2VIMA

X-ray structure of fasciola hepatica thioredoxin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
104
structure length
104
Chain Sequence
b'MRVLATAADLEKLINENKGRLIVVDFFAQWCGPCRNIAPKVEALAKEIPEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRETITRHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title The Fasciola Hepatica Thioredoxin: High Resolution Structure Reveals Two Oxidation States.
pubmed doi rcsb
source organism Fasciola hepatica
molecule tags Oxidoreductase
total genus 37
structure length 104
sequence length 104
ec nomenclature ec 1.8.4.8: Phosphoadenylyl-sulfate reductase (thioredoxin).
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vimA00
5J41A 3VWXA 1XOBA 3BBYA 3TKSE 2OACA 5B7CA 1GSFA 3VFIA 2GVPA 1GUMA 1YZXA 5CAXA 3GKNA 2LKUA 2H72A 2O87A 4FYUA 4K8MA 2CAIA 1W89A 3UBLA 1NSWA 4EL1A 2L5LA 5F0GA 3HJMA 3E9JB 3BCKA 1HNAA 3I69A 1KEBA 4IBPA 1NW2A 2FD3A 4DSSA 5AN1A 4KB3A 4F03A 4MPFA 3VK9A 2QGVA 4MLYA 3FZ9A 3LGCA 1OE7A 4J56E 4POBA 1K0AA 4WETA 3KD0A 4NXIA 2VUPA 3F8UA 5ECLB 3WGXA 3NIVA 1MEKA 2PWJA 5HR2A 4O92A 2OBKA 3NZNA 3DD3A 4XRAA 3C73A 1GNWA 5CRWA 5DCGA 3EMPA 5B8AA 3M1GA 2IWTA 2HE3A 1XIYA 4I2TA 3TB2A 1VF2A 3TJJA 3W8JA 2H6XA 2R2JA 1OKDA 5DAKA 1GTAA 3CRUA 3HXSA 1GSYA 3D6IA 1PMTA 1M2BA 4PUAA 3GIXA 1ZMAA 1I9DA 4WR5A 1MDIA 1TU7A 2YJHA 2ES7A 2GQMA 4ML6A 2ZUPA 1B4QA 4KA0A 3A2VA 4AJ7A 3CXGA 2H75A 1M7TA 2DJKA 1S3AA 4ZBAA 3D22A 1WOUA 4IQ1A 5G1LA 4WF4A 3TKSA 4TN8A 3QDNA 3EU3A 3F6DA 4IVFA 3ZL5A 3KP9A 2E2MA 2OKAA 3LYKA 4YQUA 2H76A 1XW5A 2A4VA 4AJ6A 22GSA 2FGXA 2KP2A 2VLUA 1TRUA 1TKDB 6GSVA 5JWOB 4CHSA 1EEMA 4YAPA 4MF5A 2I81A 1PA3A 3KIJA 4NHZA 2AV4A 3ERWA 3Q18A 1A2JA 4V1Ap 5DALA 2X64A 5EY6A 2IN3A 1AQXA 4GTUA 3EURA 2YN1A 2VD1A 5D9VA 1RK4A 1T3BA 2LJKA 1K3OA 5H5QA 4ZB6A 2L5OA 3RAZA 1KTEA 2XPEA 4XCSA 1UVZA 3FW2A 2L6DA 2PN8A 1OC9A 5IPHA 1OYJA 5IO2A 2M72A 2FWGA 5B6NA 1A23A 5ENUA 3UBKA 5IMDA 3ZZXA 2LS5A 1JLWA 4KDXA 4WXTA 3I43A 4ZL8A 5JWRB 3HZ4A 3M3MA 1TXXA 2CZ3A 2YV7A 3CSIA 1YKAA 5ABRA 3GFKA 1XPVA 4GXZA 1N2AA 2HLSA 4NPBA 2X8GA 2VD0A 9GSSA 3FEUA 2F8FA 1THOA 3LORA 2JZRA 4IGJA 4I5QA 1FOVA 5HR3A 1V40A 3GKKA 2LRTA 4TR0A 1F3AA 5GSTA 2GS3A 1NM3A 1BX9A 2CV4A 3EINA 5ECHB 3KTBA 1SL1B 4OCFA 2C3NA 1AW9A 1W4VA 4PUFC 4OO5A 4BPYA 4Z7XA 3WD6A 2NDOA 3UL3A 1K0CA 2H73A 2V32A 2OE1A 1MDKA 2RM6A 1U87A 3AY8A 1GWCA 2QSIA 1FB6A 3DVWA 4MP4A 2B5YA 2B6MA 5CO3A 4TW5A 2H1AA 4KCAA 3VWVA 3H93A 3QPMA 1AAZA 2RUFA 2K9FA 3TGZA 3TCOA 4ILFA 1BJXA 4XHMA 5KN2A 1EP8A 4MZWA 5LNKe 4FIWA 3UIWA 5ECNB 5GAND 2IMFA 1XBSA 4KAEA 2K8VA 2PVOC 3MNGA 1H75A 1PKWA 5HQPA 2VLVA 1Z6NA 2MYGA 1FB0A 3RHCA 4E8EA 4EE0A 1ZYEA 1T8EB 5KEJA 4ECBA 5J9BA 2JL4A 1SD8A 16GSA 1PL2A 3DMLA 1EOGA 3ZFLA 2YP6A 5DJLA 1B9YC 2R4VA 2V41A 2IPAA 2CAQA 3E3EA 1PGTA 1DSBA 2H0HA 4TR1B 3LSZA 2DIZA 1IYIA 5ELAA 1B4PA 1K0BA 4YH2A 4O5RA 2C3TA 4MJCA 4PX1A 1UC7A 1M9AA 5KN1A 2VO4A 3ZFBA 5E4WA 1M99A 4N10A 1GTIA 3KH7A 1JZWA 4OMVA 5A4VA 1FW1A 2X8CA 5ECMB 2VCQA 2VL2C 2C0GA 1PN9A 4XTSA 5B8BA 2HSYA 3FZAA 3CSHA 1SKRB 4MPGA 3LXTA 2XPDA 3HKRA 2QKEA 4BWSA 2B3SA 3KTLA 4RI6A 1TRSA 2PERA 1GL8A 1F6MC 1AUCA 1B8XA 4QQ7A 1JZOA 2PPTA 3FR9A 5HFKA 4HU7A 3FK8A 4QL7A 4V2MA 2OBIA 5LD0A 2PUKC 3WT2A 3MAKA 3D0ZA 1GNEA 3F6FA 1WPIA 5HFGA 4L5OA 7GSSA 1GSUA 2BJXA 2DMMA 2H6ZA 4G9HA 5IMVA 3TRQA 3Q74A 3GN3A 2FWFA 2IIYA 5G31A 4MJEA 12GSA 1EOHA 1X5CA 1SJIA 2G0FA 2LNSA 4IN0A 4GLTA 3GH6A 2GDRA 4N0ZA 1MD4A 3R2QA 2RM5A 4ZIJA 1A2MA 4L8EA 3UARA 3HYPA 2N5BA 4I6XA 4I2UA 2VCVA 3KCMA 1SENA 2IJYA 3L0HA 3L9UA 2AB6A 3GHAA 1A2LA 2AJQB 2D2ZA 2MMZA 2PBJA 1QUWA 2CA8A 2GQKA 3SWLA 1JZDA 4N0VA 1DUGA 5ECQB 1PKZA 4WR4A 1EGOA 3K8NA 2C0EA 13GSA 2GZPA 2JZTA 4NV5A 2HRNA 3KZQA 4FYCA 1T4YA 3IK9A 5DCHA 1K3LA 3EYTA 3L78A 3W6GA 4G19A 4K9ZA 5IPGA 1B48A 1X9SB 3ZVJD 1Y25A 1XWCA 1T4ZA 3TRPA 3F4RA 2DMLA 5IMFA 4D73B 4V2NA 3FR3A 1V2AA 1JZRA 4HS1A 3VWWA 4Q5QA 3KH9A 2R3XA 5ELGA 4EUYA 2F8AA 2B7JA 2H6YA 2CX4A 2LQQA 5F06A 2I4AA 1BG5A 5IQYA 2C1YA 4K0GA 4OWYA 1AQVA 2LRCA 4J57E 1MDJA 2H0GA 2VM2A 3IXRA 2DSAA 4ACSA 2JZSA 4ECJA 1TRVA 3ZMKA 1Z3EA 3FZ4A 3Q19A 1PL1A 1TTZA 3W8SA 1SK1A 4MJAA 1F37A 1YEPA 4PNFA 4TXOA 4F0BA 2VM1A 2PVQA 1OVNA 2WDUA 3CRTA 5D9TA 4K2DA 1TU8A 4IELA 4ZBDA 4ZB8A 2NTOA 1PQNA 3GL3A 1OC3A 2FY6A 2I1UA 2I9HA 4K6XA 1T00A 2XHFA 1XVWA 3TKSC 6GSSA 3DEXA 3M9KA 5AISA 3DIEA 1BAYA 2H01A 2IMDA 1GSSA 1X5EA 1IYHA 2OADA 1RW1A 3QAGA 2CQ9A 3TJKA 3P90A 3QD9A 2N5AA 5HR0A 1N8JA 3IBHA 1TI1A 2X8HA 5F05A 4MZBA 4K1FA 4GSSA 3E0UA 2ALBA 5ECRB 3EVIA 4PXOA 2HI7A 5FWGA 1K3YA 1VF4A 4NHWA 5INYA 2JSYA 3KEBA 2GSQA 2RIIA 2ON5A 2KP1A 5FHIA 5GZZB 1MTCA 3ZITA 1O7UA 3G9BA 3HDCA 2DBCA 4I97A 1NHYA 3IPZA 2KUCA 5B6MA 1EP7A 4WKWA 1ERVA 3GX0A 1GUKA 1TI3A 1SYXA 4IHUA 1AIUA 1SJZA 3A3TA 3ZREA 5CREA 3MDKA 4RI7A 1FVKA 2HT9A 1JLVA 4HZ4A 2ON7A 3IOSA 3D5JA 3O76A 3C71A 4WF5A 4L0WA 2FNOA 1G0TA 5D9XA 2JU5A 4N30A 1G6YA 2MZCA 1YQ1A 3D21A 1XWAA 3LJRA 2LJRA 5COHA 4HJ2A 1M2AA 1Q4JA 4GSTA 5D73A 4K0NA 1EZKA 1WE0A 1J9BA 3FKFA 3S9FA 2EIOA 5IOWA 2MBTA 4V1Ag 1A8YA 5CRDA 2GTUA 3F9UA 2MMAA 2A2SA 4MH2A 1EV9A 2VL3A 2VIMA 2DJ2A 1DE2A 4V2LA 3F0IA 3GKMA 4GWRA 2CVKA 3RHBA 2H8LA 3FZ5A 3Q6OA 4MH3A 1K0MA 5G5FA 4LA1A 2NVLA 3GL5A 2IFQA 4JR4A 3HJOA 1CQHA 1OKTA 2HFDA 14GSA 4G10A 3LEFA 3QFBC 5C00A 2XBIA 6GSTA 1F2EA 3ERGA 5ID2B 3IV4A 4LL4B 5ECIB 4P3YB 3UMAA 4IW9A 6GSYA 4ZL9A 4I8BA 2H1DA 2BMXA 2GT5A 3KJYA 3EE2A 4N11A 5A4UA 4GF0A 1Z7RA 1T7PB 2B7KA 4ECIA 1U3AA 2O89A 3I6AA 2XBQA 3IR4A 1Q98A 2CVDA 4OFMA 1XW9A 3LQ7A 3HA9A 4TR3A 4IJ3A 5EVOA 3J7Yb 3ZIJA 3TOUA 1PX7A 3PINA 2QC7A 2YWIA 3CTFA 4FYBA 3WGEA 2YOIA 1YDKA 2RLIA 5G2ZA 2NBSA 2EC4A 2IMKA 1XZOA 3CMIA 3IAS2 2R37A 1VF3A 4X1UA 3H4KA 1YKCA 2NPBA 4EO3A 3ZLPA 3L9SA 1R7HA 1F3BA 4JU5A 2PMTA 3VI5A 4EDYA 2GSSA 2REMA 1LJRA 1XFLA 3EMXA 2M80A 4MF6A 1Z5YE 3HD5A 2L6CA 3MWHA 1PD21 1YY7A 4JZQA 4RQXA 2O8VB 1O85A 3HVSA 2B1LA 2X99A 4JRRA 1X0RA 5IOXA 3TRXA 1ZOFA 2L59A 4PGTA 4HOJA 4QL9A 2E0QA 3JCML 2V2GA 1YEXA 3US3A 3QCPA 3RDWA 4PQHA 1SK0A 5EPFA 2OA7A 3PR8A 1YF0A 2YJ7A 4KSMA 1R5AA 5AIVA 3KXOA 5GSSA 3GTUB 1QQ2A 2DJ1A 1TP9A 3N5OA 2L4QA 5L71A 4F9ZA 2VAFA 3PGTA 3ZVJA 2LEGA 3FHKA 3U6VA 4ZXGA 3GNJA 1GSQA 4Q5RA 1GLPA 3ZRDA 1X9MB 3O3TA 2VCXA 4EDZA 1EEJA 5D96A 1WP0A 1YF1A 1ILOA 3P8WA 3G7YA 1EWXA 1O73A 4IP6A 1SKSB 4HZ2A 1OE8A 4POKA 3IK7A 2H30A 5A5KA 1M2DA 3DGQA 1OC8A 2YANA 3GX8A 3TKRA 3N9JA 3ZIVA 1HNBA 4JBBA 4F0CA 4GCIA 5A4WA 4GQCA 4JEDA 4KDUA 4MA9A 4DEJA 3ZMLA 2HZEA 1GP1A 3GH9A 3C1RA 4MK3A 4ZL7A 1TJDA 3DXBA 1B9XC 4MCUA 5F8BA 2YPMA 3QMXA 2O7KA 4XS4A 1WMJA 1SJ6A 1A0RP 5ECPB 2GQLA 2JADA 4POMA 2DC5A 4AGSA 2OE3A 2DLXA 1M9BA 4LMVA 2A2RA 4GSNA 4ULXA 5IMZA 5KN0A 2BTOT 1U88A 4MDCA 2YZHA 1Z6MA 1A24A 1V9WA 4KX4A 2FWHA 4LMWA 1U6TA 4HU9A 2O85A 2AYTA 2YWOA 5JCUA 4X0XA 4TRXA 1USBA 4YQVA 1TW9A 2HRFA 4WBRD 4K7IA 3P7XA 1G6WA 4EVMA 4MF7A 2FLSA 1K0DA 3PH9A 4Q5NA 2C80A 4L0UA 3HJPA 2YV9A 3HVXA 4FH8A 2GGTA 2C4JA 4HUAA 2K6VA 4F2IA 1TRWA 3V1WA 2FA4A 3CBUA 4OO4A 2F9SA 3HCZA 4PQIA 4EKZA 1WWJA 1GRXA 2PGTA 3EU4A 2FCHA 1PX6A 4D73A 3D4TA 2L57A 3QAWA 2HNLA 3MSZA 3GURA 1I5GA 4NMUA 1EGRA 4KH7A 1V58A 1WIKA 4AJ8A 3VWUA 3KMOA 5G30A 2YNXA 1SL2B 4DSSB 5ECSA 4JR6A 4IS0A 3APSA 19GSA 5E59A 1QFNA 2LTKA 4KUNA 1GSEA 1GULA 4TR4A 1HD2A 3H79A 5DQSA 3IHQA 2GSRA 3APQA 4HQZA 3APOA 2VCWA 3SBCA 1J08A 1ZCPA 2E2GA 3IDVA 5ECOB 3RPPA 5IMAA 3BOAA 1X9WB 3BD2A 8GSSA 1TK5B 2LV3A 1O8WA 3HY2A 3WT1A 5LCZA 3GV1A 5DAKB 1Z7PA 1H4OA 4OD7A 1UA5A 1BYEA 1S3DA 3ZYWA 3DYRA 4Q5FA 1G7EA 1GTBA 3NOFA 1ON4A 2VL9A 2M46A 2V6OA 3GYKA 2Z9SA 1K0OA 1THXA 3C1SA 3LWAA 3KGKA 3ZTLA 4GQFA 4JE1A 4DSRA 3P2AA 4MZCA 1GSDA 3UAPA 4KSOA 2EIRA 3H8QA 1BQ7A 1WRYA 1PRXA 4LLRA 3O6TA 5HR1A 2H74A 4HQSA 1ACVA 3LG6A 2GZYA 3TJBA 2ZCTA 1GTUA 3TJFA 4DVCA 2ZNMA 4XS6A 4KE3A 5F07A 3RPNA 3UOMA 1FVJA 2EIQA 5DDLA 2G2QA 4KGIA 1AQWA 1QGVA 6GSXA 2J23A 3EC3A 2CVBA 1Y6EA 5CYYA 5DVBA 1AC1A 1FHEA 1SU9A 2PU9C 2WCIA 2IL3A 5DALB 5AGYA 4MABA 2JSZA 2C8UA 1G7OA 1FAAA 4BVXA 1GLQA 3TOTA 5IO0A 1LU4A 1GUHA 4PURA 1QK8A 4RUVA 1FG4A 4NV2A 3FY7A 2IFQB 3IAM2 3C8EA 3ED3A 6GSWA 1OC9B 2FUG2 2VCZA 2FA8A 3F4TA 1X5DA 5J9CA 1HYUA 4HEA2 4XIHA 4ISDA 1WJKA 2H19A 1RQMA 3J7Yk 3U5RE 2VLTA 2WB9A 1ML6A 4PQ1A 3GRXA 2VOCA 4HI7A 5DJMA 4ZILA 2DJ0A 2TRCP 1XWBA 3HVVA 2CX3A 5IIZA 2H1GA 2H66A 20GSA 1F9MA 2WJUA 4K7NA 1TOFA 3DRNA 1UN2A 4POLA 3C7MA 4IP1A 4TXVA 3CYNA 4CW9A 5IMCA 2TIRA 4FO5A 17GSA 2HZFA 4F82A 5KN3A 1PSQA 2GLRA 2VCTA 2KLXA 1NHOA 5ECKB 5J3RA 2H71A 5HFIA 2GT6A 5ID2A 2KHPA 2YWNA 4H86A 3KM6A 3LFLA 3UEMA 4BA7A 1XXUA 1VGLA 4IKHA 1XWKA 4E8HA 3TUEA 3UJ1A 1SD9A 1R4WA 4O7HA 2GZZA 2WFCA 3QR6A 2JACA 3HZ8A 5D93A 1ZL9A 4K7OA 2YZUA 4EF0A 2K18A 3G7IA 11GSA 1U3IA 2K8SA 4HDEA 1XVQA 3TDGA 2F3MA 1XWGA 2WGRA 2V1MA 4ML1A 3KP8A 1T1VA 4YAVA 5EL8A 2L4CA 1SK2A 4ID0A 5JWQB 3FRCA 3VLNA 1AXDA 1XW6A 4WBJA 4O32A 1JHBA 5CRGA 2XC2A 1HNCA 3GSSA 2RUEA 5J4UA 2P5RA 4X43A 3EWLA 4BWQA 1TDIA 1XOAA 3QAVA 3L9VA 2WULA 3VI7A 2P0GA 2B1KA 5D8IA 2MMOA 18GSA 1KBNA 2OJLA 3BJ5A 1HQOA 3QFAC 4ZBBA 4XS1A 1JFUA 2N5FA 2TRXA 3FR6A 2I3YA 2WZ9A 1O8XA 3IE3A 3DKSA 3LXZA 3GMFA 4HJMA 1O6JA 2R5GA 1E6BA 3DVXA 1ZYQB 2C0DA 4TOPA 4NWYA 3CTGA 1YJ6A 2LRNA 2C3QA 1O81A 2J9HA 3M9JA 2H70A 1ZZYA 4BL7A 3UVHA 1R26A 4ECCA 3VPTA 1V98A 5JCGA 2H1BA 2B5XA 4TR1A 10GSA 2HSHA 2KOKA 3M8NA 1ABAA 1DE1A 1URMA 5JCWA 2LNTA 4TKYA 3GTUA 3GA4A 1KNGA 2FHEA 4GRFA 4RQRA 3F63A 2HXKA 1VRSD 2P5QA 4IJIA 3WYWA 2HZEB 3IC4A 1S3CA 2HYXA 4KNDA 2OE0A 1EV4A 1FO5A 1OAZA 3I9V2 2AUVA 3GUSA 2AAWA 2LSTA 4XS4B 1Z9HA 1E2YA 1ST9A 3F4SA 2FWEA 3F3QA 2P31A 4XRDA 2CT6A 4KDYA 3L4NA 5G5EA 1SKWB 4ZB9A 5H5RA 5H5SA 3TKPA 3ME7A 5C04A 4OFTA 4CDOA 4YQMA 3H1NA 3F3RA 1GH2A 2LJAA 5AIXA 5FT3A 3UVTA 2DJJA 3HHVA 4OFNA 4WEYA 5DQYA 3VURA 4TVEA 3FYGA 2VL2A 3ISOA 2E7PA 5CNWA 4G2EA 5IM9A 1ERUA 2WRTA 4EC0A 1R5PA 2CZ2A 3OR5A 4NAXA 2IMIA 2MMNA 4OCEA 3WGDA 3DWVA 2B5EA 3IA1A 1SL0B 1BEDA 3IRAA 3VPQA 1CQGA 1SYRA 1DBYA 2AHEA 4AF2A 5CP1A 1ERTA 3BCIA 3A5WA 3A2WA 3GKXA 3ME8A 3LYPA 2R6KA 4EXJA 2DJ3A 1M0UA 2H0IA 3A2XA 5CRHA 1V57A 3CSJA 4J2FA 6GSUA 3D4MA 1A8LA 4KCEA 2MBSA 1LBKA 1ZGNA 2WS2A 1QXHA 5GAPD 3KMNA 2IMEA 2V6KA 4KW6A 1C72A 4L5LA 2YCDA 5DBQA 4MJBA 3RBTA 3GSTA 2LUSA 4LL1B 3G7JA 2LQOA 4BVYA 2C0FA 2YWMA 3M0FA 5J5NA 2GSTA 1QMVA 4PNGA 1K0NA 1TK8B 2F51A 3TKQA 2DIYA 3ERFA 3TJGA 1A0FA 1ERWA 3QOUA 4IQAA 4TXOB 1MD3A 5D9WA 1J0FA 4DSQA 1VF1A 4MMMA 1XCCA 5G1KA 1TK0B
chains in the Genus database with same CATH superfamily
5J41A 3VWXA 1XOBA 3BBYA 3TKSE 2OACA 5B7CA 1GSFA 3VFIA 2GVPA 1GUMA 1YZXA 5CAXA 3GKNA 2LKUA 2H72A 2O87A 4FYUA 4K8MA 2CAIA 1W89A 3UBLA 1NSWA 4EL1A 2L5LA 5F0GA 3HJMA 3E9JB 3BCKA 1HNAA 3I69A 1KEBA 4IBPA 1NW2A 2FD3A 4DSSA 5AN1A 4KB3A 4F03A 4MPFA 3VK9A 2QGVA 4MLYA 3FZ9A 3LGCA 1OE7A 4J56E 4POBA 1K0AA 4WETA 3KD0A 4NXIA 2VUPA 3F8UA 5ECLB 3WGXA 3NIVA 1MEKA 2PWJA 5HR2A 4O92A 2OBKA 3NZNA 3DD3A 4XRAA 3C73A 1GNWA 5CRWA 5DCGA 3EMPA 5B8AA 3M1GA 2IWTA 2HE3A 1XIYA 4I2TA 3TB2A 1VF2A 3TJJA 3W8JA 2H6XA 2R2JA 1OKDA 5DAKA 1GTAA 3CRUA 3HXSA 1GSYA 3D6IA 1PMTA 1M2BA 4PUAA 3GIXA 1ZMAA 1I9DA 4WR5A 4K5RA 1MDIA 1TU7A 2YJHA 2ES7A 2GQMA 4ML6A 2ZUPA 1B4QA 4KA0A 3A2VA 4AJ7A 3CXGA 2H75A 1M7TA 2HRAA 2DJKA 1S3AA 4ZBAA 3D22A 1WOUA 4IQ1A 5G1LA 4WF4A 3TKSA 4TN8A 3QDNA 3EU3A 3F6DA 4IVFA 3ZL5A 3KP9A 2E2MA 2OKAA 3LYKA 4YQUA 2H76A 1XW5A 2A4VA 4AJ6A 22GSA 2FGXA 2KP2A 2VLUA 3A5IA 1TRUA 1TKDB 6GSVA 5JWOB 4CHSA 1EEMA 4YAPA 4MF5A 2I81A 1PA3A 3KIJA 4NHZA 2AV4A 3ERWA 3Q18A 1A2JA 4V1Ap 5DALA 2X64A 5EY6A 2IN3A 1AQXA 4GTUA 3EURA 2YN1A 2VD1A 5D9VA 1RK4A 1T3BA 2LJKA 1K3OA 4G0KA 5H5QA 4ZB6A 2L5OA 3RAZA 1KTEA 2XPEA 4XCSA 1UVZA 3FW2A 2L6DA 2PN8A 1OC9A 5IPHA 1OYJA 5IO2A 2M72A 2FWGA 5B6NA 1A23A 5ENUA 3UBKA 5IMDA 3ZZXA 2LS5A 1JLWA 4KDXA 4WXTA 3I43A 4ZL8A 1FOHA 5JWRB 3HZ4A 3M3MA 1TXXA 2CZ3A 2YV7A 3CSIA 1YKAA 5ABRA 3GFKA 1XPVA 4GXZA 1N2AA 2HLSA 4NPBA 2X8GA 2VD0A 4PTSA 9GSSA 3FEUA 2F8FA 1THOA 3LORA 2JZRA 4IGJA 4I5QA 1FOVA 5HR3A 1V40A 3GKKA 2LRTA 4TR0A 1F3AA 5GSTA 2GS3A 1NM3A 1BX9A 2CV4A 3EINA 5ECHB 3KTBA 1SL1B 4OCFA 2C3NA 1AW9A 1W4VA 4PUFC 4OO5A 4HSCX 4BPYA 4Z7XA 3WD6A 2NDOA 3FMWA 3UL3A 1K0CA 2H73A 2V32A 2OE1A 1MDKA 2RM6A 1U87A 3AY8A 1GWCA 2QSIA 1FB6A 3DVWA 4MP4A 2B5YA 2B6MA 5CO3A 4TW5A 2H1AA 4KCAA 3VWVA 3H93A 3QPMA 1AAZA 2RUFA 2K9FA 3TGZA 5BMUA 3TCOA 4ILFA 1BJXA 4USSA 4XHMA 5KN2A 1EP8A 4MZWA 5LNKe 4FIWA 3UIWA 5ECNB 4EIPA 5GAND 2IMFA 1XBSA 4KAEA 2K8VA 2PVOC 3MNGA 1H75A 1PKWA 4FQUA 5HQPA 2VLVA 1Z6NA 2MYGA 1FB0A 3RHCA 4E8EA 4EE0A 1ZYEA 1T8EB 5KEJA 4ECBA 5J9BA 2JL4A 1SD8A 16GSA 1PL2A 3DMLA 1EOGA 3ZFLA 2YP6A 5DJLA 1B9YC 2R4VA 2V41A 2IPAA 2CAQA 3E3EA 1PGTA 1DSBA 2H0HA 4TR1B 3LSZA 2DIZA 1IYIA 5ELAA 1B4PA 1K0BA 4YH2A 4O5RA 2C3TA 4MJCA 4PX1A 1UC7A 1M9AA 5KN1A 2VO4A 3ZFBA 5E4WA 1M99A 4N10A 1GTIA 4Z2UA 3KH7A 1JZWA 4OMVA 5A4VA 1FW1A 2X8CA 5ECMB 2VCQA 2VL2C 2C0GA 1PN9A 4XTSA 5B8BA 2HSYA 3FZAA 2X4AA 3CSHA 1SKRB 4MPGA 4Z2TA 3LXTA 2XPDA 3HKRA 2QKEA 4BWSA 2B3SA 3KTLA 4RI6A 1TRSA 2PERA 1GL8A 1F6MC 1AUCA 1B8XA 4QQ7A 1JZOA 2PPTA 3FR9A 5HFKA 4HU7A 3FK8A 4QL7A 4V2MA 2OBIA 5LD0A 2PUKC 3WT2A 3R3EA 3MAKA 3D0ZA 1GNEA 3F6FA 1WPIA 5HFGA 4L5OA 7GSSA 1GSUA 2BJXA 2DMMA 2H6ZA 4G9HA 4K2XA 3TRQA 5IMVA 3Q74A 3GN3A 2FWFA 2IIYA 5G31A 4MJEA 12GSA 1EOHA 1X5CA 1SJIA 2G0FA 2LNSA 4IN0A 4GLTA 3GH6A 2GDRA 4N0ZA 1MD4A 3R2QA 2RM5A 4ZIJA 1A2MA 4L8EA 3UARA 3HYPA 2N5BA 4I6XA 4I2UA 2VCVA 3KCMA 1SENA 2IJYA 3L0HA 3L9UA 2AB6A 3GHAA 1A2LA 2AJQB 2D2ZA 2MMZA 2PBJA 3MYDA 1QUWA 2CA8A 2GQKA 3SWLA 1JZDA 4N0VA 1DUGA 5ECQB 1PKZA 4WR4A 1EGOA 3K8NA 2C0EA 13GSA 2GZPA 2JZTA 4NV5A 2HRNA 3KZQA 4FYCA 1T4YA 3IK9A 5DCHA 1K3LA 3EYTA 3L78A 3W6GA 4G19A 4K9ZA 5IPGA 1B48A 4O5QA 1X9SB 3ZVJD 1Y25A 1XWCA 1T4ZA 3TRPA 3F4RA 2DMLA 5IMFA 4D73B 4V2NA 3FR3A 1V2AA 1JZRA 4HS1A 3VWWA 1PN0A 4Q5QA 4YKFA 3KH9A 2R3XA 5ELGA 4EUYA 2F8AA 2B7JA 2H6YA 2CX4A 2LQQA 2A4HA 5F06A 2I4AA 1BG5A 5IQYA 2C1YA 4K0GA 4OWYA 1AQVA 2LRCA 4J57E 1MDJA 2H0GA 2VM2A 3IXRA 2DSAA 4ACSA 2JZSA 4ECJA 1TRVA 3ZMKA 1Z3EA 3FZ4A 3Q19A 1PL1A 2A2PA 2QA2A 1TTZA 4CY6A 3W8SA 1SK1A 4MJAA 1F37A 1YEPA 4PNFA 4TXOA 4F0BA 2VM1A 2PVQA 1OVNA 2WDUA 3CRTA 5D9TA 4K2DA 1TU8A 4IELA 4ZBDA 4ZB8A 2NTOA 1PQNA 3GL3A 3HVNA 1OC3A 2FY6A 2I1UA 2I9HA 4K6XA 1T00A 2XHFA 1XVWA 3TKSC 6GSSA 3DEXA 3M9KA 5AISA 3DIEA 1BAYA 2H01A 2IMDA 1GSSA 1X5EA 1IYHA 2OADA 4X4JA 1RW1A 3QAGA 2CQ9A 3TJKA 3P90A 3QD9A 2N5AA 5HR0A 1N8JA 3IBHA 1TI1A 3IHGA 3EPTA 3PPUA 2X8HA 5F05A 4MZBA 4K1FA 4GSSA 3E0UA 2ALBA 5ECRB 3EVIA 4PXOA 2HI7A 5FWGA 1K3YA 1VF4A 4NHWA 5INYA 2JSYA 3KEBA 2GSQA 2RIIA 2ON5A 2KP1A 5FHIA 5GZZB 4BVXB 1MTCA 3ZITA 1O7UA 3G9BA 3HDCA 2DBCA 4I97A 1NHYA 3IPZA 2KUCA 5B6MA 1EP7A 4WKWA 1ERVA 3GX0A 1GUKA 1TI3A 1SYXA 4IHUA 1AIUA 1SJZA 3A3TA 3ZREA 5CREA 3MDKA 3LW9A 4RI7A 1FVKA 2HT9A 1JLVA 2UZ8A 4HZ4A 2ON7A 3IOSA 3D5JA 3O76A 3C71A 4WF5A 4L0WA 2FNOA 3CQFA 1G0TA 2JU5A 4N30A 5D9XA 1G6YA 2MZCA 1YQ1A 3D21A 1XWAA 3LJRA 2LJRA 4ICYA 5COHA 4HJ2A 1M2AA 1Q4JA 4GSTA 5D73A 4K0NA 1EZKA 1WE0A 1J9BA 3FKFA 3S9FA 2EIOA 5IOWA 2MBTA 4V1Ag 1A8YA 5CRDA 2GTUA 3F9UA 2MMAA 2A2SA 4MH2A 1EV9A 2VL3A 2VIMA 2DJ2A 2DKIA 1DE2A 4V2LA 3F0IA 3GKMA 4GWRA 2CVKA 3RHBA 2H8LA 3FZ5A 3Q6OA 4MH3A 1K0MA 5G5FA 4LA1A 2NVLA 3GL5A 2IFQA 4JR4A 3HJOA 1CQHA 1OKTA 2HFDA 14GSA 4G10A 3LEFA 3QFBC 5C00A 2XBIA 6GSTA 1F2EA 3ERGA 5ID2B 3IV4A 4LL4B 4K5SA 5ECIB 4P3YB 3UMAA 4IW9A 2R0CA 6GSYA 4ZL9A 4I8BA 2H1DA 2BMXA 2GT5A 3KJYA 3EE2A 4N11A 3IC8A 5A4UA 4GF0A 1Z7RA 4A5PA 1T7PB 2B7KA 4ECIA 1U3AA 2O89A 3I6AA 2XBQA 3IR4A 1Q98A 2CVDA 4OFMA 1XW9A 3LQ7A 3HA9A 4TR3A 4IJ3A 5EVOA 3J7Yb 3ZIJA 3TOUA 1PX7A 3PINA 2QC7A 2YWIA 3CTFA 4FYBA 3WGEA 2YOIA 1YDKA 2RLIA 5G2ZA 2NBSA 2R0GA 2EC4A 2IMKA 1XZOA 3CMIA 3IAS2 2R37A 1VF3A 4X1UA 3H4KA 1YKCA 2NPBA 4EO3A 3ZLPA 3L9SA 1R7HA 1F3BA 4JU5A 2PMTA 3VI5A 4EDYA 2GSSA 2REMA 1LJRA 1XFLA 3EMXA 2M80A 4MF6A 1Z5YE 3HD5A 2L6CA 3MWHA 1PD21 1YY7A 4JZQA 4RQXA 2O8VB 1O85A 3HVSA 2B1LA 2X99A 4JRRA 1X0RA 5IOXA 3TRXA 1ZOFA 2L59A 1S3RA 4PGTA 4BL7B 4HOJA 4QL9A 2E0QA 3JCML 2V2GA 1YEXA 3US3A 3QCPA 3RDWA 4PQHA 1SK0A 5EPFA 2OA7A 3PR8A 1YF0A 2YJ7A 4KSMA 1R5AA 5AIVA 3KXOA 5GSSA 3GTUB 1QQ2A 2DJ1A 1TP9A 3N5OA 2L4QA 5L71A 4F9ZA 2VAFA 3PGTA 3ZVJA 2LEGA 3FHKA 3U6VA 4ZXGA 3GNJA 1GSQA 4Q5RA 1GLPA 3ZRDA 1X9MB 3O3TA 2VCXA 4EDZA 1EEJA 5D96A 1WP0A 1YF1A 1ILOA 3P8WA 3G7YA 1EWXA 1O73A 4IP6A 1SKSB 4HZ2A 1OE8A 4POKA 3IK7A 2H30A 5A5KA 1M2DA 3DGQA 1OC8A 1ZYPA 2YANA 3GX8A 3TKRA 3N9JA 3ZIVA 1HNBA 4JBBA 4F0CA 4GCIA 5A4WA 4GQCA 4JEDA 4KDUA 4MA9A 4DEJA 3ZMLA 2HZEA 1GP1A 3GH9A 3C1RA 4MK3A 4ZL7A 1TJDA 3DXBA 1B9XC 4MCUA 5F8BA 2YPMA 3QMXA 2O7KA 4XS4A 1WMJA 1SJ6A 1A0RP 5ECPB 2GQLA 2JADA 4POMA 2DC5A 4AGSA 2OE3A 2DLXA 1M9BA 4LMVA 2A2RA 4GSNA 4ULXA 5IMZA 5KN0A 2BTOT 1U88A 4MDCA 2YZHA 1Z6MA 1A24A 1V9WA 4KX4A 2FWHA 4LMWA 1U6TA 4HU9A 2O85A 4BVYB 2AYTA 2YWOA 5JCUA 4X0XA 4TRXA 1USBA 4YQVA 1TW9A 2HRFA 4WBRD 4K7IA 3P7XA 1G6WA 4EVMA 4MF7A 2FLSA 1K0DA 3PH9A 4Q5NA 2C80A 4L0UA 3HJPA 2YV9A 3HVXA 4FH8A 2GGTA 2C4JA 4HUAA 2K6VA 4Z2RA 4F2IA 1TRWA 3V1WA 2FA4A 3CBUA 4EIQA 4OO4A 2F9SA 3HCZA 4PQIA 4EKZA 1WWJA 1GRXA 2PGTA 3EU4A 2FCHA 1PX6A 4D73A 3D4TA 2L57A 3QAWA 2HNLA 3MSZA 3GURA 1I5GA 4NMUA 1EGRA 4KH7A 1V58A 1WIKA 5BRTA 4AJ8A 3VWUA 3KMOA 5G30A 2YNXA 1SL2B 4DSSB 5ECSA 4JR6A 4IS0A 3APSA 19GSA 5E59A 1QFNA 2LTKA 4KUNA 1GSEA 1GULA 2QA1A 4TR4A 1HD2A 3H79A 5DQSA 3IHQA 2GSRA 3APQA 4HQZA 3APOA 2VCWA 3SBCA 1J08A 1ZCPA 2E2GA 3IDVA 5ECOB 3RPPA 5IMAA 3BOAA 1X9WB 3BD2A 8GSSA 1TK5B 2LV3A 1O8WA 3HY2A 3WT1A 5LCZA 3GV1A 5DAKB 1Z7PA 1H4OA 4OD7A 1UA5A 1BYEA 1S3DA 3ZYWA 3DYRA 4Q5FA 1G7EA 1GTBA 3NOFA 1ON4A 2VL9A 2M46A 2V6OA 3GYKA 2Z9SA 1K0OA 1THXA 3C1SA 3LWAA 3KGKA 3ZTLA 4GQFA 4JE1A 4DSRA 3P2AA 4MZCA 1GSDA 3UAPA 4KSOA 4O5UA 2EIRA 3H8QA 1BQ7A 1WRYA 1PRXA 4LLRA 3O6TA 5HR1A 2H74A 4HQSA 1ACVA 3LG6A 2GZYA 3TJBA 2ZCTA 1GTUA 3MIXA 3TJFA 4DVCA 2ZNMA 4XS6A 4KE3A 5F07A 3RPNA 3UOMA 1FVJA 2EIQA 5DDLA 2G2QA 4KGIA 1AQWA 1QGVA 6GSXA 2J23A 3EC3A 2CVBA 1Y6EA 5CYYA 5DVBA 1AC1A 1FHEA 1SU9A 2PU9C 2WCIA 2IL3A 5DALB 5AGYA 1M3IA 4MABA 2JSZA 2C8UA 1G7OA 1FAAA 4BVXA 1GLQA 3TOTA 5IO0A 1LU4A 2HSMA 1GUHA 4PURA 4BIKA 1QK8A 4RUVA 1M3JA 1FG4A 4NV2A 3FY7A 2IFQB 3IAM2 3C8EA 3ED3A 6GSWA 1OC9B 2FUG2 2VCZA 2FA8A 3F4TA 1PFOA 1X5DA 5J9CA 1HYUA 4HEA2 4XIHA 4ISDA 1WJKA 2H19A 1RQMA 3J7Yk 3U5RE 2VLTA 2WB9A 1ML6A 4PQ1A 3GRXA 2VOCA 4HI7A 5DJMA 4ZILA 2DJ0A 2TRCP 1XWBA 3HVVA 2CX3A 5IIZA 2H1GA 2H66A 20GSA 1F9MA 2WJUA 4K7NA 1TOFA 3DRNA 1UN2A 5KOXA 5KOWA 4POLA 3C7MA 4IP1A 4TXVA 3CYNA 4CW9A 5IMCA 2TIRA 4FO5A 17GSA 2HZFA 4F82A 5KN3A 1PSQA 2GLRA 2VCTA 2KLXA 1NHOA 5ECKB 5J3RA 2H71A 5HFIA 2GT6A 5ID2A 2R0PA 2KHPA 2YWNA 4H86A 3KM6A 3LFLA 3UEMA 4BA7A 1XXUA 1VGLA 4IKHA 1XWKA 4E8HA 3TUEA 3UJ1A 1SD9A 1R4WA 4O7HA 2GZZA 2WFCA 3QR6A 2JACA 3HZ8A 5D93A 1ZL9A 4K7OA 2YZUA 4EF0A 2K18A 3G7IA 11GSA 1U3IA 2K8SA 4HDEA 1XVQA 3TDGA 2F3MA 1XWGA 2WGRA 2V1MA 4ML1A 3KP8A 1T1VA 4YAVA 5EL8A 2L4CA 1SK2A 4ID0A 5JWQB 3FRCA 3VLNA 1AXDA 1XW6A 4WBJA 4O32A 1JHBA 5CRGA 2XC2A 1HNCA 3GSSA 2RUEA 5J4UA 2P5RA 4X43A 3EWLA 4BWQA 1TDIA 1XOAA 3QAVA 3L9VA 2WULA 3VI7A 2P0GA 2B1KA 5D8IA 2MMOA 4G0LA 18GSA 1KBNA 2OJLA 3BJ5A 1XG8A 1HQOA 3QFAC 4ZBBA 4XS1A 1JFUA 2N5FA 2TRXA 3FR6A 2I3YA 2WZ9A 1O8XA 3IE3A 3DKSA 3LXZA 3GMFA 4HJMA 1O6JA 2R5GA 1E6BA 3DVXA 1ZYQB 2C0DA 4TOPA 4MNNA 4NWYA 3CTGA 1YJ6A 2LRNA 2C3QA 1O81A 2J9HA 3M9JA 2H70A 1ZZYA 4BL7A 3UVHA 1R26A 4ECCA 3VPTA 1V98A 5JCGA 2H1BA 2B5XA 2HRKA 4TR1A 10GSA 2HSHA 2DKHA 2KOKA 3M8NA 1ABAA 1DE1A 1URMA 5JCWA 2LNTA 4TKYA 3GTUA 3GA4A 1KNGA 2FHEA 4GRFA 4RQRA 3F63A 2HXKA 1VRSD 2P5QA 4IJIA 3WYWA 2HZEB 3IC4A 1S3CA 2HYXA 4KNDA 2OE0A 1EV4A 1FO5A 1OAZA 3I9V2 2AUVA 3GUSA 2AAWA 2LSTA 4XS4B 1Z9HA 1E2YA 1ST9A 3F4SA 2FWEA 3F3QA 2P31A 4XRDA 2CT6A 4KDYA 4G0IA 3L4NA 5G5EA 1SKWB 4ZB9A 5H5RA 5H5SA 3TKPA 3ME7A 5C04A 4OFTA 4CDOA 4YQMA 3H1NA 3F3RA 1GH2A 2LJAA 5AIXA 5FT3A 3UVTA 2DJJA 3HHVA 4OFNA 4WEYA 5DQYA 3VURA 4TVEA 3FYGA 4YKGA 2VL2A 3ISOA 2E7PA 5CNWA 4G2EA 5IM9A 1ERUA 2WRTA 4EC0A 1R5PA 2CZ2A 3OR5A 4NAXA 2IMIA 2MMNA 4OCEA 3WGDA 3DWVA 2B5EA 3IA1A 1SL0B 1BEDA 3IRAA 3VPQA 1CQGA 1SYRA 1DBYA 2AHEA 4AF2A 5CP1A 1ERTA 3BCIA 3A5WA 3A2WA 2X49A 4KF9A 3GKXA 3ME8A 3LYPA 2R6KA 4EXJA 2DJ3A 1ZYNA 1M0UA 2H0IA 3A2XA 5CRHA 1V57A 3CSJA 4J2FA 6GSUA 3D4MA 1A8LA 4KCEA 2MBSA 1LBKA 1ZGNA 2WS2A 1QXHA 5GAPD 3KMNA 2IMEA 2V6KA 4KW6A 1C72A 4L5LA 2YCDA 5DBQA 4MJBA 3RBTA 3GSTA 2LUSA 4LL1B 3G7JA 2LQOA 4BVYA 2C0FA 2YWMA 3M0FA 5J5NA 2GSTA 1QMVA 4PNGA 1K0NA 1TK8B 2F51A 3TKQA 2DIYA 3ERFA 3TJGA 1A0FA 1ERWA 3QOUA 4IQAA 4TXOB 1MD3A 5D9WA 1J0FA 4DSQA 1VF1A 4MMMA 1XCCA 4CY8A 5G1KA 1TK0B
chains in the Genus database with same CATH topology
5J41A 3VWXA 1XOBA 3BBYA 3TKSE 2OACA 5B7CA 1GSFA 3VFIA 2GVPA 1GUMA 1YZXA 5CAXA 3GKNA 2LKUA 2H72A 2O87A 4FYUA 4K8MA 2CAIA 1W89A 3UBLA 1NSWA 4EL1A 2L5LA 5F0GA 3HJMA 3E9JB 3BCKA 1HNAA 3I69A 1KEBA 4IBPA 1NW2A 2FD3A 4DSSA 5AN1A 4KB3A 4F03A 4MPFA 3VK9A 2QGVA 4MLYA 3FZ9A 3LGCA 1OE7A 4J56E 4POBA 1K0AA 4WETA 3KD0A 4NXIA 2VUPA 3F8UA 5ECLB 3WGXA 3NIVA 1MEKA 2PWJA 5HR2A 4O92A 2OBKA 3NZNA 3DD3A 4XRAA 3C73A 1GNWA 5CRWA 5DCGA 3EMPA 5B8AA 3M1GA 2IWTA 2HE3A 1XIYA 4I2TA 3TB2A 1VF2A 3TJJA 3W8JA 2H6XA 2R2JA 1OKDA 5DAKA 1GTAA 3CRUA 3HXSA 1GSYA 3D6IA 1PMTA 1M2BA 4PUAA 3GIXA 1ZMAA 1I9DA 4WR5A 4K5RA 1MDIA 1TU7A 2YJHA 2ES7A 2GQMA 4ML6A 2ZUPA 1B4QA 4KA0A 3A2VA 4AJ7A 3CXGA 2H75A 1M7TA 2HRAA 2DJKA 1S3AA 4ZBAA 3D22A 1WOUA 4IQ1A 5G1LA 4WF4A 3TKSA 4TN8A 3QDNA 3EU3A 3F6DA 4IVFA 3ZL5A 3KP9A 2E2MA 2OKAA 3LYKA 4YQUA 2H76A 1XW5A 2A4VA 4AJ6A 22GSA 2FGXA 2KP2A 2VLUA 3A5IA 1TRUA 1TKDB 6GSVA 5JWOB 4CHSA 1EEMA 4YAPA 4MF5A 2I81A 1PA3A 3KIJA 4NHZA 2AV4A 3ERWA 3Q18A 1A2JA 4V1Ap 5DALA 2X64A 5EY6A 2IN3A 1AQXA 4GTUA 3EURA 2YN1A 2VD1A 5D9VA 1RK4A 1T3BA 2LJKA 1K3OA 4G0KA 5H5QA 4ZB6A 2L5OA 3RAZA 1KTEA 2XPEA 4XCSA 1UVZA 3FW2A 2L6DA 2PN8A 1OC9A 5IPHA 1OYJA 5IO2A 2M72A 2FWGA 5B6NA 1A23A 5ENUA 3UBKA 5IMDA 3ZZXA 2LS5A 1JLWA 4KDXA 4WXTA 3I43A 4ZL8A 1FOHA 5JWRB 3HZ4A 3M3MA 1TXXA 2CZ3A 2YV7A 3CSIA 1YKAA 5ABRA 3GFKA 1XPVA 4GXZA 1N2AA 2HLSA 4NPBA 2X8GA 2VD0A 4PTSA 9GSSA 3FEUA 2F8FA 1THOA 3LORA 2JZRA 4IGJA 4I5QA 1FOVA 5HR3A 1V40A 3GKKA 2LRTA 4TR0A 1F3AA 5GSTA 2GS3A 1NM3A 1BX9A 2CV4A 3EINA 5ECHB 3KTBA 1SL1B 4OCFA 2C3NA 1AW9A 1W4VA 4PUFC 4OO5A 4BPYA 4Z7XA 3WD6A 2NDOA 3FMWA 3UL3A 1K0CA 2H73A 2V32A 2OE1A 1MDKA 2RM6A 1U87A 3AY8A 1GWCA 2QSIA 1FB6A 3DVWA 4MP4A 2B5YA 2B6MA 5CO3A 4TW5A 2H1AA 4KCAA 3VWVA 3H93A 3QPMA 1AAZA 2RUFA 2K9FA 3TGZA 5BMUA 3TCOA 4ILFA 1BJXA 4USSA 4XHMA 5KN2A 1EP8A 4MZWA 5LNKe 4FIWA 3UIWA 5ECNB 4EIPA 5GAND 2IMFA 1XBSA 4KAEA 2K8VA 2PVOC 3MNGA 1H75A 1PKWA 4FQUA 5HQPA 2VLVA 1Z6NA 2MYGA 1FB0A 3RHCA 4E8EA 4EE0A 1ZYEA 1T8EB 5KEJA 4ECBA 5J9BA 2JL4A 1SD8A 16GSA 1PL2A 3DMLA 1EOGA 3ZFLA 2YP6A 5DJLA 1B9YC 2R4VA 2V41A 2IPAA 2CAQA 3E3EA 1PGTA 1DSBA 2H0HA 4TR1B 3LSZA 2DIZA 1IYIA 5ELAA 1B4PA 1K0BA 4YH2A 4O5RA 2C3TA 4MJCA 4PX1A 1UC7A 1M9AA 5KN1A 2VO4A 3ZFBA 5E4WA 1M99A 4N10A 1GTIA 4Z2UA 3KH7A 1JZWA 4OMVA 5A4VA 1FW1A 2X8CA 5ECMB 2VCQA 2VL2C 2C0GA 1PN9A 4XTSA 5B8BA 2HSYA 3FZAA 2X4AA 3CSHA 1SKRB 4MPGA 4Z2TA 3LXTA 2XPDA 3HKRA 2QKEA 4BWSA 2B3SA 3KTLA 4RI6A 1TRSA 2PERA 1GL8A 1F6MC 1AUCA 1B8XA 4QQ7A 1JZOA 2PPTA 3FR9A 5HFKA 4HU7A 3FK8A 4QL7A 4V2MA 2OBIA 5LD0A 2PUKC 3WT2A 3R3EA 3MAKA 3D0ZA 1GNEA 3F6FA 1WPIA 5HFGA 4L5OA 7GSSA 1GSUA 2BJXA 2DMMA 2H6ZA 4G9HA 4K2XA 3TRQA 5IMVA 3Q74A 3GN3A 2FWFA 2IIYA 5G31A 4MJEA 12GSA 1EOHA 1X5CA 1SJIA 2G0FA 2LNSA 4IN0A 4GLTA 3GH6A 2GDRA 4N0ZA 1MD4A 3R2QA 2RM5A 4ZIJA 1A2MA 4L8EA 3UARA 3HYPA 2N5BA 4I6XA 4I2UA 2VCVA 3KCMA 1SENA 2IJYA 3L0HA 3L9UA 2AB6A 3GHAA 1A2LA 2AJQB 2D2ZA 2MMZA 2PBJA 3MYDA 1QUWA 2CA8A 2GQKA 3SWLA 1JZDA 4N0VA 1DUGA 5ECQB 1PKZA 4WR4A 1EGOA 3K8NA 2C0EA 13GSA 2GZPA 2JZTA 4NV5A 2HRNA 3KZQA 4FYCA 1T4YA 3IK9A 5DCHA 1K3LA 3EYTA 3L78A 3W6GA 4G19A 4K9ZA 5IPGA 1B48A 4O5QA 1X9SB 3ZVJD 1Y25A 1XWCA 1T4ZA 3TRPA 3F4RA 2DMLA 5IMFA 4D73B 4V2NA 3FR3A 1V2AA 1JZRA 4HS1A 3VWWA 1PN0A 4Q5QA 4YKFA 3KH9A 2R3XA 5ELGA 4EUYA 2F8AA 2B7JA 2H6YA 2CX4A 2LQQA 2A4HA 5F06A 2I4AA 1BG5A 5IQYA 2C1YA 4K0GA 4OWYA 1AQVA 2LRCA 4J57E 1MDJA 2H0GA 2VM2A 3IXRA 2DSAA 4ACSA 2JZSA 4ECJA 1TRVA 3ZMKA 1Z3EA 3FZ4A 3Q19A 1PL1A 2A2PA 2QA2A 1TTZA 4CY6A 3W8SA 1SK1A 4MJAA 1F37A 1YEPA 4PNFA 4TXOA 4F0BA 2VM1A 2PVQA 1OVNA 2WDUA 3CRTA 5D9TA 4K2DA 1TU8A 4IELA 4ZBDA 4ZB8A 2NTOA 1PQNA 3GL3A 1OC3A 2FY6A 2I1UA 2I9HA 4K6XA 1T00A 2XHFA 1XVWA 3TKSC 6GSSA 3DEXA 3M9KA 5AISA 3DIEA 1BAYA 2H01A 2IMDA 1GSSA 1X5EA 1IYHA 2OADA 4X4JA 1RW1A 3QAGA 2CQ9A 3TJKA 3P90A 3QD9A 2N5AA 5HR0A 1N8JA 3IBHA 1TI1A 3IHGA 3EPTA 3PPUA 2X8HA 5F05A 4MZBA 4K1FA 4GSSA 3E0UA 2ALBA 5ECRB 3EVIA 4PXOA 2HI7A 5FWGA 1K3YA 1VF4A 4NHWA 5INYA 2JSYA 3KEBA 2GSQA 2RIIA 2ON5A 2KP1A 5FHIA 5GZZB 4BVXB 1MTCA 3ZITA 1O7UA 3G9BA 3HDCA 2DBCA 4I97A 1NHYA 3IPZA 2KUCA 5B6MA 1EP7A 4WKWA 1ERVA 3GX0A 1GUKA 1TI3A 1SYXA 4IHUA 1AIUA 1SJZA 3A3TA 3ZREA 5CREA 3MDKA 3LW9A 4RI7A 1FVKA 2HT9A 1JLVA 2UZ8A 4HZ4A 2ON7A 3IOSA 3D5JA 3O76A 3C71A 4WF5A 4L0WA 2FNOA 1G0TA 2JU5A 4N30A 5D9XA 1G6YA 2MZCA 1YQ1A 3D21A 1XWAA 3LJRA 2LJRA 4ICYA 5COHA 4HJ2A 1M2AA 1Q4JA 4GSTA 5D73A 4K0NA 1EZKA 1WE0A 1J9BA 3FKFA 3S9FA 2EIOA 5IOWA 2MBTA 4V1Ag 1A8YA 5CRDA 2GTUA 3F9UA 2MMAA 2A2SA 4MH2A 1EV9A 2VL3A 2VIMA 2DJ2A 2DKIA 1DE2A 4V2LA 3F0IA 3GKMA 4GWRA 2CVKA 3RHBA 2H8LA 3FZ5A 3Q6OA 4MH3A 1K0MA 5G5FA 4LA1A 2NVLA 3GL5A 2IFQA 4JR4A 3HJOA 1CQHA 1OKTA 2HFDA 14GSA 4G10A 3LEFA 3QFBC 5C00A 2XBIA 6GSTA 1F2EA 3ERGA 5ID2B 3IV4A 4LL4B 4K5SA 5ECIB 4P3YB 3UMAA 4IW9A 2R0CA 6GSYA 4ZL9A 4I8BA 2H1DA 2BMXA 2GT5A 3KJYA 3EE2A 4N11A 3IC8A 5A4UA 4GF0A 1Z7RA 4A5PA 1T7PB 2B7KA 4ECIA 1U3AA 2O89A 3I6AA 2XBQA 3IR4A 1Q98A 2CVDA 4OFMA 1XW9A 3LQ7A 3HA9A 4TR3A 4IJ3A 5EVOA 3J7Yb 3ZIJA 3TOUA 1PX7A 3PINA 2QC7A 2YWIA 3CTFA 4FYBA 3WGEA 2YOIA 1YDKA 2RLIA 5G2ZA 2NBSA 2R0GA 2EC4A 2IMKA 1XZOA 3CMIA 3IAS2 2R37A 1VF3A 4X1UA 3H4KA 1YKCA 2NPBA 4EO3A 3ZLPA 3L9SA 1R7HA 1F3BA 4JU5A 2PMTA 3VI5A 4EDYA 2GSSA 2REMA 1LJRA 1XFLA 3EMXA 2M80A 4MF6A 1Z5YE 3HD5A 2L6CA 3MWHA 1PD21 1YY7A 4JZQA 4RQXA 2O8VB 1O85A 3HVSA 2B1LA 2X99A 4JRRA 1X0RA 5IOXA 3TRXA 1ZOFA 2L59A 4PGTA 4BL7B 4HOJA 4QL9A 2E0QA 3JCML 2V2GA 1YEXA 3US3A 3QCPA 3RDWA 4PQHA 1SK0A 5EPFA 2OA7A 3PR8A 1YF0A 2YJ7A 4KSMA 1R5AA 5AIVA 3KXOA 5GSSA 3GTUB 1QQ2A 2DJ1A 1TP9A 3N5OA 2L4QA 5L71A 4F9ZA 2VAFA 3PGTA 3ZVJA 2LEGA 3FHKA 3U6VA 4ZXGA 3GNJA 1GSQA 4Q5RA 1GLPA 3ZRDA 1X9MB 3O3TA 2VCXA 4EDZA 1EEJA 5D96A 1WP0A 1YF1A 1ILOA 3P8WA 3G7YA 1EWXA 1O73A 4IP6A 1SKSB 4HZ2A 1OE8A 4POKA 3IK7A 2H30A 5A5KA 1M2DA 3DGQA 1OC8A 1ZYPA 2YANA 3GX8A 3TKRA 3N9JA 3ZIVA 1HNBA 4JBBA 4F0CA 4GCIA 5A4WA 4GQCA 4JEDA 4KDUA 4MA9A 4DEJA 3ZMLA 2HZEA 1GP1A 3GH9A 3C1RA 4MK3A 4ZL7A 1TJDA 3DXBA 1B9XC 4MCUA 5F8BA 2YPMA 3QMXA 2O7KA 4XS4A 1WMJA 1SJ6A 1A0RP 5ECPB 2GQLA 2JADA 4POMA 2DC5A 4AGSA 2OE3A 2DLXA 1M9BA 4LMVA 2A2RA 4GSNA 4ULXA 5IMZA 5KN0A 2BTOT 1U88A 4MDCA 2YZHA 1Z6MA 1A24A 1V9WA 4KX4A 2FWHA 4LMWA 1U6TA 4HU9A 2O85A 4BVYB 2AYTA 2YWOA 5JCUA 4X0XA 4TRXA 1USBA 4YQVA 1TW9A 2HRFA 4WBRD 4K7IA 3P7XA 1G6WA 4EVMA 4MF7A 2FLSA 1K0DA 3PH9A 4Q5NA 2C80A 4L0UA 3HJPA 2YV9A 3HVXA 4FH8A 2GGTA 2C4JA 4HUAA 2K6VA 4Z2RA 4F2IA 1TRWA 3V1WA 2FA4A 3CBUA 4EIQA 4OO4A 2F9SA 3HCZA 4PQIA 4EKZA 1WWJA 1GRXA 2PGTA 3EU4A 2FCHA 1PX6A 4D73A 3D4TA 2L57A 3QAWA 2HNLA 3MSZA 3GURA 1I5GA 4NMUA 1EGRA 4KH7A 1V58A 1WIKA 5BRTA 4AJ8A 3VWUA 3KMOA 5G30A 2YNXA 1SL2B 4DSSB 5ECSA 4JR6A 4IS0A 3APSA 19GSA 5E59A 1QFNA 2LTKA 4KUNA 1GSEA 1GULA 2QA1A 4TR4A 1HD2A 3H79A 5DQSA 3IHQA 2GSRA 3APQA 4HQZA 3APOA 2VCWA 3SBCA 1J08A 1ZCPA 2E2GA 3IDVA 5ECOB 3RPPA 5IMAA 3BOAA 1X9WB 3BD2A 8GSSA 1TK5B 2LV3A 1O8WA 3HY2A 3WT1A 5LCZA 3GV1A 5DAKB 1Z7PA 1H4OA 4OD7A 1UA5A 1BYEA 1S3DA 3ZYWA 3DYRA 4Q5FA 1G7EA 1GTBA 3NOFA 1ON4A 2VL9A 2M46A 2V6OA 3GYKA 2Z9SA 1K0OA 1THXA 3C1SA 3LWAA 3KGKA 3ZTLA 4GQFA 4JE1A 4DSRA 3P2AA 4MZCA 1GSDA 3UAPA 4KSOA 4O5UA 2EIRA 3H8QA 1BQ7A 1WRYA 1PRXA 4LLRA 3O6TA 5HR1A 2H74A 4HQSA 1ACVA 3LG6A 2GZYA 3TJBA 2ZCTA 1GTUA 3MIXA 3TJFA 4DVCA 2ZNMA 4XS6A 4KE3A 5F07A 3RPNA 3UOMA 1FVJA 2EIQA 5DDLA 2G2QA 4KGIA 1AQWA 1QGVA 6GSXA 2J23A 3EC3A 2CVBA 1Y6EA 5CYYA 5DVBA 1AC1A 1FHEA 1SU9A 2PU9C 2WCIA 2IL3A 5DALB 5AGYA 4MABA 2JSZA 2C8UA 1G7OA 1FAAA 4BVXA 1GLQA 3TOTA 5IO0A 1LU4A 2HSMA 1GUHA 4PURA 1QK8A 4RUVA 1FG4A 4NV2A 3FY7A 2IFQB 3IAM2 3C8EA 3ED3A 6GSWA 1OC9B 2FUG2 2VCZA 2FA8A 3F4TA 1X5DA 5J9CA 1HYUA 4HEA2 4XIHA 4ISDA 1WJKA 2H19A 1RQMA 3J7Yk 3U5RE 2VLTA 2WB9A 1ML6A 4PQ1A 3GRXA 2VOCA 4HI7A 5DJMA 4ZILA 2DJ0A 2TRCP 1XWBA 3HVVA 2CX3A 5IIZA 2H1GA 2H66A 20GSA 1F9MA 2WJUA 4K7NA 1TOFA 3DRNA 1UN2A 5KOXA 5KOWA 4POLA 3C7MA 4IP1A 4TXVA 3CYNA 4CW9A 5IMCA 2TIRA 4FO5A 17GSA 2HZFA 4F82A 5KN3A 1PSQA 2GLRA 2VCTA 2KLXA 1NHOA 5ECKB 5J3RA 2H71A 5HFIA 2GT6A 5ID2A 2R0PA 2KHPA 2YWNA 4H86A 3KM6A 3LFLA 3UEMA 4BA7A 1XXUA 1VGLA 4IKHA 1XWKA 4E8HA 3TUEA 3UJ1A 1SD9A 1R4WA 4O7HA 2GZZA 2WFCA 3QR6A 2JACA 3HZ8A 5D93A 1ZL9A 4K7OA 2YZUA 4EF0A 2K18A 3G7IA 11GSA 1U3IA 2K8SA 4HDEA 1XVQA 3TDGA 2F3MA 1XWGA 2WGRA 2V1MA 4ML1A 3KP8A 1T1VA 4YAVA 5EL8A 2L4CA 1SK2A 4ID0A 5JWQB 3FRCA 3VLNA 1AXDA 1XW6A 4WBJA 4O32A 1JHBA 5CRGA 2XC2A 1HNCA 3GSSA 2RUEA 5J4UA 2P5RA 4X43A 3EWLA 4BWQA 1TDIA 1XOAA 3QAVA 3L9VA 2WULA 3VI7A 2P0GA 2B1KA 5D8IA 2MMOA 4G0LA 18GSA 1KBNA 2OJLA 3BJ5A 1HQOA 3QFAC 4ZBBA 4XS1A 1JFUA 2N5FA 2TRXA 3FR6A 2I3YA 2WZ9A 1O8XA 3IE3A 3DKSA 3LXZA 3GMFA 4HJMA 1O6JA 2R5GA 1E6BA 3DVXA 1ZYQB 2C0DA 4TOPA 4MNNA 4NWYA 3CTGA 1YJ6A 2LRNA 2C3QA 1O81A 2J9HA 3M9JA 2H70A 1ZZYA 4BL7A 3UVHA 1R26A 4ECCA 3VPTA 1V98A 5JCGA 2H1BA 2B5XA 2HRKA 4TR1A 10GSA 2HSHA 2DKHA 2KOKA 3M8NA 1ABAA 1DE1A 1URMA 5JCWA 2LNTA 4TKYA 3GTUA 3GA4A 1KNGA 2FHEA 4GRFA 4RQRA 3F63A 2HXKA 1VRSD 2P5QA 4IJIA 3WYWA 2HZEB 3IC4A 1S3CA 2HYXA 4KNDA 2OE0A 1EV4A 1FO5A 1OAZA 3I9V2 2AUVA 3GUSA 2AAWA 2LSTA 4XS4B 1Z9HA 1E2YA 1ST9A 3F4SA 2FWEA 3F3QA 2P31A 4XRDA 2CT6A 4KDYA 4G0IA 3L4NA 5G5EA 1SKWB 4ZB9A 5H5RA 5H5SA 3TKPA 3ME7A 5C04A 4OFTA 4CDOA 4YQMA 3H1NA 3F3RA 1GH2A 2LJAA 5AIXA 5FT3A 3UVTA 2DJJA 3HHVA 4OFNA 4WEYA 5DQYA 3VURA 4TVEA 3FYGA 4YKGA 2VL2A 3ISOA 2E7PA 5CNWA 4G2EA 5IM9A 1ERUA 2WRTA 4EC0A 1R5PA 2CZ2A 3OR5A 4NAXA 2IMIA 2MMNA 4OCEA 3WGDA 3DWVA 2B5EA 3IA1A 1SL0B 1BEDA 3IRAA 3VPQA 1CQGA 1SYRA 1DBYA 2AHEA 4AF2A 5CP1A 1ERTA 3BCIA 3A5WA 3A2WA 2X49A 4KF9A 3GKXA 3ME8A 3LYPA 2R6KA 4EXJA 2DJ3A 1ZYNA 1M0UA 2H0IA 3A2XA 5CRHA 1V57A 3CSJA 4J2FA 6GSUA 3D4MA 1A8LA 4KCEA 2MBSA 1LBKA 1ZGNA 2WS2A 1QXHA 5GAPD 3KMNA 2IMEA 2V6KA 4KW6A 1C72A 4L5LA 2YCDA 5DBQA 4MJBA 3RBTA 3GSTA 2LUSA 4LL1B 3G7JA 2LQOA 4BVYA 2C0FA 2YWMA 3M0FA 5J5NA 2GSTA 1QMVA 4PNGA 1K0NA 1TK8B 2F51A 3TKQA 2DIYA 3ERFA 3TJGA 1A0FA 1ERWA 3QOUA 4IQAA 4TXOB 1MD3A 5D9WA 1J0FA 4DSQA 1VF1A 4MMMA 1XCCA 4CY8A 5G1KA 1TK0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J41 A;  3VWX A;  1XOB A;  3BBY A;  3TKS E;  2OAC A;  5B7C A;  1GSF A;  3VFI A;  2GVP A;  1GUM A;  1YZX A;  5CAX A;  3GKN A;  2LKU A;  2H72 A;  2O87 A;  4FYU A;  4K8M A;  2CAI A;  1W89 A;  3UBL A;  1NSW A;  4EL1 A;  2L5L A;  5F0G A;  3HJM A;  3E9J B;  3BCK A;  1HNA A;  3I69 A;  1KEB A;  4IBP A;  1NW2 A;  2FD3 A;  4DSS A;  5AN1 A;  4KB3 A;  4F03 A;  4MPF A;  3VK9 A;  2QGV A;  4MLY A;  3FZ9 A;  3LGC A;  1OE7 A;  4J56 E;  4POB A;  1K0A A;  4WET A;  3KD0 A;  4NXI A;  2VUP A;  3F8U A;  5ECL B;  3WGX A;  3NIV A;  1MEK A;  2PWJ A;  5HR2 A;  4O92 A;  2OBK A;  3NZN A;  3DD3 A;  4XRA A;  3C73 A;  1GNW A;  5CRW A;  5DCG A;  3EMP A;  5B8A A;  3M1G A;  2IWT A;  2HE3 A;  1XIY A;  4I2T A;  3TB2 A;  1VF2 A;  3TJJ A;  3W8J A;  2H6X A;  2R2J A;  1OKD A;  5DAK A;  1GTA A;  3CRU A;  3HXS A;  1GSY A;  3D6I A;  1PMT A;  1M2B A;  4PUA A;  3GIX A;  1ZMA A;  1I9D A;  4WR5 A;  1MDI A;  1TU7 A;  2YJH A;  2ES7 A;  2GQM A;  4ML6 A;  2ZUP A;  1B4Q A;  4KA0 A;  3A2V A;  4AJ7 A;  3CXG A;  2H75 A;  1M7T A;  2DJK A;  1S3A A;  4ZBA A;  3D22 A;  1WOU A;  4IQ1 A;  5G1L A;  4WF4 A;  3TKS A;  4TN8 A;  3QDN A;  3EU3 A;  3F6D A;  4IVF A;  3ZL5 A;  3KP9 A;  2E2M A;  2OKA A;  3LYK A;  4YQU A;  2H76 A;  1XW5 A;  2A4V A;  4AJ6 A;  22GS A;  2FGX A;  2KP2 A;  2VLU A;  1TRU A;  1TKD B;  6GSV A;  5JWO B;  4CHS A;  1EEM A;  4YAP A;  4MF5 A;  2I81 A;  1PA3 A;  3KIJ A;  4NHZ A;  2AV4 A;  3ERW A;  3Q18 A;  1A2J A;  4V1A p;  5DAL A;  2X64 A;  5EY6 A;  2IN3 A;  1AQX A;  4GTU A;  3EUR A;  2YN1 A;  2VD1 A;  5D9V A;  1RK4 A;  1T3B A;  2LJK A;  1K3O A;  5H5Q A;  4ZB6 A;  2L5O A;  3RAZ A;  1KTE A;  2XPE A;  4XCS A;  1UVZ A;  3FW2 A;  2L6D A;  2PN8 A;  1OC9 A;  5IPH A;  1OYJ A;  5IO2 A;  2M72 A;  2FWG A;  5B6N A;  1A23 A;  5ENU A;  3UBK A;  5IMD A;  3ZZX A;  2LS5 A;  1JLW A;  4KDX A;  4WXT A;  3I43 A;  4ZL8 A;  5JWR B;  3HZ4 A;  3M3M A;  1TXX A;  2CZ3 A;  2YV7 A;  3CSI A;  1YKA A;  5ABR A;  3GFK A;  1XPV A;  4GXZ A;  1N2A A;  2HLS A;  4NPB A;  2X8G A;  2VD0 A;  9GSS A;  3FEU A;  2F8F A;  1THO A;  3LOR A;  2JZR A;  4IGJ A;  4I5Q A;  1FOV A;  5HR3 A;  1V40 A;  3GKK A;  2LRT A;  4TR0 A;  1F3A A;  5GST A;  2GS3 A;  1NM3 A;  1BX9 A;  2CV4 A;  3EIN A;  5ECH B;  3KTB A;  1SL1 B;  4OCF A;  2C3N A;  1AW9 A;  1W4V A;  4PUF C;  4OO5 A;  4BPY A;  4Z7X A;  3WD6 A;  2NDO A;  3UL3 A;  1K0C A;  2H73 A;  2V32 A;  2OE1 A;  1MDK A;  2RM6 A;  1U87 A;  3AY8 A;  1GWC A;  2QSI A;  1FB6 A;  3DVW A;  4MP4 A;  2B5Y A;  2B6M A;  5CO3 A;  4TW5 A;  2H1A A;  4KCA A;  3VWV A;  3H93 A;  3QPM A;  1AAZ A;  2RUF A;  2K9F A;  3TGZ A;  3TCO A;  4ILF A;  1BJX A;  4XHM A;  5KN2 A;  1EP8 A;  4MZW A;  5LNK e;  4FIW A;  3UIW A;  5ECN B;  5GAN D;  2IMF A;  1XBS A;  4KAE A;  2K8V A;  2PVO C;  3MNG A;  1H75 A;  1PKW A;  5HQP A;  2VLV A;  1Z6N A;  2MYG A;  1FB0 A;  3RHC A;  4E8E A;  4EE0 A;  1ZYE A;  1T8E B;  5KEJ A;  4ECB A;  5J9B A;  2JL4 A;  1SD8 A;  16GS A;  1PL2 A;  3DML A;  1EOG A;  3ZFL A;  2YP6 A;  5DJL A;  1B9Y C;  2R4V A;  2V41 A;  2IPA A;  2CAQ A;  3E3E A;  1PGT A;  1DSB A;  2H0H A;  4TR1 B;  3LSZ A;  2DIZ A;  1IYI A;  5ELA A;  1B4P A;  1K0B A;  4YH2 A;  4O5R A;  2C3T A;  4MJC A;  4PX1 A;  1UC7 A;  1M9A A;  5KN1 A;  2VO4 A;  3ZFB A;  5E4W A;  1M99 A;  4N10 A;  1GTI A;  3KH7 A;  1JZW A;  4OMV A;  5A4V A;  1FW1 A;  2X8C A;  5ECM B;  2VCQ A;  2VL2 C;  2C0G A;  1PN9 A;  4XTS A;  5B8B A;  2HSY A;  3FZA A;  3CSH A;  1SKR B;  4MPG A;  3LXT A;  2XPD A;  3HKR A;  2QKE A;  4BWS A;  2B3S A;  3KTL A;  4RI6 A;  1TRS A;  2PER A;  1GL8 A;  1F6M C;  1AUC A;  1B8X A;  4QQ7 A;  1JZO A;  2PPT A;  3FR9 A;  5HFK A;  4HU7 A;  3FK8 A;  4QL7 A;  4V2M A;  2OBI A;  5LD0 A;  2PUK C;  3WT2 A;  3MAK A;  3D0Z A;  1GNE A;  3F6F A;  1WPI A;  5HFG A;  4L5O A;  7GSS A;  1GSU A;  2BJX A;  2DMM A;  2H6Z A;  4G9H A;  5IMV A;  3TRQ A;  3Q74 A;  3GN3 A;  2FWF A;  2IIY A;  5G31 A;  4MJE A;  12GS A;  1EOH A;  1X5C A;  1SJI A;  2G0F A;  2LNS A;  4IN0 A;  4GLT A;  3GH6 A;  2GDR A;  4N0Z A;  1MD4 A;  3R2Q A;  2RM5 A;  4ZIJ A;  1A2M A;  4L8E A;  3UAR A;  3HYP A;  2N5B A;  4I6X A;  4I2U A;  2VCV A;  3KCM A;  1SEN A;  2IJY A;  3L0H A;  3L9U A;  2AB6 A;  3GHA A;  1A2L A;  2AJQ B;  2D2Z A;  2MMZ A;  2PBJ A;  1QUW A;  2CA8 A;  2GQK A;  3SWL A;  1JZD A;  4N0V A;  1DUG A;  5ECQ B;  1PKZ A;  4WR4 A;  1EGO A;  3K8N A;  2C0E A;  13GS A;  2GZP A;  2JZT A;  4NV5 A;  2HRN A;  3KZQ A;  4FYC A;  1T4Y A;  3IK9 A;  5DCH A;  1K3L A;  3EYT A;  3L78 A;  3W6G A;  4G19 A;  4K9Z A;  5IPG A;  1B48 A;  1X9S B;  3ZVJ D;  1Y25 A;  1XWC A;  1T4Z A;  3TRP A;  3F4R A;  2DML A;  5IMF A;  4D73 B;  4V2N A;  3FR3 A;  1V2A A;  1JZR A;  4HS1 A;  3VWW A;  4Q5Q A;  3KH9 A;  2R3X A;  5ELG A;  4EUY A;  2F8A A;  2B7J A;  2H6Y A;  2CX4 A;  2LQQ A;  5F06 A;  2I4A A;  1BG5 A;  5IQY A;  2C1Y A;  4K0G A;  4OWY A;  1AQV A;  2LRC A;  4J57 E;  1MDJ A;  2H0G A;  2VM2 A;  3IXR A;  2DSA A;  4ACS A;  2JZS A;  4ECJ A;  1TRV A;  3ZMK A;  1Z3E A;  3FZ4 A;  3Q19 A;  1PL1 A;  1TTZ A;  3W8S A;  1SK1 A;  4MJA A;  1F37 A;  1YEP A;  4PNF A;  4TXO A;  4F0B A;  2VM1 A;  2PVQ A;  1OVN A;  2WDU A;  3CRT A;  5D9T A;  4K2D A;  1TU8 A;  4IEL A;  4ZBD A;  4ZB8 A;  2NTO A;  1PQN A;  3GL3 A;  1OC3 A;  2FY6 A;  2I1U A;  2I9H A;  4K6X A;  1T00 A;  2XHF A;  1XVW A;  3TKS C;  6GSS A;  3DEX A;  3M9K A;  5AIS A;  3DIE A;  1BAY A;  2H01 A;  2IMD A;  1GSS A;  1X5E A;  1IYH A;  2OAD A;  1RW1 A;  3QAG A;  2CQ9 A;  3TJK A;  3P90 A;  3QD9 A;  2N5A A;  5HR0 A;  1N8J A;  3IBH A;  1TI1 A;  2X8H A;  5F05 A;  4MZB A;  4K1F A;  4GSS A;  3E0U A;  2ALB A;  5ECR B;  3EVI A;  4PXO A;  2HI7 A;  5FWG A;  1K3Y A;  1VF4 A;  4NHW A;  5INY A;  2JSY A;  3KEB A;  2GSQ A;  2RII A;  2ON5 A;  2KP1 A;  5FHI A;  5GZZ B;  1MTC A;  3ZIT A;  1O7U A;  3G9B A;  3HDC A;  2DBC A;  4I97 A;  1NHY A;  3IPZ A;  2KUC A;  5B6M A;  1EP7 A;  4WKW A;  1ERV A;  3GX0 A;  1GUK A;  1TI3 A;  1SYX A;  4IHU A;  1AIU A;  1SJZ A;  3A3T A;  3ZRE A;  5CRE A;  3MDK A;  4RI7 A;  1FVK A;  2HT9 A;  1JLV A;  4HZ4 A;  2ON7 A;  3IOS A;  3D5J A;  3O76 A;  3C71 A;  4WF5 A;  4L0W A;  2FNO A;  1G0T A;  5D9X A;  2JU5 A;  4N30 A;  1G6Y A;  2MZC A;  1YQ1 A;  3D21 A;  1XWA A;  3LJR A;  2LJR A;  5COH A;  4HJ2 A;  1M2A A;  1Q4J A;  4GST A;  5D73 A;  4K0N A;  1EZK A;  1WE0 A;  1J9B A;  3FKF A;  3S9F A;  2EIO A;  5IOW A;  2MBT A;  4V1A g;  1A8Y A;  5CRD A;  2GTU A;  3F9U A;  2MMA A;  2A2S A;  4MH2 A;  1EV9 A;  2VL3 A;  2VIM A;  2DJ2 A;  1DE2 A;  4V2L A;  3F0I A;  3GKM A;  4GWR A;  2CVK A;  3RHB A;  2H8L A;  3FZ5 A;  3Q6O A;  4MH3 A;  1K0M A;  5G5F A;  4LA1 A;  2NVL A;  3GL5 A;  2IFQ A;  4JR4 A;  3HJO A;  1CQH A;  1OKT A;  2HFD A;  14GS A;  4G10 A;  3LEF A;  3QFB C;  5C00 A;  2XBI A;  6GST A;  1F2E A;  3ERG A;  5ID2 B;  3IV4 A;  4LL4 B;  5ECI B;  4P3Y B;  3UMA A;  4IW9 A;  6GSY A;  4ZL9 A;  4I8B A;  2H1D A;  2BMX A;  2GT5 A;  3KJY A;  3EE2 A;  4N11 A;  5A4U A;  4GF0 A;  1Z7R A;  1T7P B;  2B7K A;  4ECI A;  1U3A A;  2O89 A;  3I6A A;  2XBQ A;  3IR4 A;  1Q98 A;  2CVD A;  4OFM A;  1XW9 A;  3LQ7 A;  3HA9 A;  4TR3 A;  4IJ3 A;  5EVO A;  3J7Y b;  3ZIJ A;  3TOU A;  1PX7 A;  3PIN A;  2QC7 A;  2YWI A;  3CTF A;  4FYB A;  3WGE A;  2YOI A;  1YDK A;  2RLI A;  5G2Z A;  2NBS A;  2EC4 A;  2IMK A;  1XZO A;  3CMI A;  3IAS 2;  2R37 A;  1VF3 A;  4X1U A;  3H4K A;  1YKC A;  2NPB A;  4EO3 A;  3ZLP A;  3L9S A;  1R7H A;  1F3B A;  4JU5 A;  2PMT A;  3VI5 A;  4EDY A;  2GSS A;  2REM A;  1LJR A;  1XFL A;  3EMX A;  2M80 A;  4MF6 A;  1Z5Y E;  3HD5 A;  2L6C A;  3MWH A;  1PD2 1;  1YY7 A;  4JZQ A;  4RQX A;  2O8V B;  1O85 A;  3HVS A;  2B1L A;  2X99 A;  4JRR A;  1X0R A;  5IOX A;  3TRX A;  1ZOF A;  2L59 A;  4PGT A;  4HOJ A;  4QL9 A;  2E0Q A;  3JCM L;  2V2G A;  1YEX A;  3US3 A;  3QCP A;  3RDW A;  4PQH A;  1SK0 A;  5EPF A;  2OA7 A;  3PR8 A;  1YF0 A;  2YJ7 A;  4KSM A;  1R5A A;  5AIV A;  3KXO A;  5GSS A;  3GTU B;  1QQ2 A;  2DJ1 A;  1TP9 A;  3N5O A;  2L4Q A;  5L71 A;  4F9Z A;  2VAF A;  3PGT A;  3ZVJ A;  2LEG A;  3FHK A;  3U6V A;  4ZXG A;  3GNJ A;  1GSQ A;  4Q5R A;  1GLP A;  3ZRD A;  1X9M B;  3O3T A;  2VCX A;  4EDZ A;  1EEJ A;  5D96 A;  1WP0 A;  1YF1 A;  1ILO A;  3P8W A;  3G7Y A;  1EWX A;  1O73 A;  4IP6 A;  1SKS B;  4HZ2 A;  1OE8 A;  4POK A;  3IK7 A;  2H30 A;  5A5K A;  1M2D A;  3DGQ A;  1OC8 A;  2YAN A;  3GX8 A;  3TKR A;  3N9J A;  3ZIV A;  1HNB A;  4JBB A;  4F0C A;  4GCI A;  5A4W A;  4GQC A;  4JED A;  4KDU A;  4MA9 A;  4DEJ A;  3ZML A;  2HZE A;  1GP1 A;  3GH9 A;  3C1R A;  4MK3 A;  4ZL7 A;  1TJD A;  3DXB A;  1B9X C;  4MCU A;  5F8B A;  2YPM A;  3QMX A;  2O7K A;  4XS4 A;  1WMJ A;  1SJ6 A;  1A0R P;  5ECP B;  2GQL A;  2JAD A;  4POM A;  2DC5 A;  4AGS A;  2OE3 A;  2DLX A;  1M9B A;  4LMV A;  2A2R A;  4GSN A;  4ULX A;  5IMZ A;  5KN0 A;  2BTO T;  1U88 A;  4MDC A;  2YZH A;  1Z6M A;  1A24 A;  1V9W A;  4KX4 A;  2FWH A;  4LMW A;  1U6T A;  4HU9 A;  2O85 A;  2AYT A;  2YWO A;  5JCU A;  4X0X A;  4TRX A;  1USB A;  4YQV A;  1TW9 A;  2HRF A;  4WBR D;  4K7I A;  3P7X A;  1G6W A;  4EVM A;  4MF7 A;  2FLS A;  1K0D A;  3PH9 A;  4Q5N A;  2C80 A;  4L0U A;  3HJP A;  2YV9 A;  3HVX A;  4FH8 A;  2GGT A;  2C4J A;  4HUA A;  2K6V A;  4F2I A;  1TRW A;  3V1W A;  2FA4 A;  3CBU A;  4OO4 A;  2F9S A;  3HCZ A;  4PQI A;  4EKZ A;  1WWJ A;  1GRX A;  2PGT A;  3EU4 A;  2FCH A;  1PX6 A;  4D73 A;  3D4T A;  2L57 A;  3QAW A;  2HNL A;  3MSZ A;  3GUR A;  1I5G A;  4NMU A;  1EGR A;  4KH7 A;  1V58 A;  1WIK A;  4AJ8 A;  3VWU A;  3KMO A;  5G30 A;  2YNX A;  1SL2 B;  4DSS B;  5ECS A;  4JR6 A;  4IS0 A;  3APS A;  19GS A;  5E59 A;  1QFN A;  2LTK A;  4KUN A;  1GSE A;  1GUL A;  4TR4 A;  1HD2 A;  3H79 A;  5DQS A;  3IHQ A;  2GSR A;  3APQ A;  4HQZ A;  3APO A;  2VCW A;  3SBC A;  1J08 A;  1ZCP A;  2E2G A;  3IDV A;  5ECO B;  3RPP A;  5IMA A;  3BOA A;  1X9W B;  3BD2 A;  8GSS A;  1TK5 B;  2LV3 A;  1O8W A;  3HY2 A;  3WT1 A;  5LCZ A;  3GV1 A;  5DAK B;  1Z7P A;  1H4O A;  4OD7 A;  1UA5 A;  1BYE A;  1S3D A;  3ZYW A;  3DYR A;  4Q5F A;  1G7E A;  1GTB A;  3NOF A;  1ON4 A;  2VL9 A;  2M46 A;  2V6O A;  3GYK A;  2Z9S A;  1K0O A;  1THX A;  3C1S A;  3LWA A;  3KGK A;  3ZTL A;  4GQF A;  4JE1 A;  4DSR A;  3P2A A;  4MZC A;  1GSD A;  3UAP A;  4KSO A;  2EIR A;  3H8Q A;  1BQ7 A;  1WRY A;  1PRX A;  4LLR A;  3O6T A;  5HR1 A;  2H74 A;  4HQS A;  1ACV A;  3LG6 A;  2GZY A;  3TJB A;  2ZCT A;  1GTU A;  3TJF A;  4DVC A;  2ZNM A;  4XS6 A;  4KE3 A;  5F07 A;  3RPN A;  3UOM A;  1FVJ A;  2EIQ A;  5DDL A;  2G2Q A;  4KGI A;  1AQW A;  1QGV A;  6GSX A;  2J23 A;  3EC3 A;  2CVB A;  1Y6E A;  5CYY A;  5DVB A;  1AC1 A;  1FHE A;  1SU9 A;  2PU9 C;  2WCI A;  2IL3 A;  5DAL B;  5AGY A;  4MAB A;  2JSZ A;  2C8U A;  1G7O A;  1FAA A;  4BVX A;  1GLQ A;  3TOT A;  5IO0 A;  1LU4 A;  1GUH A;  4PUR A;  1QK8 A;  4RUV A;  1FG4 A;  4NV2 A;  3FY7 A;  2IFQ B;  3IAM 2;  3C8E A;  3ED3 A;  6GSW A;  1OC9 B;  2FUG 2;  2VCZ A;  2FA8 A;  3F4T A;  1X5D A;  5J9C A;  1HYU A;  4HEA 2;  4XIH A;  4ISD A;  1WJK A;  2H19 A;  1RQM A;  3J7Y k;  3U5R E;  2VLT A;  2WB9 A;  1ML6 A;  4PQ1 A;  3GRX A;  2VOC A;  4HI7 A;  5DJM A;  4ZIL A;  2DJ0 A;  2TRC P;  1XWB A;  3HVV A;  2CX3 A;  5IIZ A;  2H1G A;  2H66 A;  20GS A;  1F9M A;  2WJU A;  4K7N A;  1TOF A;  3DRN A;  1UN2 A;  4POL A;  3C7M A;  4IP1 A;  4TXV A;  3CYN A;  4CW9 A;  5IMC A;  2TIR A;  4FO5 A;  17GS A;  2HZF A;  4F82 A;  5KN3 A;  1PSQ A;  2GLR A;  2VCT A;  2KLX A;  1NHO A;  5ECK B;  5J3R A;  2H71 A;  5HFI A;  2GT6 A;  5ID2 A;  2KHP A;  2YWN A;  4H86 A;  3KM6 A;  3LFL A;  3UEM A;  4BA7 A;  1XXU A;  1VGL A;  4IKH A;  1XWK A;  4E8H A;  3TUE A;  3UJ1 A;  1SD9 A;  1R4W A;  4O7H A;  2GZZ A;  2WFC A;  3QR6 A;  2JAC A;  3HZ8 A;  5D93 A;  1ZL9 A;  4K7O A;  2YZU A;  4EF0 A;  2K18 A;  3G7I A;  11GS A;  1U3I A;  2K8S A;  4HDE A;  1XVQ A;  3TDG A;  2F3M A;  1XWG A;  2WGR A;  2V1M A;  4ML1 A;  3KP8 A;  1T1V A;  4YAV A;  5EL8 A;  2L4C A;  1SK2 A;  4ID0 A;  5JWQ B;  3FRC A;  3VLN A;  1AXD A;  1XW6 A;  4WBJ A;  4O32 A;  1JHB A;  5CRG A;  2XC2 A;  1HNC A;  3GSS A;  2RUE A;  5J4U A;  2P5R A;  4X43 A;  3EWL A;  4BWQ A;  1TDI A;  1XOA A;  3QAV A;  3L9V A;  2WUL A;  3VI7 A;  2P0G A;  2B1K A;  5D8I A;  2MMO A;  18GS A;  1KBN A;  2OJL A;  3BJ5 A;  1HQO A;  3QFA C;  4ZBB A;  4XS1 A;  1JFU A;  2N5F A;  2TRX A;  3FR6 A;  2I3Y A;  2WZ9 A;  1O8X A;  3IE3 A;  3DKS A;  3LXZ A;  3GMF A;  4HJM A;  1O6J A;  2R5G A;  1E6B A;  3DVX A;  1ZYQ B;  2C0D A;  4TOP A;  4NWY A;  3CTG A;  1YJ6 A;  2LRN A;  2C3Q A;  1O81 A;  2J9H A;  3M9J A;  2H70 A;  1ZZY A;  4BL7 A;  3UVH A;  1R26 A;  4ECC A;  3VPT A;  1V98 A;  5JCG A;  2H1B A;  2B5X A;  4TR1 A;  10GS A;  2HSH A;  2KOK A;  3M8N A;  1ABA A;  1DE1 A;  1URM A;  5JCW A;  2LNT A;  4TKY A;  3GTU A;  3GA4 A;  1KNG A;  2FHE A;  4GRF A;  4RQR A;  3F63 A;  2HXK A;  1VRS D;  2P5Q A;  4IJI A;  3WYW A;  2HZE B;  3IC4 A;  1S3C A;  2HYX A;  4KND A;  2OE0 A;  1EV4 A;  1FO5 A;  1OAZ A;  3I9V 2;  2AUV A;  3GUS A;  2AAW A;  2LST A;  4XS4 B;  1Z9H A;  1E2Y A;  1ST9 A;  3F4S A;  2FWE A;  3F3Q A;  2P31 A;  4XRD A;  2CT6 A;  4KDY A;  3L4N A;  5G5E A;  1SKW B;  4ZB9 A;  5H5R A;  5H5S A;  3TKP A;  3ME7 A;  5C04 A;  4OFT A;  4CDO A;  4YQM A;  3H1N A;  3F3R A;  1GH2 A;  2LJA A;  5AIX A;  5FT3 A;  3UVT A;  2DJJ A;  3HHV A;  4OFN A;  4WEY A;  5DQY A;  3VUR A;  4TVE A;  3FYG A;  2VL2 A;  3ISO A;  2E7P A;  5CNW A;  4G2E A;  5IM9 A;  1ERU A;  2WRT A;  4EC0 A;  1R5P A;  2CZ2 A;  3OR5 A;  4NAX A;  2IMI A;  2MMN A;  4OCE A;  3WGD A;  3DWV A;  2B5E A;  3IA1 A;  1SL0 B;  1BED A;  3IRA A;  3VPQ A;  1CQG A;  1SYR A;  1DBY A;  2AHE A;  4AF2 A;  5CP1 A;  1ERT A;  3BCI A;  3A5W A;  3A2W A;  3GKX A;  3ME8 A;  3LYP A;  2R6K A;  4EXJ A;  2DJ3 A;  1M0U A;  2H0I A;  3A2X A;  5CRH A;  1V57 A;  3CSJ A;  4J2F A;  6GSU A;  3D4M A;  1A8L A;  4KCE A;  2MBS A;  1LBK A;  1ZGN A;  2WS2 A;  1QXH A;  5GAP D;  3KMN A;  2IME A;  2V6K A;  4KW6 A;  1C72 A;  4L5L A;  2YCD A;  5DBQ A;  4MJB A;  3RBT A;  3GST A;  2LUS A;  4LL1 B;  3G7J A;  2LQO A;  4BVY A;  2C0F A;  2YWM A;  3M0F A;  5J5N A;  2GST A;  1QMV A;  4PNG A;  1K0N A;  1TK8 B;  2F51 A;  3TKQ A;  2DIY A;  3ERF A;  3TJG A;  1A0F A;  1ERW A;  3QOU A;  4IQA A;  4TXO B;  1MD3 A;  5D9W A;  1J0F A;  4DSQ A;  1VF1 A;  4MMM A;  1XCC A;  5G1K A;  1TK0 B; 
#chains in the Genus database with same CATH topology
 5J41 A;  3VWX A;  1XOB A;  3BBY A;  3TKS E;  2OAC A;  5B7C A;  1GSF A;  3VFI A;  2GVP A;  1GUM A;  1YZX A;  5CAX A;  3GKN A;  2LKU A;  2H72 A;  2O87 A;  4FYU A;  4K8M A;  2CAI A;  1W89 A;  3UBL A;  1NSW A;  4EL1 A;  2L5L A;  5F0G A;  3HJM A;  3E9J B;  3BCK A;  1HNA A;  3I69 A;  1KEB A;  4IBP A;  1NW2 A;  2FD3 A;  4DSS A;  5AN1 A;  4KB3 A;  4F03 A;  4MPF A;  3VK9 A;  2QGV A;  4MLY A;  3FZ9 A;  3LGC A;  1OE7 A;  4J56 E;  4POB A;  1K0A A;  4WET A;  3KD0 A;  4NXI A;  2VUP A;  3F8U A;  5ECL B;  3WGX A;  3NIV A;  1MEK A;  2PWJ A;  5HR2 A;  4O92 A;  2OBK A;  3NZN A;  3DD3 A;  4XRA A;  3C73 A;  1GNW A;  5CRW A;  5DCG A;  3EMP A;  5B8A A;  3M1G A;  2IWT A;  2HE3 A;  1XIY A;  4I2T A;  3TB2 A;  1VF2 A;  3TJJ A;  3W8J A;  2H6X A;  2R2J A;  1OKD A;  5DAK A;  1GTA A;  3CRU A;  3HXS A;  1GSY A;  3D6I A;  1PMT A;  1M2B A;  4PUA A;  3GIX A;  1ZMA A;  1I9D A;  4WR5 A;  4K5R A;  1MDI A;  1TU7 A;  2YJH A;  2ES7 A;  2GQM A;  4ML6 A;  2ZUP A;  1B4Q A;  4KA0 A;  3A2V A;  4AJ7 A;  3CXG A;  2H75 A;  1M7T A;  2HRA A;  2DJK A;  1S3A A;  4ZBA A;  3D22 A;  1WOU A;  4IQ1 A;  5G1L A;  4WF4 A;  3TKS A;  4TN8 A;  3QDN A;  3EU3 A;  3F6D A;  4IVF A;  3ZL5 A;  3KP9 A;  2E2M A;  2OKA A;  3LYK A;  4YQU A;  2H76 A;  1XW5 A;  2A4V A;  4AJ6 A;  22GS A;  2FGX A;  2KP2 A;  2VLU A;  3A5I A;  1TRU A;  1TKD B;  6GSV A;  5JWO B;  4CHS A;  1EEM A;  4YAP A;  4MF5 A;  2I81 A;  1PA3 A;  3KIJ A;  4NHZ A;  2AV4 A;  3ERW A;  3Q18 A;  1A2J A;  4V1A p;  5DAL A;  2X64 A;  5EY6 A;  2IN3 A;  1AQX A;  4GTU A;  3EUR A;  2YN1 A;  2VD1 A;  5D9V A;  1RK4 A;  1T3B A;  2LJK A;  1K3O A;  4G0K A;  5H5Q A;  4ZB6 A;  2L5O A;  3RAZ A;  1KTE A;  2XPE A;  4XCS A;  1UVZ A;  3FW2 A;  2L6D A;  2PN8 A;  1OC9 A;  5IPH A;  1OYJ A;  5IO2 A;  2M72 A;  2FWG A;  5B6N A;  1A23 A;  5ENU A;  3UBK A;  5IMD A;  3ZZX A;  2LS5 A;  1JLW A;  4KDX A;  4WXT A;  3I43 A;  4ZL8 A;  1FOH A;  5JWR B;  3HZ4 A;  3M3M A;  1TXX A;  2CZ3 A;  2YV7 A;  3CSI A;  1YKA A;  5ABR A;  3GFK A;  1XPV A;  4GXZ A;  1N2A A;  2HLS A;  4NPB A;  2X8G A;  2VD0 A;  4PTS A;  9GSS A;  3FEU A;  2F8F A;  1THO A;  3LOR A;  2JZR A;  4IGJ A;  4I5Q A;  1FOV A;  5HR3 A;  1V40 A;  3GKK A;  2LRT A;  4TR0 A;  1F3A A;  5GST A;  2GS3 A;  1NM3 A;  1BX9 A;  2CV4 A;  3EIN A;  5ECH B;  3KTB A;  1SL1 B;  4OCF A;  2C3N A;  1AW9 A;  1W4V A;  4PUF C;  4OO5 A;  4HSC X;  4BPY A;  4Z7X A;  3WD6 A;  2NDO A;  3FMW A;  3UL3 A;  1K0C A;  2H73 A;  2V32 A;  2OE1 A;  1MDK A;  2RM6 A;  1U87 A;  3AY8 A;  1GWC A;  2QSI A;  1FB6 A;  3DVW A;  4MP4 A;  2B5Y A;  2B6M A;  5CO3 A;  4TW5 A;  2H1A A;  4KCA A;  3VWV A;  3H93 A;  3QPM A;  1AAZ A;  2RUF A;  2K9F A;  3TGZ A;  5BMU A;  3TCO A;  4ILF A;  1BJX A;  4USS A;  4XHM A;  5KN2 A;  1EP8 A;  4MZW A;  5LNK e;  4FIW A;  3UIW A;  5ECN B;  4EIP A;  5GAN D;  2IMF A;  1XBS A;  4KAE A;  2K8V A;  2PVO C;  3MNG A;  1H75 A;  1PKW A;  4FQU A;  5HQP A;  2VLV A;  1Z6N A;  2MYG A;  1FB0 A;  3RHC A;  4E8E A;  4EE0 A;  1ZYE A;  1T8E B;  5KEJ A;  4ECB A;  5J9B A;  2JL4 A;  1SD8 A;  16GS A;  1PL2 A;  3DML A;  1EOG A;  3ZFL A;  2YP6 A;  5DJL A;  1B9Y C;  2R4V A;  2V41 A;  2IPA A;  2CAQ A;  3E3E A;  1PGT A;  1DSB A;  2H0H A;  4TR1 B;  3LSZ A;  2DIZ A;  1IYI A;  5ELA A;  1B4P A;  1K0B A;  4YH2 A;  4O5R A;  2C3T A;  4MJC A;  4PX1 A;  1UC7 A;  1M9A A;  5KN1 A;  2VO4 A;  3ZFB A;  5E4W A;  1M99 A;  4N10 A;  1GTI A;  4Z2U A;  3KH7 A;  1JZW A;  4OMV A;  5A4V A;  1FW1 A;  2X8C A;  5ECM B;  2VCQ A;  2VL2 C;  2C0G A;  1PN9 A;  4XTS A;  5B8B A;  2HSY A;  3FZA A;  2X4A A;  3CSH A;  1SKR B;  4MPG A;  4Z2T A;  3LXT A;  2XPD A;  3HKR A;  2QKE A;  4BWS A;  2B3S A;  3KTL A;  4RI6 A;  1TRS A;  2PER A;  1GL8 A;  1F6M C;  1AUC A;  1B8X A;  4QQ7 A;  1JZO A;  2PPT A;  3FR9 A;  5HFK A;  4HU7 A;  3FK8 A;  4QL7 A;  4V2M A;  2OBI A;  5LD0 A;  2PUK C;  3WT2 A;  3R3E A;  3MAK A;  3D0Z A;  1GNE A;  3F6F A;  1WPI A;  5HFG A;  4L5O A;  7GSS A;  1GSU A;  2BJX A;  2DMM A;  2H6Z A;  4G9H A;  4K2X A;  3TRQ A;  5IMV A;  3Q74 A;  3GN3 A;  2FWF A;  2IIY A;  5G31 A;  4MJE A;  12GS A;  1EOH A;  1X5C A;  1SJI A;  2G0F A;  2LNS A;  4IN0 A;  4GLT A;  3GH6 A;  2GDR A;  4N0Z A;  1MD4 A;  3R2Q A;  2RM5 A;  4ZIJ A;  1A2M A;  4L8E A;  3UAR A;  3HYP A;  2N5B A;  4I6X A;  4I2U A;  2VCV A;  3KCM A;  1SEN A;  2IJY A;  3L0H A;  3L9U A;  2AB6 A;  3GHA A;  1A2L A;  2AJQ B;  2D2Z A;  2MMZ A;  2PBJ A;  3MYD A;  1QUW A;  2CA8 A;  2GQK A;  3SWL A;  1JZD A;  4N0V A;  1DUG A;  5ECQ B;  1PKZ A;  4WR4 A;  1EGO A;  3K8N A;  2C0E A;  13GS A;  2GZP A;  2JZT A;  4NV5 A;  2HRN A;  3KZQ A;  4FYC A;  1T4Y A;  3IK9 A;  5DCH A;  1K3L A;  3EYT A;  3L78 A;  3W6G A;  4G19 A;  4K9Z A;  5IPG A;  1B48 A;  4O5Q A;  1X9S B;  3ZVJ D;  1Y25 A;  1XWC A;  1T4Z A;  3TRP A;  3F4R A;  2DML A;  5IMF A;  4D73 B;  4V2N A;  3FR3 A;  1V2A A;  1JZR A;  4HS1 A;  3VWW A;  1PN0 A;  4Q5Q A;  4YKF A;  3KH9 A;  2R3X A;  5ELG A;  4EUY A;  2F8A A;  2B7J A;  2H6Y A;  2CX4 A;  2LQQ A;  2A4H A;  5F06 A;  2I4A A;  1BG5 A;  5IQY A;  2C1Y A;  4K0G A;  4OWY A;  1AQV A;  2LRC A;  4J57 E;  1MDJ A;  2H0G A;  2VM2 A;  3IXR A;  2DSA A;  4ACS A;  2JZS A;  4ECJ A;  1TRV A;  3ZMK A;  1Z3E A;  3FZ4 A;  3Q19 A;  1PL1 A;  2A2P A;  2QA2 A;  1TTZ A;  4CY6 A;  3W8S A;  1SK1 A;  4MJA A;  1F37 A;  1YEP A;  4PNF A;  4TXO A;  4F0B A;  2VM1 A;  2PVQ A;  1OVN A;  2WDU A;  3CRT A;  5D9T A;  4K2D A;  1TU8 A;  4IEL A;  4ZBD A;  4ZB8 A;  2NTO A;  1PQN A;  3GL3 A;  3HVN A;  1OC3 A;  2FY6 A;  2I1U A;  2I9H A;  4K6X A;  1T00 A;  2XHF A;  1XVW A;  3TKS C;  6GSS A;  3DEX A;  3M9K A;  5AIS A;  3DIE A;  1BAY A;  2H01 A;  2IMD A;  1GSS A;  1X5E A;  1IYH A;  2OAD A;  4X4J A;  1RW1 A;  3QAG A;  2CQ9 A;  3TJK A;  3P90 A;  3QD9 A;  2N5A A;  5HR0 A;  1N8J A;  3IBH A;  1TI1 A;  3IHG A;  3EPT A;  3PPU A;  2X8H A;  5F05 A;  4MZB A;  4K1F A;  4GSS A;  3E0U A;  2ALB A;  5ECR B;  3EVI A;  4PXO A;  2HI7 A;  5FWG A;  1K3Y A;  1VF4 A;  4NHW A;  5INY A;  2JSY A;  3KEB A;  2GSQ A;  2RII A;  2ON5 A;  2KP1 A;  5FHI A;  5GZZ B;  4BVX B;  1MTC A;  3ZIT A;  1O7U A;  3G9B A;  3HDC A;  2DBC A;  4I97 A;  1NHY A;  3IPZ A;  2KUC A;  5B6M A;  1EP7 A;  4WKW A;  1ERV A;  3GX0 A;  1GUK A;  1TI3 A;  1SYX A;  4IHU A;  1AIU A;  1SJZ A;  3A3T A;  3ZRE A;  5CRE A;  3MDK A;  3LW9 A;  4RI7 A;  1FVK A;  2HT9 A;  1JLV A;  2UZ8 A;  4HZ4 A;  2ON7 A;  3IOS A;  3D5J A;  3O76 A;  3C71 A;  4WF5 A;  4L0W A;  2FNO A;  3CQF A;  1G0T A;  2JU5 A;  4N30 A;  5D9X A;  1G6Y A;  2MZC A;  1YQ1 A;  3D21 A;  1XWA A;  3LJR A;  2LJR A;  4ICY A;  5COH A;  4HJ2 A;  1M2A A;  1Q4J A;  4GST A;  5D73 A;  4K0N A;  1EZK A;  1WE0 A;  1J9B A;  3FKF A;  3S9F A;  2EIO A;  5IOW A;  2MBT A;  4V1A g;  1A8Y A;  5CRD A;  2GTU A;  3F9U A;  2MMA A;  2A2S A;  4MH2 A;  1EV9 A;  2VL3 A;  2VIM A;  2DJ2 A;  2DKI A;  1DE2 A;  4V2L A;  3F0I A;  3GKM A;  4GWR A;  2CVK A;  3RHB A;  2H8L A;  3FZ5 A;  3Q6O A;  4MH3 A;  1K0M A;  5G5F A;  4LA1 A;  2NVL A;  3GL5 A;  2IFQ A;  4JR4 A;  3HJO A;  1CQH A;  1OKT A;  2HFD A;  14GS A;  4G10 A;  3LEF A;  3QFB C;  5C00 A;  2XBI A;  6GST A;  1F2E A;  3ERG A;  5ID2 B;  3IV4 A;  4LL4 B;  4K5S A;  5ECI B;  4P3Y B;  3UMA A;  4IW9 A;  2R0C A;  6GSY A;  4ZL9 A;  4I8B A;  2H1D A;  2BMX A;  2GT5 A;  3KJY A;  3EE2 A;  4N11 A;  3IC8 A;  5A4U A;  4GF0 A;  1Z7R A;  4A5P A;  1T7P B;  2B7K A;  4ECI A;  1U3A A;  2O89 A;  3I6A A;  2XBQ A;  3IR4 A;  1Q98 A;  2CVD A;  4OFM A;  1XW9 A;  3LQ7 A;  3HA9 A;  4TR3 A;  4IJ3 A;  5EVO A;  3J7Y b;  3ZIJ A;  3TOU A;  1PX7 A;  3PIN A;  2QC7 A;  2YWI A;  3CTF A;  4FYB A;  3WGE A;  2YOI A;  1YDK A;  2RLI A;  5G2Z A;  2NBS A;  2R0G A;  2EC4 A;  2IMK A;  1XZO A;  3CMI A;  3IAS 2;  2R37 A;  1VF3 A;  4X1U A;  3H4K A;  1YKC A;  2NPB A;  4EO3 A;  3ZLP A;  3L9S A;  1R7H A;  1F3B A;  4JU5 A;  2PMT A;  3VI5 A;  4EDY A;  2GSS A;  2REM A;  1LJR A;  1XFL A;  3EMX A;  2M80 A;  4MF6 A;  1Z5Y E;  3HD5 A;  2L6C A;  3MWH A;  1PD2 1;  1YY7 A;  4JZQ A;  4RQX A;  2O8V B;  1O85 A;  3HVS A;  2B1L A;  2X99 A;  4JRR A;  1X0R A;  5IOX A;  3TRX A;  1ZOF A;  2L59 A;  1S3R A;  4PGT A;  4BL7 B;  4HOJ A;  4QL9 A;  2E0Q A;  3JCM L;  2V2G A;  1YEX A;  3US3 A;  3QCP A;  3RDW A;  4PQH A;  1SK0 A;  5EPF A;  2OA7 A;  3PR8 A;  1YF0 A;  2YJ7 A;  4KSM A;  1R5A A;  5AIV A;  3KXO A;  5GSS A;  3GTU B;  1QQ2 A;  2DJ1 A;  1TP9 A;  3N5O A;  2L4Q A;  5L71 A;  4F9Z A;  2VAF A;  3PGT A;  3ZVJ A;  2LEG A;  3FHK A;  3U6V A;  4ZXG A;  3GNJ A;  1GSQ A;  4Q5R A;  1GLP A;  3ZRD A;  1X9M B;  3O3T A;  2VCX A;  4EDZ A;  1EEJ A;  5D96 A;  1WP0 A;  1YF1 A;  1ILO A;  3P8W A;  3G7Y A;  1EWX A;  1O73 A;  4IP6 A;  1SKS B;  4HZ2 A;  1OE8 A;  4POK A;  3IK7 A;  2H30 A;  5A5K A;  1M2D A;  3DGQ A;  1OC8 A;  1ZYP A;  2YAN A;  3GX8 A;  3TKR A;  3N9J A;  3ZIV A;  1HNB A;  4JBB A;  4F0C A;  4GCI A;  5A4W A;  4GQC A;  4JED A;  4KDU A;  4MA9 A;  4DEJ A;  3ZML A;  2HZE A;  1GP1 A;  3GH9 A;  3C1R A;  4MK3 A;  4ZL7 A;  1TJD A;  3DXB A;  1B9X C;  4MCU A;  5F8B A;  2YPM A;  3QMX A;  2O7K A;  4XS4 A;  1WMJ A;  1SJ6 A;  1A0R P;  5ECP B;  2GQL A;  2JAD A;  4POM A;  2DC5 A;  4AGS A;  2OE3 A;  2DLX A;  1M9B A;  4LMV A;  2A2R A;  4GSN A;  4ULX A;  5IMZ A;  5KN0 A;  2BTO T;  1U88 A;  4MDC A;  2YZH A;  1Z6M A;  1A24 A;  1V9W A;  4KX4 A;  2FWH A;  4LMW A;  1U6T A;  4HU9 A;  2O85 A;  4BVY B;  2AYT A;  2YWO A;  5JCU A;  4X0X A;  4TRX A;  1USB A;  4YQV A;  1TW9 A;  2HRF A;  4WBR D;  4K7I A;  3P7X A;  1G6W A;  4EVM A;  4MF7 A;  2FLS A;  1K0D A;  3PH9 A;  4Q5N A;  2C80 A;  4L0U A;  3HJP A;  2YV9 A;  3HVX A;  4FH8 A;  2GGT A;  2C4J A;  4HUA A;  2K6V A;  4Z2R A;  4F2I A;  1TRW A;  3V1W A;  2FA4 A;  3CBU A;  4EIQ A;  4OO4 A;  2F9S A;  3HCZ A;  4PQI A;  4EKZ A;  1WWJ A;  1GRX A;  2PGT A;  3EU4 A;  2FCH A;  1PX6 A;  4D73 A;  3D4T A;  2L57 A;  3QAW A;  2HNL A;  3MSZ A;  3GUR A;  1I5G A;  4NMU A;  1EGR A;  4KH7 A;  1V58 A;  1WIK A;  5BRT A;  4AJ8 A;  3VWU A;  3KMO A;  5G30 A;  2YNX A;  1SL2 B;  4DSS B;  5ECS A;  4JR6 A;  4IS0 A;  3APS A;  19GS A;  5E59 A;  1QFN A;  2LTK A;  4KUN A;  1GSE A;  1GUL A;  2QA1 A;  4TR4 A;  1HD2 A;  3H79 A;  5DQS A;  3IHQ A;  2GSR A;  3APQ A;  4HQZ A;  3APO A;  2VCW A;  3SBC A;  1J08 A;  1ZCP A;  2E2G A;  3IDV A;  5ECO B;  3RPP A;  5IMA A;  3BOA A;  1X9W B;  3BD2 A;  8GSS A;  1TK5 B;  2LV3 A;  1O8W A;  3HY2 A;  3WT1 A;  5LCZ A;  3GV1 A;  5DAK B;  1Z7P A;  1H4O A;  4OD7 A;  1UA5 A;  1BYE A;  1S3D A;  3ZYW A;  3DYR A;  4Q5F A;  1G7E A;  1GTB A;  3NOF A;  1ON4 A;  2VL9 A;  2M46 A;  2V6O A;  3GYK A;  2Z9S A;  1K0O A;  1THX A;  3C1S A;  3LWA A;  3KGK A;  3ZTL A;  4GQF A;  4JE1 A;  4DSR A;  3P2A A;  4MZC A;  1GSD A;  3UAP A;  4KSO A;  4O5U A;  2EIR A;  3H8Q A;  1BQ7 A;  1WRY A;  1PRX A;  4LLR A;  3O6T A;  5HR1 A;  2H74 A;  4HQS A;  1ACV A;  3LG6 A;  2GZY A;  3TJB A;  2ZCT A;  1GTU A;  3MIX A;  3TJF A;  4DVC A;  2ZNM A;  4XS6 A;  4KE3 A;  5F07 A;  3RPN A;  3UOM A;  1FVJ A;  2EIQ A;  5DDL A;  2G2Q A;  4KGI A;  1AQW A;  1QGV A;  6GSX A;  2J23 A;  3EC3 A;  2CVB A;  1Y6E A;  5CYY A;  5DVB A;  1AC1 A;  1FHE A;  1SU9 A;  2PU9 C;  2WCI A;  2IL3 A;  5DAL B;  5AGY A;  1M3I A;  4MAB A;  2JSZ A;  2C8U A;  1G7O A;  1FAA A;  4BVX A;  1GLQ A;  3TOT A;  5IO0 A;  1LU4 A;  2HSM A;  1GUH A;  4PUR A;  4BIK A;  1QK8 A;  4RUV A;  1M3J A;  1FG4 A;  4NV2 A;  3FY7 A;  2IFQ B;  3IAM 2;  3C8E A;  3ED3 A;  6GSW A;  1OC9 B;  2FUG 2;  2VCZ A;  2FA8 A;  3F4T A;  1PFO A;  1X5D A;  5J9C A;  1HYU A;  4HEA 2;  4XIH A;  4ISD A;  1WJK A;  2H19 A;  1RQM A;  3J7Y k;  3U5R E;  2VLT A;  2WB9 A;  1ML6 A;  4PQ1 A;  3GRX A;  2VOC A;  4HI7 A;  5DJM A;  4ZIL A;  2DJ0 A;  2TRC P;  1XWB A;  3HVV A;  2CX3 A;  5IIZ A;  2H1G A;  2H66 A;  20GS A;  1F9M A;  2WJU A;  4K7N A;  1TOF A;  3DRN A;  1UN2 A;  5KOX A;  5KOW A;  4POL A;  3C7M A;  4IP1 A;  4TXV A;  3CYN A;  4CW9 A;  5IMC A;  2TIR A;  4FO5 A;  17GS A;  2HZF A;  4F82 A;  5KN3 A;  1PSQ A;  2GLR A;  2VCT A;  2KLX A;  1NHO A;  5ECK B;  5J3R A;  2H71 A;  5HFI A;  2GT6 A;  5ID2 A;  2R0P A;  2KHP A;  2YWN A;  4H86 A;  3KM6 A;  3LFL A;  3UEM A;  4BA7 A;  1XXU A;  1VGL A;  4IKH A;  1XWK A;  4E8H A;  3TUE A;  3UJ1 A;  1SD9 A;  1R4W A;  4O7H A;  2GZZ A;  2WFC A;  3QR6 A;  2JAC A;  3HZ8 A;  5D93 A;  1ZL9 A;  4K7O A;  2YZU A;  4EF0 A;  2K18 A;  3G7I A;  11GS A;  1U3I A;  2K8S A;  4HDE A;  1XVQ A;  3TDG A;  2F3M A;  1XWG A;  2WGR A;  2V1M A;  4ML1 A;  3KP8 A;  1T1V A;  4YAV A;  5EL8 A;  2L4C A;  1SK2 A;  4ID0 A;  5JWQ B;  3FRC A;  3VLN A;  1AXD A;  1XW6 A;  4WBJ A;  4O32 A;  1JHB A;  5CRG A;  2XC2 A;  1HNC A;  3GSS A;  2RUE A;  5J4U A;  2P5R A;  4X43 A;  3EWL A;  4BWQ A;  1TDI A;  1XOA A;  3QAV A;  3L9V A;  2WUL A;  3VI7 A;  2P0G A;  2B1K A;  5D8I A;  2MMO A;  4G0L A;  18GS A;  1KBN A;  2OJL A;  3BJ5 A;  1XG8 A;  1HQO A;  3QFA C;  4ZBB A;  4XS1 A;  1JFU A;  2N5F A;  2TRX A;  3FR6 A;  2I3Y A;  2WZ9 A;  1O8X A;  3IE3 A;  3DKS A;  3LXZ A;  3GMF A;  4HJM A;  1O6J A;  2R5G A;  1E6B A;  3DVX A;  1ZYQ B;  2C0D A;  4TOP A;  4MNN A;  4NWY A;  3CTG A;  1YJ6 A;  2LRN A;  2C3Q A;  1O81 A;  2J9H A;  3M9J A;  2H70 A;  1ZZY A;  4BL7 A;  3UVH A;  1R26 A;  4ECC A;  3VPT A;  1V98 A;  5JCG A;  2H1B A;  2B5X A;  2HRK A;  4TR1 A;  10GS A;  2HSH A;  2DKH A;  2KOK A;  3M8N A;  1ABA A;  1DE1 A;  1URM A;  5JCW A;  2LNT A;  4TKY A;  3GTU A;  3GA4 A;  1KNG A;  2FHE A;  4GRF A;  4RQR A;  3F63 A;  2HXK A;  1VRS D;  2P5Q A;  4IJI A;  3WYW A;  2HZE B;  3IC4 A;  1S3C A;  2HYX A;  4KND A;  2OE0 A;  1EV4 A;  1FO5 A;  1OAZ A;  3I9V 2;  2AUV A;  3GUS A;  2AAW A;  2LST A;  4XS4 B;  1Z9H A;  1E2Y A;  1ST9 A;  3F4S A;  2FWE A;  3F3Q A;  2P31 A;  4XRD A;  2CT6 A;  4KDY A;  4G0I A;  3L4N A;  5G5E A;  1SKW B;  4ZB9 A;  5H5R A;  5H5S A;  3TKP A;  3ME7 A;  5C04 A;  4OFT A;  4CDO A;  4YQM A;  3H1N A;  3F3R A;  1GH2 A;  2LJA A;  5AIX A;  5FT3 A;  3UVT A;  2DJJ A;  3HHV A;  4OFN A;  4WEY A;  5DQY A;  3VUR A;  4TVE A;  3FYG A;  4YKG A;  2VL2 A;  3ISO A;  2E7P A;  5CNW A;  4G2E A;  5IM9 A;  1ERU A;  2WRT A;  4EC0 A;  1R5P A;  2CZ2 A;  3OR5 A;  4NAX A;  2IMI A;  2MMN A;  4OCE A;  3WGD A;  3DWV A;  2B5E A;  3IA1 A;  1SL0 B;  1BED A;  3IRA A;  3VPQ A;  1CQG A;  1SYR A;  1DBY A;  2AHE A;  4AF2 A;  5CP1 A;  1ERT A;  3BCI A;  3A5W A;  3A2W A;  2X49 A;  4KF9 A;  3GKX A;  3ME8 A;  3LYP A;  2R6K A;  4EXJ A;  2DJ3 A;  1ZYN A;  1M0U A;  2H0I A;  3A2X A;  5CRH A;  1V57 A;  3CSJ A;  4J2F A;  6GSU A;  3D4M A;  1A8L A;  4KCE A;  2MBS A;  1LBK A;  1ZGN A;  2WS2 A;  1QXH A;  5GAP D;  3KMN A;  2IME A;  2V6K A;  4KW6 A;  1C72 A;  4L5L A;  2YCD A;  5DBQ A;  4MJB A;  3RBT A;  3GST A;  2LUS A;  4LL1 B;  3G7J A;  2LQO A;  4BVY A;  2C0F A;  2YWM A;  3M0F A;  5J5N A;  2GST A;  1QMV A;  4PNG A;  1K0N A;  1TK8 B;  2F51 A;  3TKQ A;  2DIY A;  3ERF A;  3TJG A;  1A0F A;  1ERW A;  3QOU A;  4IQA A;  4TXO B;  1MD3 A;  5D9W A;  1J0F A;  4DSQ A;  1VF1 A;  4MMM A;  1XCC A;  4CY8 A;  5G1K A;  1TK0 B; 
#chains in the Genus database with same CATH homology
 5J41 A;  3VWX A;  1XOB A;  3BBY A;  3TKS E;  2OAC A;  5B7C A;  1GSF A;  3VFI A;  2GVP A;  1GUM A;  1YZX A;  5CAX A;  3GKN A;  2LKU A;  2H72 A;  2O87 A;  4FYU A;  4K8M A;  2CAI A;  1W89 A;  3UBL A;  1NSW A;  4EL1 A;  2L5L A;  5F0G A;  3HJM A;  3E9J B;  3BCK A;  1HNA A;  3I69 A;  1KEB A;  4IBP A;  1NW2 A;  2FD3 A;  4DSS A;  5AN1 A;  4KB3 A;  4F03 A;  4MPF A;  3VK9 A;  2QGV A;  4MLY A;  3FZ9 A;  3LGC A;  1OE7 A;  4J56 E;  4POB A;  1K0A A;  4WET A;  3KD0 A;  4NXI A;  2VUP A;  3F8U A;  5ECL B;  3WGX A;  3NIV A;  1MEK A;  2PWJ A;  5HR2 A;  4O92 A;  2OBK A;  3NZN A;  3DD3 A;  4XRA A;  3C73 A;  1GNW A;  5CRW A;  5DCG A;  3EMP A;  5B8A A;  3M1G A;  2IWT A;  2HE3 A;  1XIY A;  4I2T A;  3TB2 A;  1VF2 A;  3TJJ A;  3W8J A;  2H6X A;  2R2J A;  1OKD A;  5DAK A;  1GTA A;  3CRU A;  3HXS A;  1GSY A;  3D6I A;  1PMT A;  1M2B A;  4PUA A;  3GIX A;  1ZMA A;  1I9D A;  4WR5 A;  4K5R A;  1MDI A;  1TU7 A;  2YJH A;  2ES7 A;  2GQM A;  4ML6 A;  2ZUP A;  1B4Q A;  4KA0 A;  3A2V A;  4AJ7 A;  3CXG A;  2H75 A;  1M7T A;  2HRA A;  2DJK A;  1S3A A;  4ZBA A;  3D22 A;  1WOU A;  4IQ1 A;  5G1L A;  4WF4 A;  3TKS A;  4TN8 A;  3QDN A;  3EU3 A;  3F6D A;  4IVF A;  3ZL5 A;  3KP9 A;  2E2M A;  2OKA A;  3LYK A;  4YQU A;  2H76 A;  1XW5 A;  2A4V A;  4AJ6 A;  22GS A;  2FGX A;  2KP2 A;  2VLU A;  3A5I A;  1TRU A;  1TKD B;  6GSV A;  5JWO B;  4CHS A;  1EEM A;  4YAP A;  4MF5 A;  2I81 A;  1PA3 A;  3KIJ A;  4NHZ A;  2AV4 A;  3ERW A;  3Q18 A;  1A2J A;  4V1A p;  5DAL A;  2X64 A;  5EY6 A;  2IN3 A;  1AQX A;  4GTU A;  3EUR A;  2YN1 A;  2VD1 A;  5D9V A;  1RK4 A;  1T3B A;  2LJK A;  1K3O A;  4G0K A;  5H5Q A;  4ZB6 A;  2L5O A;  3RAZ A;  1KTE A;  2XPE A;  4XCS A;  1UVZ A;  3FW2 A;  2L6D A;  2PN8 A;  1OC9 A;  5IPH A;  1OYJ A;  5IO2 A;  2M72 A;  2FWG A;  5B6N A;  1A23 A;  5ENU A;  3UBK A;  5IMD A;  3ZZX A;  2LS5 A;  1JLW A;  4KDX A;  4WXT A;  3I43 A;  4ZL8 A;  1FOH A;  5JWR B;  3HZ4 A;  3M3M A;  1TXX A;  2CZ3 A;  2YV7 A;  3CSI A;  1YKA A;  5ABR A;  3GFK A;  1XPV A;  4GXZ A;  1N2A A;  2HLS A;  4NPB A;  2X8G A;  2VD0 A;  4PTS A;  9GSS A;  3FEU A;  2F8F A;  1THO A;  3LOR A;  2JZR A;  4IGJ A;  4I5Q A;  1FOV A;  5HR3 A;  1V40 A;  3GKK A;  2LRT A;  4TR0 A;  1F3A A;  5GST A;  2GS3 A;  1NM3 A;  1BX9 A;  2CV4 A;  3EIN A;  5ECH B;  3KTB A;  1SL1 B;  4OCF A;  2C3N A;  1AW9 A;  1W4V A;  4PUF C;  4OO5 A;  4BPY A;  4Z7X A;  3WD6 A;  2NDO A;  3FMW A;  3UL3 A;  1K0C A;  2H73 A;  2V32 A;  2OE1 A;  1MDK A;  2RM6 A;  1U87 A;  3AY8 A;  1GWC A;  2QSI A;  1FB6 A;  3DVW A;  4MP4 A;  2B5Y A;  2B6M A;  5CO3 A;  4TW5 A;  2H1A A;  4KCA A;  3VWV A;  3H93 A;  3QPM A;  1AAZ A;  2RUF A;  2K9F A;  3TGZ A;  5BMU A;  3TCO A;  4ILF A;  1BJX A;  4USS A;  4XHM A;  5KN2 A;  1EP8 A;  4MZW A;  5LNK e;  4FIW A;  3UIW A;  5ECN B;  4EIP A;  5GAN D;  2IMF A;  1XBS A;  4KAE A;  2K8V A;  2PVO C;  3MNG A;  1H75 A;  1PKW A;  4FQU A;  5HQP A;  2VLV A;  1Z6N A;  2MYG A;  1FB0 A;  3RHC A;  4E8E A;  4EE0 A;  1ZYE A;  1T8E B;  5KEJ A;  4ECB A;  5J9B A;  2JL4 A;  1SD8 A;  16GS A;  1PL2 A;  3DML A;  1EOG A;  3ZFL A;  2YP6 A;  5DJL A;  1B9Y C;  2R4V A;  2V41 A;  2IPA A;  2CAQ A;  3E3E A;  1PGT A;  1DSB A;  2H0H A;  4TR1 B;  3LSZ A;  2DIZ A;  1IYI A;  5ELA A;  1B4P A;  1K0B A;  4YH2 A;  4O5R A;  2C3T A;  4MJC A;  4PX1 A;  1UC7 A;  1M9A A;  5KN1 A;  2VO4 A;  3ZFB A;  5E4W A;  1M99 A;  4N10 A;  1GTI A;  4Z2U A;  3KH7 A;  1JZW A;  4OMV A;  5A4V A;  1FW1 A;  2X8C A;  5ECM B;  2VCQ A;  2VL2 C;  2C0G A;  1PN9 A;  4XTS A;  5B8B A;  2HSY A;  3FZA A;  2X4A A;  3CSH A;  1SKR B;  4MPG A;  4Z2T A;  3LXT A;  2XPD A;  3HKR A;  2QKE A;  4BWS A;  2B3S A;  3KTL A;  4RI6 A;  1TRS A;  2PER A;  1GL8 A;  1F6M C;  1AUC A;  1B8X A;  4QQ7 A;  1JZO A;  2PPT A;  3FR9 A;  5HFK A;  4HU7 A;  3FK8 A;  4QL7 A;  4V2M A;  2OBI A;  5LD0 A;  2PUK C;  3WT2 A;  3R3E A;  3MAK A;  3D0Z A;  1GNE A;  3F6F A;  1WPI A;  5HFG A;  4L5O A;  7GSS A;  1GSU A;  2BJX A;  2DMM A;  2H6Z A;  4G9H A;  4K2X A;  3TRQ A;  5IMV A;  3Q74 A;  3GN3 A;  2FWF A;  2IIY A;  5G31 A;  4MJE A;  12GS A;  1EOH A;  1X5C A;  1SJI A;  2G0F A;  2LNS A;  4IN0 A;  4GLT A;  3GH6 A;  2GDR A;  4N0Z A;  1MD4 A;  3R2Q A;  2RM5 A;  4ZIJ A;  1A2M A;  4L8E A;  3UAR A;  3HYP A;  2N5B A;  4I6X A;  4I2U A;  2VCV A;  3KCM A;  1SEN A;  2IJY A;  3L0H A;  3L9U A;  2AB6 A;  3GHA A;  1A2L A;  2AJQ B;  2D2Z A;  2MMZ A;  2PBJ A;  3MYD A;  1QUW A;  2CA8 A;  2GQK A;  3SWL A;  1JZD A;  4N0V A;  1DUG A;  5ECQ B;  1PKZ A;  4WR4 A;  1EGO A;  3K8N A;  2C0E A;  13GS A;  2GZP A;  2JZT A;  4NV5 A;  2HRN A;  3KZQ A;  4FYC A;  1T4Y A;  3IK9 A;  5DCH A;  1K3L A;  3EYT A;  3L78 A;  3W6G A;  4G19 A;  4K9Z A;  5IPG A;  1B48 A;  4O5Q A;  1X9S B;  3ZVJ D;  1Y25 A;  1XWC A;  1T4Z A;  3TRP A;  3F4R A;  2DML A;  5IMF A;  4D73 B;  4V2N A;  3FR3 A;  1V2A A;  1JZR A;  4HS1 A;  3VWW A;  1PN0 A;  4Q5Q A;  4YKF A;  3KH9 A;  2R3X A;  5ELG A;  4EUY A;  2F8A A;  2B7J A;  2H6Y A;  2CX4 A;  2LQQ A;  2A4H A;  5F06 A;  2I4A A;  1BG5 A;  5IQY A;  2C1Y A;  4K0G A;  4OWY A;  1AQV A;  2LRC A;  4J57 E;  1MDJ A;  2H0G A;  2VM2 A;  3IXR A;  2DSA A;  4ACS A;  2JZS A;  4ECJ A;  1TRV A;  3ZMK A;  1Z3E A;  3FZ4 A;  3Q19 A;  1PL1 A;  2A2P A;  2QA2 A;  1TTZ A;  4CY6 A;  3W8S A;  1SK1 A;  4MJA A;  1F37 A;  1YEP A;  4PNF A;  4TXO A;  4F0B A;  2VM1 A;  2PVQ A;  1OVN A;  2WDU A;  3CRT A;  5D9T A;  4K2D A;  1TU8 A;  4IEL A;  4ZBD A;  4ZB8 A;  2NTO A;  1PQN A;  3GL3 A;  1OC3 A;  2FY6 A;  2I1U A;  2I9H A;  4K6X A;  1T00 A;  2XHF A;  1XVW A;  3TKS C;  6GSS A;  3DEX A;  3M9K A;  5AIS A;  3DIE A;  1BAY A;  2H01 A;  2IMD A;  1GSS A;  1X5E A;  1IYH A;  2OAD A;  4X4J A;  1RW1 A;  3QAG A;  2CQ9 A;  3TJK A;  3P90 A;  3QD9 A;  2N5A A;  5HR0 A;  1N8J A;  3IBH A;  1TI1 A;  3IHG A;  3EPT A;  3PPU A;  2X8H A;  5F05 A;  4MZB A;  4K1F A;  4GSS A;  3E0U A;  2ALB A;  5ECR B;  3EVI A;  4PXO A;  2HI7 A;  5FWG A;  1K3Y A;  1VF4 A;  4NHW A;  5INY A;  2JSY A;  3KEB A;  2GSQ A;  2RII A;  2ON5 A;  2KP1 A;  5FHI A;  5GZZ B;  4BVX B;  1MTC A;  3ZIT A;  1O7U A;  3G9B A;  3HDC A;  2DBC A;  4I97 A;  1NHY A;  3IPZ A;  2KUC A;  5B6M A;  1EP7 A;  4WKW A;  1ERV A;  3GX0 A;  1GUK A;  1TI3 A;  1SYX A;  4IHU A;  1AIU A;  1SJZ A;  3A3T A;  3ZRE A;  5CRE A;  3MDK A;  3LW9 A;  4RI7 A;  1FVK A;  2HT9 A;  1JLV A;  2UZ8 A;  4HZ4 A;  2ON7 A;  3IOS A;  3D5J A;  3O76 A;  3C71 A;  4WF5 A;  4L0W A;  2FNO A;  1G0T A;  2JU5 A;  4N30 A;  5D9X A;  1G6Y A;  2MZC A;  1YQ1 A;  3D21 A;  1XWA A;  3LJR A;  2LJR A;  4ICY A;  5COH A;  4HJ2 A;  1M2A A;  1Q4J A;  4GST A;  5D73 A;  4K0N A;  1EZK A;  1WE0 A;  1J9B A;  3FKF A;  3S9F A;  2EIO A;  5IOW A;  2MBT A;  4V1A g;  1A8Y A;  5CRD A;  2GTU A;  3F9U A;  2MMA A;  2A2S A;  4MH2 A;  1EV9 A;  2VL3 A;  2VIM A;  2DJ2 A;  2DKI A;  1DE2 A;  4V2L A;  3F0I A;  3GKM A;  4GWR A;  2CVK A;  3RHB A;  2H8L A;  3FZ5 A;  3Q6O A;  4MH3 A;  1K0M A;  5G5F A;  4LA1 A;  2NVL A;  3GL5 A;  2IFQ A;  4JR4 A;  3HJO A;  1CQH A;  1OKT A;  2HFD A;  14GS A;  4G10 A;  3LEF A;  3QFB C;  5C00 A;  2XBI A;  6GST A;  1F2E A;  3ERG A;  5ID2 B;  3IV4 A;  4LL4 B;  4K5S A;  5ECI B;  4P3Y B;  3UMA A;  4IW9 A;  2R0C A;  6GSY A;  4ZL9 A;  4I8B A;  2H1D A;  2BMX A;  2GT5 A;  3KJY A;  3EE2 A;  4N11 A;  3IC8 A;  5A4U A;  4GF0 A;  1Z7R A;  4A5P A;  1T7P B;  2B7K A;  4ECI A;  1U3A A;  2O89 A;  3I6A A;  2XBQ A;  3IR4 A;  1Q98 A;  2CVD A;  4OFM A;  1XW9 A;  3LQ7 A;  3HA9 A;  4TR3 A;  4IJ3 A;  5EVO A;  3J7Y b;  3ZIJ A;  3TOU A;  1PX7 A;  3PIN A;  2QC7 A;  2YWI A;  3CTF A;  4FYB A;  3WGE A;  2YOI A;  1YDK A;  2RLI A;  5G2Z A;  2NBS A;  2R0G A;  2EC4 A;  2IMK A;  1XZO A;  3CMI A;  3IAS 2;  2R37 A;  1VF3 A;  4X1U A;  3H4K A;  1YKC A;  2NPB A;  4EO3 A;  3ZLP A;  3L9S A;  1R7H A;  1F3B A;  4JU5 A;  2PMT A;  3VI5 A;  4EDY A;  2GSS A;  2REM A;  1LJR A;  1XFL A;  3EMX A;  2M80 A;  4MF6 A;  1Z5Y E;  3HD5 A;  2L6C A;  3MWH A;  1PD2 1;  1YY7 A;  4JZQ A;  4RQX A;  2O8V B;  1O85 A;  3HVS A;  2B1L A;  2X99 A;  4JRR A;  1X0R A;  5IOX A;  3TRX A;  1ZOF A;  2L59 A;  4PGT A;  4BL7 B;  4HOJ A;  4QL9 A;  2E0Q A;  3JCM L;  2V2G A;  1YEX A;  3US3 A;  3QCP A;  3RDW A;  4PQH A;  1SK0 A;  5EPF A;  2OA7 A;  3PR8 A;  1YF0 A;  2YJ7 A;  4KSM A;  1R5A A;  5AIV A;  3KXO A;  5GSS A;  3GTU B;  1QQ2 A;  2DJ1 A;  1TP9 A;  3N5O A;  2L4Q A;  5L71 A;  4F9Z A;  2VAF A;  3PGT A;  3ZVJ A;  2LEG A;  3FHK A;  3U6V A;  4ZXG A;  3GNJ A;  1GSQ A;  4Q5R A;  1GLP A;  3ZRD A;  1X9M B;  3O3T A;  2VCX A;  4EDZ A;  1EEJ A;  5D96 A;  1WP0 A;  1YF1 A;  1ILO A;  3P8W A;  3G7Y A;  1EWX A;  1O73 A;  4IP6 A;  1SKS B;  4HZ2 A;  1OE8 A;  4POK A;  3IK7 A;  2H30 A;  5A5K A;  1M2D A;  3DGQ A;  1OC8 A;  1ZYP A;  2YAN A;  3GX8 A;  3TKR A;  3N9J A;  3ZIV A;  1HNB A;  4JBB A;  4F0C A;  4GCI A;  5A4W A;  4GQC A;  4JED A;  4KDU A;  4MA9 A;  4DEJ A;  3ZML A;  2HZE A;  1GP1 A;  3GH9 A;  3C1R A;  4MK3 A;  4ZL7 A;  1TJD A;  3DXB A;  1B9X C;  4MCU A;  5F8B A;  2YPM A;  3QMX A;  2O7K A;  4XS4 A;  1WMJ A;  1SJ6 A;  1A0R P;  5ECP B;  2GQL A;  2JAD A;  4POM A;  2DC5 A;  4AGS A;  2OE3 A;  2DLX A;  1M9B A;  4LMV A;  2A2R A;  4GSN A;  4ULX A;  5IMZ A;  5KN0 A;  2BTO T;  1U88 A;  4MDC A;  2YZH A;  1Z6M A;  1A24 A;  1V9W A;  4KX4 A;  2FWH A;  4LMW A;  1U6T A;  4HU9 A;  2O85 A;  4BVY B;  2AYT A;  2YWO A;  5JCU A;  4X0X A;  4TRX A;  1USB A;  4YQV A;  1TW9 A;  2HRF A;  4WBR D;  4K7I A;  3P7X A;  1G6W A;  4EVM A;  4MF7 A;  2FLS A;  1K0D A;  3PH9 A;  4Q5N A;  2C80 A;  4L0U A;  3HJP A;  2YV9 A;  3HVX A;  4FH8 A;  2GGT A;  2C4J A;  4HUA A;  2K6V A;  4Z2R A;  4F2I A;  1TRW A;  3V1W A;  2FA4 A;  3CBU A;  4EIQ A;  4OO4 A;  2F9S A;  3HCZ A;  4PQI A;  4EKZ A;  1WWJ A;  1GRX A;  2PGT A;  3EU4 A;  2FCH A;  1PX6 A;  4D73 A;  3D4T A;  2L57 A;  3QAW A;  2HNL A;  3MSZ A;  3GUR A;  1I5G A;  4NMU A;  1EGR A;  4KH7 A;  1V58 A;  1WIK A;  5BRT A;  4AJ8 A;  3VWU A;  3KMO A;  5G30 A;  2YNX A;  1SL2 B;  4DSS B;  5ECS A;  4JR6 A;  4IS0 A;  3APS A;  19GS A;  5E59 A;  1QFN A;  2LTK A;  4KUN A;  1GSE A;  1GUL A;  2QA1 A;  4TR4 A;  1HD2 A;  3H79 A;  5DQS A;  3IHQ A;  2GSR A;  3APQ A;  4HQZ A;  3APO A;  2VCW A;  3SBC A;  1J08 A;  1ZCP A;  2E2G A;  3IDV A;  5ECO B;  3RPP A;  5IMA A;  3BOA A;  1X9W B;  3BD2 A;  8GSS A;  1TK5 B;  2LV3 A;  1O8W A;  3HY2 A;  3WT1 A;  5LCZ A;  3GV1 A;  5DAK B;  1Z7P A;  1H4O A;  4OD7 A;  1UA5 A;  1BYE A;  1S3D A;  3ZYW A;  3DYR A;  4Q5F A;  1G7E A;  1GTB A;  3NOF A;  1ON4 A;  2VL9 A;  2M46 A;  2V6O A;  3GYK A;  2Z9S A;  1K0O A;  1THX A;  3C1S A;  3LWA A;  3KGK A;  3ZTL A;  4GQF A;  4JE1 A;  4DSR A;  3P2A A;  4MZC A;  1GSD A;  3UAP A;  4KSO A;  4O5U A;  2EIR A;  3H8Q A;  1BQ7 A;  1WRY A;  1PRX A;  4LLR A;  3O6T A;  5HR1 A;  2H74 A;  4HQS A;  1ACV A;  3LG6 A;  2GZY A;  3TJB A;  2ZCT A;  1GTU A;  3MIX A;  3TJF A;  4DVC A;  2ZNM A;  4XS6 A;  4KE3 A;  5F07 A;  3RPN A;  3UOM A;  1FVJ A;  2EIQ A;  5DDL A;  2G2Q A;  4KGI A;  1AQW A;  1QGV A;  6GSX A;  2J23 A;  3EC3 A;  2CVB A;  1Y6E A;  5CYY A;  5DVB A;  1AC1 A;  1FHE A;  1SU9 A;  2PU9 C;  2WCI A;  2IL3 A;  5DAL B;  5AGY A;  4MAB A;  2JSZ A;  2C8U A;  1G7O A;  1FAA A;  4BVX A;  1GLQ A;  3TOT A;  5IO0 A;  1LU4 A;  2HSM A;  1GUH A;  4PUR A;  1QK8 A;  4RUV A;  1FG4 A;  4NV2 A;  3FY7 A;  2IFQ B;  3IAM 2;  3C8E A;  3ED3 A;  6GSW A;  1OC9 B;  2FUG 2;  2VCZ A;  2FA8 A;  3F4T A;  1X5D A;  5J9C A;  1HYU A;  4HEA 2;  4XIH A;  4ISD A;  1WJK A;  2H19 A;  1RQM A;  3J7Y k;  3U5R E;  2VLT A;  2WB9 A;  1ML6 A;  4PQ1 A;  3GRX A;  2VOC A;  4HI7 A;  5DJM A;  4ZIL A;  2DJ0 A;  2TRC P;  1XWB A;  3HVV A;  2CX3 A;  5IIZ A;  2H1G A;  2H66 A;  20GS A;  1F9M A;  2WJU A;  4K7N A;  1TOF A;  3DRN A;  1UN2 A;  5KOX A;  5KOW A;  4POL A;  3C7M A;  4IP1 A;  4TXV A;  3CYN A;  4CW9 A;  5IMC A;  2TIR A;  4FO5 A;  17GS A;  2HZF A;  4F82 A;  5KN3 A;  1PSQ A;  2GLR A;  2VCT A;  2KLX A;  1NHO A;  5ECK B;  5J3R A;  2H71 A;  5HFI A;  2GT6 A;  5ID2 A;  2R0P A;  2KHP A;  2YWN A;  4H86 A;  3KM6 A;  3LFL A;  3UEM A;  4BA7 A;  1XXU A;  1VGL A;  4IKH A;  1XWK A;  4E8H A;  3TUE A;  3UJ1 A;  1SD9 A;  1R4W A;  4O7H A;  2GZZ A;  2WFC A;  3QR6 A;  2JAC A;  3HZ8 A;  5D93 A;  1ZL9 A;  4K7O A;  2YZU A;  4EF0 A;  2K18 A;  3G7I A;  11GS A;  1U3I A;  2K8S A;  4HDE A;  1XVQ A;  3TDG A;  2F3M A;  1XWG A;  2WGR A;  2V1M A;  4ML1 A;  3KP8 A;  1T1V A;  4YAV A;  5EL8 A;  2L4C A;  1SK2 A;  4ID0 A;  5JWQ B;  3FRC A;  3VLN A;  1AXD A;  1XW6 A;  4WBJ A;  4O32 A;  1JHB A;  5CRG A;  2XC2 A;  1HNC A;  3GSS A;  2RUE A;  5J4U A;  2P5R A;  4X43 A;  3EWL A;  4BWQ A;  1TDI A;  1XOA A;  3QAV A;  3L9V A;  2WUL A;  3VI7 A;  2P0G A;  2B1K A;  5D8I A;  2MMO A;  4G0L A;  18GS A;  1KBN A;  2OJL A;  3BJ5 A;  1HQO A;  3QFA C;  4ZBB A;  4XS1 A;  1JFU A;  2N5F A;  2TRX A;  3FR6 A;  2I3Y A;  2WZ9 A;  1O8X A;  3IE3 A;  3DKS A;  3LXZ A;  3GMF A;  4HJM A;  1O6J A;  2R5G A;  1E6B A;  3DVX A;  1ZYQ B;  2C0D A;  4TOP A;  4MNN A;  4NWY A;  3CTG A;  1YJ6 A;  2LRN A;  2C3Q A;  1O81 A;  2J9H A;  3M9J A;  2H70 A;  1ZZY A;  4BL7 A;  3UVH A;  1R26 A;  4ECC A;  3VPT A;  1V98 A;  5JCG A;  2H1B A;  2B5X A;  2HRK A;  4TR1 A;  10GS A;  2HSH A;  2DKH A;  2KOK A;  3M8N A;  1ABA A;  1DE1 A;  1URM A;  5JCW A;  2LNT A;  4TKY A;  3GTU A;  3GA4 A;  1KNG A;  2FHE A;  4GRF A;  4RQR A;  3F63 A;  2HXK A;  1VRS D;  2P5Q A;  4IJI A;  3WYW A;  2HZE B;  3IC4 A;  1S3C A;  2HYX A;  4KND A;  2OE0 A;  1EV4 A;  1FO5 A;  1OAZ A;  3I9V 2;  2AUV A;  3GUS A;  2AAW A;  2LST A;  4XS4 B;  1Z9H A;  1E2Y A;  1ST9 A;  3F4S A;  2FWE A;  3F3Q A;  2P31 A;  4XRD A;  2CT6 A;  4KDY A;  4G0I A;  3L4N A;  5G5E A;  1SKW B;  4ZB9 A;  5H5R A;  5H5S A;  3TKP A;  3ME7 A;  5C04 A;  4OFT A;  4CDO A;  4YQM A;  3H1N A;  3F3R A;  1GH2 A;  2LJA A;  5AIX A;  5FT3 A;  3UVT A;  2DJJ A;  3HHV A;  4OFN A;  4WEY A;  5DQY A;  3VUR A;  4TVE A;  3FYG A;  4YKG A;  2VL2 A;  3ISO A;  2E7P A;  5CNW A;  4G2E A;  5IM9 A;  1ERU A;  2WRT A;  4EC0 A;  1R5P A;  2CZ2 A;  3OR5 A;  4NAX A;  2IMI A;  2MMN A;  4OCE A;  3WGD A;  3DWV A;  2B5E A;  3IA1 A;  1SL0 B;  1BED A;  3IRA A;  3VPQ A;  1CQG A;  1SYR A;  1DBY A;  2AHE A;  4AF2 A;  5CP1 A;  1ERT A;  3BCI A;  3A5W A;  3A2W A;  2X49 A;  4KF9 A;  3GKX A;  3ME8 A;  3LYP A;  2R6K A;  4EXJ A;  2DJ3 A;  1ZYN A;  1M0U A;  2H0I A;  3A2X A;  5CRH A;  1V57 A;  3CSJ A;  4J2F A;  6GSU A;  3D4M A;  1A8L A;  4KCE A;  2MBS A;  1LBK A;  1ZGN A;  2WS2 A;  1QXH A;  5GAP D;  3KMN A;  2IME A;  2V6K A;  4KW6 A;  1C72 A;  4L5L A;  2YCD A;  5DBQ A;  4MJB A;  3RBT A;  3GST A;  2LUS A;  4LL1 B;  3G7J A;  2LQO A;  4BVY A;  2C0F A;  2YWM A;  3M0F A;  5J5N A;  2GST A;  1QMV A;  4PNG A;  1K0N A;  1TK8 B;  2F51 A;  3TKQ A;  2DIY A;  3ERF A;  3TJG A;  1A0F A;  1ERW A;  3QOU A;  4IQA A;  4TXO B;  1MD3 A;  5D9W A;  1J0F A;  4DSQ A;  1VF1 A;  4MMM A;  1XCC A;  4CY8 A;  5G1K A;  1TK0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...