2VIMA

X-ray structure of fasciola hepatica thioredoxin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
104
structure length
104
Chain Sequence
MRVLATAADLEKLINENKGRLIVVDFFAQWCGPCRNIAPKVEALAKEIPEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRETITRHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN
publication title The Fasciola Hepatica Thioredoxin: High Resolution Structure Reveals Two Oxidation States.
pubmed doi rcsb
source organism Fasciola hepatica
total genus 37
structure length 104
sequence length 104
ec nomenclature ec 1.8.4.8: Phosphoadenylyl-sulfate reductase (thioredoxin).
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vimA00
3WT2A 2DSAA 2X8HA 4TR1B 3EVIA 3FY7A 4X0XA 4F03A 4MF7A 4FYBA 2IMKA 4HQZA 1ZOFA 2B7JA 4N10A 2HT9A 4TW5A 1SENA 2B5XA 4MABA 3VWWA 2NPBA 4DVCA 1R4WA 1M9BA 4AJ6A 1ZCPA 3KGKA 4Q5FA 3UMAA 2WCIA 1YEPA 5LNKe 5CREA 1X5DA 2P0GA 4IJIA 4DSSB 4KNDA 1SK1A 2V41A 1U88A 3GIXA 3UIWA 1GL8A 4WBJA 4KCEA 2ZCTA 4NHWA 2JZTA 5DALB 4K7OA 6GSXA 3M0FA 1AQWA 5IM9A 1EGOA 3TKSC 1JLVA 1K0MA 1QUWA 4WXTA 1EEJA 2JACA 5KN3A 2FD3A 1U87A 2FWEA 3HDCA 3M1GA 2WGRA 5B8AA 1O6JA 2YCDA 3QDNA 3FEUA 1Z6MA 1FVKA 1FHEA 3F6DA 1Z7RA 3H93A 3BBYA 1WPIA 1G7OA 1TOFA 2HRNA 5EY6A 4ZL9A 1BEDA 1XVWA 3K8NA 3ZMLA 2JZRA 4K0NA 2XPEA 5ECSA 2VCTA 2YZHA 4V2MA 4GRFA 4ZIJA 1S3CA 5J9CA 2LEGA 4QL9A 2O89A 1W4VA 3ZMKA 4NAXA 2P31A 2V6KA 5D73A 3C8EA 2LQQA 4I5QA 3PH9A 5G1LA 4MA9A 3TUEA 1M0UA 4J57E 4KSMA 4MPGA 1QMVA 2GQLA 3UOMA 1HQOA 3VI7A 4EO3A 2XBIA 1XXUA 3UVTA 4JRRA 4ZB8A 1IYIA 2H71A 1Q98A 5ECOB 4JEDA 2LV3A 1B4QA 2PU9C 1AXDA 1K3YA 2L4QA 2JZSA 4ZB9A 2H0GA 2AYTA 4KW6A 5JCWA 5ABRA 4MJBA 2DJ0A 1HYUA 1UN2A 3PR8A 2HRFA 3TJFA 2BTOT 2GDRA 3H1NA 5DCGA 2B7KA 2AHEA 1ZGNA 1G0TA 2E2GA 3EMXA 2H30A 1YKCA 3JCML 4LA1A 2EIQA 3RPPA 4TR0A 4OFTA 1TKDB 3GKKA 3FW2A 2VCVA 2CT6A 3HZ8A 5EVOA 4I6XA 1F37A 4KA0A 5JWRB 1XW6A 3DIEA 3LWAA 5IMCA 3CTGA 1T4ZA 2C3TA 4BL7A 4KCAA 2H6ZA 2IFQB 4XRDA 3GL3A 4MZBA 2D2ZA 2DMLA 2VOCA 2L6CA 2IPAA 3KH9A 1USBA 2H1GA 4NWYA 4YQMA 2VL9A 4RQRA 3OR5A 3QAGA 2YJHA 4EE0A 2ALBA 4WETA 3TJBA 4FH8A 3ZITA 3UBLA 2FA8A 1TI3A 3IRAA 1QK8A 3N5OA 2GSRA 1BQ7A 2YP6A 3H4KA 5LCZA 6GSSA 3EURA 2I81A 1JZRA 2CVKA 3VFIA 1VF2A 3TB2A 1B9YC 5G1KA 2GQKA 3CSIA 2H0IA 1AUCA 3FHKA 4DSRA 2HZEA 3A5WA 2IMIA 2OJLA 4EDYA 3LGCA 5IO2A 5GAND 1S3DA 1XCCA 4YH2A 1KTEA 1GULA 4L0UA 1PMTA 1EV4A 1LBKA 3W8JA 3VLNA 1BAYA 4OMVA 2JL4A 5IMFA 1Z3EA 2H1AA 1JFUA 5AISA 2HFDA 2F9SA 2LJAA 1TXXA 2LJRA 1YJ6A 4ULXA 1T1VA 4O32A 2V6OA 5IPHA 4D73B 3EU3A 1OE7A 5E59A 5ENUA 1RQMA 4LMVA 4IP1A 3I6AA 1ABAA 2VUPA 3TKRA 1HNBA 2N5FA 5G5EA 1YY7A 2V32A 2N5BA 2TRCP 5ECKB 5IMZA 4OCFA 3LXZA 4HUAA 1O85A 4HZ2A 3HD5A 3QD9A 1OC3A 1GTIA 3TRQA 3VK9A 4JZQA 2C4JA 2FA4A 1WMJA 3C1SA 1ERTA 2IMDA 3GV1A 11GSA 5KN2A 4O92A 4HOJA 3WD6A 2I3YA 3ZVJA 2G0FA 1X5EA 4MLYA 1V9WA 3LQ7A 3DXBA 3FR3A 5C04A 1YKAA 3G7IA 1A8LA 2QC7A 2VL2C 1XBSA 1AC1A 5CRDA 2LSTA 4L8EA 1GNEA 5D96A 3F4RA 3GRXA 3HVVA 5ECNB 3UARA 2H19A 1QQ2A 1A2LA 1HNCA 1SJIA 3M3MA 5A5KA 2R3XA 2XC2A 3VWVA 16GSA 1K0DA 10GSA 3H79A 2AV4A 1XIYA 1GLQA 2LTKA 4X43A 4PQ1A 4F2IA 1JHBA 3A3TA 22GSA 1OKDA 2HXKA 4L5OA 3W8SA 1ON4A 4I2UA 1XWAA 1V40A 1SJZA 4N0VA 4JR6A 4MH3A 2XBQA 4ECBA 3L4NA 3S9FA 2F51A 4YAPA 1X5CA 5G30A 4AGSA 2PWJA 2HYXA 1ERUA 1XOBA 4K1FA 2HSYA 2F3MA 1T4YA 3J7Yb 3ZFBA 2E7PA 1N8JA 3KCMA 4G9HA 3TGZA 2RUEA 2QSIA 2DJ1A 5IOXA 4HEA2 1MD3A 17GSA 1FB6A 4JBBA 4HU7A 3Q19A 1SU9A 4HQSA 2YWOA 9GSSA 3QFAC 3UJ1A 4TR4A 2WB9A 5DVBA 2YOIA 4K7IA 2GZPA 2H70A 2CZ3A 3TJKA 2DIYA 5H5RA 4PGTA 1VF1A 3QR6A 3GUSA 2CVDA 4PUAA 3VI5A 2E2MA 4NXIA 2OE0A 4KX4A 2FWFA 5CYYA 1GH2A 2YNXA 3HA9A 4ZILA 1Z9HA 4MJAA 2M80A 3TOTA 3FRCA 1YEXA 2JSYA 4XS4B 3QAVA 2Z9SA 4GTUA 2FUG2 4EL1A 4ZXGA 1ILOA 4ZL8A 2C0DA 1GUKA 1K0CA 2MYGA 4KDYA 1XWKA 5HQPA 2LRNA 2GSQA 2EIOA 3QPMA 6GSYA 1SD9A 2RIIA 3N9JA 1K3OA 3WT1A 2VD0A 4BWQA 2AB6A 3I69A 1XFLA 1Z6NA 2I4AA 2IJYA 3L0HA 4F9ZA 3O3TA 2FHEA 1MEKA 1OVNA 4I8BA 1AW9A 3KMOA 3EE2A 2WRTA 3ZREA 3M9JA 3HCZA 1M7TA 3ERWA 1U6TA 5ID2B 1ZZYA 2RLIA 3V1WA 3C71A 3F3RA 5L71A 3EC3A 5HFKA 2R5GA 1MDKA 4BPYA 2FCHA 3UAPA 3ME8A 3LYKA 4KH7A 1DBYA 1BX9A 2KOKA 3LXTA 3DWVA 4MZCA 2WS2A 5D8IA 1GTUA 4MPFA 4OD7A 1TRUA 5IPGA 2FGXA 1K3LA 2B6MA 2LRTA 5A4WA 4XCSA 1C72A 4WKWA 3GKMA 1TK8B 2WZ9A 4RI7A 2L6DA 4Q5RA 4HJMA 3GN3A 1XWCA 1XWGA 1K0OA 1SL1B 1A0RP 2R6KA 2I1UA 2LUSA 3ZRDA 3LJRA 3GTUA 1M2BA 4DSQA 4MF6A 3LEFA 5F06A 2B1KA 2O87A 4FIWA 4QQ7A 5GSSA 3HJOA 3IE3A 2C3NA 1NM3A 3EINA 5B7CA 4POLA 3ZLPA 2H72A 1ERVA 4WR4A 4PQHA 3PINA 2OADA 1JZOA 1WP0A 1O7UA 3MDKA 1HD2A 2C3QA 4POKA 2VAFA 3CYNA 4MH2A 5COHA 2K8SA 2RM6A 3GHAA 4G19A 2HZEB 4AJ8A 4DEJA 3HJMA 1GSEA 2KP1A 2BMXA 2HLSA 2VO4A 4KSOA 2A2SA 5C00A 3F63A 3VPQA 3TCOA 4TR1A 3O6TA 1U3AA 1GP1A 1T3BA 2GS3A 2CAIA 1ZYQB 2X8GA 1XZOA 5ELGA 2DJ3A 1PKWA 2MMOA 2VCQA 1A23A 3FYGA 1GNWA 1VF3A 3LORA 1YQ1A 2YWIA 4G10A 2IIYA 2YV7A 3MNGA 3IXRA 4TRXA 3BD2A 1EOGA 3FZ4A 2GSSA 4JU5A 1JLWA 2LS5A 3HVXA 2NDOA 4E8HA 1XWBA 4PX1A 1ERWA 1OC9B 4J56E 5ECIB 3LFLA 3NOFA 3TRPA 5DALA 2GQMA 2VCWA 2VM1A 4HI7A 4TOPA 2OKAA 2VCZA 3UL3A 1TDIA 5D9TA 1PN9A 3RBTA 5G2ZA 3Q74A 6GSTA 2DLXA 1TJDA 4O7HA 1T8EB 3TKQA 5D9XA 5DBQA 4ZL7A 1J0FA 2DJJA 1A2JA 5ECPB 4AF2A 3HXSA 2GT5A 4TVEA 2GGTA 2CVBA 4EKZA 3GKNA 5ECQB 1FG4A 8GSSA 2MMAA 2JSZA 4GQFA 3W6GA 2FNOA 2CZ2A 2ON5A 4N30A 1TK5B 1SD8A 4RQXA 4EDZA 1A2MA 1ZMAA 3F9UA 3IDVA 3DKSA 4KB3A 3LYPA 1DE2A 3DYRA 5IIZA 3CRTA 4EVMA 4ID0A 2I9HA 4G2EA 5AN1A 4MJCA 4POBA 1KBNA 3KM6A 1VF4A 4IELA 5CO3A 2K18A 5DAKA 4XIHA 4BVYA 4OO5A 4XS1A 1PD21 3G7YA 3US3A 4IKHA 1TTZA 1S3AA 3EWLA 1OC8A 2LRCA 5F0GA 1THXA 4Z7XA 2C8UA 1ST9A 1MDJA 3C73A 2O8VB 5HR3A 2A4VA 3UVHA 1BG5A 1H4OA 2OE3A 2YZUA 1XW9A 4IGJA 4OCEA 5B6MA 5D9VA 2V2GA 2IWTA 3TOUA 3Q18A 3IPZA 3EYTA 2H66A 1GSSA 1DE1A 3F3QA 4TXVA 3KH7A 2LQOA 2VIMA 14GSA 4XRAA 2B5EA 5AIXA 5JCUA 1DUGA 4K9ZA 2GVPA 5IO0A 5CAXA 3KTBA 5D9WA 4YAVA 2HZFA 2IFQA 1FB0A 2GSTA 2H1DA 3UBKA 5FWGA 3P8WA 4IBPA 2F8FA 1Z5YE 2L57A 2OA7A 3HY2A 5HR2A 5FHIA 5J41A 1SK0A 5GZZB 1SL2B 4MZWA 3ZZXA 1Z7PA 2GZYA 2CX4A 2IN3A 2YN1A 1J08A 1G7EA 4IW9A 5CRGA 1OAZA 1EP8A 3DGQA 4Q5NA 3EMPA 1GWCA 1SYXA 2OBIA 1CQGA 2PUKC 3DMLA 3M9KA 3IR4A 4NV2A 4NHZA 3WYWA 4OFMA 2RUFA 2YV9A 3WGEA 1YF0A 1GSDA 4PNFA 3ERFA 1ML6A 2GTUA 4I97A 1SKWB 1AQVA 2PN8A 4IHUA 3U6VA 4HS1A 3A2XA 1GSFA 2DC5A 5HR1A 1EV9A 3KZQA 3E0UA 2CAQA 2AAWA 1NHOA 1XOAA 4P3YB 1THOA 3C1RA 3GYKA 2VD1A 2K6VA 5DQSA 3KMNA 2K9FA 4D73A 2VL3A 1I9DA 5ECLB 4GQCA 2HNLA 3L9SA 3GX8A 2PVOC 2B5YA 3UEMA 1TP9A 4AJ7A 2H8LA 3DVWA 3L78A 3L9VA 4POMA 2DIZA 3ZVJD 1R5PA 4WR5A 3MSZA 3GX0A 2R4VA 4OFNA 3QAWA 3ZL5A 4ACSA 1TU7A 2IL3A 2H75A 4WEYA 3FR6A 2R37A 1XPVA 4LMWA 2H76A 3HKRA 3HYPA 2FLSA 5CRHA 4ECCA 4PNGA 2E0QA 2NVLA 1B48A 1FOVA 2XHFA 1PX6A 3GTUB 2NTOA 1QFNA 2G2QA 1I5GA 1E2YA 5KN0A 5J3RA 4PXOA 3QCPA 2DMMA 4TXOA 1ZYEA 3CSHA 3G9BA 2IMEA 3QOUA 4CDOA 4BVXA 3GSSA 4CHSA 1E6BA 5DQYA 1GUHA 4K6XA 5A4UA 3CSJA 1MD4A 2YWMA 2GT6A 1GSUA 3RHCA 1WWJA 1F3AA 3GMFA 4IP6A 4TKYA 3D4TA 4KGIA 1GUMA 1KEBA 2HSHA 2H73A 2J23A 2CV4A 1MDIA 1YZXA 3FZ9A 2MBSA 3RHBA 3TKPA 4GWRA 1A8YA 3D6IA 1WIKA 3R2QA 5FT3A 2VM2A 4NV5A 3SBCA 1WJKA 2JADA 1BJXA 3GNJA 5G5FA 3U5RE 1F3BA 3L9UA 5B6NA 4OO4A 4MDCA 5J5NA 1B9XC 1V2AA 5KEJA 2A2RA 1JZWA 4V1Ag 1KNGA 2PGTA 1N2AA 1X0RA 3SWLA 3NIVA 5IOWA 4ECIA 2AUVA 2VLUA 2R2JA 3F4SA 4KUNA 3GH9A 1PL2A 1YDKA 2O85A 3IK7A 3O76A 1JZDA 3F4TA 4JE1A 1O8WA 1ZL9A 4MK3A 2P5QA 2BJXA 5GSTA 4IQAA 3GFKA 1SK2A 2WDUA 3VWXA 2YANA 3F0IA 4NPBA 1K0BA 1K0AA 3A2VA 2N5AA 4GCIA 4F0BA 3KD0A 18GSA 1AAZA 4TR3A 2F8AA 3ZFLA 4HU9A 4MP4A 4HJ2A 4GSSA 4IVFA 3M8NA 1EOHA 3GSTA 2OACA 4FO5A 3GKXA 5ECRB 3P90A 3ERGA 1O81A 3FZ5A 4WF5A 5AGYA 3KEBA 1QGVA 2C0GA 3CRUA 1O73A 2VLVA 5HR0A 4V2LA 1LJRA 4XS4A 2M72A 1XVQA 2L59A 2VLTA 4MF5A 1PSQA 1V57A 5HFIA 5H5SA 5GAPD 4GLTA 4TN8A 4ISDA 1GRXA 4GF0A 2EC4A 5F05A 1T7PB 3E3EA 2H6YA 2YPMA 3QMXA 2CX3A 2QKEA 3AY8A 5F8BA 3DEXA 1X9MB 2PVQA 2LNTA 4HDEA 5H5QA 2PERA 3D22A 5JWQB 1H75A 3BJ5A 5DAKB 3DVXA 2X64A 3C7MA 4L5LA 2OE1A 4K7NA 1PRXA 2PPTA 4J2FA 1EZKA 3IK9A 4NMUA 2H6XA 4XS6A 4E8EA 3RPNA 3H8QA 4LL1B 3I43A 2B3SA 4KDXA 1WOUA 1M2DA 2HE3A 4IS0A 2TRXA 2H1BA 1NHYA 4JR4A 1Q4JA 5ID2A 4V1Ap 4DSSA 1FW1A 1UC7A 3BCIA 1ACVA 1EWXA 4OWYA 1HNAA 5DJLA 3CXGA 3DRNA 4KE3A 3MWHA 1WRYA 2WJUA 4FYUA 4FYCA 2LNSA 1WE0A 2V1MA 6GSWA 3BCKA 3HZ4A 2P5RA 3HVSA 5G31A 5B8BA 4ZBAA 3TRXA 5J4UA 4F82A 2KLXA 2FWGA 2AJQB 3IA1A 3TKSA 3I9V2 4ZBBA 3APQA 2FY6A 2DBCA 1TW9A 1W89A 5IMDA 3LSZA 1TRWA 6GSUA 2DJ2A 4L0WA 3G7JA 4YQUA 1R7HA 3GL5A 1B8XA 1NW2A 1AIUA 1R26A 1X9WB 1A0FA 1PQNA 4N0ZA 3IHQA 5CNWA 1F6MC 3CTFA 1RW1A 5CRWA 3J7Yk 1YF1A 2LKUA 4EXJA 3APSA 2L4CA 2KUCA 1Y6EA 2J9HA 2X99A 5JWOB 1GLPA 2H0HA 2JU5A 4ZB6A 1A24A 4GXZA 1SKSB 4K0GA 4I2TA 4PQIA 3MAKA 5IMVA 2YJ7A 3ZYWA 2KHPA 2MZCA 2WULA 3GA4A 3RDWA 3FZAA 3TKSE 4GSNA 1TRVA 2CA8A 2GZZA 5LD0A 1DSBA 2IMFA 4BA7A 3BOAA 1J9BA 3KJYA 4ILFA 3DD3A 20GSA 5D93A 2NBSA 3HJPA 3IC4A 1EGRA 3FK8A 3RAZA 3Q6OA 2H74A 3TJGA 6GSVA 1GTBA 1GSQA 1SL0B 1QXHA 1OE8A 4IJ3A 4LLRA 3ZIVA 2TIRA 1OC9A 3F6FA 5JCGA 1OKTA 3KIJA 1TRSA 4KDUA 1UVZA 3VPTA 5ECHB 3KXOA 3GURA 3CBUA 3IV4A 3NZNA 2K8VA 1LU4A 4HZ4A 1FO5A 3WGXA 1GTAA 1M2AA 3TJJA 4BWSA 19GSA 3F8UA 5EPFA 3KP8A 1K0NA 5IQYA 4ZBDA 4X1UA 5EL8A 3P7XA 1EEMA 2PMTA 3ED3A 2B1LA 4MMMA 1PGTA 1B4PA 1PA3A 3ZTLA 3GH6A 3EU4A 3A2WA 3IOSA 1F9MA 1MTCA 1SJ6A 1TU8A 1SKRB 1X9SB 4TXOB 1AQXA 5IMAA 1XW5A 5DDLA 12GSA 3IBHA 3KP9A 5HFGA 3HHVA 4EUYA 2XPDA 3TDGA 4H86A 4XTSA 4GSTA 1PX7A 3ZIJA 1R5AA 3ISOA 1RK4A 1URMA 3KTLA 3CMIA 2EIRA 1Y25A 4K2DA 4EC0A 1M9AA 1M99A 2MMNA 1FVJA 4EF0A 3D0ZA 4XHMA 2VCXA 4F0CA 4WF4A 1BYEA 1T00A 5ECMB 1TK0B 2KP2A 1SYRA 2O7KA 2CQ9A 1PKZA 3E9JB 3QFBC 2C0EA 3ME7A 2C1YA 3D4MA 4Q5QA 1G6WA 5DJMA 3D5JA 2RM5A 5A4VA 4MCUA 2REMA 4WBRD 2ZNMA 2L5OA 4IN0A 3VWUA 2FWHA 2MMZA 4QL7A 2HI7A 5KN1A 1FAAA 4ML1A 1PL1A 3WGDA 1V98A 1NSWA 4MJEA 5ELAA 1OYJA 1UA5A 1GSYA 13GSA 2L5LA 3VURA 3P2AA 5CP1A 4YQVA 2MBTA 3IAS2 1IYHA 2OBKA 4IQ1A 2QGVA 7GSSA 1EP7A 2WFCA 4ECJA 2X8CA 3IAM2 2LJKA 1VGLA 1V58A 1F2EA 4RUVA 4PURA 5AIVA 4KAEA 4LL4B 2YWNA 2PBJA 3FR9A 1CQHA 2C80A 4CW9A 2M46A 1VRSD 2VL2A 2H01A 1TI1A 5DCHA 2DJKA 4N11A 2GLRA 2ZUPA 2C0FA 3PGTA 5F07A 4ML6A 4K8MA 3D21A 1O8XA 3LG6A 4PUFC 4O5RA 4V2NA 5J9BA 5E4WA 2ON7A 3FKFA 3APOA 2ES7A 1G6YA 1U3IA 4RI6A 5INYA
chains in the Genus database with same CATH superfamily
3WT2A 2DSAA 2X8HA 4TR1B 3EVIA 3FY7A 4X0XA 4F03A 4MF7A 4K2XA 4FYBA 2IMKA 4HQZA 1ZOFA 2B7JA 4N10A 2HT9A 4TW5A 3IC8A 1SENA 2B5XA 4MABA 3VWWA 2NPBA 4DVCA 1R4WA 1M9BA 4AJ6A 1ZCPA 3KGKA 4Q5FA 3UMAA 2WCIA 1YEPA 5LNKe 5CREA 1X5DA 2P0GA 4IJIA 4DSSB 4KNDA 1SK1A 2V41A 1U88A 3GIXA 3UIWA 1GL8A 4WBJA 4KCEA 2ZCTA 4NHWA 2JZTA 5DALB 4K7OA 6GSXA 3M0FA 3FMWA 1AQWA 5IM9A 1EGOA 3TKSC 1JLVA 1K0MA 1QUWA 4WXTA 2DKIA 1EEJA 2JACA 5KN3A 2FD3A 1U87A 2FWEA 1M3IA 3HDCA 3M1GA 2WGRA 5B8AA 1O6JA 2YCDA 3QDNA 3FEUA 1Z6MA 1FVKA 1ZYNA 1FHEA 3F6DA 1Z7RA 3H93A 3BBYA 1WPIA 1G7OA 1TOFA 2HRNA 5EY6A 4ZL9A 1BEDA 1XVWA 3K8NA 3ZMLA 2JZRA 4K0NA 2XPEA 5ECSA 2VCTA 2YZHA 4V2MA 4GRFA 4ZIJA 1S3CA 5J9CA 2LEGA 4QL9A 2O89A 1W4VA 3ZMKA 4NAXA 2P31A 2V6KA 5D73A 3C8EA 2LQQA 4I5QA 3PH9A 5G1LA 4MA9A 3TUEA 1M0UA 4J57E 4KSMA 4MPGA 1QMVA 2GQLA 3UOMA 1HQOA 3VI7A 4EO3A 2XBIA 1XXUA 3UVTA 4JRRA 4ZB8A 1IYIA 1PFOA 2H71A 1Q98A 5ECOB 4JEDA 2LV3A 1B4QA 2PU9C 4BVYB 1AXDA 1K3YA 2L4QA 2JZSA 4ZB9A 4HSCX 2H0GA 2AYTA 4KW6A 5JCWA 5ABRA 4MJBA 5BRTA 2DJ0A 1HYUA 1UN2A 3PR8A 2HRFA 3TJFA 2BTOT 2GDRA 3H1NA 5DCGA 2B7KA 3HVNA 2AHEA 1ZGNA 1G0TA 2E2GA 3EMXA 2H30A 1YKCA 3JCML 4LA1A 2EIQA 3RPPA 4TR0A 4OFTA 1TKDB 3GKKA 3FW2A 2VCVA 2CT6A 3HZ8A 5EVOA 4I6XA 1F37A 4KA0A 5JWRB 1XW6A 3DIEA 3LWAA 5IMCA 3CTGA 1T4ZA 2C3TA 4BL7A 4KCAA 2H6ZA 2QA2A 2IFQB 4YKGA 4XRDA 3GL3A 4MZBA 2D2ZA 2DMLA 2VOCA 2L6CA 2IPAA 3KH9A 1USBA 2H1GA 4NWYA 4YQMA 2VL9A 2QA1A 4RQRA 3OR5A 3QAGA 3PPUA 2YJHA 4EE0A 2ALBA 4WETA 3TJBA 4FH8A 3ZITA 3UBLA 2FA8A 1TI3A 3IRAA 1QK8A 3N5OA 2GSRA 1BQ7A 2YP6A 3H4KA 5LCZA 6GSSA 3EURA 2I81A 1JZRA 2CVKA 3VFIA 1VF2A 3TB2A 1B9YC 5G1KA 2GQKA 3CSIA 2H0IA 1AUCA 3FHKA 4DSRA 2HZEA 3A5WA 2IMIA 2OJLA 4EDYA 3LGCA 5IO2A 5GAND 1S3DA 1XCCA 4YH2A 1KTEA 1GULA 4L0UA 1PMTA 1EV4A 1LBKA 3W8JA 3VLNA 1BAYA 4OMVA 2JL4A 5IMFA 1Z3EA 2H1AA 1JFUA 5AISA 2HFDA 2F9SA 2LJAA 1TXXA 2LJRA 1YJ6A 4ULXA 1T1VA 4O32A 2V6OA 5IPHA 4D73B 3EU3A 1OE7A 5E59A 5ENUA 1RQMA 4LMVA 4CY6A 4IP1A 3I6AA 1ABAA 2VUPA 3TKRA 1HNBA 2N5FA 5G5EA 1YY7A 2V32A 2N5BA 2TRCP 5ECKB 5IMZA 4OCFA 3LXZA 4HUAA 1O85A 4HZ2A 3HD5A 3QD9A 1OC3A 1GTIA 3TRQA 3VK9A 4JZQA 2C4JA 2FA4A 1WMJA 3C1SA 5BMUA 1ERTA 2IMDA 3GV1A 11GSA 4K5RA 5KN2A 4O92A 4HOJA 3WD6A 2I3YA 3ZVJA 2G0FA 1X5EA 4MLYA 1V9WA 3LQ7A 3DXBA 1ZYPA 3FR3A 5C04A 1YKAA 4G0KA 3G7IA 1A8LA 2QC7A 2VL2C 1XBSA 1AC1A 5CRDA 2LSTA 4L8EA 1GNEA 5D96A 3F4RA 3GRXA 3HVVA 5ECNB 3UARA 4BVXB 2H19A 1QQ2A 1A2LA 1HNCA 1SJIA 3M3MA 5A5KA 2R3XA 2XC2A 3VWVA 4X4JA 16GSA 1K0DA 10GSA 3H79A 2AV4A 1XIYA 1GLQA 2LTKA 4X43A 4PQ1A 4F2IA 1JHBA 3A3TA 22GSA 1OKDA 2HXKA 4L5OA 3W8SA 1ON4A 4I2UA 1M3JA 1XWAA 2HRAA 1V40A 1SJZA 4N0VA 4JR6A 4MH3A 2XBQA 4ECBA 1PN0A 3L4NA 3S9FA 2F51A 4YAPA 1X5CA 5G30A 4AGSA 2PWJA 2HYXA 1ERUA 1XOBA 4K1FA 2HSYA 2F3MA 1T4YA 3J7Yb 3ZFBA 2E7PA 1N8JA 3KCMA 4G9HA 3TGZA 2RUEA 2QSIA 2DJ1A 5IOXA 4HEA2 1MD3A 17GSA 1FB6A 4JBBA 4HU7A 3Q19A 1SU9A 4HQSA 2YWOA 9GSSA 3QFAC 3UJ1A 4TR4A 2WB9A 5DVBA 2YOIA 4K7IA 2GZPA 2H70A 4EIPA 4Z2TA 2CZ3A 3TJKA 2DIYA 5H5RA 4PGTA 1VF1A 3QR6A 3GUSA 2CVDA 4PUAA 3VI5A 2E2MA 4NXIA 2OE0A 4KX4A 2FWFA 5CYYA 1GH2A 2YNXA 3HA9A 4ZILA 1Z9HA 4MJAA 2M80A 3TOTA 3FRCA 1YEXA 2JSYA 4XS4B 3QAVA 2Z9SA 4GTUA 2FUG2 4EL1A 4ZXGA 1ILOA 4ZL8A 2C0DA 1GUKA 1K0CA 2MYGA 4KDYA 1XWKA 5HQPA 2LRNA 2GSQA 2EIOA 3QPMA 6GSYA 1SD9A 2RIIA 3N9JA 1K3OA 3WT1A 2VD0A 4BWQA 2AB6A 3I69A 1XFLA 1Z6NA 2I4AA 4G0LA 2IJYA 3L0HA 4F9ZA 3O3TA 2FHEA 1MEKA 1OVNA 4I8BA 1AW9A 3KMOA 3EE2A 2WRTA 3ZREA 3M9JA 3HCZA 1M7TA 3ERWA 1U6TA 5ID2B 1ZZYA 2RLIA 3V1WA 3C71A 3F3RA 5L71A 3EC3A 5HFKA 2R5GA 1MDKA 4BPYA 2FCHA 3UAPA 3ME8A 3LYKA 4KH7A 1DBYA 1BX9A 2KOKA 3LXTA 3DWVA 4MZCA 2WS2A 5D8IA 1GTUA 4MPFA 4OD7A 1TRUA 5IPGA 2FGXA 1K3LA 2B6MA 2LRTA 5A4WA 4XCSA 1C72A 4WKWA 3GKMA 1TK8B 2WZ9A 4RI7A 2L6DA 4Q5RA 4HJMA 3GN3A 1XWCA 1XWGA 4BL7B 1K0OA 1SL1B 1A0RP 2R6KA 2I1UA 2LUSA 3ZRDA 3LJRA 3GTUA 1M2BA 4DSQA 4MF6A 3LEFA 5F06A 2B1KA 2O87A 4FIWA 4QQ7A 5GSSA 3HJOA 3IE3A 2C3NA 1NM3A 3EINA 5B7CA 4POLA 3ZLPA 2H72A 1ERVA 4WR4A 4PQHA 3PINA 2OADA 1JZOA 1WP0A 1O7UA 3MDKA 1HD2A 2C3QA 4POKA 2VAFA 4YKFA 3CYNA 4MH2A 5COHA 2K8SA 2RM6A 3GHAA 4G19A 2HZEB 4AJ8A 4DEJA 3HJMA 1GSEA 2KP1A 2BMXA 2HLSA 2VO4A 4KSOA 2A2SA 5C00A 3F63A 3VPQA 3TCOA 4TR1A 3O6TA 1U3AA 1GP1A 1T3BA 2GS3A 2CAIA 1ZYQB 2X8GA 1XZOA 5ELGA 2DJ3A 1PKWA 2MMOA 2VCQA 1A23A 3FYGA 1GNWA 1VF3A 3LORA 1YQ1A 2YWIA 4G10A 2IIYA 2YV7A 3MNGA 3IXRA 4TRXA 3BD2A 1EOGA 3FZ4A 2GSSA 4JU5A 1JLWA 2LS5A 3HVXA 2NDOA 4E8HA 1XWBA 4PX1A 1ERWA 1OC9B 4J56E 5ECIB 3LFLA 4KF9A 3NOFA 3TRPA 5DALA 2GQMA 2VCWA 2VM1A 4HI7A 4TOPA 2OKAA 2VCZA 3UL3A 1TDIA 5D9TA 1PN9A 3RBTA 5G2ZA 3Q74A 6GSTA 2DLXA 1TJDA 4O7HA 1T8EB 3TKQA 5D9XA 5DBQA 4ZL7A 1J0FA 2DJJA 1A2JA 5ECPB 4AF2A 3HXSA 2GT5A 4TVEA 2GGTA 2CVBA 4EKZA 3GKNA 5ECQB 1FG4A 8GSSA 2MMAA 2JSZA 4GQFA 3W6GA 2FNOA 2CZ2A 2ON5A 4N30A 1TK5B 1SD8A 4RQXA 4EDZA 1A2MA 1ZMAA 3F9UA 3IDVA 2DKHA 3DKSA 4KB3A 3LYPA 1DE2A 2HRKA 3DYRA 5IIZA 3CRTA 4EVMA 4ID0A 2I9HA 4G2EA 5AN1A 4MJCA 4POBA 1KBNA 3KM6A 1VF4A 4IELA 5CO3A 2K18A 5DAKA 4XIHA 4BVYA 4OO5A 4XS1A 1PD21 3G7YA 3US3A 4IKHA 1TTZA 1S3AA 3EWLA 1OC8A 2LRCA 5F0GA 1THXA 4Z7XA 2C8UA 1ST9A 1MDJA 3C73A 2O8VB 5HR3A 2A4VA 3IHGA 3UVHA 2R0PA 1BG5A 1H4OA 2OE3A 2YZUA 1XW9A 4IGJA 4OCEA 5B6MA 4FQUA 2A4HA 5D9VA 2V2GA 2IWTA 3TOUA 3Q18A 3IPZA 3EYTA 2H66A 1GSSA 1DE1A 3F3QA 4TXVA 3KH7A 2LQOA 2VIMA 14GSA 4XRAA 2B5EA 5AIXA 5JCUA 1DUGA 4K9ZA 2GVPA 5IO0A 5CAXA 3KTBA 5D9WA 4YAVA 2X4AA 2HZFA 2IFQA 1FB0A 2GSTA 2H1DA 3UBKA 5FWGA 3P8WA 4IBPA 2F8FA 1Z5YE 2L57A 2OA7A 3HY2A 5HR2A 5FHIA 5J41A 1SK0A 5GZZB 1SL2B 4MZWA 3ZZXA 1Z7PA 2GZYA 2CX4A 2IN3A 2YN1A 1J08A 1G7EA 4IW9A 5CRGA 1OAZA 1EP8A 3DGQA 4Q5NA 4ICYA 3EMPA 1GWCA 1SYXA 2OBIA 1CQGA 2PUKC 3DMLA 3M9KA 3IR4A 4NV2A 4NHZA 3WYWA 4OFMA 2RUFA 2YV9A 3WGEA 1YF0A 1GSDA 4PNFA 3CQFA 3ERFA 1ML6A 2GTUA 4I97A 1SKWB 1AQVA 2PN8A 4IHUA 3U6VA 4HS1A 3A2XA 1GSFA 2DC5A 5HR1A 1EV9A 3KZQA 3E0UA 2CAQA 2AAWA 1NHOA 1XOAA 4P3YB 1THOA 3C1RA 3GYKA 2VD1A 2K6VA 5DQSA 3KMNA 2K9FA 4D73A 2VL3A 1I9DA 5ECLB 4GQCA 2HNLA 3L9SA 3GX8A 2PVOC 2B5YA 3UEMA 1TP9A 4AJ7A 2H8LA 4EIQA 3DVWA 3L78A 3L9VA 4POMA 2DIZA 3ZVJD 1R5PA 4WR5A 3MSZA 3GX0A 2R4VA 4OFNA 4O5QA 3QAWA 3ZL5A 4ACSA 1TU7A 2IL3A 2H75A 4WEYA 3FR6A 2R37A 1XPVA 4LMWA 2H76A 3HKRA 3HYPA 2FLSA 5CRHA 4ECCA 4PNGA 2E0QA 2NVLA 1B48A 1FOVA 2XHFA 1PX6A 3GTUB 2NTOA 1QFNA 2G2QA 1I5GA 1E2YA 5KN0A 5J3RA 4PXOA 3QCPA 2DMMA 4TXOA 1ZYEA 3CSHA 3G9BA 2IMEA 3QOUA 4CDOA 4BVXA 3GSSA 4CHSA 1E6BA 5DQYA 1GUHA 4K6XA 5A4UA 1FOHA 3CSJA 1MD4A 2YWMA 2GT6A 1GSUA 3RHCA 4Z2UA 1WWJA 1F3AA 3GMFA 4IP6A 4PTSA 4TKYA 3D4TA 4KGIA 1GUMA 1KEBA 2HSHA 2H73A 2J23A 2CV4A 1MDIA 1YZXA 3FZ9A 2MBSA 3RHBA 3TKPA 4GWRA 1A8YA 3D6IA 1WIKA 3R2QA 5FT3A 2VM2A 4NV5A 3SBCA 1WJKA 2JADA 1BJXA 3GNJA 5G5FA 3U5RE 1F3BA 3L9UA 5B6NA 4OO4A 4MDCA 5J5NA 1B9XC 1V2AA 5KEJA 2A2RA 1JZWA 4V1Ag 1KNGA 2PGTA 1N2AA 1X0RA 3SWLA 4O5UA 3NIVA 5IOWA 4ECIA 2AUVA 2VLUA 2R2JA 3F4SA 4KUNA 3GH9A 1PL2A 1YDKA 2O85A 3IK7A 3O76A 1JZDA 3MIXA 3F4TA 4JE1A 1O8WA 1ZL9A 4MK3A 2P5QA 2BJXA 5GSTA 4IQAA 3GFKA 1SK2A 2WDUA 3VWXA 2YANA 3F0IA 4NPBA 1K0BA 1K0AA 3A2VA 2N5AA 4GCIA 4F0BA 3KD0A 4MNNA 18GSA 1AAZA 4TR3A 2F8AA 3ZFLA 4HU9A 4MP4A 4HJ2A 4GSSA 4IVFA 3M8NA 1EOHA 3GSTA 2OACA 4FO5A 3GKXA 5ECRB 3P90A 2X49A 3ERGA 1O81A 3FZ5A 4WF5A 5AGYA 3KEBA 1QGVA 2C0GA 3CRUA 1O73A 2VLVA 5HR0A 4V2LA 1LJRA 4XS4A 2M72A 1XVQA 2L59A 2VLTA 4MF5A 1PSQA 1V57A 5HFIA 5H5SA 3LW9A 4GLTA 4TN8A 5GAPD 4ISDA 1GRXA 4GF0A 2EC4A 5F05A 1T7PB 3E3EA 2H6YA 2YPMA 3QMXA 2CX3A 2QKEA 3AY8A 5F8BA 3DEXA 1X9MB 2PVQA 2LNTA 4HDEA 5H5QA 2PERA 3D22A 5JWQB 1H75A 3BJ5A 5DAKB 3DVXA 2X64A 3C7MA 4L5LA 2OE1A 4K7NA 1PRXA 2PPTA 4J2FA 1EZKA 3IK9A 4NMUA 2H6XA 4XS6A 4E8EA 3RPNA 3H8QA 4LL1B 3I43A 2B3SA 4KDXA 1WOUA 1M2DA 2HE3A 4IS0A 2TRXA 2H1BA 1NHYA 4JR4A 1Q4JA 5ID2A 4V1Ap 4DSSA 1FW1A 1UC7A 3BCIA 1ACVA 1EWXA 4OWYA 1HNAA 5DJLA 3CXGA 3DRNA 4KE3A 3MWHA 5KOXA 1WRYA 2WJUA 4FYUA 4FYCA 2LNSA 1WE0A 2V1MA 6GSWA 3BCKA 3HZ4A 2P5RA 3HVSA 5G31A 5B8BA 4ZBAA 3TRXA 3A5IA 5J4UA 4F82A 2KLXA 2FWGA 2AJQB 3IA1A 3TKSA 3I9V2 4ZBBA 3APQA 2FY6A 2DBCA 1TW9A 1W89A 5IMDA 3LSZA 1TRWA 6GSUA 2DJ2A 4L0WA 3G7JA 4YQUA 1R7HA 3GL5A 1B8XA 1NW2A 1AIUA 1R26A 1X9WB 1A0FA 1PQNA 4N0ZA 3IHQA 5CNWA 1F6MC 3CTFA 2R0GA 1RW1A 5CRWA 3J7Yk 1YF1A 4Z2RA 2LKUA 4EXJA 3APSA 2L4CA 2KUCA 1Y6EA 2J9HA 2X99A 4G0IA 5JWOB 1GLPA 2H0HA 2JU5A 4ZB6A 1A24A 4GXZA 1SKSB 4K0GA 4I2TA 4PQIA 3MAKA 5IMVA 2YJ7A 3ZYWA 2KHPA 2MZCA 2WULA 3GA4A 3RDWA 3FZAA 3TKSE 4GSNA 1TRVA 2CA8A 2GZZA 5LD0A 1DSBA 2IMFA 4BA7A 3BOAA 1J9BA 3KJYA 4ILFA 3DD3A 20GSA 5D93A 2NBSA 3HJPA 3IC4A 3R3EA 1EGRA 3FK8A 3RAZA 3Q6OA 2H74A 3MYDA 3TJGA 6GSVA 1GTBA 1GSQA 1SL0B 1QXHA 1OE8A 4IJ3A 4LLRA 5KOWA 3ZIVA 2TIRA 1OC9A 3F6FA 5JCGA 1OKTA 3KIJA 1TRSA 4KDUA 1UVZA 3VPTA 5ECHB 3KXOA 3GURA 3CBUA 3IV4A 3NZNA 2K8VA 1LU4A 4HZ4A 4K5SA 1XG8A 1FO5A 3WGXA 2HSMA 1GTAA 1M2AA 3TJJA 4BWSA 19GSA 3F8UA 5EPFA 3KP8A 1K0NA 5IQYA 4ZBDA 4X1UA 5EL8A 3P7XA 1EEMA 2PMTA 3ED3A 2B1LA 4CY8A 4MMMA 1PGTA 1B4PA 1PA3A 3ZTLA 3GH6A 3EU4A 3A2WA 3IOSA 1F9MA 1MTCA 1SJ6A 1TU8A 1SKRB 2A2PA 4TXOB 1X9SB 1AQXA 5IMAA 1XW5A 5DDLA 12GSA 3IBHA 3KP9A 5HFGA 3HHVA 4EUYA 4A5PA 2XPDA 3TDGA 4H86A 4XTSA 4GSTA 1PX7A 3ZIJA 1R5AA 3ISOA 1RK4A 1URMA 3KTLA 3CMIA 2EIRA 1Y25A 4K2DA 4EC0A 1S3RA 1M9AA 1M99A 2MMNA 1FVJA 4EF0A 3D0ZA 4XHMA 2VCXA 4F0CA 4USSA 4WF4A 1BYEA 1T00A 5ECMB 1TK0B 2KP2A 1SYRA 2O7KA 2CQ9A 1PKZA 3E9JB 3QFBC 2C0EA 3ME7A 2C1YA 3D4MA 4Q5QA 1G6WA 5DJMA 3D5JA 2RM5A 5A4VA 4MCUA 2REMA 4WBRD 2ZNMA 2L5OA 4IN0A 3VWUA 2FWHA 2MMZA 4QL7A 2HI7A 5KN1A 1FAAA 4ML1A 1PL1A 4BIKA 3WGDA 1V98A 1NSWA 4MJEA 5ELAA 1OYJA 1UA5A 1GSYA 13GSA 2L5LA 3VURA 3P2AA 5CP1A 4YQVA 2MBTA 3IAS2 1IYHA 2OBKA 4IQ1A 2QGVA 7GSSA 1EP7A 2WFCA 4ECJA 2X8CA 3IAM2 2LJKA 1VGLA 1V58A 1F2EA 4RUVA 4PURA 5AIVA 2R0CA 4KAEA 4LL4B 2YWNA 2PBJA 3FR9A 1CQHA 3EPTA 2C80A 4CW9A 2M46A 1VRSD 2UZ8A 2VL2A 2H01A 1TI1A 5DCHA 2DJKA 4N11A 2GLRA 2ZUPA 2C0FA 3PGTA 5F07A 4ML6A 4K8MA 3D21A 1O8XA 3LG6A 4PUFC 4O5RA 4V2NA 5J9BA 5E4WA 2ON7A 3FKFA 3APOA 2ES7A 1G6YA 1U3IA 4RI6A 5INYA
chains in the Genus database with same CATH topology
3WT2A 2DSAA 2X8HA 4TR1B 3EVIA 3FY7A 4X0XA 4F03A 4MF7A 4K2XA 4FYBA 2IMKA 4HQZA 1ZOFA 2B7JA 4N10A 2HT9A 4TW5A 3IC8A 1SENA 2B5XA 4MABA 3VWWA 2NPBA 4DVCA 1R4WA 1M9BA 4AJ6A 1ZCPA 3KGKA 4Q5FA 3UMAA 2WCIA 1YEPA 5LNKe 5CREA 1X5DA 2P0GA 4IJIA 4DSSB 4KNDA 1SK1A 2V41A 1U88A 3GIXA 3UIWA 1GL8A 4WBJA 4KCEA 2ZCTA 4NHWA 2JZTA 5DALB 4K7OA 6GSXA 3M0FA 3FMWA 1AQWA 5IM9A 1EGOA 3TKSC 1JLVA 1K0MA 1QUWA 4WXTA 2DKIA 1EEJA 2JACA 5KN3A 2FD3A 1U87A 2FWEA 3HDCA 3M1GA 2WGRA 5B8AA 1O6JA 2YCDA 3QDNA 3FEUA 1Z6MA 1FVKA 1ZYNA 1FHEA 3F6DA 1Z7RA 3H93A 3BBYA 1WPIA 1G7OA 1TOFA 2HRNA 5EY6A 4ZL9A 1BEDA 1XVWA 3K8NA 3ZMLA 2JZRA 4K0NA 2XPEA 5ECSA 2VCTA 2YZHA 4V2MA 4GRFA 4ZIJA 1S3CA 5J9CA 2LEGA 4QL9A 2O89A 1W4VA 3ZMKA 4NAXA 2P31A 2V6KA 5D73A 3C8EA 2LQQA 4I5QA 3PH9A 5G1LA 4MA9A 3TUEA 1M0UA 4J57E 4KSMA 4MPGA 1QMVA 2GQLA 3UOMA 1HQOA 3VI7A 4EO3A 2XBIA 1XXUA 3UVTA 4JRRA 4ZB8A 1IYIA 2H71A 1Q98A 5ECOB 4JEDA 2LV3A 1B4QA 2PU9C 4BVYB 1AXDA 1K3YA 2L4QA 2JZSA 4ZB9A 2H0GA 2AYTA 4KW6A 5JCWA 5ABRA 4MJBA 5BRTA 2DJ0A 1HYUA 1UN2A 3PR8A 2HRFA 3TJFA 2BTOT 2GDRA 3H1NA 5DCGA 2B7KA 2AHEA 1ZGNA 1G0TA 2E2GA 3EMXA 2H30A 1YKCA 3JCML 4LA1A 2EIQA 3RPPA 4TR0A 4OFTA 1TKDB 3GKKA 3FW2A 2VCVA 2CT6A 3HZ8A 5EVOA 4I6XA 1F37A 4KA0A 5JWRB 1XW6A 3DIEA 3LWAA 5IMCA 3CTGA 1T4ZA 2C3TA 4BL7A 4KCAA 2H6ZA 2QA2A 2IFQB 4YKGA 4XRDA 3GL3A 4MZBA 2D2ZA 2DMLA 2VOCA 2L6CA 2IPAA 3KH9A 1USBA 2H1GA 4NWYA 4YQMA 2VL9A 2QA1A 4RQRA 3OR5A 3QAGA 3PPUA 2YJHA 4EE0A 2ALBA 4WETA 3TJBA 4FH8A 3ZITA 3UBLA 2FA8A 1TI3A 3IRAA 1QK8A 3N5OA 2GSRA 1BQ7A 2YP6A 3H4KA 5LCZA 6GSSA 3EURA 2I81A 1JZRA 2CVKA 3VFIA 1VF2A 3TB2A 1B9YC 5G1KA 2GQKA 3CSIA 2H0IA 1AUCA 3FHKA 4DSRA 2HZEA 3A5WA 2IMIA 2OJLA 4EDYA 3LGCA 5IO2A 5GAND 1S3DA 1XCCA 4YH2A 1KTEA 1GULA 4L0UA 1PMTA 1EV4A 1LBKA 3W8JA 3VLNA 1BAYA 4OMVA 2JL4A 5IMFA 1Z3EA 2H1AA 1JFUA 5AISA 2HFDA 2F9SA 2LJAA 1TXXA 2LJRA 1YJ6A 4ULXA 1T1VA 4O32A 2V6OA 5IPHA 4D73B 3EU3A 1OE7A 5E59A 5ENUA 1RQMA 4LMVA 4CY6A 4IP1A 3I6AA 1ABAA 2VUPA 3TKRA 1HNBA 2N5FA 5G5EA 1YY7A 2V32A 2N5BA 2TRCP 5ECKB 5IMZA 4OCFA 3LXZA 4HUAA 1O85A 4HZ2A 3HD5A 3QD9A 1OC3A 1GTIA 3TRQA 3VK9A 4JZQA 2C4JA 2FA4A 1WMJA 3C1SA 5BMUA 1ERTA 2IMDA 3GV1A 11GSA 4K5RA 5KN2A 4O92A 4HOJA 3WD6A 2I3YA 3ZVJA 2G0FA 1X5EA 4MLYA 1V9WA 3LQ7A 3DXBA 1ZYPA 3FR3A 5C04A 1YKAA 4G0KA 3G7IA 1A8LA 2QC7A 2VL2C 1XBSA 1AC1A 5CRDA 2LSTA 4L8EA 1GNEA 5D96A 3F4RA 3GRXA 3HVVA 5ECNB 3UARA 4BVXB 2H19A 1QQ2A 1A2LA 1HNCA 1SJIA 3M3MA 5A5KA 2R3XA 2XC2A 3VWVA 4X4JA 16GSA 1K0DA 10GSA 3H79A 2AV4A 1XIYA 1GLQA 2LTKA 4X43A 4PQ1A 4F2IA 1JHBA 3A3TA 22GSA 1OKDA 2HXKA 4L5OA 3W8SA 1ON4A 4I2UA 1XWAA 2HRAA 1V40A 1SJZA 4N0VA 4JR6A 4MH3A 2XBQA 4ECBA 1PN0A 3L4NA 3S9FA 2F51A 4YAPA 1X5CA 5G30A 4AGSA 2PWJA 2HYXA 1ERUA 1XOBA 4K1FA 2HSYA 2F3MA 1T4YA 3J7Yb 3ZFBA 2E7PA 1N8JA 3KCMA 4G9HA 3TGZA 2RUEA 2QSIA 2DJ1A 5IOXA 4HEA2 1MD3A 17GSA 1FB6A 4JBBA 4HU7A 3Q19A 1SU9A 4HQSA 2YWOA 9GSSA 3QFAC 3UJ1A 4TR4A 2WB9A 5DVBA 2YOIA 4K7IA 2GZPA 2H70A 4EIPA 4Z2TA 2CZ3A 3TJKA 2DIYA 5H5RA 4PGTA 1VF1A 3QR6A 3GUSA 2CVDA 4PUAA 3VI5A 2E2MA 4NXIA 2OE0A 4KX4A 2FWFA 5CYYA 1GH2A 2YNXA 3HA9A 4ZILA 1Z9HA 4MJAA 2M80A 3TOTA 3FRCA 1YEXA 2JSYA 4XS4B 3QAVA 2Z9SA 4GTUA 2FUG2 4EL1A 4ZXGA 1ILOA 4ZL8A 2C0DA 1GUKA 1K0CA 2MYGA 4KDYA 1XWKA 5HQPA 2LRNA 2GSQA 2EIOA 3QPMA 6GSYA 1SD9A 2RIIA 3N9JA 1K3OA 3WT1A 2VD0A 4BWQA 2AB6A 3I69A 1XFLA 1Z6NA 2I4AA 4G0LA 2IJYA 3L0HA 4F9ZA 3O3TA 2FHEA 1MEKA 1OVNA 4I8BA 1AW9A 3KMOA 3EE2A 2WRTA 3ZREA 3M9JA 3HCZA 1M7TA 3ERWA 1U6TA 5ID2B 1ZZYA 2RLIA 3V1WA 3C71A 3F3RA 5L71A 3EC3A 5HFKA 2R5GA 1MDKA 4BPYA 2FCHA 3UAPA 3ME8A 3LYKA 4KH7A 1DBYA 1BX9A 2KOKA 3LXTA 3DWVA 4MZCA 2WS2A 5D8IA 1GTUA 4MPFA 4OD7A 1TRUA 5IPGA 2FGXA 1K3LA 2B6MA 2LRTA 5A4WA 4XCSA 1C72A 4WKWA 3GKMA 1TK8B 2WZ9A 4RI7A 2L6DA 4Q5RA 4HJMA 3GN3A 1XWCA 1XWGA 4BL7B 1K0OA 1SL1B 1A0RP 2R6KA 2I1UA 2LUSA 3ZRDA 3LJRA 3GTUA 1M2BA 4DSQA 4MF6A 3LEFA 5F06A 2B1KA 2O87A 4FIWA 4QQ7A 5GSSA 3HJOA 3IE3A 2C3NA 1NM3A 3EINA 5B7CA 4POLA 3ZLPA 2H72A 1ERVA 4WR4A 4PQHA 3PINA 2OADA 1JZOA 1WP0A 1O7UA 3MDKA 1HD2A 2C3QA 4POKA 2VAFA 4YKFA 3CYNA 4MH2A 5COHA 2K8SA 2RM6A 3GHAA 4G19A 2HZEB 4AJ8A 4DEJA 3HJMA 1GSEA 2KP1A 2BMXA 2HLSA 2VO4A 4KSOA 2A2SA 5C00A 3F63A 3VPQA 3TCOA 4TR1A 3O6TA 1U3AA 1GP1A 1T3BA 2GS3A 2CAIA 1ZYQB 2X8GA 1XZOA 5ELGA 2DJ3A 1PKWA 2MMOA 2VCQA 1A23A 3FYGA 1GNWA 1VF3A 3LORA 1YQ1A 2YWIA 4G10A 2IIYA 2YV7A 3MNGA 3IXRA 4TRXA 3BD2A 1EOGA 3FZ4A 2GSSA 4JU5A 1JLWA 2LS5A 3HVXA 2NDOA 4E8HA 1XWBA 4PX1A 1ERWA 1OC9B 4J56E 5ECIB 3LFLA 4KF9A 3NOFA 3TRPA 5DALA 2GQMA 2VCWA 2VM1A 4HI7A 4TOPA 2OKAA 2VCZA 3UL3A 1TDIA 5D9TA 1PN9A 3RBTA 5G2ZA 3Q74A 6GSTA 2DLXA 1TJDA 4O7HA 1T8EB 3TKQA 5D9XA 5DBQA 4ZL7A 1J0FA 2DJJA 1A2JA 5ECPB 4AF2A 3HXSA 2GT5A 4TVEA 2GGTA 2CVBA 4EKZA 3GKNA 5ECQB 1FG4A 8GSSA 2MMAA 2JSZA 4GQFA 3W6GA 2FNOA 2CZ2A 2ON5A 4N30A 1TK5B 1SD8A 4RQXA 4EDZA 1A2MA 1ZMAA 3F9UA 3IDVA 2DKHA 3DKSA 4KB3A 3LYPA 1DE2A 2HRKA 3DYRA 5IIZA 3CRTA 4EVMA 4ID0A 2I9HA 4G2EA 5AN1A 4MJCA 4POBA 1KBNA 3KM6A 1VF4A 4IELA 5CO3A 2K18A 5DAKA 4XIHA 4BVYA 4OO5A 4XS1A 1PD21 3G7YA 3US3A 4IKHA 1TTZA 1S3AA 3EWLA 1OC8A 2LRCA 5F0GA 1THXA 4Z7XA 2C8UA 1ST9A 1MDJA 3C73A 2O8VB 5HR3A 2A4VA 3IHGA 3UVHA 2R0PA 1BG5A 1H4OA 2OE3A 2YZUA 1XW9A 4IGJA 4OCEA 5B6MA 4FQUA 2A4HA 5D9VA 2V2GA 2IWTA 3TOUA 3Q18A 3IPZA 3EYTA 2H66A 1GSSA 1DE1A 3F3QA 4TXVA 3KH7A 2LQOA 2VIMA 14GSA 4XRAA 2B5EA 5AIXA 5JCUA 1DUGA 4K9ZA 2GVPA 5IO0A 5CAXA 3KTBA 5D9WA 4YAVA 2X4AA 2HZFA 2IFQA 1FB0A 2GSTA 2H1DA 3UBKA 5FWGA 3P8WA 4IBPA 2F8FA 1Z5YE 2L57A 2OA7A 3HY2A 5HR2A 5FHIA 5J41A 1SK0A 5GZZB 1SL2B 4MZWA 3ZZXA 1Z7PA 2GZYA 2CX4A 2IN3A 2YN1A 1J08A 1G7EA 4IW9A 5CRGA 1OAZA 1EP8A 3DGQA 4Q5NA 4ICYA 3EMPA 1GWCA 1SYXA 2OBIA 1CQGA 2PUKC 3DMLA 3M9KA 3IR4A 4NV2A 4NHZA 3WYWA 4OFMA 2RUFA 2YV9A 3WGEA 1YF0A 1GSDA 4PNFA 3ERFA 1ML6A 2GTUA 4I97A 1SKWB 1AQVA 2PN8A 4IHUA 3U6VA 4HS1A 3A2XA 1GSFA 2DC5A 5HR1A 1EV9A 3KZQA 3E0UA 2CAQA 2AAWA 1NHOA 1XOAA 4P3YB 1THOA 3C1RA 3GYKA 2VD1A 2K6VA 5DQSA 3KMNA 2K9FA 4D73A 2VL3A 1I9DA 5ECLB 4GQCA 2HNLA 3L9SA 3GX8A 2PVOC 2B5YA 3UEMA 1TP9A 4AJ7A 2H8LA 4EIQA 3DVWA 3L78A 3L9VA 4POMA 2DIZA 3ZVJD 1R5PA 4WR5A 3MSZA 3GX0A 2R4VA 4OFNA 4O5QA 3QAWA 3ZL5A 4ACSA 1TU7A 2IL3A 2H75A 4WEYA 3FR6A 2R37A 1XPVA 4LMWA 2H76A 3HKRA 3HYPA 2FLSA 5CRHA 4ECCA 4PNGA 2E0QA 2NVLA 1B48A 1FOVA 2XHFA 1PX6A 3GTUB 2NTOA 1QFNA 2G2QA 1I5GA 1E2YA 5KN0A 5J3RA 4PXOA 3QCPA 2DMMA 4TXOA 1ZYEA 3CSHA 3G9BA 2IMEA 3QOUA 4CDOA 4BVXA 3GSSA 4CHSA 1E6BA 5DQYA 1GUHA 4K6XA 5A4UA 1FOHA 3CSJA 1MD4A 2YWMA 2GT6A 1GSUA 3RHCA 4Z2UA 1WWJA 1F3AA 3GMFA 4IP6A 4PTSA 4TKYA 3D4TA 4KGIA 1GUMA 1KEBA 2HSHA 2H73A 2J23A 2CV4A 1MDIA 1YZXA 3FZ9A 2MBSA 3RHBA 3TKPA 4GWRA 1A8YA 3D6IA 1WIKA 3R2QA 5FT3A 2VM2A 4NV5A 3SBCA 1WJKA 2JADA 1BJXA 3GNJA 5G5FA 3U5RE 1F3BA 3L9UA 5B6NA 4OO4A 4MDCA 5J5NA 1B9XC 1V2AA 5KEJA 2A2RA 1JZWA 4V1Ag 1KNGA 2PGTA 1N2AA 1X0RA 3SWLA 4O5UA 3NIVA 5IOWA 4ECIA 2AUVA 2VLUA 2R2JA 3F4SA 4KUNA 3GH9A 1PL2A 1YDKA 2O85A 3IK7A 3O76A 1JZDA 3MIXA 3F4TA 4JE1A 1O8WA 1ZL9A 4MK3A 2P5QA 2BJXA 5GSTA 4IQAA 3GFKA 1SK2A 2WDUA 3VWXA 2YANA 3F0IA 4NPBA 1K0BA 1K0AA 3A2VA 2N5AA 4GCIA 4F0BA 3KD0A 4MNNA 18GSA 1AAZA 4TR3A 2F8AA 3ZFLA 4HU9A 4MP4A 4HJ2A 4GSSA 4IVFA 3M8NA 1EOHA 3GSTA 2OACA 4FO5A 3GKXA 5ECRB 3P90A 2X49A 3ERGA 1O81A 3FZ5A 4WF5A 5AGYA 3KEBA 1QGVA 2C0GA 3CRUA 1O73A 2VLVA 5HR0A 4V2LA 1LJRA 4XS4A 2M72A 1XVQA 2L59A 2VLTA 4MF5A 1PSQA 1V57A 5HFIA 5H5SA 3LW9A 4GLTA 4TN8A 5GAPD 4ISDA 1GRXA 4GF0A 2EC4A 5F05A 1T7PB 3E3EA 2H6YA 2YPMA 3QMXA 2CX3A 2QKEA 3AY8A 5F8BA 3DEXA 1X9MB 2PVQA 2LNTA 4HDEA 5H5QA 2PERA 3D22A 5JWQB 1H75A 3BJ5A 5DAKB 3DVXA 2X64A 3C7MA 4L5LA 2OE1A 4K7NA 1PRXA 2PPTA 4J2FA 1EZKA 3IK9A 4NMUA 2H6XA 4XS6A 4E8EA 3RPNA 3H8QA 4LL1B 3I43A 2B3SA 4KDXA 1WOUA 1M2DA 2HE3A 4IS0A 2TRXA 2H1BA 1NHYA 4JR4A 1Q4JA 5ID2A 4V1Ap 4DSSA 1FW1A 1UC7A 3BCIA 1ACVA 1EWXA 4OWYA 1HNAA 5DJLA 3CXGA 3DRNA 4KE3A 3MWHA 5KOXA 1WRYA 2WJUA 4FYUA 4FYCA 2LNSA 1WE0A 2V1MA 6GSWA 3BCKA 3HZ4A 2P5RA 3HVSA 5G31A 5B8BA 4ZBAA 3TRXA 3A5IA 5J4UA 4F82A 2KLXA 2FWGA 2AJQB 3IA1A 3TKSA 3I9V2 4ZBBA 3APQA 2FY6A 2DBCA 1TW9A 1W89A 5IMDA 3LSZA 1TRWA 6GSUA 2DJ2A 4L0WA 3G7JA 4YQUA 1R7HA 3GL5A 1B8XA 1NW2A 1AIUA 1R26A 1X9WB 1A0FA 1PQNA 4N0ZA 3IHQA 5CNWA 1F6MC 3CTFA 2R0GA 1RW1A 5CRWA 3J7Yk 1YF1A 4Z2RA 2LKUA 4EXJA 3APSA 2L4CA 2KUCA 1Y6EA 2J9HA 2X99A 4G0IA 5JWOB 1GLPA 2H0HA 2JU5A 4ZB6A 1A24A 4GXZA 1SKSB 4K0GA 4I2TA 4PQIA 3MAKA 5IMVA 2YJ7A 3ZYWA 2KHPA 2MZCA 2WULA 3GA4A 3RDWA 3FZAA 3TKSE 4GSNA 1TRVA 2CA8A 2GZZA 5LD0A 1DSBA 2IMFA 4BA7A 3BOAA 1J9BA 3KJYA 4ILFA 3DD3A 20GSA 5D93A 2NBSA 3HJPA 3IC4A 3R3EA 1EGRA 3FK8A 3RAZA 3Q6OA 2H74A 3MYDA 3TJGA 6GSVA 1GTBA 1GSQA 1SL0B 1QXHA 1OE8A 4IJ3A 4LLRA 5KOWA 3ZIVA 2TIRA 1OC9A 3F6FA 5JCGA 1OKTA 3KIJA 1TRSA 4KDUA 1UVZA 3VPTA 5ECHB 3KXOA 3GURA 3CBUA 3IV4A 3NZNA 2K8VA 1LU4A 4HZ4A 4K5SA 1FO5A 3WGXA 2HSMA 1GTAA 1M2AA 3TJJA 4BWSA 19GSA 3F8UA 5EPFA 3KP8A 1K0NA 5IQYA 4ZBDA 4X1UA 5EL8A 3P7XA 1EEMA 2PMTA 3ED3A 2B1LA 4CY8A 4MMMA 1PGTA 1B4PA 1PA3A 3ZTLA 3GH6A 3EU4A 3A2WA 3IOSA 1F9MA 1MTCA 1SJ6A 1TU8A 1SKRB 2A2PA 4TXOB 1X9SB 1AQXA 5IMAA 1XW5A 5DDLA 12GSA 3IBHA 3KP9A 5HFGA 3HHVA 4EUYA 4A5PA 2XPDA 3TDGA 4H86A 4XTSA 4GSTA 1PX7A 3ZIJA 1R5AA 3ISOA 1RK4A 1URMA 3KTLA 3CMIA 2EIRA 1Y25A 4K2DA 4EC0A 1M9AA 1M99A 2MMNA 1FVJA 4EF0A 3D0ZA 4XHMA 2VCXA 4F0CA 4USSA 4WF4A 1BYEA 1T00A 5ECMB 1TK0B 2KP2A 1SYRA 2O7KA 2CQ9A 1PKZA 3E9JB 3QFBC 2C0EA 3ME7A 2C1YA 3D4MA 4Q5QA 1G6WA 5DJMA 3D5JA 2RM5A 5A4VA 4MCUA 2REMA 4WBRD 2ZNMA 2L5OA 4IN0A 3VWUA 2FWHA 2MMZA 4QL7A 2HI7A 5KN1A 1FAAA 4ML1A 1PL1A 3WGDA 1V98A 1NSWA 4MJEA 5ELAA 1OYJA 1UA5A 1GSYA 13GSA 2L5LA 3VURA 3P2AA 5CP1A 4YQVA 2MBTA 3IAS2 1IYHA 2OBKA 4IQ1A 2QGVA 7GSSA 1EP7A 2WFCA 4ECJA 2X8CA 3IAM2 2LJKA 1VGLA 1V58A 1F2EA 4RUVA 4PURA 5AIVA 2R0CA 4KAEA 4LL4B 2YWNA 2PBJA 3FR9A 1CQHA 3EPTA 2C80A 4CW9A 2M46A 1VRSD 2UZ8A 2VL2A 2H01A 1TI1A 5DCHA 2DJKA 4N11A 2GLRA 2ZUPA 2C0FA 3PGTA 5F07A 4ML6A 4K8MA 3D21A 1O8XA 3LG6A 4PUFC 4O5RA 4V2NA 5J9BA 5E4WA 2ON7A 3FKFA 3APOA 2ES7A 1G6YA 1U3IA 4RI6A 5INYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WT2 A;  2DSA A;  2X8H A;  4TR1 B;  3EVI A;  3FY7 A;  4X0X A;  4F03 A;  4MF7 A;  4FYB A;  2IMK A;  4HQZ A;  1ZOF A;  2B7J A;  4N10 A;  2HT9 A;  4TW5 A;  1SEN A;  2B5X A;  4MAB A;  3VWW A;  2NPB A;  4DVC A;  1R4W A;  1M9B A;  4AJ6 A;  1ZCP A;  3KGK A;  4Q5F A;  3UMA A;  2WCI A;  1YEP A;  5LNK e;  5CRE A;  1X5D A;  2P0G A;  4IJI A;  4DSS B;  4KND A;  1SK1 A;  2V41 A;  1U88 A;  3GIX A;  3UIW A;  1GL8 A;  4WBJ A;  4KCE A;  2ZCT A;  4NHW A;  2JZT A;  5DAL B;  4K7O A;  6GSX A;  3M0F A;  1AQW A;  5IM9 A;  1EGO A;  3TKS C;  1JLV A;  1K0M A;  1QUW A;  4WXT A;  1EEJ A;  2JAC A;  5KN3 A;  2FD3 A;  1U87 A;  2FWE A;  3HDC A;  3M1G A;  2WGR A;  5B8A A;  1O6J A;  2YCD A;  3QDN A;  3FEU A;  1Z6M A;  1FVK A;  1FHE A;  3F6D A;  1Z7R A;  3H93 A;  3BBY A;  1WPI A;  1G7O A;  1TOF A;  2HRN A;  5EY6 A;  4ZL9 A;  1BED A;  1XVW A;  3K8N A;  3ZML A;  2JZR A;  4K0N A;  2XPE A;  5ECS A;  2VCT A;  2YZH A;  4V2M A;  4GRF A;  4ZIJ A;  1S3C A;  5J9C A;  2LEG A;  4QL9 A;  2O89 A;  1W4V A;  3ZMK A;  4NAX A;  2P31 A;  2V6K A;  5D73 A;  3C8E A;  2LQQ A;  4I5Q A;  3PH9 A;  5G1L A;  4MA9 A;  3TUE A;  1M0U A;  4J57 E;  4KSM A;  4MPG A;  1QMV A;  2GQL A;  3UOM A;  1HQO A;  3VI7 A;  4EO3 A;  2XBI A;  1XXU A;  3UVT A;  4JRR A;  4ZB8 A;  1IYI A;  2H71 A;  1Q98 A;  5ECO B;  4JED A;  2LV3 A;  1B4Q A;  2PU9 C;  1AXD A;  1K3Y A;  2L4Q A;  2JZS A;  4ZB9 A;  2H0G A;  2AYT A;  4KW6 A;  5JCW A;  5ABR A;  4MJB A;  2DJ0 A;  1HYU A;  1UN2 A;  3PR8 A;  2HRF A;  3TJF A;  2BTO T;  2GDR A;  3H1N A;  5DCG A;  2B7K A;  2AHE A;  1ZGN A;  1G0T A;  2E2G A;  3EMX A;  2H30 A;  1YKC A;  3JCM L;  4LA1 A;  2EIQ A;  3RPP A;  4TR0 A;  4OFT A;  1TKD B;  3GKK A;  3FW2 A;  2VCV A;  2CT6 A;  3HZ8 A;  5EVO A;  4I6X A;  1F37 A;  4KA0 A;  5JWR B;  1XW6 A;  3DIE A;  3LWA A;  5IMC A;  3CTG A;  1T4Z A;  2C3T A;  4BL7 A;  4KCA A;  2H6Z A;  2IFQ B;  4XRD A;  3GL3 A;  4MZB A;  2D2Z A;  2DML A;  2VOC A;  2L6C A;  2IPA A;  3KH9 A;  1USB A;  2H1G A;  4NWY A;  4YQM A;  2VL9 A;  4RQR A;  3OR5 A;  3QAG A;  2YJH A;  4EE0 A;  2ALB A;  4WET A;  3TJB A;  4FH8 A;  3ZIT A;  3UBL A;  2FA8 A;  1TI3 A;  3IRA A;  1QK8 A;  3N5O A;  2GSR A;  1BQ7 A;  2YP6 A;  3H4K A;  5LCZ A;  6GSS A;  3EUR A;  2I81 A;  1JZR A;  2CVK A;  3VFI A;  1VF2 A;  3TB2 A;  1B9Y C;  5G1K A;  2GQK A;  3CSI A;  2H0I A;  1AUC A;  3FHK A;  4DSR A;  2HZE A;  3A5W A;  2IMI A;  2OJL A;  4EDY A;  3LGC A;  5IO2 A;  5GAN D;  1S3D A;  1XCC A;  4YH2 A;  1KTE A;  1GUL A;  4L0U A;  1PMT A;  1EV4 A;  1LBK A;  3W8J A;  3VLN A;  1BAY A;  4OMV A;  2JL4 A;  5IMF A;  1Z3E A;  2H1A A;  1JFU A;  5AIS A;  2HFD A;  2F9S A;  2LJA A;  1TXX A;  2LJR A;  1YJ6 A;  4ULX A;  1T1V A;  4O32 A;  2V6O A;  5IPH A;  4D73 B;  3EU3 A;  1OE7 A;  5E59 A;  5ENU A;  1RQM A;  4LMV A;  4IP1 A;  3I6A A;  1ABA A;  2VUP A;  3TKR A;  1HNB A;  2N5F A;  5G5E A;  1YY7 A;  2V32 A;  2N5B A;  2TRC P;  5ECK B;  5IMZ A;  4OCF A;  3LXZ A;  4HUA A;  1O85 A;  4HZ2 A;  3HD5 A;  3QD9 A;  1OC3 A;  1GTI A;  3TRQ A;  3VK9 A;  4JZQ A;  2C4J A;  2FA4 A;  1WMJ A;  3C1S A;  1ERT A;  2IMD A;  3GV1 A;  11GS A;  5KN2 A;  4O92 A;  4HOJ A;  3WD6 A;  2I3Y A;  3ZVJ A;  2G0F A;  1X5E A;  4MLY A;  1V9W A;  3LQ7 A;  3DXB A;  3FR3 A;  5C04 A;  1YKA A;  3G7I A;  1A8L A;  2QC7 A;  2VL2 C;  1XBS A;  1AC1 A;  5CRD A;  2LST A;  4L8E A;  1GNE A;  5D96 A;  3F4R A;  3GRX A;  3HVV A;  5ECN B;  3UAR A;  2H19 A;  1QQ2 A;  1A2L A;  1HNC A;  1SJI A;  3M3M A;  5A5K A;  2R3X A;  2XC2 A;  3VWV A;  16GS A;  1K0D A;  10GS A;  3H79 A;  2AV4 A;  1XIY A;  1GLQ A;  2LTK A;  4X43 A;  4PQ1 A;  4F2I A;  1JHB A;  3A3T A;  22GS A;  1OKD A;  2HXK A;  4L5O A;  3W8S A;  1ON4 A;  4I2U A;  1XWA A;  1V40 A;  1SJZ A;  4N0V A;  4JR6 A;  4MH3 A;  2XBQ A;  4ECB A;  3L4N A;  3S9F A;  2F51 A;  4YAP A;  1X5C A;  5G30 A;  4AGS A;  2PWJ A;  2HYX A;  1ERU A;  1XOB A;  4K1F A;  2HSY A;  2F3M A;  1T4Y A;  3J7Y b;  3ZFB A;  2E7P A;  1N8J A;  3KCM A;  4G9H A;  3TGZ A;  2RUE A;  2QSI A;  2DJ1 A;  5IOX A;  4HEA 2;  1MD3 A;  17GS A;  1FB6 A;  4JBB A;  4HU7 A;  3Q19 A;  1SU9 A;  4HQS A;  2YWO A;  9GSS A;  3QFA C;  3UJ1 A;  4TR4 A;  2WB9 A;  5DVB A;  2YOI A;  4K7I A;  2GZP A;  2H70 A;  2CZ3 A;  3TJK A;  2DIY A;  5H5R A;  4PGT A;  1VF1 A;  3QR6 A;  3GUS A;  2CVD A;  4PUA A;  3VI5 A;  2E2M A;  4NXI A;  2OE0 A;  4KX4 A;  2FWF A;  5CYY A;  1GH2 A;  2YNX A;  3HA9 A;  4ZIL A;  1Z9H A;  4MJA A;  2M80 A;  3TOT A;  3FRC A;  1YEX A;  2JSY A;  4XS4 B;  3QAV A;  2Z9S A;  4GTU A;  2FUG 2;  4EL1 A;  4ZXG A;  1ILO A;  4ZL8 A;  2C0D A;  1GUK A;  1K0C A;  2MYG A;  4KDY A;  1XWK A;  5HQP A;  2LRN A;  2GSQ A;  2EIO A;  3QPM A;  6GSY A;  1SD9 A;  2RII A;  3N9J A;  1K3O A;  3WT1 A;  2VD0 A;  4BWQ A;  2AB6 A;  3I69 A;  1XFL A;  1Z6N A;  2I4A A;  2IJY A;  3L0H A;  4F9Z A;  3O3T A;  2FHE A;  1MEK A;  1OVN A;  4I8B A;  1AW9 A;  3KMO A;  3EE2 A;  2WRT A;  3ZRE A;  3M9J A;  3HCZ A;  1M7T A;  3ERW A;  1U6T A;  5ID2 B;  1ZZY A;  2RLI A;  3V1W A;  3C71 A;  3F3R A;  5L71 A;  3EC3 A;  5HFK A;  2R5G A;  1MDK A;  4BPY A;  2FCH A;  3UAP A;  3ME8 A;  3LYK A;  4KH7 A;  1DBY A;  1BX9 A;  2KOK A;  3LXT A;  3DWV A;  4MZC A;  2WS2 A;  5D8I A;  1GTU A;  4MPF A;  4OD7 A;  1TRU A;  5IPG A;  2FGX A;  1K3L A;  2B6M A;  2LRT A;  5A4W A;  4XCS A;  1C72 A;  4WKW A;  3GKM A;  1TK8 B;  2WZ9 A;  4RI7 A;  2L6D A;  4Q5R A;  4HJM A;  3GN3 A;  1XWC A;  1XWG A;  1K0O A;  1SL1 B;  1A0R P;  2R6K A;  2I1U A;  2LUS A;  3ZRD A;  3LJR A;  3GTU A;  1M2B A;  4DSQ A;  4MF6 A;  3LEF A;  5F06 A;  2B1K A;  2O87 A;  4FIW A;  4QQ7 A;  5GSS A;  3HJO A;  3IE3 A;  2C3N A;  1NM3 A;  3EIN A;  5B7C A;  4POL A;  3ZLP A;  2H72 A;  1ERV A;  4WR4 A;  4PQH A;  3PIN A;  2OAD A;  1JZO A;  1WP0 A;  1O7U A;  3MDK A;  1HD2 A;  2C3Q A;  4POK A;  2VAF A;  3CYN A;  4MH2 A;  5COH A;  2K8S A;  2RM6 A;  3GHA A;  4G19 A;  2HZE B;  4AJ8 A;  4DEJ A;  3HJM A;  1GSE A;  2KP1 A;  2BMX A;  2HLS A;  2VO4 A;  4KSO A;  2A2S A;  5C00 A;  3F63 A;  3VPQ A;  3TCO A;  4TR1 A;  3O6T A;  1U3A A;  1GP1 A;  1T3B A;  2GS3 A;  2CAI A;  1ZYQ B;  2X8G A;  1XZO A;  5ELG A;  2DJ3 A;  1PKW A;  2MMO A;  2VCQ A;  1A23 A;  3FYG A;  1GNW A;  1VF3 A;  3LOR A;  1YQ1 A;  2YWI A;  4G10 A;  2IIY A;  2YV7 A;  3MNG A;  3IXR A;  4TRX A;  3BD2 A;  1EOG A;  3FZ4 A;  2GSS A;  4JU5 A;  1JLW A;  2LS5 A;  3HVX A;  2NDO A;  4E8H A;  1XWB A;  4PX1 A;  1ERW A;  1OC9 B;  4J56 E;  5ECI B;  3LFL A;  3NOF A;  3TRP A;  5DAL A;  2GQM A;  2VCW A;  2VM1 A;  4HI7 A;  4TOP A;  2OKA A;  2VCZ A;  3UL3 A;  1TDI A;  5D9T A;  1PN9 A;  3RBT A;  5G2Z A;  3Q74 A;  6GST A;  2DLX A;  1TJD A;  4O7H A;  1T8E B;  3TKQ A;  5D9X A;  5DBQ A;  4ZL7 A;  1J0F A;  2DJJ A;  1A2J A;  5ECP B;  4AF2 A;  3HXS A;  2GT5 A;  4TVE A;  2GGT A;  2CVB A;  4EKZ A;  3GKN A;  5ECQ B;  1FG4 A;  8GSS A;  2MMA A;  2JSZ A;  4GQF A;  3W6G A;  2FNO A;  2CZ2 A;  2ON5 A;  4N30 A;  1TK5 B;  1SD8 A;  4RQX A;  4EDZ A;  1A2M A;  1ZMA A;  3F9U A;  3IDV A;  3DKS A;  4KB3 A;  3LYP A;  1DE2 A;  3DYR A;  5IIZ A;  3CRT A;  4EVM A;  4ID0 A;  2I9H A;  4G2E A;  5AN1 A;  4MJC A;  4POB A;  1KBN A;  3KM6 A;  1VF4 A;  4IEL A;  5CO3 A;  2K18 A;  5DAK A;  4XIH A;  4BVY A;  4OO5 A;  4XS1 A;  1PD2 1;  3G7Y A;  3US3 A;  4IKH A;  1TTZ A;  1S3A A;  3EWL A;  1OC8 A;  2LRC A;  5F0G A;  1THX A;  4Z7X A;  2C8U A;  1ST9 A;  1MDJ A;  3C73 A;  2O8V B;  5HR3 A;  2A4V A;  3UVH A;  1BG5 A;  1H4O A;  2OE3 A;  2YZU A;  1XW9 A;  4IGJ A;  4OCE A;  5B6M A;  5D9V A;  2V2G A;  2IWT A;  3TOU A;  3Q18 A;  3IPZ A;  3EYT A;  2H66 A;  1GSS A;  1DE1 A;  3F3Q A;  4TXV A;  3KH7 A;  2LQO A;  2VIM A;  14GS A;  4XRA A;  2B5E A;  5AIX A;  5JCU A;  1DUG A;  4K9Z A;  2GVP A;  5IO0 A;  5CAX A;  3KTB A;  5D9W A;  4YAV A;  2HZF A;  2IFQ A;  1FB0 A;  2GST A;  2H1D A;  3UBK A;  5FWG A;  3P8W A;  4IBP A;  2F8F A;  1Z5Y E;  2L57 A;  2OA7 A;  3HY2 A;  5HR2 A;  5FHI A;  5J41 A;  1SK0 A;  5GZZ B;  1SL2 B;  4MZW A;  3ZZX A;  1Z7P A;  2GZY A;  2CX4 A;  2IN3 A;  2YN1 A;  1J08 A;  1G7E A;  4IW9 A;  5CRG A;  1OAZ A;  1EP8 A;  3DGQ A;  4Q5N A;  3EMP A;  1GWC A;  1SYX A;  2OBI A;  1CQG A;  2PUK C;  3DML A;  3M9K A;  3IR4 A;  4NV2 A;  4NHZ A;  3WYW A;  4OFM A;  2RUF A;  2YV9 A;  3WGE A;  1YF0 A;  1GSD A;  4PNF A;  3ERF A;  1ML6 A;  2GTU A;  4I97 A;  1SKW B;  1AQV A;  2PN8 A;  4IHU A;  3U6V A;  4HS1 A;  3A2X A;  1GSF A;  2DC5 A;  5HR1 A;  1EV9 A;  3KZQ A;  3E0U A;  2CAQ A;  2AAW A;  1NHO A;  1XOA A;  4P3Y B;  1THO A;  3C1R A;  3GYK A;  2VD1 A;  2K6V A;  5DQS A;  3KMN A;  2K9F A;  4D73 A;  2VL3 A;  1I9D A;  5ECL B;  4GQC A;  2HNL A;  3L9S A;  3GX8 A;  2PVO C;  2B5Y A;  3UEM A;  1TP9 A;  4AJ7 A;  2H8L A;  3DVW A;  3L78 A;  3L9V A;  4POM A;  2DIZ A;  3ZVJ D;  1R5P A;  4WR5 A;  3MSZ A;  3GX0 A;  2R4V A;  4OFN A;  3QAW A;  3ZL5 A;  4ACS A;  1TU7 A;  2IL3 A;  2H75 A;  4WEY A;  3FR6 A;  2R37 A;  1XPV A;  4LMW A;  2H76 A;  3HKR A;  3HYP A;  2FLS A;  5CRH A;  4ECC A;  4PNG A;  2E0Q A;  2NVL A;  1B48 A;  1FOV A;  2XHF A;  1PX6 A;  3GTU B;  2NTO A;  1QFN A;  2G2Q A;  1I5G A;  1E2Y A;  5KN0 A;  5J3R A;  4PXO A;  3QCP A;  2DMM A;  4TXO A;  1ZYE A;  3CSH A;  3G9B A;  2IME A;  3QOU A;  4CDO A;  4BVX A;  3GSS A;  4CHS A;  1E6B A;  5DQY A;  1GUH A;  4K6X A;  5A4U A;  3CSJ A;  1MD4 A;  2YWM A;  2GT6 A;  1GSU A;  3RHC A;  1WWJ A;  1F3A A;  3GMF A;  4IP6 A;  4TKY A;  3D4T A;  4KGI A;  1GUM A;  1KEB A;  2HSH A;  2H73 A;  2J23 A;  2CV4 A;  1MDI A;  1YZX A;  3FZ9 A;  2MBS A;  3RHB A;  3TKP A;  4GWR A;  1A8Y A;  3D6I A;  1WIK A;  3R2Q A;  5FT3 A;  2VM2 A;  4NV5 A;  3SBC A;  1WJK A;  2JAD A;  1BJX A;  3GNJ A;  5G5F A;  3U5R E;  1F3B A;  3L9U A;  5B6N A;  4OO4 A;  4MDC A;  5J5N A;  1B9X C;  1V2A A;  5KEJ A;  2A2R A;  1JZW A;  4V1A g;  1KNG A;  2PGT A;  1N2A A;  1X0R A;  3SWL A;  3NIV A;  5IOW A;  4ECI A;  2AUV A;  2VLU A;  2R2J A;  3F4S A;  4KUN A;  3GH9 A;  1PL2 A;  1YDK A;  2O85 A;  3IK7 A;  3O76 A;  1JZD A;  3F4T A;  4JE1 A;  1O8W A;  1ZL9 A;  4MK3 A;  2P5Q A;  2BJX A;  5GST A;  4IQA A;  3GFK A;  1SK2 A;  2WDU A;  3VWX A;  2YAN A;  3F0I A;  4NPB A;  1K0B A;  1K0A A;  3A2V A;  2N5A A;  4GCI A;  4F0B A;  3KD0 A;  18GS A;  1AAZ A;  4TR3 A;  2F8A A;  3ZFL A;  4HU9 A;  4MP4 A;  4HJ2 A;  4GSS A;  4IVF A;  3M8N A;  1EOH A;  3GST A;  2OAC A;  4FO5 A;  3GKX A;  5ECR B;  3P90 A;  3ERG A;  1O81 A;  3FZ5 A;  4WF5 A;  5AGY A;  3KEB A;  1QGV A;  2C0G A;  3CRU A;  1O73 A;  2VLV A;  5HR0 A;  4V2L A;  1LJR A;  4XS4 A;  2M72 A;  1XVQ A;  2L59 A;  2VLT A;  4MF5 A;  1PSQ A;  1V57 A;  5HFI A;  5H5S A;  5GAP D;  4GLT A;  4TN8 A;  4ISD A;  1GRX A;  4GF0 A;  2EC4 A;  5F05 A;  1T7P B;  3E3E A;  2H6Y A;  2YPM A;  3QMX A;  2CX3 A;  2QKE A;  3AY8 A;  5F8B A;  3DEX A;  1X9M B;  2PVQ A;  2LNT A;  4HDE A;  5H5Q A;  2PER A;  3D22 A;  5JWQ B;  1H75 A;  3BJ5 A;  5DAK B;  3DVX A;  2X64 A;  3C7M A;  4L5L A;  2OE1 A;  4K7N A;  1PRX A;  2PPT A;  4J2F A;  1EZK A;  3IK9 A;  4NMU A;  2H6X A;  4XS6 A;  4E8E A;  3RPN A;  3H8Q A;  4LL1 B;  3I43 A;  2B3S A;  4KDX A;  1WOU A;  1M2D A;  2HE3 A;  4IS0 A;  2TRX A;  2H1B A;  1NHY A;  4JR4 A;  1Q4J A;  5ID2 A;  4V1A p;  4DSS A;  1FW1 A;  1UC7 A;  3BCI A;  1ACV A;  1EWX A;  4OWY A;  1HNA A;  5DJL A;  3CXG A;  3DRN A;  4KE3 A;  3MWH A;  1WRY A;  2WJU A;  4FYU A;  4FYC A;  2LNS A;  1WE0 A;  2V1M A;  6GSW A;  3BCK A;  3HZ4 A;  2P5R A;  3HVS A;  5G31 A;  5B8B A;  4ZBA A;  3TRX A;  5J4U A;  4F82 A;  2KLX A;  2FWG A;  2AJQ B;  3IA1 A;  3TKS A;  3I9V 2;  4ZBB A;  3APQ A;  2FY6 A;  2DBC A;  1TW9 A;  1W89 A;  5IMD A;  3LSZ A;  1TRW A;  6GSU A;  2DJ2 A;  4L0W A;  3G7J A;  4YQU A;  1R7H A;  3GL5 A;  1B8X A;  1NW2 A;  1AIU A;  1R26 A;  1X9W B;  1A0F A;  1PQN A;  4N0Z A;  3IHQ A;  5CNW A;  1F6M C;  3CTF A;  1RW1 A;  5CRW A;  3J7Y k;  1YF1 A;  2LKU A;  4EXJ A;  3APS A;  2L4C A;  2KUC A;  1Y6E A;  2J9H A;  2X99 A;  5JWO B;  1GLP A;  2H0H A;  2JU5 A;  4ZB6 A;  1A24 A;  4GXZ A;  1SKS B;  4K0G A;  4I2T A;  4PQI A;  3MAK A;  5IMV A;  2YJ7 A;  3ZYW A;  2KHP A;  2MZC A;  2WUL A;  3GA4 A;  3RDW A;  3FZA A;  3TKS E;  4GSN A;  1TRV A;  2CA8 A;  2GZZ A;  5LD0 A;  1DSB A;  2IMF A;  4BA7 A;  3BOA A;  1J9B A;  3KJY A;  4ILF A;  3DD3 A;  20GS A;  5D93 A;  2NBS A;  3HJP A;  3IC4 A;  1EGR A;  3FK8 A;  3RAZ A;  3Q6O A;  2H74 A;  3TJG A;  6GSV A;  1GTB A;  1GSQ A;  1SL0 B;  1QXH A;  1OE8 A;  4IJ3 A;  4LLR A;  3ZIV A;  2TIR A;  1OC9 A;  3F6F A;  5JCG A;  1OKT A;  3KIJ A;  1TRS A;  4KDU A;  1UVZ A;  3VPT A;  5ECH B;  3KXO A;  3GUR A;  3CBU A;  3IV4 A;  3NZN A;  2K8V A;  1LU4 A;  4HZ4 A;  1FO5 A;  3WGX A;  1GTA A;  1M2A A;  3TJJ A;  4BWS A;  19GS A;  3F8U A;  5EPF A;  3KP8 A;  1K0N A;  5IQY A;  4ZBD A;  4X1U A;  5EL8 A;  3P7X A;  1EEM A;  2PMT A;  3ED3 A;  2B1L A;  4MMM A;  1PGT A;  1B4P A;  1PA3 A;  3ZTL A;  3GH6 A;  3EU4 A;  3A2W A;  3IOS A;  1F9M A;  1MTC A;  1SJ6 A;  1TU8 A;  1SKR B;  1X9S B;  4TXO B;  1AQX A;  5IMA A;  1XW5 A;  5DDL A;  12GS A;  3IBH A;  3KP9 A;  5HFG A;  3HHV A;  4EUY A;  2XPD A;  3TDG A;  4H86 A;  4XTS A;  4GST A;  1PX7 A;  3ZIJ A;  1R5A A;  3ISO A;  1RK4 A;  1URM A;  3KTL A;  3CMI A;  2EIR A;  1Y25 A;  4K2D A;  4EC0 A;  1M9A A;  1M99 A;  2MMN A;  1FVJ A;  4EF0 A;  3D0Z A;  4XHM A;  2VCX A;  4F0C A;  4WF4 A;  1BYE A;  1T00 A;  5ECM B;  1TK0 B;  2KP2 A;  1SYR A;  2O7K A;  2CQ9 A;  1PKZ A;  3E9J B;  3QFB C;  2C0E A;  3ME7 A;  2C1Y A;  3D4M A;  4Q5Q A;  1G6W A;  5DJM A;  3D5J A;  2RM5 A;  5A4V A;  4MCU A;  2REM A;  4WBR D;  2ZNM A;  2L5O A;  4IN0 A;  3VWU A;  2FWH A;  2MMZ A;  4QL7 A;  2HI7 A;  5KN1 A;  1FAA A;  4ML1 A;  1PL1 A;  3WGD A;  1V98 A;  1NSW A;  4MJE A;  5ELA A;  1OYJ A;  1UA5 A;  1GSY A;  13GS A;  2L5L A;  3VUR A;  3P2A A;  5CP1 A;  4YQV A;  2MBT A;  3IAS 2;  1IYH A;  2OBK A;  4IQ1 A;  2QGV A;  7GSS A;  1EP7 A;  2WFC A;  4ECJ A;  2X8C A;  3IAM 2;  2LJK A;  1VGL A;  1V58 A;  1F2E A;  4RUV A;  4PUR A;  5AIV A;  4KAE A;  4LL4 B;  2YWN A;  2PBJ A;  3FR9 A;  1CQH A;  2C80 A;  4CW9 A;  2M46 A;  1VRS D;  2VL2 A;  2H01 A;  1TI1 A;  5DCH A;  2DJK A;  4N11 A;  2GLR A;  2ZUP A;  2C0F A;  3PGT A;  5F07 A;  4ML6 A;  4K8M A;  3D21 A;  1O8X A;  3LG6 A;  4PUF C;  4O5R A;  4V2N A;  5J9B A;  5E4W A;  2ON7 A;  3FKF A;  3APO A;  2ES7 A;  1G6Y A;  1U3I A;  4RI6 A;  5INY A; 
#chains in the Genus database with same CATH topology
 3WT2 A;  2DSA A;  2X8H A;  4TR1 B;  3EVI A;  3FY7 A;  4X0X A;  4F03 A;  4MF7 A;  4K2X A;  4FYB A;  2IMK A;  4HQZ A;  1ZOF A;  2B7J A;  4N10 A;  2HT9 A;  4TW5 A;  3IC8 A;  1SEN A;  2B5X A;  4MAB A;  3VWW A;  2NPB A;  4DVC A;  1R4W A;  1M9B A;  4AJ6 A;  1ZCP A;  3KGK A;  4Q5F A;  3UMA A;  2WCI A;  1YEP A;  5LNK e;  5CRE A;  1X5D A;  2P0G A;  4IJI A;  4DSS B;  4KND A;  1SK1 A;  2V41 A;  1U88 A;  3GIX A;  3UIW A;  1GL8 A;  4WBJ A;  4KCE A;  2ZCT A;  4NHW A;  2JZT A;  5DAL B;  4K7O A;  6GSX A;  3M0F A;  3FMW A;  1AQW A;  5IM9 A;  1EGO A;  3TKS C;  1JLV A;  1K0M A;  1QUW A;  4WXT A;  2DKI A;  1EEJ A;  2JAC A;  5KN3 A;  2FD3 A;  1U87 A;  2FWE A;  1M3I A;  3HDC A;  3M1G A;  2WGR A;  5B8A A;  1O6J A;  2YCD A;  3QDN A;  3FEU A;  1Z6M A;  1FVK A;  1ZYN A;  1FHE A;  3F6D A;  1Z7R A;  3H93 A;  3BBY A;  1WPI A;  1G7O A;  1TOF A;  2HRN A;  5EY6 A;  4ZL9 A;  1BED A;  1XVW A;  3K8N A;  3ZML A;  2JZR A;  4K0N A;  2XPE A;  5ECS A;  2VCT A;  2YZH A;  4V2M A;  4GRF A;  4ZIJ A;  1S3C A;  5J9C A;  2LEG A;  4QL9 A;  2O89 A;  1W4V A;  3ZMK A;  4NAX A;  2P31 A;  2V6K A;  5D73 A;  3C8E A;  2LQQ A;  4I5Q A;  3PH9 A;  5G1L A;  4MA9 A;  3TUE A;  1M0U A;  4J57 E;  4KSM A;  4MPG A;  1QMV A;  2GQL A;  3UOM A;  1HQO A;  3VI7 A;  4EO3 A;  2XBI A;  1XXU A;  3UVT A;  4JRR A;  4ZB8 A;  1IYI A;  1PFO A;  2H71 A;  1Q98 A;  5ECO B;  4JED A;  2LV3 A;  1B4Q A;  2PU9 C;  4BVY B;  1AXD A;  1K3Y A;  2L4Q A;  2JZS A;  4ZB9 A;  4HSC X;  2H0G A;  2AYT A;  4KW6 A;  5JCW A;  5ABR A;  4MJB A;  5BRT A;  2DJ0 A;  1HYU A;  1UN2 A;  3PR8 A;  2HRF A;  3TJF A;  2BTO T;  2GDR A;  3H1N A;  5DCG A;  2B7K A;  3HVN A;  2AHE A;  1ZGN A;  1G0T A;  2E2G A;  3EMX A;  2H30 A;  1YKC A;  3JCM L;  4LA1 A;  2EIQ A;  3RPP A;  4TR0 A;  4OFT A;  1TKD B;  3GKK A;  3FW2 A;  2VCV A;  2CT6 A;  3HZ8 A;  5EVO A;  4I6X A;  1F37 A;  4KA0 A;  5JWR B;  1XW6 A;  3DIE A;  3LWA A;  5IMC A;  3CTG A;  1T4Z A;  2C3T A;  4BL7 A;  4KCA A;  2H6Z A;  2QA2 A;  2IFQ B;  4YKG A;  4XRD A;  3GL3 A;  4MZB A;  2D2Z A;  2DML A;  2VOC A;  2L6C A;  2IPA A;  3KH9 A;  1USB A;  2H1G A;  4NWY A;  4YQM A;  2VL9 A;  2QA1 A;  4RQR A;  3OR5 A;  3QAG A;  3PPU A;  2YJH A;  4EE0 A;  2ALB A;  4WET A;  3TJB A;  4FH8 A;  3ZIT A;  3UBL A;  2FA8 A;  1TI3 A;  3IRA A;  1QK8 A;  3N5O A;  2GSR A;  1BQ7 A;  2YP6 A;  3H4K A;  5LCZ A;  6GSS A;  3EUR A;  2I81 A;  1JZR A;  2CVK A;  3VFI A;  1VF2 A;  3TB2 A;  1B9Y C;  5G1K A;  2GQK A;  3CSI A;  2H0I A;  1AUC A;  3FHK A;  4DSR A;  2HZE A;  3A5W A;  2IMI A;  2OJL A;  4EDY A;  3LGC A;  5IO2 A;  5GAN D;  1S3D A;  1XCC A;  4YH2 A;  1KTE A;  1GUL A;  4L0U A;  1PMT A;  1EV4 A;  1LBK A;  3W8J A;  3VLN A;  1BAY A;  4OMV A;  2JL4 A;  5IMF A;  1Z3E A;  2H1A A;  1JFU A;  5AIS A;  2HFD A;  2F9S A;  2LJA A;  1TXX A;  2LJR A;  1YJ6 A;  4ULX A;  1T1V A;  4O32 A;  2V6O A;  5IPH A;  4D73 B;  3EU3 A;  1OE7 A;  5E59 A;  5ENU A;  1RQM A;  4LMV A;  4CY6 A;  4IP1 A;  3I6A A;  1ABA A;  2VUP A;  3TKR A;  1HNB A;  2N5F A;  5G5E A;  1YY7 A;  2V32 A;  2N5B A;  2TRC P;  5ECK B;  5IMZ A;  4OCF A;  3LXZ A;  4HUA A;  1O85 A;  4HZ2 A;  3HD5 A;  3QD9 A;  1OC3 A;  1GTI A;  3TRQ A;  3VK9 A;  4JZQ A;  2C4J A;  2FA4 A;  1WMJ A;  3C1S A;  5BMU A;  1ERT A;  2IMD A;  3GV1 A;  11GS A;  4K5R A;  5KN2 A;  4O92 A;  4HOJ A;  3WD6 A;  2I3Y A;  3ZVJ A;  2G0F A;  1X5E A;  4MLY A;  1V9W A;  3LQ7 A;  3DXB A;  1ZYP A;  3FR3 A;  5C04 A;  1YKA A;  4G0K A;  3G7I A;  1A8L A;  2QC7 A;  2VL2 C;  1XBS A;  1AC1 A;  5CRD A;  2LST A;  4L8E A;  1GNE A;  5D96 A;  3F4R A;  3GRX A;  3HVV A;  5ECN B;  3UAR A;  4BVX B;  2H19 A;  1QQ2 A;  1A2L A;  1HNC A;  1SJI A;  3M3M A;  5A5K A;  2R3X A;  2XC2 A;  3VWV A;  4X4J A;  16GS A;  1K0D A;  10GS A;  3H79 A;  2AV4 A;  1XIY A;  1GLQ A;  2LTK A;  4X43 A;  4PQ1 A;  4F2I A;  1JHB A;  3A3T A;  22GS A;  1OKD A;  2HXK A;  4L5O A;  3W8S A;  1ON4 A;  4I2U A;  1M3J A;  1XWA A;  2HRA A;  1V40 A;  1SJZ A;  4N0V A;  4JR6 A;  4MH3 A;  2XBQ A;  4ECB A;  1PN0 A;  3L4N A;  3S9F A;  2F51 A;  4YAP A;  1X5C A;  5G30 A;  4AGS A;  2PWJ A;  2HYX A;  1ERU A;  1XOB A;  4K1F A;  2HSY A;  2F3M A;  1T4Y A;  3J7Y b;  3ZFB A;  2E7P A;  1N8J A;  3KCM A;  4G9H A;  3TGZ A;  2RUE A;  2QSI A;  2DJ1 A;  5IOX A;  4HEA 2;  1MD3 A;  17GS A;  1FB6 A;  4JBB A;  4HU7 A;  3Q19 A;  1SU9 A;  4HQS A;  2YWO A;  9GSS A;  3QFA C;  3UJ1 A;  4TR4 A;  2WB9 A;  5DVB A;  2YOI A;  4K7I A;  2GZP A;  2H70 A;  4EIP A;  4Z2T A;  2CZ3 A;  3TJK A;  2DIY A;  5H5R A;  4PGT A;  1VF1 A;  3QR6 A;  3GUS A;  2CVD A;  4PUA A;  3VI5 A;  2E2M A;  4NXI A;  2OE0 A;  4KX4 A;  2FWF A;  5CYY A;  1GH2 A;  2YNX A;  3HA9 A;  4ZIL A;  1Z9H A;  4MJA A;  2M80 A;  3TOT A;  3FRC A;  1YEX A;  2JSY A;  4XS4 B;  3QAV A;  2Z9S A;  4GTU A;  2FUG 2;  4EL1 A;  4ZXG A;  1ILO A;  4ZL8 A;  2C0D A;  1GUK A;  1K0C A;  2MYG A;  4KDY A;  1XWK A;  5HQP A;  2LRN A;  2GSQ A;  2EIO A;  3QPM A;  6GSY A;  1SD9 A;  2RII A;  3N9J A;  1K3O A;  3WT1 A;  2VD0 A;  4BWQ A;  2AB6 A;  3I69 A;  1XFL A;  1Z6N A;  2I4A A;  4G0L A;  2IJY A;  3L0H A;  4F9Z A;  3O3T A;  2FHE A;  1MEK A;  1OVN A;  4I8B A;  1AW9 A;  3KMO A;  3EE2 A;  2WRT A;  3ZRE A;  3M9J A;  3HCZ A;  1M7T A;  3ERW A;  1U6T A;  5ID2 B;  1ZZY A;  2RLI A;  3V1W A;  3C71 A;  3F3R A;  5L71 A;  3EC3 A;  5HFK A;  2R5G A;  1MDK A;  4BPY A;  2FCH A;  3UAP A;  3ME8 A;  3LYK A;  4KH7 A;  1DBY A;  1BX9 A;  2KOK A;  3LXT A;  3DWV A;  4MZC A;  2WS2 A;  5D8I A;  1GTU A;  4MPF A;  4OD7 A;  1TRU A;  5IPG A;  2FGX A;  1K3L A;  2B6M A;  2LRT A;  5A4W A;  4XCS A;  1C72 A;  4WKW A;  3GKM A;  1TK8 B;  2WZ9 A;  4RI7 A;  2L6D A;  4Q5R A;  4HJM A;  3GN3 A;  1XWC A;  1XWG A;  4BL7 B;  1K0O A;  1SL1 B;  1A0R P;  2R6K A;  2I1U A;  2LUS A;  3ZRD A;  3LJR A;  3GTU A;  1M2B A;  4DSQ A;  4MF6 A;  3LEF A;  5F06 A;  2B1K A;  2O87 A;  4FIW A;  4QQ7 A;  5GSS A;  3HJO A;  3IE3 A;  2C3N A;  1NM3 A;  3EIN A;  5B7C A;  4POL A;  3ZLP A;  2H72 A;  1ERV A;  4WR4 A;  4PQH A;  3PIN A;  2OAD A;  1JZO A;  1WP0 A;  1O7U A;  3MDK A;  1HD2 A;  2C3Q A;  4POK A;  2VAF A;  4YKF A;  3CYN A;  4MH2 A;  5COH A;  2K8S A;  2RM6 A;  3GHA A;  4G19 A;  2HZE B;  4AJ8 A;  4DEJ A;  3HJM A;  1GSE A;  2KP1 A;  2BMX A;  2HLS A;  2VO4 A;  4KSO A;  2A2S A;  5C00 A;  3F63 A;  3VPQ A;  3TCO A;  4TR1 A;  3O6T A;  1U3A A;  1GP1 A;  1T3B A;  2GS3 A;  2CAI A;  1ZYQ B;  2X8G A;  1XZO A;  5ELG A;  2DJ3 A;  1PKW A;  2MMO A;  2VCQ A;  1A23 A;  3FYG A;  1GNW A;  1VF3 A;  3LOR A;  1YQ1 A;  2YWI A;  4G10 A;  2IIY A;  2YV7 A;  3MNG A;  3IXR A;  4TRX A;  3BD2 A;  1EOG A;  3FZ4 A;  2GSS A;  4JU5 A;  1JLW A;  2LS5 A;  3HVX A;  2NDO A;  4E8H A;  1XWB A;  4PX1 A;  1ERW A;  1OC9 B;  4J56 E;  5ECI B;  3LFL A;  4KF9 A;  3NOF A;  3TRP A;  5DAL A;  2GQM A;  2VCW A;  2VM1 A;  4HI7 A;  4TOP A;  2OKA A;  2VCZ A;  3UL3 A;  1TDI A;  5D9T A;  1PN9 A;  3RBT A;  5G2Z A;  3Q74 A;  6GST A;  2DLX A;  1TJD A;  4O7H A;  1T8E B;  3TKQ A;  5D9X A;  5DBQ A;  4ZL7 A;  1J0F A;  2DJJ A;  1A2J A;  5ECP B;  4AF2 A;  3HXS A;  2GT5 A;  4TVE A;  2GGT A;  2CVB A;  4EKZ A;  3GKN A;  5ECQ B;  1FG4 A;  8GSS A;  2MMA A;  2JSZ A;  4GQF A;  3W6G A;  2FNO A;  2CZ2 A;  2ON5 A;  4N30 A;  1TK5 B;  1SD8 A;  4RQX A;  4EDZ A;  1A2M A;  1ZMA A;  3F9U A;  3IDV A;  2DKH A;  3DKS A;  4KB3 A;  3LYP A;  1DE2 A;  2HRK A;  3DYR A;  5IIZ A;  3CRT A;  4EVM A;  4ID0 A;  2I9H A;  4G2E A;  5AN1 A;  4MJC A;  4POB A;  1KBN A;  3KM6 A;  1VF4 A;  4IEL A;  5CO3 A;  2K18 A;  5DAK A;  4XIH A;  4BVY A;  4OO5 A;  4XS1 A;  1PD2 1;  3G7Y A;  3US3 A;  4IKH A;  1TTZ A;  1S3A A;  3EWL A;  1OC8 A;  2LRC A;  5F0G A;  1THX A;  4Z7X A;  2C8U A;  1ST9 A;  1MDJ A;  3C73 A;  2O8V B;  5HR3 A;  2A4V A;  3IHG A;  3UVH A;  2R0P A;  1BG5 A;  1H4O A;  2OE3 A;  2YZU A;  1XW9 A;  4IGJ A;  4OCE A;  5B6M A;  4FQU A;  2A4H A;  5D9V A;  2V2G A;  2IWT A;  3TOU A;  3Q18 A;  3IPZ A;  3EYT A;  2H66 A;  1GSS A;  1DE1 A;  3F3Q A;  4TXV A;  3KH7 A;  2LQO A;  2VIM A;  14GS A;  4XRA A;  2B5E A;  5AIX A;  5JCU A;  1DUG A;  4K9Z A;  2GVP A;  5IO0 A;  5CAX A;  3KTB A;  5D9W A;  4YAV A;  2X4A A;  2HZF A;  2IFQ A;  1FB0 A;  2GST A;  2H1D A;  3UBK A;  5FWG A;  3P8W A;  4IBP A;  2F8F A;  1Z5Y E;  2L57 A;  2OA7 A;  3HY2 A;  5HR2 A;  5FHI A;  5J41 A;  1SK0 A;  5GZZ B;  1SL2 B;  4MZW A;  3ZZX A;  1Z7P A;  2GZY A;  2CX4 A;  2IN3 A;  2YN1 A;  1J08 A;  1G7E A;  4IW9 A;  5CRG A;  1OAZ A;  1EP8 A;  3DGQ A;  4Q5N A;  4ICY A;  3EMP A;  1GWC A;  1SYX A;  2OBI A;  1CQG A;  2PUK C;  3DML A;  3M9K A;  3IR4 A;  4NV2 A;  4NHZ A;  3WYW A;  4OFM A;  2RUF A;  2YV9 A;  3WGE A;  1YF0 A;  1GSD A;  4PNF A;  3CQF A;  3ERF A;  1ML6 A;  2GTU A;  4I97 A;  1SKW B;  1AQV A;  2PN8 A;  4IHU A;  3U6V A;  4HS1 A;  3A2X A;  1GSF A;  2DC5 A;  5HR1 A;  1EV9 A;  3KZQ A;  3E0U A;  2CAQ A;  2AAW A;  1NHO A;  1XOA A;  4P3Y B;  1THO A;  3C1R A;  3GYK A;  2VD1 A;  2K6V A;  5DQS A;  3KMN A;  2K9F A;  4D73 A;  2VL3 A;  1I9D A;  5ECL B;  4GQC A;  2HNL A;  3L9S A;  3GX8 A;  2PVO C;  2B5Y A;  3UEM A;  1TP9 A;  4AJ7 A;  2H8L A;  4EIQ A;  3DVW A;  3L78 A;  3L9V A;  4POM A;  2DIZ A;  3ZVJ D;  1R5P A;  4WR5 A;  3MSZ A;  3GX0 A;  2R4V A;  4OFN A;  4O5Q A;  3QAW A;  3ZL5 A;  4ACS A;  1TU7 A;  2IL3 A;  2H75 A;  4WEY A;  3FR6 A;  2R37 A;  1XPV A;  4LMW A;  2H76 A;  3HKR A;  3HYP A;  2FLS A;  5CRH A;  4ECC A;  4PNG A;  2E0Q A;  2NVL A;  1B48 A;  1FOV A;  2XHF A;  1PX6 A;  3GTU B;  2NTO A;  1QFN A;  2G2Q A;  1I5G A;  1E2Y A;  5KN0 A;  5J3R A;  4PXO A;  3QCP A;  2DMM A;  4TXO A;  1ZYE A;  3CSH A;  3G9B A;  2IME A;  3QOU A;  4CDO A;  4BVX A;  3GSS A;  4CHS A;  1E6B A;  5DQY A;  1GUH A;  4K6X A;  5A4U A;  1FOH A;  3CSJ A;  1MD4 A;  2YWM A;  2GT6 A;  1GSU A;  3RHC A;  4Z2U A;  1WWJ A;  1F3A A;  3GMF A;  4IP6 A;  4PTS A;  4TKY A;  3D4T A;  4KGI A;  1GUM A;  1KEB A;  2HSH A;  2H73 A;  2J23 A;  2CV4 A;  1MDI A;  1YZX A;  3FZ9 A;  2MBS A;  3RHB A;  3TKP A;  4GWR A;  1A8Y A;  3D6I A;  1WIK A;  3R2Q A;  5FT3 A;  2VM2 A;  4NV5 A;  3SBC A;  1WJK A;  2JAD A;  1BJX A;  3GNJ A;  5G5F A;  3U5R E;  1F3B A;  3L9U A;  5B6N A;  4OO4 A;  4MDC A;  5J5N A;  1B9X C;  1V2A A;  5KEJ A;  2A2R A;  1JZW A;  4V1A g;  1KNG A;  2PGT A;  1N2A A;  1X0R A;  3SWL A;  4O5U A;  3NIV A;  5IOW A;  4ECI A;  2AUV A;  2VLU A;  2R2J A;  3F4S A;  4KUN A;  3GH9 A;  1PL2 A;  1YDK A;  2O85 A;  3IK7 A;  3O76 A;  1JZD A;  3MIX A;  3F4T A;  4JE1 A;  1O8W A;  1ZL9 A;  4MK3 A;  2P5Q A;  2BJX A;  5GST A;  4IQA A;  3GFK A;  1SK2 A;  2WDU A;  3VWX A;  2YAN A;  3F0I A;  4NPB A;  1K0B A;  1K0A A;  3A2V A;  2N5A A;  4GCI A;  4F0B A;  3KD0 A;  4MNN A;  18GS A;  1AAZ A;  4TR3 A;  2F8A A;  3ZFL A;  4HU9 A;  4MP4 A;  4HJ2 A;  4GSS A;  4IVF A;  3M8N A;  1EOH A;  3GST A;  2OAC A;  4FO5 A;  3GKX A;  5ECR B;  3P90 A;  2X49 A;  3ERG A;  1O81 A;  3FZ5 A;  4WF5 A;  5AGY A;  3KEB A;  1QGV A;  2C0G A;  3CRU A;  1O73 A;  2VLV A;  5HR0 A;  4V2L A;  1LJR A;  4XS4 A;  2M72 A;  1XVQ A;  2L59 A;  2VLT A;  4MF5 A;  1PSQ A;  1V57 A;  5HFI A;  5H5S A;  3LW9 A;  4GLT A;  4TN8 A;  5GAP D;  4ISD A;  1GRX A;  4GF0 A;  2EC4 A;  5F05 A;  1T7P B;  3E3E A;  2H6Y A;  2YPM A;  3QMX A;  2CX3 A;  2QKE A;  3AY8 A;  5F8B A;  3DEX A;  1X9M B;  2PVQ A;  2LNT A;  4HDE A;  5H5Q A;  2PER A;  3D22 A;  5JWQ B;  1H75 A;  3BJ5 A;  5DAK B;  3DVX A;  2X64 A;  3C7M A;  4L5L A;  2OE1 A;  4K7N A;  1PRX A;  2PPT A;  4J2F A;  1EZK A;  3IK9 A;  4NMU A;  2H6X A;  4XS6 A;  4E8E A;  3RPN A;  3H8Q A;  4LL1 B;  3I43 A;  2B3S A;  4KDX A;  1WOU A;  1M2D A;  2HE3 A;  4IS0 A;  2TRX A;  2H1B A;  1NHY A;  4JR4 A;  1Q4J A;  5ID2 A;  4V1A p;  4DSS A;  1FW1 A;  1UC7 A;  3BCI A;  1ACV A;  1EWX A;  4OWY A;  1HNA A;  5DJL A;  3CXG A;  3DRN A;  4KE3 A;  3MWH A;  5KOX A;  1WRY A;  2WJU A;  4FYU A;  4FYC A;  2LNS A;  1WE0 A;  2V1M A;  6GSW A;  3BCK A;  3HZ4 A;  2P5R A;  3HVS A;  5G31 A;  5B8B A;  4ZBA A;  3TRX A;  3A5I A;  5J4U A;  4F82 A;  2KLX A;  2FWG A;  2AJQ B;  3IA1 A;  3TKS A;  3I9V 2;  4ZBB A;  3APQ A;  2FY6 A;  2DBC A;  1TW9 A;  1W89 A;  5IMD A;  3LSZ A;  1TRW A;  6GSU A;  2DJ2 A;  4L0W A;  3G7J A;  4YQU A;  1R7H A;  3GL5 A;  1B8X A;  1NW2 A;  1AIU A;  1R26 A;  1X9W B;  1A0F A;  1PQN A;  4N0Z A;  3IHQ A;  5CNW A;  1F6M C;  3CTF A;  2R0G A;  1RW1 A;  5CRW A;  3J7Y k;  1YF1 A;  4Z2R A;  2LKU A;  4EXJ A;  3APS A;  2L4C A;  2KUC A;  1Y6E A;  2J9H A;  2X99 A;  4G0I A;  5JWO B;  1GLP A;  2H0H A;  2JU5 A;  4ZB6 A;  1A24 A;  4GXZ A;  1SKS B;  4K0G A;  4I2T A;  4PQI A;  3MAK A;  5IMV A;  2YJ7 A;  3ZYW A;  2KHP A;  2MZC A;  2WUL A;  3GA4 A;  3RDW A;  3FZA A;  3TKS E;  4GSN A;  1TRV A;  2CA8 A;  2GZZ A;  5LD0 A;  1DSB A;  2IMF A;  4BA7 A;  3BOA A;  1J9B A;  3KJY A;  4ILF A;  3DD3 A;  20GS A;  5D93 A;  2NBS A;  3HJP A;  3IC4 A;  3R3E A;  1EGR A;  3FK8 A;  3RAZ A;  3Q6O A;  2H74 A;  3MYD A;  3TJG A;  6GSV A;  1GTB A;  1GSQ A;  1SL0 B;  1QXH A;  1OE8 A;  4IJ3 A;  4LLR A;  5KOW A;  3ZIV A;  2TIR A;  1OC9 A;  3F6F A;  5JCG A;  1OKT A;  3KIJ A;  1TRS A;  4KDU A;  1UVZ A;  3VPT A;  5ECH B;  3KXO A;  3GUR A;  3CBU A;  3IV4 A;  3NZN A;  2K8V A;  1LU4 A;  4HZ4 A;  4K5S A;  1XG8 A;  1FO5 A;  3WGX A;  2HSM A;  1GTA A;  1M2A A;  3TJJ A;  4BWS A;  19GS A;  3F8U A;  5EPF A;  3KP8 A;  1K0N A;  5IQY A;  4ZBD A;  4X1U A;  5EL8 A;  3P7X A;  1EEM A;  2PMT A;  3ED3 A;  2B1L A;  4CY8 A;  4MMM A;  1PGT A;  1B4P A;  1PA3 A;  3ZTL A;  3GH6 A;  3EU4 A;  3A2W A;  3IOS A;  1F9M A;  1MTC A;  1SJ6 A;  1TU8 A;  1SKR B;  2A2P A;  4TXO B;  1X9S B;  1AQX A;  5IMA A;  1XW5 A;  5DDL A;  12GS A;  3IBH A;  3KP9 A;  5HFG A;  3HHV A;  4EUY A;  4A5P A;  2XPD A;  3TDG A;  4H86 A;  4XTS A;  4GST A;  1PX7 A;  3ZIJ A;  1R5A A;  3ISO A;  1RK4 A;  1URM A;  3KTL A;  3CMI A;  2EIR A;  1Y25 A;  4K2D A;  4EC0 A;  1S3R A;  1M9A A;  1M99 A;  2MMN A;  1FVJ A;  4EF0 A;  3D0Z A;  4XHM A;  2VCX A;  4F0C A;  4USS A;  4WF4 A;  1BYE A;  1T00 A;  5ECM B;  1TK0 B;  2KP2 A;  1SYR A;  2O7K A;  2CQ9 A;  1PKZ A;  3E9J B;  3QFB C;  2C0E A;  3ME7 A;  2C1Y A;  3D4M A;  4Q5Q A;  1G6W A;  5DJM A;  3D5J A;  2RM5 A;  5A4V A;  4MCU A;  2REM A;  4WBR D;  2ZNM A;  2L5O A;  4IN0 A;  3VWU A;  2FWH A;  2MMZ A;  4QL7 A;  2HI7 A;  5KN1 A;  1FAA A;  4ML1 A;  1PL1 A;  4BIK A;  3WGD A;  1V98 A;  1NSW A;  4MJE A;  5ELA A;  1OYJ A;  1UA5 A;  1GSY A;  13GS A;  2L5L A;  3VUR A;  3P2A A;  5CP1 A;  4YQV A;  2MBT A;  3IAS 2;  1IYH A;  2OBK A;  4IQ1 A;  2QGV A;  7GSS A;  1EP7 A;  2WFC A;  4ECJ A;  2X8C A;  3IAM 2;  2LJK A;  1VGL A;  1V58 A;  1F2E A;  4RUV A;  4PUR A;  5AIV A;  2R0C A;  4KAE A;  4LL4 B;  2YWN A;  2PBJ A;  3FR9 A;  1CQH A;  3EPT A;  2C80 A;  4CW9 A;  2M46 A;  1VRS D;  2UZ8 A;  2VL2 A;  2H01 A;  1TI1 A;  5DCH A;  2DJK A;  4N11 A;  2GLR A;  2ZUP A;  2C0F A;  3PGT A;  5F07 A;  4ML6 A;  4K8M A;  3D21 A;  1O8X A;  3LG6 A;  4PUF C;  4O5R A;  4V2N A;  5J9B A;  5E4W A;  2ON7 A;  3FKF A;  3APO A;  2ES7 A;  1G6Y A;  1U3I A;  4RI6 A;  5INY A; 
#chains in the Genus database with same CATH homology
 3WT2 A;  2DSA A;  2X8H A;  4TR1 B;  3EVI A;  3FY7 A;  4X0X A;  4F03 A;  4MF7 A;  4K2X A;  4FYB A;  2IMK A;  4HQZ A;  1ZOF A;  2B7J A;  4N10 A;  2HT9 A;  4TW5 A;  3IC8 A;  1SEN A;  2B5X A;  4MAB A;  3VWW A;  2NPB A;  4DVC A;  1R4W A;  1M9B A;  4AJ6 A;  1ZCP A;  3KGK A;  4Q5F A;  3UMA A;  2WCI A;  1YEP A;  5LNK e;  5CRE A;  1X5D A;  2P0G A;  4IJI A;  4DSS B;  4KND A;  1SK1 A;  2V41 A;  1U88 A;  3GIX A;  3UIW A;  1GL8 A;  4WBJ A;  4KCE A;  2ZCT A;  4NHW A;  2JZT A;  5DAL B;  4K7O A;  6GSX A;  3M0F A;  3FMW A;  1AQW A;  5IM9 A;  1EGO A;  3TKS C;  1JLV A;  1K0M A;  1QUW A;  4WXT A;  2DKI A;  1EEJ A;  2JAC A;  5KN3 A;  2FD3 A;  1U87 A;  2FWE A;  3HDC A;  3M1G A;  2WGR A;  5B8A A;  1O6J A;  2YCD A;  3QDN A;  3FEU A;  1Z6M A;  1FVK A;  1ZYN A;  1FHE A;  3F6D A;  1Z7R A;  3H93 A;  3BBY A;  1WPI A;  1G7O A;  1TOF A;  2HRN A;  5EY6 A;  4ZL9 A;  1BED A;  1XVW A;  3K8N A;  3ZML A;  2JZR A;  4K0N A;  2XPE A;  5ECS A;  2VCT A;  2YZH A;  4V2M A;  4GRF A;  4ZIJ A;  1S3C A;  5J9C A;  2LEG A;  4QL9 A;  2O89 A;  1W4V A;  3ZMK A;  4NAX A;  2P31 A;  2V6K A;  5D73 A;  3C8E A;  2LQQ A;  4I5Q A;  3PH9 A;  5G1L A;  4MA9 A;  3TUE A;  1M0U A;  4J57 E;  4KSM A;  4MPG A;  1QMV A;  2GQL A;  3UOM A;  1HQO A;  3VI7 A;  4EO3 A;  2XBI A;  1XXU A;  3UVT A;  4JRR A;  4ZB8 A;  1IYI A;  2H71 A;  1Q98 A;  5ECO B;  4JED A;  2LV3 A;  1B4Q A;  2PU9 C;  4BVY B;  1AXD A;  1K3Y A;  2L4Q A;  2JZS A;  4ZB9 A;  2H0G A;  2AYT A;  4KW6 A;  5JCW A;  5ABR A;  4MJB A;  5BRT A;  2DJ0 A;  1HYU A;  1UN2 A;  3PR8 A;  2HRF A;  3TJF A;  2BTO T;  2GDR A;  3H1N A;  5DCG A;  2B7K A;  2AHE A;  1ZGN A;  1G0T A;  2E2G A;  3EMX A;  2H30 A;  1YKC A;  3JCM L;  4LA1 A;  2EIQ A;  3RPP A;  4TR0 A;  4OFT A;  1TKD B;  3GKK A;  3FW2 A;  2VCV A;  2CT6 A;  3HZ8 A;  5EVO A;  4I6X A;  1F37 A;  4KA0 A;  5JWR B;  1XW6 A;  3DIE A;  3LWA A;  5IMC A;  3CTG A;  1T4Z A;  2C3T A;  4BL7 A;  4KCA A;  2H6Z A;  2QA2 A;  2IFQ B;  4YKG A;  4XRD A;  3GL3 A;  4MZB A;  2D2Z A;  2DML A;  2VOC A;  2L6C A;  2IPA A;  3KH9 A;  1USB A;  2H1G A;  4NWY A;  4YQM A;  2VL9 A;  2QA1 A;  4RQR A;  3OR5 A;  3QAG A;  3PPU A;  2YJH A;  4EE0 A;  2ALB A;  4WET A;  3TJB A;  4FH8 A;  3ZIT A;  3UBL A;  2FA8 A;  1TI3 A;  3IRA A;  1QK8 A;  3N5O A;  2GSR A;  1BQ7 A;  2YP6 A;  3H4K A;  5LCZ A;  6GSS A;  3EUR A;  2I81 A;  1JZR A;  2CVK A;  3VFI A;  1VF2 A;  3TB2 A;  1B9Y C;  5G1K A;  2GQK A;  3CSI A;  2H0I A;  1AUC A;  3FHK A;  4DSR A;  2HZE A;  3A5W A;  2IMI A;  2OJL A;  4EDY A;  3LGC A;  5IO2 A;  5GAN D;  1S3D A;  1XCC A;  4YH2 A;  1KTE A;  1GUL A;  4L0U A;  1PMT A;  1EV4 A;  1LBK A;  3W8J A;  3VLN A;  1BAY A;  4OMV A;  2JL4 A;  5IMF A;  1Z3E A;  2H1A A;  1JFU A;  5AIS A;  2HFD A;  2F9S A;  2LJA A;  1TXX A;  2LJR A;  1YJ6 A;  4ULX A;  1T1V A;  4O32 A;  2V6O A;  5IPH A;  4D73 B;  3EU3 A;  1OE7 A;  5E59 A;  5ENU A;  1RQM A;  4LMV A;  4CY6 A;  4IP1 A;  3I6A A;  1ABA A;  2VUP A;  3TKR A;  1HNB A;  2N5F A;  5G5E A;  1YY7 A;  2V32 A;  2N5B A;  2TRC P;  5ECK B;  5IMZ A;  4OCF A;  3LXZ A;  4HUA A;  1O85 A;  4HZ2 A;  3HD5 A;  3QD9 A;  1OC3 A;  1GTI A;  3TRQ A;  3VK9 A;  4JZQ A;  2C4J A;  2FA4 A;  1WMJ A;  3C1S A;  5BMU A;  1ERT A;  2IMD A;  3GV1 A;  11GS A;  4K5R A;  5KN2 A;  4O92 A;  4HOJ A;  3WD6 A;  2I3Y A;  3ZVJ A;  2G0F A;  1X5E A;  4MLY A;  1V9W A;  3LQ7 A;  3DXB A;  1ZYP A;  3FR3 A;  5C04 A;  1YKA A;  4G0K A;  3G7I A;  1A8L A;  2QC7 A;  2VL2 C;  1XBS A;  1AC1 A;  5CRD A;  2LST A;  4L8E A;  1GNE A;  5D96 A;  3F4R A;  3GRX A;  3HVV A;  5ECN B;  3UAR A;  4BVX B;  2H19 A;  1QQ2 A;  1A2L A;  1HNC A;  1SJI A;  3M3M A;  5A5K A;  2R3X A;  2XC2 A;  3VWV A;  4X4J A;  16GS A;  1K0D A;  10GS A;  3H79 A;  2AV4 A;  1XIY A;  1GLQ A;  2LTK A;  4X43 A;  4PQ1 A;  4F2I A;  1JHB A;  3A3T A;  22GS A;  1OKD A;  2HXK A;  4L5O A;  3W8S A;  1ON4 A;  4I2U A;  1XWA A;  2HRA A;  1V40 A;  1SJZ A;  4N0V A;  4JR6 A;  4MH3 A;  2XBQ A;  4ECB A;  1PN0 A;  3L4N A;  3S9F A;  2F51 A;  4YAP A;  1X5C A;  5G30 A;  4AGS A;  2PWJ A;  2HYX A;  1ERU A;  1XOB A;  4K1F A;  2HSY A;  2F3M A;  1T4Y A;  3J7Y b;  3ZFB A;  2E7P A;  1N8J A;  3KCM A;  4G9H A;  3TGZ A;  2RUE A;  2QSI A;  2DJ1 A;  5IOX A;  4HEA 2;  1MD3 A;  17GS A;  1FB6 A;  4JBB A;  4HU7 A;  3Q19 A;  1SU9 A;  4HQS A;  2YWO A;  9GSS A;  3QFA C;  3UJ1 A;  4TR4 A;  2WB9 A;  5DVB A;  2YOI A;  4K7I A;  2GZP A;  2H70 A;  4EIP A;  4Z2T A;  2CZ3 A;  3TJK A;  2DIY A;  5H5R A;  4PGT A;  1VF1 A;  3QR6 A;  3GUS A;  2CVD A;  4PUA A;  3VI5 A;  2E2M A;  4NXI A;  2OE0 A;  4KX4 A;  2FWF A;  5CYY A;  1GH2 A;  2YNX A;  3HA9 A;  4ZIL A;  1Z9H A;  4MJA A;  2M80 A;  3TOT A;  3FRC A;  1YEX A;  2JSY A;  4XS4 B;  3QAV A;  2Z9S A;  4GTU A;  2FUG 2;  4EL1 A;  4ZXG A;  1ILO A;  4ZL8 A;  2C0D A;  1GUK A;  1K0C A;  2MYG A;  4KDY A;  1XWK A;  5HQP A;  2LRN A;  2GSQ A;  2EIO A;  3QPM A;  6GSY A;  1SD9 A;  2RII A;  3N9J A;  1K3O A;  3WT1 A;  2VD0 A;  4BWQ A;  2AB6 A;  3I69 A;  1XFL A;  1Z6N A;  2I4A A;  4G0L A;  2IJY A;  3L0H A;  4F9Z A;  3O3T A;  2FHE A;  1MEK A;  1OVN A;  4I8B A;  1AW9 A;  3KMO A;  3EE2 A;  2WRT A;  3ZRE A;  3M9J A;  3HCZ A;  1M7T A;  3ERW A;  1U6T A;  5ID2 B;  1ZZY A;  2RLI A;  3V1W A;  3C71 A;  3F3R A;  5L71 A;  3EC3 A;  5HFK A;  2R5G A;  1MDK A;  4BPY A;  2FCH A;  3UAP A;  3ME8 A;  3LYK A;  4KH7 A;  1DBY A;  1BX9 A;  2KOK A;  3LXT A;  3DWV A;  4MZC A;  2WS2 A;  5D8I A;  1GTU A;  4MPF A;  4OD7 A;  1TRU A;  5IPG A;  2FGX A;  1K3L A;  2B6M A;  2LRT A;  5A4W A;  4XCS A;  1C72 A;  4WKW A;  3GKM A;  1TK8 B;  2WZ9 A;  4RI7 A;  2L6D A;  4Q5R A;  4HJM A;  3GN3 A;  1XWC A;  1XWG A;  4BL7 B;  1K0O A;  1SL1 B;  1A0R P;  2R6K A;  2I1U A;  2LUS A;  3ZRD A;  3LJR A;  3GTU A;  1M2B A;  4DSQ A;  4MF6 A;  3LEF A;  5F06 A;  2B1K A;  2O87 A;  4FIW A;  4QQ7 A;  5GSS A;  3HJO A;  3IE3 A;  2C3N A;  1NM3 A;  3EIN A;  5B7C A;  4POL A;  3ZLP A;  2H72 A;  1ERV A;  4WR4 A;  4PQH A;  3PIN A;  2OAD A;  1JZO A;  1WP0 A;  1O7U A;  3MDK A;  1HD2 A;  2C3Q A;  4POK A;  2VAF A;  4YKF A;  3CYN A;  4MH2 A;  5COH A;  2K8S A;  2RM6 A;  3GHA A;  4G19 A;  2HZE B;  4AJ8 A;  4DEJ A;  3HJM A;  1GSE A;  2KP1 A;  2BMX A;  2HLS A;  2VO4 A;  4KSO A;  2A2S A;  5C00 A;  3F63 A;  3VPQ A;  3TCO A;  4TR1 A;  3O6T A;  1U3A A;  1GP1 A;  1T3B A;  2GS3 A;  2CAI A;  1ZYQ B;  2X8G A;  1XZO A;  5ELG A;  2DJ3 A;  1PKW A;  2MMO A;  2VCQ A;  1A23 A;  3FYG A;  1GNW A;  1VF3 A;  3LOR A;  1YQ1 A;  2YWI A;  4G10 A;  2IIY A;  2YV7 A;  3MNG A;  3IXR A;  4TRX A;  3BD2 A;  1EOG A;  3FZ4 A;  2GSS A;  4JU5 A;  1JLW A;  2LS5 A;  3HVX A;  2NDO A;  4E8H A;  1XWB A;  4PX1 A;  1ERW A;  1OC9 B;  4J56 E;  5ECI B;  3LFL A;  4KF9 A;  3NOF A;  3TRP A;  5DAL A;  2GQM A;  2VCW A;  2VM1 A;  4HI7 A;  4TOP A;  2OKA A;  2VCZ A;  3UL3 A;  1TDI A;  5D9T A;  1PN9 A;  3RBT A;  5G2Z A;  3Q74 A;  6GST A;  2DLX A;  1TJD A;  4O7H A;  1T8E B;  3TKQ A;  5D9X A;  5DBQ A;  4ZL7 A;  1J0F A;  2DJJ A;  1A2J A;  5ECP B;  4AF2 A;  3HXS A;  2GT5 A;  4TVE A;  2GGT A;  2CVB A;  4EKZ A;  3GKN A;  5ECQ B;  1FG4 A;  8GSS A;  2MMA A;  2JSZ A;  4GQF A;  3W6G A;  2FNO A;  2CZ2 A;  2ON5 A;  4N30 A;  1TK5 B;  1SD8 A;  4RQX A;  4EDZ A;  1A2M A;  1ZMA A;  3F9U A;  3IDV A;  2DKH A;  3DKS A;  4KB3 A;  3LYP A;  1DE2 A;  2HRK A;  3DYR A;  5IIZ A;  3CRT A;  4EVM A;  4ID0 A;  2I9H A;  4G2E A;  5AN1 A;  4MJC A;  4POB A;  1KBN A;  3KM6 A;  1VF4 A;  4IEL A;  5CO3 A;  2K18 A;  5DAK A;  4XIH A;  4BVY A;  4OO5 A;  4XS1 A;  1PD2 1;  3G7Y A;  3US3 A;  4IKH A;  1TTZ A;  1S3A A;  3EWL A;  1OC8 A;  2LRC A;  5F0G A;  1THX A;  4Z7X A;  2C8U A;  1ST9 A;  1MDJ A;  3C73 A;  2O8V B;  5HR3 A;  2A4V A;  3IHG A;  3UVH A;  2R0P A;  1BG5 A;  1H4O A;  2OE3 A;  2YZU A;  1XW9 A;  4IGJ A;  4OCE A;  5B6M A;  4FQU A;  2A4H A;  5D9V A;  2V2G A;  2IWT A;  3TOU A;  3Q18 A;  3IPZ A;  3EYT A;  2H66 A;  1GSS A;  1DE1 A;  3F3Q A;  4TXV A;  3KH7 A;  2LQO A;  2VIM A;  14GS A;  4XRA A;  2B5E A;  5AIX A;  5JCU A;  1DUG A;  4K9Z A;  2GVP A;  5IO0 A;  5CAX A;  3KTB A;  5D9W A;  4YAV A;  2X4A A;  2HZF A;  2IFQ A;  1FB0 A;  2GST A;  2H1D A;  3UBK A;  5FWG A;  3P8W A;  4IBP A;  2F8F A;  1Z5Y E;  2L57 A;  2OA7 A;  3HY2 A;  5HR2 A;  5FHI A;  5J41 A;  1SK0 A;  5GZZ B;  1SL2 B;  4MZW A;  3ZZX A;  1Z7P A;  2GZY A;  2CX4 A;  2IN3 A;  2YN1 A;  1J08 A;  1G7E A;  4IW9 A;  5CRG A;  1OAZ A;  1EP8 A;  3DGQ A;  4Q5N A;  4ICY A;  3EMP A;  1GWC A;  1SYX A;  2OBI A;  1CQG A;  2PUK C;  3DML A;  3M9K A;  3IR4 A;  4NV2 A;  4NHZ A;  3WYW A;  4OFM A;  2RUF A;  2YV9 A;  3WGE A;  1YF0 A;  1GSD A;  4PNF A;  3ERF A;  1ML6 A;  2GTU A;  4I97 A;  1SKW B;  1AQV A;  2PN8 A;  4IHU A;  3U6V A;  4HS1 A;  3A2X A;  1GSF A;  2DC5 A;  5HR1 A;  1EV9 A;  3KZQ A;  3E0U A;  2CAQ A;  2AAW A;  1NHO A;  1XOA A;  4P3Y B;  1THO A;  3C1R A;  3GYK A;  2VD1 A;  2K6V A;  5DQS A;  3KMN A;  2K9F A;  4D73 A;  2VL3 A;  1I9D A;  5ECL B;  4GQC A;  2HNL A;  3L9S A;  3GX8 A;  2PVO C;  2B5Y A;  3UEM A;  1TP9 A;  4AJ7 A;  2H8L A;  4EIQ A;  3DVW A;  3L78 A;  3L9V A;  4POM A;  2DIZ A;  3ZVJ D;  1R5P A;  4WR5 A;  3MSZ A;  3GX0 A;  2R4V A;  4OFN A;  4O5Q A;  3QAW A;  3ZL5 A;  4ACS A;  1TU7 A;  2IL3 A;  2H75 A;  4WEY A;  3FR6 A;  2R37 A;  1XPV A;  4LMW A;  2H76 A;  3HKR A;  3HYP A;  2FLS A;  5CRH A;  4ECC A;  4PNG A;  2E0Q A;  2NVL A;  1B48 A;  1FOV A;  2XHF A;  1PX6 A;  3GTU B;  2NTO A;  1QFN A;  2G2Q A;  1I5G A;  1E2Y A;  5KN0 A;  5J3R A;  4PXO A;  3QCP A;  2DMM A;  4TXO A;  1ZYE A;  3CSH A;  3G9B A;  2IME A;  3QOU A;  4CDO A;  4BVX A;  3GSS A;  4CHS A;  1E6B A;  5DQY A;  1GUH A;  4K6X A;  5A4U A;  1FOH A;  3CSJ A;  1MD4 A;  2YWM A;  2GT6 A;  1GSU A;  3RHC A;  4Z2U A;  1WWJ A;  1F3A A;  3GMF A;  4IP6 A;  4PTS A;  4TKY A;  3D4T A;  4KGI A;  1GUM A;  1KEB A;  2HSH A;  2H73 A;  2J23 A;  2CV4 A;  1MDI A;  1YZX A;  3FZ9 A;  2MBS A;  3RHB A;  3TKP A;  4GWR A;  1A8Y A;  3D6I A;  1WIK A;  3R2Q A;  5FT3 A;  2VM2 A;  4NV5 A;  3SBC A;  1WJK A;  2JAD A;  1BJX A;  3GNJ A;  5G5F A;  3U5R E;  1F3B A;  3L9U A;  5B6N A;  4OO4 A;  4MDC A;  5J5N A;  1B9X C;  1V2A A;  5KEJ A;  2A2R A;  1JZW A;  4V1A g;  1KNG A;  2PGT A;  1N2A A;  1X0R A;  3SWL A;  4O5U A;  3NIV A;  5IOW A;  4ECI A;  2AUV A;  2VLU A;  2R2J A;  3F4S A;  4KUN A;  3GH9 A;  1PL2 A;  1YDK A;  2O85 A;  3IK7 A;  3O76 A;  1JZD A;  3MIX A;  3F4T A;  4JE1 A;  1O8W A;  1ZL9 A;  4MK3 A;  2P5Q A;  2BJX A;  5GST A;  4IQA A;  3GFK A;  1SK2 A;  2WDU A;  3VWX A;  2YAN A;  3F0I A;  4NPB A;  1K0B A;  1K0A A;  3A2V A;  2N5A A;  4GCI A;  4F0B A;  3KD0 A;  4MNN A;  18GS A;  1AAZ A;  4TR3 A;  2F8A A;  3ZFL A;  4HU9 A;  4MP4 A;  4HJ2 A;  4GSS A;  4IVF A;  3M8N A;  1EOH A;  3GST A;  2OAC A;  4FO5 A;  3GKX A;  5ECR B;  3P90 A;  2X49 A;  3ERG A;  1O81 A;  3FZ5 A;  4WF5 A;  5AGY A;  3KEB A;  1QGV A;  2C0G A;  3CRU A;  1O73 A;  2VLV A;  5HR0 A;  4V2L A;  1LJR A;  4XS4 A;  2M72 A;  1XVQ A;  2L59 A;  2VLT A;  4MF5 A;  1PSQ A;  1V57 A;  5HFI A;  5H5S A;  3LW9 A;  4GLT A;  4TN8 A;  5GAP D;  4ISD A;  1GRX A;  4GF0 A;  2EC4 A;  5F05 A;  1T7P B;  3E3E A;  2H6Y A;  2YPM A;  3QMX A;  2CX3 A;  2QKE A;  3AY8 A;  5F8B A;  3DEX A;  1X9M B;  2PVQ A;  2LNT A;  4HDE A;  5H5Q A;  2PER A;  3D22 A;  5JWQ B;  1H75 A;  3BJ5 A;  5DAK B;  3DVX A;  2X64 A;  3C7M A;  4L5L A;  2OE1 A;  4K7N A;  1PRX A;  2PPT A;  4J2F A;  1EZK A;  3IK9 A;  4NMU A;  2H6X A;  4XS6 A;  4E8E A;  3RPN A;  3H8Q A;  4LL1 B;  3I43 A;  2B3S A;  4KDX A;  1WOU A;  1M2D A;  2HE3 A;  4IS0 A;  2TRX A;  2H1B A;  1NHY A;  4JR4 A;  1Q4J A;  5ID2 A;  4V1A p;  4DSS A;  1FW1 A;  1UC7 A;  3BCI A;  1ACV A;  1EWX A;  4OWY A;  1HNA A;  5DJL A;  3CXG A;  3DRN A;  4KE3 A;  3MWH A;  5KOX A;  1WRY A;  2WJU A;  4FYU A;  4FYC A;  2LNS A;  1WE0 A;  2V1M A;  6GSW A;  3BCK A;  3HZ4 A;  2P5R A;  3HVS A;  5G31 A;  5B8B A;  4ZBA A;  3TRX A;  3A5I A;  5J4U A;  4F82 A;  2KLX A;  2FWG A;  2AJQ B;  3IA1 A;  3TKS A;  3I9V 2;  4ZBB A;  3APQ A;  2FY6 A;  2DBC A;  1TW9 A;  1W89 A;  5IMD A;  3LSZ A;  1TRW A;  6GSU A;  2DJ2 A;  4L0W A;  3G7J A;  4YQU A;  1R7H A;  3GL5 A;  1B8X A;  1NW2 A;  1AIU A;  1R26 A;  1X9W B;  1A0F A;  1PQN A;  4N0Z A;  3IHQ A;  5CNW A;  1F6M C;  3CTF A;  2R0G A;  1RW1 A;  5CRW A;  3J7Y k;  1YF1 A;  4Z2R A;  2LKU A;  4EXJ A;  3APS A;  2L4C A;  2KUC A;  1Y6E A;  2J9H A;  2X99 A;  4G0I A;  5JWO B;  1GLP A;  2H0H A;  2JU5 A;  4ZB6 A;  1A24 A;  4GXZ A;  1SKS B;  4K0G A;  4I2T A;  4PQI A;  3MAK A;  5IMV A;  2YJ7 A;  3ZYW A;  2KHP A;  2MZC A;  2WUL A;  3GA4 A;  3RDW A;  3FZA A;  3TKS E;  4GSN A;  1TRV A;  2CA8 A;  2GZZ A;  5LD0 A;  1DSB A;  2IMF A;  4BA7 A;  3BOA A;  1J9B A;  3KJY A;  4ILF A;  3DD3 A;  20GS A;  5D93 A;  2NBS A;  3HJP A;  3IC4 A;  3R3E A;  1EGR A;  3FK8 A;  3RAZ A;  3Q6O A;  2H74 A;  3MYD A;  3TJG A;  6GSV A;  1GTB A;  1GSQ A;  1SL0 B;  1QXH A;  1OE8 A;  4IJ3 A;  4LLR A;  5KOW A;  3ZIV A;  2TIR A;  1OC9 A;  3F6F A;  5JCG A;  1OKT A;  3KIJ A;  1TRS A;  4KDU A;  1UVZ A;  3VPT A;  5ECH B;  3KXO A;  3GUR A;  3CBU A;  3IV4 A;  3NZN A;  2K8V A;  1LU4 A;  4HZ4 A;  4K5S A;  1FO5 A;  3WGX A;  2HSM A;  1GTA A;  1M2A A;  3TJJ A;  4BWS A;  19GS A;  3F8U A;  5EPF A;  3KP8 A;  1K0N A;  5IQY A;  4ZBD A;  4X1U A;  5EL8 A;  3P7X A;  1EEM A;  2PMT A;  3ED3 A;  2B1L A;  4CY8 A;  4MMM A;  1PGT A;  1B4P A;  1PA3 A;  3ZTL A;  3GH6 A;  3EU4 A;  3A2W A;  3IOS A;  1F9M A;  1MTC A;  1SJ6 A;  1TU8 A;  1SKR B;  2A2P A;  4TXO B;  1X9S B;  1AQX A;  5IMA A;  1XW5 A;  5DDL A;  12GS A;  3IBH A;  3KP9 A;  5HFG A;  3HHV A;  4EUY A;  4A5P A;  2XPD A;  3TDG A;  4H86 A;  4XTS A;  4GST A;  1PX7 A;  3ZIJ A;  1R5A A;  3ISO A;  1RK4 A;  1URM A;  3KTL A;  3CMI A;  2EIR A;  1Y25 A;  4K2D A;  4EC0 A;  1M9A A;  1M99 A;  2MMN A;  1FVJ A;  4EF0 A;  3D0Z A;  4XHM A;  2VCX A;  4F0C A;  4USS A;  4WF4 A;  1BYE A;  1T00 A;  5ECM B;  1TK0 B;  2KP2 A;  1SYR A;  2O7K A;  2CQ9 A;  1PKZ A;  3E9J B;  3QFB C;  2C0E A;  3ME7 A;  2C1Y A;  3D4M A;  4Q5Q A;  1G6W A;  5DJM A;  3D5J A;  2RM5 A;  5A4V A;  4MCU A;  2REM A;  4WBR D;  2ZNM A;  2L5O A;  4IN0 A;  3VWU A;  2FWH A;  2MMZ A;  4QL7 A;  2HI7 A;  5KN1 A;  1FAA A;  4ML1 A;  1PL1 A;  3WGD A;  1V98 A;  1NSW A;  4MJE A;  5ELA A;  1OYJ A;  1UA5 A;  1GSY A;  13GS A;  2L5L A;  3VUR A;  3P2A A;  5CP1 A;  4YQV A;  2MBT A;  3IAS 2;  1IYH A;  2OBK A;  4IQ1 A;  2QGV A;  7GSS A;  1EP7 A;  2WFC A;  4ECJ A;  2X8C A;  3IAM 2;  2LJK A;  1VGL A;  1V58 A;  1F2E A;  4RUV A;  4PUR A;  5AIV A;  2R0C A;  4KAE A;  4LL4 B;  2YWN A;  2PBJ A;  3FR9 A;  1CQH A;  3EPT A;  2C80 A;  4CW9 A;  2M46 A;  1VRS D;  2UZ8 A;  2VL2 A;  2H01 A;  1TI1 A;  5DCH A;  2DJK A;  4N11 A;  2GLR A;  2ZUP A;  2C0F A;  3PGT A;  5F07 A;  4ML6 A;  4K8M A;  3D21 A;  1O8X A;  3LG6 A;  4PUF C;  4O5R A;  4V2N A;  5J9B A;  5E4W A;  2ON7 A;  3FKF A;  3APO A;  2ES7 A;  1G6Y A;  1U3I A;  4RI6 A;  5INY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...