4WF5A

Crystal structure of e.coli dsba soaked with compound 4
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
188
structure length
188
Chain Sequence
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Thiol:disulfide interchange protein
publication title Application of Fragment-Based Screening to the Design of Inhibitors of Escherichia coli DsbA.
pubmed doi rcsb
total genus 67
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature ec 1.8.4.2: Protein-disulfide reductase (glutathione).
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4wf5A00
4IBPA 5DQYA 13GSA 4HZ4A 3M3MA 1WIKA 4NMUA 1M2BA 1XW5A 2H71A 1ERUA 5DAKB 5GZZB 4V2NA 1X5EA 4L5OA 5KN2A 2P0GA 4IQAA 1TI1A 4NPBA 5L71A 5ID2A 3DXBA 3DKSA 4MJEA 2VD0A 2CZ2A 6GSTA 2LRCA 1T1VA 3D4MA 3E0UA 2E2MA 3GH6A 2DJ1A 4TXVA 4EO3A 4DVCA 3N9JA 3GIXA 4JZQA 5IQYA 5CREA 2R37A 2B1LA 2PPTA 2VOCA 3A2VA 2PVOC 4OO4A 4MDCA 3ME7A 5B6MA 1GH2A 1A24A 1ZOFA 4HEA2 4I2TA 1PSQA 1DE2A 2YWIA 4LL1B 5ELAA 1Y25A 5D73A 1X9SB 1G6YA 3DD3A 4DSQA 1GSDA 2M72A 4WR5A 3W6GA 2IMDA 4XS1A 2LEGA 4MZBA 2LUSA 4TKYA 3QMXA 3KH7A 1TTZA 3IHQA 1NSWA 2EIRA 4EUYA 3RPNA 1A2JA 4ECCA 4AJ8A 4AGSA 1GULA 1EZKA 3HD5A 1JZRA 3ME8A 1ABAA 1GUKA 3EMPA 4QQ7A 5CNWA 3HZ8A 1FVKA 1RW1A 1SJ6A 2IMIA 3MAKA 1WWJA 3CRUA 4MH2A 2CAQA 5ENUA 4GQCA 3GX8A 1SYRA 2LV3A 3KTLA 3QD9A 2PMTA 2P5RA 1EGOA 2PBJA 4WKWA 2YJHA 2IFQB 2DJ3A 4YQMA 5ABRA 3F63A 1X9MB 2F8AA 3F9UA 4J2FA 2DIZA 3VK9A 3H1NA 1EOGA 3HKRA 1T4ZA 2WFCA 1SL1B 1SK1A 2GZYA 4IJIA 1SU9A 4BVYA 1OAZA 1HD2A 2FLSA 4MMMA 2K18A 3CTGA 4KW6A 1XCCA 2F8FA 1B48A 4P3YB 1A23A 3Q19A 3A2WA 1UN2A 1A0FA 2GTUA 5EY6A 1SL2B 2GZZA 5DAKA 4N11A 2VCTA 2GVPA 2H73A 3D6IA 4OFTA 1HNCA 1A8YA 3P2AA 2L6DA 1JZDA 3GSSA 4ECIA 2VD1A 3KMOA 3JCML 1M7TA 2ON5A 1J0FA 1S3CA 1O7UA 1X5DA 4ECBA 4WR4A 2H0IA 4Q5NA 3UBKA 2YWOA 5D9VA 1Z6MA 1VF3A 1GTBA 3IDVA 4I5QA 4TR0A 1TK8B 2GSSA 1SENA 2HRFA 1AQXA 2YNXA 1XIYA 1AIUA 5GSSA 1AAZA 1XW6A 3IRAA 2FD3A 4HZ2A 3TJFA 5EPFA 3QFBC 2VIMA 5HQPA 1Q98A 2A2RA 1HNBA 1YKCA 2E2GA 5HR2A 1ZCPA 5DQSA 1T8EB 1VGLA 3ED3A 1M9BA 1LJRA 5G31A 4N0ZA 3Q18A 3RHCA 4TVEA 3BOAA 4AJ7A 1KBNA 2WZ9A 2H0GA 3KH9A 3GMFA 4TR4A 4MABA 3LFLA 4LMVA 2AAWA 4QL7A 2YZHA 2YOIA 3VURA 1OC9B 2OKAA 3N5OA 4PURA 4MH3A 4ZL9A 4TXOB 1Z7RA 2OE1A 2IJYA 2DJ2A 5ECIB 4LL4B 5A5KA 5IPHA 2YJ7A 1J08A 2YP6A 2KLXA 2NBSA 2HYXA 3ERFA 3I6AA 2WS2A 3SWLA 4POKA 3OR5A 1PL2A 2X99A 3HJPA 4LA1A 2H1BA 2PERA 4NHWA 2WJUA 8GSSA 4DEJA 3ZRDA 1SKSB 3LG6A 3ZIJA 4XS6A 2DJKA 4OMVA 1HYUA 2K9FA 2JACA 2PWJA 3GTUA 2VL9A 4TR1B 1Z9HA 3GKMA 3GH9A 2QC7A 3FY7A 5IO2A 2VM1A 2LJRA 1XOBA 2QKEA 1M2DA 1R7HA 4KDUA 3QAWA 3Q6OA 3LYKA 3NZNA 1XWKA 1GSUA 2H1AA 3ZREA 5AGYA 1SYXA 1VF1A 2VAFA 4KCAA 4ZBDA 2GQKA 1ST9A 3C7MA 2GQLA 5H5QA 2P5QA 2XHFA 4HU7A 5G30A 1YF0A 1QK8A 2OBIA 2QGVA 2BJXA 2VCXA 2YN1A 3HZ4A 2O7KA 2HT9A 3DEXA 1G7OA 1K3OA 2AB6A 2LSTA 5CRWA 2CVDA 2VO4A 3C71A 3GYKA 1DBYA 5ECHB 3G7JA 2AYTA 3KP8A 1WPIA 2GT5A 3HY2A 3HVVA 4ISDA 4JU5A 4ZBBA 3UL3A 1GSSA 4TN8A 3L9UA 4F0BA 2DMLA 3J7Yk 4RI7A 1TOFA 2HZFA 2GGTA 2H72A 5JWQB 2CZ3A 3LJRA 3TJGA 1TK0B 5HR1A 7GSSA 1ON4A 1K0MA 1FB0A 2HSHA 2VLVA 5KN1A 4TOPA 3P90A 6GSSA 3A2XA 2VCQA 3CRTA 5J9BA 2FHEA 5IMDA 3F4RA 2FGXA 3TJBA 2L4CA 1OC9A 3E9JB 3PGTA 5HR0A 4TXOA 4K0GA 2B5YA 3VPQA 4MCUA 2KOKA 1OVNA 2VL2C 4POMA 3DGQA 3LWAA 22GSA 1EEMA 2H30A 1OC3A 4EKZA 4KAEA 4O92A 1Z6NA 3IE3A 2V41A 1T00A 4EDYA 1RK4A 4GQFA 4PNFA 2CAIA 2B5EA 2VLTA 2CX4A 2RLIA 2LNSA 5HR3A 2E0QA 3CSJA 2C0GA 4WF4A 2H76A 3G7IA 1AC1A 2YZUA 4ACSA 5GAPD 3M9JA 1GLPA 3BJ5A 1F37A 4FYBA 4TR1A 2G2QA 3S9FA 4IN0A 5DALA 5DBQA 5FHIA 3GN3A 3HVSA 4K8MA 4KGIA 2TRCP 3WYWA 3M0FA 3TRQA 1YEPA 2B7JA 4PXOA 5FT3A 2H70A 3F6FA 1GL8A 4HUAA 1F3BA 3C1SA 5D96A 5B7CA 1AQWA 2B7KA 3ZITA 2IMFA 3U6VA 5EL8A 3KTBA 5A4WA 1S3DA 3UBLA 2CV4A 3H8QA 4WBRD 2LQQA 1W89A 2ES7A 2HRNA 2F9SA 2YCDA 3FEUA 2MYGA 2L6CA 4HI7A 3AY8A 3FYGA 2FCHA 1ZYEA 3TKPA 1XXUA 1BJXA 1GNEA 3VFIA 3A5WA 4JE1A 4CDOA 1SJIA 1AQVA 3DVXA 3F3QA 3RPPA 1ZGNA 3QAGA 4FIWA 2L59A 1YKAA 1FO5A 4ZIJA 3DYRA 4I2UA 2WULA 3GA4A 1LU4A 4E8HA 3FR3A 2I1UA 1UA5A 2R4VA 4KUNA 3FRCA 2HFDA 4BWQA 3NOFA 5F0GA 1B4QA 4F9ZA 1SKRB 5JCWA 4F0CA 3ZIVA 1I5GA 2BTOT 2D2ZA 4IS0A 2IPAA 5J9CA 1MD4A 1X0RA 5HFKA 4XTSA 5C00A 4GSNA 2F3MA 3IK7A 1MD3A 1IYIA 1VRSD 4ML6A 2B3SA 1DE1A 1CQHA 1LBKA 5LCZA 1TK5B 4GSTA 3TJJA 3GL5A 3MWHA 3EWLA 4K2DA 3VI7A 4O32A 3IXRA 3VPTA 2MZCA 1E6BA 2NVLA 4NV2A 4AJ6A 4GRFA 3TRPA 2VL3A 3F3RA 1OKTA 1K0AA 2FA8A 1FVJA 2JSYA 4PUAA 4XRAA 1G0TA 1QQ2A 1PN9A 3GKNA 1R26A 2TRXA 3IAM2 3IAS2 4L8EA 5AIXA 2GT6A 1TRUA 5DJMA 4OCEA 2JSZA 5D8IA 1ERWA 1DSBA 1PKZA 3DVWA 4EDZA 1KEBA 4Z7XA 5J3RA 1E2YA 2I4AA 1GTIA 1NW2A 3EC3A 3GTUB 5J41A 5F05A 1NHYA 2L5OA 5GSTA 1BYEA 1FAAA 4X43A 1BEDA 3US3A 1THXA 2H1GA 3EE2A 4HQZA 3U5RE 2AHEA 4IQ1A 1GTAA 1FOVA 1CQGA 1PA3A 1RQMA 17GSA 3QDNA 4V1Ap 2DJ0A 1G7EA 2C4JA 2MBSA 1PL1A 1V9WA 1BG5A 3GX0A 4ZL8A 4NXIA 4WXTA 4YH2A 3PH9A 4KSMA 4L5LA 2CVKA 3BCIA 1MTCA 2FWGA 5IO0A 3CBUA 2L4QA 2F51A 2C8UA 5ECLB 5G5FA 4IW9A 3L0HA 3KM6A 4EC0A 3MNGA 2HI7A 2VUPA 3DRNA 1JZWA 1AW9A 5CO3A 5B8BA 4FYCA 4KX4A 4GLTA 2IWTA 1M99A 4N0VA 2V1MA 3ZZXA 1WP0A 2B5XA 4K7NA 1R4WA 1ERTA 1FG4A 4H86A 5DCHA 6GSXA 1THOA 3UVHA 2K8SA 4POBA 4IVFA 1TU8A 4OFNA 2FUG2 3VLNA 6GSWA 3M1GA 3UOMA 1M9AA 2YV7A 4OCFA 3BD2A 1V2AA 4YQVA 1JLVA 1T3BA 5JWOB 2AJQB 1JLWA 1W4VA 4MP4A 3C1RA 3I43A 2VCWA 3KZQA 2AV4A 2N5FA 2M46A 2LJKA 1YZXA 5B6NA 4MJBA 3GL3A 3M9KA 5ECKB 4JBBA 2N5AA 2A4VA 4F2IA 2MMZA 3HCZA 4LMWA 2JU5A 3HVXA 2X8GA 4PQIA 3GFKA 2I9HA 3L9SA 1TRVA 3EU3A 1VF2A 1VF4A 2RM5A 1GP1A 2PGTA 3H79A 2LS5A 1H4OA 3IK9A 3TJKA 2DJJA 1PX7A 4ZB8A 3KGKA 5DALB 3FW2A 3KD0A 10GSA 3KMNA 3LORA 4GCIA 4IKHA 1C72A 4OWYA 3UEMA 3DWVA 3TKQA 4MZCA 4ZB9A 3MDKA 4ZILA 2C0FA 5ECQB 4JR6A 3TKSC 3KP9A 2HNLA 20GSA 3TKSA 1ZZYA 2FWHA 3GNJA 4ECJA 1B9XC 1MDIA 1ZL9A 5H5RA 4KNDA 3QAVA 2V6KA 4YQUA 5FWGA 5A4VA 3ZLPA 4IELA 1V58A 3P8WA 4MK3A 3C73A 2QSIA 2FWFA 1TRWA 3LYPA 1YEXA 2XBQA 3HJMA 3EMXA 4TRXA 3GV1A 1XWBA 2HSYA 4MLYA 2IMEA 2KHPA 5IMFA 1F2EA 1GTUA 1ZMAA 3D0ZA 2K6VA 2O8VB 3GURA 4GWRA 4PQHA 2X64A 3L9VA 3H93A 4MF6A 2EIOA 1OE8A 1EV4A 1R5PA 2H01A 2I81A 1QFNA 1U6TA 1U3AA 3WD6A 3WGXA 1WMJA 18GSA 1JZOA 2GDRA 5J5NA 1K0CA 4WF5A 1WRYA 1WJKA 4Q5FA 5CRHA 1NHOA 4KE3A 2R2JA 5JCUA 1XW9A 2RM6A 3Q74A 3TRXA 3GKXA 2OA7A 2ZCTA 2GSRA 1QGVA 2H6XA 1EV9A 1TW9A 6GSUA 1S3AA 2N5BA 4PQ1A 5J4UA 1YF1A 3R2QA 1MDKA 2DBCA 3IBHA 4OD7A 5E59A 3CSIA 2WDUA 19GSA 3LEFA 2RIIA 3FZAA 2O85A 3BCKA 5JWRB 1N8JA 5ECSA 1BAYA 4EL1A 3APSA 1XWCA 1ILOA 3RHBA 3EVIA 2PU9C 4IHUA 3FR6A 3ZL5A 5IMZA 2R3XA 4V2MA 4ZL7A 3E3EA 3ERGA 2G0FA 3VWVA 2H0HA 4ZXGA 5D9XA 1O81A 4J57E 2DLXA 4K6XA 3UVTA 5IOWA 3HA9A 3HHVA 3SBCA 2GQMA 2MMAA 4ULXA 2YPMA 4G2EA 5ECNB 2FNOA 4X0XA 1TU7A 3FHKA 4XHMA 2H6YA 2ON7A 3IC4A 4F82A 2KP1A 1V40A 2HLSA 4I6XA 1O73A 3KIJA 3ZMLA 1USBA 3VWWA 2MBTA 2IMKA 1YY7A 4QL9A 4EXJA 4I97A 4OO5A 1GWCA 4ML1A 4GSSA 5CRGA 5G1LA 5KN3A 2OJLA 2KUCA 2YWNA 1ZYQB 1O8XA 2PN8A 3FZ4A 2JZTA 2GSTA 4EE0A 4GXZA 3KXOA 5HFGA 3TDGA 5KEJA 3VWXA 5G2ZA 1GNWA 4YAPA 5GAND 3EYTA 4ZB6A 3CSHA 4MJCA 3MSZA 3KEBA 2GSQA 3HDCA 2C3NA 5AN1A 2E7PA 4HDEA 4RI6A 3QFAC 1M0UA 4FO5A 3W8JA 3PINA 3M8NA 1ACVA 2HXKA 3IOSA 5LNKe 1TP9A 4PNGA 3UMAA 3O76A 3RDWA 2KP2A 5IMVA 1X5CA 4LLRA 1TKDB 1QXHA 1GUMA 1EP7A 5G1KA 4IP1A 4OFMA 1SD9A 1GRXA 1SD8A 1F9MA 5IPGA 4ZBAA 3WT1A 4RQXA 1PQNA 3L78A 4WBJA 2PVQA 3FKFA 1GSQA 2CVBA 2V32A 1TDIA 4D73A 1Z5YE 3LXZA 2C80A 3V1WA 3QCPA 3TKSE 3EINA 3F8UA 3GSTA 2DIYA 2B1KA 1WOUA 1MDJA 1FW1A 5F07A 5H5SA 2LQOA 4N10A 1NM3A 3UARA 3GRXA 2X8HA 3FK8A 16GSA 5C04A 4CHSA 1DUGA 4L0WA 3QOUA 1T4YA 3IPZA 4HQSA 4G9HA 4EF0A 3O3TA 3DIEA 4ID0A 4RUVA 2A2SA 4POLA 3IR4A 1Z7PA 4XRDA 1XFLA 1K0OA 3J7Yb 4HU9A 4FYUA 4DSSB 12GSA 1JFUA 2H75A 1ERVA 4E8EA 5IOXA 3W8SA 2DMMA 4G19A 2FY6A 1T7PB 3C8EA 3F0IA 3IV4A 5DJLA 4MF7A 2P31A 5CP1A 1A2MA 4I8BA 1TJDA 2DC5A 1BQ7A 5JCGA 4EVMA 2J23A 3WGDA 1SKWB 4IJ3A 4JEDA 3EURA 2V6OA 1F6MC 3F4TA 3CMIA 1GUHA 2WCIA 3WGEA 2Z9SA 2RUEA 5AIVA 2K8VA 2VCVA 4AF2A 5CRDA 1HQOA 2JZSA 3HXSA 1O8WA 1FHEA 1F3AA 1GSEA 2YANA 4NAXA 3FZ5A 4KB3A 4GTUA 3K8NA 4RQRA 3D21A 6GSYA 1WE0A 5ECRB 1V98A 3L4NA 4KA0A 2LTKA 2NPBA 2CQ9A 3PR8A 4K1FA 3QR6A 1XWGA 2C3QA 1IYHA 2ZNMA 2JL4A 3LSZA 1N2AA 4ILFA 4PGTA 2R5GA 3ZTLA 2LJAA 3A3TA 3HYPA 2DSAA 4XS4B 3WT2A 1SK0A 1OC8A 14GSA 3ZVJD 2H8LA 5ELGA 3I9V2 1ML6A 1A0RP 2ALBA 3F6DA 4KDXA 1GSYA 1KTEA 2X8CA 2GLRA 4BA7A 5B8AA 4WETA 1UC7A 3TKRA 4MJAA 1XPVA 2H66A 3TB2A 11GSA 4MPFA 1AXDA 5CYYA 3I69A 4MPGA 1YJ6A 1B8XA 3H4KA 5G5EA 5D9TA 2MMOA 3RAZA 3QPMA 4KCEA 4KH7A 4IP6A 4IGJA 4N30A 1PMTA 3ZFLA 3RBTA 1OE7A 2OE3A 1XVQA 1PX6A 1TXXA 1YDKA 4J56E 1K0NA 1U88A 2O87A 1K0BA 3TGZA 1EWXA 1XBSA 2BMXA 2XPEA 1PD21 2EIQA 2WB9A 4K7OA 4JR4A 1M2AA 4HJ2A 5F06A 2CT6A 1TRSA 4DSSA 2IIYA 2O89A 1KNGA 3NIVA 1K3YA 1SK2A 2IFQA 5ECMB 2YWMA 3G9BA 3D5JA 2VCZA 2GZPA 2OE0A 2XBIA 5ECOB 2TIRA 3CTFA 3UAPA 3CXGA 3HJOA 2VLUA 4MA9A 3FR9A 2L57A 4XIHA 1EGRA 2OADA 3ISOA 9GSSA 2GS3A 1URMA 1K0DA 3APOA 2I3YA 2C3TA 1SL0B 1O85A 1Z3EA 1O6JA 5INYA 1PGTA 1EP8A 1FB6A 4X1UA 3GUSA 2HZEB 4GF0A 2CA8A 4L0UA 3FZ9A 1G6WA 4F03A 2V2GA 2OACA 1R5AA 1AUCA 4YAVA 1Q4JA 1X9WB 3F4SA 4XCSA 1QUWA 2C1YA 2H1DA 1GSFA 4PX1A 4V1Ag 4NWYA 2PUKC 5DDLA 4V2LA 2OBKA 3TOTA 1UVZA 2MMNA 3EU4A 2RUFA 4CW9A 1OYJA 4G10A 1U3IA 3TCOA 1A8LA 1U87A 3UJ1A 5ID2B 2AUVA 1EOHA 1V57A 4DSRA 2M80A 4BL7A 3KCMA 3LQ7A 3ZMKA 4MF5A 2REMA 4XS4A 5CAXA 2H6ZA 3VWUA 2HE3A 3TUEA 4Q5RA 4HOJA 5IMCA 2JZRA 1SJZA 1JHBA 1I9DA 2CX3A 2IN3A 2YV9A 4O5RA 3VI5A 2XPDA 4JRRA 5DVBA 1XOAA 2EC4A 5COHA 3G7YA 5EVOA 4WEYA 1B4PA 4NHZA 4KSOA 5IIZA 2WRTA 1Y6EA 3APQA 4TR3A 2NTOA 2VM2A 1HNAA 2ZUPA 4K0NA 6GSVA 2B6MA 3LXTA 3TOUA 3BBYA 1BX9A 5KN0A 4D73B 1XVWA 1A2LA 4TW5A 5IM9A 4HJMA 5AISA 5F8BA 3D22A 3UIWA 2VL2A 1TI3A 1B9YC 1K3LA 2J9HA 2FWEA 2IL3A 2LNTA 4KDYA 4K9ZA 3P7XA 2NDOA 2C0DA 1PRXA 4BPYA 5D93A 5IMAA 5D9WA 2L5LA 2C0EA 1QMVA 2LKUA 4BWSA 3IA1A 4Q5QA 3ZFBA 1J9BA 1EEJA 2R6KA 2LRNA 1GLQA 4O7HA 3LGCA 3KJYA 3O6TA 1XWAA 2H19A 4PUFC 1XZOA 2WGRA 5ECPB 5LD0A 3ZYWA 3DMLA 4K7IA 3ZVJA 4BVXA 2H74A 5E4WA 3D4TA 1PKWA 3GKKA 2XC2A 3GHAA 1OKDA 3CYNA 4HS1A 5DCGA 4FH8A 3ERWA 2HZEA 5A4UA 1H75A 4NV5A 5HFIA 2JADA 4MZWA 1MEKA 1YQ1A 2LRTA 2FA4A
chains in the Genus database with same CATH superfamily
4IBPA 5DQYA 13GSA 4HZ4A 3M3MA 1WIKA 4NMUA 1M2BA 1XW5A 2H71A 1ERUA 5DAKB 5GZZB 4V2NA 1X5EA 4L5OA 5KN2A 2P0GA 4IQAA 1TI1A 4NPBA 5L71A 5ID2A 3DXBA 3DKSA 4MJEA 2VD0A 2CZ2A 6GSTA 2LRCA 1T1VA 3D4MA 3E0UA 2E2MA 3GH6A 2DJ1A 4TXVA 4EO3A 4DVCA 3N9JA 3GIXA 4JZQA 5IQYA 3EPTA 5CREA 2R37A 2B1LA 2PPTA 2VOCA 3A2VA 2PVOC 4OO4A 4MDCA 3ME7A 5B6MA 1GH2A 1A24A 1ZOFA 4HEA2 4I2TA 1PSQA 3LW9A 1DE2A 2YWIA 4LL1B 5ELAA 1Y25A 5D73A 1X9SB 1G6YA 3DD3A 4DSQA 1GSDA 2M72A 1PN0A 4WR5A 3W6GA 2IMDA 1XG8A 4XS1A 2LEGA 4MZBA 2LUSA 4TKYA 3QMXA 3KH7A 1TTZA 3IHQA 1NSWA 2EIRA 4EUYA 3RPNA 1A2JA 4ECCA 4AJ8A 4AGSA 1GULA 1EZKA 3HD5A 1JZRA 3ME8A 1ABAA 1GUKA 3EMPA 4QQ7A 5CNWA 3HZ8A 1FVKA 1RW1A 1SJ6A 2IMIA 3MAKA 1WWJA 3CRUA 4MH2A 2CAQA 5ENUA 4GQCA 3GX8A 1SYRA 2LV3A 3KTLA 3QD9A 2PMTA 2P5RA 1EGOA 2PBJA 4WKWA 5KOWA 2YJHA 2IFQB 2DJ3A 4YQMA 5ABRA 3F63A 1X9MB 2F8AA 3F9UA 4J2FA 2DIZA 3VK9A 3H1NA 1EOGA 3HKRA 1T4ZA 2WFCA 1SL1B 1SK1A 2GZYA 4IJIA 1SU9A 4BVYA 4MNNA 1OAZA 1HD2A 2FLSA 4MMMA 2K18A 3CTGA 4KW6A 1XCCA 4K2XA 2F8FA 1B48A 4P3YB 1A23A 3Q19A 3A2WA 1UN2A 1A0FA 2GTUA 5EY6A 1SL2B 2GZZA 5DAKA 4N11A 5KOXA 2VCTA 2GVPA 2H73A 3D6IA 4K5RA 4OFTA 1HNCA 1A8YA 3P2AA 2L6DA 1JZDA 3GSSA 4ECIA 2VD1A 3KMOA 3JCML 1M7TA 2ON5A 1J0FA 1S3CA 1O7UA 1X5DA 4ECBA 4WR4A 2H0IA 4Q5NA 3UBKA 2YWOA 5D9VA 1Z6MA 1VF3A 1GTBA 3IDVA 4I5QA 4TR0A 1TK8B 2GSSA 1SENA 2HRFA 1AQXA 2YNXA 1XIYA 1AIUA 5GSSA 1AAZA 1XW6A 3IRAA 2FD3A 4HZ2A 3TJFA 5EPFA 3QFBC 2VIMA 5HQPA 1Q98A 2A2RA 1HNBA 1YKCA 2E2GA 5HR2A 1ZCPA 5DQSA 1T8EB 1VGLA 3ED3A 1M9BA 1LJRA 5G31A 4N0ZA 3Q18A 3RHCA 4TVEA 3BOAA 4AJ7A 1KBNA 2WZ9A 2H0GA 3KH9A 3GMFA 4TR4A 4MABA 3LFLA 4LMVA 2AAWA 4QL7A 2YZHA 2YOIA 4G0IA 3VURA 1OC9B 2OKAA 3N5OA 4PURA 4MH3A 4ZL9A 4TXOB 1Z7RA 2OE1A 2IJYA 2DJ2A 5ECIB 4LL4B 5A5KA 5IPHA 3HVNA 2YJ7A 1J08A 2YP6A 2KLXA 2NBSA 2HYXA 3ERFA 3I6AA 2WS2A 3SWLA 4POKA 3OR5A 1PL2A 2X99A 3HJPA 4Z2TA 2R0PA 4LA1A 2H1BA 2PERA 4NHWA 2WJUA 8GSSA 4DEJA 3ZRDA 1SKSB 3LG6A 3ZIJA 4XS6A 2DJKA 4OMVA 1HYUA 2K9FA 2JACA 2PWJA 3GTUA 2VL9A 4TR1B 1Z9HA 3GKMA 3GH9A 2QC7A 3FY7A 5IO2A 2VM1A 2LJRA 4KF9A 1XOBA 2QKEA 4Z2UA 1M2DA 1R7HA 4KDUA 4EIQA 3QAWA 3Q6OA 3LYKA 3NZNA 1XWKA 1GSUA 2H1AA 3ZREA 5AGYA 1SYXA 1VF1A 2VAFA 4KCAA 4ZBDA 2GQKA 1ST9A 3C7MA 2GQLA 5H5QA 2P5QA 2XHFA 4HU7A 5G30A 1YF0A 1QK8A 2OBIA 4FQUA 2QGVA 2BJXA 2VCXA 2YN1A 4YKFA 2O7KA 3HZ4A 2HT9A 3DEXA 1G7OA 1K3OA 2AB6A 2LSTA 5CRWA 2CVDA 2VO4A 3C71A 3GYKA 1DBYA 5ECHB 3G7JA 2AYTA 3KP8A 1WPIA 2GT5A 3HY2A 3HVVA 2A2PA 4ISDA 4JU5A 4ZBBA 3UL3A 1GSSA 4TN8A 3L9UA 4F0BA 2DMLA 3J7Yk 4RI7A 1TOFA 2HZFA 2GGTA 2H72A 5JWQB 2CZ3A 3LJRA 3TJGA 1TK0B 5HR1A 7GSSA 1ON4A 1K0MA 1FB0A 2HSHA 2VLVA 5KN1A 4TOPA 3P90A 6GSSA 3A2XA 2VCQA 3CRTA 5J9BA 3FMWA 2FHEA 5IMDA 3F4RA 2FGXA 3TJBA 2L4CA 1OC9A 3E9JB 3PGTA 5HR0A 4TXOA 4K0GA 2B5YA 3VPQA 4MCUA 2KOKA 1OVNA 2VL2C 4POMA 3DGQA 3LWAA 22GSA 1EEMA 2H30A 1OC3A 4EKZA 4KAEA 4O92A 1Z6NA 3IE3A 2V41A 1T00A 4EDYA 1RK4A 4GQFA 4PNFA 2CAIA 2B5EA 2VLTA 2CX4A 2RLIA 2LNSA 5HR3A 2E0QA 3CSJA 2C0GA 4WF4A 2H76A 3G7IA 1AC1A 2YZUA 4ACSA 5GAPD 3M9JA 1GLPA 3BJ5A 1F37A 4FYBA 4TR1A 2G2QA 3S9FA 4IN0A 5DALA 5DBQA 5FHIA 3GN3A 3HVSA 4K8MA 4KGIA 2TRCP 3WYWA 3M0FA 3TRQA 1YEPA 2B7JA 4PXOA 5FT3A 2R0GA 2H70A 5BMUA 3F6FA 1GL8A 4HUAA 1F3BA 3C1SA 5D96A 5B7CA 1AQWA 2B7KA 3ZITA 2IMFA 3U6VA 5EL8A 3KTBA 5A4WA 1S3DA 3UBLA 2CV4A 3H8QA 4WBRD 2LQQA 1W89A 2ES7A 2HRNA 2F9SA 2YCDA 3FEUA 2MYGA 2L6CA 4HI7A 3AY8A 3FYGA 2FCHA 1ZYEA 3TKPA 1XXUA 1BJXA 1GNEA 3VFIA 3A5WA 4JE1A 4CDOA 1SJIA 1AQVA 3DVXA 3F3QA 3RPPA 1ZGNA 3QAGA 4FIWA 2L59A 1YKAA 1FO5A 4ZIJA 3DYRA 4I2UA 2WULA 3GA4A 1LU4A 4E8HA 3FR3A 2I1UA 1UA5A 2R4VA 4KUNA 3FRCA 2HFDA 4BWQA 3NOFA 5F0GA 1B4QA 4F9ZA 1SKRB 5JCWA 4F0CA 3ZIVA 1I5GA 2BTOT 2D2ZA 4IS0A 2IPAA 5J9CA 1MD4A 1X0RA 5HFKA 4XTSA 5C00A 4GSNA 2F3MA 3IK7A 1MD3A 1IYIA 1VRSD 4ML6A 2B3SA 1DE1A 1CQHA 1LBKA 5LCZA 1TK5B 4GSTA 3TJJA 3GL5A 3MWHA 3EWLA 4K2DA 3VI7A 4O32A 3IXRA 3VPTA 2MZCA 1E6BA 2NVLA 4NV2A 4AJ6A 4GRFA 3TRPA 2VL3A 3F3RA 1OKTA 1K0AA 2FA8A 1FVJA 2JSYA 4PUAA 4XRAA 1G0TA 1QQ2A 1PN9A 3GKNA 1R26A 2TRXA 3IAM2 3IAS2 4L8EA 5AIXA 2GT6A 1TRUA 5DJMA 4OCEA 2JSZA 5D8IA 1ERWA 1DSBA 1PKZA 3DVWA 4EDZA 1KEBA 4Z7XA 5J3RA 1E2YA 2I4AA 2DKHA 2HSMA 1GTIA 1NW2A 3EC3A 3GTUB 5J41A 5F05A 1NHYA 2L5OA 5GSTA 1BYEA 1FAAA 4X43A 1BEDA 3US3A 1THXA 2H1GA 3EE2A 4HQZA 4O5UA 3U5RE 2AHEA 5BRTA 4IQ1A 2A4HA 1GTAA 1FOVA 1CQGA 1PA3A 1RQMA 17GSA 3QDNA 4V1Ap 2DJ0A 1G7EA 2C4JA 2MBSA 1PL1A 1V9WA 1BG5A 3GX0A 4ZL8A 4NXIA 4WXTA 4YH2A 3PH9A 2UZ8A 4KSMA 4L5LA 2CVKA 3BCIA 1MTCA 2FWGA 5IO0A 3CBUA 2L4QA 2F51A 2C8UA 1FOHA 5ECLB 5G5FA 4IW9A 3L0HA 3KM6A 4EC0A 3MNGA 2HI7A 2VUPA 3DRNA 1JZWA 1AW9A 5CO3A 5B8BA 4FYCA 4KX4A 4GLTA 2IWTA 1M99A 4N0VA 4PTSA 2V1MA 3ZZXA 1WP0A 2B5XA 4K7NA 1R4WA 1ERTA 1FG4A 4H86A 5DCHA 6GSXA 1THOA 3UVHA 2K8SA 4POBA 4IVFA 1TU8A 4OFNA 2FUG2 3VLNA 6GSWA 3M1GA 3UOMA 4EIPA 1M9AA 2YV7A 4OCFA 3BD2A 1V2AA 4YQVA 1JLVA 1T3BA 5JWOB 2AJQB 1JLWA 2X4AA 1W4VA 4MP4A 3C1RA 3I43A 2VCWA 3KZQA 2AV4A 2N5FA 2M46A 2LJKA 3R3EA 1YZXA 5B6NA 4MJBA 3GL3A 3M9KA 5ECKB 4JBBA 2N5AA 2A4VA 4F2IA 2MMZA 3HCZA 4LMWA 2JU5A 3HVXA 2X8GA 4PQIA 3GFKA 2I9HA 3L9SA 1TRVA 3EU3A 1VF2A 1VF4A 2RM5A 1GP1A 2PGTA 3CQFA 3H79A 2LS5A 1H4OA 3IK9A 3PPUA 3TJKA 2DJJA 1PX7A 4ZB8A 3KGKA 5DALB 3FW2A 3KD0A 10GSA 3KMNA 3LORA 4GCIA 4IKHA 1C72A 4OWYA 3UEMA 3DWVA 3TKQA 4MZCA 4ZB9A 3MDKA 4ZILA 2C0FA 5ECQB 4JR6A 3TKSC 3KP9A 2HNLA 20GSA 3TKSA 1ZZYA 2FWHA 3GNJA 4ECJA 1B9XC 2QA1A 1MDIA 1ZL9A 5H5RA 4KNDA 3QAVA 2V6KA 4YQUA 5FWGA 5A4VA 3ZLPA 4IELA 1V58A 4X4JA 3P8WA 4MK3A 3C73A 2QSIA 2FWFA 1TRWA 3LYPA 4O5QA 1YEXA 2XBQA 3HJMA 3EMXA 4TRXA 3GV1A 1XWBA 2HSYA 4MLYA 2IMEA 2KHPA 5IMFA 1F2EA 1GTUA 1ZMAA 3D0ZA 2K6VA 2O8VB 3GURA 4GWRA 4PQHA 2X64A 3L9VA 3H93A 4MF6A 2EIOA 1OE8A 1EV4A 1R5PA 2H01A 2I81A 1QFNA 1U6TA 1U3AA 3WD6A 3WGXA 1WMJA 18GSA 1JZOA 2GDRA 5J5NA 1K0CA 4WF5A 1WRYA 1WJKA 4Q5FA 5CRHA 1NHOA 4KE3A 2R2JA 5JCUA 1XW9A 2RM6A 3Q74A 3TRXA 3GKXA 2OA7A 2ZCTA 2GSRA 1QGVA 2H6XA 1EV9A 1TW9A 3IC8A 6GSUA 1S3AA 2N5BA 4PQ1A 5J4UA 1YF1A 3R2QA 1MDKA 2DBCA 3IBHA 4OD7A 5E59A 3CSIA 2WDUA 19GSA 3LEFA 2RIIA 3FZAA 2O85A 3BCKA 5JWRB 1N8JA 5ECSA 1BAYA 4EL1A 3APSA 1XWCA 1ILOA 3RHBA 3EVIA 2PU9C 4IHUA 3FR6A 3ZL5A 5IMZA 2R3XA 4V2MA 4ZL7A 3E3EA 3ERGA 2G0FA 4K5SA 3VWVA 2H0HA 4ZXGA 2QA2A 1S3RA 5D9XA 1O81A 4J57E 2DLXA 4K6XA 3UVTA 5IOWA 3HA9A 3HHVA 3SBCA 2GQMA 2MMAA 4ULXA 2YPMA 4G2EA 5ECNB 2FNOA 4X0XA 1TU7A 3FHKA 4XHMA 2H6YA 2ON7A 3IC4A 4F82A 2KP1A 1V40A 2HLSA 4I6XA 1O73A 3KIJA 3ZMLA 1USBA 3VWWA 2MBTA 2IMKA 1YY7A 4QL9A 4EXJA 4I97A 4OO5A 1GWCA 4ML1A 4GSSA 5CRGA 5G1LA 5KN3A 2OJLA 2KUCA 2YWNA 1ZYQB 1O8XA 2PN8A 1ZYPA 3FZ4A 2JZTA 2GSTA 4EE0A 4GXZA 3KXOA 5HFGA 3TDGA 5KEJA 3VWXA 5G2ZA 1GNWA 4YAPA 5GAND 3EYTA 2HRAA 4ZB6A 3CSHA 4MJCA 3MSZA 3KEBA 2GSQA 4BIKA 3HDCA 2C3NA 5AN1A 2E7PA 4HDEA 4RI6A 3QFAC 1M0UA 4FO5A 3W8JA 3PINA 3M8NA 3IHGA 1ACVA 2HXKA 3IOSA 5LNKe 1TP9A 4PNGA 3UMAA 3O76A 3RDWA 2KP2A 5IMVA 1X5CA 4LLRA 3MYDA 1TKDB 1QXHA 1GUMA 1EP7A 5G1KA 4IP1A 4OFMA 1SD9A 1ZYNA 1GRXA 1SD8A 1F9MA 5IPGA 4ZBAA 3WT1A 4RQXA 1PQNA 3L78A 2HRKA 4WBJA 2PVQA 3FKFA 1GSQA 2CVBA 2V32A 1TDIA 4D73A 1Z5YE 3LXZA 2C80A 3V1WA 3QCPA 3TKSE 3EINA 3F8UA 3GSTA 2DIYA 2B1KA 1WOUA 1MDJA 1FW1A 5F07A 5H5SA 2LQOA 4CY6A 4N10A 1NM3A 3UARA 3GRXA 2X8HA 3FK8A 16GSA 5C04A 4CHSA 1DUGA 4L0WA 2R0CA 3QOUA 1T4YA 3IPZA 4HQSA 4G9HA 4EF0A 3O3TA 3DIEA 4ID0A 4RUVA 2A2SA 4POLA 3IR4A 1Z7PA 4XRDA 1XFLA 1K0OA 3J7Yb 4HU9A 4FYUA 4DSSB 12GSA 1JFUA 2H75A 1ERVA 4E8EA 5IOXA 3W8SA 2DMMA 4G19A 2FY6A 1T7PB 3C8EA 3F0IA 3IV4A 5DJLA 4MF7A 2P31A 5CP1A 1A2MA 4I8BA 1TJDA 2DC5A 1BQ7A 5JCGA 4EVMA 2J23A 3WGDA 1SKWB 4IJ3A 4JEDA 3EURA 2V6OA 1F6MC 3F4TA 3CMIA 1GUHA 2WCIA 3WGEA 2Z9SA 2RUEA 5AIVA 2K8VA 2VCVA 3MIXA 4AF2A 5CRDA 1HQOA 2JZSA 3HXSA 1O8WA 1FHEA 4CY8A 1F3AA 1GSEA 2YANA 4NAXA 3FZ5A 4YKGA 4KB3A 4GTUA 3K8NA 4RQRA 3D21A 4Z2RA 6GSYA 1WE0A 5ECRB 1V98A 3L4NA 4KA0A 2LTKA 2NPBA 2CQ9A 3PR8A 4K1FA 3QR6A 1XWGA 2C3QA 4G0KA 1IYHA 2ZNMA 2JL4A 3LSZA 1N2AA 4ILFA 4PGTA 2R5GA 3ZTLA 2LJAA 3A3TA 4BL7B 3HYPA 2DSAA 4XS4B 3WT2A 1SK0A 1OC8A 14GSA 3ZVJD 2H8LA 5ELGA 3I9V2 1ML6A 1A0RP 2ALBA 3F6DA 4KDXA 1GSYA 1KTEA 2X8CA 2GLRA 4BA7A 5B8AA 4WETA 1UC7A 3TKRA 4A5PA 4MJAA 1XPVA 2H66A 1PFOA 3TB2A 11GSA 4MPFA 1AXDA 5CYYA 3I69A 4MPGA 1YJ6A 1B8XA 3H4KA 5G5EA 5D9TA 2MMOA 3RAZA 3QPMA 4KCEA 4KH7A 4IP6A 4IGJA 4N30A 1PMTA 3ZFLA 1M3JA 3RBTA 1OE7A 2OE3A 1XVQA 1PX6A 1TXXA 1YDKA 4J56E 1K0NA 4ICYA 1U88A 2O87A 1K0BA 2X49A 3TGZA 1EWXA 1XBSA 2BMXA 2XPEA 1PD21 2EIQA 2WB9A 4K7OA 4JR4A 1M2AA 4HJ2A 5F06A 2CT6A 1TRSA 4DSSA 2IIYA 2O89A 1KNGA 3NIVA 1K3YA 1SK2A 2IFQA 5ECMB 2YWMA 3G9BA 3D5JA 2VCZA 2GZPA 2OE0A 2XBIA 5ECOB 2TIRA 3CTFA 3UAPA 3CXGA 3HJOA 2VLUA 4MA9A 3FR9A 2L57A 4XIHA 1EGRA 2OADA 3ISOA 9GSSA 2GS3A 1URMA 1K0DA 4BVXB 3APOA 2I3YA 2C3TA 1SL0B 1O85A 1Z3EA 1O6JA 5INYA 1PGTA 4G0LA 1EP8A 1FB6A 4X1UA 3GUSA 2HZEB 4GF0A 2CA8A 4L0UA 3FZ9A 1G6WA 4F03A 2V2GA 2OACA 1R5AA 1AUCA 4YAVA 1Q4JA 1M3IA 1X9WB 3F4SA 4XCSA 1QUWA 2C1YA 2H1DA 1GSFA 4PX1A 4V1Ag 4NWYA 2PUKC 5DDLA 4V2LA 2OBKA 3TOTA 1UVZA 2MMNA 3EU4A 2RUFA 4CW9A 1OYJA 4G10A 1U3IA 3TCOA 1A8LA 1U87A 3UJ1A 5ID2B 2AUVA 1EOHA 1V57A 4DSRA 2M80A 4BL7A 3KCMA 3LQ7A 3ZMKA 4MF5A 2REMA 4XS4A 5CAXA 2H6ZA 3VWUA 2HE3A 3TUEA 4Q5RA 4HOJA 5IMCA 2JZRA 1SJZA 1JHBA 1I9DA 2CX3A 2IN3A 2YV9A 4O5RA 3VI5A 2XPDA 4JRRA 5DVBA 1XOAA 2EC4A 5COHA 3G7YA 5EVOA 4WEYA 1B4PA 4NHZA 4KSOA 5IIZA 2WRTA 1Y6EA 3APQA 4TR3A 2NTOA 2VM2A 1HNAA 2ZUPA 4K0NA 6GSVA 2B6MA 3LXTA 3TOUA 3BBYA 1BX9A 5KN0A 4D73B 1XVWA 1A2LA 4TW5A 5IM9A 4HJMA 5AISA 5F8BA 3D22A 3UIWA 2VL2A 1TI3A 1B9YC 1K3LA 2J9HA 2FWEA 2IL3A 2LNTA 4KDYA 4K9ZA 3P7XA 4USSA 2NDOA 2C0DA 1PRXA 2DKIA 5D93A 4BPYA 5IMAA 5D9WA 2L5LA 2C0EA 1QMVA 4HSCX 2LKUA 4BWSA 3IA1A 4Q5QA 3ZFBA 1J9BA 1EEJA 2R6KA 2LRNA 1GLQA 4O7HA 3LGCA 3KJYA 3O6TA 1XWAA 2H19A 4PUFC 1XZOA 2WGRA 5ECPB 5LD0A 3ZYWA 3DMLA 4K7IA 3ZVJA 4BVXA 2H74A 5E4WA 3D4TA 1PKWA 3GKKA 2XC2A 3GHAA 1OKDA 3CYNA 4HS1A 5DCGA 4FH8A 3ERWA 2HZEA 5A4UA 1H75A 4NV5A 5HFIA 2JADA 3A5IA 4MZWA 1MEKA 1YQ1A 2LRTA 4BVYB 2FA4A
chains in the Genus database with same CATH topology
4IBPA 5DQYA 13GSA 4HZ4A 3M3MA 1WIKA 4NMUA 1M2BA 1XW5A 2H71A 1ERUA 5DAKB 5GZZB 4V2NA 1X5EA 4L5OA 5KN2A 2P0GA 4IQAA 1TI1A 4NPBA 5L71A 5ID2A 3DXBA 3DKSA 4MJEA 2VD0A 2CZ2A 6GSTA 2LRCA 1T1VA 3D4MA 3E0UA 2E2MA 3GH6A 2DJ1A 4TXVA 4EO3A 4DVCA 3N9JA 3GIXA 4JZQA 5IQYA 3EPTA 5CREA 2R37A 2B1LA 2PPTA 2VOCA 3A2VA 2PVOC 4OO4A 4MDCA 3ME7A 5B6MA 1GH2A 1A24A 1ZOFA 4HEA2 4I2TA 1PSQA 3LW9A 1DE2A 2YWIA 4LL1B 5ELAA 1Y25A 5D73A 1X9SB 1G6YA 3DD3A 4DSQA 1GSDA 2M72A 1PN0A 4WR5A 3W6GA 2IMDA 4XS1A 2LEGA 4MZBA 2LUSA 4TKYA 3QMXA 3KH7A 1TTZA 3IHQA 1NSWA 2EIRA 4EUYA 3RPNA 1A2JA 4ECCA 4AJ8A 4AGSA 1GULA 1EZKA 3HD5A 1JZRA 3ME8A 1ABAA 1GUKA 3EMPA 4QQ7A 5CNWA 3HZ8A 1FVKA 1RW1A 1SJ6A 2IMIA 3MAKA 1WWJA 3CRUA 4MH2A 2CAQA 5ENUA 4GQCA 3GX8A 1SYRA 2LV3A 3KTLA 3QD9A 2PMTA 2P5RA 1EGOA 2PBJA 4WKWA 5KOWA 2YJHA 2IFQB 2DJ3A 4YQMA 5ABRA 3F63A 1X9MB 2F8AA 3F9UA 4J2FA 2DIZA 3VK9A 3H1NA 1EOGA 3HKRA 1T4ZA 2WFCA 1SL1B 1SK1A 2GZYA 4IJIA 1SU9A 4BVYA 4MNNA 1OAZA 1HD2A 2FLSA 4MMMA 2K18A 3CTGA 4KW6A 1XCCA 4K2XA 2F8FA 1B48A 4P3YB 1A23A 3Q19A 3A2WA 1UN2A 1A0FA 2GTUA 5EY6A 1SL2B 2GZZA 5DAKA 4N11A 5KOXA 2VCTA 2GVPA 2H73A 3D6IA 4K5RA 4OFTA 1HNCA 1A8YA 3P2AA 2L6DA 1JZDA 3GSSA 4ECIA 2VD1A 3KMOA 3JCML 1M7TA 2ON5A 1J0FA 1S3CA 1O7UA 1X5DA 4ECBA 4WR4A 2H0IA 4Q5NA 3UBKA 2YWOA 5D9VA 1Z6MA 1VF3A 1GTBA 3IDVA 4I5QA 4TR0A 1TK8B 2GSSA 1SENA 2HRFA 1AQXA 2YNXA 1XIYA 1AIUA 5GSSA 1AAZA 1XW6A 3IRAA 2FD3A 4HZ2A 3TJFA 5EPFA 3QFBC 2VIMA 5HQPA 1Q98A 2A2RA 1HNBA 1YKCA 2E2GA 5HR2A 1ZCPA 5DQSA 1T8EB 1VGLA 3ED3A 1M9BA 1LJRA 5G31A 4N0ZA 3Q18A 3RHCA 4TVEA 3BOAA 4AJ7A 1KBNA 2WZ9A 2H0GA 3KH9A 3GMFA 4TR4A 4MABA 3LFLA 4LMVA 2AAWA 4QL7A 2YZHA 2YOIA 4G0IA 3VURA 1OC9B 2OKAA 3N5OA 4PURA 4MH3A 4ZL9A 4TXOB 1Z7RA 2OE1A 2IJYA 2DJ2A 5ECIB 4LL4B 5A5KA 5IPHA 2YJ7A 1J08A 2YP6A 2KLXA 2NBSA 2HYXA 3ERFA 3I6AA 2WS2A 3SWLA 4POKA 3OR5A 1PL2A 2X99A 3HJPA 4Z2TA 2R0PA 4LA1A 2H1BA 2PERA 4NHWA 2WJUA 8GSSA 4DEJA 3ZRDA 1SKSB 3LG6A 3ZIJA 4XS6A 2DJKA 4OMVA 1HYUA 2K9FA 2JACA 2PWJA 3GTUA 2VL9A 4TR1B 1Z9HA 3GKMA 3GH9A 2QC7A 3FY7A 5IO2A 2VM1A 2LJRA 4KF9A 1XOBA 2QKEA 4Z2UA 1M2DA 1R7HA 4KDUA 4EIQA 3QAWA 3Q6OA 3LYKA 3NZNA 1XWKA 1GSUA 2H1AA 3ZREA 5AGYA 1SYXA 1VF1A 2VAFA 4KCAA 4ZBDA 2GQKA 1ST9A 3C7MA 2GQLA 5H5QA 2P5QA 2XHFA 4HU7A 5G30A 1YF0A 1QK8A 2OBIA 4FQUA 2QGVA 2BJXA 2VCXA 2YN1A 4YKFA 2O7KA 3HZ4A 2HT9A 3DEXA 1G7OA 1K3OA 2AB6A 2LSTA 5CRWA 2CVDA 2VO4A 3C71A 3GYKA 1DBYA 5ECHB 3G7JA 2AYTA 3KP8A 1WPIA 2GT5A 3HY2A 3HVVA 2A2PA 4ISDA 4JU5A 4ZBBA 3UL3A 1GSSA 4TN8A 3L9UA 4F0BA 2DMLA 3J7Yk 4RI7A 1TOFA 2HZFA 2GGTA 2H72A 5JWQB 2CZ3A 3LJRA 3TJGA 1TK0B 5HR1A 7GSSA 1ON4A 1K0MA 1FB0A 2HSHA 2VLVA 5KN1A 4TOPA 3P90A 6GSSA 3A2XA 2VCQA 3CRTA 5J9BA 3FMWA 2FHEA 5IMDA 3F4RA 2FGXA 3TJBA 2L4CA 1OC9A 3E9JB 3PGTA 5HR0A 4TXOA 4K0GA 2B5YA 3VPQA 4MCUA 2KOKA 1OVNA 2VL2C 4POMA 3DGQA 3LWAA 22GSA 1EEMA 2H30A 1OC3A 4EKZA 4KAEA 4O92A 1Z6NA 3IE3A 2V41A 1T00A 4EDYA 1RK4A 4GQFA 4PNFA 2CAIA 2B5EA 2VLTA 2CX4A 2RLIA 2LNSA 5HR3A 2E0QA 3CSJA 2C0GA 4WF4A 2H76A 3G7IA 1AC1A 2YZUA 4ACSA 5GAPD 3M9JA 1GLPA 3BJ5A 1F37A 4FYBA 4TR1A 2G2QA 3S9FA 4IN0A 5DALA 5DBQA 5FHIA 3GN3A 3HVSA 4K8MA 4KGIA 2TRCP 3WYWA 3M0FA 3TRQA 1YEPA 2B7JA 4PXOA 5FT3A 2R0GA 2H70A 5BMUA 3F6FA 1GL8A 4HUAA 1F3BA 3C1SA 5D96A 5B7CA 1AQWA 2B7KA 3ZITA 2IMFA 3U6VA 5EL8A 3KTBA 5A4WA 1S3DA 3UBLA 2CV4A 3H8QA 4WBRD 2LQQA 1W89A 2ES7A 2HRNA 2F9SA 2YCDA 3FEUA 2MYGA 2L6CA 4HI7A 3AY8A 3FYGA 2FCHA 1ZYEA 3TKPA 1XXUA 1BJXA 1GNEA 3VFIA 3A5WA 4JE1A 4CDOA 1SJIA 1AQVA 3DVXA 3F3QA 3RPPA 1ZGNA 3QAGA 4FIWA 2L59A 1YKAA 1FO5A 4ZIJA 3DYRA 4I2UA 2WULA 3GA4A 1LU4A 4E8HA 3FR3A 2I1UA 1UA5A 2R4VA 4KUNA 3FRCA 2HFDA 4BWQA 3NOFA 5F0GA 1B4QA 4F9ZA 1SKRB 5JCWA 4F0CA 3ZIVA 1I5GA 2BTOT 2D2ZA 4IS0A 2IPAA 5J9CA 1MD4A 1X0RA 5HFKA 4XTSA 5C00A 4GSNA 2F3MA 3IK7A 1MD3A 1IYIA 1VRSD 4ML6A 2B3SA 1DE1A 1CQHA 1LBKA 5LCZA 1TK5B 4GSTA 3TJJA 3GL5A 3MWHA 3EWLA 4K2DA 3VI7A 4O32A 3IXRA 3VPTA 2MZCA 1E6BA 2NVLA 4NV2A 4AJ6A 4GRFA 3TRPA 2VL3A 3F3RA 1OKTA 1K0AA 2FA8A 1FVJA 2JSYA 4PUAA 4XRAA 1G0TA 1QQ2A 1PN9A 3GKNA 1R26A 2TRXA 3IAM2 3IAS2 4L8EA 5AIXA 2GT6A 1TRUA 5DJMA 4OCEA 2JSZA 5D8IA 1ERWA 1DSBA 1PKZA 3DVWA 4EDZA 1KEBA 4Z7XA 5J3RA 1E2YA 2I4AA 2DKHA 2HSMA 1GTIA 1NW2A 3EC3A 3GTUB 5J41A 5F05A 1NHYA 2L5OA 5GSTA 1BYEA 1FAAA 4X43A 1BEDA 3US3A 1THXA 2H1GA 3EE2A 4HQZA 4O5UA 3U5RE 2AHEA 5BRTA 4IQ1A 2A4HA 1GTAA 1FOVA 1CQGA 1PA3A 1RQMA 17GSA 3QDNA 4V1Ap 2DJ0A 1G7EA 2C4JA 2MBSA 1PL1A 1V9WA 1BG5A 3GX0A 4ZL8A 4NXIA 4WXTA 4YH2A 3PH9A 2UZ8A 4KSMA 4L5LA 2CVKA 3BCIA 1MTCA 2FWGA 5IO0A 3CBUA 2L4QA 2F51A 2C8UA 1FOHA 5ECLB 5G5FA 4IW9A 3L0HA 3KM6A 4EC0A 3MNGA 2HI7A 2VUPA 3DRNA 1JZWA 1AW9A 5CO3A 5B8BA 4FYCA 4KX4A 4GLTA 2IWTA 1M99A 4N0VA 4PTSA 2V1MA 3ZZXA 1WP0A 2B5XA 4K7NA 1R4WA 1ERTA 1FG4A 4H86A 5DCHA 6GSXA 1THOA 3UVHA 2K8SA 4POBA 4IVFA 1TU8A 4OFNA 2FUG2 3VLNA 6GSWA 3M1GA 3UOMA 4EIPA 1M9AA 2YV7A 4OCFA 3BD2A 1V2AA 4YQVA 1JLVA 1T3BA 5JWOB 2AJQB 1JLWA 2X4AA 1W4VA 4MP4A 3C1RA 3I43A 2VCWA 3KZQA 2AV4A 2N5FA 2M46A 2LJKA 3R3EA 1YZXA 5B6NA 4MJBA 3GL3A 3M9KA 5ECKB 4JBBA 2N5AA 2A4VA 4F2IA 2MMZA 3HCZA 4LMWA 2JU5A 3HVXA 2X8GA 4PQIA 3GFKA 2I9HA 3L9SA 1TRVA 3EU3A 1VF2A 1VF4A 2RM5A 1GP1A 2PGTA 3H79A 2LS5A 1H4OA 3IK9A 3PPUA 3TJKA 2DJJA 1PX7A 4ZB8A 3KGKA 5DALB 3FW2A 3KD0A 10GSA 3KMNA 3LORA 4GCIA 4IKHA 1C72A 4OWYA 3UEMA 3DWVA 3TKQA 4MZCA 4ZB9A 3MDKA 4ZILA 2C0FA 5ECQB 4JR6A 3TKSC 3KP9A 2HNLA 20GSA 3TKSA 1ZZYA 2FWHA 3GNJA 4ECJA 1B9XC 2QA1A 1MDIA 1ZL9A 5H5RA 4KNDA 3QAVA 2V6KA 4YQUA 5FWGA 5A4VA 3ZLPA 4IELA 1V58A 4X4JA 3P8WA 4MK3A 3C73A 2QSIA 2FWFA 1TRWA 3LYPA 4O5QA 1YEXA 2XBQA 3HJMA 3EMXA 4TRXA 3GV1A 1XWBA 2HSYA 4MLYA 2IMEA 2KHPA 5IMFA 1F2EA 1GTUA 1ZMAA 3D0ZA 2K6VA 2O8VB 3GURA 4GWRA 4PQHA 2X64A 3L9VA 3H93A 4MF6A 2EIOA 1OE8A 1EV4A 1R5PA 2H01A 2I81A 1QFNA 1U6TA 1U3AA 3WD6A 3WGXA 1WMJA 18GSA 1JZOA 2GDRA 5J5NA 1K0CA 4WF5A 1WRYA 1WJKA 4Q5FA 5CRHA 1NHOA 4KE3A 2R2JA 5JCUA 1XW9A 2RM6A 3Q74A 3TRXA 3GKXA 2OA7A 2ZCTA 2GSRA 1QGVA 2H6XA 1EV9A 1TW9A 3IC8A 6GSUA 1S3AA 2N5BA 4PQ1A 5J4UA 1YF1A 3R2QA 1MDKA 2DBCA 3IBHA 4OD7A 5E59A 3CSIA 2WDUA 19GSA 3LEFA 2RIIA 3FZAA 2O85A 3BCKA 5JWRB 1N8JA 5ECSA 1BAYA 4EL1A 3APSA 1XWCA 1ILOA 3RHBA 3EVIA 2PU9C 4IHUA 3FR6A 3ZL5A 5IMZA 2R3XA 4V2MA 4ZL7A 3E3EA 3ERGA 2G0FA 4K5SA 3VWVA 2H0HA 4ZXGA 2QA2A 5D9XA 1O81A 4J57E 2DLXA 4K6XA 3UVTA 5IOWA 3HA9A 3HHVA 3SBCA 2GQMA 2MMAA 4ULXA 2YPMA 4G2EA 5ECNB 2FNOA 4X0XA 1TU7A 3FHKA 4XHMA 2H6YA 2ON7A 3IC4A 4F82A 2KP1A 1V40A 2HLSA 4I6XA 1O73A 3KIJA 3ZMLA 1USBA 3VWWA 2MBTA 2IMKA 1YY7A 4QL9A 4EXJA 4I97A 4OO5A 1GWCA 4ML1A 4GSSA 5CRGA 5G1LA 5KN3A 2OJLA 2KUCA 2YWNA 1ZYQB 1O8XA 2PN8A 1ZYPA 3FZ4A 2JZTA 2GSTA 4EE0A 4GXZA 3KXOA 5HFGA 3TDGA 5KEJA 3VWXA 5G2ZA 1GNWA 4YAPA 5GAND 3EYTA 2HRAA 4ZB6A 3CSHA 4MJCA 3MSZA 3KEBA 2GSQA 3HDCA 2C3NA 5AN1A 2E7PA 4HDEA 4RI6A 3QFAC 1M0UA 4FO5A 3W8JA 3PINA 3M8NA 3IHGA 1ACVA 2HXKA 3IOSA 5LNKe 1TP9A 4PNGA 3UMAA 3O76A 3RDWA 2KP2A 5IMVA 1X5CA 4LLRA 3MYDA 1TKDB 1QXHA 1GUMA 1EP7A 5G1KA 4IP1A 4OFMA 1SD9A 1ZYNA 1GRXA 1SD8A 1F9MA 5IPGA 4ZBAA 3WT1A 4RQXA 1PQNA 3L78A 2HRKA 4WBJA 2PVQA 3FKFA 1GSQA 2CVBA 2V32A 1TDIA 4D73A 1Z5YE 3LXZA 2C80A 3V1WA 3QCPA 3TKSE 3EINA 3F8UA 3GSTA 2DIYA 2B1KA 1WOUA 1MDJA 1FW1A 5F07A 5H5SA 2LQOA 4CY6A 4N10A 1NM3A 3UARA 3GRXA 2X8HA 3FK8A 16GSA 5C04A 4CHSA 1DUGA 4L0WA 2R0CA 3QOUA 1T4YA 3IPZA 4HQSA 4G9HA 4EF0A 3O3TA 3DIEA 4ID0A 4RUVA 2A2SA 4POLA 3IR4A 1Z7PA 4XRDA 1XFLA 1K0OA 3J7Yb 4HU9A 4FYUA 4DSSB 12GSA 1JFUA 2H75A 1ERVA 4E8EA 5IOXA 3W8SA 2DMMA 4G19A 2FY6A 1T7PB 3C8EA 3F0IA 3IV4A 5DJLA 4MF7A 2P31A 5CP1A 1A2MA 4I8BA 1TJDA 2DC5A 1BQ7A 5JCGA 4EVMA 2J23A 3WGDA 1SKWB 4IJ3A 4JEDA 3EURA 2V6OA 1F6MC 3F4TA 3CMIA 1GUHA 2WCIA 3WGEA 2Z9SA 2RUEA 5AIVA 2K8VA 2VCVA 3MIXA 4AF2A 5CRDA 1HQOA 2JZSA 3HXSA 1O8WA 1FHEA 4CY8A 1F3AA 1GSEA 2YANA 4NAXA 3FZ5A 4YKGA 4KB3A 4GTUA 3K8NA 4RQRA 3D21A 4Z2RA 6GSYA 1WE0A 5ECRB 1V98A 3L4NA 4KA0A 2LTKA 2NPBA 2CQ9A 3PR8A 4K1FA 3QR6A 1XWGA 2C3QA 4G0KA 1IYHA 2ZNMA 2JL4A 3LSZA 1N2AA 4ILFA 4PGTA 2R5GA 3ZTLA 2LJAA 3A3TA 4BL7B 3HYPA 2DSAA 4XS4B 3WT2A 1SK0A 1OC8A 14GSA 3ZVJD 2H8LA 5ELGA 3I9V2 1ML6A 1A0RP 2ALBA 3F6DA 4KDXA 1GSYA 1KTEA 2X8CA 2GLRA 4BA7A 5B8AA 4WETA 1UC7A 3TKRA 4A5PA 4MJAA 1XPVA 2H66A 3TB2A 11GSA 4MPFA 1AXDA 5CYYA 3I69A 4MPGA 1YJ6A 1B8XA 3H4KA 5G5EA 5D9TA 2MMOA 3RAZA 3QPMA 4KCEA 4KH7A 4IP6A 4IGJA 4N30A 1PMTA 3ZFLA 3RBTA 1OE7A 2OE3A 1XVQA 1PX6A 1TXXA 1YDKA 4J56E 1K0NA 4ICYA 1U88A 2O87A 1K0BA 2X49A 3TGZA 1EWXA 1XBSA 2BMXA 2XPEA 1PD21 2EIQA 2WB9A 4K7OA 4JR4A 1M2AA 4HJ2A 5F06A 2CT6A 1TRSA 4DSSA 2IIYA 2O89A 1KNGA 3NIVA 1K3YA 1SK2A 2IFQA 5ECMB 2YWMA 3G9BA 3D5JA 2VCZA 2GZPA 2OE0A 2XBIA 5ECOB 2TIRA 3CTFA 3UAPA 3CXGA 3HJOA 2VLUA 4MA9A 3FR9A 2L57A 4XIHA 1EGRA 2OADA 3ISOA 9GSSA 2GS3A 1URMA 1K0DA 4BVXB 3APOA 2I3YA 2C3TA 1SL0B 1O85A 1Z3EA 1O6JA 5INYA 1PGTA 4G0LA 1EP8A 1FB6A 4X1UA 3GUSA 2HZEB 4GF0A 2CA8A 4L0UA 3FZ9A 1G6WA 4F03A 2V2GA 2OACA 1R5AA 1AUCA 4YAVA 1Q4JA 1X9WB 3F4SA 4XCSA 1QUWA 2C1YA 2H1DA 1GSFA 4PX1A 4V1Ag 4NWYA 2PUKC 5DDLA 4V2LA 2OBKA 3TOTA 1UVZA 2MMNA 3EU4A 2RUFA 4CW9A 1OYJA 4G10A 1U3IA 3TCOA 1A8LA 1U87A 3UJ1A 5ID2B 2AUVA 1EOHA 1V57A 4DSRA 2M80A 4BL7A 3KCMA 3LQ7A 3ZMKA 4MF5A 2REMA 4XS4A 5CAXA 2H6ZA 3VWUA 2HE3A 3TUEA 4Q5RA 4HOJA 5IMCA 2JZRA 1SJZA 1JHBA 1I9DA 2CX3A 2IN3A 2YV9A 4O5RA 3VI5A 2XPDA 4JRRA 5DVBA 1XOAA 2EC4A 5COHA 3G7YA 5EVOA 4WEYA 1B4PA 4NHZA 4KSOA 5IIZA 2WRTA 1Y6EA 3APQA 4TR3A 2NTOA 2VM2A 1HNAA 2ZUPA 4K0NA 6GSVA 2B6MA 3LXTA 3TOUA 3BBYA 1BX9A 5KN0A 4D73B 1XVWA 1A2LA 4TW5A 5IM9A 4HJMA 5AISA 5F8BA 3D22A 3UIWA 2VL2A 1TI3A 1B9YC 1K3LA 2J9HA 2FWEA 2IL3A 2LNTA 4KDYA 4K9ZA 3P7XA 4USSA 2NDOA 2C0DA 1PRXA 2DKIA 5D93A 4BPYA 5IMAA 5D9WA 2L5LA 2C0EA 1QMVA 2LKUA 4BWSA 3IA1A 4Q5QA 3ZFBA 1J9BA 1EEJA 2R6KA 2LRNA 1GLQA 4O7HA 3LGCA 3KJYA 3O6TA 1XWAA 2H19A 4PUFC 1XZOA 2WGRA 5ECPB 5LD0A 3ZYWA 3DMLA 4K7IA 3ZVJA 4BVXA 2H74A 5E4WA 3D4TA 1PKWA 3GKKA 2XC2A 3GHAA 1OKDA 3CYNA 4HS1A 5DCGA 4FH8A 3ERWA 2HZEA 5A4UA 1H75A 4NV5A 5HFIA 2JADA 3A5IA 4MZWA 1MEKA 1YQ1A 2LRTA 4BVYB 2FA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBP A;  5DQY A;  13GS A;  4HZ4 A;  3M3M A;  1WIK A;  4NMU A;  1M2B A;  1XW5 A;  2H71 A;  1ERU A;  5DAK B;  5GZZ B;  4V2N A;  1X5E A;  4L5O A;  5KN2 A;  2P0G A;  4IQA A;  1TI1 A;  4NPB A;  5L71 A;  5ID2 A;  3DXB A;  3DKS A;  4MJE A;  2VD0 A;  2CZ2 A;  6GST A;  2LRC A;  1T1V A;  3D4M A;  3E0U A;  2E2M A;  3GH6 A;  2DJ1 A;  4TXV A;  4EO3 A;  4DVC A;  3N9J A;  3GIX A;  4JZQ A;  5IQY A;  5CRE A;  2R37 A;  2B1L A;  2PPT A;  2VOC A;  3A2V A;  2PVO C;  4OO4 A;  4MDC A;  3ME7 A;  5B6M A;  1GH2 A;  1A24 A;  1ZOF A;  4HEA 2;  4I2T A;  1PSQ A;  1DE2 A;  2YWI A;  4LL1 B;  5ELA A;  1Y25 A;  5D73 A;  1X9S B;  1G6Y A;  3DD3 A;  4DSQ A;  1GSD A;  2M72 A;  4WR5 A;  3W6G A;  2IMD A;  4XS1 A;  2LEG A;  4MZB A;  2LUS A;  4TKY A;  3QMX A;  3KH7 A;  1TTZ A;  3IHQ A;  1NSW A;  2EIR A;  4EUY A;  3RPN A;  1A2J A;  4ECC A;  4AJ8 A;  4AGS A;  1GUL A;  1EZK A;  3HD5 A;  1JZR A;  3ME8 A;  1ABA A;  1GUK A;  3EMP A;  4QQ7 A;  5CNW A;  3HZ8 A;  1FVK A;  1RW1 A;  1SJ6 A;  2IMI A;  3MAK A;  1WWJ A;  3CRU A;  4MH2 A;  2CAQ A;  5ENU A;  4GQC A;  3GX8 A;  1SYR A;  2LV3 A;  3KTL A;  3QD9 A;  2PMT A;  2P5R A;  1EGO A;  2PBJ A;  4WKW A;  2YJH A;  2IFQ B;  2DJ3 A;  4YQM A;  5ABR A;  3F63 A;  1X9M B;  2F8A A;  3F9U A;  4J2F A;  2DIZ A;  3VK9 A;  3H1N A;  1EOG A;  3HKR A;  1T4Z A;  2WFC A;  1SL1 B;  1SK1 A;  2GZY A;  4IJI A;  1SU9 A;  4BVY A;  1OAZ A;  1HD2 A;  2FLS A;  4MMM A;  2K18 A;  3CTG A;  4KW6 A;  1XCC A;  2F8F A;  1B48 A;  4P3Y B;  1A23 A;  3Q19 A;  3A2W A;  1UN2 A;  1A0F A;  2GTU A;  5EY6 A;  1SL2 B;  2GZZ A;  5DAK A;  4N11 A;  2VCT A;  2GVP A;  2H73 A;  3D6I A;  4OFT A;  1HNC A;  1A8Y A;  3P2A A;  2L6D A;  1JZD A;  3GSS A;  4ECI A;  2VD1 A;  3KMO A;  3JCM L;  1M7T A;  2ON5 A;  1J0F A;  1S3C A;  1O7U A;  1X5D A;  4ECB A;  4WR4 A;  2H0I A;  4Q5N A;  3UBK A;  2YWO A;  5D9V A;  1Z6M A;  1VF3 A;  1GTB A;  3IDV A;  4I5Q A;  4TR0 A;  1TK8 B;  2GSS A;  1SEN A;  2HRF A;  1AQX A;  2YNX A;  1XIY A;  1AIU A;  5GSS A;  1AAZ A;  1XW6 A;  3IRA A;  2FD3 A;  4HZ2 A;  3TJF A;  5EPF A;  3QFB C;  2VIM A;  5HQP A;  1Q98 A;  2A2R A;  1HNB A;  1YKC A;  2E2G A;  5HR2 A;  1ZCP A;  5DQS A;  1T8E B;  1VGL A;  3ED3 A;  1M9B A;  1LJR A;  5G31 A;  4N0Z A;  3Q18 A;  3RHC A;  4TVE A;  3BOA A;  4AJ7 A;  1KBN A;  2WZ9 A;  2H0G A;  3KH9 A;  3GMF A;  4TR4 A;  4MAB A;  3LFL A;  4LMV A;  2AAW A;  4QL7 A;  2YZH A;  2YOI A;  3VUR A;  1OC9 B;  2OKA A;  3N5O A;  4PUR A;  4MH3 A;  4ZL9 A;  4TXO B;  1Z7R A;  2OE1 A;  2IJY A;  2DJ2 A;  5ECI B;  4LL4 B;  5A5K A;  5IPH A;  2YJ7 A;  1J08 A;  2YP6 A;  2KLX A;  2NBS A;  2HYX A;  3ERF A;  3I6A A;  2WS2 A;  3SWL A;  4POK A;  3OR5 A;  1PL2 A;  2X99 A;  3HJP A;  4LA1 A;  2H1B A;  2PER A;  4NHW A;  2WJU A;  8GSS A;  4DEJ A;  3ZRD A;  1SKS B;  3LG6 A;  3ZIJ A;  4XS6 A;  2DJK A;  4OMV A;  1HYU A;  2K9F A;  2JAC A;  2PWJ A;  3GTU A;  2VL9 A;  4TR1 B;  1Z9H A;  3GKM A;  3GH9 A;  2QC7 A;  3FY7 A;  5IO2 A;  2VM1 A;  2LJR A;  1XOB A;  2QKE A;  1M2D A;  1R7H A;  4KDU A;  3QAW A;  3Q6O A;  3LYK A;  3NZN A;  1XWK A;  1GSU A;  2H1A A;  3ZRE A;  5AGY A;  1SYX A;  1VF1 A;  2VAF A;  4KCA A;  4ZBD A;  2GQK A;  1ST9 A;  3C7M A;  2GQL A;  5H5Q A;  2P5Q A;  2XHF A;  4HU7 A;  5G30 A;  1YF0 A;  1QK8 A;  2OBI A;  2QGV A;  2BJX A;  2VCX A;  2YN1 A;  3HZ4 A;  2O7K A;  2HT9 A;  3DEX A;  1G7O A;  1K3O A;  2AB6 A;  2LST A;  5CRW A;  2CVD A;  2VO4 A;  3C71 A;  3GYK A;  1DBY A;  5ECH B;  3G7J A;  2AYT A;  3KP8 A;  1WPI A;  2GT5 A;  3HY2 A;  3HVV A;  4ISD A;  4JU5 A;  4ZBB A;  3UL3 A;  1GSS A;  4TN8 A;  3L9U A;  4F0B A;  2DML A;  3J7Y k;  4RI7 A;  1TOF A;  2HZF A;  2GGT A;  2H72 A;  5JWQ B;  2CZ3 A;  3LJR A;  3TJG A;  1TK0 B;  5HR1 A;  7GSS A;  1ON4 A;  1K0M A;  1FB0 A;  2HSH A;  2VLV A;  5KN1 A;  4TOP A;  3P90 A;  6GSS A;  3A2X A;  2VCQ A;  3CRT A;  5J9B A;  2FHE A;  5IMD A;  3F4R A;  2FGX A;  3TJB A;  2L4C A;  1OC9 A;  3E9J B;  3PGT A;  5HR0 A;  4TXO A;  4K0G A;  2B5Y A;  3VPQ A;  4MCU A;  2KOK A;  1OVN A;  2VL2 C;  4POM A;  3DGQ A;  3LWA A;  22GS A;  1EEM A;  2H30 A;  1OC3 A;  4EKZ A;  4KAE A;  4O92 A;  1Z6N A;  3IE3 A;  2V41 A;  1T00 A;  4EDY A;  1RK4 A;  4GQF A;  4PNF A;  2CAI A;  2B5E A;  2VLT A;  2CX4 A;  2RLI A;  2LNS A;  5HR3 A;  2E0Q A;  3CSJ A;  2C0G A;  4WF4 A;  2H76 A;  3G7I A;  1AC1 A;  2YZU A;  4ACS A;  5GAP D;  3M9J A;  1GLP A;  3BJ5 A;  1F37 A;  4FYB A;  4TR1 A;  2G2Q A;  3S9F A;  4IN0 A;  5DAL A;  5DBQ A;  5FHI A;  3GN3 A;  3HVS A;  4K8M A;  4KGI A;  2TRC P;  3WYW A;  3M0F A;  3TRQ A;  1YEP A;  2B7J A;  4PXO A;  5FT3 A;  2H70 A;  3F6F A;  1GL8 A;  4HUA A;  1F3B A;  3C1S A;  5D96 A;  5B7C A;  1AQW A;  2B7K A;  3ZIT A;  2IMF A;  3U6V A;  5EL8 A;  3KTB A;  5A4W A;  1S3D A;  3UBL A;  2CV4 A;  3H8Q A;  4WBR D;  2LQQ A;  1W89 A;  2ES7 A;  2HRN A;  2F9S A;  2YCD A;  3FEU A;  2MYG A;  2L6C A;  4HI7 A;  3AY8 A;  3FYG A;  2FCH A;  1ZYE A;  3TKP A;  1XXU A;  1BJX A;  1GNE A;  3VFI A;  3A5W A;  4JE1 A;  4CDO A;  1SJI A;  1AQV A;  3DVX A;  3F3Q A;  3RPP A;  1ZGN A;  3QAG A;  4FIW A;  2L59 A;  1YKA A;  1FO5 A;  4ZIJ A;  3DYR A;  4I2U A;  2WUL A;  3GA4 A;  1LU4 A;  4E8H A;  3FR3 A;  2I1U A;  1UA5 A;  2R4V A;  4KUN A;  3FRC A;  2HFD A;  4BWQ A;  3NOF A;  5F0G A;  1B4Q A;  4F9Z A;  1SKR B;  5JCW A;  4F0C A;  3ZIV A;  1I5G A;  2BTO T;  2D2Z A;  4IS0 A;  2IPA A;  5J9C A;  1MD4 A;  1X0R A;  5HFK A;  4XTS A;  5C00 A;  4GSN A;  2F3M A;  3IK7 A;  1MD3 A;  1IYI A;  1VRS D;  4ML6 A;  2B3S A;  1DE1 A;  1CQH A;  1LBK A;  5LCZ A;  1TK5 B;  4GST A;  3TJJ A;  3GL5 A;  3MWH A;  3EWL A;  4K2D A;  3VI7 A;  4O32 A;  3IXR A;  3VPT A;  2MZC A;  1E6B A;  2NVL A;  4NV2 A;  4AJ6 A;  4GRF A;  3TRP A;  2VL3 A;  3F3R A;  1OKT A;  1K0A A;  2FA8 A;  1FVJ A;  2JSY A;  4PUA A;  4XRA A;  1G0T A;  1QQ2 A;  1PN9 A;  3GKN A;  1R26 A;  2TRX A;  3IAM 2;  3IAS 2;  4L8E A;  5AIX A;  2GT6 A;  1TRU A;  5DJM A;  4OCE A;  2JSZ A;  5D8I A;  1ERW A;  1DSB A;  1PKZ A;  3DVW A;  4EDZ A;  1KEB A;  4Z7X A;  5J3R A;  1E2Y A;  2I4A A;  1GTI A;  1NW2 A;  3EC3 A;  3GTU B;  5J41 A;  5F05 A;  1NHY A;  2L5O A;  5GST A;  1BYE A;  1FAA A;  4X43 A;  1BED A;  3US3 A;  1THX A;  2H1G A;  3EE2 A;  4HQZ A;  3U5R E;  2AHE A;  4IQ1 A;  1GTA A;  1FOV A;  1CQG A;  1PA3 A;  1RQM A;  17GS A;  3QDN A;  4V1A p;  2DJ0 A;  1G7E A;  2C4J A;  2MBS A;  1PL1 A;  1V9W A;  1BG5 A;  3GX0 A;  4ZL8 A;  4NXI A;  4WXT A;  4YH2 A;  3PH9 A;  4KSM A;  4L5L A;  2CVK A;  3BCI A;  1MTC A;  2FWG A;  5IO0 A;  3CBU A;  2L4Q A;  2F51 A;  2C8U A;  5ECL B;  5G5F A;  4IW9 A;  3L0H A;  3KM6 A;  4EC0 A;  3MNG A;  2HI7 A;  2VUP A;  3DRN A;  1JZW A;  1AW9 A;  5CO3 A;  5B8B A;  4FYC A;  4KX4 A;  4GLT A;  2IWT A;  1M99 A;  4N0V A;  2V1M A;  3ZZX A;  1WP0 A;  2B5X A;  4K7N A;  1R4W A;  1ERT A;  1FG4 A;  4H86 A;  5DCH A;  6GSX A;  1THO A;  3UVH A;  2K8S A;  4POB A;  4IVF A;  1TU8 A;  4OFN A;  2FUG 2;  3VLN A;  6GSW A;  3M1G A;  3UOM A;  1M9A A;  2YV7 A;  4OCF A;  3BD2 A;  1V2A A;  4YQV A;  1JLV A;  1T3B A;  5JWO B;  2AJQ B;  1JLW A;  1W4V A;  4MP4 A;  3C1R A;  3I43 A;  2VCW A;  3KZQ A;  2AV4 A;  2N5F A;  2M46 A;  2LJK A;  1YZX A;  5B6N A;  4MJB A;  3GL3 A;  3M9K A;  5ECK B;  4JBB A;  2N5A A;  2A4V A;  4F2I A;  2MMZ A;  3HCZ A;  4LMW A;  2JU5 A;  3HVX A;  2X8G A;  4PQI A;  3GFK A;  2I9H A;  3L9S A;  1TRV A;  3EU3 A;  1VF2 A;  1VF4 A;  2RM5 A;  1GP1 A;  2PGT A;  3H79 A;  2LS5 A;  1H4O A;  3IK9 A;  3TJK A;  2DJJ A;  1PX7 A;  4ZB8 A;  3KGK A;  5DAL B;  3FW2 A;  3KD0 A;  10GS A;  3KMN A;  3LOR A;  4GCI A;  4IKH A;  1C72 A;  4OWY A;  3UEM A;  3DWV A;  3TKQ A;  4MZC A;  4ZB9 A;  3MDK A;  4ZIL A;  2C0F A;  5ECQ B;  4JR6 A;  3TKS C;  3KP9 A;  2HNL A;  20GS A;  3TKS A;  1ZZY A;  2FWH A;  3GNJ A;  4ECJ A;  1B9X C;  1MDI A;  1ZL9 A;  5H5R A;  4KND A;  3QAV A;  2V6K A;  4YQU A;  5FWG A;  5A4V A;  3ZLP A;  4IEL A;  1V58 A;  3P8W A;  4MK3 A;  3C73 A;  2QSI A;  2FWF A;  1TRW A;  3LYP A;  1YEX A;  2XBQ A;  3HJM A;  3EMX A;  4TRX A;  3GV1 A;  1XWB A;  2HSY A;  4MLY A;  2IME A;  2KHP A;  5IMF A;  1F2E A;  1GTU A;  1ZMA A;  3D0Z A;  2K6V A;  2O8V B;  3GUR A;  4GWR A;  4PQH A;  2X64 A;  3L9V A;  3H93 A;  4MF6 A;  2EIO A;  1OE8 A;  1EV4 A;  1R5P A;  2H01 A;  2I81 A;  1QFN A;  1U6T A;  1U3A A;  3WD6 A;  3WGX A;  1WMJ A;  18GS A;  1JZO A;  2GDR A;  5J5N A;  1K0C A;  4WF5 A;  1WRY A;  1WJK A;  4Q5F A;  5CRH A;  1NHO A;  4KE3 A;  2R2J A;  5JCU A;  1XW9 A;  2RM6 A;  3Q74 A;  3TRX A;  3GKX A;  2OA7 A;  2ZCT A;  2GSR A;  1QGV A;  2H6X A;  1EV9 A;  1TW9 A;  6GSU A;  1S3A A;  2N5B A;  4PQ1 A;  5J4U A;  1YF1 A;  3R2Q A;  1MDK A;  2DBC A;  3IBH A;  4OD7 A;  5E59 A;  3CSI A;  2WDU A;  19GS A;  3LEF A;  2RII A;  3FZA A;  2O85 A;  3BCK A;  5JWR B;  1N8J A;  5ECS A;  1BAY A;  4EL1 A;  3APS A;  1XWC A;  1ILO A;  3RHB A;  3EVI A;  2PU9 C;  4IHU A;  3FR6 A;  3ZL5 A;  5IMZ A;  2R3X A;  4V2M A;  4ZL7 A;  3E3E A;  3ERG A;  2G0F A;  3VWV A;  2H0H A;  4ZXG A;  5D9X A;  1O81 A;  4J57 E;  2DLX A;  4K6X A;  3UVT A;  5IOW A;  3HA9 A;  3HHV A;  3SBC A;  2GQM A;  2MMA A;  4ULX A;  2YPM A;  4G2E A;  5ECN B;  2FNO A;  4X0X A;  1TU7 A;  3FHK A;  4XHM A;  2H6Y A;  2ON7 A;  3IC4 A;  4F82 A;  2KP1 A;  1V40 A;  2HLS A;  4I6X A;  1O73 A;  3KIJ A;  3ZML A;  1USB A;  3VWW A;  2MBT A;  2IMK A;  1YY7 A;  4QL9 A;  4EXJ A;  4I97 A;  4OO5 A;  1GWC A;  4ML1 A;  4GSS A;  5CRG A;  5G1L A;  5KN3 A;  2OJL A;  2KUC A;  2YWN A;  1ZYQ B;  1O8X A;  2PN8 A;  3FZ4 A;  2JZT A;  2GST A;  4EE0 A;  4GXZ A;  3KXO A;  5HFG A;  3TDG A;  5KEJ A;  3VWX A;  5G2Z A;  1GNW A;  4YAP A;  5GAN D;  3EYT A;  4ZB6 A;  3CSH A;  4MJC A;  3MSZ A;  3KEB A;  2GSQ A;  3HDC A;  2C3N A;  5AN1 A;  2E7P A;  4HDE A;  4RI6 A;  3QFA C;  1M0U A;  4FO5 A;  3W8J A;  3PIN A;  3M8N A;  1ACV A;  2HXK A;  3IOS A;  5LNK e;  1TP9 A;  4PNG A;  3UMA A;  3O76 A;  3RDW A;  2KP2 A;  5IMV A;  1X5C A;  4LLR A;  1TKD B;  1QXH A;  1GUM A;  1EP7 A;  5G1K A;  4IP1 A;  4OFM A;  1SD9 A;  1GRX A;  1SD8 A;  1F9M A;  5IPG A;  4ZBA A;  3WT1 A;  4RQX A;  1PQN A;  3L78 A;  4WBJ A;  2PVQ A;  3FKF A;  1GSQ A;  2CVB A;  2V32 A;  1TDI A;  4D73 A;  1Z5Y E;  3LXZ A;  2C80 A;  3V1W A;  3QCP A;  3TKS E;  3EIN A;  3F8U A;  3GST A;  2DIY A;  2B1K A;  1WOU A;  1MDJ A;  1FW1 A;  5F07 A;  5H5S A;  2LQO A;  4N10 A;  1NM3 A;  3UAR A;  3GRX A;  2X8H A;  3FK8 A;  16GS A;  5C04 A;  4CHS A;  1DUG A;  4L0W A;  3QOU A;  1T4Y A;  3IPZ A;  4HQS A;  4G9H A;  4EF0 A;  3O3T A;  3DIE A;  4ID0 A;  4RUV A;  2A2S A;  4POL A;  3IR4 A;  1Z7P A;  4XRD A;  1XFL A;  1K0O A;  3J7Y b;  4HU9 A;  4FYU A;  4DSS B;  12GS A;  1JFU A;  2H75 A;  1ERV A;  4E8E A;  5IOX A;  3W8S A;  2DMM A;  4G19 A;  2FY6 A;  1T7P B;  3C8E A;  3F0I A;  3IV4 A;  5DJL A;  4MF7 A;  2P31 A;  5CP1 A;  1A2M A;  4I8B A;  1TJD A;  2DC5 A;  1BQ7 A;  5JCG A;  4EVM A;  2J23 A;  3WGD A;  1SKW B;  4IJ3 A;  4JED A;  3EUR A;  2V6O A;  1F6M C;  3F4T A;  3CMI A;  1GUH A;  2WCI A;  3WGE A;  2Z9S A;  2RUE A;  5AIV A;  2K8V A;  2VCV A;  4AF2 A;  5CRD A;  1HQO A;  2JZS A;  3HXS A;  1O8W A;  1FHE A;  1F3A A;  1GSE A;  2YAN A;  4NAX A;  3FZ5 A;  4KB3 A;  4GTU A;  3K8N A;  4RQR A;  3D21 A;  6GSY A;  1WE0 A;  5ECR B;  1V98 A;  3L4N A;  4KA0 A;  2LTK A;  2NPB A;  2CQ9 A;  3PR8 A;  4K1F A;  3QR6 A;  1XWG A;  2C3Q A;  1IYH A;  2ZNM A;  2JL4 A;  3LSZ A;  1N2A A;  4ILF A;  4PGT A;  2R5G A;  3ZTL A;  2LJA A;  3A3T A;  3HYP A;  2DSA A;  4XS4 B;  3WT2 A;  1SK0 A;  1OC8 A;  14GS A;  3ZVJ D;  2H8L A;  5ELG A;  3I9V 2;  1ML6 A;  1A0R P;  2ALB A;  3F6D A;  4KDX A;  1GSY A;  1KTE A;  2X8C A;  2GLR A;  4BA7 A;  5B8A A;  4WET A;  1UC7 A;  3TKR A;  4MJA A;  1XPV A;  2H66 A;  3TB2 A;  11GS A;  4MPF A;  1AXD A;  5CYY A;  3I69 A;  4MPG A;  1YJ6 A;  1B8X A;  3H4K A;  5G5E A;  5D9T A;  2MMO A;  3RAZ A;  3QPM A;  4KCE A;  4KH7 A;  4IP6 A;  4IGJ A;  4N30 A;  1PMT A;  3ZFL A;  3RBT A;  1OE7 A;  2OE3 A;  1XVQ A;  1PX6 A;  1TXX A;  1YDK A;  4J56 E;  1K0N A;  1U88 A;  2O87 A;  1K0B A;  3TGZ A;  1EWX A;  1XBS A;  2BMX A;  2XPE A;  1PD2 1;  2EIQ A;  2WB9 A;  4K7O A;  4JR4 A;  1M2A A;  4HJ2 A;  5F06 A;  2CT6 A;  1TRS A;  4DSS A;  2IIY A;  2O89 A;  1KNG A;  3NIV A;  1K3Y A;  1SK2 A;  2IFQ A;  5ECM B;  2YWM A;  3G9B A;  3D5J A;  2VCZ A;  2GZP A;  2OE0 A;  2XBI A;  5ECO B;  2TIR A;  3CTF A;  3UAP A;  3CXG A;  3HJO A;  2VLU A;  4MA9 A;  3FR9 A;  2L57 A;  4XIH A;  1EGR A;  2OAD A;  3ISO A;  9GSS A;  2GS3 A;  1URM A;  1K0D A;  3APO A;  2I3Y A;  2C3T A;  1SL0 B;  1O85 A;  1Z3E A;  1O6J A;  5INY A;  1PGT A;  1EP8 A;  1FB6 A;  4X1U A;  3GUS A;  2HZE B;  4GF0 A;  2CA8 A;  4L0U A;  3FZ9 A;  1G6W A;  4F03 A;  2V2G A;  2OAC A;  1R5A A;  1AUC A;  4YAV A;  1Q4J A;  1X9W B;  3F4S A;  4XCS A;  1QUW A;  2C1Y A;  2H1D A;  1GSF A;  4PX1 A;  4V1A g;  4NWY A;  2PUK C;  5DDL A;  4V2L A;  2OBK A;  3TOT A;  1UVZ A;  2MMN A;  3EU4 A;  2RUF A;  4CW9 A;  1OYJ A;  4G10 A;  1U3I A;  3TCO A;  1A8L A;  1U87 A;  3UJ1 A;  5ID2 B;  2AUV A;  1EOH A;  1V57 A;  4DSR A;  2M80 A;  4BL7 A;  3KCM A;  3LQ7 A;  3ZMK A;  4MF5 A;  2REM A;  4XS4 A;  5CAX A;  2H6Z A;  3VWU A;  2HE3 A;  3TUE A;  4Q5R A;  4HOJ A;  5IMC A;  2JZR A;  1SJZ A;  1JHB A;  1I9D A;  2CX3 A;  2IN3 A;  2YV9 A;  4O5R A;  3VI5 A;  2XPD A;  4JRR A;  5DVB A;  1XOA A;  2EC4 A;  5COH A;  3G7Y A;  5EVO A;  4WEY A;  1B4P A;  4NHZ A;  4KSO A;  5IIZ A;  2WRT A;  1Y6E A;  3APQ A;  4TR3 A;  2NTO A;  2VM2 A;  1HNA A;  2ZUP A;  4K0N A;  6GSV A;  2B6M A;  3LXT A;  3TOU A;  3BBY A;  1BX9 A;  5KN0 A;  4D73 B;  1XVW A;  1A2L A;  4TW5 A;  5IM9 A;  4HJM A;  5AIS A;  5F8B A;  3D22 A;  3UIW A;  2VL2 A;  1TI3 A;  1B9Y C;  1K3L A;  2J9H A;  2FWE A;  2IL3 A;  2LNT A;  4KDY A;  4K9Z A;  3P7X A;  2NDO A;  2C0D A;  1PRX A;  4BPY A;  5D93 A;  5IMA A;  5D9W A;  2L5L A;  2C0E A;  1QMV A;  2LKU A;  4BWS A;  3IA1 A;  4Q5Q A;  3ZFB A;  1J9B A;  1EEJ A;  2R6K A;  2LRN A;  1GLQ A;  4O7H A;  3LGC A;  3KJY A;  3O6T A;  1XWA A;  2H19 A;  4PUF C;  1XZO A;  2WGR A;  5ECP B;  5LD0 A;  3ZYW A;  3DML A;  4K7I A;  3ZVJ A;  4BVX A;  2H74 A;  5E4W A;  3D4T A;  1PKW A;  3GKK A;  2XC2 A;  3GHA A;  1OKD A;  3CYN A;  4HS1 A;  5DCG A;  4FH8 A;  3ERW A;  2HZE A;  5A4U A;  1H75 A;  4NV5 A;  5HFI A;  2JAD A;  4MZW A;  1MEK A;  1YQ1 A;  2LRT A;  2FA4 A; 
#chains in the Genus database with same CATH topology
 4IBP A;  5DQY A;  13GS A;  4HZ4 A;  3M3M A;  1WIK A;  4NMU A;  1M2B A;  1XW5 A;  2H71 A;  1ERU A;  5DAK B;  5GZZ B;  4V2N A;  1X5E A;  4L5O A;  5KN2 A;  2P0G A;  4IQA A;  1TI1 A;  4NPB A;  5L71 A;  5ID2 A;  3DXB A;  3DKS A;  4MJE A;  2VD0 A;  2CZ2 A;  6GST A;  2LRC A;  1T1V A;  3D4M A;  3E0U A;  2E2M A;  3GH6 A;  2DJ1 A;  4TXV A;  4EO3 A;  4DVC A;  3N9J A;  3GIX A;  4JZQ A;  5IQY A;  3EPT A;  5CRE A;  2R37 A;  2B1L A;  2PPT A;  2VOC A;  3A2V A;  2PVO C;  4OO4 A;  4MDC A;  3ME7 A;  5B6M A;  1GH2 A;  1A24 A;  1ZOF A;  4HEA 2;  4I2T A;  1PSQ A;  3LW9 A;  1DE2 A;  2YWI A;  4LL1 B;  5ELA A;  1Y25 A;  5D73 A;  1X9S B;  1G6Y A;  3DD3 A;  4DSQ A;  1GSD A;  2M72 A;  1PN0 A;  4WR5 A;  3W6G A;  2IMD A;  1XG8 A;  4XS1 A;  2LEG A;  4MZB A;  2LUS A;  4TKY A;  3QMX A;  3KH7 A;  1TTZ A;  3IHQ A;  1NSW A;  2EIR A;  4EUY A;  3RPN A;  1A2J A;  4ECC A;  4AJ8 A;  4AGS A;  1GUL A;  1EZK A;  3HD5 A;  1JZR A;  3ME8 A;  1ABA A;  1GUK A;  3EMP A;  4QQ7 A;  5CNW A;  3HZ8 A;  1FVK A;  1RW1 A;  1SJ6 A;  2IMI A;  3MAK A;  1WWJ A;  3CRU A;  4MH2 A;  2CAQ A;  5ENU A;  4GQC A;  3GX8 A;  1SYR A;  2LV3 A;  3KTL A;  3QD9 A;  2PMT A;  2P5R A;  1EGO A;  2PBJ A;  4WKW A;  5KOW A;  2YJH A;  2IFQ B;  2DJ3 A;  4YQM A;  5ABR A;  3F63 A;  1X9M B;  2F8A A;  3F9U A;  4J2F A;  2DIZ A;  3VK9 A;  3H1N A;  1EOG A;  3HKR A;  1T4Z A;  2WFC A;  1SL1 B;  1SK1 A;  2GZY A;  4IJI A;  1SU9 A;  4BVY A;  4MNN A;  1OAZ A;  1HD2 A;  2FLS A;  4MMM A;  2K18 A;  3CTG A;  4KW6 A;  1XCC A;  4K2X A;  2F8F A;  1B48 A;  4P3Y B;  1A23 A;  3Q19 A;  3A2W A;  1UN2 A;  1A0F A;  2GTU A;  5EY6 A;  1SL2 B;  2GZZ A;  5DAK A;  4N11 A;  5KOX A;  2VCT A;  2GVP A;  2H73 A;  3D6I A;  4K5R A;  4OFT A;  1HNC A;  1A8Y A;  3P2A A;  2L6D A;  1JZD A;  3GSS A;  4ECI A;  2VD1 A;  3KMO A;  3JCM L;  1M7T A;  2ON5 A;  1J0F A;  1S3C A;  1O7U A;  1X5D A;  4ECB A;  4WR4 A;  2H0I A;  4Q5N A;  3UBK A;  2YWO A;  5D9V A;  1Z6M A;  1VF3 A;  1GTB A;  3IDV A;  4I5Q A;  4TR0 A;  1TK8 B;  2GSS A;  1SEN A;  2HRF A;  1AQX A;  2YNX A;  1XIY A;  1AIU A;  5GSS A;  1AAZ A;  1XW6 A;  3IRA A;  2FD3 A;  4HZ2 A;  3TJF A;  5EPF A;  3QFB C;  2VIM A;  5HQP A;  1Q98 A;  2A2R A;  1HNB A;  1YKC A;  2E2G A;  5HR2 A;  1ZCP A;  5DQS A;  1T8E B;  1VGL A;  3ED3 A;  1M9B A;  1LJR A;  5G31 A;  4N0Z A;  3Q18 A;  3RHC A;  4TVE A;  3BOA A;  4AJ7 A;  1KBN A;  2WZ9 A;  2H0G A;  3KH9 A;  3GMF A;  4TR4 A;  4MAB A;  3LFL A;  4LMV A;  2AAW A;  4QL7 A;  2YZH A;  2YOI A;  4G0I A;  3VUR A;  1OC9 B;  2OKA A;  3N5O A;  4PUR A;  4MH3 A;  4ZL9 A;  4TXO B;  1Z7R A;  2OE1 A;  2IJY A;  2DJ2 A;  5ECI B;  4LL4 B;  5A5K A;  5IPH A;  3HVN A;  2YJ7 A;  1J08 A;  2YP6 A;  2KLX A;  2NBS A;  2HYX A;  3ERF A;  3I6A A;  2WS2 A;  3SWL A;  4POK A;  3OR5 A;  1PL2 A;  2X99 A;  3HJP A;  4Z2T A;  2R0P A;  4LA1 A;  2H1B A;  2PER A;  4NHW A;  2WJU A;  8GSS A;  4DEJ A;  3ZRD A;  1SKS B;  3LG6 A;  3ZIJ A;  4XS6 A;  2DJK A;  4OMV A;  1HYU A;  2K9F A;  2JAC A;  2PWJ A;  3GTU A;  2VL9 A;  4TR1 B;  1Z9H A;  3GKM A;  3GH9 A;  2QC7 A;  3FY7 A;  5IO2 A;  2VM1 A;  2LJR A;  4KF9 A;  1XOB A;  2QKE A;  4Z2U A;  1M2D A;  1R7H A;  4KDU A;  4EIQ A;  3QAW A;  3Q6O A;  3LYK A;  3NZN A;  1XWK A;  1GSU A;  2H1A A;  3ZRE A;  5AGY A;  1SYX A;  1VF1 A;  2VAF A;  4KCA A;  4ZBD A;  2GQK A;  1ST9 A;  3C7M A;  2GQL A;  5H5Q A;  2P5Q A;  2XHF A;  4HU7 A;  5G30 A;  1YF0 A;  1QK8 A;  2OBI A;  4FQU A;  2QGV A;  2BJX A;  2VCX A;  2YN1 A;  4YKF A;  2O7K A;  3HZ4 A;  2HT9 A;  3DEX A;  1G7O A;  1K3O A;  2AB6 A;  2LST A;  5CRW A;  2CVD A;  2VO4 A;  3C71 A;  3GYK A;  1DBY A;  5ECH B;  3G7J A;  2AYT A;  3KP8 A;  1WPI A;  2GT5 A;  3HY2 A;  3HVV A;  2A2P A;  4ISD A;  4JU5 A;  4ZBB A;  3UL3 A;  1GSS A;  4TN8 A;  3L9U A;  4F0B A;  2DML A;  3J7Y k;  4RI7 A;  1TOF A;  2HZF A;  2GGT A;  2H72 A;  5JWQ B;  2CZ3 A;  3LJR A;  3TJG A;  1TK0 B;  5HR1 A;  7GSS A;  1ON4 A;  1K0M A;  1FB0 A;  2HSH A;  2VLV A;  5KN1 A;  4TOP A;  3P90 A;  6GSS A;  3A2X A;  2VCQ A;  3CRT A;  5J9B A;  3FMW A;  2FHE A;  5IMD A;  3F4R A;  2FGX A;  3TJB A;  2L4C A;  1OC9 A;  3E9J B;  3PGT A;  5HR0 A;  4TXO A;  4K0G A;  2B5Y A;  3VPQ A;  4MCU A;  2KOK A;  1OVN A;  2VL2 C;  4POM A;  3DGQ A;  3LWA A;  22GS A;  1EEM A;  2H30 A;  1OC3 A;  4EKZ A;  4KAE A;  4O92 A;  1Z6N A;  3IE3 A;  2V41 A;  1T00 A;  4EDY A;  1RK4 A;  4GQF A;  4PNF A;  2CAI A;  2B5E A;  2VLT A;  2CX4 A;  2RLI A;  2LNS A;  5HR3 A;  2E0Q A;  3CSJ A;  2C0G A;  4WF4 A;  2H76 A;  3G7I A;  1AC1 A;  2YZU A;  4ACS A;  5GAP D;  3M9J A;  1GLP A;  3BJ5 A;  1F37 A;  4FYB A;  4TR1 A;  2G2Q A;  3S9F A;  4IN0 A;  5DAL A;  5DBQ A;  5FHI A;  3GN3 A;  3HVS A;  4K8M A;  4KGI A;  2TRC P;  3WYW A;  3M0F A;  3TRQ A;  1YEP A;  2B7J A;  4PXO A;  5FT3 A;  2R0G A;  2H70 A;  5BMU A;  3F6F A;  1GL8 A;  4HUA A;  1F3B A;  3C1S A;  5D96 A;  5B7C A;  1AQW A;  2B7K A;  3ZIT A;  2IMF A;  3U6V A;  5EL8 A;  3KTB A;  5A4W A;  1S3D A;  3UBL A;  2CV4 A;  3H8Q A;  4WBR D;  2LQQ A;  1W89 A;  2ES7 A;  2HRN A;  2F9S A;  2YCD A;  3FEU A;  2MYG A;  2L6C A;  4HI7 A;  3AY8 A;  3FYG A;  2FCH A;  1ZYE A;  3TKP A;  1XXU A;  1BJX A;  1GNE A;  3VFI A;  3A5W A;  4JE1 A;  4CDO A;  1SJI A;  1AQV A;  3DVX A;  3F3Q A;  3RPP A;  1ZGN A;  3QAG A;  4FIW A;  2L59 A;  1YKA A;  1FO5 A;  4ZIJ A;  3DYR A;  4I2U A;  2WUL A;  3GA4 A;  1LU4 A;  4E8H A;  3FR3 A;  2I1U A;  1UA5 A;  2R4V A;  4KUN A;  3FRC A;  2HFD A;  4BWQ A;  3NOF A;  5F0G A;  1B4Q A;  4F9Z A;  1SKR B;  5JCW A;  4F0C A;  3ZIV A;  1I5G A;  2BTO T;  2D2Z A;  4IS0 A;  2IPA A;  5J9C A;  1MD4 A;  1X0R A;  5HFK A;  4XTS A;  5C00 A;  4GSN A;  2F3M A;  3IK7 A;  1MD3 A;  1IYI A;  1VRS D;  4ML6 A;  2B3S A;  1DE1 A;  1CQH A;  1LBK A;  5LCZ A;  1TK5 B;  4GST A;  3TJJ A;  3GL5 A;  3MWH A;  3EWL A;  4K2D A;  3VI7 A;  4O32 A;  3IXR A;  3VPT A;  2MZC A;  1E6B A;  2NVL A;  4NV2 A;  4AJ6 A;  4GRF A;  3TRP A;  2VL3 A;  3F3R A;  1OKT A;  1K0A A;  2FA8 A;  1FVJ A;  2JSY A;  4PUA A;  4XRA A;  1G0T A;  1QQ2 A;  1PN9 A;  3GKN A;  1R26 A;  2TRX A;  3IAM 2;  3IAS 2;  4L8E A;  5AIX A;  2GT6 A;  1TRU A;  5DJM A;  4OCE A;  2JSZ A;  5D8I A;  1ERW A;  1DSB A;  1PKZ A;  3DVW A;  4EDZ A;  1KEB A;  4Z7X A;  5J3R A;  1E2Y A;  2I4A A;  2DKH A;  2HSM A;  1GTI A;  1NW2 A;  3EC3 A;  3GTU B;  5J41 A;  5F05 A;  1NHY A;  2L5O A;  5GST A;  1BYE A;  1FAA A;  4X43 A;  1BED A;  3US3 A;  1THX A;  2H1G A;  3EE2 A;  4HQZ A;  4O5U A;  3U5R E;  2AHE A;  5BRT A;  4IQ1 A;  2A4H A;  1GTA A;  1FOV A;  1CQG A;  1PA3 A;  1RQM A;  17GS A;  3QDN A;  4V1A p;  2DJ0 A;  1G7E A;  2C4J A;  2MBS A;  1PL1 A;  1V9W A;  1BG5 A;  3GX0 A;  4ZL8 A;  4NXI A;  4WXT A;  4YH2 A;  3PH9 A;  2UZ8 A;  4KSM A;  4L5L A;  2CVK A;  3BCI A;  1MTC A;  2FWG A;  5IO0 A;  3CBU A;  2L4Q A;  2F51 A;  2C8U A;  1FOH A;  5ECL B;  5G5F A;  4IW9 A;  3L0H A;  3KM6 A;  4EC0 A;  3MNG A;  2HI7 A;  2VUP A;  3DRN A;  1JZW A;  1AW9 A;  5CO3 A;  5B8B A;  4FYC A;  4KX4 A;  4GLT A;  2IWT A;  1M99 A;  4N0V A;  4PTS A;  2V1M A;  3ZZX A;  1WP0 A;  2B5X A;  4K7N A;  1R4W A;  1ERT A;  1FG4 A;  4H86 A;  5DCH A;  6GSX A;  1THO A;  3UVH A;  2K8S A;  4POB A;  4IVF A;  1TU8 A;  4OFN A;  2FUG 2;  3VLN A;  6GSW A;  3M1G A;  3UOM A;  4EIP A;  1M9A A;  2YV7 A;  4OCF A;  3BD2 A;  1V2A A;  4YQV A;  1JLV A;  1T3B A;  5JWO B;  2AJQ B;  1JLW A;  2X4A A;  1W4V A;  4MP4 A;  3C1R A;  3I43 A;  2VCW A;  3KZQ A;  2AV4 A;  2N5F A;  2M46 A;  2LJK A;  3R3E A;  1YZX A;  5B6N A;  4MJB A;  3GL3 A;  3M9K A;  5ECK B;  4JBB A;  2N5A A;  2A4V A;  4F2I A;  2MMZ A;  3HCZ A;  4LMW A;  2JU5 A;  3HVX A;  2X8G A;  4PQI A;  3GFK A;  2I9H A;  3L9S A;  1TRV A;  3EU3 A;  1VF2 A;  1VF4 A;  2RM5 A;  1GP1 A;  2PGT A;  3CQF A;  3H79 A;  2LS5 A;  1H4O A;  3IK9 A;  3PPU A;  3TJK A;  2DJJ A;  1PX7 A;  4ZB8 A;  3KGK A;  5DAL B;  3FW2 A;  3KD0 A;  10GS A;  3KMN A;  3LOR A;  4GCI A;  4IKH A;  1C72 A;  4OWY A;  3UEM A;  3DWV A;  3TKQ A;  4MZC A;  4ZB9 A;  3MDK A;  4ZIL A;  2C0F A;  5ECQ B;  4JR6 A;  3TKS C;  3KP9 A;  2HNL A;  20GS A;  3TKS A;  1ZZY A;  2FWH A;  3GNJ A;  4ECJ A;  1B9X C;  2QA1 A;  1MDI A;  1ZL9 A;  5H5R A;  4KND A;  3QAV A;  2V6K A;  4YQU A;  5FWG A;  5A4V A;  3ZLP A;  4IEL A;  1V58 A;  4X4J A;  3P8W A;  4MK3 A;  3C73 A;  2QSI A;  2FWF A;  1TRW A;  3LYP A;  4O5Q A;  1YEX A;  2XBQ A;  3HJM A;  3EMX A;  4TRX A;  3GV1 A;  1XWB A;  2HSY A;  4MLY A;  2IME A;  2KHP A;  5IMF A;  1F2E A;  1GTU A;  1ZMA A;  3D0Z A;  2K6V A;  2O8V B;  3GUR A;  4GWR A;  4PQH A;  2X64 A;  3L9V A;  3H93 A;  4MF6 A;  2EIO A;  1OE8 A;  1EV4 A;  1R5P A;  2H01 A;  2I81 A;  1QFN A;  1U6T A;  1U3A A;  3WD6 A;  3WGX A;  1WMJ A;  18GS A;  1JZO A;  2GDR A;  5J5N A;  1K0C A;  4WF5 A;  1WRY A;  1WJK A;  4Q5F A;  5CRH A;  1NHO A;  4KE3 A;  2R2J A;  5JCU A;  1XW9 A;  2RM6 A;  3Q74 A;  3TRX A;  3GKX A;  2OA7 A;  2ZCT A;  2GSR A;  1QGV A;  2H6X A;  1EV9 A;  1TW9 A;  3IC8 A;  6GSU A;  1S3A A;  2N5B A;  4PQ1 A;  5J4U A;  1YF1 A;  3R2Q A;  1MDK A;  2DBC A;  3IBH A;  4OD7 A;  5E59 A;  3CSI A;  2WDU A;  19GS A;  3LEF A;  2RII A;  3FZA A;  2O85 A;  3BCK A;  5JWR B;  1N8J A;  5ECS A;  1BAY A;  4EL1 A;  3APS A;  1XWC A;  1ILO A;  3RHB A;  3EVI A;  2PU9 C;  4IHU A;  3FR6 A;  3ZL5 A;  5IMZ A;  2R3X A;  4V2M A;  4ZL7 A;  3E3E A;  3ERG A;  2G0F A;  4K5S A;  3VWV A;  2H0H A;  4ZXG A;  2QA2 A;  1S3R A;  5D9X A;  1O81 A;  4J57 E;  2DLX A;  4K6X A;  3UVT A;  5IOW A;  3HA9 A;  3HHV A;  3SBC A;  2GQM A;  2MMA A;  4ULX A;  2YPM A;  4G2E A;  5ECN B;  2FNO A;  4X0X A;  1TU7 A;  3FHK A;  4XHM A;  2H6Y A;  2ON7 A;  3IC4 A;  4F82 A;  2KP1 A;  1V40 A;  2HLS A;  4I6X A;  1O73 A;  3KIJ A;  3ZML A;  1USB A;  3VWW A;  2MBT A;  2IMK A;  1YY7 A;  4QL9 A;  4EXJ A;  4I97 A;  4OO5 A;  1GWC A;  4ML1 A;  4GSS A;  5CRG A;  5G1L A;  5KN3 A;  2OJL A;  2KUC A;  2YWN A;  1ZYQ B;  1O8X A;  2PN8 A;  1ZYP A;  3FZ4 A;  2JZT A;  2GST A;  4EE0 A;  4GXZ A;  3KXO A;  5HFG A;  3TDG A;  5KEJ A;  3VWX A;  5G2Z A;  1GNW A;  4YAP A;  5GAN D;  3EYT A;  2HRA A;  4ZB6 A;  3CSH A;  4MJC A;  3MSZ A;  3KEB A;  2GSQ A;  4BIK A;  3HDC A;  2C3N A;  5AN1 A;  2E7P A;  4HDE A;  4RI6 A;  3QFA C;  1M0U A;  4FO5 A;  3W8J A;  3PIN A;  3M8N A;  3IHG A;  1ACV A;  2HXK A;  3IOS A;  5LNK e;  1TP9 A;  4PNG A;  3UMA A;  3O76 A;  3RDW A;  2KP2 A;  5IMV A;  1X5C A;  4LLR A;  3MYD A;  1TKD B;  1QXH A;  1GUM A;  1EP7 A;  5G1K A;  4IP1 A;  4OFM A;  1SD9 A;  1ZYN A;  1GRX A;  1SD8 A;  1F9M A;  5IPG A;  4ZBA A;  3WT1 A;  4RQX A;  1PQN A;  3L78 A;  2HRK A;  4WBJ A;  2PVQ A;  3FKF A;  1GSQ A;  2CVB A;  2V32 A;  1TDI A;  4D73 A;  1Z5Y E;  3LXZ A;  2C80 A;  3V1W A;  3QCP A;  3TKS E;  3EIN A;  3F8U A;  3GST A;  2DIY A;  2B1K A;  1WOU A;  1MDJ A;  1FW1 A;  5F07 A;  5H5S A;  2LQO A;  4CY6 A;  4N10 A;  1NM3 A;  3UAR A;  3GRX A;  2X8H A;  3FK8 A;  16GS A;  5C04 A;  4CHS A;  1DUG A;  4L0W A;  2R0C A;  3QOU A;  1T4Y A;  3IPZ A;  4HQS A;  4G9H A;  4EF0 A;  3O3T A;  3DIE A;  4ID0 A;  4RUV A;  2A2S A;  4POL A;  3IR4 A;  1Z7P A;  4XRD A;  1XFL A;  1K0O A;  3J7Y b;  4HU9 A;  4FYU A;  4DSS B;  12GS A;  1JFU A;  2H75 A;  1ERV A;  4E8E A;  5IOX A;  3W8S A;  2DMM A;  4G19 A;  2FY6 A;  1T7P B;  3C8E A;  3F0I A;  3IV4 A;  5DJL A;  4MF7 A;  2P31 A;  5CP1 A;  1A2M A;  4I8B A;  1TJD A;  2DC5 A;  1BQ7 A;  5JCG A;  4EVM A;  2J23 A;  3WGD A;  1SKW B;  4IJ3 A;  4JED A;  3EUR A;  2V6O A;  1F6M C;  3F4T A;  3CMI A;  1GUH A;  2WCI A;  3WGE A;  2Z9S A;  2RUE A;  5AIV A;  2K8V A;  2VCV A;  3MIX A;  4AF2 A;  5CRD A;  1HQO A;  2JZS A;  3HXS A;  1O8W A;  1FHE A;  4CY8 A;  1F3A A;  1GSE A;  2YAN A;  4NAX A;  3FZ5 A;  4YKG A;  4KB3 A;  4GTU A;  3K8N A;  4RQR A;  3D21 A;  4Z2R A;  6GSY A;  1WE0 A;  5ECR B;  1V98 A;  3L4N A;  4KA0 A;  2LTK A;  2NPB A;  2CQ9 A;  3PR8 A;  4K1F A;  3QR6 A;  1XWG A;  2C3Q A;  4G0K A;  1IYH A;  2ZNM A;  2JL4 A;  3LSZ A;  1N2A A;  4ILF A;  4PGT A;  2R5G A;  3ZTL A;  2LJA A;  3A3T A;  4BL7 B;  3HYP A;  2DSA A;  4XS4 B;  3WT2 A;  1SK0 A;  1OC8 A;  14GS A;  3ZVJ D;  2H8L A;  5ELG A;  3I9V 2;  1ML6 A;  1A0R P;  2ALB A;  3F6D A;  4KDX A;  1GSY A;  1KTE A;  2X8C A;  2GLR A;  4BA7 A;  5B8A A;  4WET A;  1UC7 A;  3TKR A;  4A5P A;  4MJA A;  1XPV A;  2H66 A;  1PFO A;  3TB2 A;  11GS A;  4MPF A;  1AXD A;  5CYY A;  3I69 A;  4MPG A;  1YJ6 A;  1B8X A;  3H4K A;  5G5E A;  5D9T A;  2MMO A;  3RAZ A;  3QPM A;  4KCE A;  4KH7 A;  4IP6 A;  4IGJ A;  4N30 A;  1PMT A;  3ZFL A;  1M3J A;  3RBT A;  1OE7 A;  2OE3 A;  1XVQ A;  1PX6 A;  1TXX A;  1YDK A;  4J56 E;  1K0N A;  4ICY A;  1U88 A;  2O87 A;  1K0B A;  2X49 A;  3TGZ A;  1EWX A;  1XBS A;  2BMX A;  2XPE A;  1PD2 1;  2EIQ A;  2WB9 A;  4K7O A;  4JR4 A;  1M2A A;  4HJ2 A;  5F06 A;  2CT6 A;  1TRS A;  4DSS A;  2IIY A;  2O89 A;  1KNG A;  3NIV A;  1K3Y A;  1SK2 A;  2IFQ A;  5ECM B;  2YWM A;  3G9B A;  3D5J A;  2VCZ A;  2GZP A;  2OE0 A;  2XBI A;  5ECO B;  2TIR A;  3CTF A;  3UAP A;  3CXG A;  3HJO A;  2VLU A;  4MA9 A;  3FR9 A;  2L57 A;  4XIH A;  1EGR A;  2OAD A;  3ISO A;  9GSS A;  2GS3 A;  1URM A;  1K0D A;  4BVX B;  3APO A;  2I3Y A;  2C3T A;  1SL0 B;  1O85 A;  1Z3E A;  1O6J A;  5INY A;  1PGT A;  4G0L A;  1EP8 A;  1FB6 A;  4X1U A;  3GUS A;  2HZE B;  4GF0 A;  2CA8 A;  4L0U A;  3FZ9 A;  1G6W A;  4F03 A;  2V2G A;  2OAC A;  1R5A A;  1AUC A;  4YAV A;  1Q4J A;  1M3I A;  1X9W B;  3F4S A;  4XCS A;  1QUW A;  2C1Y A;  2H1D A;  1GSF A;  4PX1 A;  4V1A g;  4NWY A;  2PUK C;  5DDL A;  4V2L A;  2OBK A;  3TOT A;  1UVZ A;  2MMN A;  3EU4 A;  2RUF A;  4CW9 A;  1OYJ A;  4G10 A;  1U3I A;  3TCO A;  1A8L A;  1U87 A;  3UJ1 A;  5ID2 B;  2AUV A;  1EOH A;  1V57 A;  4DSR A;  2M80 A;  4BL7 A;  3KCM A;  3LQ7 A;  3ZMK A;  4MF5 A;  2REM A;  4XS4 A;  5CAX A;  2H6Z A;  3VWU A;  2HE3 A;  3TUE A;  4Q5R A;  4HOJ A;  5IMC A;  2JZR A;  1SJZ A;  1JHB A;  1I9D A;  2CX3 A;  2IN3 A;  2YV9 A;  4O5R A;  3VI5 A;  2XPD A;  4JRR A;  5DVB A;  1XOA A;  2EC4 A;  5COH A;  3G7Y A;  5EVO A;  4WEY A;  1B4P A;  4NHZ A;  4KSO A;  5IIZ A;  2WRT A;  1Y6E A;  3APQ A;  4TR3 A;  2NTO A;  2VM2 A;  1HNA A;  2ZUP A;  4K0N A;  6GSV A;  2B6M A;  3LXT A;  3TOU A;  3BBY A;  1BX9 A;  5KN0 A;  4D73 B;  1XVW A;  1A2L A;  4TW5 A;  5IM9 A;  4HJM A;  5AIS A;  5F8B A;  3D22 A;  3UIW A;  2VL2 A;  1TI3 A;  1B9Y C;  1K3L A;  2J9H A;  2FWE A;  2IL3 A;  2LNT A;  4KDY A;  4K9Z A;  3P7X A;  4USS A;  2NDO A;  2C0D A;  1PRX A;  2DKI A;  5D93 A;  4BPY A;  5IMA A;  5D9W A;  2L5L A;  2C0E A;  1QMV A;  4HSC X;  2LKU A;  4BWS A;  3IA1 A;  4Q5Q A;  3ZFB A;  1J9B A;  1EEJ A;  2R6K A;  2LRN A;  1GLQ A;  4O7H A;  3LGC A;  3KJY A;  3O6T A;  1XWA A;  2H19 A;  4PUF C;  1XZO A;  2WGR A;  5ECP B;  5LD0 A;  3ZYW A;  3DML A;  4K7I A;  3ZVJ A;  4BVX A;  2H74 A;  5E4W A;  3D4T A;  1PKW A;  3GKK A;  2XC2 A;  3GHA A;  1OKD A;  3CYN A;  4HS1 A;  5DCG A;  4FH8 A;  3ERW A;  2HZE A;  5A4U A;  1H75 A;  4NV5 A;  5HFI A;  2JAD A;  3A5I A;  4MZW A;  1MEK A;  1YQ1 A;  2LRT A;  4BVY B;  2FA4 A; 
#chains in the Genus database with same CATH homology
 4IBP A;  5DQY A;  13GS A;  4HZ4 A;  3M3M A;  1WIK A;  4NMU A;  1M2B A;  1XW5 A;  2H71 A;  1ERU A;  5DAK B;  5GZZ B;  4V2N A;  1X5E A;  4L5O A;  5KN2 A;  2P0G A;  4IQA A;  1TI1 A;  4NPB A;  5L71 A;  5ID2 A;  3DXB A;  3DKS A;  4MJE A;  2VD0 A;  2CZ2 A;  6GST A;  2LRC A;  1T1V A;  3D4M A;  3E0U A;  2E2M A;  3GH6 A;  2DJ1 A;  4TXV A;  4EO3 A;  4DVC A;  3N9J A;  3GIX A;  4JZQ A;  5IQY A;  3EPT A;  5CRE A;  2R37 A;  2B1L A;  2PPT A;  2VOC A;  3A2V A;  2PVO C;  4OO4 A;  4MDC A;  3ME7 A;  5B6M A;  1GH2 A;  1A24 A;  1ZOF A;  4HEA 2;  4I2T A;  1PSQ A;  3LW9 A;  1DE2 A;  2YWI A;  4LL1 B;  5ELA A;  1Y25 A;  5D73 A;  1X9S B;  1G6Y A;  3DD3 A;  4DSQ A;  1GSD A;  2M72 A;  1PN0 A;  4WR5 A;  3W6G A;  2IMD A;  4XS1 A;  2LEG A;  4MZB A;  2LUS A;  4TKY A;  3QMX A;  3KH7 A;  1TTZ A;  3IHQ A;  1NSW A;  2EIR A;  4EUY A;  3RPN A;  1A2J A;  4ECC A;  4AJ8 A;  4AGS A;  1GUL A;  1EZK A;  3HD5 A;  1JZR A;  3ME8 A;  1ABA A;  1GUK A;  3EMP A;  4QQ7 A;  5CNW A;  3HZ8 A;  1FVK A;  1RW1 A;  1SJ6 A;  2IMI A;  3MAK A;  1WWJ A;  3CRU A;  4MH2 A;  2CAQ A;  5ENU A;  4GQC A;  3GX8 A;  1SYR A;  2LV3 A;  3KTL A;  3QD9 A;  2PMT A;  2P5R A;  1EGO A;  2PBJ A;  4WKW A;  5KOW A;  2YJH A;  2IFQ B;  2DJ3 A;  4YQM A;  5ABR A;  3F63 A;  1X9M B;  2F8A A;  3F9U A;  4J2F A;  2DIZ A;  3VK9 A;  3H1N A;  1EOG A;  3HKR A;  1T4Z A;  2WFC A;  1SL1 B;  1SK1 A;  2GZY A;  4IJI A;  1SU9 A;  4BVY A;  4MNN A;  1OAZ A;  1HD2 A;  2FLS A;  4MMM A;  2K18 A;  3CTG A;  4KW6 A;  1XCC A;  4K2X A;  2F8F A;  1B48 A;  4P3Y B;  1A23 A;  3Q19 A;  3A2W A;  1UN2 A;  1A0F A;  2GTU A;  5EY6 A;  1SL2 B;  2GZZ A;  5DAK A;  4N11 A;  5KOX A;  2VCT A;  2GVP A;  2H73 A;  3D6I A;  4K5R A;  4OFT A;  1HNC A;  1A8Y A;  3P2A A;  2L6D A;  1JZD A;  3GSS A;  4ECI A;  2VD1 A;  3KMO A;  3JCM L;  1M7T A;  2ON5 A;  1J0F A;  1S3C A;  1O7U A;  1X5D A;  4ECB A;  4WR4 A;  2H0I A;  4Q5N A;  3UBK A;  2YWO A;  5D9V A;  1Z6M A;  1VF3 A;  1GTB A;  3IDV A;  4I5Q A;  4TR0 A;  1TK8 B;  2GSS A;  1SEN A;  2HRF A;  1AQX A;  2YNX A;  1XIY A;  1AIU A;  5GSS A;  1AAZ A;  1XW6 A;  3IRA A;  2FD3 A;  4HZ2 A;  3TJF A;  5EPF A;  3QFB C;  2VIM A;  5HQP A;  1Q98 A;  2A2R A;  1HNB A;  1YKC A;  2E2G A;  5HR2 A;  1ZCP A;  5DQS A;  1T8E B;  1VGL A;  3ED3 A;  1M9B A;  1LJR A;  5G31 A;  4N0Z A;  3Q18 A;  3RHC A;  4TVE A;  3BOA A;  4AJ7 A;  1KBN A;  2WZ9 A;  2H0G A;  3KH9 A;  3GMF A;  4TR4 A;  4MAB A;  3LFL A;  4LMV A;  2AAW A;  4QL7 A;  2YZH A;  2YOI A;  4G0I A;  3VUR A;  1OC9 B;  2OKA A;  3N5O A;  4PUR A;  4MH3 A;  4ZL9 A;  4TXO B;  1Z7R A;  2OE1 A;  2IJY A;  2DJ2 A;  5ECI B;  4LL4 B;  5A5K A;  5IPH A;  2YJ7 A;  1J08 A;  2YP6 A;  2KLX A;  2NBS A;  2HYX A;  3ERF A;  3I6A A;  2WS2 A;  3SWL A;  4POK A;  3OR5 A;  1PL2 A;  2X99 A;  3HJP A;  4Z2T A;  2R0P A;  4LA1 A;  2H1B A;  2PER A;  4NHW A;  2WJU A;  8GSS A;  4DEJ A;  3ZRD A;  1SKS B;  3LG6 A;  3ZIJ A;  4XS6 A;  2DJK A;  4OMV A;  1HYU A;  2K9F A;  2JAC A;  2PWJ A;  3GTU A;  2VL9 A;  4TR1 B;  1Z9H A;  3GKM A;  3GH9 A;  2QC7 A;  3FY7 A;  5IO2 A;  2VM1 A;  2LJR A;  4KF9 A;  1XOB A;  2QKE A;  4Z2U A;  1M2D A;  1R7H A;  4KDU A;  4EIQ A;  3QAW A;  3Q6O A;  3LYK A;  3NZN A;  1XWK A;  1GSU A;  2H1A A;  3ZRE A;  5AGY A;  1SYX A;  1VF1 A;  2VAF A;  4KCA A;  4ZBD A;  2GQK A;  1ST9 A;  3C7M A;  2GQL A;  5H5Q A;  2P5Q A;  2XHF A;  4HU7 A;  5G30 A;  1YF0 A;  1QK8 A;  2OBI A;  4FQU A;  2QGV A;  2BJX A;  2VCX A;  2YN1 A;  4YKF A;  2O7K A;  3HZ4 A;  2HT9 A;  3DEX A;  1G7O A;  1K3O A;  2AB6 A;  2LST A;  5CRW A;  2CVD A;  2VO4 A;  3C71 A;  3GYK A;  1DBY A;  5ECH B;  3G7J A;  2AYT A;  3KP8 A;  1WPI A;  2GT5 A;  3HY2 A;  3HVV A;  2A2P A;  4ISD A;  4JU5 A;  4ZBB A;  3UL3 A;  1GSS A;  4TN8 A;  3L9U A;  4F0B A;  2DML A;  3J7Y k;  4RI7 A;  1TOF A;  2HZF A;  2GGT A;  2H72 A;  5JWQ B;  2CZ3 A;  3LJR A;  3TJG A;  1TK0 B;  5HR1 A;  7GSS A;  1ON4 A;  1K0M A;  1FB0 A;  2HSH A;  2VLV A;  5KN1 A;  4TOP A;  3P90 A;  6GSS A;  3A2X A;  2VCQ A;  3CRT A;  5J9B A;  3FMW A;  2FHE A;  5IMD A;  3F4R A;  2FGX A;  3TJB A;  2L4C A;  1OC9 A;  3E9J B;  3PGT A;  5HR0 A;  4TXO A;  4K0G A;  2B5Y A;  3VPQ A;  4MCU A;  2KOK A;  1OVN A;  2VL2 C;  4POM A;  3DGQ A;  3LWA A;  22GS A;  1EEM A;  2H30 A;  1OC3 A;  4EKZ A;  4KAE A;  4O92 A;  1Z6N A;  3IE3 A;  2V41 A;  1T00 A;  4EDY A;  1RK4 A;  4GQF A;  4PNF A;  2CAI A;  2B5E A;  2VLT A;  2CX4 A;  2RLI A;  2LNS A;  5HR3 A;  2E0Q A;  3CSJ A;  2C0G A;  4WF4 A;  2H76 A;  3G7I A;  1AC1 A;  2YZU A;  4ACS A;  5GAP D;  3M9J A;  1GLP A;  3BJ5 A;  1F37 A;  4FYB A;  4TR1 A;  2G2Q A;  3S9F A;  4IN0 A;  5DAL A;  5DBQ A;  5FHI A;  3GN3 A;  3HVS A;  4K8M A;  4KGI A;  2TRC P;  3WYW A;  3M0F A;  3TRQ A;  1YEP A;  2B7J A;  4PXO A;  5FT3 A;  2R0G A;  2H70 A;  5BMU A;  3F6F A;  1GL8 A;  4HUA A;  1F3B A;  3C1S A;  5D96 A;  5B7C A;  1AQW A;  2B7K A;  3ZIT A;  2IMF A;  3U6V A;  5EL8 A;  3KTB A;  5A4W A;  1S3D A;  3UBL A;  2CV4 A;  3H8Q A;  4WBR D;  2LQQ A;  1W89 A;  2ES7 A;  2HRN A;  2F9S A;  2YCD A;  3FEU A;  2MYG A;  2L6C A;  4HI7 A;  3AY8 A;  3FYG A;  2FCH A;  1ZYE A;  3TKP A;  1XXU A;  1BJX A;  1GNE A;  3VFI A;  3A5W A;  4JE1 A;  4CDO A;  1SJI A;  1AQV A;  3DVX A;  3F3Q A;  3RPP A;  1ZGN A;  3QAG A;  4FIW A;  2L59 A;  1YKA A;  1FO5 A;  4ZIJ A;  3DYR A;  4I2U A;  2WUL A;  3GA4 A;  1LU4 A;  4E8H A;  3FR3 A;  2I1U A;  1UA5 A;  2R4V A;  4KUN A;  3FRC A;  2HFD A;  4BWQ A;  3NOF A;  5F0G A;  1B4Q A;  4F9Z A;  1SKR B;  5JCW A;  4F0C A;  3ZIV A;  1I5G A;  2BTO T;  2D2Z A;  4IS0 A;  2IPA A;  5J9C A;  1MD4 A;  1X0R A;  5HFK A;  4XTS A;  5C00 A;  4GSN A;  2F3M A;  3IK7 A;  1MD3 A;  1IYI A;  1VRS D;  4ML6 A;  2B3S A;  1DE1 A;  1CQH A;  1LBK A;  5LCZ A;  1TK5 B;  4GST A;  3TJJ A;  3GL5 A;  3MWH A;  3EWL A;  4K2D A;  3VI7 A;  4O32 A;  3IXR A;  3VPT A;  2MZC A;  1E6B A;  2NVL A;  4NV2 A;  4AJ6 A;  4GRF A;  3TRP A;  2VL3 A;  3F3R A;  1OKT A;  1K0A A;  2FA8 A;  1FVJ A;  2JSY A;  4PUA A;  4XRA A;  1G0T A;  1QQ2 A;  1PN9 A;  3GKN A;  1R26 A;  2TRX A;  3IAM 2;  3IAS 2;  4L8E A;  5AIX A;  2GT6 A;  1TRU A;  5DJM A;  4OCE A;  2JSZ A;  5D8I A;  1ERW A;  1DSB A;  1PKZ A;  3DVW A;  4EDZ A;  1KEB A;  4Z7X A;  5J3R A;  1E2Y A;  2I4A A;  2DKH A;  2HSM A;  1GTI A;  1NW2 A;  3EC3 A;  3GTU B;  5J41 A;  5F05 A;  1NHY A;  2L5O A;  5GST A;  1BYE A;  1FAA A;  4X43 A;  1BED A;  3US3 A;  1THX A;  2H1G A;  3EE2 A;  4HQZ A;  4O5U A;  3U5R E;  2AHE A;  5BRT A;  4IQ1 A;  2A4H A;  1GTA A;  1FOV A;  1CQG A;  1PA3 A;  1RQM A;  17GS A;  3QDN A;  4V1A p;  2DJ0 A;  1G7E A;  2C4J A;  2MBS A;  1PL1 A;  1V9W A;  1BG5 A;  3GX0 A;  4ZL8 A;  4NXI A;  4WXT A;  4YH2 A;  3PH9 A;  2UZ8 A;  4KSM A;  4L5L A;  2CVK A;  3BCI A;  1MTC A;  2FWG A;  5IO0 A;  3CBU A;  2L4Q A;  2F51 A;  2C8U A;  1FOH A;  5ECL B;  5G5F A;  4IW9 A;  3L0H A;  3KM6 A;  4EC0 A;  3MNG A;  2HI7 A;  2VUP A;  3DRN A;  1JZW A;  1AW9 A;  5CO3 A;  5B8B A;  4FYC A;  4KX4 A;  4GLT A;  2IWT A;  1M99 A;  4N0V A;  4PTS A;  2V1M A;  3ZZX A;  1WP0 A;  2B5X A;  4K7N A;  1R4W A;  1ERT A;  1FG4 A;  4H86 A;  5DCH A;  6GSX A;  1THO A;  3UVH A;  2K8S A;  4POB A;  4IVF A;  1TU8 A;  4OFN A;  2FUG 2;  3VLN A;  6GSW A;  3M1G A;  3UOM A;  4EIP A;  1M9A A;  2YV7 A;  4OCF A;  3BD2 A;  1V2A A;  4YQV A;  1JLV A;  1T3B A;  5JWO B;  2AJQ B;  1JLW A;  2X4A A;  1W4V A;  4MP4 A;  3C1R A;  3I43 A;  2VCW A;  3KZQ A;  2AV4 A;  2N5F A;  2M46 A;  2LJK A;  3R3E A;  1YZX A;  5B6N A;  4MJB A;  3GL3 A;  3M9K A;  5ECK B;  4JBB A;  2N5A A;  2A4V A;  4F2I A;  2MMZ A;  3HCZ A;  4LMW A;  2JU5 A;  3HVX A;  2X8G A;  4PQI A;  3GFK A;  2I9H A;  3L9S A;  1TRV A;  3EU3 A;  1VF2 A;  1VF4 A;  2RM5 A;  1GP1 A;  2PGT A;  3H79 A;  2LS5 A;  1H4O A;  3IK9 A;  3PPU A;  3TJK A;  2DJJ A;  1PX7 A;  4ZB8 A;  3KGK A;  5DAL B;  3FW2 A;  3KD0 A;  10GS A;  3KMN A;  3LOR A;  4GCI A;  4IKH A;  1C72 A;  4OWY A;  3UEM A;  3DWV A;  3TKQ A;  4MZC A;  4ZB9 A;  3MDK A;  4ZIL A;  2C0F A;  5ECQ B;  4JR6 A;  3TKS C;  3KP9 A;  2HNL A;  20GS A;  3TKS A;  1ZZY A;  2FWH A;  3GNJ A;  4ECJ A;  1B9X C;  2QA1 A;  1MDI A;  1ZL9 A;  5H5R A;  4KND A;  3QAV A;  2V6K A;  4YQU A;  5FWG A;  5A4V A;  3ZLP A;  4IEL A;  1V58 A;  4X4J A;  3P8W A;  4MK3 A;  3C73 A;  2QSI A;  2FWF A;  1TRW A;  3LYP A;  4O5Q A;  1YEX A;  2XBQ A;  3HJM A;  3EMX A;  4TRX A;  3GV1 A;  1XWB A;  2HSY A;  4MLY A;  2IME A;  2KHP A;  5IMF A;  1F2E A;  1GTU A;  1ZMA A;  3D0Z A;  2K6V A;  2O8V B;  3GUR A;  4GWR A;  4PQH A;  2X64 A;  3L9V A;  3H93 A;  4MF6 A;  2EIO A;  1OE8 A;  1EV4 A;  1R5P A;  2H01 A;  2I81 A;  1QFN A;  1U6T A;  1U3A A;  3WD6 A;  3WGX A;  1WMJ A;  18GS A;  1JZO A;  2GDR A;  5J5N A;  1K0C A;  4WF5 A;  1WRY A;  1WJK A;  4Q5F A;  5CRH A;  1NHO A;  4KE3 A;  2R2J A;  5JCU A;  1XW9 A;  2RM6 A;  3Q74 A;  3TRX A;  3GKX A;  2OA7 A;  2ZCT A;  2GSR A;  1QGV A;  2H6X A;  1EV9 A;  1TW9 A;  3IC8 A;  6GSU A;  1S3A A;  2N5B A;  4PQ1 A;  5J4U A;  1YF1 A;  3R2Q A;  1MDK A;  2DBC A;  3IBH A;  4OD7 A;  5E59 A;  3CSI A;  2WDU A;  19GS A;  3LEF A;  2RII A;  3FZA A;  2O85 A;  3BCK A;  5JWR B;  1N8J A;  5ECS A;  1BAY A;  4EL1 A;  3APS A;  1XWC A;  1ILO A;  3RHB A;  3EVI A;  2PU9 C;  4IHU A;  3FR6 A;  3ZL5 A;  5IMZ A;  2R3X A;  4V2M A;  4ZL7 A;  3E3E A;  3ERG A;  2G0F A;  4K5S A;  3VWV A;  2H0H A;  4ZXG A;  2QA2 A;  5D9X A;  1O81 A;  4J57 E;  2DLX A;  4K6X A;  3UVT A;  5IOW A;  3HA9 A;  3HHV A;  3SBC A;  2GQM A;  2MMA A;  4ULX A;  2YPM A;  4G2E A;  5ECN B;  2FNO A;  4X0X A;  1TU7 A;  3FHK A;  4XHM A;  2H6Y A;  2ON7 A;  3IC4 A;  4F82 A;  2KP1 A;  1V40 A;  2HLS A;  4I6X A;  1O73 A;  3KIJ A;  3ZML A;  1USB A;  3VWW A;  2MBT A;  2IMK A;  1YY7 A;  4QL9 A;  4EXJ A;  4I97 A;  4OO5 A;  1GWC A;  4ML1 A;  4GSS A;  5CRG A;  5G1L A;  5KN3 A;  2OJL A;  2KUC A;  2YWN A;  1ZYQ B;  1O8X A;  2PN8 A;  1ZYP A;  3FZ4 A;  2JZT A;  2GST A;  4EE0 A;  4GXZ A;  3KXO A;  5HFG A;  3TDG A;  5KEJ A;  3VWX A;  5G2Z A;  1GNW A;  4YAP A;  5GAN D;  3EYT A;  2HRA A;  4ZB6 A;  3CSH A;  4MJC A;  3MSZ A;  3KEB A;  2GSQ A;  3HDC A;  2C3N A;  5AN1 A;  2E7P A;  4HDE A;  4RI6 A;  3QFA C;  1M0U A;  4FO5 A;  3W8J A;  3PIN A;  3M8N A;  3IHG A;  1ACV A;  2HXK A;  3IOS A;  5LNK e;  1TP9 A;  4PNG A;  3UMA A;  3O76 A;  3RDW A;  2KP2 A;  5IMV A;  1X5C A;  4LLR A;  3MYD A;  1TKD B;  1QXH A;  1GUM A;  1EP7 A;  5G1K A;  4IP1 A;  4OFM A;  1SD9 A;  1ZYN A;  1GRX A;  1SD8 A;  1F9M A;  5IPG A;  4ZBA A;  3WT1 A;  4RQX A;  1PQN A;  3L78 A;  2HRK A;  4WBJ A;  2PVQ A;  3FKF A;  1GSQ A;  2CVB A;  2V32 A;  1TDI A;  4D73 A;  1Z5Y E;  3LXZ A;  2C80 A;  3V1W A;  3QCP A;  3TKS E;  3EIN A;  3F8U A;  3GST A;  2DIY A;  2B1K A;  1WOU A;  1MDJ A;  1FW1 A;  5F07 A;  5H5S A;  2LQO A;  4CY6 A;  4N10 A;  1NM3 A;  3UAR A;  3GRX A;  2X8H A;  3FK8 A;  16GS A;  5C04 A;  4CHS A;  1DUG A;  4L0W A;  2R0C A;  3QOU A;  1T4Y A;  3IPZ A;  4HQS A;  4G9H A;  4EF0 A;  3O3T A;  3DIE A;  4ID0 A;  4RUV A;  2A2S A;  4POL A;  3IR4 A;  1Z7P A;  4XRD A;  1XFL A;  1K0O A;  3J7Y b;  4HU9 A;  4FYU A;  4DSS B;  12GS A;  1JFU A;  2H75 A;  1ERV A;  4E8E A;  5IOX A;  3W8S A;  2DMM A;  4G19 A;  2FY6 A;  1T7P B;  3C8E A;  3F0I A;  3IV4 A;  5DJL A;  4MF7 A;  2P31 A;  5CP1 A;  1A2M A;  4I8B A;  1TJD A;  2DC5 A;  1BQ7 A;  5JCG A;  4EVM A;  2J23 A;  3WGD A;  1SKW B;  4IJ3 A;  4JED A;  3EUR A;  2V6O A;  1F6M C;  3F4T A;  3CMI A;  1GUH A;  2WCI A;  3WGE A;  2Z9S A;  2RUE A;  5AIV A;  2K8V A;  2VCV A;  3MIX A;  4AF2 A;  5CRD A;  1HQO A;  2JZS A;  3HXS A;  1O8W A;  1FHE A;  4CY8 A;  1F3A A;  1GSE A;  2YAN A;  4NAX A;  3FZ5 A;  4YKG A;  4KB3 A;  4GTU A;  3K8N A;  4RQR A;  3D21 A;  4Z2R A;  6GSY A;  1WE0 A;  5ECR B;  1V98 A;  3L4N A;  4KA0 A;  2LTK A;  2NPB A;  2CQ9 A;  3PR8 A;  4K1F A;  3QR6 A;  1XWG A;  2C3Q A;  4G0K A;  1IYH A;  2ZNM A;  2JL4 A;  3LSZ A;  1N2A A;  4ILF A;  4PGT A;  2R5G A;  3ZTL A;  2LJA A;  3A3T A;  4BL7 B;  3HYP A;  2DSA A;  4XS4 B;  3WT2 A;  1SK0 A;  1OC8 A;  14GS A;  3ZVJ D;  2H8L A;  5ELG A;  3I9V 2;  1ML6 A;  1A0R P;  2ALB A;  3F6D A;  4KDX A;  1GSY A;  1KTE A;  2X8C A;  2GLR A;  4BA7 A;  5B8A A;  4WET A;  1UC7 A;  3TKR A;  4A5P A;  4MJA A;  1XPV A;  2H66 A;  3TB2 A;  11GS A;  4MPF A;  1AXD A;  5CYY A;  3I69 A;  4MPG A;  1YJ6 A;  1B8X A;  3H4K A;  5G5E A;  5D9T A;  2MMO A;  3RAZ A;  3QPM A;  4KCE A;  4KH7 A;  4IP6 A;  4IGJ A;  4N30 A;  1PMT A;  3ZFL A;  3RBT A;  1OE7 A;  2OE3 A;  1XVQ A;  1PX6 A;  1TXX A;  1YDK A;  4J56 E;  1K0N A;  4ICY A;  1U88 A;  2O87 A;  1K0B A;  2X49 A;  3TGZ A;  1EWX A;  1XBS A;  2BMX A;  2XPE A;  1PD2 1;  2EIQ A;  2WB9 A;  4K7O A;  4JR4 A;  1M2A A;  4HJ2 A;  5F06 A;  2CT6 A;  1TRS A;  4DSS A;  2IIY A;  2O89 A;  1KNG A;  3NIV A;  1K3Y A;  1SK2 A;  2IFQ A;  5ECM B;  2YWM A;  3G9B A;  3D5J A;  2VCZ A;  2GZP A;  2OE0 A;  2XBI A;  5ECO B;  2TIR A;  3CTF A;  3UAP A;  3CXG A;  3HJO A;  2VLU A;  4MA9 A;  3FR9 A;  2L57 A;  4XIH A;  1EGR A;  2OAD A;  3ISO A;  9GSS A;  2GS3 A;  1URM A;  1K0D A;  4BVX B;  3APO A;  2I3Y A;  2C3T A;  1SL0 B;  1O85 A;  1Z3E A;  1O6J A;  5INY A;  1PGT A;  4G0L A;  1EP8 A;  1FB6 A;  4X1U A;  3GUS A;  2HZE B;  4GF0 A;  2CA8 A;  4L0U A;  3FZ9 A;  1G6W A;  4F03 A;  2V2G A;  2OAC A;  1R5A A;  1AUC A;  4YAV A;  1Q4J A;  1X9W B;  3F4S A;  4XCS A;  1QUW A;  2C1Y A;  2H1D A;  1GSF A;  4PX1 A;  4V1A g;  4NWY A;  2PUK C;  5DDL A;  4V2L A;  2OBK A;  3TOT A;  1UVZ A;  2MMN A;  3EU4 A;  2RUF A;  4CW9 A;  1OYJ A;  4G10 A;  1U3I A;  3TCO A;  1A8L A;  1U87 A;  3UJ1 A;  5ID2 B;  2AUV A;  1EOH A;  1V57 A;  4DSR A;  2M80 A;  4BL7 A;  3KCM A;  3LQ7 A;  3ZMK A;  4MF5 A;  2REM A;  4XS4 A;  5CAX A;  2H6Z A;  3VWU A;  2HE3 A;  3TUE A;  4Q5R A;  4HOJ A;  5IMC A;  2JZR A;  1SJZ A;  1JHB A;  1I9D A;  2CX3 A;  2IN3 A;  2YV9 A;  4O5R A;  3VI5 A;  2XPD A;  4JRR A;  5DVB A;  1XOA A;  2EC4 A;  5COH A;  3G7Y A;  5EVO A;  4WEY A;  1B4P A;  4NHZ A;  4KSO A;  5IIZ A;  2WRT A;  1Y6E A;  3APQ A;  4TR3 A;  2NTO A;  2VM2 A;  1HNA A;  2ZUP A;  4K0N A;  6GSV A;  2B6M A;  3LXT A;  3TOU A;  3BBY A;  1BX9 A;  5KN0 A;  4D73 B;  1XVW A;  1A2L A;  4TW5 A;  5IM9 A;  4HJM A;  5AIS A;  5F8B A;  3D22 A;  3UIW A;  2VL2 A;  1TI3 A;  1B9Y C;  1K3L A;  2J9H A;  2FWE A;  2IL3 A;  2LNT A;  4KDY A;  4K9Z A;  3P7X A;  4USS A;  2NDO A;  2C0D A;  1PRX A;  2DKI A;  5D93 A;  4BPY A;  5IMA A;  5D9W A;  2L5L A;  2C0E A;  1QMV A;  2LKU A;  4BWS A;  3IA1 A;  4Q5Q A;  3ZFB A;  1J9B A;  1EEJ A;  2R6K A;  2LRN A;  1GLQ A;  4O7H A;  3LGC A;  3KJY A;  3O6T A;  1XWA A;  2H19 A;  4PUF C;  1XZO A;  2WGR A;  5ECP B;  5LD0 A;  3ZYW A;  3DML A;  4K7I A;  3ZVJ A;  4BVX A;  2H74 A;  5E4W A;  3D4T A;  1PKW A;  3GKK A;  2XC2 A;  3GHA A;  1OKD A;  3CYN A;  4HS1 A;  5DCG A;  4FH8 A;  3ERW A;  2HZE A;  5A4U A;  1H75 A;  4NV5 A;  5HFI A;  2JAD A;  3A5I A;  4MZW A;  1MEK A;  1YQ1 A;  2LRT A;  4BVY B;  2FA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...