2VIMA

X-ray structure of fasciola hepatica thioredoxin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
104
structure length
104
Chain Sequence
MRVLATAADLEKLINENKGRLIVVDFFAQWCGPCRNIAPKVEALAKEIPEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRETITRHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title The Fasciola Hepatica Thioredoxin: High Resolution Structure Reveals Two Oxidation States.
pubmed doi rcsb
source organism Fasciola hepatica
molecule tags Oxidoreductase
total genus 37
structure length 104
sequence length 104
ec nomenclature ec 1.8.4.8: Phosphoadenylyl-sulfate reductase (thioredoxin).
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vimA00
5F05A 3C8EA 5C04A 5JCUA 3V1WA 3CRTA 5IOXA 2XPEA 2LTKA 5HR1A 2IFQB 4GTUA 4PXOA 4POBA 1V9WA 5GAND 2LQOA 1DBYA 4LL4B 3GKXA 1TI1A 1XBSA 5ECRB 3I6AA 4JR4A 2C1YA 4WR4A 1B9YC 3ERGA 1ERTA 5KN3A 2B6MA 6GSUA 1F6MC 3FRCA 3IPZA 3RHCA 2CZ3A 2XBIA 4PX1A 3GFKA 5D93A 2C0EA 3FY7A 4G9HA 5INYA 2DC5A 2VLTA 3KXOA 5GZZB 1YKAA 3ZMLA 2YPMA 2VLVA 4V2LA 4MLYA 2G0FA 2NDOA 1GRXA 4KCAA 4I6XA 1ZOFA 4KX4A 4ISDA 1C72A 2YCDA 3L4NA 2J9HA 2GZYA 4IP6A 3QFAC 3HJPA 4ZXGA 3ZYWA 2AB6A 5HR3A 2H30A 1W4VA 1ZL9A 3ZIVA 4HU7A 4OD7A 5G1KA 4WEYA 1BYEA 2YWNA 5EY6A 4ECBA 1GUMA 3LQ7A 11GSA 2PPTA 1A2LA 1EV9A 5LCZA 4TR1A 2K9FA 1N2AA 2I1UA 4O32A 2F8FA 2MMAA 1PSQA 1MD3A 1O85A 6GSVA 5L71A 5F8BA 3UVTA 1K0CA 1GSSA 3E9JB 2H73A 3I9V2 1VF1A 2VL9A 2HZEB 1R5PA 1XIYA 4OFTA 5IMAA 1RK4A 1TP9A 3EVIA 2DJ0A 3KP8A 4X0XA 3F4TA 3TJKA 10GSA 2HE3A 3QAVA 2A2SA 4PQIA 1FO5A 4DVCA 3US3A 1Z6MA 2JADA 4AJ7A 2ZNMA 1DSBA 4TXOB 4L0WA 3CTFA 1SU9A 2H71A 1OVNA 2HFDA 2PVQA 3BCIA 4NMUA 6GSSA 2C4JA 3WGEA 5ECHB 1AXDA 3ERFA 4JRRA 3TRXA 3A3TA 1AUCA 2FD3A 4XHMA 2VCXA 4I2UA 3CYNA 1Z7PA 2YNXA 4PURA 1KNGA 2AYTA 1TRVA 4LMVA 1XWAA 3HZ8A 3N5OA 1OAZA 4J57E 1GUKA 3GHAA 1ERWA 3VWWA 5LD0A 1GULA 1Z3EA 2IIYA 2LNSA 2F3MA 2K8VA 3ISOA 4G10A 4HI7A 1OYJA 1SYXA 2EIOA 5J41A 4HS1A 4XTSA 2JSZA 2CT6A 2YWIA 1JZWA 3D5JA 1OE8A 4HZ4A 1I9DA 3WGXA 1PD21 5ELAA 3DIEA 4ZBBA 5ECMB 3DVWA 4IJ3A 4KGIA 1XWBA 1G6WA 1XWCA 1SL0B 3A2VA 2M80A 1LBKA 4ZBAA 3IA1A 3OR5A 3DEXA 4DSQA 2RM6A 4D73B 3CXGA 2JZSA 1G6YA 2FWEA 4WBJA 4IS0A 2H74A 2BTOT 4MZCA 5IPHA 4XIHA 5DVBA 5D9VA 5AIXA 5DCHA 3VPQA 1R5AA 2OE0A 3IRAA 2MMOA 2H66A 2GZZA 2HZEA 5DALB 3KMNA 3RBTA 2PBJA 4PNGA 2EIQA 1YZXA 3KM6A 3P7XA 3L0HA 5ECQB 3SWLA 5AGYA 3CSIA 3I43A 3VI7A 1F3BA 2P5RA 1B8XA 4TXOA 4NHZA 5IOWA 2DIZA 2WULA 4YAVA 2P0GA 2AAWA 2RM5A 3DYRA 4WR5A 1ERUA 3ZVJA 4F9ZA 1S3DA 1XPVA 1PKZA 1FAAA 5B8AA 3IOSA 3VK9A 5IMZA 3P90A 3QOUA 1GSQA 2FUG2 2TIRA 2L6CA 3S9FA 1H75A 4EO3A 4MCUA 4QL9A 2YOIA 2I4AA 3DD3A 4X43A 4HOJA 5HR2A 2VCTA 1S3CA 4BL7A 2X8CA 3TKQA 2IN3A 3WT2A 2PWJA 5KN2A 5D8IA 1TI3A 1JFUA 4HJMA 2H76A 4KSMA 5G2ZA 3ZL5A 4J2FA 3GKKA 4XS4A 5DAKB 3VLNA 4K0GA 1JZDA 2VAFA 2R6KA 4WKWA 1KTEA 5IMFA 1GSUA 1ACVA 4MJAA 2GQKA 1AQWA 3LJRA 3IAM2 4K9ZA 2LUSA 1QUWA 4XS1A 3R2QA 4WETA 1SKWB 1MTCA 5DBQA 5CRGA 3FR3A 4N0ZA 2O89A 2HXKA 2JU5A 3CSJA 2YV7A 4K6XA 2OBKA 4MABA 3RPPA 4O5RA 1O7UA 2B5YA 2LJKA 2AHEA 4ZB6A 4IVFA 3IE3A 2OJLA 2DSAA 4PQ1A 5DALA 1ABAA 3I69A 1PL1A 1OC9B 2V41A 3KH7A 4IQ1A 2GQMA 3VWUA 1PGTA 4RI6A 2FY6A 1V57A 2H6XA 2KUCA 1B9XC 2H0IA 3IAS2 4XCSA 1T3BA 4H86A 2C80A 1MEKA 1A23A 2H6YA 4IJIA 3TUEA 5E59A 3H93A 4GSSA 2YN1A 4ZIJA 4AF2A 2FA4A 4TVEA 4AGSA 1JZOA 1BAYA 1ON4A 4IELA 2FWFA 2H1GA 5AIVA 5B8BA 2VM1A 1YDKA 2V2GA 3IV4A 1PMTA 2VUPA 1HNCA 3TOUA 1XVQA 1GTIA 2FCHA 3ED3A 1XWKA 5HFGA 4YAPA 1FVKA 4EE0A 1XWGA 5JWOB 1ILOA 2E7PA 2C8UA 2H19A 3KGKA 1XOBA 3TKSA 5IQYA 3LWAA 3D4MA 2IPAA 1GTBA 1TJDA 5D9WA 1GL8A 2VL2A 4OO4A 1TTZA 3C1SA 3AY8A 2L4QA 5FWGA 1UA5A 1I5GA 4I97A 1MDJA 2VO4A 1Z7RA 2B1KA 4TR4A 2YJ7A 2HI7A 1XW5A 2IJYA 3G7JA 3KD0A 4KW6A 1VF2A 3UOMA 2OE1A 4V1Ag 3BBYA 3EE2A 2YZUA 5A4WA 2JZTA 4EDYA 3D4TA 2K18A 1YQ1A 3ME8A 2VCWA 3ZZXA 3HY2A 1A24A 9GSSA 4F0BA 2KHPA 4ULXA 4K1FA 2LV3A 3C1RA 2NBSA 1K3LA 1SD8A 3IK7A 1X9WB 1PKWA 2GS3A 2YP6A 3TJBA 2OKAA 4YQUA 3MAKA 1O6JA 1EGRA 2CVDA 1OC9A 1QXHA 4BWSA 5J3RA 3HCZA 2MMZA 1SKSB 4FYBA 1AIUA 1LU4A 3APOA 4JEDA 1RQMA 1WOUA 1URMA 3DWVA 4N10A 2B5XA 2PGTA 3GKMA 3ERWA 1A2JA 2CV4A 4MH3A 2WS2A 2TRXA 1AAZA 2AUVA 3LGCA 3TKPA 2X8GA 3FHKA 4GSTA 2HRNA 2LRTA 4RQRA 1O8WA 3ZLPA 4IQAA 4J56E 1VRSD 4HQSA 4ILFA 3W8SA 2FWGA 2PUKC 2GGTA 4V1Ap 4V2NA 1SJIA 4PUFC 4ECJA 1HD2A 2B5EA 1USBA 1E2YA 4ZB9A 4L0UA 4DSSA 1JLVA 2PN8A 19GSA 1KEBA 3EURA 5D9TA 3FZAA 1FOVA 3MSZA 4E8HA 1THXA 2DLXA 1ST9A 1ZCPA 3CRUA 3P8WA 2O87A 3FKFA 1EEMA 3TJJA 1X5DA 2WCIA 1QGVA 4MPGA 4EKZA 2CX4A 4NV5A 3GKNA 1LJRA 2C3TA 5AN1A 3FZ4A 4PNFA 4HQZA 5B6MA 1PX6A 3EYTA 1YEXA 2IMFA 1EWXA 4EXJA 2YZHA 4K7OA 3TJGA 2DBCA 4GRFA 3MWHA 3FR6A 4JE1A 5JCGA 1T8EB 1EV4A 1DE1A 4V2MA 3H1NA 5A4UA 4HEA2 3HZ4A 1O8XA 1R4WA 2KP1A 3WYWA 3HYPA 1DUGA 5ECNB 4GXZA 4I2TA 1A8LA 3L9UA 5IIZA 4FYCA 1TRSA 1FVJA 3FW2A 5B6NA 2F8AA 3O6TA 2GSRA 1SJZA 5EPFA 2CVBA 5EVOA 4MF7A 3G7IA 2WJUA 3DMLA 4L5LA 4TR3A 3RPNA 2EIRA 1PRXA 2CVKA 2GVPA 2XC2A 3N9JA 4ECCA 4MH2A 1SL2B 1K0BA 1TK5B 4XS4B 2IMEA 3LXTA 4GLTA 3IHQA 5F06A 1EEJA 2VCZA 1ZGNA 2B7JA 4IKHA 3UJ1A 3GRXA 5CP1A 2NTOA 5FHIA 1YKCA 1XW9A 3Q18A 5F0GA 3GX8A 3TOTA 20GSA 1RW1A 4OO5A 3KH9A 6GSTA 1GP1A 5B7CA 4KCEA 2VCQA 2V1MA 3G7YA 2R2JA 3M9KA 4HUAA 2B7KA 1XCCA 2H1AA 4KSOA 4EVMA 2JL4A 3A2WA 6GSYA 2VD1A 2R37A 3VFIA 1QFNA 2JSYA 4KNDA 2R4VA 1PL2A 3GSSA 3HKRA 1HQOA 3TJFA 3EMXA 1M2BA 6GSWA 2DJ1A 3FYGA 1MD4A 4KUNA 3F4RA 4BPYA 4X1UA 1GWCA 2I81A 1GSFA 1WMJA 3UARA 13GSA 3U6VA 4HDEA 5CREA 1U87A 4IGJA 1JLWA 5ID2B 3DKSA 3QPMA 2H70A 1J9BA 2LQQA 2N5BA 5D96A 4F03A 3H79A 2H6ZA 5D73A 2IMDA 2B3SA 3QCPA 3TB2A 5G5EA 2LSTA 3UL3A 5H5SA 5DQYA 1TXXA 1SL1B 3A2XA 1FHEA 3M3MA 2HZFA 3QR6A 3VI5A 1F3AA 5DJLA 3U5RE 5GSTA 5JWRB 1BJXA 4GSNA 5ECOB 2B1LA 2CA8A 1N8JA 3F4SA 2H72A 3EMPA 5HQPA 5D9XA 5GSSA 1JHBA 22GSA 2L4CA 3HHVA 4EF0A 3KJYA 5IO0A 3EU3A 1SJ6A 1TDIA 2IMIA 1WP0A 2HRFA 3KCMA 3ZIJA 1WJKA 3ME7A 4KE3A 1YJ6A 4Z7XA 1EP8A 1OE7A 2L6DA 3PH9A 2WDUA 2LEGA 3FZ5A 4DEJA 1CQGA 2GZPA 2C0DA 4I8BA 4LMWA 5G31A 3BCKA 3F0IA 2O8VB 5HFIA 4IHUA 2MMNA 5DQSA 1F9MA 2XHFA 1K3YA 2DJKA 5DCGA 4XS6A 4TOPA 1BEDA 3VWXA 4NWYA 1ERVA 3IBHA 3MDKA 2FWHA 5ECSA 4PGTA 4MDCA 1BX9A 4K2DA 4MZWA 3LXZA 4AJ8A 1OC3A 3FEUA 4NAXA 1X5EA 2OBIA 1SD9A 5ABRA 1Z5YE 3GN3A 2RIIA 2HSHA 3GL5A 3BD2A 5C00A 1U3AA 1GH2A 2FA8A 2R3XA 5ECIB 4ID0A 1YEPA 2G2QA 2GTUA 2QKEA 4XRAA 3WD6A 5ID2A 4NPBA 3KZQA 1B4QA 1NHYA 3ZFLA 3VURA 1A0RP 3LYPA 4HU9A 3KMOA 4KB3A 4ZB8A 4JU5A 1OC8A 2LNTA 3QMXA 3W6GA 3QD9A 3TDGA 4LLRA 1S3AA 2Z9SA 2MBSA 2X64A 5H5QA 1AQVA 4GF0A 2MZCA 4WF4A 3CTGA 3TKSC 1YF0A 2L5OA 1GUHA 1WRYA 18GSA 2VL2C 3CBUA 2LS5A 1G0TA 1V2AA 2CAQA 1V58A 3QDNA 5ECLB 3TRQA 1PA3A 2XBQA 2F51A 4DSSB 4ACSA 1DE2A 1WWJA 2BJXA 4K0NA 5ENUA 3PINA 3HVVA 1XFLA 2WGRA 1PQNA 4TXVA 5DDLA 4F0CA 3C7MA 1R7HA 1VF3A 4LA1A 3SBCA 5F07A 1V98A 1E6BA 4ZL9A 4IBPA 2J23A 5ECKB 1GNWA 2P5QA 3Q19A 3E0UA 5G30A 1TOFA 4Q5QA 1OKTA 2V6KA 2WB9A 1XW6A 1TW9A 4YQVA 2H0HA 1T4YA 2N5FA 3GTUA 3DXBA 2CX3A 5ECPB 1M9BA 2V32A 2D2ZA 4MA9A 2RLIA 4MJBA 3KTBA 2DIYA 3KEBA 3K8NA 4OFMA 1QMVA 3KTLA 3ZTLA 2IMKA 2E0QA 3ZFBA 2YWOA 3JCML 2GT6A 3RAZA 1M99A 2H8LA 1A0FA 3GIXA 2ZUPA 2K8SA 2R5GA 2FGXA 2XPDA 2M72A 1FB0A 1BG5A 3QFBC 3J7Yb 1M0UA 2VIMA 3O76A 3UMAA 3L78A 3M1GA 1SENA 4AJ6A 2A4VA 4K8MA 3WGDA 1T00A 2PU9C 4YH2A 1M2AA 3A5WA 2VOCA 1WE0A 1Q4JA 5J9BA 4POMA 3FZ9A 3LFLA 3IC4A 4ZL7A 5A5KA 2O7KA 2ON5A 1B4PA 5CYYA 4O7HA 3O3TA 16GSA 1BQ7A 2PVOC 1KBNA 5A4VA 4BVXA 4L8EA 1Q98A 3GURA 3HDCA 1K0OA 5E4WA 4EL1A 4K7NA 14GSA 1UC7A 5IMVA 2ES7A 5DJMA 4MF6A 2GSTA 3GH6A 4I5QA 3L9VA 2H75A 5IMCA 4JR6A 3UBKA 3DRNA 1AW9A 2FNOA 2LJAA 3NZNA 1SK0A 1GSYA 1U88A 3APQA 3BOAA 3M8NA 1PX7A 4Q5FA 3IR4A 5J9CA 1M2DA 1Z9HA 2VCVA 2FHEA 3F3QA 3VPTA 2ALBA 3DVXA 3UVHA 1XOAA 5EL8A 2C3QA 1QQ2A 4N11A 4GWRA 4KDXA 3J7Yk 1MDKA 4LL1B 4HZ2A 4MF5A 5IMDA 4KDUA 2C0GA 4N0VA 3ZRDA 1GLQA 3HJOA 2JACA 4E8EA 4QQ7A 2ON7A 5JWQB 3FR9A 1NSWA 1TRUA 4Q5NA 4NV2A 2YJHA 1TKDB 2HSYA 4FIWA 1X9MB 3QAWA 4HJ2A 5IO2A 4PUAA 1TK8B 1K3OA 4ECIA 2IFQA 2OA7A 2H1DA 2I3YA 1J08A 2HLSA 1T7PB 4MK3A 1H4OA 4ML1A 3M0FA 1WIKA 4RUVA 1FW1A 1EOHA 4MMMA 3QAGA 2LKUA 1M9AA 4FH8A 4POKA 1YF1A 3ZITA 4BWQA 3TKRA 1V40A 7GSSA 5KN0A 3LORA 4IP1A 1GSEA 2REMA 1HYUA 2OE3A 1SKRB 17GSA 1SK2A 3L9SA 4GQCA 4OWYA 3NIVA 4F82A 1NW2A 3ZVJD 1T4ZA 2CQ9A 3NOFA 3MNGA 1XVWA 4CDOA 2LRCA 1TU8A 5GAPD 1K0AA 1QK8A 1SK1A 1THOA 3EWLA 2X99A 3EINA 2C0FA 4ZL8A 1ZZYA 3GV1A 3F6FA 2DJ2A 4DSRA 4XRDA 4ZILA 1JZRA 2RUEA 4TRXA 2C3NA 2QSIA 1IYHA 1Y6EA 3HD5A 1T1VA 3UAPA 2HYXA 1OKDA 3Q74A 1AC1A 2FLSA 8GSSA 4TKYA 3VWVA 5JCWA 3ZMKA 2M46A 1FG4A 1G7EA 1J0FA 3GUSA 1CQHA 6GSXA 1M7TA 2WZ9A 1X5CA 4RI7A 4Q5RA 2DMLA 2AJQB 2NVLA 3IXRA 5CAXA 2WRTA 4L5OA 1XZOA 4ZBDA 5CRHA 5G5FA 3GYKA 1PN9A 5LNKe 2DJ3A 2H01A 2A2RA 1TK0B 1WPIA 1ZYQB 4FYUA 2CAIA 1ZYEA 3APSA 3GA4A 4O92A 1Y25A 3GX0A 5J5NA 3HVXA 2GDRA 3P2AA 4WXTA 2PERA 5HR0A 4G19A 1VGLA 2CZ2A 2GT5A 3LYKA 2H0GA 2BMXA 3WT1A 2L5LA 5IPGA 3UBLA 3TCOA 2DMMA 1X0RA 3LSZA 2VLUA 2LRNA 4BVYA 4GCIA 2I9HA 4KH7A 4P3YB 3ZREA 2JZRA 4EUYA 4IW9A 3TRPA 1VF4A 2V6OA 3GL3A 2OADA 5COHA 2F9SA 3H4KA 1GTUA 1X9SB 1HNAA 4IN0A 1F37A 1YY7A 5ELGA 2X8HA 2VL3A 1XXUA 4RQXA 1O81A 2KLXA 4PQHA 2GSSA 5KEJA 2EC4A 2OACA 2IL3A 4OMVA 2NPBA 3GSTA 1HNBA 4NXIA 2QC7A 3H8QA 3C71A 5H5RA 1B48A 2IWTA 3GTUB 2YWMA 1FB6A 4JBBA 4G2EA 4NHWA 1TRWA 5CO3A 3TGZA 4N30A 2P31A 3HA9A 1EZKA 1EGOA 1U3IA 3PR8A 5KN1A 4D73A 4TR0A 4MJCA 5HFKA 1Z6NA 5CNWA 2N5AA 3D6IA 1TU7A 1K0MA 1O73A 3D0ZA 3UIWA 2WFCA 2VM2A 3HVSA 1AQXA 3EU4A 2KP2A 4WBRD 12GSA 3Q6OA 1UN2A 1GLPA 4FO5A 5G1LA 3KIJA 1K0NA 1R26A 2GLRA 1GSDA 3PGTA 4EC0A 1GNEA 3TKSE 2LJRA 3G9BA 1NM3A 1UVZA 2ZCTA 4ML6A 1U6TA 5CRWA 1K0DA 2VD0A 2QGVA 4CHSA 2GQLA 1MDIA 4KA0A 4MP4A 2MYGA 3W8JA 2KOKA 4MPFA 2E2MA 3LEFA 4TN8A 1GTAA 5CRDA 1ZMAA 5J4UA 1SYRA 3KP9A 2K6VA 3F8UA 1NHOA 2AV4A 2TRCP 3DGQA 2H1BA 3F63A 1EOGA 3RDWA 4F2IA 1A8YA 2YANA 2YV9A 3IK9A 3CMIA 4K7IA 1A2MA 2PMTA 1EP7A 3BJ5A 3E3EA 4CW9A 3GMFA 4POLA 3GNJA 4QL7A 3M9JA 3UEMA 3GH9A 4TR1B 2DJJA 3HXSA 4KDYA 1ML6A 2MBTA 3F6DA 3LG6A 4WF5A 5IM9A 4BA7A 3D21A 4KAEA 3IDVA 4GQFA 5FT3A 2RUFA 1W89A 3HJMA 1G7OA 3FK8A 1F2EA 4OCFA 2E2GA 4EDZA 3RHBA 3EC3A 4OFNA 4MJEA 3F3RA 5AISA 4OCEA 1IYIA 3C73A 3CSHA 3D22A 2O85A 3F9UA 2HT9A 5DAKA 2HNLA 2L59A 4TW5A 4JZQA 4MZBA 4YQMA 2L57A 2GSQA
chains in the Genus database with same CATH superfamily
5F05A 3C8EA 5C04A 5JCUA 3V1WA 3CRTA 5IOXA 2XPEA 2LTKA 5HR1A 2IFQB 4GTUA 4PXOA 4POBA 1V9WA 5GAND 2LQOA 1DBYA 4LL4B 3GKXA 1TI1A 1XBSA 5ECRB 3I6AA 4JR4A 2C1YA 4WR4A 4CY6A 1B9YC 3ERGA 1ERTA 5KN3A 2B6MA 6GSUA 1F6MC 3FRCA 3IPZA 3RHCA 2CZ3A 2XBIA 4PX1A 3GFKA 5D93A 2C0EA 3FY7A 4G9HA 5INYA 2DC5A 2VLTA 3KXOA 5GZZB 1YKAA 3ZMLA 2YPMA 2VLVA 4V2LA 4MLYA 2G0FA 2NDOA 1GRXA 4KCAA 4I6XA 1ZOFA 4KX4A 4ISDA 1C72A 2YCDA 3L4NA 2J9HA 2GZYA 4IP6A 3QFAC 3HJPA 4ZXGA 3ZYWA 2AB6A 5HR3A 2H30A 1W4VA 1ZL9A 3ZIVA 4HU7A 4OD7A 5G1KA 4WEYA 1BYEA 2YWNA 5EY6A 4ECBA 1GUMA 3LQ7A 11GSA 2PPTA 1A2LA 1EV9A 5LCZA 2UZ8A 4TR1A 2K9FA 1N2AA 4O5UA 2I1UA 4O32A 2F8FA 2MMAA 1PSQA 1MD3A 1O85A 6GSVA 5L71A 5F8BA 3UVTA 1K0CA 1GSSA 3E9JB 2H73A 3I9V2 1VF1A 2VL9A 2HZEB 1R5PA 1XIYA 4OFTA 5IMAA 1RK4A 1TP9A 3EVIA 2DJ0A 3KP8A 4X0XA 3F4TA 3TJKA 10GSA 2HE3A 3QAVA 2A2SA 4PQIA 2QA2A 1FO5A 4DVCA 3US3A 1Z6MA 2JADA 4AJ7A 2ZNMA 1DSBA 4TXOB 4L0WA 3CTFA 1SU9A 2H71A 1OVNA 2HFDA 2PVQA 3BCIA 4NMUA 6GSSA 2C4JA 3WGEA 5ECHB 1AXDA 3ERFA 4JRRA 3TRXA 3A3TA 1AUCA 2FD3A 4XHMA 2VCXA 4I2UA 3CYNA 1Z7PA 2YNXA 4PURA 1KNGA 2AYTA 1TRVA 4LMVA 1XWAA 3HZ8A 3N5OA 1OAZA 4J57E 1GUKA 3GHAA 1ERWA 3VWWA 5LD0A 1GULA 1Z3EA 2IIYA 2LNSA 2F3MA 2K8VA 3ISOA 4G10A 4HI7A 4BL7B 1OYJA 1SYXA 2EIOA 5J41A 4HS1A 4XTSA 2JSZA 2CT6A 2YWIA 1JZWA 3D5JA 1OE8A 4HZ4A 1I9DA 3WGXA 1PD21 5ELAA 3DIEA 4ZBBA 5ECMB 3DVWA 4IJ3A 4KGIA 1XWBA 1G6WA 1XWCA 1SL0B 3A2VA 2M80A 1LBKA 4ZBAA 3IA1A 3OR5A 3DEXA 4DSQA 2RM6A 4D73B 3CXGA 2JZSA 1G6YA 2FWEA 4WBJA 4IS0A 2H74A 2BTOT 4MZCA 5IPHA 4XIHA 5DVBA 5D9VA 5AIXA 5DCHA 3VPQA 1R5AA 2OE0A 3IRAA 2MMOA 2H66A 2GZZA 2HZEA 4PTSA 5DALB 3KMNA 3RBTA 4Z2TA 2PBJA 4PNGA 2EIQA 1YZXA 3KM6A 3P7XA 3L0HA 5ECQB 3SWLA 5AGYA 3CSIA 3I43A 3VI7A 1F3BA 2P5RA 1B8XA 4TXOA 4NHZA 5IOWA 2DIZA 2WULA 4YAVA 2P0GA 2AAWA 2RM5A 3DYRA 4WR5A 1ERUA 3ZVJA 4F9ZA 1S3DA 1XPVA 1PKZA 1FAAA 5B8AA 3IOSA 3VK9A 5IMZA 3P90A 3QOUA 1GSQA 2FUG2 2TIRA 2L6CA 3S9FA 1H75A 4EO3A 4MCUA 4QL9A 2YOIA 2I4AA 3DD3A 4X43A 4HOJA 5HR2A 2VCTA 1S3CA 4BL7A 2X8CA 3TKQA 2IN3A 3WT2A 2PWJA 5KN2A 4YKGA 5D8IA 1TI3A 1JFUA 4HJMA 2HSMA 2H76A 4KSMA 5G2ZA 3ZL5A 4J2FA 3GKKA 4XS4A 5DAKB 3VLNA 4K0GA 1JZDA 2VAFA 2R6KA 4WKWA 1KTEA 5IMFA 1GSUA 1ACVA 4MJAA 2GQKA 1AQWA 3LJRA 3IAM2 4K9ZA 2LUSA 1QUWA 4XS1A 3R2QA 4WETA 1SKWB 1MTCA 5DBQA 5CRGA 3FR3A 4N0ZA 2O89A 2HXKA 2JU5A 3CSJA 2YV7A 4K6XA 4K5RA 2OBKA 3A5IA 4MABA 3RPPA 4O5RA 1O7UA 4MNNA 4FQUA 2B5YA 2LJKA 2AHEA 4ZB6A 4IVFA 3IE3A 2OJLA 2DSAA 4PQ1A 5DALA 1ABAA 3I69A 1PL1A 1OC9B 2V41A 3KH7A 4IQ1A 2GQMA 3VWUA 1PGTA 4RI6A 2FY6A 1V57A 4HSCX 2H6XA 2KUCA 1B9XC 2H0IA 3IAS2 4XCSA 1T3BA 4H86A 2C80A 1MEKA 1A23A 2H6YA 4IJIA 3TUEA 5E59A 3H93A 4GSSA 2YN1A 4ZIJA 4AF2A 2FA4A 4TVEA 4AGSA 1JZOA 1BAYA 1ON4A 4IELA 2FWFA 2H1GA 5AIVA 5B8BA 2VM1A 1YDKA 2V2GA 3IV4A 1PMTA 2VUPA 1HNCA 3TOUA 1XVQA 4G0LA 1GTIA 2FCHA 3ED3A 1XWKA 5HFGA 4YAPA 1FVKA 4EE0A 1XWGA 5JWOB 1ILOA 2E7PA 2C8UA 2H19A 3KGKA 1XOBA 3TKSA 5IQYA 3LWAA 3D4MA 2IPAA 1GTBA 1TJDA 2HRAA 5D9WA 4BIKA 1GL8A 2VL2A 4OO4A 1TTZA 3C1SA 3AY8A 2L4QA 5FWGA 2DKIA 1UA5A 1I5GA 4I97A 1MDJA 2VO4A 1Z7RA 2B1KA 4TR4A 2YJ7A 2HI7A 1XW5A 2IJYA 3G7JA 3KD0A 4KW6A 1VF2A 3UOMA 2OE1A 4V1Ag 3BBYA 3EE2A 2YZUA 5A4WA 2JZTA 4EDYA 3D4TA 3CQFA 2K18A 1YQ1A 3ME8A 2VCWA 3ZZXA 3HY2A 1A24A 9GSSA 4F0BA 2KHPA 4ULXA 4K1FA 2LV3A 3C1RA 2NBSA 1K3LA 1SD8A 3IK7A 1X9WB 1PKWA 2GS3A 2YP6A 3TJBA 2OKAA 4YQUA 3MAKA 1O6JA 1EGRA 2CVDA 1OC9A 1QXHA 4BWSA 5J3RA 3HCZA 2MMZA 1SKSB 4FYBA 1AIUA 1LU4A 3APOA 4JEDA 1RQMA 1WOUA 1URMA 3DWVA 4N10A 2B5XA 2PGTA 3GKMA 3ERWA 1A2JA 2CV4A 4MH3A 2WS2A 2TRXA 1AAZA 2AUVA 3LGCA 3TKPA 2X8GA 3FHKA 4GSTA 2HRNA 1M3IA 2LRTA 4RQRA 1O8WA 3ZLPA 1PFOA 4IQAA 4J56E 1VRSD 4HQSA 4ILFA 4G0KA 3W8SA 2FWGA 2PUKC 2GGTA 4V1Ap 4V2NA 1SJIA 4PUFC 4ECJA 1HD2A 1ZYPA 2B5EA 1USBA 1E2YA 4ZB9A 4L0UA 4DSSA 1JLVA 2PN8A 4K2XA 19GSA 1KEBA 3EURA 5D9TA 3FZAA 1FOVA 3MSZA 4E8HA 3IC8A 1THXA 2DLXA 1ST9A 1ZCPA 3CRUA 3P8WA 2O87A 3FKFA 1EEMA 3TJJA 1X5DA 2WCIA 1QGVA 4MPGA 4EKZA 2CX4A 4NV5A 3GKNA 1LJRA 2C3TA 5AN1A 3FZ4A 4PNFA 4HQZA 5B6MA 1PX6A 3EYTA 1YEXA 2IMFA 1EWXA 4EXJA 2YZHA 4K7OA 3TJGA 2DBCA 4GRFA 3MWHA 4EIQA 3FR6A 4JE1A 5JCGA 1T8EB 1EV4A 1DE1A 4V2MA 3H1NA 5A4UA 4HEA2 3HZ4A 1O8XA 1R4WA 2KP1A 3WYWA 3HYPA 1DUGA 5ECNB 4GXZA 4I2TA 1A8LA 3L9UA 5IIZA 4FYCA 1TRSA 1FVJA 3FW2A 5B6NA 2F8AA 3O6TA 2GSRA 1SJZA 5EPFA 2CVBA 5EVOA 4MF7A 3G7IA 2WJUA 3DMLA 4L5LA 4TR3A 3RPNA 2EIRA 1PRXA 2CVKA 2GVPA 2XC2A 3N9JA 4ECCA 4MH2A 1SL2B 1K0BA 1TK5B 4XS4B 2IMEA 3LXTA 4GLTA 3IHQA 5F06A 1EEJA 2VCZA 1ZGNA 2B7JA 4IKHA 3UJ1A 3GRXA 5CP1A 2NTOA 5FHIA 1YKCA 1XW9A 3Q18A 5F0GA 3GX8A 3TOTA 20GSA 1RW1A 4OO5A 3KH9A 6GSTA 1GP1A 5B7CA 4KCEA 2VCQA 2V1MA 3G7YA 2R2JA 3M9KA 4HUAA 2B7KA 1XCCA 2H1AA 4KSOA 4EVMA 2JL4A 2DKHA 3A2WA 6GSYA 2VD1A 2R37A 3VFIA 1QFNA 2JSYA 4KNDA 2R4VA 1PL2A 3GSSA 3HKRA 1HQOA 3TJFA 3EMXA 1M2BA 6GSWA 2DJ1A 3FYGA 4O5QA 1MD4A 4KUNA 3F4RA 4BPYA 4X1UA 1GWCA 2I81A 1GSFA 1WMJA 3UARA 13GSA 3U6VA 4HDEA 5CREA 1U87A 4IGJA 1JLWA 5ID2B 3DKSA 3QPMA 2H70A 1J9BA 2LQQA 2N5BA 5D96A 4F03A 3H79A 2H6ZA 5D73A 2IMDA 4A5PA 1FOHA 2B3SA 3QCPA 3TB2A 5G5EA 2LSTA 3UL3A 4CY8A 5H5SA 5DQYA 1TXXA 1SL1B 3A2XA 1FHEA 2HRKA 3M3MA 2HZFA 3QR6A 3VI5A 1F3AA 5DJLA 3U5RE 5GSTA 5JWRB 1BJXA 4GSNA 5ECOB 2B1LA 2CA8A 1N8JA 3F4SA 2H72A 3EMPA 2A2PA 2X4AA 5HQPA 5D9XA 5GSSA 1JHBA 22GSA 1S3RA 2L4CA 3HHVA 4EF0A 3KJYA 5IO0A 3EU3A 1SJ6A 3IHGA 1TDIA 2IMIA 1WP0A 2HRFA 3KCMA 3ZIJA 1M3JA 1WJKA 3ME7A 4KE3A 1YJ6A 4Z7XA 1EP8A 1OE7A 2L6DA 3PH9A 2WDUA 2LEGA 3FZ5A 4DEJA 1CQGA 2GZPA 2C0DA 4I8BA 3LW9A 4LMWA 5G31A 3BCKA 3F0IA 2O8VB 5HFIA 4IHUA 5BRTA 2MMNA 5DQSA 1F9MA 2XHFA 1K3YA 2DJKA 2X49A 5DCGA 4XS6A 4TOPA 1BEDA 3VWXA 4NWYA 1ERVA 3IBHA 3MDKA 3PPUA 2FWHA 5ECSA 4PGTA 4MDCA 1BX9A 4K2DA 4MZWA 3LXZA 4AJ8A 1OC3A 3FEUA 4NAXA 1X5EA 2OBIA 1SD9A 5ABRA 1Z5YE 3GN3A 2RIIA 2HSHA 3GL5A 3BD2A 5C00A 1U3AA 1GH2A 2FA8A 2R3XA 1ZYNA 5ECIB 4ID0A 4ICYA 1YEPA 2G2QA 2GTUA 2QKEA 4XRAA 3WD6A 5ID2A 4NPBA 3KZQA 1B4QA 1NHYA 3ZFLA 3VURA 1A0RP 3LYPA 4HU9A 3KMOA 4KB3A 4ZB8A 4JU5A 1OC8A 2LNTA 3QMXA 3W6GA 3QD9A 3TDGA 4LLRA 4K5SA 1S3AA 2Z9SA 2MBSA 2X64A 5H5QA 1AQVA 4GF0A 2MZCA 4WF4A 3CTGA 3TKSC 4X4JA 1YF0A 4BVXB 2L5OA 1GUHA 1WRYA 18GSA 2VL2C 3CBUA 2LS5A 1G0TA 1V2AA 2CAQA 1V58A 3QDNA 5ECLB 3TRQA 1PA3A 2XBQA 2F51A 4DSSB 4ACSA 1DE2A 1WWJA 2BJXA 4K0NA 5ENUA 3PINA 3HVVA 1XFLA 2WGRA 1PQNA 4TXVA 5DDLA 4F0CA 3C7MA 1R7HA 1VF3A 4LA1A 3SBCA 5F07A 1V98A 1E6BA 4ZL9A 4IBPA 2J23A 5ECKB 1GNWA 2P5QA 3Q19A 3E0UA 5G30A 1TOFA 4Q5QA 1OKTA 2V6KA 2WB9A 1XW6A 1TW9A 4YQVA 2H0HA 1T4YA 2N5FA 3GTUA 3DXBA 2CX3A 5ECPB 1M9BA 2V32A 2D2ZA 4MA9A 2RLIA 4MJBA 3KTBA 2DIYA 3KEBA 3K8NA 4OFMA 1QMVA 3KTLA 3ZTLA 2IMKA 2E0QA 3ZFBA 2YWOA 3JCML 2GT6A 3RAZA 4EIPA 1M99A 2H8LA 1A0FA 3GIXA 2ZUPA 2K8SA 2R5GA 2FGXA 2XPDA 2M72A 1FB0A 1BG5A 3QFBC 3J7Yb 1M0UA 2VIMA 3O76A 3UMAA 3L78A 3M1GA 1SENA 4AJ6A 2A4VA 4K8MA 3WGDA 1T00A 2PU9C 4YH2A 1M2AA 3A5WA 2VOCA 1WE0A 1Q4JA 5J9BA 4POMA 3FZ9A 3LFLA 4KF9A 3IC4A 4ZL7A 5A5KA 2O7KA 2ON5A 1B4PA 2A4HA 5CYYA 4O7HA 3O3TA 16GSA 1BQ7A 2PVOC 1KBNA 5A4VA 4BVXA 4L8EA 1Q98A 3GURA 3HDCA 1K0OA 5E4WA 4EL1A 4K7NA 14GSA 1UC7A 5IMVA 1PN0A 2ES7A 5DJMA 5KOXA 4MF6A 2GSTA 3GH6A 4I5QA 3L9VA 2H75A 5IMCA 4JR6A 3UBKA 5BMUA 3DRNA 1AW9A 2FNOA 2LJAA 3NZNA 1SK0A 1GSYA 1U88A 3APQA 3BOAA 3M8NA 1PX7A 4Q5FA 3IR4A 5J9CA 1M2DA 1Z9HA 2VCVA 2FHEA 3F3QA 3VPTA 2ALBA 3DVXA 3UVHA 1XOAA 3HVNA 5EL8A 1XG8A 2C3QA 1QQ2A 4N11A 4GWRA 4KDXA 3J7Yk 3R3EA 1MDKA 4LL1B 4HZ2A 4MF5A 5IMDA 4KDUA 2C0GA 4N0VA 3ZRDA 1GLQA 3HJOA 2JACA 4E8EA 4QQ7A 2ON7A 5JWQB 3FR9A 1NSWA 1TRUA 4Q5NA 4NV2A 2YJHA 1TKDB 2HSYA 4FIWA 1X9MB 3QAWA 4HJ2A 5IO2A 4PUAA 1TK8B 1K3OA 4ECIA 2IFQA 2OA7A 2H1DA 2I3YA 1J08A 2HLSA 1T7PB 4MK3A 1H4OA 4ML1A 3M0FA 1WIKA 4RUVA 1FW1A 1EOHA 4MMMA 3QAGA 3EPTA 2R0GA 2LKUA 1M9AA 4FH8A 4USSA 4BVYB 4POKA 1YF1A 3ZITA 4BWQA 3TKRA 1V40A 7GSSA 5KN0A 3LORA 4IP1A 1GSEA 2REMA 1HYUA 2OE3A 1SKRB 17GSA 1SK2A 3L9SA 4GQCA 4OWYA 3NIVA 4F82A 1NW2A 3ZVJD 1T4ZA 2CQ9A 3NOFA 3MNGA 1XVWA 4CDOA 2LRCA 1TU8A 5GAPD 1K0AA 1QK8A 1SK1A 1THOA 3EWLA 2X99A 3EINA 2C0FA 4ZL8A 1ZZYA 3GV1A 3F6FA 2DJ2A 4DSRA 4XRDA 4ZILA 1JZRA 2RUEA 4TRXA 2C3NA 2QSIA 1IYHA 1Y6EA 3HD5A 1T1VA 3UAPA 2HYXA 1OKDA 3Q74A 1AC1A 2FLSA 8GSSA 4TKYA 3VWVA 5JCWA 3ZMKA 2M46A 1FG4A 1G7EA 1J0FA 3GUSA 1CQHA 6GSXA 1M7TA 2WZ9A 1X5CA 4RI7A 4Q5RA 2DMLA 2AJQB 2NVLA 3IXRA 5CAXA 2WRTA 4L5OA 2QA1A 1XZOA 4ZBDA 5CRHA 5G5FA 3GYKA 1PN9A 5LNKe 2DJ3A 2H01A 2A2RA 1TK0B 1WPIA 1ZYQB 4FYUA 2CAIA 1ZYEA 3APSA 3GA4A 4O92A 1Y25A 3GX0A 5J5NA 3HVXA 2GDRA 3P2AA 4WXTA 2PERA 5HR0A 4G19A 1VGLA 2CZ2A 2GT5A 3LYKA 2H0GA 2BMXA 3WT1A 2L5LA 5IPGA 3UBLA 3TCOA 2DMMA 5KOWA 1X0RA 3LSZA 2R0PA 2VLUA 2LRNA 4BVYA 4GCIA 2I9HA 4KH7A 4P3YB 3ZREA 2JZRA 4EUYA 3MIXA 4IW9A 3TRPA 1VF4A 2V6OA 3GL3A 2OADA 5COHA 2F9SA 3H4KA 1GTUA 1X9SB 1HNAA 4IN0A 1F37A 1YY7A 5ELGA 2X8HA 2VL3A 1XXUA 4RQXA 1O81A 2KLXA 4PQHA 2GSSA 5KEJA 2EC4A 2OACA 2IL3A 4OMVA 2NPBA 3GSTA 1HNBA 4NXIA 2QC7A 3H8QA 3C71A 5H5RA 1B48A 2IWTA 4Z2RA 3GTUB 2YWMA 1FB6A 4JBBA 4G2EA 4NHWA 1TRWA 5CO3A 3TGZA 4N30A 2P31A 3HA9A 1EZKA 1EGOA 1U3IA 3PR8A 5KN1A 4D73A 4TR0A 4MJCA 5HFKA 3MYDA 1Z6NA 5CNWA 2N5AA 3D6IA 1TU7A 1K0MA 1O73A 3D0ZA 3UIWA 2WFCA 2VM2A 3HVSA 1AQXA 3EU4A 2KP2A 4WBRD 12GSA 3Q6OA 1UN2A 1GLPA 4FO5A 5G1LA 3KIJA 1K0NA 1R26A 2GLRA 4Z2UA 1GSDA 3PGTA 4EC0A 1GNEA 3TKSE 2LJRA 3G9BA 1NM3A 1UVZA 2ZCTA 4ML6A 1U6TA 5CRWA 1K0DA 2VD0A 2QGVA 4CHSA 2GQLA 1MDIA 4KA0A 4MP4A 2MYGA 3W8JA 2KOKA 4MPFA 2E2MA 3LEFA 4TN8A 1GTAA 5CRDA 1ZMAA 5J4UA 1SYRA 3KP9A 2K6VA 3F8UA 1NHOA 2AV4A 2TRCP 3DGQA 2H1BA 3F63A 1EOGA 3RDWA 4F2IA 1A8YA 2YANA 2YV9A 3IK9A 3CMIA 4K7IA 1A2MA 2PMTA 1EP7A 3BJ5A 3E3EA 4CW9A 3GMFA 4POLA 3GNJA 4QL7A 2R0CA 3M9JA 3UEMA 3GH9A 4TR1B 2DJJA 3HXSA 4KDYA 1ML6A 2MBTA 3F6DA 3LG6A 4WF5A 5IM9A 3FMWA 4BA7A 3D21A 4KAEA 3IDVA 4GQFA 5FT3A 2RUFA 1W89A 3HJMA 1G7OA 3FK8A 1F2EA 4OCFA 2E2GA 4EDZA 3RHBA 3EC3A 4OFNA 4MJEA 3F3RA 5AISA 4OCEA 1IYIA 3C73A 3CSHA 3D22A 4YKFA 2O85A 3F9UA 2HT9A 5DAKA 2HNLA 2L59A 4TW5A 4JZQA 4MZBA 4YQMA 4G0IA 2L57A 2GSQA
chains in the Genus database with same CATH topology
5F05A 3C8EA 5C04A 5JCUA 3V1WA 3CRTA 5IOXA 2XPEA 2LTKA 5HR1A 2IFQB 4GTUA 4PXOA 4POBA 1V9WA 5GAND 2LQOA 1DBYA 4LL4B 3GKXA 1TI1A 1XBSA 5ECRB 3I6AA 4JR4A 2C1YA 4WR4A 4CY6A 1B9YC 3ERGA 1ERTA 5KN3A 2B6MA 6GSUA 1F6MC 3FRCA 3IPZA 3RHCA 2CZ3A 2XBIA 4PX1A 3GFKA 5D93A 2C0EA 3FY7A 4G9HA 5INYA 2DC5A 2VLTA 3KXOA 5GZZB 1YKAA 3ZMLA 2YPMA 2VLVA 4V2LA 4MLYA 2G0FA 2NDOA 1GRXA 4KCAA 4I6XA 1ZOFA 4KX4A 4ISDA 1C72A 2YCDA 3L4NA 2J9HA 2GZYA 4IP6A 3QFAC 3HJPA 4ZXGA 3ZYWA 2AB6A 5HR3A 2H30A 1W4VA 1ZL9A 3ZIVA 4HU7A 4OD7A 5G1KA 4WEYA 1BYEA 2YWNA 5EY6A 4ECBA 1GUMA 3LQ7A 11GSA 2PPTA 1A2LA 1EV9A 5LCZA 2UZ8A 4TR1A 2K9FA 1N2AA 4O5UA 2I1UA 4O32A 2F8FA 2MMAA 1PSQA 1MD3A 1O85A 6GSVA 5L71A 5F8BA 3UVTA 1K0CA 1GSSA 3E9JB 2H73A 3I9V2 1VF1A 2VL9A 2HZEB 1R5PA 1XIYA 4OFTA 5IMAA 1RK4A 1TP9A 3EVIA 2DJ0A 3KP8A 4X0XA 3F4TA 3TJKA 10GSA 2HE3A 3QAVA 2A2SA 4PQIA 2QA2A 1FO5A 4DVCA 3US3A 1Z6MA 2JADA 4AJ7A 2ZNMA 1DSBA 4TXOB 4L0WA 3CTFA 1SU9A 2H71A 1OVNA 2HFDA 2PVQA 3BCIA 4NMUA 6GSSA 2C4JA 3WGEA 5ECHB 1AXDA 3ERFA 4JRRA 3TRXA 3A3TA 1AUCA 2FD3A 4XHMA 2VCXA 4I2UA 3CYNA 1Z7PA 2YNXA 4PURA 1KNGA 2AYTA 1TRVA 4LMVA 1XWAA 3HZ8A 3N5OA 1OAZA 4J57E 1GUKA 3GHAA 1ERWA 3VWWA 5LD0A 1GULA 1Z3EA 2IIYA 2LNSA 2F3MA 2K8VA 3ISOA 4G10A 4HI7A 4BL7B 1OYJA 1SYXA 2EIOA 5J41A 4HS1A 4XTSA 2JSZA 2CT6A 2YWIA 1JZWA 3D5JA 1OE8A 4HZ4A 1I9DA 3WGXA 1PD21 5ELAA 3DIEA 4ZBBA 5ECMB 3DVWA 4IJ3A 4KGIA 1XWBA 1G6WA 1XWCA 1SL0B 3A2VA 2M80A 1LBKA 4ZBAA 3IA1A 3OR5A 3DEXA 4DSQA 2RM6A 4D73B 3CXGA 2JZSA 1G6YA 2FWEA 4WBJA 4IS0A 2H74A 2BTOT 4MZCA 5IPHA 4XIHA 5DVBA 5D9VA 5AIXA 5DCHA 3VPQA 1R5AA 2OE0A 3IRAA 2MMOA 2H66A 2GZZA 2HZEA 4PTSA 5DALB 3KMNA 3RBTA 4Z2TA 2PBJA 4PNGA 2EIQA 1YZXA 3KM6A 3P7XA 3L0HA 5ECQB 3SWLA 5AGYA 3CSIA 3I43A 3VI7A 1F3BA 2P5RA 1B8XA 4TXOA 4NHZA 5IOWA 2DIZA 2WULA 4YAVA 2P0GA 2AAWA 2RM5A 3DYRA 4WR5A 1ERUA 3ZVJA 4F9ZA 1S3DA 1XPVA 1PKZA 1FAAA 5B8AA 3IOSA 3VK9A 5IMZA 3P90A 3QOUA 1GSQA 2FUG2 2TIRA 2L6CA 3S9FA 1H75A 4EO3A 4MCUA 4QL9A 2YOIA 2I4AA 3DD3A 4X43A 4HOJA 5HR2A 2VCTA 1S3CA 4BL7A 2X8CA 3TKQA 2IN3A 3WT2A 2PWJA 5KN2A 4YKGA 5D8IA 1TI3A 1JFUA 4HJMA 2HSMA 2H76A 4KSMA 5G2ZA 3ZL5A 4J2FA 3GKKA 4XS4A 5DAKB 3VLNA 4K0GA 1JZDA 2VAFA 2R6KA 4WKWA 1KTEA 5IMFA 1GSUA 1ACVA 4MJAA 2GQKA 1AQWA 3LJRA 3IAM2 4K9ZA 2LUSA 1QUWA 4XS1A 3R2QA 4WETA 1SKWB 1MTCA 5DBQA 5CRGA 3FR3A 4N0ZA 2O89A 2HXKA 2JU5A 3CSJA 2YV7A 4K6XA 4K5RA 2OBKA 3A5IA 4MABA 3RPPA 4O5RA 1O7UA 4MNNA 4FQUA 2B5YA 2LJKA 2AHEA 4ZB6A 4IVFA 3IE3A 2OJLA 2DSAA 4PQ1A 5DALA 1ABAA 3I69A 1PL1A 1OC9B 2V41A 3KH7A 4IQ1A 2GQMA 3VWUA 1PGTA 4RI6A 2FY6A 1V57A 2H6XA 2KUCA 1B9XC 2H0IA 3IAS2 4XCSA 1T3BA 4H86A 2C80A 1MEKA 1A23A 2H6YA 4IJIA 3TUEA 5E59A 3H93A 4GSSA 2YN1A 4ZIJA 4AF2A 2FA4A 4TVEA 4AGSA 1JZOA 1BAYA 1ON4A 4IELA 2FWFA 2H1GA 5AIVA 5B8BA 2VM1A 1YDKA 2V2GA 3IV4A 1PMTA 2VUPA 1HNCA 3TOUA 1XVQA 4G0LA 1GTIA 2FCHA 3ED3A 1XWKA 5HFGA 4YAPA 1FVKA 4EE0A 1XWGA 5JWOB 1ILOA 2E7PA 2C8UA 2H19A 3KGKA 1XOBA 3TKSA 5IQYA 3LWAA 3D4MA 2IPAA 1GTBA 1TJDA 2HRAA 5D9WA 1GL8A 2VL2A 4OO4A 1TTZA 3C1SA 3AY8A 2L4QA 5FWGA 2DKIA 1UA5A 1I5GA 4I97A 1MDJA 2VO4A 1Z7RA 2B1KA 4TR4A 2YJ7A 2HI7A 1XW5A 2IJYA 3G7JA 3KD0A 4KW6A 1VF2A 3UOMA 2OE1A 4V1Ag 3BBYA 3EE2A 2YZUA 5A4WA 2JZTA 4EDYA 3D4TA 2K18A 1YQ1A 3ME8A 2VCWA 3ZZXA 3HY2A 1A24A 9GSSA 4F0BA 2KHPA 4ULXA 4K1FA 2LV3A 3C1RA 2NBSA 1K3LA 1SD8A 3IK7A 1X9WB 1PKWA 2GS3A 2YP6A 3TJBA 2OKAA 4YQUA 3MAKA 1O6JA 1EGRA 2CVDA 1OC9A 1QXHA 4BWSA 5J3RA 3HCZA 2MMZA 1SKSB 4FYBA 1AIUA 1LU4A 3APOA 4JEDA 1RQMA 1WOUA 1URMA 3DWVA 4N10A 2B5XA 2PGTA 3GKMA 3ERWA 1A2JA 2CV4A 4MH3A 2WS2A 2TRXA 1AAZA 2AUVA 3LGCA 3TKPA 2X8GA 3FHKA 4GSTA 2HRNA 2LRTA 4RQRA 1O8WA 3ZLPA 4IQAA 4J56E 1VRSD 4HQSA 4ILFA 4G0KA 3W8SA 2FWGA 2PUKC 2GGTA 4V1Ap 4V2NA 1SJIA 4PUFC 4ECJA 1HD2A 1ZYPA 2B5EA 1USBA 1E2YA 4ZB9A 4L0UA 4DSSA 1JLVA 2PN8A 4K2XA 19GSA 1KEBA 3EURA 5D9TA 3FZAA 1FOVA 3MSZA 4E8HA 3IC8A 1THXA 2DLXA 1ST9A 1ZCPA 3CRUA 3P8WA 2O87A 3FKFA 1EEMA 3TJJA 1X5DA 2WCIA 1QGVA 4MPGA 4EKZA 2CX4A 4NV5A 3GKNA 1LJRA 2C3TA 5AN1A 3FZ4A 4PNFA 4HQZA 5B6MA 1PX6A 3EYTA 1YEXA 2IMFA 1EWXA 4EXJA 2YZHA 4K7OA 3TJGA 2DBCA 4GRFA 3MWHA 4EIQA 3FR6A 4JE1A 5JCGA 1T8EB 1EV4A 1DE1A 4V2MA 3H1NA 5A4UA 4HEA2 3HZ4A 1O8XA 1R4WA 2KP1A 3WYWA 3HYPA 1DUGA 5ECNB 4GXZA 4I2TA 1A8LA 3L9UA 5IIZA 4FYCA 1TRSA 1FVJA 3FW2A 5B6NA 2F8AA 3O6TA 2GSRA 1SJZA 5EPFA 2CVBA 5EVOA 4MF7A 3G7IA 2WJUA 3DMLA 4L5LA 4TR3A 3RPNA 2EIRA 1PRXA 2CVKA 2GVPA 2XC2A 3N9JA 4ECCA 4MH2A 1SL2B 1K0BA 1TK5B 4XS4B 2IMEA 3LXTA 4GLTA 3IHQA 5F06A 1EEJA 2VCZA 1ZGNA 2B7JA 4IKHA 3UJ1A 3GRXA 5CP1A 2NTOA 5FHIA 1YKCA 1XW9A 3Q18A 5F0GA 3GX8A 3TOTA 20GSA 1RW1A 4OO5A 3KH9A 6GSTA 1GP1A 5B7CA 4KCEA 2VCQA 2V1MA 3G7YA 2R2JA 3M9KA 4HUAA 2B7KA 1XCCA 2H1AA 4KSOA 4EVMA 2JL4A 2DKHA 3A2WA 6GSYA 2VD1A 2R37A 3VFIA 1QFNA 2JSYA 4KNDA 2R4VA 1PL2A 3GSSA 3HKRA 1HQOA 3TJFA 3EMXA 1M2BA 6GSWA 2DJ1A 3FYGA 4O5QA 1MD4A 4KUNA 3F4RA 4BPYA 4X1UA 1GWCA 2I81A 1GSFA 1WMJA 3UARA 13GSA 3U6VA 4HDEA 5CREA 1U87A 4IGJA 1JLWA 5ID2B 3DKSA 3QPMA 2H70A 1J9BA 2LQQA 2N5BA 5D96A 4F03A 3H79A 2H6ZA 5D73A 2IMDA 4A5PA 1FOHA 2B3SA 3QCPA 3TB2A 5G5EA 2LSTA 3UL3A 4CY8A 5H5SA 5DQYA 1TXXA 1SL1B 3A2XA 1FHEA 2HRKA 3M3MA 2HZFA 3QR6A 3VI5A 1F3AA 5DJLA 3U5RE 5GSTA 5JWRB 1BJXA 4GSNA 5ECOB 2B1LA 2CA8A 1N8JA 3F4SA 2H72A 3EMPA 2A2PA 2X4AA 5HQPA 5D9XA 5GSSA 1JHBA 22GSA 2L4CA 3HHVA 4EF0A 3KJYA 5IO0A 3EU3A 1SJ6A 3IHGA 1TDIA 2IMIA 1WP0A 2HRFA 3KCMA 3ZIJA 1WJKA 3ME7A 4KE3A 1YJ6A 4Z7XA 1EP8A 1OE7A 2L6DA 3PH9A 2WDUA 2LEGA 3FZ5A 4DEJA 1CQGA 2GZPA 2C0DA 4I8BA 3LW9A 4LMWA 5G31A 3BCKA 3F0IA 2O8VB 5HFIA 4IHUA 5BRTA 2MMNA 5DQSA 1F9MA 2XHFA 1K3YA 2DJKA 2X49A 5DCGA 4XS6A 4TOPA 1BEDA 3VWXA 4NWYA 1ERVA 3IBHA 3MDKA 3PPUA 2FWHA 5ECSA 4PGTA 4MDCA 1BX9A 4K2DA 4MZWA 3LXZA 4AJ8A 1OC3A 3FEUA 4NAXA 1X5EA 2OBIA 1SD9A 5ABRA 1Z5YE 3GN3A 2RIIA 2HSHA 3GL5A 3BD2A 5C00A 1U3AA 1GH2A 2FA8A 2R3XA 1ZYNA 5ECIB 4ID0A 4ICYA 1YEPA 2G2QA 2GTUA 2QKEA 4XRAA 3WD6A 5ID2A 4NPBA 3KZQA 1B4QA 1NHYA 3ZFLA 3VURA 1A0RP 3LYPA 4HU9A 3KMOA 4KB3A 4ZB8A 4JU5A 1OC8A 2LNTA 3QMXA 3W6GA 3QD9A 3TDGA 4LLRA 4K5SA 1S3AA 2Z9SA 2MBSA 2X64A 5H5QA 1AQVA 4GF0A 2MZCA 4WF4A 3CTGA 3TKSC 4X4JA 1YF0A 4BVXB 2L5OA 1GUHA 1WRYA 18GSA 2VL2C 3CBUA 2LS5A 1G0TA 1V2AA 2CAQA 1V58A 3QDNA 5ECLB 3TRQA 1PA3A 2XBQA 2F51A 4DSSB 4ACSA 1DE2A 1WWJA 2BJXA 4K0NA 5ENUA 3PINA 3HVVA 1XFLA 2WGRA 1PQNA 4TXVA 5DDLA 4F0CA 3C7MA 1R7HA 1VF3A 4LA1A 3SBCA 5F07A 1V98A 1E6BA 4ZL9A 4IBPA 2J23A 5ECKB 1GNWA 2P5QA 3Q19A 3E0UA 5G30A 1TOFA 4Q5QA 1OKTA 2V6KA 2WB9A 1XW6A 1TW9A 4YQVA 2H0HA 1T4YA 2N5FA 3GTUA 3DXBA 2CX3A 5ECPB 1M9BA 2V32A 2D2ZA 4MA9A 2RLIA 4MJBA 3KTBA 2DIYA 3KEBA 3K8NA 4OFMA 1QMVA 3KTLA 3ZTLA 2IMKA 2E0QA 3ZFBA 2YWOA 3JCML 2GT6A 3RAZA 4EIPA 1M99A 2H8LA 1A0FA 3GIXA 2ZUPA 2K8SA 2R5GA 2FGXA 2XPDA 2M72A 1FB0A 1BG5A 3QFBC 3J7Yb 1M0UA 2VIMA 3O76A 3UMAA 3L78A 3M1GA 1SENA 4AJ6A 2A4VA 4K8MA 3WGDA 1T00A 2PU9C 4YH2A 1M2AA 3A5WA 2VOCA 1WE0A 1Q4JA 5J9BA 4POMA 3FZ9A 3LFLA 4KF9A 3IC4A 4ZL7A 5A5KA 2O7KA 2ON5A 1B4PA 2A4HA 5CYYA 4O7HA 3O3TA 16GSA 1BQ7A 2PVOC 1KBNA 5A4VA 4BVXA 4L8EA 1Q98A 3GURA 3HDCA 1K0OA 5E4WA 4EL1A 4K7NA 14GSA 1UC7A 5IMVA 1PN0A 2ES7A 5DJMA 5KOXA 4MF6A 2GSTA 3GH6A 4I5QA 3L9VA 2H75A 5IMCA 4JR6A 3UBKA 5BMUA 3DRNA 1AW9A 2FNOA 2LJAA 3NZNA 1SK0A 1GSYA 1U88A 3APQA 3BOAA 3M8NA 1PX7A 4Q5FA 3IR4A 5J9CA 1M2DA 1Z9HA 2VCVA 2FHEA 3F3QA 3VPTA 2ALBA 3DVXA 3UVHA 1XOAA 5EL8A 2C3QA 1QQ2A 4N11A 4GWRA 4KDXA 3J7Yk 3R3EA 1MDKA 4LL1B 4HZ2A 4MF5A 5IMDA 4KDUA 2C0GA 4N0VA 3ZRDA 1GLQA 3HJOA 2JACA 4E8EA 4QQ7A 2ON7A 5JWQB 3FR9A 1NSWA 1TRUA 4Q5NA 4NV2A 2YJHA 1TKDB 2HSYA 4FIWA 1X9MB 3QAWA 4HJ2A 5IO2A 4PUAA 1TK8B 1K3OA 4ECIA 2IFQA 2OA7A 2H1DA 2I3YA 1J08A 2HLSA 1T7PB 4MK3A 1H4OA 4ML1A 3M0FA 1WIKA 4RUVA 1FW1A 1EOHA 4MMMA 3QAGA 3EPTA 2R0GA 2LKUA 1M9AA 4FH8A 4USSA 4BVYB 4POKA 1YF1A 3ZITA 4BWQA 3TKRA 1V40A 7GSSA 5KN0A 3LORA 4IP1A 1GSEA 2REMA 1HYUA 2OE3A 1SKRB 17GSA 1SK2A 3L9SA 4GQCA 4OWYA 3NIVA 4F82A 1NW2A 3ZVJD 1T4ZA 2CQ9A 3NOFA 3MNGA 1XVWA 4CDOA 2LRCA 1TU8A 5GAPD 1K0AA 1QK8A 1SK1A 1THOA 3EWLA 2X99A 3EINA 2C0FA 4ZL8A 1ZZYA 3GV1A 3F6FA 2DJ2A 4DSRA 4XRDA 4ZILA 1JZRA 2RUEA 4TRXA 2C3NA 2QSIA 1IYHA 1Y6EA 3HD5A 1T1VA 3UAPA 2HYXA 1OKDA 3Q74A 1AC1A 2FLSA 8GSSA 4TKYA 3VWVA 5JCWA 3ZMKA 2M46A 1FG4A 1G7EA 1J0FA 3GUSA 1CQHA 6GSXA 1M7TA 2WZ9A 1X5CA 4RI7A 4Q5RA 2DMLA 2AJQB 2NVLA 3IXRA 5CAXA 2WRTA 4L5OA 2QA1A 1XZOA 4ZBDA 5CRHA 5G5FA 3GYKA 1PN9A 5LNKe 2DJ3A 2H01A 2A2RA 1TK0B 1WPIA 1ZYQB 4FYUA 2CAIA 1ZYEA 3APSA 3GA4A 4O92A 1Y25A 3GX0A 5J5NA 3HVXA 2GDRA 3P2AA 4WXTA 2PERA 5HR0A 4G19A 1VGLA 2CZ2A 2GT5A 3LYKA 2H0GA 2BMXA 3WT1A 2L5LA 5IPGA 3UBLA 3TCOA 2DMMA 5KOWA 1X0RA 3LSZA 2R0PA 2VLUA 2LRNA 4BVYA 4GCIA 2I9HA 4KH7A 4P3YB 3ZREA 2JZRA 4EUYA 3MIXA 4IW9A 3TRPA 1VF4A 2V6OA 3GL3A 2OADA 5COHA 2F9SA 3H4KA 1GTUA 1X9SB 1HNAA 4IN0A 1F37A 1YY7A 5ELGA 2X8HA 2VL3A 1XXUA 4RQXA 1O81A 2KLXA 4PQHA 2GSSA 5KEJA 2EC4A 2OACA 2IL3A 4OMVA 2NPBA 3GSTA 1HNBA 4NXIA 2QC7A 3H8QA 3C71A 5H5RA 1B48A 2IWTA 4Z2RA 3GTUB 2YWMA 1FB6A 4JBBA 4G2EA 4NHWA 1TRWA 5CO3A 3TGZA 4N30A 2P31A 3HA9A 1EZKA 1EGOA 1U3IA 3PR8A 5KN1A 4D73A 4TR0A 4MJCA 5HFKA 3MYDA 1Z6NA 5CNWA 2N5AA 3D6IA 1TU7A 1K0MA 1O73A 3D0ZA 3UIWA 2WFCA 2VM2A 3HVSA 1AQXA 3EU4A 2KP2A 4WBRD 12GSA 3Q6OA 1UN2A 1GLPA 4FO5A 5G1LA 3KIJA 1K0NA 1R26A 2GLRA 4Z2UA 1GSDA 3PGTA 4EC0A 1GNEA 3TKSE 2LJRA 3G9BA 1NM3A 1UVZA 2ZCTA 4ML6A 1U6TA 5CRWA 1K0DA 2VD0A 2QGVA 4CHSA 2GQLA 1MDIA 4KA0A 4MP4A 2MYGA 3W8JA 2KOKA 4MPFA 2E2MA 3LEFA 4TN8A 1GTAA 5CRDA 1ZMAA 5J4UA 1SYRA 3KP9A 2K6VA 3F8UA 1NHOA 2AV4A 2TRCP 3DGQA 2H1BA 3F63A 1EOGA 3RDWA 4F2IA 1A8YA 2YANA 2YV9A 3IK9A 3CMIA 4K7IA 1A2MA 2PMTA 1EP7A 3BJ5A 3E3EA 4CW9A 3GMFA 4POLA 3GNJA 4QL7A 2R0CA 3M9JA 3UEMA 3GH9A 4TR1B 2DJJA 3HXSA 4KDYA 1ML6A 2MBTA 3F6DA 3LG6A 4WF5A 5IM9A 3FMWA 4BA7A 3D21A 4KAEA 3IDVA 4GQFA 5FT3A 2RUFA 1W89A 3HJMA 1G7OA 3FK8A 1F2EA 4OCFA 2E2GA 4EDZA 3RHBA 3EC3A 4OFNA 4MJEA 3F3RA 5AISA 4OCEA 1IYIA 3C73A 3CSHA 3D22A 4YKFA 2O85A 3F9UA 2HT9A 5DAKA 2HNLA 2L59A 4TW5A 4JZQA 4MZBA 4YQMA 4G0IA 2L57A 2GSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F05 A;  3C8E A;  5C04 A;  5JCU A;  3V1W A;  3CRT A;  5IOX A;  2XPE A;  2LTK A;  5HR1 A;  2IFQ B;  4GTU A;  4PXO A;  4POB A;  1V9W A;  5GAN D;  2LQO A;  1DBY A;  4LL4 B;  3GKX A;  1TI1 A;  1XBS A;  5ECR B;  3I6A A;  4JR4 A;  2C1Y A;  4WR4 A;  1B9Y C;  3ERG A;  1ERT A;  5KN3 A;  2B6M A;  6GSU A;  1F6M C;  3FRC A;  3IPZ A;  3RHC A;  2CZ3 A;  2XBI A;  4PX1 A;  3GFK A;  5D93 A;  2C0E A;  3FY7 A;  4G9H A;  5INY A;  2DC5 A;  2VLT A;  3KXO A;  5GZZ B;  1YKA A;  3ZML A;  2YPM A;  2VLV A;  4V2L A;  4MLY A;  2G0F A;  2NDO A;  1GRX A;  4KCA A;  4I6X A;  1ZOF A;  4KX4 A;  4ISD A;  1C72 A;  2YCD A;  3L4N A;  2J9H A;  2GZY A;  4IP6 A;  3QFA C;  3HJP A;  4ZXG A;  3ZYW A;  2AB6 A;  5HR3 A;  2H30 A;  1W4V A;  1ZL9 A;  3ZIV A;  4HU7 A;  4OD7 A;  5G1K A;  4WEY A;  1BYE A;  2YWN A;  5EY6 A;  4ECB A;  1GUM A;  3LQ7 A;  11GS A;  2PPT A;  1A2L A;  1EV9 A;  5LCZ A;  4TR1 A;  2K9F A;  1N2A A;  2I1U A;  4O32 A;  2F8F A;  2MMA A;  1PSQ A;  1MD3 A;  1O85 A;  6GSV A;  5L71 A;  5F8B A;  3UVT A;  1K0C A;  1GSS A;  3E9J B;  2H73 A;  3I9V 2;  1VF1 A;  2VL9 A;  2HZE B;  1R5P A;  1XIY A;  4OFT A;  5IMA A;  1RK4 A;  1TP9 A;  3EVI A;  2DJ0 A;  3KP8 A;  4X0X A;  3F4T A;  3TJK A;  10GS A;  2HE3 A;  3QAV A;  2A2S A;  4PQI A;  1FO5 A;  4DVC A;  3US3 A;  1Z6M A;  2JAD A;  4AJ7 A;  2ZNM A;  1DSB A;  4TXO B;  4L0W A;  3CTF A;  1SU9 A;  2H71 A;  1OVN A;  2HFD A;  2PVQ A;  3BCI A;  4NMU A;  6GSS A;  2C4J A;  3WGE A;  5ECH B;  1AXD A;  3ERF A;  4JRR A;  3TRX A;  3A3T A;  1AUC A;  2FD3 A;  4XHM A;  2VCX A;  4I2U A;  3CYN A;  1Z7P A;  2YNX A;  4PUR A;  1KNG A;  2AYT A;  1TRV A;  4LMV A;  1XWA A;  3HZ8 A;  3N5O A;  1OAZ A;  4J57 E;  1GUK A;  3GHA A;  1ERW A;  3VWW A;  5LD0 A;  1GUL A;  1Z3E A;  2IIY A;  2LNS A;  2F3M A;  2K8V A;  3ISO A;  4G10 A;  4HI7 A;  1OYJ A;  1SYX A;  2EIO A;  5J41 A;  4HS1 A;  4XTS A;  2JSZ A;  2CT6 A;  2YWI A;  1JZW A;  3D5J A;  1OE8 A;  4HZ4 A;  1I9D A;  3WGX A;  1PD2 1;  5ELA A;  3DIE A;  4ZBB A;  5ECM B;  3DVW A;  4IJ3 A;  4KGI A;  1XWB A;  1G6W A;  1XWC A;  1SL0 B;  3A2V A;  2M80 A;  1LBK A;  4ZBA A;  3IA1 A;  3OR5 A;  3DEX A;  4DSQ A;  2RM6 A;  4D73 B;  3CXG A;  2JZS A;  1G6Y A;  2FWE A;  4WBJ A;  4IS0 A;  2H74 A;  2BTO T;  4MZC A;  5IPH A;  4XIH A;  5DVB A;  5D9V A;  5AIX A;  5DCH A;  3VPQ A;  1R5A A;  2OE0 A;  3IRA A;  2MMO A;  2H66 A;  2GZZ A;  2HZE A;  5DAL B;  3KMN A;  3RBT A;  2PBJ A;  4PNG A;  2EIQ A;  1YZX A;  3KM6 A;  3P7X A;  3L0H A;  5ECQ B;  3SWL A;  5AGY A;  3CSI A;  3I43 A;  3VI7 A;  1F3B A;  2P5R A;  1B8X A;  4TXO A;  4NHZ A;  5IOW A;  2DIZ A;  2WUL A;  4YAV A;  2P0G A;  2AAW A;  2RM5 A;  3DYR A;  4WR5 A;  1ERU A;  3ZVJ A;  4F9Z A;  1S3D A;  1XPV A;  1PKZ A;  1FAA A;  5B8A A;  3IOS A;  3VK9 A;  5IMZ A;  3P90 A;  3QOU A;  1GSQ A;  2FUG 2;  2TIR A;  2L6C A;  3S9F A;  1H75 A;  4EO3 A;  4MCU A;  4QL9 A;  2YOI A;  2I4A A;  3DD3 A;  4X43 A;  4HOJ A;  5HR2 A;  2VCT A;  1S3C A;  4BL7 A;  2X8C A;  3TKQ A;  2IN3 A;  3WT2 A;  2PWJ A;  5KN2 A;  5D8I A;  1TI3 A;  1JFU A;  4HJM A;  2H76 A;  4KSM A;  5G2Z A;  3ZL5 A;  4J2F A;  3GKK A;  4XS4 A;  5DAK B;  3VLN A;  4K0G A;  1JZD A;  2VAF A;  2R6K A;  4WKW A;  1KTE A;  5IMF A;  1GSU A;  1ACV A;  4MJA A;  2GQK A;  1AQW A;  3LJR A;  3IAM 2;  4K9Z A;  2LUS A;  1QUW A;  4XS1 A;  3R2Q A;  4WET A;  1SKW B;  1MTC A;  5DBQ A;  5CRG A;  3FR3 A;  4N0Z A;  2O89 A;  2HXK A;  2JU5 A;  3CSJ A;  2YV7 A;  4K6X A;  2OBK A;  4MAB A;  3RPP A;  4O5R A;  1O7U A;  2B5Y A;  2LJK A;  2AHE A;  4ZB6 A;  4IVF A;  3IE3 A;  2OJL A;  2DSA A;  4PQ1 A;  5DAL A;  1ABA A;  3I69 A;  1PL1 A;  1OC9 B;  2V41 A;  3KH7 A;  4IQ1 A;  2GQM A;  3VWU A;  1PGT A;  4RI6 A;  2FY6 A;  1V57 A;  2H6X A;  2KUC A;  1B9X C;  2H0I A;  3IAS 2;  4XCS A;  1T3B A;  4H86 A;  2C80 A;  1MEK A;  1A23 A;  2H6Y A;  4IJI A;  3TUE A;  5E59 A;  3H93 A;  4GSS A;  2YN1 A;  4ZIJ A;  4AF2 A;  2FA4 A;  4TVE A;  4AGS A;  1JZO A;  1BAY A;  1ON4 A;  4IEL A;  2FWF A;  2H1G A;  5AIV A;  5B8B A;  2VM1 A;  1YDK A;  2V2G A;  3IV4 A;  1PMT A;  2VUP A;  1HNC A;  3TOU A;  1XVQ A;  1GTI A;  2FCH A;  3ED3 A;  1XWK A;  5HFG A;  4YAP A;  1FVK A;  4EE0 A;  1XWG A;  5JWO B;  1ILO A;  2E7P A;  2C8U A;  2H19 A;  3KGK A;  1XOB A;  3TKS A;  5IQY A;  3LWA A;  3D4M A;  2IPA A;  1GTB A;  1TJD A;  5D9W A;  1GL8 A;  2VL2 A;  4OO4 A;  1TTZ A;  3C1S A;  3AY8 A;  2L4Q A;  5FWG A;  1UA5 A;  1I5G A;  4I97 A;  1MDJ A;  2VO4 A;  1Z7R A;  2B1K A;  4TR4 A;  2YJ7 A;  2HI7 A;  1XW5 A;  2IJY A;  3G7J A;  3KD0 A;  4KW6 A;  1VF2 A;  3UOM A;  2OE1 A;  4V1A g;  3BBY A;  3EE2 A;  2YZU A;  5A4W A;  2JZT A;  4EDY A;  3D4T A;  2K18 A;  1YQ1 A;  3ME8 A;  2VCW A;  3ZZX A;  3HY2 A;  1A24 A;  9GSS A;  4F0B A;  2KHP A;  4ULX A;  4K1F A;  2LV3 A;  3C1R A;  2NBS A;  1K3L A;  1SD8 A;  3IK7 A;  1X9W B;  1PKW A;  2GS3 A;  2YP6 A;  3TJB A;  2OKA A;  4YQU A;  3MAK A;  1O6J A;  1EGR A;  2CVD A;  1OC9 A;  1QXH A;  4BWS A;  5J3R A;  3HCZ A;  2MMZ A;  1SKS B;  4FYB A;  1AIU A;  1LU4 A;  3APO A;  4JED A;  1RQM A;  1WOU A;  1URM A;  3DWV A;  4N10 A;  2B5X A;  2PGT A;  3GKM A;  3ERW A;  1A2J A;  2CV4 A;  4MH3 A;  2WS2 A;  2TRX A;  1AAZ A;  2AUV A;  3LGC A;  3TKP A;  2X8G A;  3FHK A;  4GST A;  2HRN A;  2LRT A;  4RQR A;  1O8W A;  3ZLP A;  4IQA A;  4J56 E;  1VRS D;  4HQS A;  4ILF A;  3W8S A;  2FWG A;  2PUK C;  2GGT A;  4V1A p;  4V2N A;  1SJI A;  4PUF C;  4ECJ A;  1HD2 A;  2B5E A;  1USB A;  1E2Y A;  4ZB9 A;  4L0U A;  4DSS A;  1JLV A;  2PN8 A;  19GS A;  1KEB A;  3EUR A;  5D9T A;  3FZA A;  1FOV A;  3MSZ A;  4E8H A;  1THX A;  2DLX A;  1ST9 A;  1ZCP A;  3CRU A;  3P8W A;  2O87 A;  3FKF A;  1EEM A;  3TJJ A;  1X5D A;  2WCI A;  1QGV A;  4MPG A;  4EKZ A;  2CX4 A;  4NV5 A;  3GKN A;  1LJR A;  2C3T A;  5AN1 A;  3FZ4 A;  4PNF A;  4HQZ A;  5B6M A;  1PX6 A;  3EYT A;  1YEX A;  2IMF A;  1EWX A;  4EXJ A;  2YZH A;  4K7O A;  3TJG A;  2DBC A;  4GRF A;  3MWH A;  3FR6 A;  4JE1 A;  5JCG A;  1T8E B;  1EV4 A;  1DE1 A;  4V2M A;  3H1N A;  5A4U A;  4HEA 2;  3HZ4 A;  1O8X A;  1R4W A;  2KP1 A;  3WYW A;  3HYP A;  1DUG A;  5ECN B;  4GXZ A;  4I2T A;  1A8L A;  3L9U A;  5IIZ A;  4FYC A;  1TRS A;  1FVJ A;  3FW2 A;  5B6N A;  2F8A A;  3O6T A;  2GSR A;  1SJZ A;  5EPF A;  2CVB A;  5EVO A;  4MF7 A;  3G7I A;  2WJU A;  3DML A;  4L5L A;  4TR3 A;  3RPN A;  2EIR A;  1PRX A;  2CVK A;  2GVP A;  2XC2 A;  3N9J A;  4ECC A;  4MH2 A;  1SL2 B;  1K0B A;  1TK5 B;  4XS4 B;  2IME A;  3LXT A;  4GLT A;  3IHQ A;  5F06 A;  1EEJ A;  2VCZ A;  1ZGN A;  2B7J A;  4IKH A;  3UJ1 A;  3GRX A;  5CP1 A;  2NTO A;  5FHI A;  1YKC A;  1XW9 A;  3Q18 A;  5F0G A;  3GX8 A;  3TOT A;  20GS A;  1RW1 A;  4OO5 A;  3KH9 A;  6GST A;  1GP1 A;  5B7C A;  4KCE A;  2VCQ A;  2V1M A;  3G7Y A;  2R2J A;  3M9K A;  4HUA A;  2B7K A;  1XCC A;  2H1A A;  4KSO A;  4EVM A;  2JL4 A;  3A2W A;  6GSY A;  2VD1 A;  2R37 A;  3VFI A;  1QFN A;  2JSY A;  4KND A;  2R4V A;  1PL2 A;  3GSS A;  3HKR A;  1HQO A;  3TJF A;  3EMX A;  1M2B A;  6GSW A;  2DJ1 A;  3FYG A;  1MD4 A;  4KUN A;  3F4R A;  4BPY A;  4X1U A;  1GWC A;  2I81 A;  1GSF A;  1WMJ A;  3UAR A;  13GS A;  3U6V A;  4HDE A;  5CRE A;  1U87 A;  4IGJ A;  1JLW A;  5ID2 B;  3DKS A;  3QPM A;  2H70 A;  1J9B A;  2LQQ A;  2N5B A;  5D96 A;  4F03 A;  3H79 A;  2H6Z A;  5D73 A;  2IMD A;  2B3S A;  3QCP A;  3TB2 A;  5G5E A;  2LST A;  3UL3 A;  5H5S A;  5DQY A;  1TXX A;  1SL1 B;  3A2X A;  1FHE A;  3M3M A;  2HZF A;  3QR6 A;  3VI5 A;  1F3A A;  5DJL A;  3U5R E;  5GST A;  5JWR B;  1BJX A;  4GSN A;  5ECO B;  2B1L A;  2CA8 A;  1N8J A;  3F4S A;  2H72 A;  3EMP A;  5HQP A;  5D9X A;  5GSS A;  1JHB A;  22GS A;  2L4C A;  3HHV A;  4EF0 A;  3KJY A;  5IO0 A;  3EU3 A;  1SJ6 A;  1TDI A;  2IMI A;  1WP0 A;  2HRF A;  3KCM A;  3ZIJ A;  1WJK A;  3ME7 A;  4KE3 A;  1YJ6 A;  4Z7X A;  1EP8 A;  1OE7 A;  2L6D A;  3PH9 A;  2WDU A;  2LEG A;  3FZ5 A;  4DEJ A;  1CQG A;  2GZP A;  2C0D A;  4I8B A;  4LMW A;  5G31 A;  3BCK A;  3F0I A;  2O8V B;  5HFI A;  4IHU A;  2MMN A;  5DQS A;  1F9M A;  2XHF A;  1K3Y A;  2DJK A;  5DCG A;  4XS6 A;  4TOP A;  1BED A;  3VWX A;  4NWY A;  1ERV A;  3IBH A;  3MDK A;  2FWH A;  5ECS A;  4PGT A;  4MDC A;  1BX9 A;  4K2D A;  4MZW A;  3LXZ A;  4AJ8 A;  1OC3 A;  3FEU A;  4NAX A;  1X5E A;  2OBI A;  1SD9 A;  5ABR A;  1Z5Y E;  3GN3 A;  2RII A;  2HSH A;  3GL5 A;  3BD2 A;  5C00 A;  1U3A A;  1GH2 A;  2FA8 A;  2R3X A;  5ECI B;  4ID0 A;  1YEP A;  2G2Q A;  2GTU A;  2QKE A;  4XRA A;  3WD6 A;  5ID2 A;  4NPB A;  3KZQ A;  1B4Q A;  1NHY A;  3ZFL A;  3VUR A;  1A0R P;  3LYP A;  4HU9 A;  3KMO A;  4KB3 A;  4ZB8 A;  4JU5 A;  1OC8 A;  2LNT A;  3QMX A;  3W6G A;  3QD9 A;  3TDG A;  4LLR A;  1S3A A;  2Z9S A;  2MBS A;  2X64 A;  5H5Q A;  1AQV A;  4GF0 A;  2MZC A;  4WF4 A;  3CTG A;  3TKS C;  1YF0 A;  2L5O A;  1GUH A;  1WRY A;  18GS A;  2VL2 C;  3CBU A;  2LS5 A;  1G0T A;  1V2A A;  2CAQ A;  1V58 A;  3QDN A;  5ECL B;  3TRQ A;  1PA3 A;  2XBQ A;  2F51 A;  4DSS B;  4ACS A;  1DE2 A;  1WWJ A;  2BJX A;  4K0N A;  5ENU A;  3PIN A;  3HVV A;  1XFL A;  2WGR A;  1PQN A;  4TXV A;  5DDL A;  4F0C A;  3C7M A;  1R7H A;  1VF3 A;  4LA1 A;  3SBC A;  5F07 A;  1V98 A;  1E6B A;  4ZL9 A;  4IBP A;  2J23 A;  5ECK B;  1GNW A;  2P5Q A;  3Q19 A;  3E0U A;  5G30 A;  1TOF A;  4Q5Q A;  1OKT A;  2V6K A;  2WB9 A;  1XW6 A;  1TW9 A;  4YQV A;  2H0H A;  1T4Y A;  2N5F A;  3GTU A;  3DXB A;  2CX3 A;  5ECP B;  1M9B A;  2V32 A;  2D2Z A;  4MA9 A;  2RLI A;  4MJB A;  3KTB A;  2DIY A;  3KEB A;  3K8N A;  4OFM A;  1QMV A;  3KTL A;  3ZTL A;  2IMK A;  2E0Q A;  3ZFB A;  2YWO A;  3JCM L;  2GT6 A;  3RAZ A;  1M99 A;  2H8L A;  1A0F A;  3GIX A;  2ZUP A;  2K8S A;  2R5G A;  2FGX A;  2XPD A;  2M72 A;  1FB0 A;  1BG5 A;  3QFB C;  3J7Y b;  1M0U A;  2VIM A;  3O76 A;  3UMA A;  3L78 A;  3M1G A;  1SEN A;  4AJ6 A;  2A4V A;  4K8M A;  3WGD A;  1T00 A;  2PU9 C;  4YH2 A;  1M2A A;  3A5W A;  2VOC A;  1WE0 A;  1Q4J A;  5J9B A;  4POM A;  3FZ9 A;  3LFL A;  3IC4 A;  4ZL7 A;  5A5K A;  2O7K A;  2ON5 A;  1B4P A;  5CYY A;  4O7H A;  3O3T A;  16GS A;  1BQ7 A;  2PVO C;  1KBN A;  5A4V A;  4BVX A;  4L8E A;  1Q98 A;  3GUR A;  3HDC A;  1K0O A;  5E4W A;  4EL1 A;  4K7N A;  14GS A;  1UC7 A;  5IMV A;  2ES7 A;  5DJM A;  4MF6 A;  2GST A;  3GH6 A;  4I5Q A;  3L9V A;  2H75 A;  5IMC A;  4JR6 A;  3UBK A;  3DRN A;  1AW9 A;  2FNO A;  2LJA A;  3NZN A;  1SK0 A;  1GSY A;  1U88 A;  3APQ A;  3BOA A;  3M8N A;  1PX7 A;  4Q5F A;  3IR4 A;  5J9C A;  1M2D A;  1Z9H A;  2VCV A;  2FHE A;  3F3Q A;  3VPT A;  2ALB A;  3DVX A;  3UVH A;  1XOA A;  5EL8 A;  2C3Q A;  1QQ2 A;  4N11 A;  4GWR A;  4KDX A;  3J7Y k;  1MDK A;  4LL1 B;  4HZ2 A;  4MF5 A;  5IMD A;  4KDU A;  2C0G A;  4N0V A;  3ZRD A;  1GLQ A;  3HJO A;  2JAC A;  4E8E A;  4QQ7 A;  2ON7 A;  5JWQ B;  3FR9 A;  1NSW A;  1TRU A;  4Q5N A;  4NV2 A;  2YJH A;  1TKD B;  2HSY A;  4FIW A;  1X9M B;  3QAW A;  4HJ2 A;  5IO2 A;  4PUA A;  1TK8 B;  1K3O A;  4ECI A;  2IFQ A;  2OA7 A;  2H1D A;  2I3Y A;  1J08 A;  2HLS A;  1T7P B;  4MK3 A;  1H4O A;  4ML1 A;  3M0F A;  1WIK A;  4RUV A;  1FW1 A;  1EOH A;  4MMM A;  3QAG A;  2LKU A;  1M9A A;  4FH8 A;  4POK A;  1YF1 A;  3ZIT A;  4BWQ A;  3TKR A;  1V40 A;  7GSS A;  5KN0 A;  3LOR A;  4IP1 A;  1GSE A;  2REM A;  1HYU A;  2OE3 A;  1SKR B;  17GS A;  1SK2 A;  3L9S A;  4GQC A;  4OWY A;  3NIV A;  4F82 A;  1NW2 A;  3ZVJ D;  1T4Z A;  2CQ9 A;  3NOF A;  3MNG A;  1XVW A;  4CDO A;  2LRC A;  1TU8 A;  5GAP D;  1K0A A;  1QK8 A;  1SK1 A;  1THO A;  3EWL A;  2X99 A;  3EIN A;  2C0F A;  4ZL8 A;  1ZZY A;  3GV1 A;  3F6F A;  2DJ2 A;  4DSR A;  4XRD A;  4ZIL A;  1JZR A;  2RUE A;  4TRX A;  2C3N A;  2QSI A;  1IYH A;  1Y6E A;  3HD5 A;  1T1V A;  3UAP A;  2HYX A;  1OKD A;  3Q74 A;  1AC1 A;  2FLS A;  8GSS A;  4TKY A;  3VWV A;  5JCW A;  3ZMK A;  2M46 A;  1FG4 A;  1G7E A;  1J0F A;  3GUS A;  1CQH A;  6GSX A;  1M7T A;  2WZ9 A;  1X5C A;  4RI7 A;  4Q5R A;  2DML A;  2AJQ B;  2NVL A;  3IXR A;  5CAX A;  2WRT A;  4L5O A;  1XZO A;  4ZBD A;  5CRH A;  5G5F A;  3GYK A;  1PN9 A;  5LNK e;  2DJ3 A;  2H01 A;  2A2R A;  1TK0 B;  1WPI A;  1ZYQ B;  4FYU A;  2CAI A;  1ZYE A;  3APS A;  3GA4 A;  4O92 A;  1Y25 A;  3GX0 A;  5J5N A;  3HVX A;  2GDR A;  3P2A A;  4WXT A;  2PER A;  5HR0 A;  4G19 A;  1VGL A;  2CZ2 A;  2GT5 A;  3LYK A;  2H0G A;  2BMX A;  3WT1 A;  2L5L A;  5IPG A;  3UBL A;  3TCO A;  2DMM A;  1X0R A;  3LSZ A;  2VLU A;  2LRN A;  4BVY A;  4GCI A;  2I9H A;  4KH7 A;  4P3Y B;  3ZRE A;  2JZR A;  4EUY A;  4IW9 A;  3TRP A;  1VF4 A;  2V6O A;  3GL3 A;  2OAD A;  5COH A;  2F9S A;  3H4K A;  1GTU A;  1X9S B;  1HNA A;  4IN0 A;  1F37 A;  1YY7 A;  5ELG A;  2X8H A;  2VL3 A;  1XXU A;  4RQX A;  1O81 A;  2KLX A;  4PQH A;  2GSS A;  5KEJ A;  2EC4 A;  2OAC A;  2IL3 A;  4OMV A;  2NPB A;  3GST A;  1HNB A;  4NXI A;  2QC7 A;  3H8Q A;  3C71 A;  5H5R A;  1B48 A;  2IWT A;  3GTU B;  2YWM A;  1FB6 A;  4JBB A;  4G2E A;  4NHW A;  1TRW A;  5CO3 A;  3TGZ A;  4N30 A;  2P31 A;  3HA9 A;  1EZK A;  1EGO A;  1U3I A;  3PR8 A;  5KN1 A;  4D73 A;  4TR0 A;  4MJC A;  5HFK A;  1Z6N A;  5CNW A;  2N5A A;  3D6I A;  1TU7 A;  1K0M A;  1O73 A;  3D0Z A;  3UIW A;  2WFC A;  2VM2 A;  3HVS A;  1AQX A;  3EU4 A;  2KP2 A;  4WBR D;  12GS A;  3Q6O A;  1UN2 A;  1GLP A;  4FO5 A;  5G1L A;  3KIJ A;  1K0N A;  1R26 A;  2GLR A;  1GSD A;  3PGT A;  4EC0 A;  1GNE A;  3TKS E;  2LJR A;  3G9B A;  1NM3 A;  1UVZ A;  2ZCT A;  4ML6 A;  1U6T A;  5CRW A;  1K0D A;  2VD0 A;  2QGV A;  4CHS A;  2GQL A;  1MDI A;  4KA0 A;  4MP4 A;  2MYG A;  3W8J A;  2KOK A;  4MPF A;  2E2M A;  3LEF A;  4TN8 A;  1GTA A;  5CRD A;  1ZMA A;  5J4U A;  1SYR A;  3KP9 A;  2K6V A;  3F8U A;  1NHO A;  2AV4 A;  2TRC P;  3DGQ A;  2H1B A;  3F63 A;  1EOG A;  3RDW A;  4F2I A;  1A8Y A;  2YAN A;  2YV9 A;  3IK9 A;  3CMI A;  4K7I A;  1A2M A;  2PMT A;  1EP7 A;  3BJ5 A;  3E3E A;  4CW9 A;  3GMF A;  4POL A;  3GNJ A;  4QL7 A;  3M9J A;  3UEM A;  3GH9 A;  4TR1 B;  2DJJ A;  3HXS A;  4KDY A;  1ML6 A;  2MBT A;  3F6D A;  3LG6 A;  4WF5 A;  5IM9 A;  4BA7 A;  3D21 A;  4KAE A;  3IDV A;  4GQF A;  5FT3 A;  2RUF A;  1W89 A;  3HJM A;  1G7O A;  3FK8 A;  1F2E A;  4OCF A;  2E2G A;  4EDZ A;  3RHB A;  3EC3 A;  4OFN A;  4MJE A;  3F3R A;  5AIS A;  4OCE A;  1IYI A;  3C73 A;  3CSH A;  3D22 A;  2O85 A;  3F9U A;  2HT9 A;  5DAK A;  2HNL A;  2L59 A;  4TW5 A;  4JZQ A;  4MZB A;  4YQM A;  2L57 A;  2GSQ A; 
#chains in the Genus database with same CATH topology
 5F05 A;  3C8E A;  5C04 A;  5JCU A;  3V1W A;  3CRT A;  5IOX A;  2XPE A;  2LTK A;  5HR1 A;  2IFQ B;  4GTU A;  4PXO A;  4POB A;  1V9W A;  5GAN D;  2LQO A;  1DBY A;  4LL4 B;  3GKX A;  1TI1 A;  1XBS A;  5ECR B;  3I6A A;  4JR4 A;  2C1Y A;  4WR4 A;  4CY6 A;  1B9Y C;  3ERG A;  1ERT A;  5KN3 A;  2B6M A;  6GSU A;  1F6M C;  3FRC A;  3IPZ A;  3RHC A;  2CZ3 A;  2XBI A;  4PX1 A;  3GFK A;  5D93 A;  2C0E A;  3FY7 A;  4G9H A;  5INY A;  2DC5 A;  2VLT A;  3KXO A;  5GZZ B;  1YKA A;  3ZML A;  2YPM A;  2VLV A;  4V2L A;  4MLY A;  2G0F A;  2NDO A;  1GRX A;  4KCA A;  4I6X A;  1ZOF A;  4KX4 A;  4ISD A;  1C72 A;  2YCD A;  3L4N A;  2J9H A;  2GZY A;  4IP6 A;  3QFA C;  3HJP A;  4ZXG A;  3ZYW A;  2AB6 A;  5HR3 A;  2H30 A;  1W4V A;  1ZL9 A;  3ZIV A;  4HU7 A;  4OD7 A;  5G1K A;  4WEY A;  1BYE A;  2YWN A;  5EY6 A;  4ECB A;  1GUM A;  3LQ7 A;  11GS A;  2PPT A;  1A2L A;  1EV9 A;  5LCZ A;  2UZ8 A;  4TR1 A;  2K9F A;  1N2A A;  4O5U A;  2I1U A;  4O32 A;  2F8F A;  2MMA A;  1PSQ A;  1MD3 A;  1O85 A;  6GSV A;  5L71 A;  5F8B A;  3UVT A;  1K0C A;  1GSS A;  3E9J B;  2H73 A;  3I9V 2;  1VF1 A;  2VL9 A;  2HZE B;  1R5P A;  1XIY A;  4OFT A;  5IMA A;  1RK4 A;  1TP9 A;  3EVI A;  2DJ0 A;  3KP8 A;  4X0X A;  3F4T A;  3TJK A;  10GS A;  2HE3 A;  3QAV A;  2A2S A;  4PQI A;  2QA2 A;  1FO5 A;  4DVC A;  3US3 A;  1Z6M A;  2JAD A;  4AJ7 A;  2ZNM A;  1DSB A;  4TXO B;  4L0W A;  3CTF A;  1SU9 A;  2H71 A;  1OVN A;  2HFD A;  2PVQ A;  3BCI A;  4NMU A;  6GSS A;  2C4J A;  3WGE A;  5ECH B;  1AXD A;  3ERF A;  4JRR A;  3TRX A;  3A3T A;  1AUC A;  2FD3 A;  4XHM A;  2VCX A;  4I2U A;  3CYN A;  1Z7P A;  2YNX A;  4PUR A;  1KNG A;  2AYT A;  1TRV A;  4LMV A;  1XWA A;  3HZ8 A;  3N5O A;  1OAZ A;  4J57 E;  1GUK A;  3GHA A;  1ERW A;  3VWW A;  5LD0 A;  1GUL A;  1Z3E A;  2IIY A;  2LNS A;  2F3M A;  2K8V A;  3ISO A;  4G10 A;  4HI7 A;  4BL7 B;  1OYJ A;  1SYX A;  2EIO A;  5J41 A;  4HS1 A;  4XTS A;  2JSZ A;  2CT6 A;  2YWI A;  1JZW A;  3D5J A;  1OE8 A;  4HZ4 A;  1I9D A;  3WGX A;  1PD2 1;  5ELA A;  3DIE A;  4ZBB A;  5ECM B;  3DVW A;  4IJ3 A;  4KGI A;  1XWB A;  1G6W A;  1XWC A;  1SL0 B;  3A2V A;  2M80 A;  1LBK A;  4ZBA A;  3IA1 A;  3OR5 A;  3DEX A;  4DSQ A;  2RM6 A;  4D73 B;  3CXG A;  2JZS A;  1G6Y A;  2FWE A;  4WBJ A;  4IS0 A;  2H74 A;  2BTO T;  4MZC A;  5IPH A;  4XIH A;  5DVB A;  5D9V A;  5AIX A;  5DCH A;  3VPQ A;  1R5A A;  2OE0 A;  3IRA A;  2MMO A;  2H66 A;  2GZZ A;  2HZE A;  4PTS A;  5DAL B;  3KMN A;  3RBT A;  4Z2T A;  2PBJ A;  4PNG A;  2EIQ A;  1YZX A;  3KM6 A;  3P7X A;  3L0H A;  5ECQ B;  3SWL A;  5AGY A;  3CSI A;  3I43 A;  3VI7 A;  1F3B A;  2P5R A;  1B8X A;  4TXO A;  4NHZ A;  5IOW A;  2DIZ A;  2WUL A;  4YAV A;  2P0G A;  2AAW A;  2RM5 A;  3DYR A;  4WR5 A;  1ERU A;  3ZVJ A;  4F9Z A;  1S3D A;  1XPV A;  1PKZ A;  1FAA A;  5B8A A;  3IOS A;  3VK9 A;  5IMZ A;  3P90 A;  3QOU A;  1GSQ A;  2FUG 2;  2TIR A;  2L6C A;  3S9F A;  1H75 A;  4EO3 A;  4MCU A;  4QL9 A;  2YOI A;  2I4A A;  3DD3 A;  4X43 A;  4HOJ A;  5HR2 A;  2VCT A;  1S3C A;  4BL7 A;  2X8C A;  3TKQ A;  2IN3 A;  3WT2 A;  2PWJ A;  5KN2 A;  4YKG A;  5D8I A;  1TI3 A;  1JFU A;  4HJM A;  2HSM A;  2H76 A;  4KSM A;  5G2Z A;  3ZL5 A;  4J2F A;  3GKK A;  4XS4 A;  5DAK B;  3VLN A;  4K0G A;  1JZD A;  2VAF A;  2R6K A;  4WKW A;  1KTE A;  5IMF A;  1GSU A;  1ACV A;  4MJA A;  2GQK A;  1AQW A;  3LJR A;  3IAM 2;  4K9Z A;  2LUS A;  1QUW A;  4XS1 A;  3R2Q A;  4WET A;  1SKW B;  1MTC A;  5DBQ A;  5CRG A;  3FR3 A;  4N0Z A;  2O89 A;  2HXK A;  2JU5 A;  3CSJ A;  2YV7 A;  4K6X A;  4K5R A;  2OBK A;  3A5I A;  4MAB A;  3RPP A;  4O5R A;  1O7U A;  4MNN A;  4FQU A;  2B5Y A;  2LJK A;  2AHE A;  4ZB6 A;  4IVF A;  3IE3 A;  2OJL A;  2DSA A;  4PQ1 A;  5DAL A;  1ABA A;  3I69 A;  1PL1 A;  1OC9 B;  2V41 A;  3KH7 A;  4IQ1 A;  2GQM A;  3VWU A;  1PGT A;  4RI6 A;  2FY6 A;  1V57 A;  4HSC X;  2H6X A;  2KUC A;  1B9X C;  2H0I A;  3IAS 2;  4XCS A;  1T3B A;  4H86 A;  2C80 A;  1MEK A;  1A23 A;  2H6Y A;  4IJI A;  3TUE A;  5E59 A;  3H93 A;  4GSS A;  2YN1 A;  4ZIJ A;  4AF2 A;  2FA4 A;  4TVE A;  4AGS A;  1JZO A;  1BAY A;  1ON4 A;  4IEL A;  2FWF A;  2H1G A;  5AIV A;  5B8B A;  2VM1 A;  1YDK A;  2V2G A;  3IV4 A;  1PMT A;  2VUP A;  1HNC A;  3TOU A;  1XVQ A;  4G0L A;  1GTI A;  2FCH A;  3ED3 A;  1XWK A;  5HFG A;  4YAP A;  1FVK A;  4EE0 A;  1XWG A;  5JWO B;  1ILO A;  2E7P A;  2C8U A;  2H19 A;  3KGK A;  1XOB A;  3TKS A;  5IQY A;  3LWA A;  3D4M A;  2IPA A;  1GTB A;  1TJD A;  2HRA A;  5D9W A;  4BIK A;  1GL8 A;  2VL2 A;  4OO4 A;  1TTZ A;  3C1S A;  3AY8 A;  2L4Q A;  5FWG A;  2DKI A;  1UA5 A;  1I5G A;  4I97 A;  1MDJ A;  2VO4 A;  1Z7R A;  2B1K A;  4TR4 A;  2YJ7 A;  2HI7 A;  1XW5 A;  2IJY A;  3G7J A;  3KD0 A;  4KW6 A;  1VF2 A;  3UOM A;  2OE1 A;  4V1A g;  3BBY A;  3EE2 A;  2YZU A;  5A4W A;  2JZT A;  4EDY A;  3D4T A;  3CQF A;  2K18 A;  1YQ1 A;  3ME8 A;  2VCW A;  3ZZX A;  3HY2 A;  1A24 A;  9GSS A;  4F0B A;  2KHP A;  4ULX A;  4K1F A;  2LV3 A;  3C1R A;  2NBS A;  1K3L A;  1SD8 A;  3IK7 A;  1X9W B;  1PKW A;  2GS3 A;  2YP6 A;  3TJB A;  2OKA A;  4YQU A;  3MAK A;  1O6J A;  1EGR A;  2CVD A;  1OC9 A;  1QXH A;  4BWS A;  5J3R A;  3HCZ A;  2MMZ A;  1SKS B;  4FYB A;  1AIU A;  1LU4 A;  3APO A;  4JED A;  1RQM A;  1WOU A;  1URM A;  3DWV A;  4N10 A;  2B5X A;  2PGT A;  3GKM A;  3ERW A;  1A2J A;  2CV4 A;  4MH3 A;  2WS2 A;  2TRX A;  1AAZ A;  2AUV A;  3LGC A;  3TKP A;  2X8G A;  3FHK A;  4GST A;  2HRN A;  1M3I A;  2LRT A;  4RQR A;  1O8W A;  3ZLP A;  1PFO A;  4IQA A;  4J56 E;  1VRS D;  4HQS A;  4ILF A;  4G0K A;  3W8S A;  2FWG A;  2PUK C;  2GGT A;  4V1A p;  4V2N A;  1SJI A;  4PUF C;  4ECJ A;  1HD2 A;  1ZYP A;  2B5E A;  1USB A;  1E2Y A;  4ZB9 A;  4L0U A;  4DSS A;  1JLV A;  2PN8 A;  4K2X A;  19GS A;  1KEB A;  3EUR A;  5D9T A;  3FZA A;  1FOV A;  3MSZ A;  4E8H A;  3IC8 A;  1THX A;  2DLX A;  1ST9 A;  1ZCP A;  3CRU A;  3P8W A;  2O87 A;  3FKF A;  1EEM A;  3TJJ A;  1X5D A;  2WCI A;  1QGV A;  4MPG A;  4EKZ A;  2CX4 A;  4NV5 A;  3GKN A;  1LJR A;  2C3T A;  5AN1 A;  3FZ4 A;  4PNF A;  4HQZ A;  5B6M A;  1PX6 A;  3EYT A;  1YEX A;  2IMF A;  1EWX A;  4EXJ A;  2YZH A;  4K7O A;  3TJG A;  2DBC A;  4GRF A;  3MWH A;  4EIQ A;  3FR6 A;  4JE1 A;  5JCG A;  1T8E B;  1EV4 A;  1DE1 A;  4V2M A;  3H1N A;  5A4U A;  4HEA 2;  3HZ4 A;  1O8X A;  1R4W A;  2KP1 A;  3WYW A;  3HYP A;  1DUG A;  5ECN B;  4GXZ A;  4I2T A;  1A8L A;  3L9U A;  5IIZ A;  4FYC A;  1TRS A;  1FVJ A;  3FW2 A;  5B6N A;  2F8A A;  3O6T A;  2GSR A;  1SJZ A;  5EPF A;  2CVB A;  5EVO A;  4MF7 A;  3G7I A;  2WJU A;  3DML A;  4L5L A;  4TR3 A;  3RPN A;  2EIR A;  1PRX A;  2CVK A;  2GVP A;  2XC2 A;  3N9J A;  4ECC A;  4MH2 A;  1SL2 B;  1K0B A;  1TK5 B;  4XS4 B;  2IME A;  3LXT A;  4GLT A;  3IHQ A;  5F06 A;  1EEJ A;  2VCZ A;  1ZGN A;  2B7J A;  4IKH A;  3UJ1 A;  3GRX A;  5CP1 A;  2NTO A;  5FHI A;  1YKC A;  1XW9 A;  3Q18 A;  5F0G A;  3GX8 A;  3TOT A;  20GS A;  1RW1 A;  4OO5 A;  3KH9 A;  6GST A;  1GP1 A;  5B7C A;  4KCE A;  2VCQ A;  2V1M A;  3G7Y A;  2R2J A;  3M9K A;  4HUA A;  2B7K A;  1XCC A;  2H1A A;  4KSO A;  4EVM A;  2JL4 A;  2DKH A;  3A2W A;  6GSY A;  2VD1 A;  2R37 A;  3VFI A;  1QFN A;  2JSY A;  4KND A;  2R4V A;  1PL2 A;  3GSS A;  3HKR A;  1HQO A;  3TJF A;  3EMX A;  1M2B A;  6GSW A;  2DJ1 A;  3FYG A;  4O5Q A;  1MD4 A;  4KUN A;  3F4R A;  4BPY A;  4X1U A;  1GWC A;  2I81 A;  1GSF A;  1WMJ A;  3UAR A;  13GS A;  3U6V A;  4HDE A;  5CRE A;  1U87 A;  4IGJ A;  1JLW A;  5ID2 B;  3DKS A;  3QPM A;  2H70 A;  1J9B A;  2LQQ A;  2N5B A;  5D96 A;  4F03 A;  3H79 A;  2H6Z A;  5D73 A;  2IMD A;  4A5P A;  1FOH A;  2B3S A;  3QCP A;  3TB2 A;  5G5E A;  2LST A;  3UL3 A;  4CY8 A;  5H5S A;  5DQY A;  1TXX A;  1SL1 B;  3A2X A;  1FHE A;  2HRK A;  3M3M A;  2HZF A;  3QR6 A;  3VI5 A;  1F3A A;  5DJL A;  3U5R E;  5GST A;  5JWR B;  1BJX A;  4GSN A;  5ECO B;  2B1L A;  2CA8 A;  1N8J A;  3F4S A;  2H72 A;  3EMP A;  2A2P A;  2X4A A;  5HQP A;  5D9X A;  5GSS A;  1JHB A;  22GS A;  1S3R A;  2L4C A;  3HHV A;  4EF0 A;  3KJY A;  5IO0 A;  3EU3 A;  1SJ6 A;  3IHG A;  1TDI A;  2IMI A;  1WP0 A;  2HRF A;  3KCM A;  3ZIJ A;  1M3J A;  1WJK A;  3ME7 A;  4KE3 A;  1YJ6 A;  4Z7X A;  1EP8 A;  1OE7 A;  2L6D A;  3PH9 A;  2WDU A;  2LEG A;  3FZ5 A;  4DEJ A;  1CQG A;  2GZP A;  2C0D A;  4I8B A;  3LW9 A;  4LMW A;  5G31 A;  3BCK A;  3F0I A;  2O8V B;  5HFI A;  4IHU A;  5BRT A;  2MMN A;  5DQS A;  1F9M A;  2XHF A;  1K3Y A;  2DJK A;  2X49 A;  5DCG A;  4XS6 A;  4TOP A;  1BED A;  3VWX A;  4NWY A;  1ERV A;  3IBH A;  3MDK A;  3PPU A;  2FWH A;  5ECS A;  4PGT A;  4MDC A;  1BX9 A;  4K2D A;  4MZW A;  3LXZ A;  4AJ8 A;  1OC3 A;  3FEU A;  4NAX A;  1X5E A;  2OBI A;  1SD9 A;  5ABR A;  1Z5Y E;  3GN3 A;  2RII A;  2HSH A;  3GL5 A;  3BD2 A;  5C00 A;  1U3A A;  1GH2 A;  2FA8 A;  2R3X A;  1ZYN A;  5ECI B;  4ID0 A;  4ICY A;  1YEP A;  2G2Q A;  2GTU A;  2QKE A;  4XRA A;  3WD6 A;  5ID2 A;  4NPB A;  3KZQ A;  1B4Q A;  1NHY A;  3ZFL A;  3VUR A;  1A0R P;  3LYP A;  4HU9 A;  3KMO A;  4KB3 A;  4ZB8 A;  4JU5 A;  1OC8 A;  2LNT A;  3QMX A;  3W6G A;  3QD9 A;  3TDG A;  4LLR A;  4K5S A;  1S3A A;  2Z9S A;  2MBS A;  2X64 A;  5H5Q A;  1AQV A;  4GF0 A;  2MZC A;  4WF4 A;  3CTG A;  3TKS C;  4X4J A;  1YF0 A;  4BVX B;  2L5O A;  1GUH A;  1WRY A;  18GS A;  2VL2 C;  3CBU A;  2LS5 A;  1G0T A;  1V2A A;  2CAQ A;  1V58 A;  3QDN A;  5ECL B;  3TRQ A;  1PA3 A;  2XBQ A;  2F51 A;  4DSS B;  4ACS A;  1DE2 A;  1WWJ A;  2BJX A;  4K0N A;  5ENU A;  3PIN A;  3HVV A;  1XFL A;  2WGR A;  1PQN A;  4TXV A;  5DDL A;  4F0C A;  3C7M A;  1R7H A;  1VF3 A;  4LA1 A;  3SBC A;  5F07 A;  1V98 A;  1E6B A;  4ZL9 A;  4IBP A;  2J23 A;  5ECK B;  1GNW A;  2P5Q A;  3Q19 A;  3E0U A;  5G30 A;  1TOF A;  4Q5Q A;  1OKT A;  2V6K A;  2WB9 A;  1XW6 A;  1TW9 A;  4YQV A;  2H0H A;  1T4Y A;  2N5F A;  3GTU A;  3DXB A;  2CX3 A;  5ECP B;  1M9B A;  2V32 A;  2D2Z A;  4MA9 A;  2RLI A;  4MJB A;  3KTB A;  2DIY A;  3KEB A;  3K8N A;  4OFM A;  1QMV A;  3KTL A;  3ZTL A;  2IMK A;  2E0Q A;  3ZFB A;  2YWO A;  3JCM L;  2GT6 A;  3RAZ A;  4EIP A;  1M99 A;  2H8L A;  1A0F A;  3GIX A;  2ZUP A;  2K8S A;  2R5G A;  2FGX A;  2XPD A;  2M72 A;  1FB0 A;  1BG5 A;  3QFB C;  3J7Y b;  1M0U A;  2VIM A;  3O76 A;  3UMA A;  3L78 A;  3M1G A;  1SEN A;  4AJ6 A;  2A4V A;  4K8M A;  3WGD A;  1T00 A;  2PU9 C;  4YH2 A;  1M2A A;  3A5W A;  2VOC A;  1WE0 A;  1Q4J A;  5J9B A;  4POM A;  3FZ9 A;  3LFL A;  4KF9 A;  3IC4 A;  4ZL7 A;  5A5K A;  2O7K A;  2ON5 A;  1B4P A;  2A4H A;  5CYY A;  4O7H A;  3O3T A;  16GS A;  1BQ7 A;  2PVO C;  1KBN A;  5A4V A;  4BVX A;  4L8E A;  1Q98 A;  3GUR A;  3HDC A;  1K0O A;  5E4W A;  4EL1 A;  4K7N A;  14GS A;  1UC7 A;  5IMV A;  1PN0 A;  2ES7 A;  5DJM A;  5KOX A;  4MF6 A;  2GST A;  3GH6 A;  4I5Q A;  3L9V A;  2H75 A;  5IMC A;  4JR6 A;  3UBK A;  5BMU A;  3DRN A;  1AW9 A;  2FNO A;  2LJA A;  3NZN A;  1SK0 A;  1GSY A;  1U88 A;  3APQ A;  3BOA A;  3M8N A;  1PX7 A;  4Q5F A;  3IR4 A;  5J9C A;  1M2D A;  1Z9H A;  2VCV A;  2FHE A;  3F3Q A;  3VPT A;  2ALB A;  3DVX A;  3UVH A;  1XOA A;  3HVN A;  5EL8 A;  1XG8 A;  2C3Q A;  1QQ2 A;  4N11 A;  4GWR A;  4KDX A;  3J7Y k;  3R3E A;  1MDK A;  4LL1 B;  4HZ2 A;  4MF5 A;  5IMD A;  4KDU A;  2C0G A;  4N0V A;  3ZRD A;  1GLQ A;  3HJO A;  2JAC A;  4E8E A;  4QQ7 A;  2ON7 A;  5JWQ B;  3FR9 A;  1NSW A;  1TRU A;  4Q5N A;  4NV2 A;  2YJH A;  1TKD B;  2HSY A;  4FIW A;  1X9M B;  3QAW A;  4HJ2 A;  5IO2 A;  4PUA A;  1TK8 B;  1K3O A;  4ECI A;  2IFQ A;  2OA7 A;  2H1D A;  2I3Y A;  1J08 A;  2HLS A;  1T7P B;  4MK3 A;  1H4O A;  4ML1 A;  3M0F A;  1WIK A;  4RUV A;  1FW1 A;  1EOH A;  4MMM A;  3QAG A;  3EPT A;  2R0G A;  2LKU A;  1M9A A;  4FH8 A;  4USS A;  4BVY B;  4POK A;  1YF1 A;  3ZIT A;  4BWQ A;  3TKR A;  1V40 A;  7GSS A;  5KN0 A;  3LOR A;  4IP1 A;  1GSE A;  2REM A;  1HYU A;  2OE3 A;  1SKR B;  17GS A;  1SK2 A;  3L9S A;  4GQC A;  4OWY A;  3NIV A;  4F82 A;  1NW2 A;  3ZVJ D;  1T4Z A;  2CQ9 A;  3NOF A;  3MNG A;  1XVW A;  4CDO A;  2LRC A;  1TU8 A;  5GAP D;  1K0A A;  1QK8 A;  1SK1 A;  1THO A;  3EWL A;  2X99 A;  3EIN A;  2C0F A;  4ZL8 A;  1ZZY A;  3GV1 A;  3F6F A;  2DJ2 A;  4DSR A;  4XRD A;  4ZIL A;  1JZR A;  2RUE A;  4TRX A;  2C3N A;  2QSI A;  1IYH A;  1Y6E A;  3HD5 A;  1T1V A;  3UAP A;  2HYX A;  1OKD A;  3Q74 A;  1AC1 A;  2FLS A;  8GSS A;  4TKY A;  3VWV A;  5JCW A;  3ZMK A;  2M46 A;  1FG4 A;  1G7E A;  1J0F A;  3GUS A;  1CQH A;  6GSX A;  1M7T A;  2WZ9 A;  1X5C A;  4RI7 A;  4Q5R A;  2DML A;  2AJQ B;  2NVL A;  3IXR A;  5CAX A;  2WRT A;  4L5O A;  2QA1 A;  1XZO A;  4ZBD A;  5CRH A;  5G5F A;  3GYK A;  1PN9 A;  5LNK e;  2DJ3 A;  2H01 A;  2A2R A;  1TK0 B;  1WPI A;  1ZYQ B;  4FYU A;  2CAI A;  1ZYE A;  3APS A;  3GA4 A;  4O92 A;  1Y25 A;  3GX0 A;  5J5N A;  3HVX A;  2GDR A;  3P2A A;  4WXT A;  2PER A;  5HR0 A;  4G19 A;  1VGL A;  2CZ2 A;  2GT5 A;  3LYK A;  2H0G A;  2BMX A;  3WT1 A;  2L5L A;  5IPG A;  3UBL A;  3TCO A;  2DMM A;  5KOW A;  1X0R A;  3LSZ A;  2R0P A;  2VLU A;  2LRN A;  4BVY A;  4GCI A;  2I9H A;  4KH7 A;  4P3Y B;  3ZRE A;  2JZR A;  4EUY A;  3MIX A;  4IW9 A;  3TRP A;  1VF4 A;  2V6O A;  3GL3 A;  2OAD A;  5COH A;  2F9S A;  3H4K A;  1GTU A;  1X9S B;  1HNA A;  4IN0 A;  1F37 A;  1YY7 A;  5ELG A;  2X8H A;  2VL3 A;  1XXU A;  4RQX A;  1O81 A;  2KLX A;  4PQH A;  2GSS A;  5KEJ A;  2EC4 A;  2OAC A;  2IL3 A;  4OMV A;  2NPB A;  3GST A;  1HNB A;  4NXI A;  2QC7 A;  3H8Q A;  3C71 A;  5H5R A;  1B48 A;  2IWT A;  4Z2R A;  3GTU B;  2YWM A;  1FB6 A;  4JBB A;  4G2E A;  4NHW A;  1TRW A;  5CO3 A;  3TGZ A;  4N30 A;  2P31 A;  3HA9 A;  1EZK A;  1EGO A;  1U3I A;  3PR8 A;  5KN1 A;  4D73 A;  4TR0 A;  4MJC A;  5HFK A;  3MYD A;  1Z6N A;  5CNW A;  2N5A A;  3D6I A;  1TU7 A;  1K0M A;  1O73 A;  3D0Z A;  3UIW A;  2WFC A;  2VM2 A;  3HVS A;  1AQX A;  3EU4 A;  2KP2 A;  4WBR D;  12GS A;  3Q6O A;  1UN2 A;  1GLP A;  4FO5 A;  5G1L A;  3KIJ A;  1K0N A;  1R26 A;  2GLR A;  4Z2U A;  1GSD A;  3PGT A;  4EC0 A;  1GNE A;  3TKS E;  2LJR A;  3G9B A;  1NM3 A;  1UVZ A;  2ZCT A;  4ML6 A;  1U6T A;  5CRW A;  1K0D A;  2VD0 A;  2QGV A;  4CHS A;  2GQL A;  1MDI A;  4KA0 A;  4MP4 A;  2MYG A;  3W8J A;  2KOK A;  4MPF A;  2E2M A;  3LEF A;  4TN8 A;  1GTA A;  5CRD A;  1ZMA A;  5J4U A;  1SYR A;  3KP9 A;  2K6V A;  3F8U A;  1NHO A;  2AV4 A;  2TRC P;  3DGQ A;  2H1B A;  3F63 A;  1EOG A;  3RDW A;  4F2I A;  1A8Y A;  2YAN A;  2YV9 A;  3IK9 A;  3CMI A;  4K7I A;  1A2M A;  2PMT A;  1EP7 A;  3BJ5 A;  3E3E A;  4CW9 A;  3GMF A;  4POL A;  3GNJ A;  4QL7 A;  2R0C A;  3M9J A;  3UEM A;  3GH9 A;  4TR1 B;  2DJJ A;  3HXS A;  4KDY A;  1ML6 A;  2MBT A;  3F6D A;  3LG6 A;  4WF5 A;  5IM9 A;  3FMW A;  4BA7 A;  3D21 A;  4KAE A;  3IDV A;  4GQF A;  5FT3 A;  2RUF A;  1W89 A;  3HJM A;  1G7O A;  3FK8 A;  1F2E A;  4OCF A;  2E2G A;  4EDZ A;  3RHB A;  3EC3 A;  4OFN A;  4MJE A;  3F3R A;  5AIS A;  4OCE A;  1IYI A;  3C73 A;  3CSH A;  3D22 A;  4YKF A;  2O85 A;  3F9U A;  2HT9 A;  5DAK A;  2HNL A;  2L59 A;  4TW5 A;  4JZQ A;  4MZB A;  4YQM A;  4G0I A;  2L57 A;  2GSQ A; 
#chains in the Genus database with same CATH homology
 5F05 A;  3C8E A;  5C04 A;  5JCU A;  3V1W A;  3CRT A;  5IOX A;  2XPE A;  2LTK A;  5HR1 A;  2IFQ B;  4GTU A;  4PXO A;  4POB A;  1V9W A;  5GAN D;  2LQO A;  1DBY A;  4LL4 B;  3GKX A;  1TI1 A;  1XBS A;  5ECR B;  3I6A A;  4JR4 A;  2C1Y A;  4WR4 A;  4CY6 A;  1B9Y C;  3ERG A;  1ERT A;  5KN3 A;  2B6M A;  6GSU A;  1F6M C;  3FRC A;  3IPZ A;  3RHC A;  2CZ3 A;  2XBI A;  4PX1 A;  3GFK A;  5D93 A;  2C0E A;  3FY7 A;  4G9H A;  5INY A;  2DC5 A;  2VLT A;  3KXO A;  5GZZ B;  1YKA A;  3ZML A;  2YPM A;  2VLV A;  4V2L A;  4MLY A;  2G0F A;  2NDO A;  1GRX A;  4KCA A;  4I6X A;  1ZOF A;  4KX4 A;  4ISD A;  1C72 A;  2YCD A;  3L4N A;  2J9H A;  2GZY A;  4IP6 A;  3QFA C;  3HJP A;  4ZXG A;  3ZYW A;  2AB6 A;  5HR3 A;  2H30 A;  1W4V A;  1ZL9 A;  3ZIV A;  4HU7 A;  4OD7 A;  5G1K A;  4WEY A;  1BYE A;  2YWN A;  5EY6 A;  4ECB A;  1GUM A;  3LQ7 A;  11GS A;  2PPT A;  1A2L A;  1EV9 A;  5LCZ A;  2UZ8 A;  4TR1 A;  2K9F A;  1N2A A;  4O5U A;  2I1U A;  4O32 A;  2F8F A;  2MMA A;  1PSQ A;  1MD3 A;  1O85 A;  6GSV A;  5L71 A;  5F8B A;  3UVT A;  1K0C A;  1GSS A;  3E9J B;  2H73 A;  3I9V 2;  1VF1 A;  2VL9 A;  2HZE B;  1R5P A;  1XIY A;  4OFT A;  5IMA A;  1RK4 A;  1TP9 A;  3EVI A;  2DJ0 A;  3KP8 A;  4X0X A;  3F4T A;  3TJK A;  10GS A;  2HE3 A;  3QAV A;  2A2S A;  4PQI A;  2QA2 A;  1FO5 A;  4DVC A;  3US3 A;  1Z6M A;  2JAD A;  4AJ7 A;  2ZNM A;  1DSB A;  4TXO B;  4L0W A;  3CTF A;  1SU9 A;  2H71 A;  1OVN A;  2HFD A;  2PVQ A;  3BCI A;  4NMU A;  6GSS A;  2C4J A;  3WGE A;  5ECH B;  1AXD A;  3ERF A;  4JRR A;  3TRX A;  3A3T A;  1AUC A;  2FD3 A;  4XHM A;  2VCX A;  4I2U A;  3CYN A;  1Z7P A;  2YNX A;  4PUR A;  1KNG A;  2AYT A;  1TRV A;  4LMV A;  1XWA A;  3HZ8 A;  3N5O A;  1OAZ A;  4J57 E;  1GUK A;  3GHA A;  1ERW A;  3VWW A;  5LD0 A;  1GUL A;  1Z3E A;  2IIY A;  2LNS A;  2F3M A;  2K8V A;  3ISO A;  4G10 A;  4HI7 A;  4BL7 B;  1OYJ A;  1SYX A;  2EIO A;  5J41 A;  4HS1 A;  4XTS A;  2JSZ A;  2CT6 A;  2YWI A;  1JZW A;  3D5J A;  1OE8 A;  4HZ4 A;  1I9D A;  3WGX A;  1PD2 1;  5ELA A;  3DIE A;  4ZBB A;  5ECM B;  3DVW A;  4IJ3 A;  4KGI A;  1XWB A;  1G6W A;  1XWC A;  1SL0 B;  3A2V A;  2M80 A;  1LBK A;  4ZBA A;  3IA1 A;  3OR5 A;  3DEX A;  4DSQ A;  2RM6 A;  4D73 B;  3CXG A;  2JZS A;  1G6Y A;  2FWE A;  4WBJ A;  4IS0 A;  2H74 A;  2BTO T;  4MZC A;  5IPH A;  4XIH A;  5DVB A;  5D9V A;  5AIX A;  5DCH A;  3VPQ A;  1R5A A;  2OE0 A;  3IRA A;  2MMO A;  2H66 A;  2GZZ A;  2HZE A;  4PTS A;  5DAL B;  3KMN A;  3RBT A;  4Z2T A;  2PBJ A;  4PNG A;  2EIQ A;  1YZX A;  3KM6 A;  3P7X A;  3L0H A;  5ECQ B;  3SWL A;  5AGY A;  3CSI A;  3I43 A;  3VI7 A;  1F3B A;  2P5R A;  1B8X A;  4TXO A;  4NHZ A;  5IOW A;  2DIZ A;  2WUL A;  4YAV A;  2P0G A;  2AAW A;  2RM5 A;  3DYR A;  4WR5 A;  1ERU A;  3ZVJ A;  4F9Z A;  1S3D A;  1XPV A;  1PKZ A;  1FAA A;  5B8A A;  3IOS A;  3VK9 A;  5IMZ A;  3P90 A;  3QOU A;  1GSQ A;  2FUG 2;  2TIR A;  2L6C A;  3S9F A;  1H75 A;  4EO3 A;  4MCU A;  4QL9 A;  2YOI A;  2I4A A;  3DD3 A;  4X43 A;  4HOJ A;  5HR2 A;  2VCT A;  1S3C A;  4BL7 A;  2X8C A;  3TKQ A;  2IN3 A;  3WT2 A;  2PWJ A;  5KN2 A;  4YKG A;  5D8I A;  1TI3 A;  1JFU A;  4HJM A;  2HSM A;  2H76 A;  4KSM A;  5G2Z A;  3ZL5 A;  4J2F A;  3GKK A;  4XS4 A;  5DAK B;  3VLN A;  4K0G A;  1JZD A;  2VAF A;  2R6K A;  4WKW A;  1KTE A;  5IMF A;  1GSU A;  1ACV A;  4MJA A;  2GQK A;  1AQW A;  3LJR A;  3IAM 2;  4K9Z A;  2LUS A;  1QUW A;  4XS1 A;  3R2Q A;  4WET A;  1SKW B;  1MTC A;  5DBQ A;  5CRG A;  3FR3 A;  4N0Z A;  2O89 A;  2HXK A;  2JU5 A;  3CSJ A;  2YV7 A;  4K6X A;  4K5R A;  2OBK A;  3A5I A;  4MAB A;  3RPP A;  4O5R A;  1O7U A;  4MNN A;  4FQU A;  2B5Y A;  2LJK A;  2AHE A;  4ZB6 A;  4IVF A;  3IE3 A;  2OJL A;  2DSA A;  4PQ1 A;  5DAL A;  1ABA A;  3I69 A;  1PL1 A;  1OC9 B;  2V41 A;  3KH7 A;  4IQ1 A;  2GQM A;  3VWU A;  1PGT A;  4RI6 A;  2FY6 A;  1V57 A;  2H6X A;  2KUC A;  1B9X C;  2H0I A;  3IAS 2;  4XCS A;  1T3B A;  4H86 A;  2C80 A;  1MEK A;  1A23 A;  2H6Y A;  4IJI A;  3TUE A;  5E59 A;  3H93 A;  4GSS A;  2YN1 A;  4ZIJ A;  4AF2 A;  2FA4 A;  4TVE A;  4AGS A;  1JZO A;  1BAY A;  1ON4 A;  4IEL A;  2FWF A;  2H1G A;  5AIV A;  5B8B A;  2VM1 A;  1YDK A;  2V2G A;  3IV4 A;  1PMT A;  2VUP A;  1HNC A;  3TOU A;  1XVQ A;  4G0L A;  1GTI A;  2FCH A;  3ED3 A;  1XWK A;  5HFG A;  4YAP A;  1FVK A;  4EE0 A;  1XWG A;  5JWO B;  1ILO A;  2E7P A;  2C8U A;  2H19 A;  3KGK A;  1XOB A;  3TKS A;  5IQY A;  3LWA A;  3D4M A;  2IPA A;  1GTB A;  1TJD A;  2HRA A;  5D9W A;  1GL8 A;  2VL2 A;  4OO4 A;  1TTZ A;  3C1S A;  3AY8 A;  2L4Q A;  5FWG A;  2DKI A;  1UA5 A;  1I5G A;  4I97 A;  1MDJ A;  2VO4 A;  1Z7R A;  2B1K A;  4TR4 A;  2YJ7 A;  2HI7 A;  1XW5 A;  2IJY A;  3G7J A;  3KD0 A;  4KW6 A;  1VF2 A;  3UOM A;  2OE1 A;  4V1A g;  3BBY A;  3EE2 A;  2YZU A;  5A4W A;  2JZT A;  4EDY A;  3D4T A;  2K18 A;  1YQ1 A;  3ME8 A;  2VCW A;  3ZZX A;  3HY2 A;  1A24 A;  9GSS A;  4F0B A;  2KHP A;  4ULX A;  4K1F A;  2LV3 A;  3C1R A;  2NBS A;  1K3L A;  1SD8 A;  3IK7 A;  1X9W B;  1PKW A;  2GS3 A;  2YP6 A;  3TJB A;  2OKA A;  4YQU A;  3MAK A;  1O6J A;  1EGR A;  2CVD A;  1OC9 A;  1QXH A;  4BWS A;  5J3R A;  3HCZ A;  2MMZ A;  1SKS B;  4FYB A;  1AIU A;  1LU4 A;  3APO A;  4JED A;  1RQM A;  1WOU A;  1URM A;  3DWV A;  4N10 A;  2B5X A;  2PGT A;  3GKM A;  3ERW A;  1A2J A;  2CV4 A;  4MH3 A;  2WS2 A;  2TRX A;  1AAZ A;  2AUV A;  3LGC A;  3TKP A;  2X8G A;  3FHK A;  4GST A;  2HRN A;  2LRT A;  4RQR A;  1O8W A;  3ZLP A;  4IQA A;  4J56 E;  1VRS D;  4HQS A;  4ILF A;  4G0K A;  3W8S A;  2FWG A;  2PUK C;  2GGT A;  4V1A p;  4V2N A;  1SJI A;  4PUF C;  4ECJ A;  1HD2 A;  1ZYP A;  2B5E A;  1USB A;  1E2Y A;  4ZB9 A;  4L0U A;  4DSS A;  1JLV A;  2PN8 A;  4K2X A;  19GS A;  1KEB A;  3EUR A;  5D9T A;  3FZA A;  1FOV A;  3MSZ A;  4E8H A;  3IC8 A;  1THX A;  2DLX A;  1ST9 A;  1ZCP A;  3CRU A;  3P8W A;  2O87 A;  3FKF A;  1EEM A;  3TJJ A;  1X5D A;  2WCI A;  1QGV A;  4MPG A;  4EKZ A;  2CX4 A;  4NV5 A;  3GKN A;  1LJR A;  2C3T A;  5AN1 A;  3FZ4 A;  4PNF A;  4HQZ A;  5B6M A;  1PX6 A;  3EYT A;  1YEX A;  2IMF A;  1EWX A;  4EXJ A;  2YZH A;  4K7O A;  3TJG A;  2DBC A;  4GRF A;  3MWH A;  4EIQ A;  3FR6 A;  4JE1 A;  5JCG A;  1T8E B;  1EV4 A;  1DE1 A;  4V2M A;  3H1N A;  5A4U A;  4HEA 2;  3HZ4 A;  1O8X A;  1R4W A;  2KP1 A;  3WYW A;  3HYP A;  1DUG A;  5ECN B;  4GXZ A;  4I2T A;  1A8L A;  3L9U A;  5IIZ A;  4FYC A;  1TRS A;  1FVJ A;  3FW2 A;  5B6N A;  2F8A A;  3O6T A;  2GSR A;  1SJZ A;  5EPF A;  2CVB A;  5EVO A;  4MF7 A;  3G7I A;  2WJU A;  3DML A;  4L5L A;  4TR3 A;  3RPN A;  2EIR A;  1PRX A;  2CVK A;  2GVP A;  2XC2 A;  3N9J A;  4ECC A;  4MH2 A;  1SL2 B;  1K0B A;  1TK5 B;  4XS4 B;  2IME A;  3LXT A;  4GLT A;  3IHQ A;  5F06 A;  1EEJ A;  2VCZ A;  1ZGN A;  2B7J A;  4IKH A;  3UJ1 A;  3GRX A;  5CP1 A;  2NTO A;  5FHI A;  1YKC A;  1XW9 A;  3Q18 A;  5F0G A;  3GX8 A;  3TOT A;  20GS A;  1RW1 A;  4OO5 A;  3KH9 A;  6GST A;  1GP1 A;  5B7C A;  4KCE A;  2VCQ A;  2V1M A;  3G7Y A;  2R2J A;  3M9K A;  4HUA A;  2B7K A;  1XCC A;  2H1A A;  4KSO A;  4EVM A;  2JL4 A;  2DKH A;  3A2W A;  6GSY A;  2VD1 A;  2R37 A;  3VFI A;  1QFN A;  2JSY A;  4KND A;  2R4V A;  1PL2 A;  3GSS A;  3HKR A;  1HQO A;  3TJF A;  3EMX A;  1M2B A;  6GSW A;  2DJ1 A;  3FYG A;  4O5Q A;  1MD4 A;  4KUN A;  3F4R A;  4BPY A;  4X1U A;  1GWC A;  2I81 A;  1GSF A;  1WMJ A;  3UAR A;  13GS A;  3U6V A;  4HDE A;  5CRE A;  1U87 A;  4IGJ A;  1JLW A;  5ID2 B;  3DKS A;  3QPM A;  2H70 A;  1J9B A;  2LQQ A;  2N5B A;  5D96 A;  4F03 A;  3H79 A;  2H6Z A;  5D73 A;  2IMD A;  4A5P A;  1FOH A;  2B3S A;  3QCP A;  3TB2 A;  5G5E A;  2LST A;  3UL3 A;  4CY8 A;  5H5S A;  5DQY A;  1TXX A;  1SL1 B;  3A2X A;  1FHE A;  2HRK A;  3M3M A;  2HZF A;  3QR6 A;  3VI5 A;  1F3A A;  5DJL A;  3U5R E;  5GST A;  5JWR B;  1BJX A;  4GSN A;  5ECO B;  2B1L A;  2CA8 A;  1N8J A;  3F4S A;  2H72 A;  3EMP A;  2A2P A;  2X4A A;  5HQP A;  5D9X A;  5GSS A;  1JHB A;  22GS A;  2L4C A;  3HHV A;  4EF0 A;  3KJY A;  5IO0 A;  3EU3 A;  1SJ6 A;  3IHG A;  1TDI A;  2IMI A;  1WP0 A;  2HRF A;  3KCM A;  3ZIJ A;  1WJK A;  3ME7 A;  4KE3 A;  1YJ6 A;  4Z7X A;  1EP8 A;  1OE7 A;  2L6D A;  3PH9 A;  2WDU A;  2LEG A;  3FZ5 A;  4DEJ A;  1CQG A;  2GZP A;  2C0D A;  4I8B A;  3LW9 A;  4LMW A;  5G31 A;  3BCK A;  3F0I A;  2O8V B;  5HFI A;  4IHU A;  5BRT A;  2MMN A;  5DQS A;  1F9M A;  2XHF A;  1K3Y A;  2DJK A;  2X49 A;  5DCG A;  4XS6 A;  4TOP A;  1BED A;  3VWX A;  4NWY A;  1ERV A;  3IBH A;  3MDK A;  3PPU A;  2FWH A;  5ECS A;  4PGT A;  4MDC A;  1BX9 A;  4K2D A;  4MZW A;  3LXZ A;  4AJ8 A;  1OC3 A;  3FEU A;  4NAX A;  1X5E A;  2OBI A;  1SD9 A;  5ABR A;  1Z5Y E;  3GN3 A;  2RII A;  2HSH A;  3GL5 A;  3BD2 A;  5C00 A;  1U3A A;  1GH2 A;  2FA8 A;  2R3X A;  1ZYN A;  5ECI B;  4ID0 A;  4ICY A;  1YEP A;  2G2Q A;  2GTU A;  2QKE A;  4XRA A;  3WD6 A;  5ID2 A;  4NPB A;  3KZQ A;  1B4Q A;  1NHY A;  3ZFL A;  3VUR A;  1A0R P;  3LYP A;  4HU9 A;  3KMO A;  4KB3 A;  4ZB8 A;  4JU5 A;  1OC8 A;  2LNT A;  3QMX A;  3W6G A;  3QD9 A;  3TDG A;  4LLR A;  4K5S A;  1S3A A;  2Z9S A;  2MBS A;  2X64 A;  5H5Q A;  1AQV A;  4GF0 A;  2MZC A;  4WF4 A;  3CTG A;  3TKS C;  4X4J A;  1YF0 A;  4BVX B;  2L5O A;  1GUH A;  1WRY A;  18GS A;  2VL2 C;  3CBU A;  2LS5 A;  1G0T A;  1V2A A;  2CAQ A;  1V58 A;  3QDN A;  5ECL B;  3TRQ A;  1PA3 A;  2XBQ A;  2F51 A;  4DSS B;  4ACS A;  1DE2 A;  1WWJ A;  2BJX A;  4K0N A;  5ENU A;  3PIN A;  3HVV A;  1XFL A;  2WGR A;  1PQN A;  4TXV A;  5DDL A;  4F0C A;  3C7M A;  1R7H A;  1VF3 A;  4LA1 A;  3SBC A;  5F07 A;  1V98 A;  1E6B A;  4ZL9 A;  4IBP A;  2J23 A;  5ECK B;  1GNW A;  2P5Q A;  3Q19 A;  3E0U A;  5G30 A;  1TOF A;  4Q5Q A;  1OKT A;  2V6K A;  2WB9 A;  1XW6 A;  1TW9 A;  4YQV A;  2H0H A;  1T4Y A;  2N5F A;  3GTU A;  3DXB A;  2CX3 A;  5ECP B;  1M9B A;  2V32 A;  2D2Z A;  4MA9 A;  2RLI A;  4MJB A;  3KTB A;  2DIY A;  3KEB A;  3K8N A;  4OFM A;  1QMV A;  3KTL A;  3ZTL A;  2IMK A;  2E0Q A;  3ZFB A;  2YWO A;  3JCM L;  2GT6 A;  3RAZ A;  4EIP A;  1M99 A;  2H8L A;  1A0F A;  3GIX A;  2ZUP A;  2K8S A;  2R5G A;  2FGX A;  2XPD A;  2M72 A;  1FB0 A;  1BG5 A;  3QFB C;  3J7Y b;  1M0U A;  2VIM A;  3O76 A;  3UMA A;  3L78 A;  3M1G A;  1SEN A;  4AJ6 A;  2A4V A;  4K8M A;  3WGD A;  1T00 A;  2PU9 C;  4YH2 A;  1M2A A;  3A5W A;  2VOC A;  1WE0 A;  1Q4J A;  5J9B A;  4POM A;  3FZ9 A;  3LFL A;  4KF9 A;  3IC4 A;  4ZL7 A;  5A5K A;  2O7K A;  2ON5 A;  1B4P A;  2A4H A;  5CYY A;  4O7H A;  3O3T A;  16GS A;  1BQ7 A;  2PVO C;  1KBN A;  5A4V A;  4BVX A;  4L8E A;  1Q98 A;  3GUR A;  3HDC A;  1K0O A;  5E4W A;  4EL1 A;  4K7N A;  14GS A;  1UC7 A;  5IMV A;  1PN0 A;  2ES7 A;  5DJM A;  5KOX A;  4MF6 A;  2GST A;  3GH6 A;  4I5Q A;  3L9V A;  2H75 A;  5IMC A;  4JR6 A;  3UBK A;  5BMU A;  3DRN A;  1AW9 A;  2FNO A;  2LJA A;  3NZN A;  1SK0 A;  1GSY A;  1U88 A;  3APQ A;  3BOA A;  3M8N A;  1PX7 A;  4Q5F A;  3IR4 A;  5J9C A;  1M2D A;  1Z9H A;  2VCV A;  2FHE A;  3F3Q A;  3VPT A;  2ALB A;  3DVX A;  3UVH A;  1XOA A;  5EL8 A;  2C3Q A;  1QQ2 A;  4N11 A;  4GWR A;  4KDX A;  3J7Y k;  3R3E A;  1MDK A;  4LL1 B;  4HZ2 A;  4MF5 A;  5IMD A;  4KDU A;  2C0G A;  4N0V A;  3ZRD A;  1GLQ A;  3HJO A;  2JAC A;  4E8E A;  4QQ7 A;  2ON7 A;  5JWQ B;  3FR9 A;  1NSW A;  1TRU A;  4Q5N A;  4NV2 A;  2YJH A;  1TKD B;  2HSY A;  4FIW A;  1X9M B;  3QAW A;  4HJ2 A;  5IO2 A;  4PUA A;  1TK8 B;  1K3O A;  4ECI A;  2IFQ A;  2OA7 A;  2H1D A;  2I3Y A;  1J08 A;  2HLS A;  1T7P B;  4MK3 A;  1H4O A;  4ML1 A;  3M0F A;  1WIK A;  4RUV A;  1FW1 A;  1EOH A;  4MMM A;  3QAG A;  3EPT A;  2R0G A;  2LKU A;  1M9A A;  4FH8 A;  4USS A;  4BVY B;  4POK A;  1YF1 A;  3ZIT A;  4BWQ A;  3TKR A;  1V40 A;  7GSS A;  5KN0 A;  3LOR A;  4IP1 A;  1GSE A;  2REM A;  1HYU A;  2OE3 A;  1SKR B;  17GS A;  1SK2 A;  3L9S A;  4GQC A;  4OWY A;  3NIV A;  4F82 A;  1NW2 A;  3ZVJ D;  1T4Z A;  2CQ9 A;  3NOF A;  3MNG A;  1XVW A;  4CDO A;  2LRC A;  1TU8 A;  5GAP D;  1K0A A;  1QK8 A;  1SK1 A;  1THO A;  3EWL A;  2X99 A;  3EIN A;  2C0F A;  4ZL8 A;  1ZZY A;  3GV1 A;  3F6F A;  2DJ2 A;  4DSR A;  4XRD A;  4ZIL A;  1JZR A;  2RUE A;  4TRX A;  2C3N A;  2QSI A;  1IYH A;  1Y6E A;  3HD5 A;  1T1V A;  3UAP A;  2HYX A;  1OKD A;  3Q74 A;  1AC1 A;  2FLS A;  8GSS A;  4TKY A;  3VWV A;  5JCW A;  3ZMK A;  2M46 A;  1FG4 A;  1G7E A;  1J0F A;  3GUS A;  1CQH A;  6GSX A;  1M7T A;  2WZ9 A;  1X5C A;  4RI7 A;  4Q5R A;  2DML A;  2AJQ B;  2NVL A;  3IXR A;  5CAX A;  2WRT A;  4L5O A;  2QA1 A;  1XZO A;  4ZBD A;  5CRH A;  5G5F A;  3GYK A;  1PN9 A;  5LNK e;  2DJ3 A;  2H01 A;  2A2R A;  1TK0 B;  1WPI A;  1ZYQ B;  4FYU A;  2CAI A;  1ZYE A;  3APS A;  3GA4 A;  4O92 A;  1Y25 A;  3GX0 A;  5J5N A;  3HVX A;  2GDR A;  3P2A A;  4WXT A;  2PER A;  5HR0 A;  4G19 A;  1VGL A;  2CZ2 A;  2GT5 A;  3LYK A;  2H0G A;  2BMX A;  3WT1 A;  2L5L A;  5IPG A;  3UBL A;  3TCO A;  2DMM A;  5KOW A;  1X0R A;  3LSZ A;  2R0P A;  2VLU A;  2LRN A;  4BVY A;  4GCI A;  2I9H A;  4KH7 A;  4P3Y B;  3ZRE A;  2JZR A;  4EUY A;  3MIX A;  4IW9 A;  3TRP A;  1VF4 A;  2V6O A;  3GL3 A;  2OAD A;  5COH A;  2F9S A;  3H4K A;  1GTU A;  1X9S B;  1HNA A;  4IN0 A;  1F37 A;  1YY7 A;  5ELG A;  2X8H A;  2VL3 A;  1XXU A;  4RQX A;  1O81 A;  2KLX A;  4PQH A;  2GSS A;  5KEJ A;  2EC4 A;  2OAC A;  2IL3 A;  4OMV A;  2NPB A;  3GST A;  1HNB A;  4NXI A;  2QC7 A;  3H8Q A;  3C71 A;  5H5R A;  1B48 A;  2IWT A;  4Z2R A;  3GTU B;  2YWM A;  1FB6 A;  4JBB A;  4G2E A;  4NHW A;  1TRW A;  5CO3 A;  3TGZ A;  4N30 A;  2P31 A;  3HA9 A;  1EZK A;  1EGO A;  1U3I A;  3PR8 A;  5KN1 A;  4D73 A;  4TR0 A;  4MJC A;  5HFK A;  3MYD A;  1Z6N A;  5CNW A;  2N5A A;  3D6I A;  1TU7 A;  1K0M A;  1O73 A;  3D0Z A;  3UIW A;  2WFC A;  2VM2 A;  3HVS A;  1AQX A;  3EU4 A;  2KP2 A;  4WBR D;  12GS A;  3Q6O A;  1UN2 A;  1GLP A;  4FO5 A;  5G1L A;  3KIJ A;  1K0N A;  1R26 A;  2GLR A;  4Z2U A;  1GSD A;  3PGT A;  4EC0 A;  1GNE A;  3TKS E;  2LJR A;  3G9B A;  1NM3 A;  1UVZ A;  2ZCT A;  4ML6 A;  1U6T A;  5CRW A;  1K0D A;  2VD0 A;  2QGV A;  4CHS A;  2GQL A;  1MDI A;  4KA0 A;  4MP4 A;  2MYG A;  3W8J A;  2KOK A;  4MPF A;  2E2M A;  3LEF A;  4TN8 A;  1GTA A;  5CRD A;  1ZMA A;  5J4U A;  1SYR A;  3KP9 A;  2K6V A;  3F8U A;  1NHO A;  2AV4 A;  2TRC P;  3DGQ A;  2H1B A;  3F63 A;  1EOG A;  3RDW A;  4F2I A;  1A8Y A;  2YAN A;  2YV9 A;  3IK9 A;  3CMI A;  4K7I A;  1A2M A;  2PMT A;  1EP7 A;  3BJ5 A;  3E3E A;  4CW9 A;  3GMF A;  4POL A;  3GNJ A;  4QL7 A;  2R0C A;  3M9J A;  3UEM A;  3GH9 A;  4TR1 B;  2DJJ A;  3HXS A;  4KDY A;  1ML6 A;  2MBT A;  3F6D A;  3LG6 A;  4WF5 A;  5IM9 A;  3FMW A;  4BA7 A;  3D21 A;  4KAE A;  3IDV A;  4GQF A;  5FT3 A;  2RUF A;  1W89 A;  3HJM A;  1G7O A;  3FK8 A;  1F2E A;  4OCF A;  2E2G A;  4EDZ A;  3RHB A;  3EC3 A;  4OFN A;  4MJE A;  3F3R A;  5AIS A;  4OCE A;  1IYI A;  3C73 A;  3CSH A;  3D22 A;  4YKF A;  2O85 A;  3F9U A;  2HT9 A;  5DAK A;  2HNL A;  2L59 A;  4TW5 A;  4JZQ A;  4MZB A;  4YQM A;  4G0I A;  2L57 A;  2GSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...