1ZYPA

Synchrotron reduced form of the n-terminal domain of salmonella typhimurium ahpf
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
196
structure length
196
Chain Sequence
MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPVRKPSFLITNPGSQQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEFETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKEFGQGRMTLTEIVAKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alkyl hydroperoxide reductase subunit F
publication title Oxidized and synchrotron cleaved structures of the disulfide redox center in the N-terminal domain of Salmonella typhimurium AhpF
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 65
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.6.4.-:
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13192 Thioredoxin_3 Thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.80 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1zypA00
4MNNA 4YKFA 4O5QA 4O5UA 4YKGA 1ZYPA 1ZYNA
chains in the Genus database with same CATH superfamily
3Q6OA 3BBYA 2TIRA 2KLXA 1EV9A 2L4CA 1KEBA 1XWAA 4KDYA 2YN1A 4P3YB 2YOIA 4GTUA 3P7XA 5G2ZA 3ZFBA 3GTUA 13GSA 5HFIA 1JLWA 2H72A 4ZBBA 1FB6A 2FUG2 1Q98A 2L59A 3HCZA 3G7IA 3BOAA 3US3A 2OE0A 1V9WA 4BPYA 5H5QA 1SYRA 5IQYA 4MF7A 2IFQA 4FO5A 2QA1A 4MZWA 4WR5A 4EDYA 2PERA 2FA4A 2TRCP 4MJBA 4MNNA 4X4JA 5J3RA 1EGOA 3N5OA 3F4RA 3M0FA 2PVQA 4ULXA 16GSA 4XS4B 2LQOA 2GSSA 1S3DA 5ECMB 3H8QA 3TJJA 1Y6EA 4YAPA 3SWLA 3CMIA 4IVFA 2HSYA 3HDCA 2EIOA 4L8EA 6GSSA 5ECHB 4D73A 4POKA 2V1MA 3FK8A 2R0CA 2C0EA 1XVQA 2ON7A 1R26A 5JWRB 3HD5A 1EZKA 2WJUA 3ERFA 4IQ1A 1SD9A 1F9MA 3KZQA 3UARA 1GTIA 2X49A 4IELA 1N2AA 1T1VA 4XS1A 3L9UA 1PL2A 3Q18A 1AQWA 4TOPA 5DVBA 1RW1A 2KP2A 4Q5RA 2H66A 3HZ8A 1XWKA 4FIWA 4EKZA 3G9BA 4PXOA 3C73A 3O6TA 1PX7A 1KNGA 2B7KA 4IP6A 1PFOA 3KMOA 5G1KA 4AJ7A 4L0WA 1BQ7A 5A4WA 1GSQA 3EINA 2O87A 2J23A 2E2GA 3LYKA 2V32A 4K2XA 1ERTA 3D6IA 2I1UA 5ECKB 2WGRA 3MSZA 2PUKC 3MNGA 4LA1A 1M0UA 2DKHA 4KA0A 4EVMA 5GAND 5KOWA 2VL2A 5J41A 2O7KA 3RPPA 3Q74A 3FRCA 3A3TA 2OADA 3J7Yk 4XCSA 2HYXA 5F06A 3IRAA 5LD0A 5DAKB 2FGXA 4BVXA 4KDXA 3CRTA 1FB0A 5IMDA 2VD0A 2DIYA 3DGQA 4DSSA 1DE2A 3IV4A 1K0AA 2DJKA 1TP9A 3VFIA 4XTSA 4EDZA 5IO0A 4BVYA 3HVSA 3FHKA 4LL4B 6GSXA 2Z9SA 2H73A 4ML6A 4ID0A 4OFTA 5A4UA 1JZDA 2GDRA 4BA7A 1SJ6A 1GNWA 1VF4A 5ECPB 1R5PA 3E0UA 4WXTA 4MPFA 5DBQA 2WB9A 4TN8A 1URMA 4YQVA 2L57A 3EWLA 2GZYA 4KW6A 1T3BA 2D2ZA 4K0GA 5H5SA 3PGTA 2F3MA 5KN0A 1ZGNA 1HYUA 2ON5A 3IBHA 4NMUA 2K8SA 4ZBDA 4JBBA 3RDWA 3BCKA 1X5CA 1B4QA 2R37A 2VM2A 4NV2A 4KSMA 3TKPA 3TOTA 2H74A 1XWBA 4IHUA 2IMEA 1K3YA 2IMFA 3UL3A 4I2TA 3GMFA 3BCIA 14GSA 4EC0A 2NVLA 2PN8A 2WZ9A 3EMPA 1SJZA 1GH2A 4J2FA 2VO4A 2YWNA 5HR3A 1YEXA 1SK2A 1W89A 2OJLA 2VLTA 3CYNA 5F07A 1EOHA 2YWOA 1WPIA 2IMKA 3RHBA 1UA5A 8GSSA 4MH2A 1BX9A 3DXBA 3VLNA 2YWIA 3KH7A 3R2QA 3IHQA 3F6DA 2XBQA 3TKQA 3A5IA 4IJ3A 1XPVA 1XWGA 5IMAA 4K2DA 4Q5FA 1AIUA 5IMVA 4OCFA 4MJCA 3ZIJA 1ZOFA 3R3EA 2A2PA 1ERUA 3GKKA 4TW5A 2C0GA 2P31A 2GQKA 4CHSA 4EF0A 4HQZA 1XBSA 5JCWA 1KBNA 1GL8A 2P5QA 1OVNA 3QDNA 5IPGA 4E8HA 2H76A 3HA9A 5D9VA 1J0FA 3ZREA 3ZMLA 1ZCPA 3C7MA 2YV9A 1K0OA 4ZB9A 1U88A 3NZNA 2CZ2A 2GQMA 1O81A 3H4KA 4IBPA 2PBJA 4LL1B 4WKWA 7GSSA 4YAVA 2RUEA 1M3IA 5HR2A 5CRHA 2AAWA 2GZZA 3P8WA 4FYUA 1YF1A 2IJYA 3WT2A 2FD3A 1EEJA 3M1GA 1I9DA 1R4WA 5COHA 4ECJA 1UN2A 4X1UA 3ME8A 4PUFC 3CSHA 1NHOA 1M9AA 4N0VA 2HSHA 4POBA 5ECSA 1FOVA 2X8HA 5DJMA 3F4TA 5ELGA 4IKHA 4MCUA 1THXA 2PVOC 4TRXA 1U87A 2V6OA 4K0NA 5J9CA 2LSTA 3PINA 4EUYA 4JR6A 5KN1A 3UOMA 3GIXA 2LRCA 1A2LA 4EE0A 2KHPA 3QAGA 3TJFA 4XRAA 1Z5YE 3HJPA 2F8AA 2RM5A 1SU9A 4XS4A 1SD8A 2OACA 3LXTA 2H71A 2DC5A 3GSSA 2IPAA 4ZB8A 1KTEA 1A8LA 3EPTA 2V2GA 4O5QA 2MZCA 1PD21 3GA4A 2B7JA 2I9HA 5CP1A 1A2JA 1V57A 2FA8A 4N0ZA 4QL7A 3UMAA 3LXZA 2YANA 1JHBA 1SJIA 1XOBA 4V2LA 4AGSA 5JWOB 2V41A 4KCEA 1QGVA 5IOWA 3IAM2 4I97A 2GQLA 2DJJA 4GF0A 2YJHA 1WRYA 1QMVA 1TRSA 4JU5A 1B8XA 5INYA 4BWQA 5IMFA 1ERWA 2DMLA 3TJBA 3CTGA 4O92A 1YF0A 3HYPA 4K7IA 3N9JA 1ILOA 3QR6A 3DWVA 4FYBA 2HRNA 1TK8B 3ISOA 4Z2TA 2DJ1A 2C3NA 1GSFA 3VI5A 5D9XA 12GSA 1F6MC 3E3EA 3TB2A 2BTOT 4A5PA 2CAIA 5DAKA 4IQAA 1XWCA 3LQ7A 5B6NA 2LJKA 5B6MA 2L6CA 4TR1B 5DJLA 5KEJA 3F0IA 2B3SA 2RIIA 3W8SA 2OBIA 4ZB6A 2H1GA 3LW9A 1K3OA 2R0PA 4JRRA 5F05A 2JSYA 4G10A 2LKUA 1X5DA 4HEA2 1MDKA 2DBCA 1R5AA 1OC9B 2OE3A 4RUVA 2H0HA 5F8BA 2JU5A 4MZBA 2LTKA 3MYDA 1PSQA 3HVXA 3CSJA 5DALA 3TCOA 1XG8A 2EIQA 1WE0A 5LCZA 3LG6A 1H75A 3SBCA 4LMWA 5H5RA 3EU3A 1HQOA 1XZOA 5HR1A 4CDOA 2R0GA 4RI6A 2AB6A 5ID2B 1FW1A 3CRUA 4RI7A 1IYHA 4TR0A 4N30A 3TOUA 1GSEA 1FHEA 2K8VA 1PGTA 1MDIA 1O85A 1TOFA 2VLUA 5D73A 1T00A 2B5EA 3M9KA 3EYTA 3Q19A 3GKNA 2H19A 4NAXA 5G30A 1DSBA 1K0DA 1X0RA 3HXSA 3IC4A 2N5AA 1BEDA 1MDJA 4WBRD 4BL7B 1TTZA 3UBKA 1FAAA 3EE2A 5ECRB 1TU8A 4K7NA 2GTUA 3F9UA 4G0KA 2CAQA 5IM9A 5HFKA 4GRFA 4KX4A 1GSDA 5G31A 1O6JA 1EV4A 2M72A 1PQNA 3KP8A 1J08A 3QCPA 2OBKA 5A5KA 1M9BA 1AW9A 3F6FA 2QA2A 3U5RE 1SKSB 4POLA 4MZCA 2M80A 4OD7A 4Q5QA 4EO3A 4XHMA 2F8FA 4MA9A 4XIHA 1WMJA 3EC3A 2X64A 1GUKA 2HT9A 3FZAA 4E8EA 4KE3A 3DIEA 1F3AA 3DVWA 3GURA 2VLVA 5JCGA 3GX0A 1QXHA 2PPTA 4OCEA 1XFLA 1TJDA 2MMZA 3GH6A 3M8NA 3IK9A 3BD2A 1OC3A 5ABRA 2P0GA 3W6GA 1Z3EA 4MP4A 4Z2RA 2H8LA 3LFLA 3FEUA 1ACVA 1J9BA 2DJ3A 3ZTLA 5ECQB 2JACA 3L78A 2MMNA 1F3BA 2IL3A 2E2MA 3KXOA 2CX3A 4MF6A 4GQCA 1H4OA 2R4VA 3GX8A 1MD4A 1TK5B 1GRXA 1AXDA 1Q4JA 4GWRA 4GSNA 4HSCX 5ECNB 2R3XA 2FY6A 2F9SA 3CXGA 3VPQA 2C8UA 4PGTA 2C3QA 2UZ8A 4Z7XA 4I8BA 4HJ2A 2B1LA 3A5WA 5C04A 1JZRA 1PKWA 2K9FA 1EEMA 5G5EA 10GSA 3L4NA 1K0CA 1PMTA 3HHVA 3VK9A 2AHEA 2EIRA 1JZOA 2VL9A 3IE3A 3RPNA 1I5GA 1O8WA 3DVXA 3UVHA 2XC2A 4GSSA 1TRVA 1BG5A 3RHCA 1GTUA 3ZLPA 3D4TA 4KAEA 4K5RA 4XRDA 3MAKA 4ACSA 3DMLA 3IC8A 1AQVA 2CV4A 4NHZA 2AJQB 3FR3A 1K0NA 5AISA 2CVKA 4CW9A 4WF4A 4PNFA 4G2EA 1OC8A 1WOUA 5DQYA 5HFGA 1CQHA 4HZ4A 2H30A 5AGYA 4K9ZA 4O32A 1DUGA 5DCHA 1Z7PA 1G0TA 2PU9C 5DCGA 2RM6A 3ZZXA 3PPUA 3I43A 2VCQA 4NWYA 2GZPA 4LLRA 2WDUA 1THOA 2KUCA 2GVPA 4WEYA 1QK8A 2QC7A 1F2EA 1M2BA 1V2AA 3DD3A 5BMUA 1ERVA 3KD0A 3V1WA 4PUAA 4D73B 1VGLA 5J4UA 2M46A 5D93A 2HRAA 1X5EA 3IK7A 3TRQA 5HR0A 2HZEA 3QPMA 4FH8A 2YZUA 3WGEA 4MJAA 3KGKA 4GXZA 5KN2A 1UVZA 2YWMA 3TKSE 1G7OA 4IP1A 2ZCTA 4YQMA 2FNOA 4ML1A 3JCML 1GUHA 2LNTA 1SL1B 3KMNA 4I2UA 3WYWA 3L9SA 3ZYWA 5GZZB 4F0BA 1TRUA 1VF2A 2C80A 1NHYA 4KDUA 3TDGA 1A0RP 5IMCA 4TR1A 4F82A 3APSA 1TI1A 2GT6A 2XPEA 6GSVA 3ZITA 3D4MA 1O7UA 2R6KA 4YKFA 3MIXA 1QFNA 3DYRA 3VPTA 3W8JA 1ZL9A 1PA3A 1O8XA 3F63A 4OFNA 4F0CA 3FY7A 3P90A 1FVJA 2VCTA 3VWWA 2LUSA 1K0MA 1U3AA 1S3RA 1Z7RA 4ZBAA 4AJ6A 5B8BA 2C4JA 4PNGA 3A2WA 4BVXB 5EPFA 2MBTA 3C1RA 3C71A 3GL3A 3E9JB 5GAPD 2VOCA 1Y25A 1OE7A 3KCMA 4PQHA 4MJEA 1YKCA 4L0UA 3P2AA 5CREA 1BJXA 3LJRA 2ZUPA 1GSUA 4TXOB 1LU4A 3WGDA 2LS5A 2MMOA 3EU4A 4EL1A 4K5SA 1DE1A 4USSA 4IS0A 1M7TA 3IR4A 3U6VA 2VL3A 2QSIA 4KB3A 4OMVA 4K7OA 2VUPA 2HI7A 4KH7A 4KSOA 4BL7A 4KNDA 4TXVA 2AV4A 1ZYPA 2A4VA 3VWVA 1QUWA 2L4QA 2VCVA 2AUVA 5B8AA 3PH9A 3MWHA 3NOFA 1ZZYA 3VWXA 3I69A 5IOXA 1M99A 2J9HA 2OKAA 3ZIVA 2H01A 1PN0A 4HJMA 1NSWA 4QL9A 2YV7A 1ON4A 2GLRA 2G2QA 4G19A 1HNBA 4ZIJA 1GWCA 2IIYA 2LQQA 1R7HA 4DVCA 4O5UA 1USBA 3A2XA 2FCHA 1Z6MA 1G7EA 3HJOA 4V1Ag 4IJIA 5G5FA 5D9WA 1SKRB 3TJKA 4IW9A 5EVOA 1JZWA 1SL0B 5GSSA 5E4WA 3APOA 2LEGA 1VRSD 4JEDA 2NDOA 4K6XA 1A2MA 1GLPA 2BMXA 2YZHA 2EC4A 1PKZA 2PWJA 4K8MA 4POMA 3GSTA 3M9JA 4QQ7A 4X0XA 1XW9A 1LJRA 3TRPA 4KGIA 5CYYA 3A2VA 3K8NA 2FWGA 1B9XC 4ZL7A 4L5OA 3S9FA 2PGTA 1YEPA 3DEXA 2K6VA 4ISDA 4F2IA 1U6TA 1YDKA 1A0FA 1EP8A 4RQRA 3ZMKA 1GTBA 4PQ1A 3O76A 3DRNA 4I5QA 2GSRA 5CRDA 3D5JA 5AN1A 3FZ9A 1VF1A 1G6YA 2WRTA 3HJMA 3TUEA 3I9V2 3BJ5A 1PL1A 4CY8A 2CA8A 5HQPA 1XW6A 4X43A 2HFDA 3IPZA 2LJAA 5F0GA 3G7YA 3LWAA 2WFCA 3QAVA 1T7PB 2NBSA 3VI7A 5CO3A 5CNWA 1WP0A 2I3YA 5D8IA 2O89A 5IMZA 1Z6NA 2G0FA 2H6XA 3ZRDA 4ECIA 4ZL8A 4XS6A 3D21A 3GNJA 1XOAA 1LBKA 3CSIA 2IMIA 1N8JA 1FOHA 2DJ2A 3FYGA 4G0IA 1YJ6A 2YCDA 3LEFA 3RAZA 4HUAA 4PQIA 4DSRA 3FKFA 4OFMA 2C3TA 4NHWA 1V40A 2C1YA 20GSA 5J9BA 3HVNA 2ALBA 1HD2A 2I4AA 4KUNA 3LGCA 2H6YA 4TR4A 4N10A 3GKXA 2X8GA 3DKSA 4G0LA 4BWSA 3GH9A 2R2JA 4YQUA 2VM1A 1TXXA 2DMMA 3MDKA 2JZSA 2CT6A 3AY8A 2MMAA 1K3LA 4OO4A 4NV5A 1YY7A 2FHEA 2V6KA 3KJYA 4FYCA 4WETA 4PTSA 2IMDA 19GSA 4OWYA 4MABA 5ECLB 4ICYA 4Q5NA 3KIJA 4Z2UA 3L0HA 2OE1A 4MPGA 1XIYA 3ED3A 2HRFA 6GSUA 4HI7A 3VWUA 2B1KA 3KM6A 1VF3A 3HKRA 4V2NA 2LV3A 5D9TA 3ERGA 4J56E 2X4AA 3I6AA 4MLYA 1TKDB 1GLQA 9GSSA 2C0DA 1OYJA 5KOXA 1UC7A 1YKAA 2KP1A 5D96A 1EWXA 5CAXA 3IDVA 2FWFA 3TRXA 1RK4A 2HLSA 3LYPA 4TVEA 2FWHA 4O5RA 5JCUA 1PX6A 3F3QA 5FT3A 2CVDA 3APQA 1EOGA 3C8EA 5B7CA 5IPHA 2KOKA 3HY2A 3ERWA 3LSZA 1MTCA 2NTOA 22GSA 1S3CA 2X8CA 1ZMAA 1TDIA 4K1FA 4I6XA 2A4HA 2DLXA 4JE1A 2L5OA 4DSQA 3HZ4A 2GGTA 4V1Ap 4HOJA 3FZ5A 1U3IA 4IGJA 2H75A 1ZYNA 5FWGA 1GSSA 3CTFA 2R5GA 3FR6A 2H0GA 2YPMA 4EIPA 3WT1A 5BRTA 2REMA 3FR9A 1XXUA 4OO5A 1GNEA 5DQSA 1XW5A 4TXOA 2WS2A 1Z9HA 2CX4A 1FVKA 4RQXA 1MD3A 2VIMA 5IIZA 1IYIA 1T4YA 4ILFA 5DALB 4TR3A 2YNXA 1CQGA 2LJRA 2H6ZA 3QD9A 1PRXA 3ME7A 5EL8A 4MK3A 3GTUB 4HDEA 1B9YC 5FHIA 1M3JA 3F3RA 3IAS2 6GSWA 1A23A 2H1AA 3VURA 3IOSA 2JL4A 4ZL9A 2E7PA 4WF5A 6GSYA 2XHFA 2XBIA 11GSA 3LORA 1TU7A 3ZL5A 1NW2A 5ELAA 3ZFLA 1SK1A 3FZ4A 2IFQB 1SK0A 5IO2A 4MH3A 4ZXGA 3IXRA 3GHAA 4AF2A 4EIQA 2AYTA 4ECBA 4J57E 1GULA 5ECIB 1TW9A 3IHGA 5L71A 4MF5A 2ES7A 2LNSA 2VL2C 3F4SA 4N11A 2A2RA 1XCCA 2MYGA 3FMWA 5ECOB 2JZRA 3KTLA 3O3TA 2GT5A 2ZNMA 4F9ZA 2HRKA 3CQFA 2BJXA 3UVTA 3HVVA 4V2MA 4YKGA 1ZYQB 1ABAA 1WJKA 2L5LA 5EY6A 1T4ZA 18GSA 3OR5A 2O85A 1AQXA 1BYEA 1EP7A 4GCIA 2JSZA 2WULA 4IN0A 3QFAC 5E59A 3C1SA 1SYXA 1MEKA 3GN3A 4PX1A 1E2YA 1AAZA 3UBLA 3PR8A 2DKIA 5J5NA 4F03A 2LRTA 2QGVA 2L6DA 4TKYA 2DJ0A 3FW2A 1OC9A 1JLVA 1PN9A 3CBUA 1ST9A 3QOUA 2X99A 2GSTA 1K0BA 2FLSA 2XPDA 1HNAA 4DEJA 4BIKA 1M2AA 2H1DA 2H0IA 2A2SA 2GS3A 4O7HA 4L5LA 4AJ8A 1EGRA 1B48A 5GSTA 3L9VA 4G9HA 4GSTA 1WIKA 3TJGA 3GL5A 1OAZA 2HZFA 4GQFA 4ECCA 3NIVA 1G6WA 2VD1A 3D0ZA 2JADA 2RUFA 4DSSB 4CY6A 5ID2A 2JZTA 1DBYA 3TKSA 2DSAA 4BVYB 2N5FA 5AIXA 2F51A 2TRXA 2O8VB 4KF9A 1B4PA 17GSA 3EVIA 3GYKA 2K18A 4PURA 1TK0B 2E0QA 3GFKA 5A4VA 1O73A 2NPBA 1S3AA 2IN3A 1W4VA 5DDLA 3GV1A 3WGXA 3KEBA 3EMXA 1OKTA 3G7JA 1V98A 1SL2B 3H1NA 1OKDA 3TKRA 4H86A 4ZILA 3EURA 1BAYA 3UIWA 5ENUA 2PMTA 3M3MA 1A24A 3UEMA 3RBTA 2B6MA 4HZ2A 5AIVA 4WBJA 2IWTA 2VCWA 1NM3A 3GRXA 4NXIA 3UJ1A 4LMVA 2B5XA 1OE8A 2LRNA 1ML6A 2VCXA 1YZXA 1GP1A 1A8YA 1QQ2A 4FQUA 2HNLA 2GSQA 2RLIA 1F37A 2HXKA 2B5YA 1SKWB 4JZQA 3H93A 1TI3A 1WWJA 4KCAA 1GUMA 1YQ1A 2CZ3A 1AC1A 4GLTA 2CVBA 2YJ7A 5G1LA 5C00A 1FG4A 2HE3A 4HU7A 5CRWA 2QKEA 1HNCA 1E6BA 6GSTA 2H1BA 3IA1A 3GKMA 1FO5A 4JR4A 3TKSC 1ZYEA 2C0FA 2VAFA 1JFUA 3KH9A 2HSMA 3D22A 3QAWA 1X9WB 2P5RA 4HQSA 2HZEB 5CRGA 1SENA 3QMXA 3J7Yb 1GSYA 4HS1A 3KP9A 5KN3A 1GTAA 3ZVJA 1V58A 4NPBA 4HU9A 3H79A 3WD6A 2FWEA 3F8UA 4MMMA 2DIZA 5JWQB 3KTBA 3GUSA 3ZVJD 1T8EB 1XVWA 2N5BA 4MDCA 1RQMA 2WCIA 2YP6A 1C72A 1M2DA 2VCZA 1X9MB 1X9SB 3TGZA 4WR4A 1TRWA 3UAPA 2H70A 2I81A 2OA7A 4EXJA 4YH2A 2CQ9A 3QFBC 1AUCA 2MBSA 5LNKe
chains in the Genus database with same CATH topology
3Q6OA 3BBYA 2TIRA 2KLXA 1EV9A 2L4CA 1KEBA 1XWAA 4KDYA 2YN1A 4P3YB 2YOIA 4GTUA 3P7XA 5G2ZA 3ZFBA 3GTUA 13GSA 5HFIA 1JLWA 2H72A 4ZBBA 1FB6A 2FUG2 1Q98A 2L59A 3HCZA 3G7IA 3BOAA 3US3A 2OE0A 1V9WA 4BPYA 5H5QA 1SYRA 5IQYA 4MF7A 2IFQA 4FO5A 2QA1A 4MZWA 4WR5A 4EDYA 2PERA 2FA4A 2TRCP 4MJBA 4MNNA 4X4JA 5J3RA 1EGOA 3N5OA 3F4RA 3M0FA 2PVQA 4ULXA 16GSA 4XS4B 2LQOA 2GSSA 1S3DA 5ECMB 3H8QA 3TJJA 1Y6EA 4YAPA 3SWLA 3CMIA 4IVFA 2HSYA 3HDCA 2EIOA 4L8EA 6GSSA 5ECHB 4D73A 4POKA 2V1MA 3FK8A 2R0CA 2C0EA 1XVQA 2ON7A 1R26A 5JWRB 3HD5A 1EZKA 2WJUA 3ERFA 4IQ1A 1SD9A 1F9MA 3KZQA 3UARA 1GTIA 2X49A 4IELA 1N2AA 1T1VA 4XS1A 3L9UA 1PL2A 3Q18A 1AQWA 4TOPA 5DVBA 1RW1A 2KP2A 4Q5RA 2H66A 3HZ8A 1XWKA 4FIWA 4EKZA 3G9BA 4PXOA 3C73A 3O6TA 1PX7A 1KNGA 2B7KA 4IP6A 3KMOA 5G1KA 4AJ7A 4L0WA 1BQ7A 5A4WA 1GSQA 3EINA 2O87A 2J23A 2E2GA 3LYKA 2V32A 4K2XA 1ERTA 3D6IA 2I1UA 5ECKB 2WGRA 3MSZA 2PUKC 3MNGA 4LA1A 1M0UA 2DKHA 4KA0A 4EVMA 5GAND 5KOWA 2VL2A 5J41A 2O7KA 3RPPA 3Q74A 3FRCA 3A3TA 2OADA 3J7Yk 4XCSA 2HYXA 5F06A 3IRAA 5LD0A 5DAKB 2FGXA 4BVXA 4KDXA 3CRTA 1FB0A 5IMDA 2VD0A 2DIYA 3DGQA 4DSSA 1DE2A 3IV4A 1K0AA 2DJKA 1TP9A 3VFIA 4XTSA 4EDZA 5IO0A 4BVYA 3HVSA 3FHKA 4LL4B 6GSXA 2Z9SA 2H73A 4ML6A 4ID0A 4OFTA 5A4UA 1JZDA 2GDRA 4BA7A 1SJ6A 1GNWA 1VF4A 5ECPB 1R5PA 3E0UA 4WXTA 4MPFA 5DBQA 2WB9A 4TN8A 1URMA 4YQVA 2L57A 3EWLA 2GZYA 4KW6A 1T3BA 2D2ZA 4K0GA 5H5SA 3PGTA 2F3MA 5KN0A 1ZGNA 1HYUA 2ON5A 3IBHA 4NMUA 2K8SA 4ZBDA 4JBBA 3RDWA 3BCKA 1X5CA 1B4QA 2R37A 2VM2A 4NV2A 4KSMA 3TKPA 3TOTA 2H74A 1XWBA 4IHUA 2IMEA 1K3YA 2IMFA 3UL3A 4I2TA 3GMFA 3BCIA 14GSA 4EC0A 2NVLA 2PN8A 2WZ9A 3EMPA 1SJZA 1GH2A 4J2FA 2VO4A 2YWNA 5HR3A 1YEXA 1SK2A 1W89A 2OJLA 2VLTA 3CYNA 5F07A 1EOHA 2YWOA 1WPIA 2IMKA 3RHBA 1UA5A 8GSSA 4MH2A 1BX9A 3DXBA 3VLNA 2YWIA 3KH7A 3R2QA 3IHQA 3F6DA 2XBQA 3TKQA 3A5IA 4IJ3A 1XPVA 1XWGA 5IMAA 4K2DA 4Q5FA 1AIUA 5IMVA 4OCFA 4MJCA 3ZIJA 1ZOFA 3R3EA 2A2PA 1ERUA 3GKKA 4TW5A 2C0GA 2P31A 2GQKA 4CHSA 4EF0A 4HQZA 1XBSA 5JCWA 1KBNA 1GL8A 2P5QA 1OVNA 3QDNA 5IPGA 4E8HA 2H76A 3HA9A 5D9VA 1J0FA 3ZREA 3ZMLA 1ZCPA 3C7MA 2YV9A 1K0OA 4ZB9A 1U88A 3NZNA 2CZ2A 2GQMA 1O81A 3H4KA 4IBPA 2PBJA 4LL1B 4WKWA 7GSSA 4YAVA 2RUEA 5HR2A 5CRHA 2AAWA 2GZZA 3P8WA 4FYUA 1YF1A 2IJYA 3WT2A 2FD3A 1EEJA 3M1GA 1I9DA 1R4WA 5COHA 4ECJA 1UN2A 4X1UA 3ME8A 4PUFC 3CSHA 1NHOA 1M9AA 4N0VA 2HSHA 4POBA 5ECSA 1FOVA 2X8HA 5DJMA 3F4TA 5ELGA 4IKHA 4MCUA 1THXA 2PVOC 4TRXA 1U87A 2V6OA 4K0NA 5J9CA 2LSTA 3PINA 4EUYA 4JR6A 5KN1A 3UOMA 3GIXA 2LRCA 1A2LA 4EE0A 2KHPA 3QAGA 3TJFA 4XRAA 1Z5YE 3HJPA 2F8AA 2RM5A 1SU9A 4XS4A 1SD8A 2OACA 3LXTA 2H71A 2DC5A 3GSSA 2IPAA 4ZB8A 1KTEA 1A8LA 3EPTA 2V2GA 4O5QA 2MZCA 1PD21 3GA4A 2B7JA 2I9HA 5CP1A 1A2JA 1V57A 2FA8A 4N0ZA 4QL7A 3UMAA 3LXZA 2YANA 1JHBA 1SJIA 1XOBA 4V2LA 4AGSA 5JWOB 2V41A 4KCEA 1QGVA 5IOWA 3IAM2 4I97A 2GQLA 2DJJA 4GF0A 2YJHA 1WRYA 1QMVA 1TRSA 4JU5A 1B8XA 5INYA 4BWQA 5IMFA 1ERWA 2DMLA 3TJBA 3CTGA 4O92A 1YF0A 3HYPA 4K7IA 3N9JA 1ILOA 3QR6A 3DWVA 4FYBA 2HRNA 1TK8B 3ISOA 4Z2TA 2DJ1A 2C3NA 1GSFA 3VI5A 5D9XA 12GSA 1F6MC 3E3EA 3TB2A 2BTOT 4A5PA 2CAIA 5DAKA 4IQAA 1XWCA 3LQ7A 5B6NA 2LJKA 5B6MA 2L6CA 4TR1B 5DJLA 5KEJA 3F0IA 2B3SA 2RIIA 3W8SA 2OBIA 4ZB6A 2H1GA 3LW9A 1K3OA 2R0PA 4JRRA 5F05A 2JSYA 4G10A 2LKUA 1X5DA 4HEA2 1MDKA 2DBCA 1R5AA 1OC9B 2OE3A 4RUVA 2H0HA 5F8BA 2JU5A 4MZBA 2LTKA 3MYDA 1PSQA 3HVXA 3CSJA 5DALA 3TCOA 2EIQA 1WE0A 5LCZA 3LG6A 1H75A 3SBCA 4LMWA 5H5RA 3EU3A 1HQOA 1XZOA 5HR1A 4CDOA 2R0GA 4RI6A 2AB6A 5ID2B 1FW1A 3CRUA 4RI7A 1IYHA 4TR0A 4N30A 3TOUA 1GSEA 1FHEA 2K8VA 1PGTA 1MDIA 1O85A 1TOFA 2VLUA 5D73A 1T00A 2B5EA 3M9KA 3EYTA 3Q19A 3GKNA 2H19A 4NAXA 5G30A 1DSBA 1K0DA 1X0RA 3HXSA 3IC4A 2N5AA 1BEDA 1MDJA 4WBRD 4BL7B 1TTZA 3UBKA 1FAAA 3EE2A 5ECRB 1TU8A 4K7NA 2GTUA 3F9UA 4G0KA 2CAQA 5IM9A 5HFKA 4GRFA 4KX4A 1GSDA 5G31A 1O6JA 1EV4A 2M72A 1PQNA 3KP8A 1J08A 3QCPA 2OBKA 5A5KA 1M9BA 1AW9A 3F6FA 2QA2A 3U5RE 1SKSB 4POLA 4MZCA 2M80A 4OD7A 4Q5QA 4EO3A 4XHMA 2F8FA 4MA9A 4XIHA 1WMJA 3EC3A 2X64A 1GUKA 2HT9A 3FZAA 4E8EA 4KE3A 3DIEA 1F3AA 3DVWA 3GURA 2VLVA 5JCGA 3GX0A 1QXHA 2PPTA 4OCEA 1XFLA 1TJDA 2MMZA 3GH6A 3M8NA 3IK9A 3BD2A 1OC3A 5ABRA 2P0GA 3W6GA 1Z3EA 4MP4A 4Z2RA 2H8LA 3LFLA 3FEUA 1ACVA 1J9BA 2DJ3A 3ZTLA 5ECQB 2JACA 3L78A 2MMNA 1F3BA 2IL3A 2E2MA 3KXOA 2CX3A 4MF6A 4GQCA 1H4OA 2R4VA 3GX8A 1MD4A 1TK5B 1GRXA 1AXDA 1Q4JA 4GWRA 4GSNA 5ECNB 2R3XA 2FY6A 2F9SA 3CXGA 3VPQA 2C8UA 4PGTA 2C3QA 2UZ8A 4Z7XA 4I8BA 4HJ2A 2B1LA 3A5WA 5C04A 1JZRA 1PKWA 2K9FA 1EEMA 5G5EA 10GSA 3L4NA 1K0CA 1PMTA 3HHVA 3VK9A 2AHEA 2EIRA 1JZOA 2VL9A 3IE3A 3RPNA 1I5GA 1O8WA 3DVXA 3UVHA 2XC2A 4GSSA 1TRVA 1BG5A 3RHCA 1GTUA 3ZLPA 3D4TA 4KAEA 4K5RA 4XRDA 3MAKA 4ACSA 3DMLA 3IC8A 1AQVA 2CV4A 4NHZA 2AJQB 3FR3A 1K0NA 5AISA 2CVKA 4CW9A 4WF4A 4PNFA 4G2EA 1OC8A 1WOUA 5DQYA 5HFGA 1CQHA 4HZ4A 2H30A 5AGYA 4K9ZA 4O32A 1DUGA 5DCHA 1Z7PA 1G0TA 2PU9C 5DCGA 2RM6A 3ZZXA 3PPUA 3I43A 2VCQA 4NWYA 2GZPA 4LLRA 2WDUA 1THOA 2KUCA 2GVPA 4WEYA 1QK8A 2QC7A 1F2EA 1M2BA 1V2AA 3DD3A 5BMUA 1ERVA 3KD0A 3V1WA 4PUAA 4D73B 1VGLA 5J4UA 2M46A 5D93A 2HRAA 1X5EA 3IK7A 3TRQA 5HR0A 2HZEA 3QPMA 4FH8A 2YZUA 3WGEA 4MJAA 3KGKA 4GXZA 5KN2A 1UVZA 2YWMA 3TKSE 1G7OA 4IP1A 2ZCTA 4YQMA 2FNOA 4ML1A 3JCML 1GUHA 2LNTA 1SL1B 3KMNA 4I2UA 3WYWA 3L9SA 3ZYWA 5GZZB 4F0BA 1TRUA 1VF2A 2C80A 1NHYA 4KDUA 3TDGA 1A0RP 5IMCA 4TR1A 4F82A 3APSA 1TI1A 2GT6A 2XPEA 6GSVA 3ZITA 3D4MA 1O7UA 2R6KA 4YKFA 3MIXA 1QFNA 3DYRA 3VPTA 3W8JA 1ZL9A 1PA3A 1O8XA 3F63A 4OFNA 4F0CA 3FY7A 3P90A 1FVJA 2VCTA 3VWWA 2LUSA 1K0MA 1U3AA 1Z7RA 4AJ6A 4ZBAA 5B8BA 2C4JA 4PNGA 3A2WA 4BVXB 5EPFA 2MBTA 3C1RA 3C71A 3GL3A 3E9JB 5GAPD 2VOCA 1Y25A 1OE7A 3KCMA 4PQHA 4MJEA 1YKCA 4L0UA 3P2AA 5CREA 1BJXA 3LJRA 2ZUPA 1GSUA 4TXOB 1LU4A 3WGDA 2LS5A 2MMOA 3EU4A 4EL1A 4K5SA 1DE1A 4USSA 4IS0A 1M7TA 3IR4A 3U6VA 2VL3A 2QSIA 4KB3A 4OMVA 4K7OA 2VUPA 2HI7A 4KH7A 4KSOA 4BL7A 4KNDA 4TXVA 2AV4A 1ZYPA 2A4VA 3VWVA 1QUWA 2L4QA 2VCVA 2AUVA 5B8AA 3PH9A 3MWHA 3NOFA 1ZZYA 3VWXA 3I69A 5IOXA 1M99A 2J9HA 2OKAA 3ZIVA 2H01A 1PN0A 4HJMA 1NSWA 4QL9A 2YV7A 1ON4A 2GLRA 2G2QA 4G19A 1HNBA 4ZIJA 1GWCA 2IIYA 2LQQA 1R7HA 4DVCA 4O5UA 1USBA 3A2XA 2FCHA 1Z6MA 1G7EA 3HJOA 4V1Ag 4IJIA 5G5FA 5D9WA 1SKRB 3TJKA 4IW9A 5EVOA 1JZWA 1SL0B 5GSSA 5E4WA 3APOA 2LEGA 1VRSD 4JEDA 2NDOA 4K6XA 1A2MA 1GLPA 2BMXA 2YZHA 2EC4A 1PKZA 2PWJA 4K8MA 4POMA 3GSTA 3M9JA 4QQ7A 4X0XA 1XW9A 1LJRA 3TRPA 4KGIA 5CYYA 3A2VA 3K8NA 2FWGA 1B9XC 4ZL7A 4L5OA 3S9FA 2PGTA 1YEPA 3DEXA 2K6VA 4ISDA 4F2IA 1U6TA 1YDKA 1A0FA 1EP8A 4RQRA 3ZMKA 1GTBA 4PQ1A 3O76A 3DRNA 4I5QA 2GSRA 5CRDA 3D5JA 5AN1A 3FZ9A 1VF1A 1G6YA 2WRTA 3HJMA 3TUEA 3I9V2 3BJ5A 1PL1A 4CY8A 2CA8A 5HQPA 1XW6A 4X43A 2HFDA 3IPZA 2LJAA 5F0GA 3G7YA 3LWAA 2WFCA 3QAVA 1T7PB 2NBSA 3VI7A 5CO3A 5CNWA 1WP0A 2I3YA 5D8IA 2O89A 5IMZA 1Z6NA 2G0FA 2H6XA 3ZRDA 4ECIA 4ZL8A 4XS6A 3D21A 3GNJA 1XOAA 1LBKA 3CSIA 2IMIA 1N8JA 1FOHA 2DJ2A 3FYGA 4G0IA 1YJ6A 2YCDA 3LEFA 3RAZA 4HUAA 4PQIA 4DSRA 3FKFA 4OFMA 2C3TA 4NHWA 1V40A 2C1YA 20GSA 5J9BA 2ALBA 1HD2A 2I4AA 4KUNA 3LGCA 2H6YA 4TR4A 4N10A 3GKXA 2X8GA 3DKSA 4G0LA 4BWSA 3GH9A 2R2JA 4YQUA 2VM1A 1TXXA 2DMMA 3MDKA 2JZSA 2CT6A 3AY8A 2MMAA 1K3LA 4OO4A 4NV5A 1YY7A 2FHEA 2V6KA 3KJYA 4FYCA 4WETA 4PTSA 2IMDA 19GSA 4OWYA 4MABA 5ECLB 4ICYA 4Q5NA 3KIJA 4Z2UA 3L0HA 2OE1A 4MPGA 1XIYA 3ED3A 2HRFA 6GSUA 4HI7A 3VWUA 2B1KA 3KM6A 1VF3A 3HKRA 4V2NA 2LV3A 5D9TA 3ERGA 4J56E 2X4AA 3I6AA 4MLYA 1TKDB 1GLQA 9GSSA 2C0DA 1OYJA 5KOXA 1UC7A 1YKAA 2KP1A 5D96A 1EWXA 5CAXA 3IDVA 2FWFA 3TRXA 1RK4A 2HLSA 3LYPA 4TVEA 2FWHA 4O5RA 5JCUA 1PX6A 3F3QA 5FT3A 2CVDA 3APQA 1EOGA 3C8EA 5B7CA 5IPHA 2KOKA 3HY2A 3ERWA 3LSZA 1MTCA 2NTOA 22GSA 1S3CA 2X8CA 1ZMAA 1TDIA 4K1FA 4I6XA 2A4HA 2DLXA 4JE1A 2L5OA 4DSQA 3HZ4A 2GGTA 4V1Ap 4HOJA 3FZ5A 1U3IA 4IGJA 2H75A 1ZYNA 5FWGA 1GSSA 3CTFA 2R5GA 3FR6A 2H0GA 2YPMA 4EIPA 3WT1A 5BRTA 2REMA 3FR9A 1XXUA 4OO5A 1GNEA 5DQSA 1XW5A 4TXOA 2WS2A 1Z9HA 2CX4A 1FVKA 4RQXA 1MD3A 2VIMA 5IIZA 1IYIA 1T4YA 4ILFA 5DALB 4TR3A 2YNXA 1CQGA 2LJRA 2H6ZA 3QD9A 1PRXA 3ME7A 5EL8A 4MK3A 3GTUB 4HDEA 1B9YC 5FHIA 3F3RA 3IAS2 6GSWA 1A23A 2H1AA 3VURA 3IOSA 2JL4A 4ZL9A 2E7PA 4WF5A 6GSYA 2XHFA 2XBIA 11GSA 3LORA 1TU7A 3ZL5A 1NW2A 5ELAA 3ZFLA 1SK1A 3FZ4A 2IFQB 1SK0A 5IO2A 4MH3A 4ZXGA 3IXRA 3GHAA 4AF2A 4EIQA 2AYTA 4ECBA 4J57E 1GULA 5ECIB 1TW9A 3IHGA 5L71A 4MF5A 2ES7A 2LNSA 2VL2C 3F4SA 4N11A 2A2RA 1XCCA 2MYGA 3FMWA 5ECOB 2JZRA 3KTLA 3O3TA 2GT5A 2ZNMA 4F9ZA 2HRKA 2BJXA 3UVTA 3HVVA 4V2MA 4YKGA 1ZYQB 1ABAA 1WJKA 2L5LA 5EY6A 1T4ZA 18GSA 3OR5A 2O85A 1AQXA 1BYEA 1EP7A 4GCIA 2JSZA 2WULA 4IN0A 3QFAC 5E59A 3C1SA 1SYXA 1MEKA 3GN3A 4PX1A 1E2YA 1AAZA 3UBLA 3PR8A 2DKIA 5J5NA 4F03A 2LRTA 2QGVA 2L6DA 4TKYA 2DJ0A 3FW2A 1OC9A 1JLVA 1PN9A 3CBUA 1ST9A 3QOUA 2X99A 2GSTA 1K0BA 2FLSA 2XPDA 1HNAA 4DEJA 1M2AA 2H1DA 2H0IA 2A2SA 2GS3A 4O7HA 4L5LA 4AJ8A 1EGRA 1B48A 5GSTA 3L9VA 4G9HA 4GSTA 1WIKA 3TJGA 3GL5A 1OAZA 2HZFA 4GQFA 4ECCA 3NIVA 1G6WA 2VD1A 3D0ZA 2JADA 2RUFA 4DSSB 4CY6A 5ID2A 2JZTA 1DBYA 3TKSA 2DSAA 4BVYB 2N5FA 5AIXA 2F51A 2TRXA 2O8VB 4KF9A 1B4PA 17GSA 3EVIA 3GYKA 2K18A 4PURA 1TK0B 2E0QA 3GFKA 5A4VA 1O73A 2NPBA 1S3AA 2IN3A 1W4VA 5DDLA 3GV1A 3WGXA 3KEBA 3EMXA 1OKTA 3G7JA 1V98A 1SL2B 3H1NA 1OKDA 3TKRA 4H86A 4ZILA 3EURA 1BAYA 3UIWA 5ENUA 2PMTA 3M3MA 1A24A 3UEMA 3RBTA 2B6MA 4HZ2A 5AIVA 4WBJA 2IWTA 2VCWA 1NM3A 3GRXA 4NXIA 3UJ1A 4LMVA 2B5XA 1OE8A 2LRNA 1ML6A 2VCXA 1YZXA 1GP1A 1A8YA 1QQ2A 4FQUA 2HNLA 2GSQA 2RLIA 1F37A 2HXKA 2B5YA 1SKWB 4JZQA 3H93A 1TI3A 1WWJA 4KCAA 1GUMA 1YQ1A 2CZ3A 1AC1A 4GLTA 2CVBA 2YJ7A 5G1LA 5C00A 1FG4A 2HE3A 4HU7A 5CRWA 2QKEA 1HNCA 1E6BA 6GSTA 2H1BA 3IA1A 3GKMA 1FO5A 4JR4A 3TKSC 1ZYEA 2C0FA 2VAFA 1JFUA 3KH9A 2HSMA 3D22A 3QAWA 1X9WB 2P5RA 4HQSA 2HZEB 5CRGA 1SENA 3QMXA 3J7Yb 1GSYA 4HS1A 3KP9A 5KN3A 1GTAA 3ZVJA 1V58A 4NPBA 4HU9A 3H79A 3WD6A 2FWEA 3F8UA 4MMMA 2DIZA 5JWQB 3KTBA 3GUSA 3ZVJD 1T8EB 1XVWA 2N5BA 4MDCA 1RQMA 2WCIA 2YP6A 1C72A 1M2DA 2VCZA 1X9MB 1X9SB 3TGZA 4WR4A 1TRWA 3UAPA 2H70A 2I81A 2OA7A 4EXJA 4YH2A 2CQ9A 3QFBC 1AUCA 2MBSA 5LNKe
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MNN A;  4YKF A;  4O5Q A;  4O5U A;  4YKG A;  1ZYP A;  1ZYN A; 
#chains in the Genus database with same CATH topology
 3Q6O A;  3BBY A;  2TIR A;  2KLX A;  1EV9 A;  2L4C A;  1KEB A;  1XWA A;  4KDY A;  2YN1 A;  4P3Y B;  2YOI A;  4GTU A;  3P7X A;  5G2Z A;  3ZFB A;  3GTU A;  13GS A;  5HFI A;  1JLW A;  2H72 A;  4ZBB A;  1FB6 A;  2FUG 2;  1Q98 A;  2L59 A;  3HCZ A;  3G7I A;  3BOA A;  3US3 A;  2OE0 A;  1V9W A;  4BPY A;  5H5Q A;  1SYR A;  5IQY A;  4MF7 A;  2IFQ A;  4FO5 A;  2QA1 A;  4MZW A;  4WR5 A;  4EDY A;  2PER A;  2FA4 A;  2TRC P;  4MJB A;  4MNN A;  4X4J A;  5J3R A;  1EGO A;  3N5O A;  3F4R A;  3M0F A;  2PVQ A;  4ULX A;  16GS A;  4XS4 B;  2LQO A;  2GSS A;  1S3D A;  5ECM B;  3H8Q A;  3TJJ A;  1Y6E A;  4YAP A;  3SWL A;  3CMI A;  4IVF A;  2HSY A;  3HDC A;  2EIO A;  4L8E A;  6GSS A;  5ECH B;  4D73 A;  4POK A;  2V1M A;  3FK8 A;  2R0C A;  2C0E A;  1XVQ A;  2ON7 A;  1R26 A;  5JWR B;  3HD5 A;  1EZK A;  2WJU A;  3ERF A;  4IQ1 A;  1SD9 A;  1F9M A;  3KZQ A;  3UAR A;  1GTI A;  2X49 A;  4IEL A;  1N2A A;  1T1V A;  4XS1 A;  3L9U A;  1PL2 A;  3Q18 A;  1AQW A;  4TOP A;  5DVB A;  1RW1 A;  2KP2 A;  4Q5R A;  2H66 A;  3HZ8 A;  1XWK A;  4FIW A;  4EKZ A;  3G9B A;  4PXO A;  3C73 A;  3O6T A;  1PX7 A;  1KNG A;  2B7K A;  4IP6 A;  1PFO A;  3KMO A;  5G1K A;  4AJ7 A;  4L0W A;  1BQ7 A;  5A4W A;  1GSQ A;  3EIN A;  2O87 A;  2J23 A;  2E2G A;  3LYK A;  2V32 A;  4K2X A;  1ERT A;  3D6I A;  2I1U A;  5ECK B;  2WGR A;  3MSZ A;  2PUK C;  3MNG A;  4LA1 A;  1M0U A;  2DKH A;  4KA0 A;  4EVM A;  5GAN D;  5KOW A;  2VL2 A;  5J41 A;  2O7K A;  3RPP A;  3Q74 A;  3FRC A;  3A3T A;  2OAD A;  3J7Y k;  4XCS A;  2HYX A;  5F06 A;  3IRA A;  5LD0 A;  5DAK B;  2FGX A;  4BVX A;  4KDX A;  3CRT A;  1FB0 A;  5IMD A;  2VD0 A;  2DIY A;  3DGQ A;  4DSS A;  1DE2 A;  3IV4 A;  1K0A A;  2DJK A;  1TP9 A;  3VFI A;  4XTS A;  4EDZ A;  5IO0 A;  4BVY A;  3HVS A;  3FHK A;  4LL4 B;  6GSX A;  2Z9S A;  2H73 A;  4ML6 A;  4ID0 A;  4OFT A;  5A4U A;  1JZD A;  2GDR A;  4BA7 A;  1SJ6 A;  1GNW A;  1VF4 A;  5ECP B;  1R5P A;  3E0U A;  4WXT A;  4MPF A;  5DBQ A;  2WB9 A;  4TN8 A;  1URM A;  4YQV A;  2L57 A;  3EWL A;  2GZY A;  4KW6 A;  1T3B A;  2D2Z A;  4K0G A;  5H5S A;  3PGT A;  2F3M A;  5KN0 A;  1ZGN A;  1HYU A;  2ON5 A;  3IBH A;  4NMU A;  2K8S A;  4ZBD A;  4JBB A;  3RDW A;  3BCK A;  1X5C A;  1B4Q A;  2R37 A;  2VM2 A;  4NV2 A;  4KSM A;  3TKP A;  3TOT A;  2H74 A;  1XWB A;  4IHU A;  2IME A;  1K3Y A;  2IMF A;  3UL3 A;  4I2T A;  3GMF A;  3BCI A;  14GS A;  4EC0 A;  2NVL A;  2PN8 A;  2WZ9 A;  3EMP A;  1SJZ A;  1GH2 A;  4J2F A;  2VO4 A;  2YWN A;  5HR3 A;  1YEX A;  1SK2 A;  1W89 A;  2OJL A;  2VLT A;  3CYN A;  5F07 A;  1EOH A;  2YWO A;  1WPI A;  2IMK A;  3RHB A;  1UA5 A;  8GSS A;  4MH2 A;  1BX9 A;  3DXB A;  3VLN A;  2YWI A;  3KH7 A;  3R2Q A;  3IHQ A;  3F6D A;  2XBQ A;  3TKQ A;  3A5I A;  4IJ3 A;  1XPV A;  1XWG A;  5IMA A;  4K2D A;  4Q5F A;  1AIU A;  5IMV A;  4OCF A;  4MJC A;  3ZIJ A;  1ZOF A;  3R3E A;  2A2P A;  1ERU A;  3GKK A;  4TW5 A;  2C0G A;  2P31 A;  2GQK A;  4CHS A;  4EF0 A;  4HQZ A;  1XBS A;  5JCW A;  1KBN A;  1GL8 A;  2P5Q A;  1OVN A;  3QDN A;  5IPG A;  4E8H A;  2H76 A;  3HA9 A;  5D9V A;  1J0F A;  3ZRE A;  3ZML A;  1ZCP A;  3C7M A;  2YV9 A;  1K0O A;  4ZB9 A;  1U88 A;  3NZN A;  2CZ2 A;  2GQM A;  1O81 A;  3H4K A;  4IBP A;  2PBJ A;  4LL1 B;  4WKW A;  7GSS A;  4YAV A;  2RUE A;  1M3I A;  5HR2 A;  5CRH A;  2AAW A;  2GZZ A;  3P8W A;  4FYU A;  1YF1 A;  2IJY A;  3WT2 A;  2FD3 A;  1EEJ A;  3M1G A;  1I9D A;  1R4W A;  5COH A;  4ECJ A;  1UN2 A;  4X1U A;  3ME8 A;  4PUF C;  3CSH A;  1NHO A;  1M9A A;  4N0V A;  2HSH A;  4POB A;  5ECS A;  1FOV A;  2X8H A;  5DJM A;  3F4T A;  5ELG A;  4IKH A;  4MCU A;  1THX A;  2PVO C;  4TRX A;  1U87 A;  2V6O A;  4K0N A;  5J9C A;  2LST A;  3PIN A;  4EUY A;  4JR6 A;  5KN1 A;  3UOM A;  3GIX A;  2LRC A;  1A2L A;  4EE0 A;  2KHP A;  3QAG A;  3TJF A;  4XRA A;  1Z5Y E;  3HJP A;  2F8A A;  2RM5 A;  1SU9 A;  4XS4 A;  1SD8 A;  2OAC A;  3LXT A;  2H71 A;  2DC5 A;  3GSS A;  2IPA A;  4ZB8 A;  1KTE A;  1A8L A;  3EPT A;  2V2G A;  4O5Q A;  2MZC A;  1PD2 1;  3GA4 A;  2B7J A;  2I9H A;  5CP1 A;  1A2J A;  1V57 A;  2FA8 A;  4N0Z A;  4QL7 A;  3UMA A;  3LXZ A;  2YAN A;  1JHB A;  1SJI A;  1XOB A;  4V2L A;  4AGS A;  5JWO B;  2V41 A;  4KCE A;  1QGV A;  5IOW A;  3IAM 2;  4I97 A;  2GQL A;  2DJJ A;  4GF0 A;  2YJH A;  1WRY A;  1QMV A;  1TRS A;  4JU5 A;  1B8X A;  5INY A;  4BWQ A;  5IMF A;  1ERW A;  2DML A;  3TJB A;  3CTG A;  4O92 A;  1YF0 A;  3HYP A;  4K7I A;  3N9J A;  1ILO A;  3QR6 A;  3DWV A;  4FYB A;  2HRN A;  1TK8 B;  3ISO A;  4Z2T A;  2DJ1 A;  2C3N A;  1GSF A;  3VI5 A;  5D9X A;  12GS A;  1F6M C;  3E3E A;  3TB2 A;  2BTO T;  4A5P A;  2CAI A;  5DAK A;  4IQA A;  1XWC A;  3LQ7 A;  5B6N A;  2LJK A;  5B6M A;  2L6C A;  4TR1 B;  5DJL A;  5KEJ A;  3F0I A;  2B3S A;  2RII A;  3W8S A;  2OBI A;  4ZB6 A;  2H1G A;  3LW9 A;  1K3O A;  2R0P A;  4JRR A;  5F05 A;  2JSY A;  4G10 A;  2LKU A;  1X5D A;  4HEA 2;  1MDK A;  2DBC A;  1R5A A;  1OC9 B;  2OE3 A;  4RUV A;  2H0H A;  5F8B A;  2JU5 A;  4MZB A;  2LTK A;  3MYD A;  1PSQ A;  3HVX A;  3CSJ A;  5DAL A;  3TCO A;  1XG8 A;  2EIQ A;  1WE0 A;  5LCZ A;  3LG6 A;  1H75 A;  3SBC A;  4LMW A;  5H5R A;  3EU3 A;  1HQO A;  1XZO A;  5HR1 A;  4CDO A;  2R0G A;  4RI6 A;  2AB6 A;  5ID2 B;  1FW1 A;  3CRU A;  4RI7 A;  1IYH A;  4TR0 A;  4N30 A;  3TOU A;  1GSE A;  1FHE A;  2K8V A;  1PGT A;  1MDI A;  1O85 A;  1TOF A;  2VLU A;  5D73 A;  1T00 A;  2B5E A;  3M9K A;  3EYT A;  3Q19 A;  3GKN A;  2H19 A;  4NAX A;  5G30 A;  1DSB A;  1K0D A;  1X0R A;  3HXS A;  3IC4 A;  2N5A A;  1BED A;  1MDJ A;  4WBR D;  4BL7 B;  1TTZ A;  3UBK A;  1FAA A;  3EE2 A;  5ECR B;  1TU8 A;  4K7N A;  2GTU A;  3F9U A;  4G0K A;  2CAQ A;  5IM9 A;  5HFK A;  4GRF A;  4KX4 A;  1GSD A;  5G31 A;  1O6J A;  1EV4 A;  2M72 A;  1PQN A;  3KP8 A;  1J08 A;  3QCP A;  2OBK A;  5A5K A;  1M9B A;  1AW9 A;  3F6F A;  2QA2 A;  3U5R E;  1SKS B;  4POL A;  4MZC A;  2M80 A;  4OD7 A;  4Q5Q A;  4EO3 A;  4XHM A;  2F8F A;  4MA9 A;  4XIH A;  1WMJ A;  3EC3 A;  2X64 A;  1GUK A;  2HT9 A;  3FZA A;  4E8E A;  4KE3 A;  3DIE A;  1F3A A;  3DVW A;  3GUR A;  2VLV A;  5JCG A;  3GX0 A;  1QXH A;  2PPT A;  4OCE A;  1XFL A;  1TJD A;  2MMZ A;  3GH6 A;  3M8N A;  3IK9 A;  3BD2 A;  1OC3 A;  5ABR A;  2P0G A;  3W6G A;  1Z3E A;  4MP4 A;  4Z2R A;  2H8L A;  3LFL A;  3FEU A;  1ACV A;  1J9B A;  2DJ3 A;  3ZTL A;  5ECQ B;  2JAC A;  3L78 A;  2MMN A;  1F3B A;  2IL3 A;  2E2M A;  3KXO A;  2CX3 A;  4MF6 A;  4GQC A;  1H4O A;  2R4V A;  3GX8 A;  1MD4 A;  1TK5 B;  1GRX A;  1AXD A;  1Q4J A;  4GWR A;  4GSN A;  4HSC X;  5ECN B;  2R3X A;  2FY6 A;  2F9S A;  3CXG A;  3VPQ A;  2C8U A;  4PGT A;  2C3Q A;  2UZ8 A;  4Z7X A;  4I8B A;  4HJ2 A;  2B1L A;  3A5W A;  5C04 A;  1JZR A;  1PKW A;  2K9F A;  1EEM A;  5G5E A;  10GS A;  3L4N A;  1K0C A;  1PMT A;  3HHV A;  3VK9 A;  2AHE A;  2EIR A;  1JZO A;  2VL9 A;  3IE3 A;  3RPN A;  1I5G A;  1O8W A;  3DVX A;  3UVH A;  2XC2 A;  4GSS A;  1TRV A;  1BG5 A;  3RHC A;  1GTU A;  3ZLP A;  3D4T A;  4KAE A;  4K5R A;  4XRD A;  3MAK A;  4ACS A;  3DML A;  3IC8 A;  1AQV A;  2CV4 A;  4NHZ A;  2AJQ B;  3FR3 A;  1K0N A;  5AIS A;  2CVK A;  4CW9 A;  4WF4 A;  4PNF A;  4G2E A;  1OC8 A;  1WOU A;  5DQY A;  5HFG A;  1CQH A;  4HZ4 A;  2H30 A;  5AGY A;  4K9Z A;  4O32 A;  1DUG A;  5DCH A;  1Z7P A;  1G0T A;  2PU9 C;  5DCG A;  2RM6 A;  3ZZX A;  3PPU A;  3I43 A;  2VCQ A;  4NWY A;  2GZP A;  4LLR A;  2WDU A;  1THO A;  2KUC A;  2GVP A;  4WEY A;  1QK8 A;  2QC7 A;  1F2E A;  1M2B A;  1V2A A;  3DD3 A;  5BMU A;  1ERV A;  3KD0 A;  3V1W A;  4PUA A;  4D73 B;  1VGL A;  5J4U A;  2M46 A;  5D93 A;  2HRA A;  1X5E A;  3IK7 A;  3TRQ A;  5HR0 A;  2HZE A;  3QPM A;  4FH8 A;  2YZU A;  3WGE A;  4MJA A;  3KGK A;  4GXZ A;  5KN2 A;  1UVZ A;  2YWM A;  3TKS E;  1G7O A;  4IP1 A;  2ZCT A;  4YQM A;  2FNO A;  4ML1 A;  3JCM L;  1GUH A;  2LNT A;  1SL1 B;  3KMN A;  4I2U A;  3WYW A;  3L9S A;  3ZYW A;  5GZZ B;  4F0B A;  1TRU A;  1VF2 A;  2C80 A;  1NHY A;  4KDU A;  3TDG A;  1A0R P;  5IMC A;  4TR1 A;  4F82 A;  3APS A;  1TI1 A;  2GT6 A;  2XPE A;  6GSV A;  3ZIT A;  3D4M A;  1O7U A;  2R6K A;  4YKF A;  3MIX A;  1QFN A;  3DYR A;  3VPT A;  3W8J A;  1ZL9 A;  1PA3 A;  1O8X A;  3F63 A;  4OFN A;  4F0C A;  3FY7 A;  3P90 A;  1FVJ A;  2VCT A;  3VWW A;  2LUS A;  1K0M A;  1U3A A;  1S3R A;  1Z7R A;  4ZBA A;  4AJ6 A;  5B8B A;  2C4J A;  4PNG A;  3A2W A;  4BVX B;  5EPF A;  2MBT A;  3C1R A;  3C71 A;  3GL3 A;  3E9J B;  5GAP D;  2VOC A;  1Y25 A;  1OE7 A;  3KCM A;  4PQH A;  4MJE A;  1YKC A;  4L0U A;  3P2A A;  5CRE A;  1BJX A;  3LJR A;  2ZUP A;  1GSU A;  4TXO B;  1LU4 A;  3WGD A;  2LS5 A;  2MMO A;  3EU4 A;  4EL1 A;  4K5S A;  1DE1 A;  4USS A;  4IS0 A;  1M7T A;  3IR4 A;  3U6V A;  2VL3 A;  2QSI A;  4KB3 A;  4OMV A;  4K7O A;  2VUP A;  2HI7 A;  4KH7 A;  4KSO A;  4BL7 A;  4KND A;  4TXV A;  2AV4 A;  1ZYP A;  2A4V A;  3VWV A;  1QUW A;  2L4Q A;  2VCV A;  2AUV A;  5B8A A;  3PH9 A;  3MWH A;  3NOF A;  1ZZY A;  3VWX A;  3I69 A;  5IOX A;  1M99 A;  2J9H A;  2OKA A;  3ZIV A;  2H01 A;  1PN0 A;  4HJM A;  1NSW A;  4QL9 A;  2YV7 A;  1ON4 A;  2GLR A;  2G2Q A;  4G19 A;  1HNB A;  4ZIJ A;  1GWC A;  2IIY A;  2LQQ A;  1R7H A;  4DVC A;  4O5U A;  1USB A;  3A2X A;  2FCH A;  1Z6M A;  1G7E A;  3HJO A;  4V1A g;  4IJI A;  5G5F A;  5D9W A;  1SKR B;  3TJK A;  4IW9 A;  5EVO A;  1JZW A;  1SL0 B;  5GSS A;  5E4W A;  3APO A;  2LEG A;  1VRS D;  4JED A;  2NDO A;  4K6X A;  1A2M A;  1GLP A;  2BMX A;  2YZH A;  2EC4 A;  1PKZ A;  2PWJ A;  4K8M A;  4POM A;  3GST A;  3M9J A;  4QQ7 A;  4X0X A;  1XW9 A;  1LJR A;  3TRP A;  4KGI A;  5CYY A;  3A2V A;  3K8N A;  2FWG A;  1B9X C;  4ZL7 A;  4L5O A;  3S9F A;  2PGT A;  1YEP A;  3DEX A;  2K6V A;  4ISD A;  4F2I A;  1U6T A;  1YDK A;  1A0F A;  1EP8 A;  4RQR A;  3ZMK A;  1GTB A;  4PQ1 A;  3O76 A;  3DRN A;  4I5Q A;  2GSR A;  5CRD A;  3D5J A;  5AN1 A;  3FZ9 A;  1VF1 A;  1G6Y A;  2WRT A;  3HJM A;  3TUE A;  3I9V 2;  3BJ5 A;  1PL1 A;  4CY8 A;  2CA8 A;  5HQP A;  1XW6 A;  4X43 A;  2HFD A;  3IPZ A;  2LJA A;  5F0G A;  3G7Y A;  3LWA A;  2WFC A;  3QAV A;  1T7P B;  2NBS A;  3VI7 A;  5CO3 A;  5CNW A;  1WP0 A;  2I3Y A;  5D8I A;  2O89 A;  5IMZ A;  1Z6N A;  2G0F A;  2H6X A;  3ZRD A;  4ECI A;  4ZL8 A;  4XS6 A;  3D21 A;  3GNJ A;  1XOA A;  1LBK A;  3CSI A;  2IMI A;  1N8J A;  1FOH A;  2DJ2 A;  3FYG A;  4G0I A;  1YJ6 A;  2YCD A;  3LEF A;  3RAZ A;  4HUA A;  4PQI A;  4DSR A;  3FKF A;  4OFM A;  2C3T A;  4NHW A;  1V40 A;  2C1Y A;  20GS A;  5J9B A;  3HVN A;  2ALB A;  1HD2 A;  2I4A A;  4KUN A;  3LGC A;  2H6Y A;  4TR4 A;  4N10 A;  3GKX A;  2X8G A;  3DKS A;  4G0L A;  4BWS A;  3GH9 A;  2R2J A;  4YQU A;  2VM1 A;  1TXX A;  2DMM A;  3MDK A;  2JZS A;  2CT6 A;  3AY8 A;  2MMA A;  1K3L A;  4OO4 A;  4NV5 A;  1YY7 A;  2FHE A;  2V6K A;  3KJY A;  4FYC A;  4WET A;  4PTS A;  2IMD A;  19GS A;  4OWY A;  4MAB A;  5ECL B;  4ICY A;  4Q5N A;  3KIJ A;  4Z2U A;  3L0H A;  2OE1 A;  4MPG A;  1XIY A;  3ED3 A;  2HRF A;  6GSU A;  4HI7 A;  3VWU A;  2B1K A;  3KM6 A;  1VF3 A;  3HKR A;  4V2N A;  2LV3 A;  5D9T A;  3ERG A;  4J56 E;  2X4A A;  3I6A A;  4MLY A;  1TKD B;  1GLQ A;  9GSS A;  2C0D A;  1OYJ A;  5KOX A;  1UC7 A;  1YKA A;  2KP1 A;  5D96 A;  1EWX A;  5CAX A;  3IDV A;  2FWF A;  3TRX A;  1RK4 A;  2HLS A;  3LYP A;  4TVE A;  2FWH A;  4O5R A;  5JCU A;  1PX6 A;  3F3Q A;  5FT3 A;  2CVD A;  3APQ A;  1EOG A;  3C8E A;  5B7C A;  5IPH A;  2KOK A;  3HY2 A;  3ERW A;  3LSZ A;  1MTC A;  2NTO A;  22GS A;  1S3C A;  2X8C A;  1ZMA A;  1TDI A;  4K1F A;  4I6X A;  2A4H A;  2DLX A;  4JE1 A;  2L5O A;  4DSQ A;  3HZ4 A;  2GGT A;  4V1A p;  4HOJ A;  3FZ5 A;  1U3I A;  4IGJ A;  2H75 A;  1ZYN A;  5FWG A;  1GSS A;  3CTF A;  2R5G A;  3FR6 A;  2H0G A;  2YPM A;  4EIP A;  3WT1 A;  5BRT A;  2REM A;  3FR9 A;  1XXU A;  4OO5 A;  1GNE A;  5DQS A;  1XW5 A;  4TXO A;  2WS2 A;  1Z9H A;  2CX4 A;  1FVK A;  4RQX A;  1MD3 A;  2VIM A;  5IIZ A;  1IYI A;  1T4Y A;  4ILF A;  5DAL B;  4TR3 A;  2YNX A;  1CQG A;  2LJR A;  2H6Z A;  3QD9 A;  1PRX A;  3ME7 A;  5EL8 A;  4MK3 A;  3GTU B;  4HDE A;  1B9Y C;  5FHI A;  1M3J A;  3F3R A;  3IAS 2;  6GSW A;  1A23 A;  2H1A A;  3VUR A;  3IOS A;  2JL4 A;  4ZL9 A;  2E7P A;  4WF5 A;  6GSY A;  2XHF A;  2XBI A;  11GS A;  3LOR A;  1TU7 A;  3ZL5 A;  1NW2 A;  5ELA A;  3ZFL A;  1SK1 A;  3FZ4 A;  2IFQ B;  1SK0 A;  5IO2 A;  4MH3 A;  4ZXG A;  3IXR A;  3GHA A;  4AF2 A;  4EIQ A;  2AYT A;  4ECB A;  4J57 E;  1GUL A;  5ECI B;  1TW9 A;  3IHG A;  5L71 A;  4MF5 A;  2ES7 A;  2LNS A;  2VL2 C;  3F4S A;  4N11 A;  2A2R A;  1XCC A;  2MYG A;  3FMW A;  5ECO B;  2JZR A;  3KTL A;  3O3T A;  2GT5 A;  2ZNM A;  4F9Z A;  2HRK A;  3CQF A;  2BJX A;  3UVT A;  3HVV A;  4V2M A;  4YKG A;  1ZYQ B;  1ABA A;  1WJK A;  2L5L A;  5EY6 A;  1T4Z A;  18GS A;  3OR5 A;  2O85 A;  1AQX A;  1BYE A;  1EP7 A;  4GCI A;  2JSZ A;  2WUL A;  4IN0 A;  3QFA C;  5E59 A;  3C1S A;  1SYX A;  1MEK A;  3GN3 A;  4PX1 A;  1E2Y A;  1AAZ A;  3UBL A;  3PR8 A;  2DKI A;  5J5N A;  4F03 A;  2LRT A;  2QGV A;  2L6D A;  4TKY A;  2DJ0 A;  3FW2 A;  1OC9 A;  1JLV A;  1PN9 A;  3CBU A;  1ST9 A;  3QOU A;  2X99 A;  2GST A;  1K0B A;  2FLS A;  2XPD A;  1HNA A;  4DEJ A;  4BIK A;  1M2A A;  2H1D A;  2H0I A;  2A2S A;  2GS3 A;  4O7H A;  4L5L A;  4AJ8 A;  1EGR A;  1B48 A;  5GST A;  3L9V A;  4G9H A;  4GST A;  1WIK A;  3TJG A;  3GL5 A;  1OAZ A;  2HZF A;  4GQF A;  4ECC A;  3NIV A;  1G6W A;  2VD1 A;  3D0Z A;  2JAD A;  2RUF A;  4DSS B;  4CY6 A;  5ID2 A;  2JZT A;  1DBY A;  3TKS A;  2DSA A;  4BVY B;  2N5F A;  5AIX A;  2F51 A;  2TRX A;  2O8V B;  4KF9 A;  1B4P A;  17GS A;  3EVI A;  3GYK A;  2K18 A;  4PUR A;  1TK0 B;  2E0Q A;  3GFK A;  5A4V A;  1O73 A;  2NPB A;  1S3A A;  2IN3 A;  1W4V A;  5DDL A;  3GV1 A;  3WGX A;  3KEB A;  3EMX A;  1OKT A;  3G7J A;  1V98 A;  1SL2 B;  3H1N A;  1OKD A;  3TKR A;  4H86 A;  4ZIL A;  3EUR A;  1BAY A;  3UIW A;  5ENU A;  2PMT A;  3M3M A;  1A24 A;  3UEM A;  3RBT A;  2B6M A;  4HZ2 A;  5AIV A;  4WBJ A;  2IWT A;  2VCW A;  1NM3 A;  3GRX A;  4NXI A;  3UJ1 A;  4LMV A;  2B5X A;  1OE8 A;  2LRN A;  1ML6 A;  2VCX A;  1YZX A;  1GP1 A;  1A8Y A;  1QQ2 A;  4FQU A;  2HNL A;  2GSQ A;  2RLI A;  1F37 A;  2HXK A;  2B5Y A;  1SKW B;  4JZQ A;  3H93 A;  1TI3 A;  1WWJ A;  4KCA A;  1GUM A;  1YQ1 A;  2CZ3 A;  1AC1 A;  4GLT A;  2CVB A;  2YJ7 A;  5G1L A;  5C00 A;  1FG4 A;  2HE3 A;  4HU7 A;  5CRW A;  2QKE A;  1HNC A;  1E6B A;  6GST A;  2H1B A;  3IA1 A;  3GKM A;  1FO5 A;  4JR4 A;  3TKS C;  1ZYE A;  2C0F A;  2VAF A;  1JFU A;  3KH9 A;  2HSM A;  3D22 A;  3QAW A;  1X9W B;  2P5R A;  4HQS A;  2HZE B;  5CRG A;  1SEN A;  3QMX A;  3J7Y b;  1GSY A;  4HS1 A;  3KP9 A;  5KN3 A;  1GTA A;  3ZVJ A;  1V58 A;  4NPB A;  4HU9 A;  3H79 A;  3WD6 A;  2FWE A;  3F8U A;  4MMM A;  2DIZ A;  5JWQ B;  3KTB A;  3GUS A;  3ZVJ D;  1T8E B;  1XVW A;  2N5B A;  4MDC A;  1RQM A;  2WCI A;  2YP6 A;  1C72 A;  1M2D A;  2VCZ A;  1X9M B;  1X9S B;  3TGZ A;  4WR4 A;  1TRW A;  3UAP A;  2H70 A;  2I81 A;  2OA7 A;  4EXJ A;  4YH2 A;  2CQ9 A;  3QFB C;  1AUC A;  2MBS A;  5LNK e; 
#chains in the Genus database with same CATH homology
 3Q6O A;  3BBY A;  2TIR A;  2KLX A;  1EV9 A;  2L4C A;  1KEB A;  1XWA A;  4KDY A;  2YN1 A;  4P3Y B;  2YOI A;  4GTU A;  3P7X A;  5G2Z A;  3ZFB A;  3GTU A;  13GS A;  5HFI A;  1JLW A;  2H72 A;  4ZBB A;  1FB6 A;  2FUG 2;  1Q98 A;  2L59 A;  3HCZ A;  3G7I A;  3BOA A;  3US3 A;  2OE0 A;  1V9W A;  4BPY A;  5H5Q A;  1SYR A;  5IQY A;  4MF7 A;  2IFQ A;  4FO5 A;  2QA1 A;  4MZW A;  4WR5 A;  4EDY A;  2PER A;  2FA4 A;  2TRC P;  4MJB A;  4MNN A;  4X4J A;  5J3R A;  1EGO A;  3N5O A;  3F4R A;  3M0F A;  2PVQ A;  4ULX A;  16GS A;  4XS4 B;  2LQO A;  2GSS A;  1S3D A;  5ECM B;  3H8Q A;  3TJJ A;  1Y6E A;  4YAP A;  3SWL A;  3CMI A;  4IVF A;  2HSY A;  3HDC A;  2EIO A;  4L8E A;  6GSS A;  5ECH B;  4D73 A;  4POK A;  2V1M A;  3FK8 A;  2R0C A;  2C0E A;  1XVQ A;  2ON7 A;  1R26 A;  5JWR B;  3HD5 A;  1EZK A;  2WJU A;  3ERF A;  4IQ1 A;  1SD9 A;  1F9M A;  3KZQ A;  3UAR A;  1GTI A;  2X49 A;  4IEL A;  1N2A A;  1T1V A;  4XS1 A;  3L9U A;  1PL2 A;  3Q18 A;  1AQW A;  4TOP A;  5DVB A;  1RW1 A;  2KP2 A;  4Q5R A;  2H66 A;  3HZ8 A;  1XWK A;  4FIW A;  4EKZ A;  3G9B A;  4PXO A;  3C73 A;  3O6T A;  1PX7 A;  1KNG A;  2B7K A;  4IP6 A;  3KMO A;  5G1K A;  4AJ7 A;  4L0W A;  1BQ7 A;  5A4W A;  1GSQ A;  3EIN A;  2O87 A;  2J23 A;  2E2G A;  3LYK A;  2V32 A;  4K2X A;  1ERT A;  3D6I A;  2I1U A;  5ECK B;  2WGR A;  3MSZ A;  2PUK C;  3MNG A;  4LA1 A;  1M0U A;  2DKH A;  4KA0 A;  4EVM A;  5GAN D;  5KOW A;  2VL2 A;  5J41 A;  2O7K A;  3RPP A;  3Q74 A;  3FRC A;  3A3T A;  2OAD A;  3J7Y k;  4XCS A;  2HYX A;  5F06 A;  3IRA A;  5LD0 A;  5DAK B;  2FGX A;  4BVX A;  4KDX A;  3CRT A;  1FB0 A;  5IMD A;  2VD0 A;  2DIY A;  3DGQ A;  4DSS A;  1DE2 A;  3IV4 A;  1K0A A;  2DJK A;  1TP9 A;  3VFI A;  4XTS A;  4EDZ A;  5IO0 A;  4BVY A;  3HVS A;  3FHK A;  4LL4 B;  6GSX A;  2Z9S A;  2H73 A;  4ML6 A;  4ID0 A;  4OFT A;  5A4U A;  1JZD A;  2GDR A;  4BA7 A;  1SJ6 A;  1GNW A;  1VF4 A;  5ECP B;  1R5P A;  3E0U A;  4WXT A;  4MPF A;  5DBQ A;  2WB9 A;  4TN8 A;  1URM A;  4YQV A;  2L57 A;  3EWL A;  2GZY A;  4KW6 A;  1T3B A;  2D2Z A;  4K0G A;  5H5S A;  3PGT A;  2F3M A;  5KN0 A;  1ZGN A;  1HYU A;  2ON5 A;  3IBH A;  4NMU A;  2K8S A;  4ZBD A;  4JBB A;  3RDW A;  3BCK A;  1X5C A;  1B4Q A;  2R37 A;  2VM2 A;  4NV2 A;  4KSM A;  3TKP A;  3TOT A;  2H74 A;  1XWB A;  4IHU A;  2IME A;  1K3Y A;  2IMF A;  3UL3 A;  4I2T A;  3GMF A;  3BCI A;  14GS A;  4EC0 A;  2NVL A;  2PN8 A;  2WZ9 A;  3EMP A;  1SJZ A;  1GH2 A;  4J2F A;  2VO4 A;  2YWN A;  5HR3 A;  1YEX A;  1SK2 A;  1W89 A;  2OJL A;  2VLT A;  3CYN A;  5F07 A;  1EOH A;  2YWO A;  1WPI A;  2IMK A;  3RHB A;  1UA5 A;  8GSS A;  4MH2 A;  1BX9 A;  3DXB A;  3VLN A;  2YWI A;  3KH7 A;  3R2Q A;  3IHQ A;  3F6D A;  2XBQ A;  3TKQ A;  3A5I A;  4IJ3 A;  1XPV A;  1XWG A;  5IMA A;  4K2D A;  4Q5F A;  1AIU A;  5IMV A;  4OCF A;  4MJC A;  3ZIJ A;  1ZOF A;  3R3E A;  2A2P A;  1ERU A;  3GKK A;  4TW5 A;  2C0G A;  2P31 A;  2GQK A;  4CHS A;  4EF0 A;  4HQZ A;  1XBS A;  5JCW A;  1KBN A;  1GL8 A;  2P5Q A;  1OVN A;  3QDN A;  5IPG A;  4E8H A;  2H76 A;  3HA9 A;  5D9V A;  1J0F A;  3ZRE A;  3ZML A;  1ZCP A;  3C7M A;  2YV9 A;  1K0O A;  4ZB9 A;  1U88 A;  3NZN A;  2CZ2 A;  2GQM A;  1O81 A;  3H4K A;  4IBP A;  2PBJ A;  4LL1 B;  4WKW A;  7GSS A;  4YAV A;  2RUE A;  5HR2 A;  5CRH A;  2AAW A;  2GZZ A;  3P8W A;  4FYU A;  1YF1 A;  2IJY A;  3WT2 A;  2FD3 A;  1EEJ A;  3M1G A;  1I9D A;  1R4W A;  5COH A;  4ECJ A;  1UN2 A;  4X1U A;  3ME8 A;  4PUF C;  3CSH A;  1NHO A;  1M9A A;  4N0V A;  2HSH A;  4POB A;  5ECS A;  1FOV A;  2X8H A;  5DJM A;  3F4T A;  5ELG A;  4IKH A;  4MCU A;  1THX A;  2PVO C;  4TRX A;  1U87 A;  2V6O A;  4K0N A;  5J9C A;  2LST A;  3PIN A;  4EUY A;  4JR6 A;  5KN1 A;  3UOM A;  3GIX A;  2LRC A;  1A2L A;  4EE0 A;  2KHP A;  3QAG A;  3TJF A;  4XRA A;  1Z5Y E;  3HJP A;  2F8A A;  2RM5 A;  1SU9 A;  4XS4 A;  1SD8 A;  2OAC A;  3LXT A;  2H71 A;  2DC5 A;  3GSS A;  2IPA A;  4ZB8 A;  1KTE A;  1A8L A;  3EPT A;  2V2G A;  4O5Q A;  2MZC A;  1PD2 1;  3GA4 A;  2B7J A;  2I9H A;  5CP1 A;  1A2J A;  1V57 A;  2FA8 A;  4N0Z A;  4QL7 A;  3UMA A;  3LXZ A;  2YAN A;  1JHB A;  1SJI A;  1XOB A;  4V2L A;  4AGS A;  5JWO B;  2V41 A;  4KCE A;  1QGV A;  5IOW A;  3IAM 2;  4I97 A;  2GQL A;  2DJJ A;  4GF0 A;  2YJH A;  1WRY A;  1QMV A;  1TRS A;  4JU5 A;  1B8X A;  5INY A;  4BWQ A;  5IMF A;  1ERW A;  2DML A;  3TJB A;  3CTG A;  4O92 A;  1YF0 A;  3HYP A;  4K7I A;  3N9J A;  1ILO A;  3QR6 A;  3DWV A;  4FYB A;  2HRN A;  1TK8 B;  3ISO A;  4Z2T A;  2DJ1 A;  2C3N A;  1GSF A;  3VI5 A;  5D9X A;  12GS A;  1F6M C;  3E3E A;  3TB2 A;  2BTO T;  4A5P A;  2CAI A;  5DAK A;  4IQA A;  1XWC A;  3LQ7 A;  5B6N A;  2LJK A;  5B6M A;  2L6C A;  4TR1 B;  5DJL A;  5KEJ A;  3F0I A;  2B3S A;  2RII A;  3W8S A;  2OBI A;  4ZB6 A;  2H1G A;  3LW9 A;  1K3O A;  2R0P A;  4JRR A;  5F05 A;  2JSY A;  4G10 A;  2LKU A;  1X5D A;  4HEA 2;  1MDK A;  2DBC A;  1R5A A;  1OC9 B;  2OE3 A;  4RUV A;  2H0H A;  5F8B A;  2JU5 A;  4MZB A;  2LTK A;  3MYD A;  1PSQ A;  3HVX A;  3CSJ A;  5DAL A;  3TCO A;  2EIQ A;  1WE0 A;  5LCZ A;  3LG6 A;  1H75 A;  3SBC A;  4LMW A;  5H5R A;  3EU3 A;  1HQO A;  1XZO A;  5HR1 A;  4CDO A;  2R0G A;  4RI6 A;  2AB6 A;  5ID2 B;  1FW1 A;  3CRU A;  4RI7 A;  1IYH A;  4TR0 A;  4N30 A;  3TOU A;  1GSE A;  1FHE A;  2K8V A;  1PGT A;  1MDI A;  1O85 A;  1TOF A;  2VLU A;  5D73 A;  1T00 A;  2B5E A;  3M9K A;  3EYT A;  3Q19 A;  3GKN A;  2H19 A;  4NAX A;  5G30 A;  1DSB A;  1K0D A;  1X0R A;  3HXS A;  3IC4 A;  2N5A A;  1BED A;  1MDJ A;  4WBR D;  4BL7 B;  1TTZ A;  3UBK A;  1FAA A;  3EE2 A;  5ECR B;  1TU8 A;  4K7N A;  2GTU A;  3F9U A;  4G0K A;  2CAQ A;  5IM9 A;  5HFK A;  4GRF A;  4KX4 A;  1GSD A;  5G31 A;  1O6J A;  1EV4 A;  2M72 A;  1PQN A;  3KP8 A;  1J08 A;  3QCP A;  2OBK A;  5A5K A;  1M9B A;  1AW9 A;  3F6F A;  2QA2 A;  3U5R E;  1SKS B;  4POL A;  4MZC A;  2M80 A;  4OD7 A;  4Q5Q A;  4EO3 A;  4XHM A;  2F8F A;  4MA9 A;  4XIH A;  1WMJ A;  3EC3 A;  2X64 A;  1GUK A;  2HT9 A;  3FZA A;  4E8E A;  4KE3 A;  3DIE A;  1F3A A;  3DVW A;  3GUR A;  2VLV A;  5JCG A;  3GX0 A;  1QXH A;  2PPT A;  4OCE A;  1XFL A;  1TJD A;  2MMZ A;  3GH6 A;  3M8N A;  3IK9 A;  3BD2 A;  1OC3 A;  5ABR A;  2P0G A;  3W6G A;  1Z3E A;  4MP4 A;  4Z2R A;  2H8L A;  3LFL A;  3FEU A;  1ACV A;  1J9B A;  2DJ3 A;  3ZTL A;  5ECQ B;  2JAC A;  3L78 A;  2MMN A;  1F3B A;  2IL3 A;  2E2M A;  3KXO A;  2CX3 A;  4MF6 A;  4GQC A;  1H4O A;  2R4V A;  3GX8 A;  1MD4 A;  1TK5 B;  1GRX A;  1AXD A;  1Q4J A;  4GWR A;  4GSN A;  5ECN B;  2R3X A;  2FY6 A;  2F9S A;  3CXG A;  3VPQ A;  2C8U A;  4PGT A;  2C3Q A;  2UZ8 A;  4Z7X A;  4I8B A;  4HJ2 A;  2B1L A;  3A5W A;  5C04 A;  1JZR A;  1PKW A;  2K9F A;  1EEM A;  5G5E A;  10GS A;  3L4N A;  1K0C A;  1PMT A;  3HHV A;  3VK9 A;  2AHE A;  2EIR A;  1JZO A;  2VL9 A;  3IE3 A;  3RPN A;  1I5G A;  1O8W A;  3DVX A;  3UVH A;  2XC2 A;  4GSS A;  1TRV A;  1BG5 A;  3RHC A;  1GTU A;  3ZLP A;  3D4T A;  4KAE A;  4K5R A;  4XRD A;  3MAK A;  4ACS A;  3DML A;  3IC8 A;  1AQV A;  2CV4 A;  4NHZ A;  2AJQ B;  3FR3 A;  1K0N A;  5AIS A;  2CVK A;  4CW9 A;  4WF4 A;  4PNF A;  4G2E A;  1OC8 A;  1WOU A;  5DQY A;  5HFG A;  1CQH A;  4HZ4 A;  2H30 A;  5AGY A;  4K9Z A;  4O32 A;  1DUG A;  5DCH A;  1Z7P A;  1G0T A;  2PU9 C;  5DCG A;  2RM6 A;  3ZZX A;  3PPU A;  3I43 A;  2VCQ A;  4NWY A;  2GZP A;  4LLR A;  2WDU A;  1THO A;  2KUC A;  2GVP A;  4WEY A;  1QK8 A;  2QC7 A;  1F2E A;  1M2B A;  1V2A A;  3DD3 A;  5BMU A;  1ERV A;  3KD0 A;  3V1W A;  4PUA A;  4D73 B;  1VGL A;  5J4U A;  2M46 A;  5D93 A;  2HRA A;  1X5E A;  3IK7 A;  3TRQ A;  5HR0 A;  2HZE A;  3QPM A;  4FH8 A;  2YZU A;  3WGE A;  4MJA A;  3KGK A;  4GXZ A;  5KN2 A;  1UVZ A;  2YWM A;  3TKS E;  1G7O A;  4IP1 A;  2ZCT A;  4YQM A;  2FNO A;  4ML1 A;  3JCM L;  1GUH A;  2LNT A;  1SL1 B;  3KMN A;  4I2U A;  3WYW A;  3L9S A;  3ZYW A;  5GZZ B;  4F0B A;  1TRU A;  1VF2 A;  2C80 A;  1NHY A;  4KDU A;  3TDG A;  1A0R P;  5IMC A;  4TR1 A;  4F82 A;  3APS A;  1TI1 A;  2GT6 A;  2XPE A;  6GSV A;  3ZIT A;  3D4M A;  1O7U A;  2R6K A;  4YKF A;  3MIX A;  1QFN A;  3DYR A;  3VPT A;  3W8J A;  1ZL9 A;  1PA3 A;  1O8X A;  3F63 A;  4OFN A;  4F0C A;  3FY7 A;  3P90 A;  1FVJ A;  2VCT A;  3VWW A;  2LUS A;  1K0M A;  1U3A A;  1Z7R A;  4AJ6 A;  4ZBA A;  5B8B A;  2C4J A;  4PNG A;  3A2W A;  4BVX B;  5EPF A;  2MBT A;  3C1R A;  3C71 A;  3GL3 A;  3E9J B;  5GAP D;  2VOC A;  1Y25 A;  1OE7 A;  3KCM A;  4PQH A;  4MJE A;  1YKC A;  4L0U A;  3P2A A;  5CRE A;  1BJX A;  3LJR A;  2ZUP A;  1GSU A;  4TXO B;  1LU4 A;  3WGD A;  2LS5 A;  2MMO A;  3EU4 A;  4EL1 A;  4K5S A;  1DE1 A;  4USS A;  4IS0 A;  1M7T A;  3IR4 A;  3U6V A;  2VL3 A;  2QSI A;  4KB3 A;  4OMV A;  4K7O A;  2VUP A;  2HI7 A;  4KH7 A;  4KSO A;  4BL7 A;  4KND A;  4TXV A;  2AV4 A;  1ZYP A;  2A4V A;  3VWV A;  1QUW A;  2L4Q A;  2VCV A;  2AUV A;  5B8A A;  3PH9 A;  3MWH A;  3NOF A;  1ZZY A;  3VWX A;  3I69 A;  5IOX A;  1M99 A;  2J9H A;  2OKA A;  3ZIV A;  2H01 A;  1PN0 A;  4HJM A;  1NSW A;  4QL9 A;  2YV7 A;  1ON4 A;  2GLR A;  2G2Q A;  4G19 A;  1HNB A;  4ZIJ A;  1GWC A;  2IIY A;  2LQQ A;  1R7H A;  4DVC A;  4O5U A;  1USB A;  3A2X A;  2FCH A;  1Z6M A;  1G7E A;  3HJO A;  4V1A g;  4IJI A;  5G5F A;  5D9W A;  1SKR B;  3TJK A;  4IW9 A;  5EVO A;  1JZW A;  1SL0 B;  5GSS A;  5E4W A;  3APO A;  2LEG A;  1VRS D;  4JED A;  2NDO A;  4K6X A;  1A2M A;  1GLP A;  2BMX A;  2YZH A;  2EC4 A;  1PKZ A;  2PWJ A;  4K8M A;  4POM A;  3GST A;  3M9J A;  4QQ7 A;  4X0X A;  1XW9 A;  1LJR A;  3TRP A;  4KGI A;  5CYY A;  3A2V A;  3K8N A;  2FWG A;  1B9X C;  4ZL7 A;  4L5O A;  3S9F A;  2PGT A;  1YEP A;  3DEX A;  2K6V A;  4ISD A;  4F2I A;  1U6T A;  1YDK A;  1A0F A;  1EP8 A;  4RQR A;  3ZMK A;  1GTB A;  4PQ1 A;  3O76 A;  3DRN A;  4I5Q A;  2GSR A;  5CRD A;  3D5J A;  5AN1 A;  3FZ9 A;  1VF1 A;  1G6Y A;  2WRT A;  3HJM A;  3TUE A;  3I9V 2;  3BJ5 A;  1PL1 A;  4CY8 A;  2CA8 A;  5HQP A;  1XW6 A;  4X43 A;  2HFD A;  3IPZ A;  2LJA A;  5F0G A;  3G7Y A;  3LWA A;  2WFC A;  3QAV A;  1T7P B;  2NBS A;  3VI7 A;  5CO3 A;  5CNW A;  1WP0 A;  2I3Y A;  5D8I A;  2O89 A;  5IMZ A;  1Z6N A;  2G0F A;  2H6X A;  3ZRD A;  4ECI A;  4ZL8 A;  4XS6 A;  3D21 A;  3GNJ A;  1XOA A;  1LBK A;  3CSI A;  2IMI A;  1N8J A;  1FOH A;  2DJ2 A;  3FYG A;  4G0I A;  1YJ6 A;  2YCD A;  3LEF A;  3RAZ A;  4HUA A;  4PQI A;  4DSR A;  3FKF A;  4OFM A;  2C3T A;  4NHW A;  1V40 A;  2C1Y A;  20GS A;  5J9B A;  2ALB A;  1HD2 A;  2I4A A;  4KUN A;  3LGC A;  2H6Y A;  4TR4 A;  4N10 A;  3GKX A;  2X8G A;  3DKS A;  4G0L A;  4BWS A;  3GH9 A;  2R2J A;  4YQU A;  2VM1 A;  1TXX A;  2DMM A;  3MDK A;  2JZS A;  2CT6 A;  3AY8 A;  2MMA A;  1K3L A;  4OO4 A;  4NV5 A;  1YY7 A;  2FHE A;  2V6K A;  3KJY A;  4FYC A;  4WET A;  4PTS A;  2IMD A;  19GS A;  4OWY A;  4MAB A;  5ECL B;  4ICY A;  4Q5N A;  3KIJ A;  4Z2U A;  3L0H A;  2OE1 A;  4MPG A;  1XIY A;  3ED3 A;  2HRF A;  6GSU A;  4HI7 A;  3VWU A;  2B1K A;  3KM6 A;  1VF3 A;  3HKR A;  4V2N A;  2LV3 A;  5D9T A;  3ERG A;  4J56 E;  2X4A A;  3I6A A;  4MLY A;  1TKD B;  1GLQ A;  9GSS A;  2C0D A;  1OYJ A;  5KOX A;  1UC7 A;  1YKA A;  2KP1 A;  5D96 A;  1EWX A;  5CAX A;  3IDV A;  2FWF A;  3TRX A;  1RK4 A;  2HLS A;  3LYP A;  4TVE A;  2FWH A;  4O5R A;  5JCU A;  1PX6 A;  3F3Q A;  5FT3 A;  2CVD A;  3APQ A;  1EOG A;  3C8E A;  5B7C A;  5IPH A;  2KOK A;  3HY2 A;  3ERW A;  3LSZ A;  1MTC A;  2NTO A;  22GS A;  1S3C A;  2X8C A;  1ZMA A;  1TDI A;  4K1F A;  4I6X A;  2A4H A;  2DLX A;  4JE1 A;  2L5O A;  4DSQ A;  3HZ4 A;  2GGT A;  4V1A p;  4HOJ A;  3FZ5 A;  1U3I A;  4IGJ A;  2H75 A;  1ZYN A;  5FWG A;  1GSS A;  3CTF A;  2R5G A;  3FR6 A;  2H0G A;  2YPM A;  4EIP A;  3WT1 A;  5BRT A;  2REM A;  3FR9 A;  1XXU A;  4OO5 A;  1GNE A;  5DQS A;  1XW5 A;  4TXO A;  2WS2 A;  1Z9H A;  2CX4 A;  1FVK A;  4RQX A;  1MD3 A;  2VIM A;  5IIZ A;  1IYI A;  1T4Y A;  4ILF A;  5DAL B;  4TR3 A;  2YNX A;  1CQG A;  2LJR A;  2H6Z A;  3QD9 A;  1PRX A;  3ME7 A;  5EL8 A;  4MK3 A;  3GTU B;  4HDE A;  1B9Y C;  5FHI A;  3F3R A;  3IAS 2;  6GSW A;  1A23 A;  2H1A A;  3VUR A;  3IOS A;  2JL4 A;  4ZL9 A;  2E7P A;  4WF5 A;  6GSY A;  2XHF A;  2XBI A;  11GS A;  3LOR A;  1TU7 A;  3ZL5 A;  1NW2 A;  5ELA A;  3ZFL A;  1SK1 A;  3FZ4 A;  2IFQ B;  1SK0 A;  5IO2 A;  4MH3 A;  4ZXG A;  3IXR A;  3GHA A;  4AF2 A;  4EIQ A;  2AYT A;  4ECB A;  4J57 E;  1GUL A;  5ECI B;  1TW9 A;  3IHG A;  5L71 A;  4MF5 A;  2ES7 A;  2LNS A;  2VL2 C;  3F4S A;  4N11 A;  2A2R A;  1XCC A;  2MYG A;  3FMW A;  5ECO B;  2JZR A;  3KTL A;  3O3T A;  2GT5 A;  2ZNM A;  4F9Z A;  2HRK A;  2BJX A;  3UVT A;  3HVV A;  4V2M A;  4YKG A;  1ZYQ B;  1ABA A;  1WJK A;  2L5L A;  5EY6 A;  1T4Z A;  18GS A;  3OR5 A;  2O85 A;  1AQX A;  1BYE A;  1EP7 A;  4GCI A;  2JSZ A;  2WUL A;  4IN0 A;  3QFA C;  5E59 A;  3C1S A;  1SYX A;  1MEK A;  3GN3 A;  4PX1 A;  1E2Y A;  1AAZ A;  3UBL A;  3PR8 A;  2DKI A;  5J5N A;  4F03 A;  2LRT A;  2QGV A;  2L6D A;  4TKY A;  2DJ0 A;  3FW2 A;  1OC9 A;  1JLV A;  1PN9 A;  3CBU A;  1ST9 A;  3QOU A;  2X99 A;  2GST A;  1K0B A;  2FLS A;  2XPD A;  1HNA A;  4DEJ A;  1M2A A;  2H1D A;  2H0I A;  2A2S A;  2GS3 A;  4O7H A;  4L5L A;  4AJ8 A;  1EGR A;  1B48 A;  5GST A;  3L9V A;  4G9H A;  4GST A;  1WIK A;  3TJG A;  3GL5 A;  1OAZ A;  2HZF A;  4GQF A;  4ECC A;  3NIV A;  1G6W A;  2VD1 A;  3D0Z A;  2JAD A;  2RUF A;  4DSS B;  4CY6 A;  5ID2 A;  2JZT A;  1DBY A;  3TKS A;  2DSA A;  4BVY B;  2N5F A;  5AIX A;  2F51 A;  2TRX A;  2O8V B;  4KF9 A;  1B4P A;  17GS A;  3EVI A;  3GYK A;  2K18 A;  4PUR A;  1TK0 B;  2E0Q A;  3GFK A;  5A4V A;  1O73 A;  2NPB A;  1S3A A;  2IN3 A;  1W4V A;  5DDL A;  3GV1 A;  3WGX A;  3KEB A;  3EMX A;  1OKT A;  3G7J A;  1V98 A;  1SL2 B;  3H1N A;  1OKD A;  3TKR A;  4H86 A;  4ZIL A;  3EUR A;  1BAY A;  3UIW A;  5ENU A;  2PMT A;  3M3M A;  1A24 A;  3UEM A;  3RBT A;  2B6M A;  4HZ2 A;  5AIV A;  4WBJ A;  2IWT A;  2VCW A;  1NM3 A;  3GRX A;  4NXI A;  3UJ1 A;  4LMV A;  2B5X A;  1OE8 A;  2LRN A;  1ML6 A;  2VCX A;  1YZX A;  1GP1 A;  1A8Y A;  1QQ2 A;  4FQU A;  2HNL A;  2GSQ A;  2RLI A;  1F37 A;  2HXK A;  2B5Y A;  1SKW B;  4JZQ A;  3H93 A;  1TI3 A;  1WWJ A;  4KCA A;  1GUM A;  1YQ1 A;  2CZ3 A;  1AC1 A;  4GLT A;  2CVB A;  2YJ7 A;  5G1L A;  5C00 A;  1FG4 A;  2HE3 A;  4HU7 A;  5CRW A;  2QKE A;  1HNC A;  1E6B A;  6GST A;  2H1B A;  3IA1 A;  3GKM A;  1FO5 A;  4JR4 A;  3TKS C;  1ZYE A;  2C0F A;  2VAF A;  1JFU A;  3KH9 A;  2HSM A;  3D22 A;  3QAW A;  1X9W B;  2P5R A;  4HQS A;  2HZE B;  5CRG A;  1SEN A;  3QMX A;  3J7Y b;  1GSY A;  4HS1 A;  3KP9 A;  5KN3 A;  1GTA A;  3ZVJ A;  1V58 A;  4NPB A;  4HU9 A;  3H79 A;  3WD6 A;  2FWE A;  3F8U A;  4MMM A;  2DIZ A;  5JWQ B;  3KTB A;  3GUS A;  3ZVJ D;  1T8E B;  1XVW A;  2N5B A;  4MDC A;  1RQM A;  2WCI A;  2YP6 A;  1C72 A;  1M2D A;  2VCZ A;  1X9M B;  1X9S B;  3TGZ A;  4WR4 A;  1TRW A;  3UAP A;  2H70 A;  2I81 A;  2OA7 A;  4EXJ A;  4YH2 A;  2CQ9 A;  3QFB C;  1AUC A;  2MBS A;  5LNK e; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...