOJ A;  2YV9 A;  4AJ6 A;  2JAC A;  3KP9 A;  3ERG A;  1DE1 A;  1FVK A;  1FOH A;  1R5P A;  4CW9 A;  3C1R A;  1DUG A;  3QFA C;  1SJ6 A;  2F9S A;  3KTL A;  2IMK A;  4V2N A;  4P3Y B;  1XWK A;  2IIY A;  1B9Y C;  4I8B A;  2OJL A;  3IRA A;  1CQH A;  2TRC P;  3VUR A;  1OKD A;  4O7H A;  5CYY A;  2LQO A;  4PX1 A;  1GRX A;  4EXJ A;  3CSJ A;  1H4O A;  4WXT A;  4X0X A;  2CVD A;  2VCT A;  3WYW A;  2O85 A;  1TKD B;  3L9V A;  1M99 A;  1T4Z A;  4GQC A;  4HU7 A;  1T1V A;  2BTO T;  1MTC A;  3C71 A;  2PWJ A;  2N5F A;  1JLV A;  4AGS A;  1AUC A;  3ED3 A;  1ZYQ B;  1XVQ A;  1YKC A;  3HKR A;  2H75 A;  5L71 A;  1Q4J A;  3DKS A;  4Q5Q A;  2YN1 A;  1M2D A;  5KN0 A;  4ECJ A;  3F9U A;  1LBK A;  1E6B A;  2C80 A;  3C8E A;  1SJI A;  3FHK A;  3VWX A;  3DD3 A;  6GSY A;  2GDR A;  2HRF A;  2GZP A;  2LRN A;  1EZK A;  1QXH A;  4K2X A;  4HJ2 A;  5IOX A;  5IMZ A;  1VRS D;  4K6X A;  2B5X A;  2L6D A;  1GSY A;  1GSF A;  2VL2 C;  2H30 A;  2V2G A;  3MNG A;  1VF4 A;  5B6N A;  5JCW A;  1PKW A;  3KH9 A;  4LMW A;  2V32 A;  4JR6 A;  1C72 A;  4K0N A;  1WE0 A;  2CZ3 A;  5ECO B;  1Z5Y E;  1EOG A;  2GT5 A;  1OE7 A;  22GS A;  2HLS A;  4KCE A;  1O73 A;  2DBC A;  2E7P A;  4I2T A;  2VLT A;  3RPN A;  3F4S A;  2DKI A;  5EL8 A;  3ZIJ A;  4MJC A;  4ACS A;  2AYT A;  1ZYN A;  1SU9 A;  5EVO A;  3GHA A;  4BA7 A;  2VUP A;  3UBK A;  5H5Q A;  2BMX A;  2R5G A;  1PGT A;  4I97 A;  3FRC A;  1K3L A;  2X4A A;  1ILO A;  4KF9 A;  1F2E A;  5CAX A;  4LL4 B;  3RAZ A;  1SL0 B;  3HJP A;  3ZIV A;  2YP6 A;  2DML A;  3RHC A;  2X8G A;  4J57 E;  2YCD A;  3DVX A;  1DSB A;  2LJK A;  1ZYP A;  1YF0 A;  1TU7 A;  2OBI A;  4N11 A;  1WP0 A;  1M9B A;  5KOW A;  5JWR B;  3L4N A;  3MDK A;  4TW5 A;  3GA4 A;  3PH9 A;  3Q74 A;  1PX7 A;  3UEM A;  3HA9 A;  3CTF A;  2VL9 A;  3VWU A;  3EC3 A;  1UVZ A;  2WJU A;  1EV4 A;  1U3I A;  2XPD A;  3BCK A;  4K5R A;  5B6M A;  3TGZ A;  1GTU A;  3A2X A;  2B7K A;  1R7H A;  2MBS A;  1SYR A;  1JZO A;  3LYP A;  3J7Y k;  4EIQ A;  1O7U A;  3A5W A;  2MMA A;  3E3E A;  4FQU A;  3F6D A;  2HZE B;  4RQR A;  1BG5 A;  4AF2 A;  2L4C A;  2HFD A;  4XS1 A;  4XS6 A;  3ZL5 A;  1SKW B;  3LSZ A;  2L57 A;  5HFK A;  3HVX A;  3KM6 A;  3ME7 A;  4OD7 A;  2PPT A;  1EV9 A;  2FA4 A;  1SK2 A;  3IV4 A;  4HZ2 A;  1RK4 A;  2C4J A;  2LUS A;  2YNX A;  4XTS A;  2H19 A;  2H6Y A;  4KH7 A;  1PL1 A;  1GSQ A;  3HZ4 A;  3VWV A;  3QAG A;  5GST A;  3K8N A;  1B9X C;  2CX3 A;  3BBY A;  3P8W A;  4G9H A;  5INY A;  1K0O A;  3M8N A;  18GS A;  3F3R A;  3KP8 A;  4GCI A;  3IR4 A;  4O32 A;  1G7O A;  4XRD A;  1B4P A;  3D4M A;  6GSV A;  2YZU A;  3JCM L;  2GSS A;  6GSX A;  1T7P B;  4QL7 A;  2A2P A;  2I9H A;  3KH7 A;  4BPY A;  4RQX A;  3IC4 A;  1GSD A;  2VL2 A;  3KXO A;  4EO3 A;  4IBP A;  1ZZY A;  3M3M A;  4NPB A;  1X5C A;  5CRH A;  3IDV A;  4OCE A;  4G2E A;  1MDJ A;  4KCA A;  4TR1 A;  2GVP A;  2H1A A;  4NMU A;  3TB2 A;  1X9S B;  3UAR A;  3R3E A;  5J3R A;  5D9X A;  5IMD A;  4TR1 B;  2LJR A;  2DJ2 A;  3ZZX A;  1S3C A;  5GAP D;  1OAZ A;  4G0L A;  1QFN A;  3GFK A;  4GQF A;  2H0H A;  2DMM A;  1PA3 A;  4TKY A;  3LJR A;  3CRU A;  1BX9 A;  3FZ9 A;  4Z2U A;  4J56 E;  3LYK A;  3WGX A;  1R4W A;  2PER A;  4HUA A;  1H75 A;  4BVY A;  2R37 A;  1O8X A;  1PRX A;  4TVE A;  1G6Y A;  4HQZ A;  1I5G A;  2P5R A;  3LGC A;  4TRX A;  4OFM A;  4OFN A;  4FO5 A;  3GKN A;  1AQX A;  2G2Q A;  3RBT A;  3FR9 A;  4V2L A;  1XBS A;  4K5S A;  4BVY B;  2FHE A;  3ME8 A;  1GUH A;  4ZL7 A;  2AB6 A;  2FGX A;  3G7Y A;  1E2Y A;  4CY8 A;  4KA0 A;  2PBJ A;  2C8U A;  1WOU A;  1ERW A;  5ECS A;  3IE3 A;  4CHS A;  1XOB A;  1FO5 A;  3D21 A;  3GX8 A;  4K9Z A;  4X4J A;  2YWI A;  3FY7 A;  3F0I A;  3LW9 A;  1GLP A;  4NHZ A;  1XZO A;  3GV1 A;  2J23 A;  4MZC A;  2JSY A;  4E8E A;  4F82 A;  2I3Y A;  4PUR A;  3ERF A;  5JWO B;  2G0F A;  4PQH A;  1XWG A;  2BJX A;  4IKH A;  2CAQ A;  2DJ3 A;  1XWA A;  4MP4 A;  3IAM 2;  2DSA A;  3BOA A;  3IA1 A;  4OMV A;  2XHF A;  5HFG A;  1FOV A;  3R2Q A;  3EMP A;  1Z7R A;  5ECM B;  1O81 A;  4LMV A;  2MMO A;  4WEY A;  3UJ1 A;  1WWJ A;  3ZFL A;  2HT9 A;  1K0C A;  4KB3 A;  2B3S A;  2H6Z A;  1BED A;  2LV3 A;  4POB A;  1EP8 A;  4MLY A;  1TK5 B;  5AGY A;  3FZA A;  5IPH A;  5KOX A;  2IMI A;  3FEU A;  2LKU A;  1NHO A;  3QMX A;  1JFU A;  3M1G A;  4ZBD A;  1KEB A;  1MDI A;  2D2Z A;  2A4H A;  3ZML A;  16GS A;  6GSU A;  4G19 A;  4DEJ A;  5BMU A;  3H4K A;  3H8Q A;  3EUR A;  1ZL9 A;  3TCO A;  3MSZ A;  2IJY A;  3GKK A;  3NIV A;  1X0R A;  5ENU A;  3CRT A;  4IJ3 A;  2VD1 A;  3H93 A;  5C04 A;  2FWE A;  4K1F A;  3HXS A;  3LQ7 A;  4GSS A;  5FHI A;  3Q18 A;  3DEX A;  2HI7 A;  2QC7 A;  3F4T A;  1G0T A;  2RUE A;  4KE3 A;  4Z7X A;  4GXZ A;  1Q98 A;  2PVO C;  1MD3 A;  4V2M A;  2IFQ A;  4HS1 A;  3DWV A;  3IK9 A;  4ID0 A;  4IHU A;  1WRY A;  5IMV A;  1SJZ A;  1WMJ A;  1XOA A;  1AAZ A;  2H1D A;  2MMN A;  4ML1 A;  2IFQ B;  5E59 A;  3GKM A;  5DQS A;  1BAY A;  3EU4 A;  1K0D A;  2TRX A;  1A0F A;  1UA5 A;  3D6I A;  3PPU A;  2RM5 A;  5CRE A;  4ECI A;  2H1G A;  2B7J A;  4MJE A;  1Z6M A;  3TKP A;  4POK A;  2HXK A;  5C00 A;  3TJG A;  4ECB A;  3IOS A;  5D73 A;  4MJB A;  2WCI A;  4ZXG A;  2X64 A;  2I4A A;  5IMA A;  2O7K A;  2WGR A;  3QPM A;  2YAN A;  4EUY A;  3ZYW A;  1TW9 A;  1JLW A;  2EIO A;  3UOM A;  3EVI A;  2WS2 A;  2KP1 A;  1ABA A;  3ZMK A;  2K18 A;  5BRT A;  5FWG A;  2GSR A;  1GLQ A;  3GSS A;  1XW6 A;  3DRN A;  4O5Q A;  2R6K A;  2XPE A;  4IQA A;  3DGQ A;  1TK8 B;  4XHM A;  4MZW A;  4LLR A;  2E2M A;  3VK9 A;  3FMW A;  2FWF A;  2LST A;  5AIS A;  1YY7 A;  4NV2 A;  2FY6 A;  3FYG A;  5ECN B;  3FZ4 A;  3CSI A;  3LFL A;  2CT6 A;  1A8L A;  4A5P A;  3E0U A;  2VAF A;  1HYU A;  3KCM A;  2H76 A;  3UVH A;  3MIX A;  4TN8 A;  3LOR A;  2CQ9 A;  1NHY A;  1URM A;  5KN2 A;  3PR8 A;  3FKF A;  1B8X A;  2RLI A;  2H70 A;  5KEJ A;  2M72 A;  1QMV A;  3ZRD A;  1F37 A;  1A0R P;  3QOU A;  4N0V A;  1X9M B;  1SEN A;  4PXO A;  5LCZ A;  1THX A;  4F0B A;  3H79 A;  3LEF A;  1U87 A;  4HEA 2;  4OWY A;  5ID2 B;  5IM9 A;  1FAA A;  1G7E A;  4NV5 A;  1X5E A;  1SL1 B;  5EY6 A;  2L4Q A;  1FB0 A;  3Q19 A;  2LRC A;  1JZR A;  4MPG A;  2DKH A;  4ZIL A;  4MAB A;  3DYR A;  3VI7 A;  5A4W A;  1XPV A;  4ICY A;  3N5O A;  1OC3 A;  4E8H A;  2KOK A;  4BWS A;  1HNA A;  1ZOF A;  3WGE A;  3FW2 A;  2O8V B;  1TRV A;  4X1U A;  3Q6O A;  2V6O A;  5GSS A;  2H66 A;  4DSQ A;  3IXR A;  4IJI A;  2WFC A;  4WF4 A;  1OC8 A;  1XVW A;  1ON4 A;  1XXU A;  4L8E A;  3D22 A;  4FYB A;  2E0Q A;  1J9B A;  1WIK A;  2IN3 A;  3VI5 A;  2VL3 A;  4TXO B;  1Z7P A;  3D4T A;  3WD6 A;  2OE0 A;  4YKG A;  2AUV A;  3EPT A;  1YF1 A;  2MBT A;  1K3Y A;  3PGT A;  1W4V A;  2VD0 A;  1N2A A;  2X99 A;  4Q5R A;  3I9V 2;  1F3B A;  2H8L A;  3IPZ A;  1PQN A;  3HYP A;  1AQW A;  3VWW A;  1SD8 A;  2YZH A;  1Y6E A;  5LNK e;  1V98 A;  1XCC A;  2RII A;  3P90 A;  4K7O A;  5EPF A;  2HZE A;  4IP1 A;  2PN8 A;  4KUN A;  2GQK A;  3C7M A;  5ECI B;  2VCQ A;  1NSW A;  4CY6 A;  2GQL A;  5B8A A;  5CRD A;  3GTU A;  3L9U A;  1K0B A;  6GSS A;  3C1S A;  4JRR A;  5IPG A;  4Z2T A;  2C1Y A;  3OR5 A;  5FT3 A;  4OO4 A;  4HJM A;  2FD3 A;  4JR4 A;  3GTU B;  4FYC A;  4NHW A;  3KIJ A;  1V2A A;  3DXB A;  2QGV A;  1T8E B;  5D9V A;  2HSY A;  4ZB9 A;  4YAV A;  5DAL A;  1OE8 A;  2C0E A;  1AIU A;  3GH6 A;  4EVM A;  4PQI A;  2OBK A;  1T4Y A;  3HHV A;  4PNG A;  1YKA A;  4F0C A;  2LS5 A;  2NVL A;  4NAX A;  1M7T A;  4F2I A;  5DAL B;  3KJY A;  1ZMA A;  3F3Q A;  2H01 A;  1PKZ A;  3E9J B;  1GH2 A;  2HRK A;  3APO A;  3TJB A;  2FA8 A;  4ZB6 A;  4GRF A;  2K8S A;  2DC5 A;  4IP6 A;  5D96 A;  4FIW A;  2JL4 A;  5AIX A;  2MMZ A;  3IAS 2;  1DBY A;  4POM A;  3TKS A;  1THO A;  4MH3 A;  2Z9S A;  3I6A A;  4HZ4 A;  1TU8 A;  4CDO A;  4ML6 A;  2H0I A;  5D9W A;  3HCZ A;  3EWL A;  5HR2 A;  2IMF A;  3GNJ A;  1TI3 A;  3FR3 A;  4GWR A;  2GGT A;  2H1B A;  2VOC A;  3ZVJ A;  2C0F A;  4Z2R A;  4HU9 A;  3QAW A;  3KGK A;  4Q5N A;  5B8B A;  2A4V A;  2GT6 A;  4ZB8 A;  2R0C A;  5HFI A;  3GIX A;  4TXV A;  3TOU A;  4K7I A;  4EDY A;  4MZB A;  5IIZ A;  1A23 A;  5G2Z A;  1I9D A;  2X49 A;  9GSS A;  2C0D A;  2FNO A;  5IMF A;  3KMN A;  4WF5 A;  1OC9 A;  2VCZ A;  8GSS A;  2IMD A;  2XBQ A;  3F8U A;  1XIY A;  1TP9 A;  3RDW A;  1SKS B;  4QQ7 A;  4IQ1 A;  3W6G A;  2M80 A;  3F4R A;  2YWO A;  4K7N A;  4LL1 B;  1TI1 A;  1OC9 B;  1FHE A;  2K9F A;  4TR0 A;  3ZRE A;  2CVK A;  2ON5 A;  1GL8 A;  4D73 A;  2QA1 A;  1AXD A;  2ZNM A;  4MMM A;  2L5O A;  4RUV A;  3TKQ A;  3ZVJ D;  4HI7 A;  3G7I A;  4D73 B;  1M0U A;  2B5Y A;  1PD2 1;  2VM2 A;  5CRW A;  2P5Q A;  2AJQ B;  1AW9 A;  1KNG A;  1EGO A;  2LQQ A;  1PN0 A;  2PUK C;  3MAK A;  3KMO A;  1V57 A;  1PX6 A;  2DLX A;  4F03 A;  4XS4 B;  3QD9 A;  3HVS A;  3TJF A;  2B6M A;  1BJX A;  3AY8 A;  4KGI A;  4JU5 A;  2R2J A;  3NOF A;  11GS A;  1ERT A;  2K6V A;  1VF2 A;  4G0I A;  5ECP B;  2JZT A;  2HSM A;  1CQG A;  3FR6 A;  2F8F A;  4X43 A;  4EL1 A;  5DJL A;  4MF6 A;  5D8I A;  4BVX A;  1KTE A;  4V1A p;  1OVN A;  1KBN A;  4IN0 A;  4OO5 A;  4O92 A;  3TRP A;  2JSZ A;  3UMA A;  2MYG A;  2KP2 A;  1AQV A;  1NW2 A;  5A5K A;  2C3N A;  1MEK A;  4FYU A;  2YWN A;  4BVX B;  1T00 A;  3P2A A;  4GLT A;  2DIY A;  2HRN A;  1JZD A;  2H71 A;  6GSW A;  1F9M A;  5ECQ B;  5IMC A;  2VCV A;  1LJR A;  4KAE A;  5ELG A;  5F06 A;  2A2R A;  3RPP A;  2GST A;  3UBL A;  5G1K A;  4WBJ A;  3A2W A;  3DIE A;  3W8S A;  3GN3 A;  5COH A;  2H72 A;  5F0G A;  4K8M A;  1B48 A;  2HNL A;  1WJK A;  2GLR A;  3CXG A;  1HNB A;  3GX0 A;  1EGR A;  1IYH A;  3US3 A;  4IW9 A;  7GSS A;  4KDX A;  3V1W A;  5G30 A;  4MJA A;  4MNN A;  1F3A A;  1EWX A;  3TKR A;  2YV7 A;  5KN3 A;  5A4V A;  1GSU A;  5J5N A;  5D9T A;  4ZBA A;  3TOT A;  1GUM A;  1U6T A;  2JZR A;  1QGV A;  4IEL A;  2LNS A;  5HR3 A;  3BD2 A;  1U88 A;  5JWQ B;  4AJ7 A;  2NDO A;  2YOI A;  2FCH A;  3L9S A;  4EF0 A;  4FH8 A;  1A2L A;  4N30 A;  4ECC A;  1MD4 A;  1O8W A;  4YAP A;  2EIR A;  3ZFB A;  4POL A;  1A24 A;  4GSN A;  3QAV A;  4NWY A;  2N5A A;  3EYT A;  5DDL A;  2B5E A;  4USS A;  1PL2 A;  1FVJ A;  2XC2 A;  3WGD A;  4JED A;  2ZCT A;  2L59 A;  3L78 A;  1WPI A;  3FZ5 A;  5J9B A;  3SWL A;  2YJH A;  4J2F A;  3BJ5 A;  3GST A;  1X9W B;  1A2M A;  4JBB A;  4KSM A;  1F6M C;  3GH9 A;  1VF1 A;  3UVT A;  2OAD A;  2JZS A;  2HE3 A;  3UAP A;  3VPT A;  2CAI A;  5J4U A;  5JCG A;  3A2V A;  2V6K A;  3ISO A;  3HZ8 A;  4KX4 A;  3EMX A;  2F3M A;  4L5L A;  2H0G A;  2NBS A;  5GAN D;  4AJ8 A;  4OFT A;  5HR1 A;  5ECK B;  12GS A;  4N10 A;  1TRW A;  2PMT A;  2CX4 A;  2GZZ A;  3D5J A;  1TDI A;  4MPF A;  3M9J A;  3RHB A;  3I43 A;  3GYK A;  4G10 A;  2YPM A;  5DQY A;  2GZY A;  1RW1 A;  1PSQ A;  4K0G A;  2DJK A;  1SYX A;  1GSE A;  1A2J A;  3W8J A;  1T3B A;  2L6C A;  3NZN A;  2ON7 A;  1YZX A;  3QDN A;  3DVW A;  2P0G A;  4DSS A;  3LWA A;  1GSS A;  3GUS A;  1X5D A;  2OE3 A;  2VO4 A;  2HSH A;  3M0F A;  3KZQ A;  4EIP A;  1UC7 A;  3DML A;  5F8B A;  3TKS C;  5ABR A;  5ID2 A;  3GRX A;  4XCS A;  4DSS B;  2UZ8 A;  4YH2 A;  1XFL A;  2O89 A;  2CZ2 A;  5CNW A;  1OKT A;  4MF5 A;  1ERU A;  1QK8 A;  1ML6 A;  1TTZ A;  2O87 A;  2B1K A;  10GS A;  1HD2 A;  2KUC A;  4MDC A;  1EEJ A;  2HZF A;  4H86 A;  4TR3 A;  2A2S A;  1YEP A;  1TJD A;  2AHE A;  2JU5 A;  5DAK A;  3GUR A;  2LEG A;  4YQV A;  1XW5 A;  3MYD A;  4DVC A;  3BCI A;  2E2G A;  5LD0 A;  3G9B A;  4PQ1 A;  4EDZ A;  4ZL9 A;  1HQO A;  3HJM A;  3UIW A;  5DAK B;  1EOH A;  2MZC A;  3H1N A;  3VPQ A;  1XWB A;  1GNE A;  1G6W A;  2QSI A;  4TXO A;  1V58 A;  2ES7 A;  3IHG A;  2WRT A;  3L0H A;  2GSQ A;  2IME A;  2C3T A;  3WT1 A;  4KND A;  3M9K A;  3TJK A;  3HDC A;  4IVF A;  5DBQ A;  1TXX A;  5ELA A;  1R26 A;  5DCH A;  4G0K A;  2PVQ A;  1K3O A;  4PUA A;  2LJA A;  19GS A;  3IBH A;  2XBI A;  4KDY A;  1ZCP A;  1ZGN A;  5JCU A;  1XW9 A;  2R0G A;  4WKW A;  1TRU A;  1GTB A;  2IPA A;  1O85 A;  2IWT A;  2CV4 A;  5J9C A;  1K0A A;  4KW6 A;  2VCW A;  4MCU A;  2YJ7 A;  2IL3 A;  5DCG A;  1IYI A;  4WR5 A;  1M9A A;  1EP7 A;  1Z3E A;  3O6T A;  5DVB A;  5AIV A;  4I6X A;  4KSO A;  1TRS A;  1EEM A;  6GST A;  2FUG 2;  2DJ1 A;  2HRA A;  4OCF A;  4EC0 A;  4F9Z A;  2DIZ A;  2PU9 C;  1K0M A;  4IS0 A;  3TDG A;  2JAD A;  4RI7 A;  2WZ9 A;  1UN2 A;  4JE1 A;  3ZTL A;  1JZW A;  3GL3 A;  2V41 A;  2YWM A;  1BYE A;  4YQM A;  2RUF A;  5D93 A;  1VF3 A;  3O76 A;  1SL2 B;  2VCX A;  4V1A g;  4WET A;  3TUE A;  1ST9 A;  1USB A;  4L0W A;  1B4Q A;  4RI6 A;  2H74 A;  2WB9 A;  1K0N A;  1RQM A;  2H73 A;  2PGT A;  4ZIJ A;  3C73 A;  4MF7 A;  5IO0 A;  1V9W A;  5B7C A;  3KEB A;  4L0U A;  2DJ0 A;  2I1U A;  2F51 A;  2L5L A;  3CSH A;  1ZYE A;  4O5R A;  1TOF A;  3F6F A;  3UL3 A;  1FB6 A;  2FWH A;  3IK7 A;  2VLV A;  4EE0 A;  4MA9 A;  1YDK A;  2RM6 A;  2EIQ A;  5GZZ B;  4KDU A;  3TRX A;  2TIR A;  4XIH A;  1VGL A;  1A8Y A;  1ERV A;  3I69 A;  4O5U A;  2AAW A;  1U3A A;  2NTO A;  3CMI A;  3F63 A;  3IC8 A;  1DE2 A;  5IO2 A;  3KTB A;  2C3Q A;  5F07 A;  4PGT A;  17GS A;  3PIN A;  4L5O A;  1S3A A;  5ECH B;  5ECR B;  3U5R E;  1GUK A;  3ZIT A;  1SK0 A;  4PUF C;  1SK1 A;  3S9F A;  5G5E A;  2NPB A;  4TOP A;  2GQM A;  1PN9 A;  1ACV A;  4BL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...