3FK8A

The crystal structure of disulphide isomerase from xylella fastidiosa temecula1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
131
structure length
131
Chain Sequence
ALNLPYDEHADAWTQVKKALAAGKRTHKPTLLVFGANWCTDCRALDKSLRNQKNTALIAKHFEVVKIDVGNFDRNLELSQAYGDPIQDGIPAVVVVNSDGKVRYTTKGGELANARKMSDQGIYDFFAKITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Disulphide isomerase
publication title The crystal structure of disulphide isomerase from Xylella fastidiosa Temecula1
rcsb
source organism Xylella fastidiosa
molecule tags Isomerase
total genus 51
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3fk8A00
4HOJA 4GQFA 4PX1A 3RPPA 3VPQA 12GSA 3DKSA 3TDGA 2WULA 4JZQA 3KIJA 2RM6A 3OR5A 2LJKA 2B3SA 1J9BA 4HZ2A 3F3QA 1TK0B 2ZUPA 4V1Ag 4WBRD 3VPTA 2B7KA 1GUMA 1B9YC 3FR9A 1QUWA 1C72A 2VIMA 2WRTA 1B48A 3D22A 4ZL8A 3RHBA 2HSHA 3KMNA 3PGTA 2GSQA 2PVQA 2VCWA 1SL1B 3VWWA 3P90A 3H79A 3F6DA 2LRCA 1GLQA 3IV4A 4TOPA 3UOMA 1T3BA 2GDRA 1GSDA 4DSQA 3GSSA 5HR3A 1TRUA 3TRPA 2A2RA 1SU9A 3NZNA 3TJJA 2WB9A 4KSMA 8GSSA 3DVWA 4F2IA 2OJLA 2PPTA 1TI3A 5A4VA 4ECBA 1A24A 5D93A 4GQCA 2YNXA 3BCIA 3IE3A 3L4NA 2A2SA 3A2XA 5HFGA 1SK1A 2QC7A 2KP2A 4NMUA 3TOTA 5DCHA 1FOVA 1YEXA 3J7Yk 2AJQB 3ME8A 5CRWA 4MDCA 6GSWA 1TU8A 5ECLB 3A2VA 4ZXGA 3PINA 4WBJA 5IPGA 4MZCA 4GXZA 2H75A 4F0BA 1U88A 1TJDA 2JZTA 3ZREA 1TU7A 1YKAA 3LYPA 2FHEA 1GSYA 5EPFA 1PD21 5G2ZA 2KLXA 3KTBA 5DVBA 2O87A 1R7HA 2OACA 3LGCA 1K0DA 1BG5A 3C7MA 3TKSA 5FHIA 2C0GA 3A5WA 3ZFBA 1SYRA 3UVHA 1FVKA 2H0IA 3F4SA 1G6YA 2DLXA 4XS4B 4E8EA 3WT2A 3LSZA 3QMXA 2C0EA 4P3YB 2ON5A 5HR2A 4HS1A 4FIWA 3IOSA 5GAPD 5ECRB 4MF7A 1GSFA 3F9UA 1M7TA 1VF2A 5ELGA 4MZWA 3D4MA 2YZUA 5KN2A 2AYTA 2WS2A 4WKWA 1XIYA 3FZ4A 1LU4A 3WD6A 2DJJA 3M0FA 1N8JA 1PX7A 3VI7A 3WYWA 1HD2A 5ECSA 1USBA 2X64A 2YV7A 2IIYA 2F9SA 5ECNB 5LNKe 3EC3A 1GSQA 3E0UA 3DD3A 5ABRA 5B6NA 3CRTA 4HQSA 2I4AA 5IMDA 4OMVA 1GTAA 4IKHA 1XPVA 2MMAA 4GCIA 2XC2A 2IMKA 1QK8A 5ECHB 5CRHA 4OFMA 1E6BA 4V2MA 2FLSA 3HXSA 2N5BA 3ZITA 4NWYA 5IO2A 5A4WA 4G9HA 1G0TA 4ZBAA 4J2FA 1V9WA 2DJ3A 1THOA 4HI7A 3IAM2 4TXOB 3GL5A 4ML6A 2TRXA 2FUG2 4MJEA 2PWJA 5DQSA 5IMVA 5HR0A 3LXZA 2PGTA 4LA1A 2VM1A 1SD8A 1ON4A 1GLPA 4AF2A 3ZVJA 2L4CA 2DIYA 4TR3A 4OO4A 4ECJA 4NHZA 4IBPA 3LEFA 2L5LA 1PMTA 1HQOA 3G9BA 1T00A 4IJIA 3Q18A 4DVCA 5KEJA 4KX4A 2K18A 1OVNA 5KN1A 1JZDA 1X5EA 4N0VA 2MMNA 3CBUA 2V6KA 1A8YA 2C1YA 4EE0A 2DC5A 5J3RA 1JZRA 2B1KA 1M2BA 2KP1A 2F8AA 2K8SA 1G6WA 4L5LA 1F2EA 4MPFA 2IMEA 4JRRA 4TXVA 2K6VA 2YP6A 1Y6EA 4GWRA 5ENUA 4IW9A 2DJKA 4KB3A 4J56E 3UIWA 4H86A 4NV2A 3CTFA 3DWVA 1F9MA 1RW1A 4N10A 4O32A 5EY6A 5COHA 2CV4A 1XVWA 3UBLA 3ZIJA 3BBYA 3W6GA 1SK2A 1ST9A 1W4VA 3G7YA 4PXOA 1LBKA 1T4ZA 3IR4A 5G5FA 3C1SA 1UA5A 4DSSB 3AY8A 3WGEA 1FAAA 2DMLA 3IAS2 1FW1A 1XOBA 2GSSA 3GKNA 3VFIA 2C8UA 5JWQB 3GKXA 2VCTA 1PX6A 3W8JA 3I43A 1K0CA 4MP4A 4KDXA 2O85A 3M9JA 4TR1B 3PR8A 1EV4A 1K0OA 3ZYWA 3GTUA 5H5SA 5A5KA 19GSA 1JLWA 4GSTA 2M80A 6GSYA 3U5RE 5ECKB 2WGRA 3K8NA 2X99A 3QOUA 4IS0A 3TKQA 4K7NA 1V98A 1QQ2A 2JU5A 2AUVA 2JSYA 1GH2A 4X1UA 3M3MA 1ZL9A 4KW6A 2BTOT 1SJ6A 4ID0A 4OCFA 5CP1A 4RI6A 1YEPA 4HZ4A 4I2TA 3L0HA 1GWCA 2MZCA 3F6FA 5ECPB 3DMLA 4ZL7A 1K0BA 2GQLA 3U6VA 3I69A 4PUAA 3APSA 1O8XA 4YH2A 3H1NA 1FB0A 4TR0A 4NPBA 3V1WA 1X9SB 1OC9B 4ZL9A 2HXKA 1A2JA 1AQVA 2JADA 2GQMA 3ZZXA 1YJ6A 4LMVA 2R3XA 4QL9A 1A2MA 2P5RA 2PBJA 3IK9A 4GSSA 4IELA 5ECOB 3P8WA 4TW5A 2HZFA 3TB2A 3KP8A 2G2QA 1URMA 4OFNA 4PURA 2IL3A 3ZTLA 5F05A 1TRSA 3GH9A 1TI1A 2LJRA 3QPMA 1M0UA 3LFLA 3Q19A 1MDKA 4PUFC 2FGXA 1KTEA 2HE3A 3DIEA 5FWGA 3MSZA 4EO3A 4NHWA 4KA0A 4G2EA 1O81A 3TCOA 3GV1A 1JFUA 4KH7A 2N5AA 4BVYA 4MZBA 4YQMA 2PVOC 1G7EA 2H1GA 3KH7A 3ME7A 1H4OA 5JWRB 18GSA 4K9ZA 5D9VA 1GUKA 3VWXA 1WE0A 2XBIA 5B7CA 2KOKA 3TKSE 3BD2A 4MJAA 3KP9A 2TIRA 1QFNA 3HA9A 4F9ZA 1TKDB 4YAPA 4ISDA 1DE1A 2VCZA 1Z3EA 5EL8A 4N0ZA 3QD9A 3RBTA 5CRDA 2YWIA 3EE2A 3HVXA 2PMTA 3KEBA 5JWOB 1UVZA 3HHVA 1K0AA 2JL4A 2LNSA 2H6ZA 5DALA 2YWOA 4L0UA 3L9SA 3D21A 3FW2A 2B5XA 3F4TA 4XRAA 2DBCA 3FZAA 2QSIA 1OC8A 3L9UA 3LWAA 4LLRA 1XFLA 2HZEB 3TKSC 5J4UA 1JLVA 2YCDA 4D73A 1U87A 2H66A 2I3YA 4F82A 2CZ2A 2NBSA 1YF0A 4KDYA 1U6TA 2R5GA 4MK3A 1VRSD 5H5QA 3BJ5A 1VF4A 1A0FA 3G7JA 4CDOA 4WF5A 1G7OA 4ZBBA 4BWQA 1QMVA 3HVSA 1THXA 4GF0A 4GSNA 4MPGA 3FY7A 3ZFLA 5CRGA 2K8VA 3RAZA 4IJ3A 4DSRA 4AJ6A 2PU9C 1Q4JA 2P31A 2LKUA 3QFAC 4NAXA 1TOFA 4DEJA 4WXTA 3GN3A 2F3MA 2C80A 2AV4A 3CSHA 4IP1A 4Q5QA 1TXXA 3GIXA 2V32A 4G19A 4EDYA 5DAKA 3KD0A 2H72A 2LNTA 3EVIA 5G5EA 2HYXA 2REMA 3FRCA 3TKPA 2IFQB 2H71A 4TVEA 5B8AA 4MH3A 3TKRA 2EC4A 4FYBA 1B8XA 1OC3A 3LORA 4KCAA 1O6JA 1F3AA 4ZB8A 1Z7RA 3TJBA 17GSA 1EEMA 1PKWA 3TRXA 5JCUA 2E2GA 2H76A 3VURA 5GAND 1OE7A 2H0GA 2WJUA 4JR4A 4I97A 4PNFA 1JHBA 3L9VA 4PQHA 2J23A 4JU5A 5HFIA 3GSTA 4ZIJA 2YANA 1DE2A 1BAYA 1Z9HA 1SJZA 1ILOA 1MEKA 4BWSA 1B4PA 2P0GA 4HJ2A 5B6MA 3QAGA 4HJMA 4Q5NA 2F51A 4G10A 5DCGA 2OE0A 4OWYA 4XRDA 3UL3A 3S9FA 1SENA 4AJ7A 2NPBA 3Q6OA 2LQOA 1TP9A 4IQ1A 2K9FA 1M2DA 1SKWB 2HRFA 1QXHA 1NW2A 4L5OA 6GSUA 2C3NA 2OA7A 1KEBA 1GTBA 5DDLA 3I9V2 3KXOA 2LV3A 1GSSA 3Q74A 3TRQA 5IPHA 1JZWA 1RK4A 3GL3A 1R5PA 3A3TA 2GTUA 5CYYA 1GSEA 4RQRA 4EC0A 3WGDA 1X9WB 1GNEA 3GX0A 3F4RA 3FYGA 3EYTA 5J9BA 4XCSA 3M1GA 2E2MA 1U3IA 1WWJA 5HR1A 6GSXA 5IMFA 1GULA 2VAFA 1O8WA 1F37A 3KMOA 3P7XA 4JR6A 5IO0A 1LJRA 1IYIA 1SYXA 3SBCA 3D6IA 1W89A 3IK7A 3LYKA 1FG4A 1UC7A 2BMXA 2IMFA 3MWHA 5D8IA 2A4VA 3C73A 2VCVA 4ECIA 1B4QA 2CZ3A 3ZMLA 1T4YA 1TRWA 3BOAA 2G0FA 3QCPA 1YDKA 3N9JA 4ULXA 3GNJA 1XW5A 2IWTA 4IQAA 1WMJA 2VD0A 4XS1A 2H8LA 3CYNA 3F63A 1O7UA 5G31A 1AC1A 2HT9A 5GZZB 1XWAA 3E9JB 2V2GA 1FHEA 3KZQA 2LUSA 3KJYA 4HDEA 1ERUA 1K0NA 1TTZA 2DSAA 2OBKA 4LL4B 3TOUA 1DUGA 2HSYA 3EURA 3TGZA 4XS4A 5KN3A 11GSA 4FH8A 1X9MB 2Z9SA 2OBIA 1ERWA 2YV9A 2E7PA 2FWEA 1EGRA 4V2LA 4GRFA 3GKMA 3HJPA 5CO3A 2H74A 1XWBA 1WIKA 2H6XA 4EVMA 5INYA 1SL0B 3ZVJD 1NHYA 2YPMA 3HYPA 1WOUA 3GMFA 4KDUA 4MF6A 4NV5A 4POLA 4GTUA 5JCGA 2NTOA 2YWMA 3LQ7A 3GA4A 7GSSA 2GZZA 4MF5A 2MBSA 1HYUA 3CXGA 5C04A 4IP6A 2KUCA 4KSOA 2CX3A 5F06A 1M2AA 1U3AA 3O6TA 4WR4A 2H19A 3FZ9A 22GSA 2FCHA 3UEMA 5IOWA 4JE1A 3IA1A 4F03A 4CW9A 4XS6A 1J08A 2ZNMA 1IYHA 3EU3A 2IN3A 4MLYA 3M8NA 2V41A 4I5QA 4WR5A 4HU9A 4Z7XA 3DGQA 1R26A 9GSSA 1T7PB 16GSA 3HKRA 2CVKA 1K3YA 1EEJA 3KH9A 1WPIA 3ED3A 1TDIA 3LXTA 3FZ5A 2VLVA 3QAVA 5EVOA 1M99A 3O3TA 5GSTA 4L0WA 2C3TA 1AUCA 2IMDA 4YQVA 1ZCPA 4PGTA 2O8VB 4TXOA 4WETA 3WT1A 2B1LA 2R2JA 3HJOA 4KUNA 1M9AA 1F3BA 4KE3A 5JCWA 1M9BA 3R2QA 3UJ1A 1Y25A 1MDIA 3EINA 3W8SA 3MAKA 6GSTA 2OE3A 1ZZYA 1PA3A 2LRNA 3P2AA 2YJHA 2PUKC 2HRNA 1BJXA 3VK9A 1HNCA 1NSWA 1O85A 4POKA 2X8HA 3UVTA 3H8QA 2H1DA 2JACA 3TUEA 1A23A 2GSTA 3GX8A 1MD3A 3JCML 1K3OA 1WJKA 2D2ZA 5HQPA 3QR6A 2GZPA 4O92A 1TK8B 5IQYA 2CVDA 3IC4A 4XIHA 2V6OA 3QAWA 1XCCA 2L59A 5J41A 5D9XA 2LJAA 2YZHA 4TR4A 3H4KA 1J0FA 3EU4A 1B9XC 3MNGA 2C3QA 2RM5A 1DBYA 4KAEA 5G1LA 3ZLPA 5GSSA 5IMZA 2J9HA 2VD1A 3I6AA 2JZSA 2WZ9A 1O73A 4MMMA 4IN0A 3EMPA 2FNOA 3HJMA 1XWCA 4DSSA 1MTCA 2FWHA 2FWGA 4F0CA 3DEXA 2L6CA 1CQHA 4MJBA 4RUVA 2VUPA 5D9WA 2LS5A 5E59A 1YZXA 5C00A 3US3A 4ZBDA 2EIOA 3N5OA 5E4WA 4OFTA 5ID2A 3CMIA 2H6YA 2AB6A 2L6DA 1XOAA 1E2YA 2IJYA 2LEGA 4TR1A 5J9CA 3A2WA 3HD5A 1S3AA 4AJ8A 3ZMKA 1WP0A 2N5FA 3DRNA 4JEDA 2ZCTA 1BX9A 1YF1A 2GGTA 3NOFA 1XW6A 1X5CA 5DJMA 1GL8A 3CSJA 2H01A 4TRXA 5G30A 2VLTA 2NDOA 3D5JA 2XPEA 4HEA2 2F8FA 4K0GA 1S3CA 2TRCP 1VF3A 1ABAA 2LQQA 2CAIA 2VL9A 4BVXA 4O5RA 2MBTA 2L5OA 2H30A 4XHMA 4ZILA 4OO5A 4I6XA 3DXBA 5DJLA 10GSA 3TJGA 1SK0A 1TW9A 1EP7A 20GSA 1HNAA 2WCIA 4K7IA 3C8EA 1PKZA 2M72A 3VLNA 1Z7PA 2WFCA 2RUFA 4RI7A 1OC9A 2R37A 2B6MA 3HZ8A 3QDNA 3IPZA 2OKAA 1X0RA 1PQNA 4POMA 2H70A 4MH2A 4N30A 4I8BA 4TKYA 1XZOA 2EIQA 1VGLA 3DVXA 1ACVA 5IIZA 4KGIA 1K3LA 3IDVA 5ECQB 2XPDA 1YKCA 3RHCA 1ZGNA 5F8BA 1HNBA 2VL2C 1V40A 2H0HA 2H1BA 4K6XA 3J7Yb 1V58A 6GSSA 3QFBC 5ELAA 3E3EA 2FA8A 4KNDA 1SL2B 1GUHA 4JBBA 4IHUA 4QQ7A 1PRXA 5DBQA 3HCZA 1PL1A 1R4WA 2QGVA 1KBNA 3F0IA 3WGXA 3GHAA 3HVVA 2JZRA 1PN9A 3L78A 2O7KA 3RPNA 5AIVA 1ML6A 5FT3A 3MDKA 1PL2A 4I2UA 1Z5YE 4ECCA 4K0NA 1I9DA 1OKTA 2ON7A 1PGTA 2VL2A 2CX4A 1Q98A 5H5RA 1A0RP 2LRTA 4BL7A 1EP8A 4V2NA 4CHSA 1Z6NA 2C4JA 4PNGA 4ML1A 1FO5A 2B5YA 4HU7A 2JSZA 1EZKA 4ILFA 3UBKA 2V1MA 2CAQA 1BQ7A 2VM2A 3ISOA 3ERFA 2DJ0A 3GUSA 2M46A 1XWKA 2OADA 5F07A 2VOCA 1AQXA 2P5QA 5G1KA 5HFKA 3HZ4A 2KHPA 2DJ2A 3FEUA 1H75A 4WF4A 3VWVA 3IHQA 2X8GA 4XTSA 3APOA 2R6KA 2H73A 2HNLA 4AGSA 1TK5B 1GTIA 3BCKA 3RDWA 1WRYA 2IMIA 3TJFA 4K7OA 1BEDA 2B5EA 3GTUB 1KNGA 5AGYA 5CNWA 5L71A 2YOIA 3IBHA 5LD0A 3GURA 4FO5A 2HZEA 1F6MC 4NXIA 3ZRDA 4E8HA 3IXRA 2CA8A 1FVJA 2XBQA 2ALBA 4PQ1A 3GFKA 3D4TA 5IMAA 2C0DA 3FR6A 3KM6A 3GKKA 1XVQA 1XWGA 1I5GA 1X5DA 4TN8A 1ZMAA 2I81A 4K1FA 5J5NA 2CVBA 3G7IA 4ZB9A 2PN8A 14GSA 1QGVA 1R5AA 3D0ZA 5CAXA 2LSTA 1SKSB 2FWFA 1S3DA 2MMZA 2X8CA 13GSA 1XW9A 5IMCA 3KTLA 4YQUA 1JZOA 4QL7A 1T1VA 3F8UA 3ZL5A 1OKDA 3FR3A 2NVLA 1GP1A 3EMXA 1A8LA 5CREA 4OCEA 3DYRA 3SWLA 2VLUA 3ERWA 4V1Ap 2VO4A 2IFQA 3KCMA 2VCQA 3GRXA 2PERA 1NM3A 3LJRA 2AAWA 1NHOA 1ZOFA 5KN0A 1BYEA 1T8EB 1EOGA 3GH6A 4KCEA 4IGJA 4L8EA 3TJKA 3M9KA 2YWNA 2VCXA 2RUEA 2VL3A 2BJXA 2YJ7A 1CQGA 3F3RA 1SJIA 2CT6A 4IVFA 2GZYA 3LG6A 4EKZA 3FK8A 4HUAA 1OE8A 3O76A 2RIIA 5D73A 2L57A 1SKRB 2DJ1A 3IRAA 2GLRA 1XXUA 1K0MA 6GSVA 2IPAA 2I9HA 2LTKA 2RLIA 5AISA 3APQA 1N2AA 2EIRA 1AW9A 2FY6A 2AHEA 1A2LA 4X43A 5AIXA 1GSUA 1V2AA 4FYUA 2O89A 5ID2B 2HLSA 5LCZA 1MDJA 2E0QA 4X0XA 4K8MA 1ZYEA 4OD7A 5D96A 3CRUA 2ES7A 1ZYQB 2H1AA 1EV9A 4EDZA 1GRXA 1Z6MA 2GS3A 3VI5A 3UAPA 2GT5A 5D9TA 2R4VA 3ZIVA 3VWUA 2C0FA 4FYCA 1FB6A 1XBSA 4LL1B 1ERTA 4Q5FA 2GVPA 5F0GA 4YAVA 4N11A 3KGKA 2FA4A 2MYGA 2DMMA 4O7HA 3CSIA 5B8BA 1AAZA 2MMOA 4BA7A 4LMWA 1SD9A 2QKEA 3ERGA 1ERVA 5DALB 1MD4A 4POBA 4ACSA 2HFDA 4GLTA 1OAZA 1DSBA 2GQKA 5ECMB 3HDCA 3UARA 4MCUA 1TRVA 4J57E 4D73B 1EWXA 1YY7A 1AQWA 1AIUA 2YN1A 4EXJA 4PQIA 1EOHA 4ZB6A 3UMAA 2B7JA 3GYKA 1GTUA 1RQMA 1YQ1A 3FKFA 5A4UA 2XHFA 3EWLA 4MJCA 4MA9A 5IM9A 1UN2A 4RQXA 2WDUA 2HI7A 5IOXA 1AXDA 5AN1A 4Q5RA 4EUYA 1OYJA 2L4QA 3C1RA 5DAKB 2OE1A 2FD3A 2GT6A 1VF1A 4MABA 3NIVA 1EGOA 4WEYA 1GNWA 4K2DA 5ECIB 2I1UA 1V57A 5DQYA 3H93A 3HY2A 3C71A 4EF0A 4HQZA 3PH9A 2CQ9A 2GSRA 2DIZA 1PSQA 4EL1A 3FHKA 4BPYA 3CTGA
chains in the Genus database with same CATH superfamily
4HOJA 4GQFA 4PX1A 3RPPA 3VPQA 12GSA 3DKSA 3TDGA 2WULA 4JZQA 3KIJA 2RM6A 3OR5A 2LJKA 2B3SA 1J9BA 4HZ2A 3F3QA 1TK0B 2ZUPA 4V1Ag 4WBRD 4BL7B 3VPTA 2B7KA 1GUMA 1B9YC 3FR9A 1QUWA 1C72A 2VIMA 2WRTA 1B48A 3D22A 4ZL8A 3RHBA 2HSHA 3KMNA 3PGTA 2GSQA 2PVQA 2VCWA 1SL1B 3VWWA 3P90A 3H79A 3F6DA 2LRCA 1GLQA 3IV4A 4TOPA 3UOMA 1T3BA 2GDRA 1GSDA 4DSQA 3GSSA 5HR3A 1TRUA 3TRPA 2A2RA 1FOHA 1SU9A 3NZNA 3TJJA 2WB9A 4KSMA 8GSSA 3DVWA 4F2IA 2OJLA 2PPTA 1TI3A 5A4VA 4ECBA 1A24A 5D93A 4GQCA 2YNXA 3BCIA 3IE3A 3L4NA 2A2SA 3A2XA 5HFGA 1SK1A 2QC7A 2KP2A 4NMUA 3TOTA 5DCHA 1FOVA 1YEXA 3J7Yk 2AJQB 3ME8A 5CRWA 4MDCA 6GSWA 1TU8A 5ECLB 3A2VA 4ZXGA 3PINA 4WBJA 5IPGA 4MZCA 4GXZA 2H75A 4F0BA 1U88A 1TJDA 2JZTA 3ZREA 1TU7A 1YKAA 3LYPA 2FHEA 1GSYA 5EPFA 1PD21 5G2ZA 2KLXA 3KTBA 5DVBA 2O87A 1R7HA 2OACA 3LGCA 1K0DA 1BG5A 3C7MA 3TKSA 5FHIA 2C0GA 3A5WA 3ZFBA 1SYRA 3UVHA 1FVKA 2H0IA 3F4SA 1G6YA 2DLXA 4XS4B 4E8EA 2QA2A 3WT2A 3LSZA 3QMXA 2C0EA 4P3YB 2ON5A 2UZ8A 5HR2A 4HS1A 4FIWA 3IOSA 4O5QA 5GAPD 5ECRB 4MF7A 1GSFA 3F9UA 1M7TA 1VF2A 5ELGA 4MZWA 3D4MA 2YZUA 5KN2A 2AYTA 2WS2A 4K2XA 1XIYA 4WKWA 3FZ4A 1LU4A 3WD6A 2DJJA 3M0FA 1N8JA 1PX7A 3VI7A 3WYWA 4USSA 1HD2A 5ECSA 1USBA 2X64A 2YV7A 2IIYA 2F9SA 5ECNB 5LNKe 3EC3A 1GSQA 3E0UA 3DD3A 5ABRA 5B6NA 3CRTA 4HQSA 2I4AA 5IMDA 4OMVA 1GTAA 4IKHA 1XPVA 2MMAA 4GCIA 2XC2A 2IMKA 4KF9A 1QK8A 5ECHB 5CRHA 4OFMA 1E6BA 4V2MA 2FLSA 3HXSA 2N5BA 3ZITA 4NWYA 5IO2A 5A4WA 4G9HA 1G0TA 4ZBAA 5KOXA 4J2FA 1V9WA 2DJ3A 1THOA 4HI7A 3IAM2 4TXOB 3GL5A 4ML6A 2TRXA 2FUG2 4MJEA 2PWJA 5DQSA 5IMVA 5HR0A 3LXZA 2PGTA 4LA1A 2VM1A 1SD8A 1ON4A 1GLPA 4AF2A 3ZVJA 2L4CA 2DIYA 4TR3A 4OO4A 4ECJA 1PN0A 4NHZA 1ZYNA 4IBPA 3LEFA 2L5LA 1PMTA 1HQOA 3G9BA 1XG8A 1T00A 4IJIA 3Q18A 4DVCA 5KEJA 4KX4A 2K18A 1OVNA 5KN1A 1JZDA 1X5EA 4N0VA 2MMNA 3CBUA 2V6KA 1A8YA 2C1YA 4EE0A 2DC5A 5J3RA 1JZRA 2B1KA 1M2BA 2KP1A 2F8AA 2K8SA 1G6WA 4L5LA 1F2EA 4MPFA 2IMEA 4JRRA 4TXVA 2K6VA 2YP6A 1Y6EA 4GWRA 5ENUA 4IW9A 2DJKA 4KB3A 4J56E 2R0PA 3UIWA 4H86A 4NV2A 3CTFA 3DWVA 1F9MA 1RW1A 4N10A 4O32A 5COHA 5EY6A 2CV4A 1XVWA 3UBLA 3ZIJA 3BBYA 3W6GA 1SK2A 1ST9A 3CQFA 1W4VA 3G7YA 4PXOA 1LBKA 1T4ZA 3IR4A 5G5FA 3C1SA 1UA5A 4DSSB 3AY8A 3WGEA 1FAAA 2DMLA 3IAS2 1FW1A 1XOBA 2GSSA 3GKNA 3VFIA 2C8UA 5JWQB 3GKXA 2VCTA 1PX6A 3W8JA 3I43A 1K0CA 4MP4A 4KDXA 2O85A 3M9JA 4TR1B 3PR8A 1EV4A 1K0OA 3ZYWA 3GTUA 5H5SA 5A5KA 19GSA 1JLWA 4GSTA 2M80A 6GSYA 3U5RE 5ECKB 2WGRA 3K8NA 2X99A 3QOUA 4IS0A 3TKQA 4K7NA 1V98A 1QQ2A 2JU5A 2AUVA 2JSYA 1GH2A 4X1UA 2X4AA 3M3MA 1ZL9A 4KW6A 2BTOT 1SJ6A 4ID0A 4OCFA 5CP1A 4RI6A 1YEPA 4HZ4A 4I2TA 3L0HA 1GWCA 2MZCA 3F6FA 5ECPB 3DMLA 4A5PA 4ZL7A 1K0BA 2GQLA 3U6VA 3I69A 4PUAA 3APSA 1O8XA 4YH2A 3H1NA 1FB0A 4TR0A 2HRKA 4NPBA 3V1WA 1X9SB 1OC9B 4ZL9A 2HXKA 1A2JA 1AQVA 2JADA 2GQMA 3ZZXA 1YJ6A 2A2PA 4LMVA 2R3XA 4QL9A 1A2MA 2P5RA 2PBJA 3IK9A 4GSSA 4IELA 5ECOB 4PTSA 3P8WA 4TW5A 2HZFA 3TB2A 3KP8A 4CY6A 2G2QA 1URMA 4OFNA 4PURA 2IL3A 3ZTLA 5F05A 1TRSA 3GH9A 1TI1A 2LJRA 3QPMA 1M0UA 3LFLA 3Q19A 1MDKA 4PUFC 2FGXA 1KTEA 2HE3A 3DIEA 5FWGA 3MSZA 4EO3A 2HSMA 4NHWA 4KA0A 4G2EA 1O81A 3TCOA 3GV1A 1JFUA 4KH7A 2N5AA 4BVYA 4MZBA 4YQMA 2PVOC 1G7EA 2H1GA 3KH7A 3MIXA 3ME7A 1H4OA 5JWRB 18GSA 4K9ZA 3R3EA 5D9VA 1GUKA 3VWXA 1WE0A 2XBIA 5B7CA 2KOKA 3TKSE 4O5UA 3BD2A 4MJAA 3KP9A 2TIRA 1QFNA 3HA9A 4F9ZA 1TKDB 4YAPA 4ISDA 1DE1A 2VCZA 1Z3EA 5EL8A 4N0ZA 3QD9A 3RBTA 5CRDA 2YWIA 3EE2A 3HVXA 2PMTA 3KEBA 5JWOB 1UVZA 3HHVA 1K0AA 2JL4A 2LNSA 4EIQA 2H6ZA 3A5IA 5DALA 2YWOA 4L0UA 3L9SA 3D21A 3FW2A 2B5XA 3F4TA 4XRAA 2DBCA 3FZAA 2QSIA 1OC8A 3L9UA 3LWAA 4LLRA 1XFLA 2HZEB 3TKSC 5J4UA 1JLVA 2YCDA 4D73A 1U87A 2H66A 2I3YA 4F82A 2CZ2A 2NBSA 1YF0A 4KDYA 1U6TA 2R5GA 4MK3A 1VRSD 5H5QA 3BJ5A 1VF4A 1A0FA 3G7JA 4CDOA 4WF5A 1G7OA 4ZBBA 4BWQA 1QMVA 3HVSA 4K5SA 1THXA 4GF0A 4GSNA 4MPGA 3FY7A 3ZFLA 5CRGA 2K8VA 3RAZA 4IJ3A 4DSRA 4AJ6A 2PU9C 1Q4JA 2P31A 2LKUA 3QFAC 4NAXA 1TOFA 4DEJA 4WXTA 3GN3A 2F3MA 2C80A 2AV4A 3CSHA 4IP1A 4Q5QA 4FQUA 1TXXA 3GIXA 2V32A 4G19A 4EDYA 5DAKA 3KD0A 2H72A 2LNTA 3EVIA 5G5EA 2HYXA 2REMA 3FRCA 3TKPA 2IFQB 2H71A 4TVEA 5B8AA 4MH3A 3TKRA 2EC4A 4FYBA 1B8XA 1OC3A 3LORA 4KCAA 1O6JA 1F3AA 4ZB8A 1Z7RA 3TJBA 17GSA 1EEMA 1PKWA 3TRXA 5JCUA 2E2GA 2H76A 3VURA 5GAND 1OE7A 2H0GA 2WJUA 4JR4A 4I97A 4PNFA 1JHBA 3L9VA 4PQHA 2J23A 4JU5A 5HFIA 3GSTA 4ZIJA 2YANA 1DE2A 1BAYA 1Z9HA 1SJZA 1ILOA 1MEKA 4BWSA 4MNNA 1B4PA 2P0GA 4HJ2A 5B6MA 3QAGA 4HJMA 4Q5NA 2F51A 4G10A 5DCGA 2OE0A 4OWYA 4XRDA 3UL3A 3S9FA 1SENA 4AJ7A 2NPBA 3Q6OA 2LQOA 1M3JA 1TP9A 4IQ1A 2K9FA 1M2DA 1SKWB 2HRFA 1QXHA 1NW2A 4L5OA 6GSUA 2C3NA 2OA7A 1KEBA 1GTBA 5DDLA 3I9V2 3KXOA 3HVNA 2LV3A 1GSSA 3Q74A 3TRQA 5IPHA 1JZWA 1RK4A 3GL3A 1R5PA 3A3TA 2GTUA 5CYYA 1GSEA 4RQRA 4EC0A 3WGDA 1X9WB 1GNEA 3GX0A 3F4RA 3FYGA 3EYTA 5J9BA 4XCSA 3M1GA 2E2MA 1U3IA 1WWJA 5HR1A 6GSXA 5IMFA 1GULA 2VAFA 1O8WA 1F37A 3KMOA 3P7XA 4JR6A 5IO0A 1LJRA 1IYIA 1SYXA 3SBCA 3D6IA 1W89A 3IK7A 3LYKA 1FG4A 1UC7A 2BMXA 2IMFA 3MWHA 5D8IA 2A4VA 2X49A 3C73A 2VCVA 4ECIA 1B4QA 2CZ3A 3ZMLA 1T4YA 1TRWA 3BOAA 2G0FA 3QCPA 1YDKA 3N9JA 4ULXA 3GNJA 1XW5A 1S3RA 2IWTA 4IQAA 1WMJA 2VD0A 4XS1A 2H8LA 3CYNA 3F63A 1O7UA 5G31A 1AC1A 2HT9A 5GZZB 1XWAA 3E9JB 2V2GA 1FHEA 3KZQA 2LUSA 3KJYA 4HDEA 1ERUA 1K0NA 1TTZA 2DSAA 2OBKA 4LL4B 3TOUA 1DUGA 2HSYA 3EURA 3FMWA 3TGZA 4XS4A 5KN3A 11GSA 4FH8A 1X9MB 2Z9SA 2OBIA 1ERWA 2YV9A 2E7PA 2FWEA 1EGRA 4V2LA 4GRFA 3GKMA 3HJPA 5CO3A 2H74A 1XWBA 1WIKA 2H6XA 4EVMA 5INYA 1M3IA 1SL0B 3ZVJD 1NHYA 2YPMA 3HYPA 1WOUA 3GMFA 4KDUA 4MF6A 4NV5A 4POLA 4GTUA 5JCGA 2NTOA 2YWMA 3LQ7A 3GA4A 7GSSA 2GZZA 4MF5A 2MBSA 1HYUA 3CXGA 5C04A 4IP6A 2KUCA 4KSOA 2CX3A 5F06A 1M2AA 1U3AA 3O6TA 4WR4A 2H19A 3FZ9A 22GSA 2FCHA 3UEMA 1PFOA 5IOWA 4JE1A 3IA1A 4F03A 4CW9A 4XS6A 1J08A 2ZNMA 1IYHA 3EU3A 2IN3A 4MLYA 3M8NA 2V41A 4I5QA 4WR5A 4HU9A 4Z7XA 3DGQA 1R26A 9GSSA 1T7PB 16GSA 3HKRA 2CVKA 1K3YA 1EEJA 3KH9A 1WPIA 3ED3A 1TDIA 3LXTA 3FZ5A 2VLVA 3QAVA 5EVOA 1M99A 3O3TA 5GSTA 4L0WA 2C3TA 1AUCA 2IMDA 4YQVA 1ZCPA 4PGTA 2O8VB 4TXOA 4WETA 4X4JA 3WT1A 2B1LA 2R2JA 3HJOA 4KUNA 1M9AA 1F3BA 4KE3A 5JCWA 3PPUA 1M9BA 4YKFA 3R2QA 3UJ1A 1Y25A 1MDIA 3EINA 3W8SA 3MAKA 6GSTA 2OE3A 1ZZYA 1PA3A 2LRNA 3P2AA 2YJHA 2PUKC 2HRNA 1BJXA 3VK9A 1HNCA 1NSWA 1O85A 4POKA 2X8HA 3UVTA 3H8QA 2H1DA 2JACA 3TUEA 1A23A 2GSTA 3GX8A 1MD3A 4Z2UA 3JCML 1K3OA 1WJKA 2D2ZA 5HQPA 3QR6A 2GZPA 4O92A 1TK8B 5IQYA 2CVDA 3IC4A 4XIHA 2V6OA 3QAWA 1XCCA 2L59A 5J41A 5D9XA 2LJAA 2YZHA 4TR4A 3H4KA 1J0FA 3EU4A 1B9XC 4HSCX 3MNGA 2C3QA 2RM5A 1DBYA 4KAEA 5G1LA 3ZLPA 5GSSA 5IMZA 2J9HA 2VD1A 3I6AA 2JZSA 2WZ9A 1O73A 4MMMA 4IN0A 3EMPA 2FNOA 3HJMA 1XWCA 4DSSA 1MTCA 2FWHA 2FWGA 4F0CA 3DEXA 2L6CA 1CQHA 4MJBA 4RUVA 2VUPA 5D9WA 2LS5A 5E59A 4BIKA 1YZXA 5C00A 3US3A 4ZBDA 2EIOA 3N5OA 5E4WA 4OFTA 5ID2A 3CMIA 2H6YA 2AB6A 2L6DA 1XOAA 1E2YA 2IJYA 2LEGA 4TR1A 5J9CA 3A2WA 3HD5A 1S3AA 4AJ8A 3ZMKA 1WP0A 2N5FA 3DRNA 4JEDA 4Z2RA 2ZCTA 1BX9A 1YF1A 2GGTA 3NOFA 1XW6A 1X5CA 5DJMA 1GL8A 3CSJA 2H01A 4TRXA 5G30A 2VLTA 2NDOA 3D5JA 2XPEA 4HEA2 2F8FA 4K0GA 1S3CA 2TRCP 1VF3A 1ABAA 2LQQA 2CAIA 5BRTA 2VL9A 4BVXA 4O5RA 2MBTA 2L5OA 2H30A 4XHMA 4ZILA 4OO5A 4I6XA 3DXBA 5DJLA 10GSA 3TJGA 1SK0A 1TW9A 1EP7A 20GSA 2DKHA 1HNAA 2WCIA 4K7IA 3C8EA 1PKZA 2M72A 3VLNA 1Z7PA 2WFCA 2RUFA 4RI7A 1OC9A 2R37A 2B6MA 3HZ8A 3IC8A 3QDNA 3IPZA 2OKAA 1X0RA 1PQNA 4POMA 2H70A 4MH2A 4N30A 4I8BA 4TKYA 1XZOA 2EIQA 1VGLA 3DVXA 1ACVA 5IIZA 4KGIA 1K3LA 3IDVA 5ECQB 2XPDA 1YKCA 3RHCA 1ZGNA 5F8BA 1HNBA 2VL2C 1V40A 2H0HA 2H1BA 4K6XA 3J7Yb 1V58A 6GSSA 3QFBC 5ELAA 3E3EA 2FA8A 4KNDA 1SL2B 1GUHA 4JBBA 4IHUA 4QQ7A 1PRXA 5DBQA 3HCZA 1PL1A 1R4WA 2QGVA 1KBNA 3F0IA 3WGXA 3GHAA 3HVVA 2JZRA 1PN9A 3L78A 2O7KA 3RPNA 5AIVA 1ZYPA 1ML6A 5FT3A 3MDKA 1PL2A 4I2UA 1Z5YE 4ECCA 4K0NA 1I9DA 1OKTA 2ON7A 1PGTA 2VL2A 2CX4A 1Q98A 5H5RA 1A0RP 2LRTA 4BL7A 1EP8A 4V2NA 4CHSA 3IHGA 1Z6NA 2C4JA 4PNGA 4ML1A 1FO5A 2B5YA 4HU7A 2JSZA 1EZKA 4ILFA 3UBKA 2V1MA 2CAQA 1BQ7A 2VM2A 3ISOA 3ERFA 2DJ0A 3EPTA 3GUSA 2M46A 1XWKA 2OADA 5F07A 2VOCA 1AQXA 2P5QA 5G1KA 5HFKA 3HZ4A 2KHPA 2DJ2A 3FEUA 1H75A 4WF4A 3VWVA 3IHQA 2X8GA 4XTSA 3APOA 2R6KA 2H73A 2HNLA 4AGSA 1TK5B 1GTIA 3BCKA 3RDWA 1WRYA 2IMIA 3TJFA 4K7OA 1BEDA 2B5EA 3GTUB 1KNGA 5AGYA 5CNWA 5L71A 2YOIA 3IBHA 5LD0A 3GURA 4FO5A 2HZEA 1F6MC 4NXIA 3ZRDA 4E8HA 3IXRA 2CA8A 1FVJA 2XBQA 2ALBA 4PQ1A 3GFKA 3D4TA 5IMAA 2C0DA 3FR6A 3KM6A 3GKKA 1XVQA 1XWGA 1I5GA 1X5DA 4TN8A 1ZMAA 2I81A 4K1FA 5J5NA 2CVBA 2DKIA 3G7IA 4ZB9A 2PN8A 14GSA 1QGVA 1R5AA 3D0ZA 5CAXA 2LSTA 1SKSB 2FWFA 1S3DA 2MMZA 2X8CA 13GSA 1XW9A 5IMCA 3KTLA 4YQUA 1JZOA 4QL7A 1T1VA 3F8UA 3ZL5A 1OKDA 3FR3A 2NVLA 1GP1A 3EMXA 1A8LA 5CREA 4OCEA 3DYRA 3SWLA 2VLUA 3ERWA 4V1Ap 2VO4A 2IFQA 3KCMA 2VCQA 3GRXA 4ICYA 2PERA 1NM3A 3LJRA 2AAWA 1NHOA 1ZOFA 5KN0A 1BYEA 1T8EB 4EIPA 3MYDA 1EOGA 3GH6A 4KCEA 4IGJA 4L8EA 3TJKA 3M9KA 2YWNA 2VCXA 2RUEA 2VL3A 2BJXA 2YJ7A 1CQGA 3F3RA 1SJIA 2CT6A 4IVFA 2GZYA 3LG6A 4EKZA 3FK8A 4HUAA 1OE8A 3O76A 2RIIA 5D73A 2L57A 2QA1A 1SKRB 2DJ1A 4G0KA 3IRAA 2GLRA 1XXUA 1K0MA 6GSVA 2IPAA 2I9HA 2LTKA 2RLIA 4BVYB 5AISA 3APQA 1N2AA 2EIRA 1AW9A 2FY6A 2AHEA 1A2LA 4X43A 5AIXA 1GSUA 5BMUA 1V2AA 4FYUA 2O89A 5ID2B 2HLSA 5LCZA 1MDJA 2E0QA 4X0XA 4K8MA 4CY8A 1ZYEA 4OD7A 5D96A 3CRUA 2ES7A 1ZYQB 2H1AA 1EV9A 4EDZA 2R0GA 1GRXA 1Z6MA 2GS3A 3VI5A 3UAPA 2GT5A 5D9TA 2R4VA 3ZIVA 3VWUA 2C0FA 4FYCA 1FB6A 1XBSA 4LL1B 1ERTA 4Q5FA 2GVPA 5F0GA 4YAVA 4N11A 3KGKA 2FA4A 2MYGA 2DMMA 4O7HA 3CSIA 5B8BA 1AAZA 2MMOA 4Z2TA 4BA7A 4LMWA 1SD9A 2QKEA 3ERGA 1ERVA 5DALB 1MD4A 4POBA 4ACSA 2HFDA 4GLTA 1OAZA 4BVXB 1DSBA 2GQKA 5ECMB 5KOWA 3HDCA 3UARA 4MCUA 1TRVA 4J57E 4D73B 1EWXA 1YY7A 2R0CA 1AQWA 4K5RA 1AIUA 2YN1A 4EXJA 4PQIA 1EOHA 4ZB6A 3UMAA 2B7JA 3GYKA 1GTUA 2HRAA 1RQMA 1YQ1A 3FKFA 5A4UA 2XHFA 3EWLA 4MJCA 4MA9A 5IM9A 1UN2A 3LW9A 4RQXA 2WDUA 2HI7A 5IOXA 1AXDA 5AN1A 4Q5RA 4EUYA 1OYJA 2L4QA 4G0IA 3C1RA 5DAKB 2OE1A 2FD3A 2GT6A 1VF1A 4MABA 3NIVA 1EGOA 4WEYA 1GNWA 4K2DA 5ECIB 4G0LA 2I1UA 4YKGA 1V57A 5DQYA 3H93A 3HY2A 3C71A 4EF0A 4HQZA 2A4HA 3PH9A 2CQ9A 2GSRA 2DIZA 1PSQA 4EL1A 3FHKA 4BPYA 3CTGA
chains in the Genus database with same CATH topology
4HOJA 4GQFA 4PX1A 3RPPA 3VPQA 12GSA 3DKSA 3TDGA 2WULA 4JZQA 3KIJA 2RM6A 3OR5A 2LJKA 2B3SA 1J9BA 4HZ2A 3F3QA 1TK0B 2ZUPA 4V1Ag 4WBRD 4BL7B 3VPTA 2B7KA 1GUMA 1B9YC 3FR9A 1QUWA 1C72A 2VIMA 2WRTA 1B48A 3D22A 4ZL8A 3RHBA 2HSHA 3KMNA 3PGTA 2GSQA 2PVQA 2VCWA 1SL1B 3VWWA 3P90A 3H79A 3F6DA 2LRCA 1GLQA 3IV4A 4TOPA 3UOMA 1T3BA 2GDRA 1GSDA 4DSQA 3GSSA 5HR3A 1TRUA 3TRPA 2A2RA 1FOHA 1SU9A 3NZNA 3TJJA 2WB9A 4KSMA 8GSSA 3DVWA 4F2IA 2OJLA 2PPTA 1TI3A 5A4VA 4ECBA 1A24A 5D93A 4GQCA 2YNXA 3BCIA 3IE3A 3L4NA 2A2SA 3A2XA 5HFGA 1SK1A 2QC7A 2KP2A 4NMUA 3TOTA 5DCHA 1FOVA 1YEXA 3J7Yk 2AJQB 3ME8A 5CRWA 4MDCA 6GSWA 1TU8A 5ECLB 3A2VA 4ZXGA 3PINA 4WBJA 5IPGA 4MZCA 4GXZA 2H75A 4F0BA 1U88A 1TJDA 2JZTA 3ZREA 1TU7A 1YKAA 3LYPA 2FHEA 1GSYA 5EPFA 1PD21 5G2ZA 2KLXA 3KTBA 5DVBA 2O87A 1R7HA 2OACA 3LGCA 1K0DA 1BG5A 3C7MA 3TKSA 5FHIA 2C0GA 3A5WA 3ZFBA 1SYRA 3UVHA 1FVKA 2H0IA 3F4SA 1G6YA 2DLXA 4XS4B 4E8EA 2QA2A 3WT2A 3LSZA 3QMXA 2C0EA 4P3YB 2ON5A 2UZ8A 5HR2A 4HS1A 4FIWA 3IOSA 4O5QA 5GAPD 5ECRB 4MF7A 1GSFA 3F9UA 1M7TA 1VF2A 5ELGA 4MZWA 3D4MA 2YZUA 5KN2A 2AYTA 2WS2A 4K2XA 1XIYA 4WKWA 3FZ4A 1LU4A 3WD6A 2DJJA 3M0FA 1N8JA 1PX7A 3VI7A 3WYWA 4USSA 1HD2A 5ECSA 1USBA 2X64A 2YV7A 2IIYA 2F9SA 5ECNB 5LNKe 3EC3A 1GSQA 3E0UA 3DD3A 5ABRA 5B6NA 3CRTA 4HQSA 2I4AA 5IMDA 4OMVA 1GTAA 4IKHA 1XPVA 2MMAA 4GCIA 2XC2A 2IMKA 4KF9A 1QK8A 5ECHB 5CRHA 4OFMA 1E6BA 4V2MA 2FLSA 3HXSA 2N5BA 3ZITA 4NWYA 5IO2A 5A4WA 4G9HA 1G0TA 4ZBAA 5KOXA 4J2FA 1V9WA 2DJ3A 1THOA 4HI7A 3IAM2 4TXOB 3GL5A 4ML6A 2TRXA 2FUG2 4MJEA 2PWJA 5DQSA 5IMVA 5HR0A 3LXZA 2PGTA 4LA1A 2VM1A 1SD8A 1ON4A 1GLPA 4AF2A 3ZVJA 2L4CA 2DIYA 4TR3A 4OO4A 4ECJA 1PN0A 4NHZA 1ZYNA 4IBPA 3LEFA 2L5LA 1PMTA 1HQOA 3G9BA 1T00A 4IJIA 3Q18A 4DVCA 5KEJA 4KX4A 2K18A 1OVNA 5KN1A 1JZDA 1X5EA 4N0VA 2MMNA 3CBUA 2V6KA 1A8YA 2C1YA 4EE0A 2DC5A 5J3RA 1JZRA 2B1KA 1M2BA 2KP1A 2F8AA 2K8SA 1G6WA 4L5LA 1F2EA 4MPFA 2IMEA 4JRRA 4TXVA 2K6VA 2YP6A 1Y6EA 4GWRA 5ENUA 4IW9A 2DJKA 4KB3A 4J56E 2R0PA 3UIWA 4H86A 4NV2A 3CTFA 3DWVA 1F9MA 1RW1A 4N10A 4O32A 5COHA 5EY6A 2CV4A 1XVWA 3UBLA 3ZIJA 3BBYA 3W6GA 1SK2A 1ST9A 1W4VA 3G7YA 4PXOA 1LBKA 1T4ZA 3IR4A 5G5FA 3C1SA 1UA5A 4DSSB 3AY8A 3WGEA 1FAAA 2DMLA 3IAS2 1FW1A 1XOBA 2GSSA 3GKNA 3VFIA 2C8UA 5JWQB 3GKXA 2VCTA 1PX6A 3W8JA 3I43A 1K0CA 4MP4A 4KDXA 2O85A 3M9JA 4TR1B 3PR8A 1EV4A 1K0OA 3ZYWA 3GTUA 5H5SA 5A5KA 19GSA 1JLWA 4GSTA 2M80A 6GSYA 3U5RE 5ECKB 2WGRA 3K8NA 2X99A 3QOUA 4IS0A 3TKQA 4K7NA 1V98A 1QQ2A 2JU5A 2AUVA 2JSYA 1GH2A 4X1UA 2X4AA 3M3MA 1ZL9A 4KW6A 2BTOT 1SJ6A 4ID0A 4OCFA 5CP1A 4RI6A 1YEPA 4HZ4A 4I2TA 3L0HA 1GWCA 2MZCA 3F6FA 5ECPB 3DMLA 4A5PA 4ZL7A 1K0BA 2GQLA 3U6VA 3I69A 4PUAA 3APSA 1O8XA 4YH2A 3H1NA 1FB0A 4TR0A 2HRKA 4NPBA 3V1WA 1X9SB 1OC9B 4ZL9A 2HXKA 1A2JA 1AQVA 2JADA 2GQMA 3ZZXA 1YJ6A 2A2PA 4LMVA 2R3XA 4QL9A 1A2MA 2P5RA 2PBJA 3IK9A 4GSSA 4IELA 5ECOB 4PTSA 3P8WA 4TW5A 2HZFA 3TB2A 3KP8A 4CY6A 2G2QA 1URMA 4OFNA 4PURA 2IL3A 3ZTLA 5F05A 1TRSA 3GH9A 1TI1A 2LJRA 3QPMA 1M0UA 3LFLA 3Q19A 1MDKA 4PUFC 2FGXA 1KTEA 2HE3A 3DIEA 5FWGA 3MSZA 4EO3A 2HSMA 4NHWA 4KA0A 4G2EA 1O81A 3TCOA 3GV1A 1JFUA 4KH7A 2N5AA 4BVYA 4MZBA 4YQMA 2PVOC 1G7EA 2H1GA 3KH7A 3MIXA 3ME7A 1H4OA 5JWRB 18GSA 4K9ZA 3R3EA 5D9VA 1GUKA 3VWXA 1WE0A 2XBIA 5B7CA 2KOKA 3TKSE 4O5UA 3BD2A 4MJAA 3KP9A 2TIRA 1QFNA 3HA9A 4F9ZA 1TKDB 4YAPA 4ISDA 1DE1A 2VCZA 1Z3EA 5EL8A 4N0ZA 3QD9A 3RBTA 5CRDA 2YWIA 3EE2A 3HVXA 2PMTA 3KEBA 5JWOB 1UVZA 3HHVA 1K0AA 2JL4A 2LNSA 4EIQA 2H6ZA 3A5IA 5DALA 2YWOA 4L0UA 3L9SA 3D21A 3FW2A 2B5XA 3F4TA 4XRAA 2DBCA 3FZAA 2QSIA 1OC8A 3L9UA 3LWAA 4LLRA 1XFLA 2HZEB 3TKSC 5J4UA 1JLVA 2YCDA 4D73A 1U87A 2H66A 2I3YA 4F82A 2CZ2A 2NBSA 1YF0A 4KDYA 1U6TA 2R5GA 4MK3A 1VRSD 5H5QA 3BJ5A 1VF4A 1A0FA 3G7JA 4CDOA 4WF5A 1G7OA 4ZBBA 4BWQA 1QMVA 3HVSA 4K5SA 1THXA 4GF0A 4GSNA 4MPGA 3FY7A 3ZFLA 5CRGA 2K8VA 3RAZA 4IJ3A 4DSRA 4AJ6A 2PU9C 1Q4JA 2P31A 2LKUA 3QFAC 4NAXA 1TOFA 4DEJA 4WXTA 3GN3A 2F3MA 2C80A 2AV4A 3CSHA 4IP1A 4Q5QA 4FQUA 1TXXA 3GIXA 2V32A 4G19A 4EDYA 5DAKA 3KD0A 2H72A 2LNTA 3EVIA 5G5EA 2HYXA 2REMA 3FRCA 3TKPA 2IFQB 2H71A 4TVEA 5B8AA 4MH3A 3TKRA 2EC4A 4FYBA 1B8XA 1OC3A 3LORA 4KCAA 1O6JA 1F3AA 4ZB8A 1Z7RA 3TJBA 17GSA 1EEMA 1PKWA 3TRXA 5JCUA 2E2GA 2H76A 3VURA 5GAND 1OE7A 2H0GA 2WJUA 4JR4A 4I97A 4PNFA 1JHBA 3L9VA 4PQHA 2J23A 4JU5A 5HFIA 3GSTA 4ZIJA 2YANA 1DE2A 1BAYA 1Z9HA 1SJZA 1ILOA 1MEKA 4BWSA 4MNNA 1B4PA 2P0GA 4HJ2A 5B6MA 3QAGA 4HJMA 4Q5NA 2F51A 4G10A 5DCGA 2OE0A 4OWYA 4XRDA 3UL3A 3S9FA 1SENA 4AJ7A 2NPBA 3Q6OA 2LQOA 1TP9A 4IQ1A 2K9FA 1M2DA 1SKWB 2HRFA 1QXHA 1NW2A 4L5OA 6GSUA 2C3NA 2OA7A 1KEBA 1GTBA 5DDLA 3I9V2 3KXOA 2LV3A 1GSSA 3Q74A 3TRQA 5IPHA 1JZWA 1RK4A 3GL3A 1R5PA 3A3TA 2GTUA 5CYYA 1GSEA 4RQRA 4EC0A 3WGDA 1X9WB 1GNEA 3GX0A 3F4RA 3FYGA 3EYTA 5J9BA 4XCSA 3M1GA 2E2MA 1U3IA 1WWJA 5HR1A 6GSXA 5IMFA 1GULA 2VAFA 1O8WA 1F37A 3KMOA 3P7XA 4JR6A 5IO0A 1LJRA 1IYIA 1SYXA 3SBCA 3D6IA 1W89A 3IK7A 3LYKA 1FG4A 1UC7A 2BMXA 2IMFA 3MWHA 5D8IA 2A4VA 2X49A 3C73A 2VCVA 4ECIA 1B4QA 2CZ3A 3ZMLA 1T4YA 1TRWA 3BOAA 2G0FA 3QCPA 1YDKA 3N9JA 4ULXA 3GNJA 1XW5A 2IWTA 4IQAA 1WMJA 2VD0A 4XS1A 2H8LA 3CYNA 3F63A 1O7UA 5G31A 1AC1A 2HT9A 5GZZB 1XWAA 3E9JB 2V2GA 1FHEA 3KZQA 2LUSA 3KJYA 4HDEA 1ERUA 1K0NA 1TTZA 2DSAA 2OBKA 4LL4B 3TOUA 1DUGA 2HSYA 3EURA 3FMWA 3TGZA 4XS4A 5KN3A 11GSA 4FH8A 1X9MB 2Z9SA 2OBIA 1ERWA 2YV9A 2E7PA 2FWEA 1EGRA 4V2LA 4GRFA 3GKMA 3HJPA 5CO3A 2H74A 1XWBA 1WIKA 2H6XA 4EVMA 5INYA 1SL0B 3ZVJD 1NHYA 2YPMA 3HYPA 1WOUA 3GMFA 4KDUA 4MF6A 4NV5A 4POLA 4GTUA 5JCGA 2NTOA 2YWMA 3LQ7A 3GA4A 7GSSA 2GZZA 4MF5A 2MBSA 1HYUA 3CXGA 5C04A 4IP6A 2KUCA 4KSOA 2CX3A 5F06A 1M2AA 1U3AA 3O6TA 4WR4A 2H19A 3FZ9A 22GSA 2FCHA 3UEMA 5IOWA 4JE1A 3IA1A 4F03A 4CW9A 4XS6A 1J08A 2ZNMA 1IYHA 3EU3A 2IN3A 4MLYA 3M8NA 2V41A 4I5QA 4WR5A 4HU9A 4Z7XA 3DGQA 1R26A 9GSSA 1T7PB 16GSA 3HKRA 2CVKA 1K3YA 1EEJA 3KH9A 1WPIA 3ED3A 1TDIA 3LXTA 3FZ5A 2VLVA 3QAVA 5EVOA 1M99A 3O3TA 5GSTA 4L0WA 2C3TA 1AUCA 2IMDA 4YQVA 1ZCPA 4PGTA 2O8VB 4TXOA 4WETA 4X4JA 3WT1A 2B1LA 2R2JA 3HJOA 4KUNA 1M9AA 1F3BA 4KE3A 5JCWA 3PPUA 1M9BA 4YKFA 3R2QA 3UJ1A 1Y25A 1MDIA 3EINA 3W8SA 3MAKA 6GSTA 2OE3A 1ZZYA 1PA3A 2LRNA 3P2AA 2YJHA 2PUKC 2HRNA 1BJXA 3VK9A 1HNCA 1NSWA 1O85A 4POKA 2X8HA 3UVTA 3H8QA 2H1DA 2JACA 3TUEA 1A23A 2GSTA 3GX8A 1MD3A 4Z2UA 3JCML 1K3OA 1WJKA 2D2ZA 5HQPA 3QR6A 2GZPA 4O92A 1TK8B 5IQYA 2CVDA 3IC4A 4XIHA 2V6OA 3QAWA 1XCCA 2L59A 5J41A 5D9XA 2LJAA 2YZHA 4TR4A 3H4KA 1J0FA 3EU4A 1B9XC 3MNGA 2C3QA 2RM5A 1DBYA 4KAEA 5G1LA 3ZLPA 5GSSA 5IMZA 2J9HA 2VD1A 3I6AA 2JZSA 2WZ9A 1O73A 4MMMA 4IN0A 3EMPA 2FNOA 3HJMA 1XWCA 4DSSA 1MTCA 2FWHA 2FWGA 4F0CA 3DEXA 2L6CA 1CQHA 4MJBA 4RUVA 2VUPA 5D9WA 2LS5A 5E59A 1YZXA 5C00A 3US3A 4ZBDA 2EIOA 3N5OA 5E4WA 4OFTA 5ID2A 3CMIA 2H6YA 2AB6A 2L6DA 1XOAA 1E2YA 2IJYA 2LEGA 4TR1A 5J9CA 3A2WA 3HD5A 1S3AA 4AJ8A 3ZMKA 1WP0A 2N5FA 3DRNA 4JEDA 4Z2RA 2ZCTA 1BX9A 1YF1A 2GGTA 3NOFA 1XW6A 1X5CA 5DJMA 1GL8A 3CSJA 2H01A 4TRXA 5G30A 2VLTA 2NDOA 3D5JA 2XPEA 4HEA2 2F8FA 4K0GA 1S3CA 2TRCP 1VF3A 1ABAA 2LQQA 2CAIA 5BRTA 2VL9A 4BVXA 4O5RA 2MBTA 2L5OA 2H30A 4XHMA 4ZILA 4OO5A 4I6XA 3DXBA 5DJLA 10GSA 3TJGA 1SK0A 1TW9A 1EP7A 20GSA 2DKHA 1HNAA 2WCIA 4K7IA 3C8EA 1PKZA 2M72A 3VLNA 1Z7PA 2WFCA 2RUFA 4RI7A 1OC9A 2R37A 2B6MA 3HZ8A 3IC8A 3QDNA 3IPZA 2OKAA 1X0RA 1PQNA 4POMA 2H70A 4MH2A 4N30A 4I8BA 4TKYA 1XZOA 2EIQA 1VGLA 3DVXA 1ACVA 5IIZA 4KGIA 1K3LA 3IDVA 5ECQB 2XPDA 1YKCA 3RHCA 1ZGNA 5F8BA 1HNBA 2VL2C 1V40A 2H0HA 2H1BA 4K6XA 3J7Yb 1V58A 6GSSA 3QFBC 5ELAA 3E3EA 2FA8A 4KNDA 1SL2B 1GUHA 4JBBA 4IHUA 4QQ7A 1PRXA 5DBQA 3HCZA 1PL1A 1R4WA 2QGVA 1KBNA 3F0IA 3WGXA 3GHAA 3HVVA 2JZRA 1PN9A 3L78A 2O7KA 3RPNA 5AIVA 1ZYPA 1ML6A 5FT3A 3MDKA 1PL2A 4I2UA 1Z5YE 4ECCA 4K0NA 1I9DA 1OKTA 2ON7A 1PGTA 2VL2A 2CX4A 1Q98A 5H5RA 1A0RP 2LRTA 4BL7A 1EP8A 4V2NA 4CHSA 3IHGA 1Z6NA 2C4JA 4PNGA 4ML1A 1FO5A 2B5YA 4HU7A 2JSZA 1EZKA 4ILFA 3UBKA 2V1MA 2CAQA 1BQ7A 2VM2A 3ISOA 3ERFA 2DJ0A 3EPTA 3GUSA 2M46A 1XWKA 2OADA 5F07A 2VOCA 1AQXA 2P5QA 5G1KA 5HFKA 3HZ4A 2KHPA 2DJ2A 3FEUA 1H75A 4WF4A 3VWVA 3IHQA 2X8GA 4XTSA 3APOA 2R6KA 2H73A 2HNLA 4AGSA 1TK5B 1GTIA 3BCKA 3RDWA 1WRYA 2IMIA 3TJFA 4K7OA 1BEDA 2B5EA 3GTUB 1KNGA 5AGYA 5CNWA 5L71A 2YOIA 3IBHA 5LD0A 3GURA 4FO5A 2HZEA 1F6MC 4NXIA 3ZRDA 4E8HA 3IXRA 2CA8A 1FVJA 2XBQA 2ALBA 4PQ1A 3GFKA 3D4TA 5IMAA 2C0DA 3FR6A 3KM6A 3GKKA 1XVQA 1XWGA 1I5GA 1X5DA 4TN8A 1ZMAA 2I81A 4K1FA 5J5NA 2CVBA 2DKIA 3G7IA 4ZB9A 2PN8A 14GSA 1QGVA 1R5AA 3D0ZA 5CAXA 2LSTA 1SKSB 2FWFA 1S3DA 2MMZA 2X8CA 13GSA 1XW9A 5IMCA 3KTLA 4YQUA 1JZOA 4QL7A 1T1VA 3F8UA 3ZL5A 1OKDA 3FR3A 2NVLA 1GP1A 3EMXA 1A8LA 5CREA 4OCEA 3DYRA 3SWLA 2VLUA 3ERWA 4V1Ap 2VO4A 2IFQA 3KCMA 2VCQA 3GRXA 4ICYA 2PERA 1NM3A 3LJRA 2AAWA 1NHOA 1ZOFA 5KN0A 1BYEA 1T8EB 4EIPA 3MYDA 1EOGA 3GH6A 4KCEA 4IGJA 4L8EA 3TJKA 3M9KA 2YWNA 2VCXA 2RUEA 2VL3A 2BJXA 2YJ7A 1CQGA 3F3RA 1SJIA 2CT6A 4IVFA 2GZYA 3LG6A 4EKZA 3FK8A 4HUAA 1OE8A 3O76A 2RIIA 5D73A 2L57A 2QA1A 1SKRB 2DJ1A 4G0KA 3IRAA 2GLRA 1XXUA 1K0MA 6GSVA 2IPAA 2I9HA 2LTKA 2RLIA 4BVYB 5AISA 3APQA 1N2AA 2EIRA 1AW9A 2FY6A 2AHEA 1A2LA 4X43A 5AIXA 1GSUA 5BMUA 1V2AA 4FYUA 2O89A 5ID2B 2HLSA 5LCZA 1MDJA 2E0QA 4X0XA 4K8MA 4CY8A 1ZYEA 4OD7A 5D96A 3CRUA 2ES7A 1ZYQB 2H1AA 1EV9A 4EDZA 2R0GA 1GRXA 1Z6MA 2GS3A 3VI5A 3UAPA 2GT5A 5D9TA 2R4VA 3ZIVA 3VWUA 2C0FA 4FYCA 1FB6A 1XBSA 4LL1B 1ERTA 4Q5FA 2GVPA 5F0GA 4YAVA 4N11A 3KGKA 2FA4A 2MYGA 2DMMA 4O7HA 3CSIA 5B8BA 1AAZA 2MMOA 4Z2TA 4BA7A 4LMWA 1SD9A 2QKEA 3ERGA 1ERVA 5DALB 1MD4A 4POBA 4ACSA 2HFDA 4GLTA 1OAZA 4BVXB 1DSBA 2GQKA 5ECMB 5KOWA 3HDCA 3UARA 4MCUA 1TRVA 4J57E 4D73B 1EWXA 1YY7A 2R0CA 1AQWA 4K5RA 1AIUA 2YN1A 4EXJA 4PQIA 1EOHA 4ZB6A 3UMAA 2B7JA 3GYKA 1GTUA 2HRAA 1RQMA 1YQ1A 3FKFA 5A4UA 2XHFA 3EWLA 4MJCA 4MA9A 5IM9A 1UN2A 3LW9A 4RQXA 2WDUA 2HI7A 5IOXA 1AXDA 5AN1A 4Q5RA 4EUYA 1OYJA 2L4QA 4G0IA 3C1RA 5DAKB 2OE1A 2FD3A 2GT6A 1VF1A 4MABA 3NIVA 1EGOA 4WEYA 1GNWA 4K2DA 5ECIB 4G0LA 2I1UA 4YKGA 1V57A 5DQYA 3H93A 3HY2A 3C71A 4EF0A 4HQZA 2A4HA 3PH9A 2CQ9A 2GSRA 2DIZA 1PSQA 4EL1A 3FHKA 4BPYA 3CTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HOJ A;  4GQF A;  4PX1 A;  3RPP A;  3VPQ A;  12GS A;  3DKS A;  3TDG A;  2WUL A;  4JZQ A;  3KIJ A;  2RM6 A;  3OR5 A;  2LJK A;  2B3S A;  1J9B A;  4HZ2 A;  3F3Q A;  1TK0 B;  2ZUP A;  4V1A g;  4WBR D;  3VPT A;  2B7K A;  1GUM A;  1B9Y C;  3FR9 A;  1QUW A;  1C72 A;  2VIM A;  2WRT A;  1B48 A;  3D22 A;  4ZL8 A;  3RHB A;  2HSH A;  3KMN A;  3PGT A;  2GSQ A;  2PVQ A;  2VCW A;  1SL1 B;  3VWW A;  3P90 A;  3H79 A;  3F6D A;  2LRC A;  1GLQ A;  3IV4 A;  4TOP A;  3UOM A;  1T3B A;  2GDR A;  1GSD A;  4DSQ A;  3GSS A;  5HR3 A;  1TRU A;  3TRP A;  2A2R A;  1SU9 A;  3NZN A;  3TJJ A;  2WB9 A;  4KSM A;  8GSS A;  3DVW A;  4F2I A;  2OJL A;  2PPT A;  1TI3 A;  5A4V A;  4ECB A;  1A24 A;  5D93 A;  4GQC A;  2YNX A;  3BCI A;  3IE3 A;  3L4N A;  2A2S A;  3A2X A;  5HFG A;  1SK1 A;  2QC7 A;  2KP2 A;  4NMU A;  3TOT A;  5DCH A;  1FOV A;  1YEX A;  3J7Y k;  2AJQ B;  3ME8 A;  5CRW A;  4MDC A;  6GSW A;  1TU8 A;  5ECL B;  3A2V A;  4ZXG A;  3PIN A;  4WBJ A;  5IPG A;  4MZC A;  4GXZ A;  2H75 A;  4F0B A;  1U88 A;  1TJD A;  2JZT A;  3ZRE A;  1TU7 A;  1YKA A;  3LYP A;  2FHE A;  1GSY A;  5EPF A;  1PD2 1;  5G2Z A;  2KLX A;  3KTB A;  5DVB A;  2O87 A;  1R7H A;  2OAC A;  3LGC A;  1K0D A;  1BG5 A;  3C7M A;  3TKS A;  5FHI A;  2C0G A;  3A5W A;  3ZFB A;  1SYR A;  3UVH A;  1FVK A;  2H0I A;  3F4S A;  1G6Y A;  2DLX A;  4XS4 B;  4E8E A;  3WT2 A;  3LSZ A;  3QMX A;  2C0E A;  4P3Y B;  2ON5 A;  5HR2 A;  4HS1 A;  4FIW A;  3IOS A;  5GAP D;  5ECR B;  4MF7 A;  1GSF A;  3F9U A;  1M7T A;  1VF2 A;  5ELG A;  4MZW A;  3D4M A;  2YZU A;  5KN2 A;  2AYT A;  2WS2 A;  4WKW A;  1XIY A;  3FZ4 A;  1LU4 A;  3WD6 A;  2DJJ A;  3M0F A;  1N8J A;  1PX7 A;  3VI7 A;  3WYW A;  1HD2 A;  5ECS A;  1USB A;  2X64 A;  2YV7 A;  2IIY A;  2F9S A;  5ECN B;  5LNK e;  3EC3 A;  1GSQ A;  3E0U A;  3DD3 A;  5ABR A;  5B6N A;  3CRT A;  4HQS A;  2I4A A;  5IMD A;  4OMV A;  1GTA A;  4IKH A;  1XPV A;  2MMA A;  4GCI A;  2XC2 A;  2IMK A;  1QK8 A;  5ECH B;  5CRH A;  4OFM A;  1E6B A;  4V2M A;  2FLS A;  3HXS A;  2N5B A;  3ZIT A;  4NWY A;  5IO2 A;  5A4W A;  4G9H A;  1G0T A;  4ZBA A;  4J2F A;  1V9W A;  2DJ3 A;  1THO A;  4HI7 A;  3IAM 2;  4TXO B;  3GL5 A;  4ML6 A;  2TRX A;  2FUG 2;  4MJE A;  2PWJ A;  5DQS A;  5IMV A;  5HR0 A;  3LXZ A;  2PGT A;  4LA1 A;  2VM1 A;  1SD8 A;  1ON4 A;  1GLP A;  4AF2 A;  3ZVJ A;  2L4C A;  2DIY A;  4TR3 A;  4OO4 A;  4ECJ A;  4NHZ A;  4IBP A;  3LEF A;  2L5L A;  1PMT A;  1HQO A;  3G9B A;  1T00 A;  4IJI A;  3Q18 A;  4DVC A;  5KEJ A;  4KX4 A;  2K18 A;  1OVN A;  5KN1 A;  1JZD A;  1X5E A;  4N0V A;  2MMN A;  3CBU A;  2V6K A;  1A8Y A;  2C1Y A;  4EE0 A;  2DC5 A;  5J3R A;  1JZR A;  2B1K A;  1M2B A;  2KP1 A;  2F8A A;  2K8S A;  1G6W A;  4L5L A;  1F2E A;  4MPF A;  2IME A;  4JRR A;  4TXV A;  2K6V A;  2YP6 A;  1Y6E A;  4GWR A;  5ENU A;  4IW9 A;  2DJK A;  4KB3 A;  4J56 E;  3UIW A;  4H86 A;  4NV2 A;  3CTF A;  3DWV A;  1F9M A;  1RW1 A;  4N10 A;  4O32 A;  5EY6 A;  5COH A;  2CV4 A;  1XVW A;  3UBL A;  3ZIJ A;  3BBY A;  3W6G A;  1SK2 A;  1ST9 A;  1W4V A;  3G7Y A;  4PXO A;  1LBK A;  1T4Z A;  3IR4 A;  5G5F A;  3C1S A;  1UA5 A;  4DSS B;  3AY8 A;  3WGE A;  1FAA A;  2DML A;  3IAS 2;  1FW1 A;  1XOB A;  2GSS A;  3GKN A;  3VFI A;  2C8U A;  5JWQ B;  3GKX A;  2VCT A;  1PX6 A;  3W8J A;  3I43 A;  1K0C A;  4MP4 A;  4KDX A;  2O85 A;  3M9J A;  4TR1 B;  3PR8 A;  1EV4 A;  1K0O A;  3ZYW A;  3GTU A;  5H5S A;  5A5K A;  19GS A;  1JLW A;  4GST A;  2M80 A;  6GSY A;  3U5R E;  5ECK B;  2WGR A;  3K8N A;  2X99 A;  3QOU A;  4IS0 A;  3TKQ A;  4K7N A;  1V98 A;  1QQ2 A;  2JU5 A;  2AUV A;  2JSY A;  1GH2 A;  4X1U A;  3M3M A;  1ZL9 A;  4KW6 A;  2BTO T;  1SJ6 A;  4ID0 A;  4OCF A;  5CP1 A;  4RI6 A;  1YEP A;  4HZ4 A;  4I2T A;  3L0H A;  1GWC A;  2MZC A;  3F6F A;  5ECP B;  3DML A;  4ZL7 A;  1K0B A;  2GQL A;  3U6V A;  3I69 A;  4PUA A;  3APS A;  1O8X A;  4YH2 A;  3H1N A;  1FB0 A;  4TR0 A;  4NPB A;  3V1W A;  1X9S B;  1OC9 B;  4ZL9 A;  2HXK A;  1A2J A;  1AQV A;  2JAD A;  2GQM A;  3ZZX A;  1YJ6 A;  4LMV A;  2R3X A;  4QL9 A;  1A2M A;  2P5R A;  2PBJ A;  3IK9 A;  4GSS A;  4IEL A;  5ECO B;  3P8W A;  4TW5 A;  2HZF A;  3TB2 A;  3KP8 A;  2G2Q A;  1URM A;  4OFN A;  4PUR A;  2IL3 A;  3ZTL A;  5F05 A;  1TRS A;  3GH9 A;  1TI1 A;  2LJR A;  3QPM A;  1M0U A;  3LFL A;  3Q19 A;  1MDK A;  4PUF C;  2FGX A;  1KTE A;  2HE3 A;  3DIE A;  5FWG A;  3MSZ A;  4EO3 A;  4NHW A;  4KA0 A;  4G2E A;  1O81 A;  3TCO A;  3GV1 A;  1JFU A;  4KH7 A;  2N5A A;  4BVY A;  4MZB A;  4YQM A;  2PVO C;  1G7E A;  2H1G A;  3KH7 A;  3ME7 A;  1H4O A;  5JWR B;  18GS A;  4K9Z A;  5D9V A;  1GUK A;  3VWX A;  1WE0 A;  2XBI A;  5B7C A;  2KOK A;  3TKS E;  3BD2 A;  4MJA A;  3KP9 A;  2TIR A;  1QFN A;  3HA9 A;  4F9Z A;  1TKD B;  4YAP A;  4ISD A;  1DE1 A;  2VCZ A;  1Z3E A;  5EL8 A;  4N0Z A;  3QD9 A;  3RBT A;  5CRD A;  2YWI A;  3EE2 A;  3HVX A;  2PMT A;  3KEB A;  5JWO B;  1UVZ A;  3HHV A;  1K0A A;  2JL4 A;  2LNS A;  2H6Z A;  5DAL A;  2YWO A;  4L0U A;  3L9S A;  3D21 A;  3FW2 A;  2B5X A;  3F4T A;  4XRA A;  2DBC A;  3FZA A;  2QSI A;  1OC8 A;  3L9U A;  3LWA A;  4LLR A;  1XFL A;  2HZE B;  3TKS C;  5J4U A;  1JLV A;  2YCD A;  4D73 A;  1U87 A;  2H66 A;  2I3Y A;  4F82 A;  2CZ2 A;  2NBS A;  1YF0 A;  4KDY A;  1U6T A;  2R5G A;  4MK3 A;  1VRS D;  5H5Q A;  3BJ5 A;  1VF4 A;  1A0F A;  3G7J A;  4CDO A;  4WF5 A;  1G7O A;  4ZBB A;  4BWQ A;  1QMV A;  3HVS A;  1THX A;  4GF0 A;  4GSN A;  4MPG A;  3FY7 A;  3ZFL A;  5CRG A;  2K8V A;  3RAZ A;  4IJ3 A;  4DSR A;  4AJ6 A;  2PU9 C;  1Q4J A;  2P31 A;  2LKU A;  3QFA C;  4NAX A;  1TOF A;  4DEJ A;  4WXT A;  3GN3 A;  2F3M A;  2C80 A;  2AV4 A;  3CSH A;  4IP1 A;  4Q5Q A;  1TXX A;  3GIX A;  2V32 A;  4G19 A;  4EDY A;  5DAK A;  3KD0 A;  2H72 A;  2LNT A;  3EVI A;  5G5E A;  2HYX A;  2REM A;  3FRC A;  3TKP A;  2IFQ B;  2H71 A;  4TVE A;  5B8A A;  4MH3 A;  3TKR A;  2EC4 A;  4FYB A;  1B8X A;  1OC3 A;  3LOR A;  4KCA A;  1O6J A;  1F3A A;  4ZB8 A;  1Z7R A;  3TJB A;  17GS A;  1EEM A;  1PKW A;  3TRX A;  5JCU A;  2E2G A;  2H76 A;  3VUR A;  5GAN D;  1OE7 A;  2H0G A;  2WJU A;  4JR4 A;  4I97 A;  4PNF A;  1JHB A;  3L9V A;  4PQH A;  2J23 A;  4JU5 A;  5HFI A;  3GST A;  4ZIJ A;  2YAN A;  1DE2 A;  1BAY A;  1Z9H A;  1SJZ A;  1ILO A;  1MEK A;  4BWS A;  1B4P A;  2P0G A;  4HJ2 A;  5B6M A;  3QAG A;  4HJM A;  4Q5N A;  2F51 A;  4G10 A;  5DCG A;  2OE0 A;  4OWY A;  4XRD A;  3UL3 A;  3S9F A;  1SEN A;  4AJ7 A;  2NPB A;  3Q6O A;  2LQO A;  1TP9 A;  4IQ1 A;  2K9F A;  1M2D A;  1SKW B;  2HRF A;  1QXH A;  1NW2 A;  4L5O A;  6GSU A;  2C3N A;  2OA7 A;  1KEB A;  1GTB A;  5DDL A;  3I9V 2;  3KXO A;  2LV3 A;  1GSS A;  3Q74 A;  3TRQ A;  5IPH A;  1JZW A;  1RK4 A;  3GL3 A;  1R5P A;  3A3T A;  2GTU A;  5CYY A;  1GSE A;  4RQR A;  4EC0 A;  3WGD A;  1X9W B;  1GNE A;  3GX0 A;  3F4R A;  3FYG A;  3EYT A;  5J9B A;  4XCS A;  3M1G A;  2E2M A;  1U3I A;  1WWJ A;  5HR1 A;  6GSX A;  5IMF A;  1GUL A;  2VAF A;  1O8W A;  1F37 A;  3KMO A;  3P7X A;  4JR6 A;  5IO0 A;  1LJR A;  1IYI A;  1SYX A;  3SBC A;  3D6I A;  1W89 A;  3IK7 A;  3LYK A;  1FG4 A;  1UC7 A;  2BMX A;  2IMF A;  3MWH A;  5D8I A;  2A4V A;  3C73 A;  2VCV A;  4ECI A;  1B4Q A;  2CZ3 A;  3ZML A;  1T4Y A;  1TRW A;  3BOA A;  2G0F A;  3QCP A;  1YDK A;  3N9J A;  4ULX A;  3GNJ A;  1XW5 A;  2IWT A;  4IQA A;  1WMJ A;  2VD0 A;  4XS1 A;  2H8L A;  3CYN A;  3F63 A;  1O7U A;  5G31 A;  1AC1 A;  2HT9 A;  5GZZ B;  1XWA A;  3E9J B;  2V2G A;  1FHE A;  3KZQ A;  2LUS A;  3KJY A;  4HDE A;  1ERU A;  1K0N A;  1TTZ A;  2DSA A;  2OBK A;  4LL4 B;  3TOU A;  1DUG A;  2HSY A;  3EUR A;  3TGZ A;  4XS4 A;  5KN3 A;  11GS A;  4FH8 A;  1X9M B;  2Z9S A;  2OBI A;  1ERW A;  2YV9 A;  2E7P A;  2FWE A;  1EGR A;  4V2L A;  4GRF A;  3GKM A;  3HJP A;  5CO3 A;  2H74 A;  1XWB A;  1WIK A;  2H6X A;  4EVM A;  5INY A;  1SL0 B;  3ZVJ D;  1NHY A;  2YPM A;  3HYP A;  1WOU A;  3GMF A;  4KDU A;  4MF6 A;  4NV5 A;  4POL A;  4GTU A;  5JCG A;  2NTO A;  2YWM A;  3LQ7 A;  3GA4 A;  7GSS A;  2GZZ A;  4MF5 A;  2MBS A;  1HYU A;  3CXG A;  5C04 A;  4IP6 A;  2KUC A;  4KSO A;  2CX3 A;  5F06 A;  1M2A A;  1U3A A;  3O6T A;  4WR4 A;  2H19 A;  3FZ9 A;  22GS A;  2FCH A;  3UEM A;  5IOW A;  4JE1 A;  3IA1 A;  4F03 A;  4CW9 A;  4XS6 A;  1J08 A;  2ZNM A;  1IYH A;  3EU3 A;  2IN3 A;  4MLY A;  3M8N A;  2V41 A;  4I5Q A;  4WR5 A;  4HU9 A;  4Z7X A;  3DGQ A;  1R26 A;  9GSS A;  1T7P B;  16GS A;  3HKR A;  2CVK A;  1K3Y A;  1EEJ A;  3KH9 A;  1WPI A;  3ED3 A;  1TDI A;  3LXT A;  3FZ5 A;  2VLV A;  3QAV A;  5EVO A;  1M99 A;  3O3T A;  5GST A;  4L0W A;  2C3T A;  1AUC A;  2IMD A;  4YQV A;  1ZCP A;  4PGT A;  2O8V B;  4TXO A;  4WET A;  3WT1 A;  2B1L A;  2R2J A;  3HJO A;  4KUN A;  1M9A A;  1F3B A;  4KE3 A;  5JCW A;  1M9B A;  3R2Q A;  3UJ1 A;  1Y25 A;  1MDI A;  3EIN A;  3W8S A;  3MAK A;  6GST A;  2OE3 A;  1ZZY A;  1PA3 A;  2LRN A;  3P2A A;  2YJH A;  2PUK C;  2HRN A;  1BJX A;  3VK9 A;  1HNC A;  1NSW A;  1O85 A;  4POK A;  2X8H A;  3UVT A;  3H8Q A;  2H1D A;  2JAC A;  3TUE A;  1A23 A;  2GST A;  3GX8 A;  1MD3 A;  3JCM L;  1K3O A;  1WJK A;  2D2Z A;  5HQP A;  3QR6 A;  2GZP A;  4O92 A;  1TK8 B;  5IQY A;  2CVD A;  3IC4 A;  4XIH A;  2V6O A;  3QAW A;  1XCC A;  2L59 A;  5J41 A;  5D9X A;  2LJA A;  2YZH A;  4TR4 A;  3H4K A;  1J0F A;  3EU4 A;  1B9X C;  3MNG A;  2C3Q A;  2RM5 A;  1DBY A;  4KAE A;  5G1L A;  3ZLP A;  5GSS A;  5IMZ A;  2J9H A;  2VD1 A;  3I6A A;  2JZS A;  2WZ9 A;  1O73 A;  4MMM A;  4IN0 A;  3EMP A;  2FNO A;  3HJM A;  1XWC A;  4DSS A;  1MTC A;  2FWH A;  2FWG A;  4F0C A;  3DEX A;  2L6C A;  1CQH A;  4MJB A;  4RUV A;  2VUP A;  5D9W A;  2LS5 A;  5E59 A;  1YZX A;  5C00 A;  3US3 A;  4ZBD A;  2EIO A;  3N5O A;  5E4W A;  4OFT A;  5ID2 A;  3CMI A;  2H6Y A;  2AB6 A;  2L6D A;  1XOA A;  1E2Y A;  2IJY A;  2LEG A;  4TR1 A;  5J9C A;  3A2W A;  3HD5 A;  1S3A A;  4AJ8 A;  3ZMK A;  1WP0 A;  2N5F A;  3DRN A;  4JED A;  2ZCT A;  1BX9 A;  1YF1 A;  2GGT A;  3NOF A;  1XW6 A;  1X5C A;  5DJM A;  1GL8 A;  3CSJ A;  2H01 A;  4TRX A;  5G30 A;  2VLT A;  2NDO A;  3D5J A;  2XPE A;  4HEA 2;  2F8F A;  4K0G A;  1S3C A;  2TRC P;  1VF3 A;  1ABA A;  2LQQ A;  2CAI A;  2VL9 A;  4BVX A;  4O5R A;  2MBT A;  2L5O A;  2H30 A;  4XHM A;  4ZIL A;  4OO5 A;  4I6X A;  3DXB A;  5DJL A;  10GS A;  3TJG A;  1SK0 A;  1TW9 A;  1EP7 A;  20GS A;  1HNA A;  2WCI A;  4K7I A;  3C8E A;  1PKZ A;  2M72 A;  3VLN A;  1Z7P A;  2WFC A;  2RUF A;  4RI7 A;  1OC9 A;  2R37 A;  2B6M A;  3HZ8 A;  3QDN A;  3IPZ A;  2OKA A;  1X0R A;  1PQN A;  4POM A;  2H70 A;  4MH2 A;  4N30 A;  4I8B A;  4TKY A;  1XZO A;  2EIQ A;  1VGL A;  3DVX A;  1ACV A;  5IIZ A;  4KGI A;  1K3L A;  3IDV A;  5ECQ B;  2XPD A;  1YKC A;  3RHC A;  1ZGN A;  5F8B A;  1HNB A;  2VL2 C;  1V40 A;  2H0H A;  2H1B A;  4K6X A;  3J7Y b;  1V58 A;  6GSS A;  3QFB C;  5ELA A;  3E3E A;  2FA8 A;  4KND A;  1SL2 B;  1GUH A;  4JBB A;  4IHU A;  4QQ7 A;  1PRX A;  5DBQ A;  3HCZ A;  1PL1 A;  1R4W A;  2QGV A;  1KBN A;  3F0I A;  3WGX A;  3GHA A;  3HVV A;  2JZR A;  1PN9 A;  3L78 A;  2O7K A;  3RPN A;  5AIV A;  1ML6 A;  5FT3 A;  3MDK A;  1PL2 A;  4I2U A;  1Z5Y E;  4ECC A;  4K0N A;  1I9D A;  1OKT A;  2ON7 A;  1PGT A;  2VL2 A;  2CX4 A;  1Q98 A;  5H5R A;  1A0R P;  2LRT A;  4BL7 A;  1EP8 A;  4V2N A;  4CHS A;  1Z6N A;  2C4J A;  4PNG A;  4ML1 A;  1FO5 A;  2B5Y A;  4HU7 A;  2JSZ A;  1EZK A;  4ILF A;  3UBK A;  2V1M A;  2CAQ A;  1BQ7 A;  2VM2 A;  3ISO A;  3ERF A;  2DJ0 A;  3GUS A;  2M46 A;  1XWK A;  2OAD A;  5F07 A;  2VOC A;  1AQX A;  2P5Q A;  5G1K A;  5HFK A;  3HZ4 A;  2KHP A;  2DJ2 A;  3FEU A;  1H75 A;  4WF4 A;  3VWV A;  3IHQ A;  2X8G A;  4XTS A;  3APO A;  2R6K A;  2H73 A;  2HNL A;  4AGS A;  1TK5 B;  1GTI A;  3BCK A;  3RDW A;  1WRY A;  2IMI A;  3TJF A;  4K7O A;  1BED A;  2B5E A;  3GTU B;  1KNG A;  5AGY A;  5CNW A;  5L71 A;  2YOI A;  3IBH A;  5LD0 A;  3GUR A;  4FO5 A;  2HZE A;  1F6M C;  4NXI A;  3ZRD A;  4E8H A;  3IXR A;  2CA8 A;  1FVJ A;  2XBQ A;  2ALB A;  4PQ1 A;  3GFK A;  3D4T A;  5IMA A;  2C0D A;  3FR6 A;  3KM6 A;  3GKK A;  1XVQ A;  1XWG A;  1I5G A;  1X5D A;  4TN8 A;  1ZMA A;  2I81 A;  4K1F A;  5J5N A;  2CVB A;  3G7I A;  4ZB9 A;  2PN8 A;  14GS A;  1QGV A;  1R5A A;  3D0Z A;  5CAX A;  2LST A;  1SKS B;  2FWF A;  1S3D A;  2MMZ A;  2X8C A;  13GS A;  1XW9 A;  5IMC A;  3KTL A;  4YQU A;  1JZO A;  4QL7 A;  1T1V A;  3F8U A;  3ZL5 A;  1OKD A;  3FR3 A;  2NVL A;  1GP1 A;  3EMX A;  1A8L A;  5CRE A;  4OCE A;  3DYR A;  3SWL A;  2VLU A;  3ERW A;  4V1A p;  2VO4 A;  2IFQ A;  3KCM A;  2VCQ A;  3GRX A;  2PER A;  1NM3 A;  3LJR A;  2AAW A;  1NHO A;  1ZOF A;  5KN0 A;  1BYE A;  1T8E B;  1EOG A;  3GH6 A;  4KCE A;  4IGJ A;  4L8E A;  3TJK A;  3M9K A;  2YWN A;  2VCX A;  2RUE A;  2VL3 A;  2BJX A;  2YJ7 A;  1CQG A;  3F3R A;  1SJI A;  2CT6 A;  4IVF A;  2GZY A;  3LG6 A;  4EKZ A;  3FK8 A;  4HUA A;  1OE8 A;  3O76 A;  2RII A;  5D73 A;  2L57 A;  1SKR B;  2DJ1 A;  3IRA A;  2GLR A;  1XXU A;  1K0M A;  6GSV A;  2IPA A;  2I9H A;  2LTK A;  2RLI A;  5AIS A;  3APQ A;  1N2A A;  2EIR A;  1AW9 A;  2FY6 A;  2AHE A;  1A2L A;  4X43 A;  5AIX A;  1GSU A;  1V2A A;  4FYU A;  2O89 A;  5ID2 B;  2HLS A;  5LCZ A;  1MDJ A;  2E0Q A;  4X0X A;  4K8M A;  1ZYE A;  4OD7 A;  5D96 A;  3CRU A;  2ES7 A;  1ZYQ B;  2H1A A;  1EV9 A;  4EDZ A;  1GRX A;  1Z6M A;  2GS3 A;  3VI5 A;  3UAP A;  2GT5 A;  5D9T A;  2R4V A;  3ZIV A;  3VWU A;  2C0F A;  4FYC A;  1FB6 A;  1XBS A;  4LL1 B;  1ERT A;  4Q5F A;  2GVP A;  5F0G A;  4YAV A;  4N11 A;  3KGK A;  2FA4 A;  2MYG A;  2DMM A;  4O7H A;  3CSI A;  5B8B A;  1AAZ A;  2MMO A;  4BA7 A;  4LMW A;  1SD9 A;  2QKE A;  3ERG A;  1ERV A;  5DAL B;  1MD4 A;  4POB A;  4ACS A;  2HFD A;  4GLT A;  1OAZ A;  1DSB A;  2GQK A;  5ECM B;  3HDC A;  3UAR A;  4MCU A;  1TRV A;  4J57 E;  4D73 B;  1EWX A;  1YY7 A;  1AQW A;  1AIU A;  2YN1 A;  4EXJ A;  4PQI A;  1EOH A;  4ZB6 A;  3UMA A;  2B7J A;  3GYK A;  1GTU A;  1RQM A;  1YQ1 A;  3FKF A;  5A4U A;  2XHF A;  3EWL A;  4MJC A;  4MA9 A;  5IM9 A;  1UN2 A;  4RQX A;  2WDU A;  2HI7 A;  5IOX A;  1AXD A;  5AN1 A;  4Q5R A;  4EUY A;  1OYJ A;  2L4Q A;  3C1R A;  5DAK B;  2OE1 A;  2FD3 A;  2GT6 A;  1VF1 A;  4MAB A;  3NIV A;  1EGO A;  4WEY A;  1GNW A;  4K2D A;  5ECI B;  2I1U A;  1V57 A;  5DQY A;  3H93 A;  3HY2 A;  3C71 A;  4EF0 A;  4HQZ A;  3PH9 A;  2CQ9 A;  2GSR A;  2DIZ A;  1PSQ A;  4EL1 A;  3FHK A;  4BPY A;  3CTG A; 
#chains in the Genus database with same CATH topology
 4HOJ A;  4GQF A;  4PX1 A;  3RPP A;  3VPQ A;  12GS A;  3DKS A;  3TDG A;  2WUL A;  4JZQ A;  3KIJ A;  2RM6 A;  3OR5 A;  2LJK A;  2B3S A;  1J9B A;  4HZ2 A;  3F3Q A;  1TK0 B;  2ZUP A;  4V1A g;  4WBR D;  4BL7 B;  3VPT A;  2B7K A;  1GUM A;  1B9Y C;  3FR9 A;  1QUW A;  1C72 A;  2VIM A;  2WRT A;  1B48 A;  3D22 A;  4ZL8 A;  3RHB A;  2HSH A;  3KMN A;  3PGT A;  2GSQ A;  2PVQ A;  2VCW A;  1SL1 B;  3VWW A;  3P90 A;  3H79 A;  3F6D A;  2LRC A;  1GLQ A;  3IV4 A;  4TOP A;  3UOM A;  1T3B A;  2GDR A;  1GSD A;  4DSQ A;  3GSS A;  5HR3 A;  1TRU A;  3TRP A;  2A2R A;  1FOH A;  1SU9 A;  3NZN A;  3TJJ A;  2WB9 A;  4KSM A;  8GSS A;  3DVW A;  4F2I A;  2OJL A;  2PPT A;  1TI3 A;  5A4V A;  4ECB A;  1A24 A;  5D93 A;  4GQC A;  2YNX A;  3BCI A;  3IE3 A;  3L4N A;  2A2S A;  3A2X A;  5HFG A;  1SK1 A;  2QC7 A;  2KP2 A;  4NMU A;  3TOT A;  5DCH A;  1FOV A;  1YEX A;  3J7Y k;  2AJQ B;  3ME8 A;  5CRW A;  4MDC A;  6GSW A;  1TU8 A;  5ECL B;  3A2V A;  4ZXG A;  3PIN A;  4WBJ A;  5IPG A;  4MZC A;  4GXZ A;  2H75 A;  4F0B A;  1U88 A;  1TJD A;  2JZT A;  3ZRE A;  1TU7 A;  1YKA A;  3LYP A;  2FHE A;  1GSY A;  5EPF A;  1PD2 1;  5G2Z A;  2KLX A;  3KTB A;  5DVB A;  2O87 A;  1R7H A;  2OAC A;  3LGC A;  1K0D A;  1BG5 A;  3C7M A;  3TKS A;  5FHI A;  2C0G A;  3A5W A;  3ZFB A;  1SYR A;  3UVH A;  1FVK A;  2H0I A;  3F4S A;  1G6Y A;  2DLX A;  4XS4 B;  4E8E A;  2QA2 A;  3WT2 A;  3LSZ A;  3QMX A;  2C0E A;  4P3Y B;  2ON5 A;  2UZ8 A;  5HR2 A;  4HS1 A;  4FIW A;  3IOS A;  4O5Q A;  5GAP D;  5ECR B;  4MF7 A;  1GSF A;  3F9U A;  1M7T A;  1VF2 A;  5ELG A;  4MZW A;  3D4M A;  2YZU A;  5KN2 A;  2AYT A;  2WS2 A;  4K2X A;  1XIY A;  4WKW A;  3FZ4 A;  1LU4 A;  3WD6 A;  2DJJ A;  3M0F A;  1N8J A;  1PX7 A;  3VI7 A;  3WYW A;  4USS A;  1HD2 A;  5ECS A;  1USB A;  2X64 A;  2YV7 A;  2IIY A;  2F9S A;  5ECN B;  5LNK e;  3EC3 A;  1GSQ A;  3E0U A;  3DD3 A;  5ABR A;  5B6N A;  3CRT A;  4HQS A;  2I4A A;  5IMD A;  4OMV A;  1GTA A;  4IKH A;  1XPV A;  2MMA A;  4GCI A;  2XC2 A;  2IMK A;  4KF9 A;  1QK8 A;  5ECH B;  5CRH A;  4OFM A;  1E6B A;  4V2M A;  2FLS A;  3HXS A;  2N5B A;  3ZIT A;  4NWY A;  5IO2 A;  5A4W A;  4G9H A;  1G0T A;  4ZBA A;  5KOX A;  4J2F A;  1V9W A;  2DJ3 A;  1THO A;  4HI7 A;  3IAM 2;  4TXO B;  3GL5 A;  4ML6 A;  2TRX A;  2FUG 2;  4MJE A;  2PWJ A;  5DQS A;  5IMV A;  5HR0 A;  3LXZ A;  2PGT A;  4LA1 A;  2VM1 A;  1SD8 A;  1ON4 A;  1GLP A;  4AF2 A;  3ZVJ A;  2L4C A;  2DIY A;  4TR3 A;  4OO4 A;  4ECJ A;  1PN0 A;  4NHZ A;  1ZYN A;  4IBP A;  3LEF A;  2L5L A;  1PMT A;  1HQO A;  3G9B A;  1XG8 A;  1T00 A;  4IJI A;  3Q18 A;  4DVC A;  5KEJ A;  4KX4 A;  2K18 A;  1OVN A;  5KN1 A;  1JZD A;  1X5E A;  4N0V A;  2MMN A;  3CBU A;  2V6K A;  1A8Y A;  2C1Y A;  4EE0 A;  2DC5 A;  5J3R A;  1JZR A;  2B1K A;  1M2B A;  2KP1 A;  2F8A A;  2K8S A;  1G6W A;  4L5L A;  1F2E A;  4MPF A;  2IME A;  4JRR A;  4TXV A;  2K6V A;  2YP6 A;  1Y6E A;  4GWR A;  5ENU A;  4IW9 A;  2DJK A;  4KB3 A;  4J56 E;  2R0P A;  3UIW A;  4H86 A;  4NV2 A;  3CTF A;  3DWV A;  1F9M A;  1RW1 A;  4N10 A;  4O32 A;  5COH A;  5EY6 A;  2CV4 A;  1XVW A;  3UBL A;  3ZIJ A;  3BBY A;  3W6G A;  1SK2 A;  1ST9 A;  3CQF A;  1W4V A;  3G7Y A;  4PXO A;  1LBK A;  1T4Z A;  3IR4 A;  5G5F A;  3C1S A;  1UA5 A;  4DSS B;  3AY8 A;  3WGE A;  1FAA A;  2DML A;  3IAS 2;  1FW1 A;  1XOB A;  2GSS A;  3GKN A;  3VFI A;  2C8U A;  5JWQ B;  3GKX A;  2VCT A;  1PX6 A;  3W8J A;  3I43 A;  1K0C A;  4MP4 A;  4KDX A;  2O85 A;  3M9J A;  4TR1 B;  3PR8 A;  1EV4 A;  1K0O A;  3ZYW A;  3GTU A;  5H5S A;  5A5K A;  19GS A;  1JLW A;  4GST A;  2M80 A;  6GSY A;  3U5R E;  5ECK B;  2WGR A;  3K8N A;  2X99 A;  3QOU A;  4IS0 A;  3TKQ A;  4K7N A;  1V98 A;  1QQ2 A;  2JU5 A;  2AUV A;  2JSY A;  1GH2 A;  4X1U A;  2X4A A;  3M3M A;  1ZL9 A;  4KW6 A;  2BTO T;  1SJ6 A;  4ID0 A;  4OCF A;  5CP1 A;  4RI6 A;  1YEP A;  4HZ4 A;  4I2T A;  3L0H A;  1GWC A;  2MZC A;  3F6F A;  5ECP B;  3DML A;  4A5P A;  4ZL7 A;  1K0B A;  2GQL A;  3U6V A;  3I69 A;  4PUA A;  3APS A;  1O8X A;  4YH2 A;  3H1N A;  1FB0 A;  4TR0 A;  2HRK A;  4NPB A;  3V1W A;  1X9S B;  1OC9 B;  4ZL9 A;  2HXK A;  1A2J A;  1AQV A;  2JAD A;  2GQM A;  3ZZX A;  1YJ6 A;  2A2P A;  4LMV A;  2R3X A;  4QL9 A;  1A2M A;  2P5R A;  2PBJ A;  3IK9 A;  4GSS A;  4IEL A;  5ECO B;  4PTS A;  3P8W A;  4TW5 A;  2HZF A;  3TB2 A;  3KP8 A;  4CY6 A;  2G2Q A;  1URM A;  4OFN A;  4PUR A;  2IL3 A;  3ZTL A;  5F05 A;  1TRS A;  3GH9 A;  1TI1 A;  2LJR A;  3QPM A;  1M0U A;  3LFL A;  3Q19 A;  1MDK A;  4PUF C;  2FGX A;  1KTE A;  2HE3 A;  3DIE A;  5FWG A;  3MSZ A;  4EO3 A;  2HSM A;  4NHW A;  4KA0 A;  4G2E A;  1O81 A;  3TCO A;  3GV1 A;  1JFU A;  4KH7 A;  2N5A A;  4BVY A;  4MZB A;  4YQM A;  2PVO C;  1G7E A;  2H1G A;  3KH7 A;  3MIX A;  3ME7 A;  1H4O A;  5JWR B;  18GS A;  4K9Z A;  3R3E A;  5D9V A;  1GUK A;  3VWX A;  1WE0 A;  2XBI A;  5B7C A;  2KOK A;  3TKS E;  4O5U A;  3BD2 A;  4MJA A;  3KP9 A;  2TIR A;  1QFN A;  3HA9 A;  4F9Z A;  1TKD B;  4YAP A;  4ISD A;  1DE1 A;  2VCZ A;  1Z3E A;  5EL8 A;  4N0Z A;  3QD9 A;  3RBT A;  5CRD A;  2YWI A;  3EE2 A;  3HVX A;  2PMT A;  3KEB A;  5JWO B;  1UVZ A;  3HHV A;  1K0A A;  2JL4 A;  2LNS A;  4EIQ A;  2H6Z A;  3A5I A;  5DAL A;  2YWO A;  4L0U A;  3L9S A;  3D21 A;  3FW2 A;  2B5X A;  3F4T A;  4XRA A;  2DBC A;  3FZA A;  2QSI A;  1OC8 A;  3L9U A;  3LWA A;  4LLR A;  1XFL A;  2HZE B;  3TKS C;  5J4U A;  1JLV A;  2YCD A;  4D73 A;  1U87 A;  2H66 A;  2I3Y A;  4F82 A;  2CZ2 A;  2NBS A;  1YF0 A;  4KDY A;  1U6T A;  2R5G A;  4MK3 A;  1VRS D;  5H5Q A;  3BJ5 A;  1VF4 A;  1A0F A;  3G7J A;  4CDO A;  4WF5 A;  1G7O A;  4ZBB A;  4BWQ A;  1QMV A;  3HVS A;  4K5S A;  1THX A;  4GF0 A;  4GSN A;  4MPG A;  3FY7 A;  3ZFL A;  5CRG A;  2K8V A;  3RAZ A;  4IJ3 A;  4DSR A;  4AJ6 A;  2PU9 C;  1Q4J A;  2P31 A;  2LKU A;  3QFA C;  4NAX A;  1TOF A;  4DEJ A;  4WXT A;  3GN3 A;  2F3M A;  2C80 A;  2AV4 A;  3CSH A;  4IP1 A;  4Q5Q A;  4FQU A;  1TXX A;  3GIX A;  2V32 A;  4G19 A;  4EDY A;  5DAK A;  3KD0 A;  2H72 A;  2LNT A;  3EVI A;  5G5E A;  2HYX A;  2REM A;  3FRC A;  3TKP A;  2IFQ B;  2H71 A;  4TVE A;  5B8A A;  4MH3 A;  3TKR A;  2EC4 A;  4FYB A;  1B8X A;  1OC3 A;  3LOR A;  4KCA A;  1O6J A;  1F3A A;  4ZB8 A;  1Z7R A;  3TJB A;  17GS A;  1EEM A;  1PKW A;  3TRX A;  5JCU A;  2E2G A;  2H76 A;  3VUR A;  5GAN D;  1OE7 A;  2H0G A;  2WJU A;  4JR4 A;  4I97 A;  4PNF A;  1JHB A;  3L9V A;  4PQH A;  2J23 A;  4JU5 A;  5HFI A;  3GST A;  4ZIJ A;  2YAN A;  1DE2 A;  1BAY A;  1Z9H A;  1SJZ A;  1ILO A;  1MEK A;  4BWS A;  4MNN A;  1B4P A;  2P0G A;  4HJ2 A;  5B6M A;  3QAG A;  4HJM A;  4Q5N A;  2F51 A;  4G10 A;  5DCG A;  2OE0 A;  4OWY A;  4XRD A;  3UL3 A;  3S9F A;  1SEN A;  4AJ7 A;  2NPB A;  3Q6O A;  2LQO A;  1M3J A;  1TP9 A;  4IQ1 A;  2K9F A;  1M2D A;  1SKW B;  2HRF A;  1QXH A;  1NW2 A;  4L5O A;  6GSU A;  2C3N A;  2OA7 A;  1KEB A;  1GTB A;  5DDL A;  3I9V 2;  3KXO A;  3HVN A;  2LV3 A;  1GSS A;  3Q74 A;  3TRQ A;  5IPH A;  1JZW A;  1RK4 A;  3GL3 A;  1R5P A;  3A3T A;  2GTU A;  5CYY A;  1GSE A;  4RQR A;  4EC0 A;  3WGD A;  1X9W B;  1GNE A;  3GX0 A;  3F4R A;  3FYG A;  3EYT A;  5J9B A;  4XCS A;  3M1G A;  2E2M A;  1U3I A;  1WWJ A;  5HR1 A;  6GSX A;  5IMF A;  1GUL A;  2VAF A;  1O8W A;  1F37 A;  3KMO A;  3P7X A;  4JR6 A;  5IO0 A;  1LJR A;  1IYI A;  1SYX A;  3SBC A;  3D6I A;  1W89 A;  3IK7 A;  3LYK A;  1FG4 A;  1UC7 A;  2BMX A;  2IMF A;  3MWH A;  5D8I A;  2A4V A;  2X49 A;  3C73 A;  2VCV A;  4ECI A;  1B4Q A;  2CZ3 A;  3ZML A;  1T4Y A;  1TRW A;  3BOA A;  2G0F A;  3QCP A;  1YDK A;  3N9J A;  4ULX A;  3GNJ A;  1XW5 A;  1S3R A;  2IWT A;  4IQA A;  1WMJ A;  2VD0 A;  4XS1 A;  2H8L A;  3CYN A;  3F63 A;  1O7U A;  5G31 A;  1AC1 A;  2HT9 A;  5GZZ B;  1XWA A;  3E9J B;  2V2G A;  1FHE A;  3KZQ A;  2LUS A;  3KJY A;  4HDE A;  1ERU A;  1K0N A;  1TTZ A;  2DSA A;  2OBK A;  4LL4 B;  3TOU A;  1DUG A;  2HSY A;  3EUR A;  3FMW A;  3TGZ A;  4XS4 A;  5KN3 A;  11GS A;  4FH8 A;  1X9M B;  2Z9S A;  2OBI A;  1ERW A;  2YV9 A;  2E7P A;  2FWE A;  1EGR A;  4V2L A;  4GRF A;  3GKM A;  3HJP A;  5CO3 A;  2H74 A;  1XWB A;  1WIK A;  2H6X A;  4EVM A;  5INY A;  1M3I A;  1SL0 B;  3ZVJ D;  1NHY A;  2YPM A;  3HYP A;  1WOU A;  3GMF A;  4KDU A;  4MF6 A;  4NV5 A;  4POL A;  4GTU A;  5JCG A;  2NTO A;  2YWM A;  3LQ7 A;  3GA4 A;  7GSS A;  2GZZ A;  4MF5 A;  2MBS A;  1HYU A;  3CXG A;  5C04 A;  4IP6 A;  2KUC A;  4KSO A;  2CX3 A;  5F06 A;  1M2A A;  1U3A A;  3O6T A;  4WR4 A;  2H19 A;  3FZ9 A;  22GS A;  2FCH A;  3UEM A;  1PFO A;  5IOW A;  4JE1 A;  3IA1 A;  4F03 A;  4CW9 A;  4XS6 A;  1J08 A;  2ZNM A;  1IYH A;  3EU3 A;  2IN3 A;  4MLY A;  3M8N A;  2V41 A;  4I5Q A;  4WR5 A;  4HU9 A;  4Z7X A;  3DGQ A;  1R26 A;  9GSS A;  1T7P B;  16GS A;  3HKR A;  2CVK A;  1K3Y A;  1EEJ A;  3KH9 A;  1WPI A;  3ED3 A;  1TDI A;  3LXT A;  3FZ5 A;  2VLV A;  3QAV A;  5EVO A;  1M99 A;  3O3T A;  5GST A;  4L0W A;  2C3T A;  1AUC A;  2IMD A;  4YQV A;  1ZCP A;  4PGT A;  2O8V B;  4TXO A;  4WET A;  4X4J A;  3WT1 A;  2B1L A;  2R2J A;  3HJO A;  4KUN A;  1M9A A;  1F3B A;  4KE3 A;  5JCW A;  3PPU A;  1M9B A;  4YKF A;  3R2Q A;  3UJ1 A;  1Y25 A;  1MDI A;  3EIN A;  3W8S A;  3MAK A;  6GST A;  2OE3 A;  1ZZY A;  1PA3 A;  2LRN A;  3P2A A;  2YJH A;  2PUK C;  2HRN A;  1BJX A;  3VK9 A;  1HNC A;  1NSW A;  1O85 A;  4POK A;  2X8H A;  3UVT A;  3H8Q A;  2H1D A;  2JAC A;  3TUE A;  1A23 A;  2GST A;  3GX8 A;  1MD3 A;  4Z2U A;  3JCM L;  1K3O A;  1WJK A;  2D2Z A;  5HQP A;  3QR6 A;  2GZP A;  4O92 A;  1TK8 B;  5IQY A;  2CVD A;  3IC4 A;  4XIH A;  2V6O A;  3QAW A;  1XCC A;  2L59 A;  5J41 A;  5D9X A;  2LJA A;  2YZH A;  4TR4 A;  3H4K A;  1J0F A;  3EU4 A;  1B9X C;  4HSC X;  3MNG A;  2C3Q A;  2RM5 A;  1DBY A;  4KAE A;  5G1L A;  3ZLP A;  5GSS A;  5IMZ A;  2J9H A;  2VD1 A;  3I6A A;  2JZS A;  2WZ9 A;  1O73 A;  4MMM A;  4IN0 A;  3EMP A;  2FNO A;  3HJM A;  1XWC A;  4DSS A;  1MTC A;  2FWH A;  2FWG A;  4F0C A;  3DEX A;  2L6C A;  1CQH A;  4MJB A;  4RUV A;  2VUP A;  5D9W A;  2LS5 A;  5E59 A;  4BIK A;  1YZX A;  5C00 A;  3US3 A;  4ZBD A;  2EIO A;  3N5O A;  5E4W A;  4OFT A;  5ID2 A;  3CMI A;  2H6Y A;  2AB6 A;  2L6D A;  1XOA A;  1E2Y A;  2IJY A;  2LEG A;  4TR1 A;  5J9C A;  3A2W A;  3HD5 A;  1S3A A;  4AJ8 A;  3ZMK A;  1WP0 A;  2N5F A;  3DRN A;  4JED A;  4Z2R A;  2ZCT A;  1BX9 A;  1YF1 A;  2GGT A;  3NOF A;  1XW6 A;  1X5C A;  5DJM A;  1GL8 A;  3CSJ A;  2H01 A;  4TRX A;  5G30 A;  2VLT A;  2NDO A;  3D5J A;  2XPE A;  4HEA 2;  2F8F A;  4K0G A;  1S3C A;  2TRC P;  1VF3 A;  1ABA A;  2LQQ A;  2CAI A;  5BRT A;  2VL9 A;  4BVX A;  4O5R A;  2MBT A;  2L5O A;  2H30 A;  4XHM A;  4ZIL A;  4OO5 A;  4I6X A;  3DXB A;  5DJL A;  10GS A;  3TJG A;  1SK0 A;  1TW9 A;  1EP7 A;  20GS A;  2DKH A;  1HNA A;  2WCI A;  4K7I A;  3C8E A;  1PKZ A;  2M72 A;  3VLN A;  1Z7P A;  2WFC A;  2RUF A;  4RI7 A;  1OC9 A;  2R37 A;  2B6M A;  3HZ8 A;  3IC8 A;  3QDN A;  3IPZ A;  2OKA A;  1X0R A;  1PQN A;  4POM A;  2H70 A;  4MH2 A;  4N30 A;  4I8B A;  4TKY A;  1XZO A;  2EIQ A;  1VGL A;  3DVX A;  1ACV A;  5IIZ A;  4KGI A;  1K3L A;  3IDV A;  5ECQ B;  2XPD A;  1YKC A;  3RHC A;  1ZGN A;  5F8B A;  1HNB A;  2VL2 C;  1V40 A;  2H0H A;  2H1B A;  4K6X A;  3J7Y b;  1V58 A;  6GSS A;  3QFB C;  5ELA A;  3E3E A;  2FA8 A;  4KND A;  1SL2 B;  1GUH A;  4JBB A;  4IHU A;  4QQ7 A;  1PRX A;  5DBQ A;  3HCZ A;  1PL1 A;  1R4W A;  2QGV A;  1KBN A;  3F0I A;  3WGX A;  3GHA A;  3HVV A;  2JZR A;  1PN9 A;  3L78 A;  2O7K A;  3RPN A;  5AIV A;  1ZYP A;  1ML6 A;  5FT3 A;  3MDK A;  1PL2 A;  4I2U A;  1Z5Y E;  4ECC A;  4K0N A;  1I9D A;  1OKT A;  2ON7 A;  1PGT A;  2VL2 A;  2CX4 A;  1Q98 A;  5H5R A;  1A0R P;  2LRT A;  4BL7 A;  1EP8 A;  4V2N A;  4CHS A;  3IHG A;  1Z6N A;  2C4J A;  4PNG A;  4ML1 A;  1FO5 A;  2B5Y A;  4HU7 A;  2JSZ A;  1EZK A;  4ILF A;  3UBK A;  2V1M A;  2CAQ A;  1BQ7 A;  2VM2 A;  3ISO A;  3ERF A;  2DJ0 A;  3EPT A;  3GUS A;  2M46 A;  1XWK A;  2OAD A;  5F07 A;  2VOC A;  1AQX A;  2P5Q A;  5G1K A;  5HFK A;  3HZ4 A;  2KHP A;  2DJ2 A;  3FEU A;  1H75 A;  4WF4 A;  3VWV A;  3IHQ A;  2X8G A;  4XTS A;  3APO A;  2R6K A;  2H73 A;  2HNL A;  4AGS A;  1TK5 B;  1GTI A;  3BCK A;  3RDW A;  1WRY A;  2IMI A;  3TJF A;  4K7O A;  1BED A;  2B5E A;  3GTU B;  1KNG A;  5AGY A;  5CNW A;  5L71 A;  2YOI A;  3IBH A;  5LD0 A;  3GUR A;  4FO5 A;  2HZE A;  1F6M C;  4NXI A;  3ZRD A;  4E8H A;  3IXR A;  2CA8 A;  1FVJ A;  2XBQ A;  2ALB A;  4PQ1 A;  3GFK A;  3D4T A;  5IMA A;  2C0D A;  3FR6 A;  3KM6 A;  3GKK A;  1XVQ A;  1XWG A;  1I5G A;  1X5D A;  4TN8 A;  1ZMA A;  2I81 A;  4K1F A;  5J5N A;  2CVB A;  2DKI A;  3G7I A;  4ZB9 A;  2PN8 A;  14GS A;  1QGV A;  1R5A A;  3D0Z A;  5CAX A;  2LST A;  1SKS B;  2FWF A;  1S3D A;  2MMZ A;  2X8C A;  13GS A;  1XW9 A;  5IMC A;  3KTL A;  4YQU A;  1JZO A;  4QL7 A;  1T1V A;  3F8U A;  3ZL5 A;  1OKD A;  3FR3 A;  2NVL A;  1GP1 A;  3EMX A;  1A8L A;  5CRE A;  4OCE A;  3DYR A;  3SWL A;  2VLU A;  3ERW A;  4V1A p;  2VO4 A;  2IFQ A;  3KCM A;  2VCQ A;  3GRX A;  4ICY A;  2PER A;  1NM3 A;  3LJR A;  2AAW A;  1NHO A;  1ZOF A;  5KN0 A;  1BYE A;  1T8E B;  4EIP A;  3MYD A;  1EOG A;  3GH6 A;  4KCE A;  4IGJ A;  4L8E A;  3TJK A;  3M9K A;  2YWN A;  2VCX A;  2RUE A;  2VL3 A;  2BJX A;  2YJ7 A;  1CQG A;  3F3R A;  1SJI A;  2CT6 A;  4IVF A;  2GZY A;  3LG6 A;  4EKZ A;  3FK8 A;  4HUA A;  1OE8 A;  3O76 A;  2RII A;  5D73 A;  2L57 A;  2QA1 A;  1SKR B;  2DJ1 A;  4G0K A;  3IRA A;  2GLR A;  1XXU A;  1K0M A;  6GSV A;  2IPA A;  2I9H A;  2LTK A;  2RLI A;  4BVY B;  5AIS A;  3APQ A;  1N2A A;  2EIR A;  1AW9 A;  2FY6 A;  2AHE A;  1A2L A;  4X43 A;  5AIX A;  1GSU A;  5BMU A;  1V2A A;  4FYU A;  2O89 A;  5ID2 B;  2HLS A;  5LCZ A;  1MDJ A;  2E0Q A;  4X0X A;  4K8M A;  4CY8 A;  1ZYE A;  4OD7 A;  5D96 A;  3CRU A;  2ES7 A;  1ZYQ B;  2H1A A;  1EV9 A;  4EDZ A;  2R0G A;  1GRX A;  1Z6M A;  2GS3 A;  3VI5 A;  3UAP A;  2GT5 A;  5D9T A;  2R4V A;  3ZIV A;  3VWU A;  2C0F A;  4FYC A;  1FB6 A;  1XBS A;  4LL1 B;  1ERT A;  4Q5F A;  2GVP A;  5F0G A;  4YAV A;  4N11 A;  3KGK A;  2FA4 A;  2MYG A;  2DMM A;  4O7H A;  3CSI A;  5B8B A;  1AAZ A;  2MMO A;  4Z2T A;  4BA7 A;  4LMW A;  1SD9 A;  2QKE A;  3ERG A;  1ERV A;  5DAL B;  1MD4 A;  4POB A;  4ACS A;  2HFD A;  4GLT A;  1OAZ A;  4BVX B;  1DSB A;  2GQK A;  5ECM B;  5KOW A;  3HDC A;  3UAR A;  4MCU A;  1TRV A;  4J57 E;  4D73 B;  1EWX A;  1YY7 A;  2R0C A;  1AQW A;  4K5R A;  1AIU A;  2YN1 A;  4EXJ A;  4PQI A;  1EOH A;  4ZB6 A;  3UMA A;  2B7J A;  3GYK A;  1GTU A;  2HRA A;  1RQM A;  1YQ1 A;  3FKF A;  5A4U A;  2XHF A;  3EWL A;  4MJC A;  4MA9 A;  5IM9 A;  1UN2 A;  3LW9 A;  4RQX A;  2WDU A;  2HI7 A;  5IOX A;  1AXD A;  5AN1 A;  4Q5R A;  4EUY A;  1OYJ A;  2L4Q A;  4G0I A;  3C1R A;  5DAK B;  2OE1 A;  2FD3 A;  2GT6 A;  1VF1 A;  4MAB A;  3NIV A;  1EGO A;  4WEY A;  1GNW A;  4K2D A;  5ECI B;  4G0L A;  2I1U A;  4YKG A;  1V57 A;  5DQY A;  3H93 A;  3HY2 A;  3C71 A;  4EF0 A;  4HQZ A;  2A4H A;  3PH9 A;  2CQ9 A;  2GSR A;  2DIZ A;  1PSQ A;  4EL1 A;  3FHK A;  4BPY A;  3CTG A; 
#chains in the Genus database with same CATH homology
 4HOJ A;  4GQF A;  4PX1 A;  3RPP A;  3VPQ A;  12GS A;  3DKS A;  3TDG A;  2WUL A;  4JZQ A;  3KIJ A;  2RM6 A;  3OR5 A;  2LJK A;  2B3S A;  1J9B A;  4HZ2 A;  3F3Q A;  1TK0 B;  2ZUP A;  4V1A g;  4WBR D;  4BL7 B;  3VPT A;  2B7K A;  1GUM A;  1B9Y C;  3FR9 A;  1QUW A;  1C72 A;  2VIM A;  2WRT A;  1B48 A;  3D22 A;  4ZL8 A;  3RHB A;  2HSH A;  3KMN A;  3PGT A;  2GSQ A;  2PVQ A;  2VCW A;  1SL1 B;  3VWW A;  3P90 A;  3H79 A;  3F6D A;  2LRC A;  1GLQ A;  3IV4 A;  4TOP A;  3UOM A;  1T3B A;  2GDR A;  1GSD A;  4DSQ A;  3GSS A;  5HR3 A;  1TRU A;  3TRP A;  2A2R A;  1FOH A;  1SU9 A;  3NZN A;  3TJJ A;  2WB9 A;  4KSM A;  8GSS A;  3DVW A;  4F2I A;  2OJL A;  2PPT A;  1TI3 A;  5A4V A;  4ECB A;  1A24 A;  5D93 A;  4GQC A;  2YNX A;  3BCI A;  3IE3 A;  3L4N A;  2A2S A;  3A2X A;  5HFG A;  1SK1 A;  2QC7 A;  2KP2 A;  4NMU A;  3TOT A;  5DCH A;  1FOV A;  1YEX A;  3J7Y k;  2AJQ B;  3ME8 A;  5CRW A;  4MDC A;  6GSW A;  1TU8 A;  5ECL B;  3A2V A;  4ZXG A;  3PIN A;  4WBJ A;  5IPG A;  4MZC A;  4GXZ A;  2H75 A;  4F0B A;  1U88 A;  1TJD A;  2JZT A;  3ZRE A;  1TU7 A;  1YKA A;  3LYP A;  2FHE A;  1GSY A;  5EPF A;  1PD2 1;  5G2Z A;  2KLX A;  3KTB A;  5DVB A;  2O87 A;  1R7H A;  2OAC A;  3LGC A;  1K0D A;  1BG5 A;  3C7M A;  3TKS A;  5FHI A;  2C0G A;  3A5W A;  3ZFB A;  1SYR A;  3UVH A;  1FVK A;  2H0I A;  3F4S A;  1G6Y A;  2DLX A;  4XS4 B;  4E8E A;  2QA2 A;  3WT2 A;  3LSZ A;  3QMX A;  2C0E A;  4P3Y B;  2ON5 A;  2UZ8 A;  5HR2 A;  4HS1 A;  4FIW A;  3IOS A;  4O5Q A;  5GAP D;  5ECR B;  4MF7 A;  1GSF A;  3F9U A;  1M7T A;  1VF2 A;  5ELG A;  4MZW A;  3D4M A;  2YZU A;  5KN2 A;  2AYT A;  2WS2 A;  4K2X A;  1XIY A;  4WKW A;  3FZ4 A;  1LU4 A;  3WD6 A;  2DJJ A;  3M0F A;  1N8J A;  1PX7 A;  3VI7 A;  3WYW A;  4USS A;  1HD2 A;  5ECS A;  1USB A;  2X64 A;  2YV7 A;  2IIY A;  2F9S A;  5ECN B;  5LNK e;  3EC3 A;  1GSQ A;  3E0U A;  3DD3 A;  5ABR A;  5B6N A;  3CRT A;  4HQS A;  2I4A A;  5IMD A;  4OMV A;  1GTA A;  4IKH A;  1XPV A;  2MMA A;  4GCI A;  2XC2 A;  2IMK A;  4KF9 A;  1QK8 A;  5ECH B;  5CRH A;  4OFM A;  1E6B A;  4V2M A;  2FLS A;  3HXS A;  2N5B A;  3ZIT A;  4NWY A;  5IO2 A;  5A4W A;  4G9H A;  1G0T A;  4ZBA A;  5KOX A;  4J2F A;  1V9W A;  2DJ3 A;  1THO A;  4HI7 A;  3IAM 2;  4TXO B;  3GL5 A;  4ML6 A;  2TRX A;  2FUG 2;  4MJE A;  2PWJ A;  5DQS A;  5IMV A;  5HR0 A;  3LXZ A;  2PGT A;  4LA1 A;  2VM1 A;  1SD8 A;  1ON4 A;  1GLP A;  4AF2 A;  3ZVJ A;  2L4C A;  2DIY A;  4TR3 A;  4OO4 A;  4ECJ A;  1PN0 A;  4NHZ A;  1ZYN A;  4IBP A;  3LEF A;  2L5L A;  1PMT A;  1HQO A;  3G9B A;  1T00 A;  4IJI A;  3Q18 A;  4DVC A;  5KEJ A;  4KX4 A;  2K18 A;  1OVN A;  5KN1 A;  1JZD A;  1X5E A;  4N0V A;  2MMN A;  3CBU A;  2V6K A;  1A8Y A;  2C1Y A;  4EE0 A;  2DC5 A;  5J3R A;  1JZR A;  2B1K A;  1M2B A;  2KP1 A;  2F8A A;  2K8S A;  1G6W A;  4L5L A;  1F2E A;  4MPF A;  2IME A;  4JRR A;  4TXV A;  2K6V A;  2YP6 A;  1Y6E A;  4GWR A;  5ENU A;  4IW9 A;  2DJK A;  4KB3 A;  4J56 E;  2R0P A;  3UIW A;  4H86 A;  4NV2 A;  3CTF A;  3DWV A;  1F9M A;  1RW1 A;  4N10 A;  4O32 A;  5COH A;  5EY6 A;  2CV4 A;  1XVW A;  3UBL A;  3ZIJ A;  3BBY A;  3W6G A;  1SK2 A;  1ST9 A;  1W4V A;  3G7Y A;  4PXO A;  1LBK A;  1T4Z A;  3IR4 A;  5G5F A;  3C1S A;  1UA5 A;  4DSS B;  3AY8 A;  3WGE A;  1FAA A;  2DML A;  3IAS 2;  1FW1 A;  1XOB A;  2GSS A;  3GKN A;  3VFI A;  2C8U A;  5JWQ B;  3GKX A;  2VCT A;  1PX6 A;  3W8J A;  3I43 A;  1K0C A;  4MP4 A;  4KDX A;  2O85 A;  3M9J A;  4TR1 B;  3PR8 A;  1EV4 A;  1K0O A;  3ZYW A;  3GTU A;  5H5S A;  5A5K A;  19GS A;  1JLW A;  4GST A;  2M80 A;  6GSY A;  3U5R E;  5ECK B;  2WGR A;  3K8N A;  2X99 A;  3QOU A;  4IS0 A;  3TKQ A;  4K7N A;  1V98 A;  1QQ2 A;  2JU5 A;  2AUV A;  2JSY A;  1GH2 A;  4X1U A;  2X4A A;  3M3M A;  1ZL9 A;  4KW6 A;  2BTO T;  1SJ6 A;  4ID0 A;  4OCF A;  5CP1 A;  4RI6 A;  1YEP A;  4HZ4 A;  4I2T A;  3L0H A;  1GWC A;  2MZC A;  3F6F A;  5ECP B;  3DML A;  4A5P A;  4ZL7 A;  1K0B A;  2GQL A;  3U6V A;  3I69 A;  4PUA A;  3APS A;  1O8X A;  4YH2 A;  3H1N A;  1FB0 A;  4TR0 A;  2HRK A;  4NPB A;  3V1W A;  1X9S B;  1OC9 B;  4ZL9 A;  2HXK A;  1A2J A;  1AQV A;  2JAD A;  2GQM A;  3ZZX A;  1YJ6 A;  2A2P A;  4LMV A;  2R3X A;  4QL9 A;  1A2M A;  2P5R A;  2PBJ A;  3IK9 A;  4GSS A;  4IEL A;  5ECO B;  4PTS A;  3P8W A;  4TW5 A;  2HZF A;  3TB2 A;  3KP8 A;  4CY6 A;  2G2Q A;  1URM A;  4OFN A;  4PUR A;  2IL3 A;  3ZTL A;  5F05 A;  1TRS A;  3GH9 A;  1TI1 A;  2LJR A;  3QPM A;  1M0U A;  3LFL A;  3Q19 A;  1MDK A;  4PUF C;  2FGX A;  1KTE A;  2HE3 A;  3DIE A;  5FWG A;  3MSZ A;  4EO3 A;  2HSM A;  4NHW A;  4KA0 A;  4G2E A;  1O81 A;  3TCO A;  3GV1 A;  1JFU A;  4KH7 A;  2N5A A;  4BVY A;  4MZB A;  4YQM A;  2PVO C;  1G7E A;  2H1G A;  3KH7 A;  3MIX A;  3ME7 A;  1H4O A;  5JWR B;  18GS A;  4K9Z A;  3R3E A;  5D9V A;  1GUK A;  3VWX A;  1WE0 A;  2XBI A;  5B7C A;  2KOK A;  3TKS E;  4O5U A;  3BD2 A;  4MJA A;  3KP9 A;  2TIR A;  1QFN A;  3HA9 A;  4F9Z A;  1TKD B;  4YAP A;  4ISD A;  1DE1 A;  2VCZ A;  1Z3E A;  5EL8 A;  4N0Z A;  3QD9 A;  3RBT A;  5CRD A;  2YWI A;  3EE2 A;  3HVX A;  2PMT A;  3KEB A;  5JWO B;  1UVZ A;  3HHV A;  1K0A A;  2JL4 A;  2LNS A;  4EIQ A;  2H6Z A;  3A5I A;  5DAL A;  2YWO A;  4L0U A;  3L9S A;  3D21 A;  3FW2 A;  2B5X A;  3F4T A;  4XRA A;  2DBC A;  3FZA A;  2QSI A;  1OC8 A;  3L9U A;  3LWA A;  4LLR A;  1XFL A;  2HZE B;  3TKS C;  5J4U A;  1JLV A;  2YCD A;  4D73 A;  1U87 A;  2H66 A;  2I3Y A;  4F82 A;  2CZ2 A;  2NBS A;  1YF0 A;  4KDY A;  1U6T A;  2R5G A;  4MK3 A;  1VRS D;  5H5Q A;  3BJ5 A;  1VF4 A;  1A0F A;  3G7J A;  4CDO A;  4WF5 A;  1G7O A;  4ZBB A;  4BWQ A;  1QMV A;  3HVS A;  4K5S A;  1THX A;  4GF0 A;  4GSN A;  4MPG A;  3FY7 A;  3ZFL A;  5CRG A;  2K8V A;  3RAZ A;  4IJ3 A;  4DSR A;  4AJ6 A;  2PU9 C;  1Q4J A;  2P31 A;  2LKU A;  3QFA C;  4NAX A;  1TOF A;  4DEJ A;  4WXT A;  3GN3 A;  2F3M A;  2C80 A;  2AV4 A;  3CSH A;  4IP1 A;  4Q5Q A;  4FQU A;  1TXX A;  3GIX A;  2V32 A;  4G19 A;  4EDY A;  5DAK A;  3KD0 A;  2H72 A;  2LNT A;  3EVI A;  5G5E A;  2HYX A;  2REM A;  3FRC A;  3TKP A;  2IFQ B;  2H71 A;  4TVE A;  5B8A A;  4MH3 A;  3TKR A;  2EC4 A;  4FYB A;  1B8X A;  1OC3 A;  3LOR A;  4KCA A;  1O6J A;  1F3A A;  4ZB8 A;  1Z7R A;  3TJB A;  17GS A;  1EEM A;  1PKW A;  3TRX A;  5JCU A;  2E2G A;  2H76 A;  3VUR A;  5GAN D;  1OE7 A;  2H0G A;  2WJU A;  4JR4 A;  4I97 A;  4PNF A;  1JHB A;  3L9V A;  4PQH A;  2J23 A;  4JU5 A;  5HFI A;  3GST A;  4ZIJ A;  2YAN A;  1DE2 A;  1BAY A;  1Z9H A;  1SJZ A;  1ILO A;  1MEK A;  4BWS A;  4MNN A;  1B4P A;  2P0G A;  4HJ2 A;  5B6M A;  3QAG A;  4HJM A;  4Q5N A;  2F51 A;  4G10 A;  5DCG A;  2OE0 A;  4OWY A;  4XRD A;  3UL3 A;  3S9F A;  1SEN A;  4AJ7 A;  2NPB A;  3Q6O A;  2LQO A;  1TP9 A;  4IQ1 A;  2K9F A;  1M2D A;  1SKW B;  2HRF A;  1QXH A;  1NW2 A;  4L5O A;  6GSU A;  2C3N A;  2OA7 A;  1KEB A;  1GTB A;  5DDL A;  3I9V 2;  3KXO A;  2LV3 A;  1GSS A;  3Q74 A;  3TRQ A;  5IPH A;  1JZW A;  1RK4 A;  3GL3 A;  1R5P A;  3A3T A;  2GTU A;  5CYY A;  1GSE A;  4RQR A;  4EC0 A;  3WGD A;  1X9W B;  1GNE A;  3GX0 A;  3F4R A;  3FYG A;  3EYT A;  5J9B A;  4XCS A;  3M1G A;  2E2M A;  1U3I A;  1WWJ A;  5HR1 A;  6GSX A;  5IMF A;  1GUL A;  2VAF A;  1O8W A;  1F37 A;  3KMO A;  3P7X A;  4JR6 A;  5IO0 A;  1LJR A;  1IYI A;  1SYX A;  3SBC A;  3D6I A;  1W89 A;  3IK7 A;  3LYK A;  1FG4 A;  1UC7 A;  2BMX A;  2IMF A;  3MWH A;  5D8I A;  2A4V A;  2X49 A;  3C73 A;  2VCV A;  4ECI A;  1B4Q A;  2CZ3 A;  3ZML A;  1T4Y A;  1TRW A;  3BOA A;  2G0F A;  3QCP A;  1YDK A;  3N9J A;  4ULX A;  3GNJ A;  1XW5 A;  2IWT A;  4IQA A;  1WMJ A;  2VD0 A;  4XS1 A;  2H8L A;  3CYN A;  3F63 A;  1O7U A;  5G31 A;  1AC1 A;  2HT9 A;  5GZZ B;  1XWA A;  3E9J B;  2V2G A;  1FHE A;  3KZQ A;  2LUS A;  3KJY A;  4HDE A;  1ERU A;  1K0N A;  1TTZ A;  2DSA A;  2OBK A;  4LL4 B;  3TOU A;  1DUG A;  2HSY A;  3EUR A;  3FMW A;  3TGZ A;  4XS4 A;  5KN3 A;  11GS A;  4FH8 A;  1X9M B;  2Z9S A;  2OBI A;  1ERW A;  2YV9 A;  2E7P A;  2FWE A;  1EGR A;  4V2L A;  4GRF A;  3GKM A;  3HJP A;  5CO3 A;  2H74 A;  1XWB A;  1WIK A;  2H6X A;  4EVM A;  5INY A;  1SL0 B;  3ZVJ D;  1NHY A;  2YPM A;  3HYP A;  1WOU A;  3GMF A;  4KDU A;  4MF6 A;  4NV5 A;  4POL A;  4GTU A;  5JCG A;  2NTO A;  2YWM A;  3LQ7 A;  3GA4 A;  7GSS A;  2GZZ A;  4MF5 A;  2MBS A;  1HYU A;  3CXG A;  5C04 A;  4IP6 A;  2KUC A;  4KSO A;  2CX3 A;  5F06 A;  1M2A A;  1U3A A;  3O6T A;  4WR4 A;  2H19 A;  3FZ9 A;  22GS A;  2FCH A;  3UEM A;  5IOW A;  4JE1 A;  3IA1 A;  4F03 A;  4CW9 A;  4XS6 A;  1J08 A;  2ZNM A;  1IYH A;  3EU3 A;  2IN3 A;  4MLY A;  3M8N A;  2V41 A;  4I5Q A;  4WR5 A;  4HU9 A;  4Z7X A;  3DGQ A;  1R26 A;  9GSS A;  1T7P B;  16GS A;  3HKR A;  2CVK A;  1K3Y A;  1EEJ A;  3KH9 A;  1WPI A;  3ED3 A;  1TDI A;  3LXT A;  3FZ5 A;  2VLV A;  3QAV A;  5EVO A;  1M99 A;  3O3T A;  5GST A;  4L0W A;  2C3T A;  1AUC A;  2IMD A;  4YQV A;  1ZCP A;  4PGT A;  2O8V B;  4TXO A;  4WET A;  4X4J A;  3WT1 A;  2B1L A;  2R2J A;  3HJO A;  4KUN A;  1M9A A;  1F3B A;  4KE3 A;  5JCW A;  3PPU A;  1M9B A;  4YKF A;  3R2Q A;  3UJ1 A;  1Y25 A;  1MDI A;  3EIN A;  3W8S A;  3MAK A;  6GST A;  2OE3 A;  1ZZY A;  1PA3 A;  2LRN A;  3P2A A;  2YJH A;  2PUK C;  2HRN A;  1BJX A;  3VK9 A;  1HNC A;  1NSW A;  1O85 A;  4POK A;  2X8H A;  3UVT A;  3H8Q A;  2H1D A;  2JAC A;  3TUE A;  1A23 A;  2GST A;  3GX8 A;  1MD3 A;  4Z2U A;  3JCM L;  1K3O A;  1WJK A;  2D2Z A;  5HQP A;  3QR6 A;  2GZP A;  4O92 A;  1TK8 B;  5IQY A;  2CVD A;  3IC4 A;  4XIH A;  2V6O A;  3QAW A;  1XCC A;  2L59 A;  5J41 A;  5D9X A;  2LJA A;  2YZH A;  4TR4 A;  3H4K A;  1J0F A;  3EU4 A;  1B9X C;  3MNG A;  2C3Q A;  2RM5 A;  1DBY A;  4KAE A;  5G1L A;  3ZLP A;  5GSS A;  5IMZ A;  2J9H A;  2VD1 A;  3I6A A;  2JZS A;  2WZ9 A;  1O73 A;  4MMM A;  4IN0 A;  3EMP A;  2FNO A;  3HJM A;  1XWC A;  4DSS A;  1MTC A;  2FWH A;  2FWG A;  4F0C A;  3DEX A;  2L6C A;  1CQH A;  4MJB A;  4RUV A;  2VUP A;  5D9W A;  2LS5 A;  5E59 A;  1YZX A;  5C00 A;  3US3 A;  4ZBD A;  2EIO A;  3N5O A;  5E4W A;  4OFT A;  5ID2 A;  3CMI A;  2H6Y A;  2AB6 A;  2L6D A;  1XOA A;  1E2Y A;  2IJY A;  2LEG A;  4TR1 A;  5J9C A;  3A2W A;  3HD5 A;  1S3A A;  4AJ8 A;  3ZMK A;  1WP0 A;  2N5F A;  3DRN A;  4JED A;  4Z2R A;  2ZCT A;  1BX9 A;  1YF1 A;  2GGT A;  3NOF A;  1XW6 A;  1X5C A;  5DJM A;  1GL8 A;  3CSJ A;  2H01 A;  4TRX A;  5G30 A;  2VLT A;  2NDO A;  3D5J A;  2XPE A;  4HEA 2;  2F8F A;  4K0G A;  1S3C A;  2TRC P;  1VF3 A;  1ABA A;  2LQQ A;  2CAI A;  5BRT A;  2VL9 A;  4BVX A;  4O5R A;  2MBT A;  2L5O A;  2H30 A;  4XHM A;  4ZIL A;  4OO5 A;  4I6X A;  3DXB A;  5DJL A;  10GS A;  3TJG A;  1SK0 A;  1TW9 A;  1EP7 A;  20GS A;  2DKH A;  1HNA A;  2WCI A;  4K7I A;  3C8E A;  1PKZ A;  2M72 A;  3VLN A;  1Z7P A;  2WFC A;  2RUF A;  4RI7 A;  1OC9 A;  2R37 A;  2B6M A;  3HZ8 A;  3IC8 A;  3QDN A;  3IPZ A;  2OKA A;  1X0R A;  1PQN A;  4POM A;  2H70 A;  4MH2 A;  4N30 A;  4I8B A;  4TKY A;  1XZO A;  2EIQ A;  1VGL A;  3DVX A;  1ACV A;  5IIZ A;  4KGI A;  1K3L A;  3IDV A;  5ECQ B;  2XPD A;  1YKC A;  3RHC A;  1ZGN A;  5F8B A;  1HNB A;  2VL2 C;  1V40 A;  2H0H A;  2H1B A;  4K6X A;  3J7Y b;  1V58 A;  6GSS A;  3QFB C;  5ELA A;  3E3E A;  2FA8 A;  4KND A;  1SL2 B;  1GUH A;  4JBB A;  4IHU A;  4QQ7 A;  1PRX A;  5DBQ A;  3HCZ A;  1PL1 A;  1R4W A;  2QGV A;  1KBN A;  3F0I A;  3WGX A;  3GHA A;  3HVV A;  2JZR A;  1PN9 A;  3L78 A;  2O7K A;  3RPN A;  5AIV A;  1ZYP A;  1ML6 A;  5FT3 A;  3MDK A;  1PL2 A;  4I2U A;  1Z5Y E;  4ECC A;  4K0N A;  1I9D A;  1OKT A;  2ON7 A;  1PGT A;  2VL2 A;  2CX4 A;  1Q98 A;  5H5R A;  1A0R P;  2LRT A;  4BL7 A;  1EP8 A;  4V2N A;  4CHS A;  3IHG A;  1Z6N A;  2C4J A;  4PNG A;  4ML1 A;  1FO5 A;  2B5Y A;  4HU7 A;  2JSZ A;  1EZK A;  4ILF A;  3UBK A;  2V1M A;  2CAQ A;  1BQ7 A;  2VM2 A;  3ISO A;  3ERF A;  2DJ0 A;  3EPT A;  3GUS A;  2M46 A;  1XWK A;  2OAD A;  5F07 A;  2VOC A;  1AQX A;  2P5Q A;  5G1K A;  5HFK A;  3HZ4 A;  2KHP A;  2DJ2 A;  3FEU A;  1H75 A;  4WF4 A;  3VWV A;  3IHQ A;  2X8G A;  4XTS A;  3APO A;  2R6K A;  2H73 A;  2HNL A;  4AGS A;  1TK5 B;  1GTI A;  3BCK A;  3RDW A;  1WRY A;  2IMI A;  3TJF A;  4K7O A;  1BED A;  2B5E A;  3GTU B;  1KNG A;  5AGY A;  5CNW A;  5L71 A;  2YOI A;  3IBH A;  5LD0 A;  3GUR A;  4FO5 A;  2HZE A;  1F6M C;  4NXI A;  3ZRD A;  4E8H A;  3IXR A;  2CA8 A;  1FVJ A;  2XBQ A;  2ALB A;  4PQ1 A;  3GFK A;  3D4T A;  5IMA A;  2C0D A;  3FR6 A;  3KM6 A;  3GKK A;  1XVQ A;  1XWG A;  1I5G A;  1X5D A;  4TN8 A;  1ZMA A;  2I81 A;  4K1F A;  5J5N A;  2CVB A;  2DKI A;  3G7I A;  4ZB9 A;  2PN8 A;  14GS A;  1QGV A;  1R5A A;  3D0Z A;  5CAX A;  2LST A;  1SKS B;  2FWF A;  1S3D A;  2MMZ A;  2X8C A;  13GS A;  1XW9 A;  5IMC A;  3KTL A;  4YQU A;  1JZO A;  4QL7 A;  1T1V A;  3F8U A;  3ZL5 A;  1OKD A;  3FR3 A;  2NVL A;  1GP1 A;  3EMX A;  1A8L A;  5CRE A;  4OCE A;  3DYR A;  3SWL A;  2VLU A;  3ERW A;  4V1A p;  2VO4 A;  2IFQ A;  3KCM A;  2VCQ A;  3GRX A;  4ICY A;  2PER A;  1NM3 A;  3LJR A;  2AAW A;  1NHO A;  1ZOF A;  5KN0 A;  1BYE A;  1T8E B;  4EIP A;  3MYD A;  1EOG A;  3GH6 A;  4KCE A;  4IGJ A;  4L8E A;  3TJK A;  3M9K A;  2YWN A;  2VCX A;  2RUE A;  2VL3 A;  2BJX A;  2YJ7 A;  1CQG A;  3F3R A;  1SJI A;  2CT6 A;  4IVF A;  2GZY A;  3LG6 A;  4EKZ A;  3FK8 A;  4HUA A;  1OE8 A;  3O76 A;  2RII A;  5D73 A;  2L57 A;  2QA1 A;  1SKR B;  2DJ1 A;  4G0K A;  3IRA A;  2GLR A;  1XXU A;  1K0M A;  6GSV A;  2IPA A;  2I9H A;  2LTK A;  2RLI A;  4BVY B;  5AIS A;  3APQ A;  1N2A A;  2EIR A;  1AW9 A;  2FY6 A;  2AHE A;  1A2L A;  4X43 A;  5AIX A;  1GSU A;  5BMU A;  1V2A A;  4FYU A;  2O89 A;  5ID2 B;  2HLS A;  5LCZ A;  1MDJ A;  2E0Q A;  4X0X A;  4K8M A;  4CY8 A;  1ZYE A;  4OD7 A;  5D96 A;  3CRU A;  2ES7 A;  1ZYQ B;  2H1A A;  1EV9 A;  4EDZ A;  2R0G A;  1GRX A;  1Z6M A;  2GS3 A;  3VI5 A;  3UAP A;  2GT5 A;  5D9T A;  2R4V A;  3ZIV A;  3VWU A;  2C0F A;  4FYC A;  1FB6 A;  1XBS A;  4LL1 B;  1ERT A;  4Q5F A;  2GVP A;  5F0G A;  4YAV A;  4N11 A;  3KGK A;  2FA4 A;  2MYG A;  2DMM A;  4O7H A;  3CSI A;  5B8B A;  1AAZ A;  2MMO A;  4Z2T A;  4BA7 A;  4LMW A;  1SD9 A;  2QKE A;  3ERG A;  1ERV A;  5DAL B;  1MD4 A;  4POB A;  4ACS A;  2HFD A;  4GLT A;  1OAZ A;  4BVX B;  1DSB A;  2GQK A;  5ECM B;  5KOW A;  3HDC A;  3UAR A;  4MCU A;  1TRV A;  4J57 E;  4D73 B;  1EWX A;  1YY7 A;  2R0C A;  1AQW A;  4K5R A;  1AIU A;  2YN1 A;  4EXJ A;  4PQI A;  1EOH A;  4ZB6 A;  3UMA A;  2B7J A;  3GYK A;  1GTU A;  2HRA A;  1RQM A;  1YQ1 A;  3FKF A;  5A4U A;  2XHF A;  3EWL A;  4MJC A;  4MA9 A;  5IM9 A;  1UN2 A;  3LW9 A;  4RQX A;  2WDU A;  2HI7 A;  5IOX A;  1AXD A;  5AN1 A;  4Q5R A;  4EUY A;  1OYJ A;  2L4Q A;  4G0I A;  3C1R A;  5DAK B;  2OE1 A;  2FD3 A;  2GT6 A;  1VF1 A;  4MAB A;  3NIV A;  1EGO A;  4WEY A;  1GNW A;  4K2D A;  5ECI B;  4G0L A;  2I1U A;  4YKG A;  1V57 A;  5DQY A;  3H93 A;  3HY2 A;  3C71 A;  4EF0 A;  4HQZ A;  2A4H A;  3PH9 A;  2CQ9 A;  2GSR A;  2DIZ A;  1PSQ A;  4EL1 A;  3FHK A;  4BPY A;  3CTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...