4WF5A

Crystal structure of e.coli dsba soaked with compound 4
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
188
structure length
188
Chain Sequence
b'AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein
publication title Application of Fragment-Based Screening to the Design of Inhibitors of Escherichia coli DsbA.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 67
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature ec 1.8.4.2: Protein-disulfide reductase (glutathione).
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4wf5A00
1XCCA 4MJBA 5B8AA 2I4AA 1OC9B 5IMAA 2X8HA 1U3IA 4PNGA 5ECPB 3APOA 1A8YA 3WD6A 4GF0A 2F9SA 1SYRA 3UARA 1JZWA 3IOSA 2VO4A 1S3CA 5HR3A 2L5LA 1K3LA 4HQZA 3JCML 3V1WA 1PX7A 3FYGA 4JR4A 5CNWA 5DALB 4TXOA 2H1GA 2H73A 2O8VB 3G7JA 2GSRA 3HA9A 1XVQA 1PQNA 1K0MA 3GH9A 5AIXA 1N8JA 1V9WA 1GTAA 1GTUA 5ID2B 1GSUA 2EC4A 3ZLPA 4PUFC 3FY7A 2YWOA 5F0GA 3M8NA 4IVFA 2CT6A 1T4ZA 1X9MB 2PN8A 3RHCA 1R26A 1TDIA 3WT2A 2ON7A 2XBQA 4JE1A 2K18A 5ECOB 4V1Ap 4WEYA 4TR1A 2I81A 4PXOA 2L4QA 3N5OA 13GSA 2ALBA 1WIKA 3LORA 3TJGA 2CX3A 2G2QA 2RM6A 4DSQA 4RUVA 4L0UA 2GQLA 1TKDB 1K0CA 1T7PB 3RHBA 1SENA 3ZMLA 4EXJA 3D0ZA 4X1UA 2IPAA 5GAPD 1AUCA 1AQVA 2VCTA 1GLQA 2HNLA 1S3AA 2RUFA 5J3RA 4IN0A 1M7TA 3L0HA 3C71A 4IP1A 4L5OA 2VD0A 5ECLB 1DUGA 1TW9A 4FYCA 4TXOB 3C73A 1YKAA 4BWQA 1UVZA 1KEBA 2CAIA 4NV5A 5JCWA 2TRCP 5F06A 2VLVA 2FUG2 1QUWA 3MAKA 1EOGA 1A2JA 1SL0B 3VI7A 3RPNA 2PMTA 1M99A 1A2LA 1K0OA 4TR1B 1G6WA 2LEGA 3K8NA 4GTUA 2VCVA 1X9SB 4CHSA 1DE1A 1J08A 2PUKC 1IYIA 2OE0A 3LG6A 3QPMA 19GSA 1YF1A 3DIEA 5DAKB 3DEXA 1H75A 2FWEA 4HJMA 4ISDA 4BL7A 3VWXA 2B3SA 2C3NA 4MZCA 5HFIA 1E6BA 4ILFA 4K7IA 3IC4A 5CO3A 1YQ1A 3QFAC 2EIOA 1YEXA 5CYYA 4F2IA 1SJIA 3AY8A 3Q6OA 1EWXA 3BD2A 2K6VA 3HZ8A 3EMPA 5IPGA 2NPBA 5ELAA 2WULA 1Z7PA 2LUSA 1KBNA 3EC3A 3ZFLA 3LYPA 3TJJA 2LJKA 2VIMA 5AGYA 5G1KA 2C8UA 1A0RP 3O6TA 1YEPA 1EGOA 4L5LA 3CMIA 2VLUA 3KXOA 2V41A 5AIVA 2VL2C 5DDLA 17GSA 5ECNB 2WJUA 3GURA 3ZREA 1XOAA 3E0UA 3HVSA 3GL3A 2AUVA 3ZVJD 3NIVA 3QMXA 4J2FA 1GNWA 2REMA 4AJ7A 1OKTA 2BMXA 4IS0A 4CDOA 4F0CA 4TKYA 5IIZA 4GQFA 1GSDA 3VWUA 2IFQA 5IOWA 5HFKA 1Z6MA 1SKRB 2GZYA 2J9HA 3HJMA 2FLSA 1FHEA 1ERUA 3GYKA 3TJFA 1Z9HA 3TKQA 4N30A 4KGIA 3CSJA 2HSHA 2LRTA 1SK1A 2O87A 5E59A 1MDJA 4MJCA 4NXIA 4MH3A 4JZQA 1BG5A 2XHFA 4KDUA 2X8CA 1EGRA 5FHIA 2PERA 2C3QA 1DBYA 4WF5A 5D9XA 3WT1A 3KM6A 4MMMA 1SD9A 3LYKA 2H8LA 1J9BA 5D93A 2GQKA 2TIRA 3KH9A 4L0WA 4TOPA 2DC5A 1FW1A 1MD3A 5J9BA 4EC0A 3CSIA 3VFIA 1ZL9A 1MDIA 2IN3A 1SU9A 4LMWA 1TK5B 4HUAA 4HI7A 2GLRA 5G1LA 5B7CA 3QOUA 1I5GA 3FHKA 4MK3A 5GSTA 4XS4A 4EE0A 1M2BA 1FG4A 4PQIA 1TK8B 3IHQA 3D4MA 1EEJA 5B8BA 2H0GA 5DBQA 3HJOA 1HQOA 1Y25A 1DE2A 1TRSA 3ZFBA 4BA7A 4PGTA 2V6KA 1U87A 2CVDA 3PR8A 1G7EA 2KHPA 3A2XA 1GP1A 2KLXA 3J7Yk 2YV9A 1TXXA 2H6ZA 2LKUA 5HR0A 2I9HA 1M0UA 4OFTA 5IO0A 4OCEA 1OVNA 5INYA 1QQ2A 4MZBA 2E2MA 3TB2A 1EZKA 1ERWA 1TOFA 1F37A 2C0DA 2FGXA 3WGDA 2DIYA 1JFUA 3M3MA 2M80A 3Q19A 3GHAA 3D21A 1OKDA 1RQMA 4Q5FA 2DJKA 1T00A 2NDOA 1ZYEA 1GSFA 4FIWA 4EVMA 1LBKA 4O92A 3L9SA 5JWQB 2R2JA 3TJKA 4JBBA 3F4RA 20GSA 4NPBA 9GSSA 2P5QA 4MA9A 3KCMA 4KH7A 3GH6A 3DXBA 1HD2A 4XS1A 1C72A 4XS4B 2MBSA 3TJBA 4D73B 1PGTA 3MSZA 1GSQA 1ML6A 2PWJA 1F2EA 22GSA 3ERWA 4GSSA 5KN2A 5HQPA 4K7NA 3BJ5A 4GSTA 3IE3A 2C1YA 2H0HA 4L8EA 1VF2A 4MF7A 4PURA 1GNEA 3KMNA 4K7OA 1G7OA 4KAEA 1O85A 4RQRA 2DMLA 3I43A 4HOJA 5KN3A 2OE3A 4MPGA 4HJ2A 4HQSA 5DQSA 3TRPA 2MBTA 4TXVA 4FH8A 3DD3A 4FYUA 3SWLA 1FVKA 3L4NA 3J7Yb 4F9ZA 2FNOA 2QC7A 2I1UA 3G7IA 1ZYQB 3DVWA 5G5EA 3ZIVA 2H0IA 5G2ZA 2RM5A 3FEUA 6GSVA 2XBIA 3CTFA 2IJYA 3A2WA 3PGTA 2FHEA 5ECRB 2GDRA 4GWRA 3L78A 2XPEA 4QL9A 1R5PA 5GZZB 5F8BA 1U3AA 3GKNA 3TKRA 2EIQA 2ZUPA 5DJMA 2JADA 1OYJA 3FR9A 5EL8A 1WP0A 1YDKA 3FK8A 2LQQA 3UBLA 1YY7A 5F05A 4IGJA 2YZHA 1PN9A 1Z7RA 1TU8A 4XRAA 2VL9A 1VF4A 4WKWA 4IQAA 4HU7A 1SD8A 2DJ2A 2HYXA 3FR3A 4N10A 1FB6A 4GCIA 5HR1A 2CZ2A 2B1KA 2VL2A 1I9DA 4BPYA 10GSA 4PQHA 3GKKA 2DSAA 3DGQA 2H74A 3BOAA 2YWNA 2IMEA 1V2AA 2B5YA 4EO3A 3TKPA 3E9JB 3UL3A 2HRNA 3QFBC 4G19A 4V1Ag 2NTOA 1XW6A 2P31A 4X43A 1TJDA 1Y6EA 1K0DA 1M2DA 1ZCPA 1FB0A 4MABA 5IMVA 2N5BA 3IPZA 1ERVA 3IK7A 2VCQA 1ZGNA 3EU3A 4XRDA 2B5EA 4AJ8A 1XWCA 2H30A 3QDNA 2GS3A 3ISOA 2RIIA 3QAWA 5H5QA 4IJ3A 4OFNA 2OA7A 2QSIA 3O3TA 3U5RE 4ECBA 4EDYA 1VRSD 1U6TA 1XPVA 5J41A 3ED3A 1FVJA 2PVQA 3DRNA 5FT3A 2AAWA 3ZITA 3C1SA 4ZL7A 4HZ4A 1X5DA 4TRXA 4EDZA 4KSOA 4V2LA 3TCOA 3KIJA 3D4TA 5AN1A 2Z9SA 4F0BA 2H71A 11GSA 4EKZA 3GIXA 4YAPA 5H5RA 2BJXA 1EOHA 2YANA 1R4WA 5CRHA 2WZ9A 2V6OA 1BQ7A 4LL1B 4NMUA 3GSSA 2VD1A 3SBCA 3US3A 1N2AA 2OJLA 2L4CA 1OE7A 1PSQA 2R3XA 4JEDA 2VM2A 3C1RA 3QAGA 5LD0A 3E3EA 2L57A 5CP1A 4FYBA 4MZWA 4OCFA 2HT9A 2B1LA 2IMDA 3HHVA 3IAM2 1LJRA 1UN2A 3FRCA 1SKWB 4YQUA 4ZBBA 1S3DA 1TTZA 1BYEA 3HCZA 3GNJA 5ELGA 3HDCA 2H72A 3F6DA 4Q5QA 3RAZA 1B9XC 3ZYWA 2HSYA 2PVOC 3IBHA 1TI3A 3VWVA 4DSSA 3ERFA 4POBA 1G0TA 3MDKA 4GSNA 4K0GA 1EV4A 4IBPA 2KP2A 3FR6A 5IO2A 5ECKB 4O5RA 4PQ1A 4ZB6A 3GV1A 1PA3A 5CAXA 5GSSA 1OC8A 4KUNA 2YWIA 4GQCA 4I6XA 3GKMA 3H79A 1O81A 4ZB8A 4ZIJA 1JHBA 2JU5A 2HRFA 1NSWA 4BVXA 2CZ3A 2NBSA 1HNAA 2IWTA 1XW5A 1BJXA 4IELA 4YAVA 3ZZXA 2V1MA 3QAVA 2M46A 3O76A 3FZ9A 3ERGA 3LFLA 2GT5A 3TKSC 1TRWA 3DKSA 3GUSA 2YJHA 3KGKA 1V57A 3MWHA 4IHUA 2I3YA 3GRXA 1JZDA 1NW2A 2MMNA 4TW5A 1VF3A 2DJ1A 1UA5A 2JZRA 1F3BA 3FZAA 3A5WA 1FAAA 3S9FA 2KOKA 3EMXA 3KZQA 1R5AA 4HS1A 1NHYA 2R37A 4MF6A 5JCUA 3UBKA 4WF4A 1T4YA 4K1FA 3IK9A 3LJRA 3GKXA 4HZ2A 4Q5RA 2IIYA 3QR6A 1HNCA 1PL2A 4G10A 2JZSA 2KP1A 6GSUA 4KCAA 2WB9A 4IP6A 4KA0A 2B6MA 1ON4A 1RW1A 3ZIJA 8GSSA 2YOIA 5B6MA 4EF0A 5KEJA 2FWGA 4BWSA 5ECQB 4PNFA 2H6XA 3GTUA 3EINA 3HYPA 1PKZA 2OKAA 2CA8A 2WRTA 3IXRA 4POLA 2GSTA 2JSZA 2YPMA 4XHMA 4NWYA 2DMMA 2GVPA 3P7XA 2VOCA 2P5RA 4NV2A 4LL4B 2OBKA 2LJRA 1SYXA 2CV4A 3IAS2 2IL3A 2JSYA 1QK8A 3L9UA 3TOTA 5C00A 5JWOB 5LCZA 2VCWA 3HVXA 3KP8A 4RQXA 3M9JA 2O89A 3ZL5A 4KW6A 1ILOA 2LRNA 3VI5A 1XWAA 3LGCA 1BAYA 1JLVA 2YNXA 1SKSB 3UVTA 3I6AA 3DYRA 3I9V2 1ACVA 2IFQB 3IA1A 12GSA 4K9ZA 2A4VA 4X0XA 4ML6A 1ZOFA 3LQ7A 2HXKA 3G9BA 6GSSA 1ABAA 4RI7A 5IMZA 3KD0A 4ZILA 4KDXA 3TUEA 3C7MA 2DBCA 3M9KA 7GSSA 1MDKA 1PL1A 2JL4A 2MZCA 1CQGA 1K3OA 3CYNA 5ECSA 1GUKA 1M2AA 2YP6A 2C4JA 2VUPA 2WDUA 5EVOA 3DVXA 2HFDA 4MJEA 2VCXA 4I5QA 3GFKA 1XWKA 5A4UA 2X8GA 4MH2A 3P90A 4KCEA 2YWMA 3NZNA 2FWHA 3W6GA 3TDGA 1PRXA 3H1NA 3KTLA 3KMOA 5G31A 4GXZA 1WJKA 1DSBA 5A4WA 5E4WA 2K8VA 2R5GA 3U6VA 2X99A 1HYUA 2GZZA 2HZFA 1V58A 2CQ9A 3P2AA 2A2SA 1B9YC 3GA4A 5A5KA 4LMVA 4PX1A 2K8SA 5JWRB 4ZB9A 3CSHA 3M1GA 2F8FA 5IQYA 1B4PA 5DVBA 1XVWA 3L9VA 4NHZA 2E0QA 2HZEA 1UC7A 3PH9A 1OC9A 3KTBA 4TR0A 2WGRA 4DSRA 1GL8A 3QCPA 5ABRA 3IV4A 3HVVA 3NOFA 4XTSA 2DJ3A 1T8EB 4J57E 2B5XA 3F3QA 1GWCA 4K8MA 3HY2A 3CRUA 1B8XA 4KNDA 1O7UA 3VPTA 3F8UA 4MLYA 2TRXA 1R7HA 3F4TA 3CBUA 4KX4A 3W8SA 2AB6A 2P0GA 4ZBDA 5DALA 3HJPA 1PMTA 4WETA 1GSEA 4WXTA 2E2GA 3HZ4A 1YJ6A 1SK2A 1XOBA 2C80A 1WE0A 4MJAA 4Q5NA 3RPPA 2ON5A 4LLRA 4QQ7A 2LV3A 2CX4A 1TU7A 2N5AA 1THXA 4P3YB 1GTIA 3UMAA 2QKEA 1K0AA 1TP9A 5IM9A 5CREA 4HDEA 4PUAA 5LNKe 2AYTA 3F0IA 4EUYA 1EEMA 1GULA 1U88A 5DCHA 3DMLA 4I97A 4TR4A 2FA8A 4ECIA 1XZOA 3TKSA 4TVEA 4AF2A 1OC3A 2MMZA 4ZL8A 3FW2A 4KB3A 2HZEB 1WOUA 3Q18A 4OFMA 4G9HA 2L6CA 1QMVA 4ZBAA 3F9UA 2H66A 2V32A 16GSA 3EWLA 5HR2A 4ULXA 2XPDA 4IQ1A 4N0ZA 4XCSA 4IJIA 2RUEA 3H4KA 1EP7A 2PBJA 2C0GA 2F51A 1ERTA 3H8QA 5A4VA 1PX6A 4H86A 2L59A 4MF5A 1BX9A 1CQHA 2AV4A 3N9JA 3FZ4A 1E2YA 2R4VA 3BBYA 5J5NA 1YF0A 3APQA 1WPIA 4MPFA 3BCKA 3LEFA 2OBIA 4OMVA 5ECIB 5EPFA 5IPHA 2LNSA 4BVYA 1MD4A 5IMCA 3A3TA 1XXUA 1FO5A 3A2VA 2C0EA 3ME7A 3ZVJA 1FOVA 4GLTA 1KTEA 3WGXA 18GSA 1AAZA 1Z5YE 1A24A 2H1DA 2DJ0A 2D2ZA 2GT6A 1TRUA 2X64A 5DAKA 3F6FA 1F3AA 3VWWA 2B7JA 1XWBA 1WMJA 1IYHA 2PGTA 2FWFA 3FZ5A 3EE2A 3MNGA 3ZMKA 3PINA 5DQYA 1TK0B 5D9VA 4AJ6A 1RK4A 2XC2A 1V40A 2VM1A 1Z3EA 5H5SA 2E7PA 2CVBA 3TOUA 4WBJA 4F03A 1ZZYA 2VLTA 2CVKA 3LWAA 1TRVA 3KEBA 4YQMA 1K0BA 4OO5A 3KP9A 4OD7A 2JACA 3LSZA 1W89A 1O8XA 1AQXA 4O32A 1K3YA 3WYWA 3D22A 2AJQB 2PU9C 5JCGA 3R2QA 6GSTA 1JZRA 3OR5A 1XWGA 5CRGA 3TRQA 1XIYA 3TRXA 1QGVA 5CRWA 2GSQA 1NM3A 2IMKA 3VK9A 2ZNMA 1XBSA 4TN8A 1VGLA 3CTGA 3CRTA 3IRAA 3FKFA 4K2DA 4ZXGA 2CAQA 1USBA 2LSTA 2A2RA 1GH2A 1F9MA 3VPQA 2WFCA 3GSTA 3LXZA 2ES7A 3I69A 1B4QA 2LNTA 4ACSA 2GZPA 1O6JA 2H1BA 4I8BA 4N11A 4OO4A 4V2MA 1GUHA 1F6MC 2O85A 3EYTA 3G7YA 5DCGA 2H19A 3UEMA 1SK0A 2VL3A 2IMFA 4KDYA 1A23A 2ZCTA 3UVHA 4ZL9A 3APSA 3IDVA 4KSMA 4JU5A 3D5JA 4K6XA 4WR4A 4DSSB 1SL2B 2MYGA 1TI1A 1VF1A 4AGSA 1LU4A 2H70A 2RLIA 4MDCA 1XFLA 4I2TA 3UOMA 1G6YA 5B6NA 1X5EA 3GMFA 2GTUA 1B48A 4WR5A 1YZXA 1H4OA 4RI6A 2F8AA 2H75A 1PD21 2YZUA 4YH2A 5J9CA 4O7HA 2LRCA 1GSYA 5J4UA 4MCUA 2J23A 2C3TA 1OAZA 1URMA 5L71A 2MMAA 5COHA 1M9BA 1WRYA 2L5OA 5G5FA 6GSYA 5D96A 2V2GA 2LJAA 4GRFA 3GL5A 3VURA 4E8HA 4POMA 1PKWA 5KN1A 3VLNA 2JZTA 1EV9A 4IKHA 1QXHA 2VCZA 4NAXA 4ML1A 1MTCA 4E8EA 4ECJA 6GSWA 1YKCA 4EL1A 4MP4A 2OADA 4DVCA 2MMOA 4JRRA 1KNGA 1T1VA 4HEA2 1GTBA 2N5FA 1V98A 2G0FA 3CXGA 1GSSA 3WGEA 2F3MA 3M0FA 1JLWA 1NHOA 5D8IA 1EP8A 3RDWA 2O7KA 1SL1B 2EIRA 3GX8A 5G30A 5ECMB 1SJ6A 4D73A 3Q74A 2GQMA 5D9WA 2M72A 4G2EA 3EU4A 5ECHB 4FO5A 5EY6A 5IMFA 3RBTA 1AIUA 4K0NA 5CRDA 2VAFA 3F63A 3W8JA 2NVLA 2HE3A 2HI7A 2FY6A 5KN0A 2C0FA 2DJJA 5AISA 1BEDA 2GSSA 1MEKA 5ENUA 2R6KA 3GTUB 1OE8A 3F3RA 1A8LA 2FD3A 1AC1A 1AW9A 2GGTA 1HNBA 1O73A 2YV7A 2FCHA 2KUCA 1AQWA 1GRXA 1X0RA 2HLSA 4IW9A 1XW9A 3GN3A 3ME8A 3HKRA 4CW9A 5IMDA 2YCDA 2OACA 2DIZA 1Z6NA 1SJZA 1A0FA 1J0FA 2YN1A 4NHWA 2B7KA 2H6YA 3UAPA 5FWGA 3DWVA 1Q4JA 3ZTLA 1QFNA 4TR3A 3HD5A 2L6DA 4WBRD 2YJ7A 4OWYA 1WWJA 5DJLA 3P8WA 5HFGA 6GSXA 3KJYA 4DEJA 3UIWA 1THOA 5D73A 1Q98A 1T3BA 2LS5A 5IOXA 1ZMAA 1X5CA 4V2NA 4XS6A 2LQOA 4QL7A 1AXDA 2WS2A 4ECCA 4N0VA 3IR4A 1GLPA 14GSA 1O8WA 3TKSE 3QD9A 1W4VA 3D6IA 3TGZA 1M9AA 1K0NA 2DLXA 4HU9A 3HXSA 4ID0A 4POKA 2PPTA 5ID2A 4JR6A 1JZOA 3EURA 3EVIA 2LTKA 2H76A 3C8EA 4YQVA 1ST9A 3BCIA 5GAND 3H93A 4Z7XA 5F07A 1A2MA 4F82A 3LXTA 2QGVA 2H1AA 4KE3A 4J56E 3GX0A 4LA1A 2IMIA 2H01A 2OE1A 3ZRDA 5C04A 3F4SA 5D9TA 3UJ1A 2FA4A 4I2UA 1GUMA 3KH7A 4XIHA 2BTOT 2WCIA 2AHEA 1X9WB 2K9FA
chains in the Genus database with same CATH superfamily
1XCCA 4MJBA 5B8AA 2I4AA 1OC9B 5IMAA 2X8HA 1U3IA 4PNGA 5ECPB 3APOA 1A8YA 3WD6A 4GF0A 2F9SA 1SYRA 3UARA 1JZWA 3IOSA 2VO4A 1S3CA 5HR3A 2L5LA 1K3LA 4HQZA 3JCML 3V1WA 1PX7A 3FYGA 4JR4A 5CNWA 5DALB 4TXOA 2H1GA 2H73A 2O8VB 3G7JA 3PPUA 2GSRA 3HA9A 1XVQA 1PQNA 1K0MA 3GH9A 3LW9A 5AIXA 1N8JA 1V9WA 1GTAA 4K5RA 1GTUA 5ID2B 1GSUA 2EC4A 3ZLPA 4PUFC 3FY7A 2YWOA 5F0GA 3M8NA 4IVFA 2CT6A 1T4ZA 1X9MB 2PN8A 3RHCA 1R26A 1TDIA 3WT2A 2ON7A 5BRTA 2XBQA 4JE1A 2K18A 1XG8A 5ECOB 4V1Ap 4WEYA 4TR1A 2I81A 4PXOA 2L4QA 3N5OA 13GSA 2QA1A 2ALBA 1WIKA 3LORA 3TJGA 2CX3A 3FMWA 2G2QA 2RM6A 4DSQA 4RUVA 4L0UA 2GQLA 1TKDB 1K0CA 1T7PB 3RHBA 1SENA 3ZMLA 4EXJA 3D0ZA 4X1UA 2IPAA 5GAPD 1AUCA 1AQVA 2VCTA 1GLQA 2HNLA 1S3AA 2RUFA 5J3RA 4IN0A 1M7TA 3L0HA 3C71A 4IP1A 4L5OA 2VD0A 5ECLB 1DUGA 1TW9A 4FYCA 4TXOB 3C73A 1YKAA 4BWQA 1UVZA 1KEBA 2CAIA 4NV5A 5JCWA 2TRCP 5F06A 2VLVA 2FUG2 1QUWA 3MAKA 1EOGA 1A2JA 1SL0B 3VI7A 3RPNA 2PMTA 1M99A 1A2LA 1K0OA 4TR1B 1G6WA 2LEGA 3K8NA 4GTUA 2VCVA 1X9SB 4CHSA 1DE1A 1J08A 2PUKC 1IYIA 2OE0A 3LG6A 3QPMA 19GSA 1YF1A 3DIEA 5DAKB 3DEXA 1H75A 2FWEA 4HJMA 4ISDA 4BL7A 3VWXA 2B3SA 2C3NA 2R0PA 4MZCA 5HFIA 1E6BA 4ILFA 4K7IA 3IHGA 3IC4A 5CO3A 1YQ1A 3QFAC 2EIOA 1YEXA 5CYYA 4F2IA 1SJIA 3AY8A 3Q6OA 1EWXA 3BD2A 2K6VA 3HZ8A 3EMPA 5IPGA 2NPBA 5ELAA 2WULA 1Z7PA 2LUSA 1KBNA 3EC3A 3ZFLA 3LYPA 3TJJA 2LJKA 2VIMA 5AGYA 5G1KA 2C8UA 1A0RP 3O6TA 1YEPA 1EGOA 4L5LA 3CMIA 2VLUA 3KXOA 2V41A 5AIVA 2VL2C 5DDLA 17GSA 5ECNB 2WJUA 3GURA 3ZREA 1XOAA 3E0UA 3HVSA 3GL3A 2AUVA 3HVNA 3ZVJD 3NIVA 3QMXA 4J2FA 1GNWA 2REMA 4AJ7A 4EIPA 1OKTA 2BMXA 4IS0A 4CDOA 4F0CA 4TKYA 5IIZA 2R0GA 4GQFA 1GSDA 3VWUA 2IFQA 5IOWA 5HFKA 1Z6MA 1SKRB 2GZYA 2J9HA 4BL7B 3HJMA 2FLSA 1FHEA 1ERUA 3GYKA 3TJFA 1Z9HA 3TKQA 4N30A 4KGIA 1ZYPA 3CSJA 2HSHA 2LRTA 1SK1A 2O87A 5E59A 1MDJA 4MJCA 4NXIA 4MH3A 4JZQA 1BG5A 2XHFA 4KDUA 2X8CA 1EGRA 5FHIA 2PERA 2C3QA 1DBYA 4WF5A 5D9XA 3WT1A 3KM6A 4MMMA 1PFOA 1SD9A 3LYKA 2H8LA 1J9BA 5D93A 2GQKA 2TIRA 3KH9A 4L0WA 4TOPA 2DC5A 1FW1A 1MD3A 5J9BA 4EC0A 2A4HA 3CSIA 3VFIA 1ZL9A 1MDIA 2IN3A 1SU9A 4LMWA 1TK5B 4HUAA 4HI7A 2GLRA 5G1LA 5B7CA 3QOUA 1I5GA 3FHKA 4MK3A 5GSTA 3R3EA 4XS4A 4EE0A 1M2BA 1FG4A 4PQIA 1TK8B 3IHQA 3D4MA 1EEJA 4KF9A 5B8BA 2H0GA 5DBQA 3HJOA 1HQOA 1Y25A 1DE2A 1TRSA 3ZFBA 4BA7A 4PGTA 2V6KA 1U87A 2CVDA 3PR8A 1G7EA 4MNNA 2KHPA 3A2XA 1GP1A 2KLXA 3J7Yk 5KOXA 2YV9A 1TXXA 2H6ZA 2LKUA 5HR0A 2I9HA 1M0UA 4OFTA 5IO0A 4OCEA 1OVNA 5INYA 1QQ2A 4MZBA 2E2MA 3TB2A 1EZKA 2HRKA 1ERWA 1TOFA 1F37A 2C0DA 2FGXA 3WGDA 2DIYA 1JFUA 3M3MA 2M80A 3Q19A 3GHAA 3D21A 1OKDA 1RQMA 4Q5FA 2DJKA 1T00A 2NDOA 1ZYEA 1GSFA 4FIWA 4EVMA 1LBKA 4O92A 3L9SA 5JWQB 2R2JA 3TJKA 4JBBA 3F4RA 20GSA 4NPBA 9GSSA 2P5QA 4CY6A 4MA9A 3KCMA 4KH7A 3GH6A 3DXBA 1HD2A 4XS1A 1C72A 4XS4B 2MBSA 3TJBA 4D73B 1PGTA 3MSZA 1GSQA 1ML6A 2PWJA 1F2EA 22GSA 3ERWA 4GSSA 5KN2A 5HQPA 4K7NA 3BJ5A 4GSTA 3IE3A 2C1YA 2H0HA 4L8EA 1VF2A 4MF7A 4PURA 1GNEA 3KMNA 4K7OA 1G7OA 4KAEA 1O85A 4RQRA 2DMLA 3I43A 4HOJA 5KN3A 2OE3A 4MPGA 4HJ2A 4HQSA 5DQSA 3TRPA 2MBTA 4TXVA 4FH8A 3DD3A 4FYUA 3SWLA 1FVKA 3L4NA 3J7Yb 4F9ZA 2FNOA 2QC7A 2DKHA 2I1UA 3G7IA 1ZYQB 3DVWA 5G5EA 3ZIVA 2H0IA 5G2ZA 2RM5A 3FEUA 3IC8A 6GSVA 1FOHA 2XBIA 3CTFA 2IJYA 3A2WA 3PGTA 2FHEA 5ECRB 2GDRA 4GWRA 3L78A 2XPEA 4QL9A 1R5PA 5GZZB 5F8BA 1U3AA 3GKNA 3TKRA 2EIQA 2ZUPA 5DJMA 2JADA 1OYJA 3FR9A 5EL8A 1WP0A 1YDKA 3FK8A 2LQQA 3UBLA 1YY7A 5F05A 4IGJA 2YZHA 1PN9A 1Z7RA 1TU8A 4XRAA 1M3JA 2VL9A 1VF4A 4WKWA 4IQAA 4HU7A 1SD8A 2DJ2A 2HYXA 3FR3A 4N10A 1FB6A 4GCIA 5HR1A 2CZ2A 2B1KA 2VL2A 1I9DA 4BPYA 10GSA 4PQHA 3GKKA 2DSAA 3DGQA 2H74A 3BOAA 2YWNA 2IMEA 1V2AA 2B5YA 4EO3A 3TKPA 3E9JB 3UL3A 2HRNA 3QFBC 4G19A 4V1Ag 2NTOA 1XW6A 2P31A 4X43A 1TJDA 1Y6EA 1K0DA 1M2DA 1ZCPA 1FB0A 4MABA 5IMVA 2N5BA 3IPZA 1ERVA 3IK7A 2VCQA 1ZGNA 3EU3A 4XRDA 2B5EA 4AJ8A 1XWCA 2H30A 3QDNA 2GS3A 3ISOA 2RIIA 3QAWA 5H5QA 4IJ3A 4OFNA 2OA7A 2QSIA 3O3TA 3U5RE 4ECBA 4EDYA 1VRSD 1U6TA 1XPVA 5J41A 3ED3A 1FVJA 2PVQA 3DRNA 5FT3A 2AAWA 3ZITA 3C1SA 4ZL7A 4HZ4A 1X5DA 4TRXA 4EDZA 4KSOA 4V2LA 3TCOA 3KIJA 3D4TA 5AN1A 2Z9SA 4F0BA 2H71A 11GSA 4EKZA 3GIXA 4YAPA 5H5RA 2UZ8A 2BJXA 1EOHA 2YANA 1R4WA 5CRHA 2WZ9A 2V6OA 1BQ7A 4LL1B 4NMUA 3GSSA 2VD1A 3SBCA 3US3A 1N2AA 2OJLA 2L4CA 1OE7A 1PSQA 2R3XA 4JEDA 2VM2A 3C1RA 3QAGA 5LD0A 3E3EA 2L57A 5CP1A 4FYBA 4MZWA 4OCFA 2HT9A 2B1LA 2IMDA 3HHVA 3IAM2 1LJRA 1UN2A 3FRCA 1SKWB 4YQUA 4ZBBA 1S3DA 1TTZA 1BYEA 3HCZA 3GNJA 5ELGA 3HDCA 2H72A 3F6DA 4Q5QA 3RAZA 1B9XC 3ZYWA 2HSYA 2PVOC 3IBHA 1TI3A 3VWVA 4DSSA 3ERFA 4POBA 1G0TA 3MDKA 4GSNA 4K0GA 1EV4A 4IBPA 2KP2A 3FR6A 5IO2A 5ECKB 4O5RA 4PQ1A 4ZB6A 3GV1A 1PA3A 5CAXA 5GSSA 1OC8A 4KUNA 2YWIA 4GQCA 4I6XA 3GKMA 3H79A 1O81A 4ZB8A 4ZIJA 1JHBA 2JU5A 2HRFA 1NSWA 4BVXA 2CZ3A 2NBSA 1HNAA 2IWTA 3MIXA 1XW5A 1BJXA 4IELA 4YAVA 3ZZXA 2V1MA 3QAVA 2M46A 3O76A 3FZ9A 3ERGA 3LFLA 2GT5A 3TKSC 1TRWA 3DKSA 3GUSA 2YJHA 3KGKA 1V57A 3MWHA 4IHUA 2I3YA 3GRXA 1JZDA 1NW2A 2MMNA 4TW5A 1VF3A 2DJ1A 1UA5A 2JZRA 1F3BA 3FZAA 3A5WA 1FAAA 3S9FA 2KOKA 3EMXA 3KZQA 1R5AA 4HS1A 1NHYA 2R37A 1ZYNA 4MF6A 5JCUA 3UBKA 4WF4A 1T4YA 4K1FA 3IK9A 3LJRA 3GKXA 4HZ2A 4Q5RA 4YKGA 2IIYA 3QR6A 1HNCA 1PL2A 4G10A 2JZSA 2KP1A 6GSUA 4KCAA 2WB9A 4IP6A 4KA0A 2B6MA 1ON4A 1RW1A 3ZIJA 8GSSA 2YOIA 5B6MA 4EF0A 5KEJA 2FWGA 4BWSA 5ECQB 4PNFA 2H6XA 3GTUA 3EINA 3HYPA 1PKZA 2OKAA 2CA8A 2WRTA 3IXRA 4POLA 2GSTA 2JSZA 2YPMA 4XHMA 4NWYA 2DMMA 2GVPA 3P7XA 2VOCA 2P5RA 4NV2A 4LL4B 2OBKA 2LJRA 1SYXA 2CV4A 3IAS2 2IL3A 2JSYA 1QK8A 3L9UA 3TOTA 5C00A 5JWOB 5LCZA 2VCWA 3HVXA 3KP8A 4RQXA 3M9JA 2O89A 3ZL5A 4KW6A 1ILOA 2LRNA 3VI5A 1XWAA 3LGCA 4CY8A 1BAYA 1JLVA 2A2PA 2YNXA 1SKSB 3UVTA 3I6AA 3DYRA 3I9V2 1ACVA 2IFQB 3IA1A 12GSA 4K9ZA 2A4VA 4X0XA 4ML6A 1ZOFA 4YKFA 3LQ7A 2HXKA 3G9BA 6GSSA 1ABAA 4RI7A 5IMZA 3KD0A 4ZILA 4KDXA 3TUEA 3C7MA 2DBCA 3M9KA 7GSSA 1MDKA 1PL1A 2JL4A 2MZCA 1CQGA 1K3OA 3CYNA 5ECSA 1GUKA 1M2AA 2YP6A 2C4JA 2VUPA 2WDUA 5EVOA 3DVXA 2HFDA 4MJEA 2VCXA 4I5QA 3GFKA 1XWKA 5A4UA 2X8GA 4MH2A 3P90A 4Z2TA 4KCEA 2YWMA 3NZNA 2FWHA 3W6GA 3TDGA 1PRXA 3H1NA 3KTLA 3KMOA 5G31A 4GXZA 1WJKA 1DSBA 5A4WA 5E4WA 2K8VA 2R5GA 2X4AA 4X4JA 3U6VA 5BMUA 2X99A 1HYUA 2GZZA 2HZFA 1V58A 2CQ9A 3P2AA 2A2SA 1B9YC 3GA4A 5A5KA 4LMVA 4PX1A 2K8SA 5JWRB 4ZB9A 3CSHA 3M1GA 2F8FA 4ICYA 5IQYA 1B4PA 5DVBA 1XVWA 3L9VA 4NHZA 2E0QA 2HZEA 1UC7A 3PH9A 1OC9A 3KTBA 4TR0A 2WGRA 4DSRA 1GL8A 3QCPA 5ABRA 1PN0A 3IV4A 3HVVA 3NOFA 4XTSA 2DJ3A 1T8EB 4J57E 2B5XA 3F3QA 1GWCA 4K8MA 3HY2A 3CRUA 1B8XA 4KNDA 1O7UA 3VPTA 3F8UA 4MLYA 2TRXA 1R7HA 3F4TA 2QA2A 3CBUA 4KX4A 3W8SA 2AB6A 2P0GA 4ZBDA 5DALA 3HJPA 1PMTA 4WETA 1GSEA 4WXTA 2E2GA 3HZ4A 1YJ6A 1SK2A 1XOBA 2C80A 1WE0A 4MJAA 4Q5NA 3RPPA 2ON5A 4LLRA 4QQ7A 2LV3A 2CX4A 1TU7A 2N5AA 1THXA 4P3YB 1GTIA 3UMAA 2QKEA 1K0AA 1TP9A 5IM9A 5CREA 4HDEA 4PUAA 5LNKe 4K5SA 2AYTA 3F0IA 4EUYA 1EEMA 1GULA 1U88A 5DCHA 3DMLA 4I97A 4TR4A 2FA8A 4ECIA 1XZOA 3TKSA 4TVEA 4AF2A 1OC3A 2MMZA 4ZL8A 3FW2A 4KB3A 2HZEB 1WOUA 3Q18A 4OFMA 4G9HA 2L6CA 1QMVA 4ZBAA 3F9UA 2H66A 2V32A 16GSA 3EWLA 5HR2A 4ULXA 2XPDA 4IQ1A 4N0ZA 4XCSA 4IJIA 2RUEA 3H4KA 1M3IA 1EP7A 2PBJA 2C0GA 2F51A 1ERTA 3H8QA 5A4VA 1PX6A 4H86A 2L59A 4MF5A 1BX9A 4O5QA 1CQHA 2AV4A 3N9JA 3FZ4A 1E2YA 2R4VA 4Z2UA 3BBYA 5J5NA 1YF0A 3APQA 1WPIA 4MPFA 3BCKA 3LEFA 2OBIA 4OMVA 5ECIB 5EPFA 5IPHA 2LNSA 4BVYA 1MD4A 5IMCA 3A3TA 1XXUA 1FO5A 3A2VA 2C0EA 3ME7A 3ZVJA 1FOVA 4GLTA 1KTEA 3WGXA 18GSA 4Z2RA 1AAZA 1Z5YE 1A24A 2H1DA 2DJ0A 2D2ZA 2GT6A 1TRUA 2X64A 5DAKA 3F6FA 1F3AA 3VWWA 2B7JA 1XWBA 1WMJA 1IYHA 2PGTA 2FWFA 3FZ5A 3EE2A 3MNGA 4O5UA 3ZMKA 3PINA 5DQYA 1TK0B 5D9VA 4AJ6A 1RK4A 2XC2A 1V40A 2VM1A 1Z3EA 5H5SA 2E7PA 2CVBA 3TOUA 4WBJA 4F03A 1ZZYA 2VLTA 2CVKA 3LWAA 1TRVA 3KEBA 4YQMA 1K0BA 4OO5A 3KP9A 4G0LA 4OD7A 2JACA 3LSZA 1W89A 1O8XA 1AQXA 4O32A 1K3YA 3WYWA 3D22A 2AJQB 2PU9C 5JCGA 3R2QA 2HSMA 6GSTA 1JZRA 3OR5A 1XWGA 5CRGA 3TRQA 1XIYA 3A5IA 4BVYB 3TRXA 1QGVA 5CRWA 2GSQA 1NM3A 2IMKA 3VK9A 2ZNMA 1XBSA 4TN8A 1VGLA 3CTGA 3CRTA 3IRAA 3FKFA 4K2DA 4ZXGA 2CAQA 1USBA 2LSTA 2A2RA 1GH2A 1F9MA 3VPQA 2WFCA 3GSTA 3LXZA 2ES7A 3I69A 1B4QA 2LNTA 4ACSA 2GZPA 1O6JA 1S3RA 2H1BA 4I8BA 4N11A 4OO4A 4V2MA 1GUHA 1F6MC 2O85A 3EYTA 3G7YA 5DCGA 2H19A 3UEMA 1SK0A 2VL3A 2IMFA 4USSA 4KDYA 1A23A 2ZCTA 3UVHA 4ZL9A 3APSA 3EPTA 3IDVA 4KSMA 4JU5A 3D5JA 4K6XA 4WR4A 4DSSB 1SL2B 4EIQA 2MYGA 1TI1A 2DKIA 1VF1A 4AGSA 1LU4A 2H70A 2RLIA 4MDCA 1XFLA 4I2TA 3UOMA 1G6YA 5B6NA 1X5EA 3GMFA 2GTUA 2X49A 1B48A 4WR5A 1YZXA 1H4OA 4RI6A 2F8AA 2H75A 1PD21 2YZUA 4YH2A 5J9CA 4O7HA 2LRCA 1GSYA 5J4UA 4MCUA 2J23A 2C3TA 1OAZA 1URMA 5L71A 2MMAA 5COHA 1M9BA 1WRYA 4BVXB 2L5OA 5G5FA 6GSYA 5D96A 2V2GA 2LJAA 4GRFA 3GL5A 3VURA 4K2XA 4E8HA 3MYDA 4POMA 1PKWA 4G0IA 5KN1A 2JZTA 4G0KA 3VLNA 1EV9A 4IKHA 1QXHA 2VCZA 4NAXA 4ML1A 1MTCA 4E8EA 4ECJA 4PTSA 6GSWA 1YKCA 4EL1A 4MP4A 2OADA 4DVCA 2MMOA 4JRRA 1KNGA 5KOWA 1T1VA 4HEA2 1GTBA 2R0CA 2N5FA 1V98A 2G0FA 3CXGA 1GSSA 3WGEA 2F3MA 3M0FA 1JLWA 1NHOA 5D8IA 1EP8A 3RDWA 2O7KA 1SL1B 2EIRA 3GX8A 5G30A 5ECMB 1SJ6A 4D73A 3Q74A 2HRAA 2GQMA 5D9WA 2M72A 4G2EA 3EU4A 5ECHB 4FO5A 5EY6A 5IMFA 3RBTA 1AIUA 4K0NA 5CRDA 2VAFA 3F63A 3W8JA 2NVLA 2HE3A 2HI7A 2FY6A 5KN0A 2C0FA 2DJJA 5AISA 1BEDA 2GSSA 1MEKA 5ENUA 2R6KA 3GTUB 1OE8A 3F3RA 1A8LA 2FD3A 1AC1A 1AW9A 2GGTA 1HNBA 1O73A 2YV7A 2FCHA 2KUCA 1AQWA 1GRXA 1X0RA 2HLSA 4IW9A 1XW9A 3GN3A 3ME8A 3HKRA 4CW9A 5IMDA 2YCDA 2OACA 2DIZA 1Z6NA 1SJZA 1A0FA 1J0FA 2YN1A 4NHWA 2B7KA 4BIKA 2H6YA 3UAPA 5FWGA 3DWVA 4A5PA 1Q4JA 3ZTLA 1QFNA 4TR3A 3HD5A 2L6DA 4WBRD 2YJ7A 4OWYA 1WWJA 5DJLA 3P8WA 5HFGA 6GSXA 3KJYA 4DEJA 3UIWA 4HSCX 1THOA 5D73A 1Q98A 1T3BA 2LS5A 5IOXA 1ZMAA 4FQUA 1X5CA 4V2NA 4XS6A 2LQOA 4QL7A 1AXDA 2WS2A 4ECCA 4N0VA 3IR4A 1GLPA 14GSA 1O8WA 3TKSE 3QD9A 1W4VA 3D6IA 3TGZA 1M9AA 1K0NA 2DLXA 4HU9A 3HXSA 4ID0A 4POKA 2PPTA 5ID2A 4JR6A 1JZOA 3EURA 3EVIA 2LTKA 2H76A 3C8EA 4YQVA 3CQFA 1ST9A 3BCIA 5GAND 3H93A 4Z7XA 5F07A 1A2MA 4F82A 3LXTA 2QGVA 2H1AA 4KE3A 4J56E 3GX0A 4LA1A 2IMIA 2H01A 2OE1A 3ZRDA 5C04A 3F4SA 5D9TA 3UJ1A 2FA4A 4I2UA 1GUMA 3KH7A 4XIHA 2BTOT 2WCIA 2AHEA 1X9WB 2K9FA
chains in the Genus database with same CATH topology
1XCCA 4MJBA 5B8AA 2I4AA 1OC9B 5IMAA 2X8HA 1U3IA 4PNGA 5ECPB 3APOA 1A8YA 3WD6A 4GF0A 2F9SA 1SYRA 3UARA 1JZWA 3IOSA 2VO4A 1S3CA 5HR3A 2L5LA 1K3LA 4HQZA 3JCML 3V1WA 1PX7A 3FYGA 4JR4A 5CNWA 5DALB 4TXOA 2H1GA 2H73A 2O8VB 3G7JA 3PPUA 2GSRA 3HA9A 1XVQA 1PQNA 1K0MA 3GH9A 3LW9A 5AIXA 1N8JA 1V9WA 1GTAA 4K5RA 1GTUA 5ID2B 1GSUA 2EC4A 3ZLPA 4PUFC 3FY7A 2YWOA 5F0GA 3M8NA 4IVFA 2CT6A 1T4ZA 1X9MB 2PN8A 3RHCA 1R26A 1TDIA 3WT2A 2ON7A 5BRTA 2XBQA 4JE1A 2K18A 5ECOB 4V1Ap 4WEYA 4TR1A 2I81A 4PXOA 2L4QA 3N5OA 13GSA 2QA1A 2ALBA 1WIKA 3LORA 3TJGA 2CX3A 3FMWA 2G2QA 2RM6A 4DSQA 4RUVA 4L0UA 2GQLA 1TKDB 1K0CA 1T7PB 3RHBA 1SENA 3ZMLA 4EXJA 3D0ZA 4X1UA 2IPAA 5GAPD 1AUCA 1AQVA 2VCTA 1GLQA 2HNLA 1S3AA 2RUFA 5J3RA 4IN0A 1M7TA 3L0HA 3C71A 4IP1A 4L5OA 2VD0A 5ECLB 1DUGA 1TW9A 4FYCA 4TXOB 3C73A 1YKAA 4BWQA 1UVZA 1KEBA 2CAIA 4NV5A 5JCWA 2TRCP 5F06A 2VLVA 2FUG2 1QUWA 3MAKA 1EOGA 1A2JA 1SL0B 3VI7A 3RPNA 2PMTA 1M99A 1A2LA 1K0OA 4TR1B 1G6WA 2LEGA 3K8NA 4GTUA 2VCVA 1X9SB 4CHSA 1DE1A 1J08A 2PUKC 1IYIA 2OE0A 3LG6A 3QPMA 19GSA 1YF1A 3DIEA 5DAKB 3DEXA 1H75A 2FWEA 4HJMA 4ISDA 4BL7A 3VWXA 2B3SA 2C3NA 2R0PA 4MZCA 5HFIA 1E6BA 4ILFA 4K7IA 3IHGA 3IC4A 5CO3A 1YQ1A 3QFAC 2EIOA 1YEXA 5CYYA 4F2IA 1SJIA 3AY8A 3Q6OA 1EWXA 3BD2A 2K6VA 3HZ8A 3EMPA 5IPGA 2NPBA 5ELAA 2WULA 1Z7PA 2LUSA 1KBNA 3EC3A 3ZFLA 3LYPA 3TJJA 2LJKA 2VIMA 5AGYA 5G1KA 2C8UA 1A0RP 3O6TA 1YEPA 1EGOA 4L5LA 3CMIA 2VLUA 3KXOA 2V41A 5AIVA 2VL2C 5DDLA 17GSA 5ECNB 2WJUA 3GURA 3ZREA 1XOAA 3E0UA 3HVSA 3GL3A 2AUVA 3ZVJD 3NIVA 3QMXA 4J2FA 1GNWA 2REMA 4AJ7A 4EIPA 1OKTA 2BMXA 4IS0A 4CDOA 4F0CA 4TKYA 5IIZA 2R0GA 4GQFA 1GSDA 3VWUA 2IFQA 5IOWA 5HFKA 1Z6MA 1SKRB 2GZYA 2J9HA 4BL7B 3HJMA 2FLSA 1FHEA 1ERUA 3GYKA 3TJFA 1Z9HA 3TKQA 4N30A 4KGIA 1ZYPA 3CSJA 2HSHA 2LRTA 1SK1A 2O87A 5E59A 1MDJA 4MJCA 4NXIA 4MH3A 4JZQA 1BG5A 2XHFA 4KDUA 2X8CA 1EGRA 5FHIA 2PERA 2C3QA 1DBYA 4WF5A 5D9XA 3WT1A 3KM6A 4MMMA 1SD9A 3LYKA 2H8LA 1J9BA 5D93A 2GQKA 2TIRA 3KH9A 4L0WA 4TOPA 2DC5A 1FW1A 1MD3A 5J9BA 4EC0A 2A4HA 3CSIA 3VFIA 1ZL9A 1MDIA 2IN3A 1SU9A 4LMWA 1TK5B 4HUAA 4HI7A 2GLRA 5G1LA 5B7CA 3QOUA 1I5GA 3FHKA 4MK3A 5GSTA 3R3EA 4XS4A 4EE0A 1M2BA 1FG4A 4PQIA 1TK8B 3IHQA 3D4MA 1EEJA 4KF9A 5B8BA 2H0GA 5DBQA 3HJOA 1HQOA 1Y25A 1DE2A 1TRSA 3ZFBA 4BA7A 4PGTA 2V6KA 1U87A 2CVDA 3PR8A 1G7EA 4MNNA 2KHPA 3A2XA 1GP1A 2KLXA 3J7Yk 5KOXA 2YV9A 1TXXA 2H6ZA 2LKUA 5HR0A 2I9HA 1M0UA 4OFTA 5IO0A 4OCEA 1OVNA 5INYA 1QQ2A 4MZBA 2E2MA 3TB2A 1EZKA 2HRKA 1ERWA 1TOFA 1F37A 2C0DA 2FGXA 3WGDA 2DIYA 1JFUA 3M3MA 2M80A 3Q19A 3GHAA 3D21A 1OKDA 1RQMA 4Q5FA 2DJKA 1T00A 2NDOA 1ZYEA 1GSFA 4FIWA 4EVMA 1LBKA 4O92A 3L9SA 5JWQB 2R2JA 3TJKA 4JBBA 3F4RA 20GSA 4NPBA 9GSSA 2P5QA 4CY6A 4MA9A 3KCMA 4KH7A 3GH6A 3DXBA 1HD2A 4XS1A 1C72A 4XS4B 2MBSA 3TJBA 4D73B 1PGTA 3MSZA 1GSQA 1ML6A 2PWJA 1F2EA 22GSA 3ERWA 4GSSA 5KN2A 5HQPA 4K7NA 3BJ5A 4GSTA 3IE3A 2C1YA 2H0HA 4L8EA 1VF2A 4MF7A 4PURA 1GNEA 3KMNA 4K7OA 1G7OA 4KAEA 1O85A 4RQRA 2DMLA 3I43A 4HOJA 5KN3A 2OE3A 4MPGA 4HJ2A 4HQSA 5DQSA 3TRPA 2MBTA 4TXVA 4FH8A 3DD3A 4FYUA 3SWLA 1FVKA 3L4NA 3J7Yb 4F9ZA 2FNOA 2QC7A 2DKHA 2I1UA 3G7IA 1ZYQB 3DVWA 5G5EA 3ZIVA 2H0IA 5G2ZA 2RM5A 3FEUA 3IC8A 6GSVA 1FOHA 2XBIA 3CTFA 2IJYA 3A2WA 3PGTA 2FHEA 5ECRB 2GDRA 4GWRA 3L78A 2XPEA 4QL9A 1R5PA 5GZZB 5F8BA 1U3AA 3GKNA 3TKRA 2EIQA 2ZUPA 5DJMA 2JADA 1OYJA 3FR9A 5EL8A 1WP0A 1YDKA 3FK8A 2LQQA 3UBLA 1YY7A 5F05A 4IGJA 2YZHA 1PN9A 1Z7RA 1TU8A 4XRAA 2VL9A 1VF4A 4WKWA 4IQAA 4HU7A 1SD8A 2DJ2A 2HYXA 3FR3A 4N10A 1FB6A 4GCIA 5HR1A 2CZ2A 2B1KA 2VL2A 1I9DA 4BPYA 10GSA 4PQHA 3GKKA 2DSAA 3DGQA 2H74A 3BOAA 2YWNA 2IMEA 1V2AA 2B5YA 4EO3A 3TKPA 3E9JB 3UL3A 2HRNA 3QFBC 4G19A 4V1Ag 2NTOA 1XW6A 2P31A 4X43A 1TJDA 1Y6EA 1K0DA 1M2DA 1ZCPA 1FB0A 4MABA 5IMVA 2N5BA 3IPZA 1ERVA 3IK7A 2VCQA 1ZGNA 3EU3A 4XRDA 2B5EA 4AJ8A 1XWCA 2H30A 3QDNA 2GS3A 3ISOA 2RIIA 3QAWA 5H5QA 4IJ3A 4OFNA 2OA7A 2QSIA 3O3TA 3U5RE 4ECBA 4EDYA 1VRSD 1U6TA 1XPVA 5J41A 3ED3A 1FVJA 2PVQA 3DRNA 5FT3A 2AAWA 3ZITA 3C1SA 4ZL7A 4HZ4A 1X5DA 4TRXA 4EDZA 4KSOA 4V2LA 3TCOA 3KIJA 3D4TA 5AN1A 2Z9SA 4F0BA 2H71A 11GSA 4EKZA 3GIXA 4YAPA 5H5RA 2UZ8A 2BJXA 1EOHA 2YANA 1R4WA 5CRHA 2WZ9A 2V6OA 1BQ7A 4LL1B 4NMUA 3GSSA 2VD1A 3SBCA 3US3A 1N2AA 2OJLA 2L4CA 1OE7A 1PSQA 2R3XA 4JEDA 2VM2A 3C1RA 3QAGA 5LD0A 3E3EA 2L57A 5CP1A 4FYBA 4MZWA 4OCFA 2HT9A 2B1LA 2IMDA 3HHVA 3IAM2 1LJRA 1UN2A 3FRCA 1SKWB 4YQUA 4ZBBA 1S3DA 1TTZA 1BYEA 3HCZA 3GNJA 5ELGA 3HDCA 2H72A 3F6DA 4Q5QA 3RAZA 1B9XC 3ZYWA 2HSYA 2PVOC 3IBHA 1TI3A 3VWVA 4DSSA 3ERFA 4POBA 1G0TA 3MDKA 4GSNA 4K0GA 1EV4A 4IBPA 2KP2A 3FR6A 5IO2A 5ECKB 4O5RA 4PQ1A 4ZB6A 3GV1A 1PA3A 5CAXA 5GSSA 1OC8A 4KUNA 2YWIA 4GQCA 4I6XA 3GKMA 3H79A 1O81A 4ZB8A 4ZIJA 1JHBA 2JU5A 2HRFA 1NSWA 4BVXA 2CZ3A 2NBSA 1HNAA 2IWTA 3MIXA 1XW5A 1BJXA 4IELA 4YAVA 3ZZXA 2V1MA 3QAVA 2M46A 3O76A 3FZ9A 3ERGA 3LFLA 2GT5A 3TKSC 1TRWA 3DKSA 3GUSA 2YJHA 3KGKA 1V57A 3MWHA 4IHUA 2I3YA 3GRXA 1JZDA 1NW2A 2MMNA 4TW5A 1VF3A 2DJ1A 1UA5A 2JZRA 1F3BA 3FZAA 3A5WA 1FAAA 3S9FA 2KOKA 3EMXA 3KZQA 1R5AA 4HS1A 1NHYA 2R37A 1ZYNA 4MF6A 5JCUA 3UBKA 4WF4A 1T4YA 4K1FA 3IK9A 3LJRA 3GKXA 4HZ2A 4Q5RA 4YKGA 2IIYA 3QR6A 1HNCA 1PL2A 4G10A 2JZSA 2KP1A 6GSUA 4KCAA 2WB9A 4IP6A 4KA0A 2B6MA 1ON4A 1RW1A 3ZIJA 8GSSA 2YOIA 5B6MA 4EF0A 5KEJA 2FWGA 4BWSA 5ECQB 4PNFA 2H6XA 3GTUA 3EINA 3HYPA 1PKZA 2OKAA 2CA8A 2WRTA 3IXRA 4POLA 2GSTA 2JSZA 2YPMA 4XHMA 4NWYA 2DMMA 2GVPA 3P7XA 2VOCA 2P5RA 4NV2A 4LL4B 2OBKA 2LJRA 1SYXA 2CV4A 3IAS2 2IL3A 2JSYA 1QK8A 3L9UA 3TOTA 5C00A 5JWOB 5LCZA 2VCWA 3HVXA 3KP8A 4RQXA 3M9JA 2O89A 3ZL5A 4KW6A 1ILOA 2LRNA 3VI5A 1XWAA 3LGCA 4CY8A 1BAYA 1JLVA 2A2PA 2YNXA 1SKSB 3UVTA 3I6AA 3DYRA 3I9V2 1ACVA 2IFQB 3IA1A 12GSA 4K9ZA 2A4VA 4X0XA 4ML6A 1ZOFA 4YKFA 3LQ7A 2HXKA 3G9BA 6GSSA 1ABAA 4RI7A 5IMZA 3KD0A 4ZILA 4KDXA 3TUEA 3C7MA 2DBCA 3M9KA 7GSSA 1MDKA 1PL1A 2JL4A 2MZCA 1CQGA 1K3OA 3CYNA 5ECSA 1GUKA 1M2AA 2YP6A 2C4JA 2VUPA 2WDUA 5EVOA 3DVXA 2HFDA 4MJEA 2VCXA 4I5QA 3GFKA 1XWKA 5A4UA 2X8GA 4MH2A 3P90A 4Z2TA 4KCEA 2YWMA 3NZNA 2FWHA 3W6GA 3TDGA 1PRXA 3H1NA 3KTLA 3KMOA 5G31A 4GXZA 1WJKA 1DSBA 5A4WA 5E4WA 2K8VA 2R5GA 2X4AA 4X4JA 3U6VA 5BMUA 2X99A 1HYUA 2GZZA 2HZFA 1V58A 2CQ9A 3P2AA 2A2SA 1B9YC 3GA4A 5A5KA 4LMVA 4PX1A 2K8SA 5JWRB 4ZB9A 3CSHA 3M1GA 2F8FA 4ICYA 5IQYA 1B4PA 5DVBA 1XVWA 3L9VA 4NHZA 2E0QA 2HZEA 1UC7A 3PH9A 1OC9A 3KTBA 4TR0A 2WGRA 4DSRA 1GL8A 3QCPA 5ABRA 1PN0A 3IV4A 3HVVA 3NOFA 4XTSA 2DJ3A 1T8EB 4J57E 2B5XA 3F3QA 1GWCA 4K8MA 3HY2A 3CRUA 1B8XA 4KNDA 1O7UA 3VPTA 3F8UA 4MLYA 2TRXA 1R7HA 3F4TA 2QA2A 3CBUA 4KX4A 3W8SA 2AB6A 2P0GA 4ZBDA 5DALA 3HJPA 1PMTA 4WETA 1GSEA 4WXTA 2E2GA 3HZ4A 1YJ6A 1SK2A 1XOBA 2C80A 1WE0A 4MJAA 4Q5NA 3RPPA 2ON5A 4LLRA 4QQ7A 2LV3A 2CX4A 1TU7A 2N5AA 1THXA 4P3YB 1GTIA 3UMAA 2QKEA 1K0AA 1TP9A 5IM9A 5CREA 4HDEA 4PUAA 5LNKe 4K5SA 2AYTA 3F0IA 4EUYA 1EEMA 1GULA 1U88A 5DCHA 3DMLA 4I97A 4TR4A 2FA8A 4ECIA 1XZOA 3TKSA 4TVEA 4AF2A 1OC3A 2MMZA 4ZL8A 3FW2A 4KB3A 2HZEB 1WOUA 3Q18A 4OFMA 4G9HA 2L6CA 1QMVA 4ZBAA 3F9UA 2H66A 2V32A 16GSA 3EWLA 5HR2A 4ULXA 2XPDA 4IQ1A 4N0ZA 4XCSA 4IJIA 2RUEA 3H4KA 1EP7A 2PBJA 2C0GA 2F51A 1ERTA 3H8QA 5A4VA 1PX6A 4H86A 2L59A 4MF5A 1BX9A 4O5QA 1CQHA 2AV4A 3N9JA 3FZ4A 1E2YA 2R4VA 4Z2UA 3BBYA 5J5NA 1YF0A 3APQA 1WPIA 4MPFA 3BCKA 3LEFA 2OBIA 4OMVA 5ECIB 5EPFA 5IPHA 2LNSA 4BVYA 1MD4A 5IMCA 3A3TA 1XXUA 1FO5A 3A2VA 2C0EA 3ME7A 3ZVJA 1FOVA 4GLTA 1KTEA 3WGXA 18GSA 4Z2RA 1AAZA 1Z5YE 1A24A 2H1DA 2DJ0A 2D2ZA 2GT6A 1TRUA 2X64A 5DAKA 3F6FA 1F3AA 3VWWA 2B7JA 1XWBA 1WMJA 1IYHA 2PGTA 2FWFA 3FZ5A 3EE2A 3MNGA 4O5UA 3ZMKA 3PINA 5DQYA 1TK0B 5D9VA 4AJ6A 1RK4A 2XC2A 1V40A 2VM1A 1Z3EA 5H5SA 2E7PA 2CVBA 3TOUA 4WBJA 4F03A 1ZZYA 2VLTA 2CVKA 3LWAA 1TRVA 3KEBA 4YQMA 1K0BA 4OO5A 3KP9A 4G0LA 4OD7A 2JACA 3LSZA 1W89A 1O8XA 1AQXA 4O32A 1K3YA 3WYWA 3D22A 2AJQB 2PU9C 5JCGA 3R2QA 2HSMA 6GSTA 1JZRA 3OR5A 1XWGA 5CRGA 3TRQA 1XIYA 3A5IA 4BVYB 3TRXA 1QGVA 5CRWA 2GSQA 1NM3A 2IMKA 3VK9A 2ZNMA 1XBSA 4TN8A 1VGLA 3CTGA 3CRTA 3IRAA 3FKFA 4K2DA 4ZXGA 2CAQA 1USBA 2LSTA 2A2RA 1GH2A 1F9MA 3VPQA 2WFCA 3GSTA 3LXZA 2ES7A 3I69A 1B4QA 2LNTA 4ACSA 2GZPA 1O6JA 2H1BA 4I8BA 4N11A 4OO4A 4V2MA 1GUHA 1F6MC 2O85A 3EYTA 3G7YA 5DCGA 2H19A 3UEMA 1SK0A 2VL3A 2IMFA 4USSA 4KDYA 1A23A 2ZCTA 3UVHA 4ZL9A 3APSA 3EPTA 3IDVA 4KSMA 4JU5A 3D5JA 4K6XA 4WR4A 4DSSB 1SL2B 4EIQA 2MYGA 1TI1A 2DKIA 1VF1A 4AGSA 1LU4A 2H70A 2RLIA 4MDCA 1XFLA 4I2TA 3UOMA 1G6YA 5B6NA 1X5EA 3GMFA 2GTUA 2X49A 1B48A 4WR5A 1YZXA 1H4OA 4RI6A 2F8AA 2H75A 1PD21 2YZUA 4YH2A 5J9CA 4O7HA 2LRCA 1GSYA 5J4UA 4MCUA 2J23A 2C3TA 1OAZA 1URMA 5L71A 2MMAA 5COHA 1M9BA 1WRYA 4BVXB 2L5OA 5G5FA 6GSYA 5D96A 2V2GA 2LJAA 4GRFA 3GL5A 3VURA 4K2XA 4E8HA 3MYDA 4POMA 1PKWA 4G0IA 5KN1A 2JZTA 4G0KA 3VLNA 1EV9A 4IKHA 1QXHA 2VCZA 4NAXA 4ML1A 1MTCA 4E8EA 4ECJA 4PTSA 6GSWA 1YKCA 4EL1A 4MP4A 2OADA 4DVCA 2MMOA 4JRRA 1KNGA 5KOWA 1T1VA 4HEA2 1GTBA 2R0CA 2N5FA 1V98A 2G0FA 3CXGA 1GSSA 3WGEA 2F3MA 3M0FA 1JLWA 1NHOA 5D8IA 1EP8A 3RDWA 2O7KA 1SL1B 2EIRA 3GX8A 5G30A 5ECMB 1SJ6A 4D73A 3Q74A 2HRAA 2GQMA 5D9WA 2M72A 4G2EA 3EU4A 5ECHB 4FO5A 5EY6A 5IMFA 3RBTA 1AIUA 4K0NA 5CRDA 2VAFA 3F63A 3W8JA 2NVLA 2HE3A 2HI7A 2FY6A 5KN0A 2C0FA 2DJJA 5AISA 1BEDA 2GSSA 1MEKA 5ENUA 2R6KA 3GTUB 1OE8A 3F3RA 1A8LA 2FD3A 1AC1A 1AW9A 2GGTA 1HNBA 1O73A 2YV7A 2FCHA 2KUCA 1AQWA 1GRXA 1X0RA 2HLSA 4IW9A 1XW9A 3GN3A 3ME8A 3HKRA 4CW9A 5IMDA 2YCDA 2OACA 2DIZA 1Z6NA 1SJZA 1A0FA 1J0FA 2YN1A 4NHWA 2B7KA 2H6YA 3UAPA 5FWGA 3DWVA 4A5PA 1Q4JA 3ZTLA 1QFNA 4TR3A 3HD5A 2L6DA 4WBRD 2YJ7A 4OWYA 1WWJA 5DJLA 3P8WA 5HFGA 6GSXA 3KJYA 4DEJA 3UIWA 1THOA 5D73A 1Q98A 1T3BA 2LS5A 5IOXA 1ZMAA 4FQUA 1X5CA 4V2NA 4XS6A 2LQOA 4QL7A 1AXDA 2WS2A 4ECCA 4N0VA 3IR4A 1GLPA 14GSA 1O8WA 3TKSE 3QD9A 1W4VA 3D6IA 3TGZA 1M9AA 1K0NA 2DLXA 4HU9A 3HXSA 4ID0A 4POKA 2PPTA 5ID2A 4JR6A 1JZOA 3EURA 3EVIA 2LTKA 2H76A 3C8EA 4YQVA 1ST9A 3BCIA 5GAND 3H93A 4Z7XA 5F07A 1A2MA 4F82A 3LXTA 2QGVA 2H1AA 4KE3A 4J56E 3GX0A 4LA1A 2IMIA 2H01A 2OE1A 3ZRDA 5C04A 3F4SA 5D9TA 3UJ1A 2FA4A 4I2UA 1GUMA 3KH7A 4XIHA 2BTOT 2WCIA 2AHEA 1X9WB 2K9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XCC A;  4MJB A;  5B8A A;  2I4A A;  1OC9 B;  5IMA A;  2X8H A;  1U3I A;  4PNG A;  5ECP B;  3APO A;  1A8Y A;  3WD6 A;  4GF0 A;  2F9S A;  1SYR A;  3UAR A;  1JZW A;  3IOS A;  2VO4 A;  1S3C A;  5HR3 A;  2L5L A;  1K3L A;  4HQZ A;  3JCM L;  3V1W A;  1PX7 A;  3FYG A;  4JR4 A;  5CNW A;  5DAL B;  4TXO A;  2H1G A;  2H73 A;  2O8V B;  3G7J A;  2GSR A;  3HA9 A;  1XVQ A;  1PQN A;  1K0M A;  3GH9 A;  5AIX A;  1N8J A;  1V9W A;  1GTA A;  1GTU A;  5ID2 B;  1GSU A;  2EC4 A;  3ZLP A;  4PUF C;  3FY7 A;  2YWO A;  5F0G A;  3M8N A;  4IVF A;  2CT6 A;  1T4Z A;  1X9M B;  2PN8 A;  3RHC A;  1R26 A;  1TDI A;  3WT2 A;  2ON7 A;  2XBQ A;  4JE1 A;  2K18 A;  5ECO B;  4V1A p;  4WEY A;  4TR1 A;  2I81 A;  4PXO A;  2L4Q A;  3N5O A;  13GS A;  2ALB A;  1WIK A;  3LOR A;  3TJG A;  2CX3 A;  2G2Q A;  2RM6 A;  4DSQ A;  4RUV A;  4L0U A;  2GQL A;  1TKD B;  1K0C A;  1T7P B;  3RHB A;  1SEN A;  3ZML A;  4EXJ A;  3D0Z A;  4X1U A;  2IPA A;  5GAP D;  1AUC A;  1AQV A;  2VCT A;  1GLQ A;  2HNL A;  1S3A A;  2RUF A;  5J3R A;  4IN0 A;  1M7T A;  3L0H A;  3C71 A;  4IP1 A;  4L5O A;  2VD0 A;  5ECL B;  1DUG A;  1TW9 A;  4FYC A;  4TXO B;  3C73 A;  1YKA A;  4BWQ A;  1UVZ A;  1KEB A;  2CAI A;  4NV5 A;  5JCW A;  2TRC P;  5F06 A;  2VLV A;  2FUG 2;  1QUW A;  3MAK A;  1EOG A;  1A2J A;  1SL0 B;  3VI7 A;  3RPN A;  2PMT A;  1M99 A;  1A2L A;  1K0O A;  4TR1 B;  1G6W A;  2LEG A;  3K8N A;  4GTU A;  2VCV A;  1X9S B;  4CHS A;  1DE1 A;  1J08 A;  2PUK C;  1IYI A;  2OE0 A;  3LG6 A;  3QPM A;  19GS A;  1YF1 A;  3DIE A;  5DAK B;  3DEX A;  1H75 A;  2FWE A;  4HJM A;  4ISD A;  4BL7 A;  3VWX A;  2B3S A;  2C3N A;  4MZC A;  5HFI A;  1E6B A;  4ILF A;  4K7I A;  3IC4 A;  5CO3 A;  1YQ1 A;  3QFA C;  2EIO A;  1YEX A;  5CYY A;  4F2I A;  1SJI A;  3AY8 A;  3Q6O A;  1EWX A;  3BD2 A;  2K6V A;  3HZ8 A;  3EMP A;  5IPG A;  2NPB A;  5ELA A;  2WUL A;  1Z7P A;  2LUS A;  1KBN A;  3EC3 A;  3ZFL A;  3LYP A;  3TJJ A;  2LJK A;  2VIM A;  5AGY A;  5G1K A;  2C8U A;  1A0R P;  3O6T A;  1YEP A;  1EGO A;  4L5L A;  3CMI A;  2VLU A;  3KXO A;  2V41 A;  5AIV A;  2VL2 C;  5DDL A;  17GS A;  5ECN B;  2WJU A;  3GUR A;  3ZRE A;  1XOA A;  3E0U A;  3HVS A;  3GL3 A;  2AUV A;  3ZVJ D;  3NIV A;  3QMX A;  4J2F A;  1GNW A;  2REM A;  4AJ7 A;  1OKT A;  2BMX A;  4IS0 A;  4CDO A;  4F0C A;  4TKY A;  5IIZ A;  4GQF A;  1GSD A;  3VWU A;  2IFQ A;  5IOW A;  5HFK A;  1Z6M A;  1SKR B;  2GZY A;  2J9H A;  3HJM A;  2FLS A;  1FHE A;  1ERU A;  3GYK A;  3TJF A;  1Z9H A;  3TKQ A;  4N30 A;  4KGI A;  3CSJ A;  2HSH A;  2LRT A;  1SK1 A;  2O87 A;  5E59 A;  1MDJ A;  4MJC A;  4NXI A;  4MH3 A;  4JZQ A;  1BG5 A;  2XHF A;  4KDU A;  2X8C A;  1EGR A;  5FHI A;  2PER A;  2C3Q A;  1DBY A;  4WF5 A;  5D9X A;  3WT1 A;  3KM6 A;  4MMM A;  1SD9 A;  3LYK A;  2H8L A;  1J9B A;  5D93 A;  2GQK A;  2TIR A;  3KH9 A;  4L0W A;  4TOP A;  2DC5 A;  1FW1 A;  1MD3 A;  5J9B A;  4EC0 A;  3CSI A;  3VFI A;  1ZL9 A;  1MDI A;  2IN3 A;  1SU9 A;  4LMW A;  1TK5 B;  4HUA A;  4HI7 A;  2GLR A;  5G1L A;  5B7C A;  3QOU A;  1I5G A;  3FHK A;  4MK3 A;  5GST A;  4XS4 A;  4EE0 A;  1M2B A;  1FG4 A;  4PQI A;  1TK8 B;  3IHQ A;  3D4M A;  1EEJ A;  5B8B A;  2H0G A;  5DBQ A;  3HJO A;  1HQO A;  1Y25 A;  1DE2 A;  1TRS A;  3ZFB A;  4BA7 A;  4PGT A;  2V6K A;  1U87 A;  2CVD A;  3PR8 A;  1G7E A;  2KHP A;  3A2X A;  1GP1 A;  2KLX A;  3J7Y k;  2YV9 A;  1TXX A;  2H6Z A;  2LKU A;  5HR0 A;  2I9H A;  1M0U A;  4OFT A;  5IO0 A;  4OCE A;  1OVN A;  5INY A;  1QQ2 A;  4MZB A;  2E2M A;  3TB2 A;  1EZK A;  1ERW A;  1TOF A;  1F37 A;  2C0D A;  2FGX A;  3WGD A;  2DIY A;  1JFU A;  3M3M A;  2M80 A;  3Q19 A;  3GHA A;  3D21 A;  1OKD A;  1RQM A;  4Q5F A;  2DJK A;  1T00 A;  2NDO A;  1ZYE A;  1GSF A;  4FIW A;  4EVM A;  1LBK A;  4O92 A;  3L9S A;  5JWQ B;  2R2J A;  3TJK A;  4JBB A;  3F4R A;  20GS A;  4NPB A;  9GSS A;  2P5Q A;  4MA9 A;  3KCM A;  4KH7 A;  3GH6 A;  3DXB A;  1HD2 A;  4XS1 A;  1C72 A;  4XS4 B;  2MBS A;  3TJB A;  4D73 B;  1PGT A;  3MSZ A;  1GSQ A;  1ML6 A;  2PWJ A;  1F2E A;  22GS A;  3ERW A;  4GSS A;  5KN2 A;  5HQP A;  4K7N A;  3BJ5 A;  4GST A;  3IE3 A;  2C1Y A;  2H0H A;  4L8E A;  1VF2 A;  4MF7 A;  4PUR A;  1GNE A;  3KMN A;  4K7O A;  1G7O A;  4KAE A;  1O85 A;  4RQR A;  2DML A;  3I43 A;  4HOJ A;  5KN3 A;  2OE3 A;  4MPG A;  4HJ2 A;  4HQS A;  5DQS A;  3TRP A;  2MBT A;  4TXV A;  4FH8 A;  3DD3 A;  4FYU A;  3SWL A;  1FVK A;  3L4N A;  3J7Y b;  4F9Z A;  2FNO A;  2QC7 A;  2I1U A;  3G7I A;  1ZYQ B;  3DVW A;  5G5E A;  3ZIV A;  2H0I A;  5G2Z A;  2RM5 A;  3FEU A;  6GSV A;  2XBI A;  3CTF A;  2IJY A;  3A2W A;  3PGT A;  2FHE A;  5ECR B;  2GDR A;  4GWR A;  3L78 A;  2XPE A;  4QL9 A;  1R5P A;  5GZZ B;  5F8B A;  1U3A A;  3GKN A;  3TKR A;  2EIQ A;  2ZUP A;  5DJM A;  2JAD A;  1OYJ A;  3FR9 A;  5EL8 A;  1WP0 A;  1YDK A;  3FK8 A;  2LQQ A;  3UBL A;  1YY7 A;  5F05 A;  4IGJ A;  2YZH A;  1PN9 A;  1Z7R A;  1TU8 A;  4XRA A;  2VL9 A;  1VF4 A;  4WKW A;  4IQA A;  4HU7 A;  1SD8 A;  2DJ2 A;  2HYX A;  3FR3 A;  4N10 A;  1FB6 A;  4GCI A;  5HR1 A;  2CZ2 A;  2B1K A;  2VL2 A;  1I9D A;  4BPY A;  10GS A;  4PQH A;  3GKK A;  2DSA A;  3DGQ A;  2H74 A;  3BOA A;  2YWN A;  2IME A;  1V2A A;  2B5Y A;  4EO3 A;  3TKP A;  3E9J B;  3UL3 A;  2HRN A;  3QFB C;  4G19 A;  4V1A g;  2NTO A;  1XW6 A;  2P31 A;  4X43 A;  1TJD A;  1Y6E A;  1K0D A;  1M2D A;  1ZCP A;  1FB0 A;  4MAB A;  5IMV A;  2N5B A;  3IPZ A;  1ERV A;  3IK7 A;  2VCQ A;  1ZGN A;  3EU3 A;  4XRD A;  2B5E A;  4AJ8 A;  1XWC A;  2H30 A;  3QDN A;  2GS3 A;  3ISO A;  2RII A;  3QAW A;  5H5Q A;  4IJ3 A;  4OFN A;  2OA7 A;  2QSI A;  3O3T A;  3U5R E;  4ECB A;  4EDY A;  1VRS D;  1U6T A;  1XPV A;  5J41 A;  3ED3 A;  1FVJ A;  2PVQ A;  3DRN A;  5FT3 A;  2AAW A;  3ZIT A;  3C1S A;  4ZL7 A;  4HZ4 A;  1X5D A;  4TRX A;  4EDZ A;  4KSO A;  4V2L A;  3TCO A;  3KIJ A;  3D4T A;  5AN1 A;  2Z9S A;  4F0B A;  2H71 A;  11GS A;  4EKZ A;  3GIX A;  4YAP A;  5H5R A;  2BJX A;  1EOH A;  2YAN A;  1R4W A;  5CRH A;  2WZ9 A;  2V6O A;  1BQ7 A;  4LL1 B;  4NMU A;  3GSS A;  2VD1 A;  3SBC A;  3US3 A;  1N2A A;  2OJL A;  2L4C A;  1OE7 A;  1PSQ A;  2R3X A;  4JED A;  2VM2 A;  3C1R A;  3QAG A;  5LD0 A;  3E3E A;  2L57 A;  5CP1 A;  4FYB A;  4MZW A;  4OCF A;  2HT9 A;  2B1L A;  2IMD A;  3HHV A;  3IAM 2;  1LJR A;  1UN2 A;  3FRC A;  1SKW B;  4YQU A;  4ZBB A;  1S3D A;  1TTZ A;  1BYE A;  3HCZ A;  3GNJ A;  5ELG A;  3HDC A;  2H72 A;  3F6D A;  4Q5Q A;  3RAZ A;  1B9X C;  3ZYW A;  2HSY A;  2PVO C;  3IBH A;  1TI3 A;  3VWV A;  4DSS A;  3ERF A;  4POB A;  1G0T A;  3MDK A;  4GSN A;  4K0G A;  1EV4 A;  4IBP A;  2KP2 A;  3FR6 A;  5IO2 A;  5ECK B;  4O5R A;  4PQ1 A;  4ZB6 A;  3GV1 A;  1PA3 A;  5CAX A;  5GSS A;  1OC8 A;  4KUN A;  2YWI A;  4GQC A;  4I6X A;  3GKM A;  3H79 A;  1O81 A;  4ZB8 A;  4ZIJ A;  1JHB A;  2JU5 A;  2HRF A;  1NSW A;  4BVX A;  2CZ3 A;  2NBS A;  1HNA A;  2IWT A;  1XW5 A;  1BJX A;  4IEL A;  4YAV A;  3ZZX A;  2V1M A;  3QAV A;  2M46 A;  3O76 A;  3FZ9 A;  3ERG A;  3LFL A;  2GT5 A;  3TKS C;  1TRW A;  3DKS A;  3GUS A;  2YJH A;  3KGK A;  1V57 A;  3MWH A;  4IHU A;  2I3Y A;  3GRX A;  1JZD A;  1NW2 A;  2MMN A;  4TW5 A;  1VF3 A;  2DJ1 A;  1UA5 A;  2JZR A;  1F3B A;  3FZA A;  3A5W A;  1FAA A;  3S9F A;  2KOK A;  3EMX A;  3KZQ A;  1R5A A;  4HS1 A;  1NHY A;  2R37 A;  4MF6 A;  5JCU A;  3UBK A;  4WF4 A;  1T4Y A;  4K1F A;  3IK9 A;  3LJR A;  3GKX A;  4HZ2 A;  4Q5R A;  2IIY A;  3QR6 A;  1HNC A;  1PL2 A;  4G10 A;  2JZS A;  2KP1 A;  6GSU A;  4KCA A;  2WB9 A;  4IP6 A;  4KA0 A;  2B6M A;  1ON4 A;  1RW1 A;  3ZIJ A;  8GSS A;  2YOI A;  5B6M A;  4EF0 A;  5KEJ A;  2FWG A;  4BWS A;  5ECQ B;  4PNF A;  2H6X A;  3GTU A;  3EIN A;  3HYP A;  1PKZ A;  2OKA A;  2CA8 A;  2WRT A;  3IXR A;  4POL A;  2GST A;  2JSZ A;  2YPM A;  4XHM A;  4NWY A;  2DMM A;  2GVP A;  3P7X A;  2VOC A;  2P5R A;  4NV2 A;  4LL4 B;  2OBK A;  2LJR A;  1SYX A;  2CV4 A;  3IAS 2;  2IL3 A;  2JSY A;  1QK8 A;  3L9U A;  3TOT A;  5C00 A;  5JWO B;  5LCZ A;  2VCW A;  3HVX A;  3KP8 A;  4RQX A;  3M9J A;  2O89 A;  3ZL5 A;  4KW6 A;  1ILO A;  2LRN A;  3VI5 A;  1XWA A;  3LGC A;  1BAY A;  1JLV A;  2YNX A;  1SKS B;  3UVT A;  3I6A A;  3DYR A;  3I9V 2;  1ACV A;  2IFQ B;  3IA1 A;  12GS A;  4K9Z A;  2A4V A;  4X0X A;  4ML6 A;  1ZOF A;  3LQ7 A;  2HXK A;  3G9B A;  6GSS A;  1ABA A;  4RI7 A;  5IMZ A;  3KD0 A;  4ZIL A;  4KDX A;  3TUE A;  3C7M A;  2DBC A;  3M9K A;  7GSS A;  1MDK A;  1PL1 A;  2JL4 A;  2MZC A;  1CQG A;  1K3O A;  3CYN A;  5ECS A;  1GUK A;  1M2A A;  2YP6 A;  2C4J A;  2VUP A;  2WDU A;  5EVO A;  3DVX A;  2HFD A;  4MJE A;  2VCX A;  4I5Q A;  3GFK A;  1XWK A;  5A4U A;  2X8G A;  4MH2 A;  3P90 A;  4KCE A;  2YWM A;  3NZN A;  2FWH A;  3W6G A;  3TDG A;  1PRX A;  3H1N A;  3KTL A;  3KMO A;  5G31 A;  4GXZ A;  1WJK A;  1DSB A;  5A4W A;  5E4W A;  2K8V A;  2R5G A;  3U6V A;  2X99 A;  1HYU A;  2GZZ A;  2HZF A;  1V58 A;  2CQ9 A;  3P2A A;  2A2S A;  1B9Y C;  3GA4 A;  5A5K A;  4LMV A;  4PX1 A;  2K8S A;  5JWR B;  4ZB9 A;  3CSH A;  3M1G A;  2F8F A;  5IQY A;  1B4P A;  5DVB A;  1XVW A;  3L9V A;  4NHZ A;  2E0Q A;  2HZE A;  1UC7 A;  3PH9 A;  1OC9 A;  3KTB A;  4TR0 A;  2WGR A;  4DSR A;  1GL8 A;  3QCP A;  5ABR A;  3IV4 A;  3HVV A;  3NOF A;  4XTS A;  2DJ3 A;  1T8E B;  4J57 E;  2B5X A;  3F3Q A;  1GWC A;  4K8M A;  3HY2 A;  3CRU A;  1B8X A;  4KND A;  1O7U A;  3VPT A;  3F8U A;  4MLY A;  2TRX A;  1R7H A;  3F4T A;  3CBU A;  4KX4 A;  3W8S A;  2AB6 A;  2P0G A;  4ZBD A;  5DAL A;  3HJP A;  1PMT A;  4WET A;  1GSE A;  4WXT A;  2E2G A;  3HZ4 A;  1YJ6 A;  1SK2 A;  1XOB A;  2C80 A;  1WE0 A;  4MJA A;  4Q5N A;  3RPP A;  2ON5 A;  4LLR A;  4QQ7 A;  2LV3 A;  2CX4 A;  1TU7 A;  2N5A A;  1THX A;  4P3Y B;  1GTI A;  3UMA A;  2QKE A;  1K0A A;  1TP9 A;  5IM9 A;  5CRE A;  4HDE A;  4PUA A;  5LNK e;  2AYT A;  3F0I A;  4EUY A;  1EEM A;  1GUL A;  1U88 A;  5DCH A;  3DML A;  4I97 A;  4TR4 A;  2FA8 A;  4ECI A;  1XZO A;  3TKS A;  4TVE A;  4AF2 A;  1OC3 A;  2MMZ A;  4ZL8 A;  3FW2 A;  4KB3 A;  2HZE B;  1WOU A;  3Q18 A;  4OFM A;  4G9H A;  2L6C A;  1QMV A;  4ZBA A;  3F9U A;  2H66 A;  2V32 A;  16GS A;  3EWL A;  5HR2 A;  4ULX A;  2XPD A;  4IQ1 A;  4N0Z A;  4XCS A;  4IJI A;  2RUE A;  3H4K A;  1EP7 A;  2PBJ A;  2C0G A;  2F51 A;  1ERT A;  3H8Q A;  5A4V A;  1PX6 A;  4H86 A;  2L59 A;  4MF5 A;  1BX9 A;  1CQH A;  2AV4 A;  3N9J A;  3FZ4 A;  1E2Y A;  2R4V A;  3BBY A;  5J5N A;  1YF0 A;  3APQ A;  1WPI A;  4MPF A;  3BCK A;  3LEF A;  2OBI A;  4OMV A;  5ECI B;  5EPF A;  5IPH A;  2LNS A;  4BVY A;  1MD4 A;  5IMC A;  3A3T A;  1XXU A;  1FO5 A;  3A2V A;  2C0E A;  3ME7 A;  3ZVJ A;  1FOV A;  4GLT A;  1KTE A;  3WGX A;  18GS A;  1AAZ A;  1Z5Y E;  1A24 A;  2H1D A;  2DJ0 A;  2D2Z A;  2GT6 A;  1TRU A;  2X64 A;  5DAK A;  3F6F A;  1F3A A;  3VWW A;  2B7J A;  1XWB A;  1WMJ A;  1IYH A;  2PGT A;  2FWF A;  3FZ5 A;  3EE2 A;  3MNG A;  3ZMK A;  3PIN A;  5DQY A;  1TK0 B;  5D9V A;  4AJ6 A;  1RK4 A;  2XC2 A;  1V40 A;  2VM1 A;  1Z3E A;  5H5S A;  2E7P A;  2CVB A;  3TOU A;  4WBJ A;  4F03 A;  1ZZY A;  2VLT A;  2CVK A;  3LWA A;  1TRV A;  3KEB A;  4YQM A;  1K0B A;  4OO5 A;  3KP9 A;  4OD7 A;  2JAC A;  3LSZ A;  1W89 A;  1O8X A;  1AQX A;  4O32 A;  1K3Y A;  3WYW A;  3D22 A;  2AJQ B;  2PU9 C;  5JCG A;  3R2Q A;  6GST A;  1JZR A;  3OR5 A;  1XWG A;  5CRG A;  3TRQ A;  1XIY A;  3TRX A;  1QGV A;  5CRW A;  2GSQ A;  1NM3 A;  2IMK A;  3VK9 A;  2ZNM A;  1XBS A;  4TN8 A;  1VGL A;  3CTG A;  3CRT A;  3IRA A;  3FKF A;  4K2D A;  4ZXG A;  2CAQ A;  1USB A;  2LST A;  2A2R A;  1GH2 A;  1F9M A;  3VPQ A;  2WFC A;  3GST A;  3LXZ A;  2ES7 A;  3I69 A;  1B4Q A;  2LNT A;  4ACS A;  2GZP A;  1O6J A;  2H1B A;  4I8B A;  4N11 A;  4OO4 A;  4V2M A;  1GUH A;  1F6M C;  2O85 A;  3EYT A;  3G7Y A;  5DCG A;  2H19 A;  3UEM A;  1SK0 A;  2VL3 A;  2IMF A;  4KDY A;  1A23 A;  2ZCT A;  3UVH A;  4ZL9 A;  3APS A;  3IDV A;  4KSM A;  4JU5 A;  3D5J A;  4K6X A;  4WR4 A;  4DSS B;  1SL2 B;  2MYG A;  1TI1 A;  1VF1 A;  4AGS A;  1LU4 A;  2H70 A;  2RLI A;  4MDC A;  1XFL A;  4I2T A;  3UOM A;  1G6Y A;  5B6N A;  1X5E A;  3GMF A;  2GTU A;  1B48 A;  4WR5 A;  1YZX A;  1H4O A;  4RI6 A;  2F8A A;  2H75 A;  1PD2 1;  2YZU A;  4YH2 A;  5J9C A;  4O7H A;  2LRC A;  1GSY A;  5J4U A;  4MCU A;  2J23 A;  2C3T A;  1OAZ A;  1URM A;  5L71 A;  2MMA A;  5COH A;  1M9B A;  1WRY A;  2L5O A;  5G5F A;  6GSY A;  5D96 A;  2V2G A;  2LJA A;  4GRF A;  3GL5 A;  3VUR A;  4E8H A;  4POM A;  1PKW A;  5KN1 A;  3VLN A;  2JZT A;  1EV9 A;  4IKH A;  1QXH A;  2VCZ A;  4NAX A;  4ML1 A;  1MTC A;  4E8E A;  4ECJ A;  6GSW A;  1YKC A;  4EL1 A;  4MP4 A;  2OAD A;  4DVC A;  2MMO A;  4JRR A;  1KNG A;  1T1V A;  4HEA 2;  1GTB A;  2N5F A;  1V98 A;  2G0F A;  3CXG A;  1GSS A;  3WGE A;  2F3M A;  3M0F A;  1JLW A;  1NHO A;  5D8I A;  1EP8 A;  3RDW A;  2O7K A;  1SL1 B;  2EIR A;  3GX8 A;  5G30 A;  5ECM B;  1SJ6 A;  4D73 A;  3Q74 A;  2GQM A;  5D9W A;  2M72 A;  4G2E A;  3EU4 A;  5ECH B;  4FO5 A;  5EY6 A;  5IMF A;  3RBT A;  1AIU A;  4K0N A;  5CRD A;  2VAF A;  3F63 A;  3W8J A;  2NVL A;  2HE3 A;  2HI7 A;  2FY6 A;  5KN0 A;  2C0F A;  2DJJ A;  5AIS A;  1BED A;  2GSS A;  1MEK A;  5ENU A;  2R6K A;  3GTU B;  1OE8 A;  3F3R A;  1A8L A;  2FD3 A;  1AC1 A;  1AW9 A;  2GGT A;  1HNB A;  1O73 A;  2YV7 A;  2FCH A;  2KUC A;  1AQW A;  1GRX A;  1X0R A;  2HLS A;  4IW9 A;  1XW9 A;  3GN3 A;  3ME8 A;  3HKR A;  4CW9 A;  5IMD A;  2YCD A;  2OAC A;  2DIZ A;  1Z6N A;  1SJZ A;  1A0F A;  1J0F A;  2YN1 A;  4NHW A;  2B7K A;  2H6Y A;  3UAP A;  5FWG A;  3DWV A;  1Q4J A;  3ZTL A;  1QFN A;  4TR3 A;  3HD5 A;  2L6D A;  4WBR D;  2YJ7 A;  4OWY A;  1WWJ A;  5DJL A;  3P8W A;  5HFG A;  6GSX A;  3KJY A;  4DEJ A;  3UIW A;  1THO A;  5D73 A;  1Q98 A;  1T3B A;  2LS5 A;  5IOX A;  1ZMA A;  1X5C A;  4V2N A;  4XS6 A;  2LQO A;  4QL7 A;  1AXD A;  2WS2 A;  4ECC A;  4N0V A;  3IR4 A;  1GLP A;  14GS A;  1O8W A;  3TKS E;  3QD9 A;  1W4V A;  3D6I A;  3TGZ A;  1M9A A;  1K0N A;  2DLX A;  4HU9 A;  3HXS A;  4ID0 A;  4POK A;  2PPT A;  5ID2 A;  4JR6 A;  1JZO A;  3EUR A;  3EVI A;  2LTK A;  2H76 A;  3C8E A;  4YQV A;  1ST9 A;  3BCI A;  5GAN D;  3H93 A;  4Z7X A;  5F07 A;  1A2M A;  4F82 A;  3LXT A;  2QGV A;  2H1A A;  4KE3 A;  4J56 E;  3GX0 A;  4LA1 A;  2IMI A;  2H01 A;  2OE1 A;  3ZRD A;  5C04 A;  3F4S A;  5D9T A;  3UJ1 A;  2FA4 A;  4I2U A;  1GUM A;  3KH7 A;  4XIH A;  2BTO T;  2WCI A;  2AHE A;  1X9W B;  2K9F A; 
#chains in the Genus database with same CATH topology
 1XCC A;  4MJB A;  5B8A A;  2I4A A;  1OC9 B;  5IMA A;  2X8H A;  1U3I A;  4PNG A;  5ECP B;  3APO A;  1A8Y A;  3WD6 A;  4GF0 A;  2F9S A;  1SYR A;  3UAR A;  1JZW A;  3IOS A;  2VO4 A;  1S3C A;  5HR3 A;  2L5L A;  1K3L A;  4HQZ A;  3JCM L;  3V1W A;  1PX7 A;  3FYG A;  4JR4 A;  5CNW A;  5DAL B;  4TXO A;  2H1G A;  2H73 A;  2O8V B;  3G7J A;  3PPU A;  2GSR A;  3HA9 A;  1XVQ A;  1PQN A;  1K0M A;  3GH9 A;  3LW9 A;  5AIX A;  1N8J A;  1V9W A;  1GTA A;  4K5R A;  1GTU A;  5ID2 B;  1GSU A;  2EC4 A;  3ZLP A;  4PUF C;  3FY7 A;  2YWO A;  5F0G A;  3M8N A;  4IVF A;  2CT6 A;  1T4Z A;  1X9M B;  2PN8 A;  3RHC A;  1R26 A;  1TDI A;  3WT2 A;  2ON7 A;  5BRT A;  2XBQ A;  4JE1 A;  2K18 A;  1XG8 A;  5ECO B;  4V1A p;  4WEY A;  4TR1 A;  2I81 A;  4PXO A;  2L4Q A;  3N5O A;  13GS A;  2QA1 A;  2ALB A;  1WIK A;  3LOR A;  3TJG A;  2CX3 A;  3FMW A;  2G2Q A;  2RM6 A;  4DSQ A;  4RUV A;  4L0U A;  2GQL A;  1TKD B;  1K0C A;  1T7P B;  3RHB A;  1SEN A;  3ZML A;  4EXJ A;  3D0Z A;  4X1U A;  2IPA A;  5GAP D;  1AUC A;  1AQV A;  2VCT A;  1GLQ A;  2HNL A;  1S3A A;  2RUF A;  5J3R A;  4IN0 A;  1M7T A;  3L0H A;  3C71 A;  4IP1 A;  4L5O A;  2VD0 A;  5ECL B;  1DUG A;  1TW9 A;  4FYC A;  4TXO B;  3C73 A;  1YKA A;  4BWQ A;  1UVZ A;  1KEB A;  2CAI A;  4NV5 A;  5JCW A;  2TRC P;  5F06 A;  2VLV A;  2FUG 2;  1QUW A;  3MAK A;  1EOG A;  1A2J A;  1SL0 B;  3VI7 A;  3RPN A;  2PMT A;  1M99 A;  1A2L A;  1K0O A;  4TR1 B;  1G6W A;  2LEG A;  3K8N A;  4GTU A;  2VCV A;  1X9S B;  4CHS A;  1DE1 A;  1J08 A;  2PUK C;  1IYI A;  2OE0 A;  3LG6 A;  3QPM A;  19GS A;  1YF1 A;  3DIE A;  5DAK B;  3DEX A;  1H75 A;  2FWE A;  4HJM A;  4ISD A;  4BL7 A;  3VWX A;  2B3S A;  2C3N A;  2R0P A;  4MZC A;  5HFI A;  1E6B A;  4ILF A;  4K7I A;  3IHG A;  3IC4 A;  5CO3 A;  1YQ1 A;  3QFA C;  2EIO A;  1YEX A;  5CYY A;  4F2I A;  1SJI A;  3AY8 A;  3Q6O A;  1EWX A;  3BD2 A;  2K6V A;  3HZ8 A;  3EMP A;  5IPG A;  2NPB A;  5ELA A;  2WUL A;  1Z7P A;  2LUS A;  1KBN A;  3EC3 A;  3ZFL A;  3LYP A;  3TJJ A;  2LJK A;  2VIM A;  5AGY A;  5G1K A;  2C8U A;  1A0R P;  3O6T A;  1YEP A;  1EGO A;  4L5L A;  3CMI A;  2VLU A;  3KXO A;  2V41 A;  5AIV A;  2VL2 C;  5DDL A;  17GS A;  5ECN B;  2WJU A;  3GUR A;  3ZRE A;  1XOA A;  3E0U A;  3HVS A;  3GL3 A;  2AUV A;  3HVN A;  3ZVJ D;  3NIV A;  3QMX A;  4J2F A;  1GNW A;  2REM A;  4AJ7 A;  4EIP A;  1OKT A;  2BMX A;  4IS0 A;  4CDO A;  4F0C A;  4TKY A;  5IIZ A;  2R0G A;  4GQF A;  1GSD A;  3VWU A;  2IFQ A;  5IOW A;  5HFK A;  1Z6M A;  1SKR B;  2GZY A;  2J9H A;  4BL7 B;  3HJM A;  2FLS A;  1FHE A;  1ERU A;  3GYK A;  3TJF A;  1Z9H A;  3TKQ A;  4N30 A;  4KGI A;  1ZYP A;  3CSJ A;  2HSH A;  2LRT A;  1SK1 A;  2O87 A;  5E59 A;  1MDJ A;  4MJC A;  4NXI A;  4MH3 A;  4JZQ A;  1BG5 A;  2XHF A;  4KDU A;  2X8C A;  1EGR A;  5FHI A;  2PER A;  2C3Q A;  1DBY A;  4WF5 A;  5D9X A;  3WT1 A;  3KM6 A;  4MMM A;  1PFO A;  1SD9 A;  3LYK A;  2H8L A;  1J9B A;  5D93 A;  2GQK A;  2TIR A;  3KH9 A;  4L0W A;  4TOP A;  2DC5 A;  1FW1 A;  1MD3 A;  5J9B A;  4EC0 A;  2A4H A;  3CSI A;  3VFI A;  1ZL9 A;  1MDI A;  2IN3 A;  1SU9 A;  4LMW A;  1TK5 B;  4HUA A;  4HI7 A;  2GLR A;  5G1L A;  5B7C A;  3QOU A;  1I5G A;  3FHK A;  4MK3 A;  5GST A;  3R3E A;  4XS4 A;  4EE0 A;  1M2B A;  1FG4 A;  4PQI A;  1TK8 B;  3IHQ A;  3D4M A;  1EEJ A;  4KF9 A;  5B8B A;  2H0G A;  5DBQ A;  3HJO A;  1HQO A;  1Y25 A;  1DE2 A;  1TRS A;  3ZFB A;  4BA7 A;  4PGT A;  2V6K A;  1U87 A;  2CVD A;  3PR8 A;  1G7E A;  4MNN A;  2KHP A;  3A2X A;  1GP1 A;  2KLX A;  3J7Y k;  5KOX A;  2YV9 A;  1TXX A;  2H6Z A;  2LKU A;  5HR0 A;  2I9H A;  1M0U A;  4OFT A;  5IO0 A;  4OCE A;  1OVN A;  5INY A;  1QQ2 A;  4MZB A;  2E2M A;  3TB2 A;  1EZK A;  2HRK A;  1ERW A;  1TOF A;  1F37 A;  2C0D A;  2FGX A;  3WGD A;  2DIY A;  1JFU A;  3M3M A;  2M80 A;  3Q19 A;  3GHA A;  3D21 A;  1OKD A;  1RQM A;  4Q5F A;  2DJK A;  1T00 A;  2NDO A;  1ZYE A;  1GSF A;  4FIW A;  4EVM A;  1LBK A;  4O92 A;  3L9S A;  5JWQ B;  2R2J A;  3TJK A;  4JBB A;  3F4R A;  20GS A;  4NPB A;  9GSS A;  2P5Q A;  4CY6 A;  4MA9 A;  3KCM A;  4KH7 A;  3GH6 A;  3DXB A;  1HD2 A;  4XS1 A;  1C72 A;  4XS4 B;  2MBS A;  3TJB A;  4D73 B;  1PGT A;  3MSZ A;  1GSQ A;  1ML6 A;  2PWJ A;  1F2E A;  22GS A;  3ERW A;  4GSS A;  5KN2 A;  5HQP A;  4K7N A;  3BJ5 A;  4GST A;  3IE3 A;  2C1Y A;  2H0H A;  4L8E A;  1VF2 A;  4MF7 A;  4PUR A;  1GNE A;  3KMN A;  4K7O A;  1G7O A;  4KAE A;  1O85 A;  4RQR A;  2DML A;  3I43 A;  4HOJ A;  5KN3 A;  2OE3 A;  4MPG A;  4HJ2 A;  4HQS A;  5DQS A;  3TRP A;  2MBT A;  4TXV A;  4FH8 A;  3DD3 A;  4FYU A;  3SWL A;  1FVK A;  3L4N A;  3J7Y b;  4F9Z A;  2FNO A;  2QC7 A;  2DKH A;  2I1U A;  3G7I A;  1ZYQ B;  3DVW A;  5G5E A;  3ZIV A;  2H0I A;  5G2Z A;  2RM5 A;  3FEU A;  3IC8 A;  6GSV A;  1FOH A;  2XBI A;  3CTF A;  2IJY A;  3A2W A;  3PGT A;  2FHE A;  5ECR B;  2GDR A;  4GWR A;  3L78 A;  2XPE A;  4QL9 A;  1R5P A;  5GZZ B;  5F8B A;  1U3A A;  3GKN A;  3TKR A;  2EIQ A;  2ZUP A;  5DJM A;  2JAD A;  1OYJ A;  3FR9 A;  5EL8 A;  1WP0 A;  1YDK A;  3FK8 A;  2LQQ A;  3UBL A;  1YY7 A;  5F05 A;  4IGJ A;  2YZH A;  1PN9 A;  1Z7R A;  1TU8 A;  4XRA A;  1M3J A;  2VL9 A;  1VF4 A;  4WKW A;  4IQA A;  4HU7 A;  1SD8 A;  2DJ2 A;  2HYX A;  3FR3 A;  4N10 A;  1FB6 A;  4GCI A;  5HR1 A;  2CZ2 A;  2B1K A;  2VL2 A;  1I9D A;  4BPY A;  10GS A;  4PQH A;  3GKK A;  2DSA A;  3DGQ A;  2H74 A;  3BOA A;  2YWN A;  2IME A;  1V2A A;  2B5Y A;  4EO3 A;  3TKP A;  3E9J B;  3UL3 A;  2HRN A;  3QFB C;  4G19 A;  4V1A g;  2NTO A;  1XW6 A;  2P31 A;  4X43 A;  1TJD A;  1Y6E A;  1K0D A;  1M2D A;  1ZCP A;  1FB0 A;  4MAB A;  5IMV A;  2N5B A;  3IPZ A;  1ERV A;  3IK7 A;  2VCQ A;  1ZGN A;  3EU3 A;  4XRD A;  2B5E A;  4AJ8 A;  1XWC A;  2H30 A;  3QDN A;  2GS3 A;  3ISO A;  2RII A;  3QAW A;  5H5Q A;  4IJ3 A;  4OFN A;  2OA7 A;  2QSI A;  3O3T A;  3U5R E;  4ECB A;  4EDY A;  1VRS D;  1U6T A;  1XPV A;  5J41 A;  3ED3 A;  1FVJ A;  2PVQ A;  3DRN A;  5FT3 A;  2AAW A;  3ZIT A;  3C1S A;  4ZL7 A;  4HZ4 A;  1X5D A;  4TRX A;  4EDZ A;  4KSO A;  4V2L A;  3TCO A;  3KIJ A;  3D4T A;  5AN1 A;  2Z9S A;  4F0B A;  2H71 A;  11GS A;  4EKZ A;  3GIX A;  4YAP A;  5H5R A;  2UZ8 A;  2BJX A;  1EOH A;  2YAN A;  1R4W A;  5CRH A;  2WZ9 A;  2V6O A;  1BQ7 A;  4LL1 B;  4NMU A;  3GSS A;  2VD1 A;  3SBC A;  3US3 A;  1N2A A;  2OJL A;  2L4C A;  1OE7 A;  1PSQ A;  2R3X A;  4JED A;  2VM2 A;  3C1R A;  3QAG A;  5LD0 A;  3E3E A;  2L57 A;  5CP1 A;  4FYB A;  4MZW A;  4OCF A;  2HT9 A;  2B1L A;  2IMD A;  3HHV A;  3IAM 2;  1LJR A;  1UN2 A;  3FRC A;  1SKW B;  4YQU A;  4ZBB A;  1S3D A;  1TTZ A;  1BYE A;  3HCZ A;  3GNJ A;  5ELG A;  3HDC A;  2H72 A;  3F6D A;  4Q5Q A;  3RAZ A;  1B9X C;  3ZYW A;  2HSY A;  2PVO C;  3IBH A;  1TI3 A;  3VWV A;  4DSS A;  3ERF A;  4POB A;  1G0T A;  3MDK A;  4GSN A;  4K0G A;  1EV4 A;  4IBP A;  2KP2 A;  3FR6 A;  5IO2 A;  5ECK B;  4O5R A;  4PQ1 A;  4ZB6 A;  3GV1 A;  1PA3 A;  5CAX A;  5GSS A;  1OC8 A;  4KUN A;  2YWI A;  4GQC A;  4I6X A;  3GKM A;  3H79 A;  1O81 A;  4ZB8 A;  4ZIJ A;  1JHB A;  2JU5 A;  2HRF A;  1NSW A;  4BVX A;  2CZ3 A;  2NBS A;  1HNA A;  2IWT A;  3MIX A;  1XW5 A;  1BJX A;  4IEL A;  4YAV A;  3ZZX A;  2V1M A;  3QAV A;  2M46 A;  3O76 A;  3FZ9 A;  3ERG A;  3LFL A;  2GT5 A;  3TKS C;  1TRW A;  3DKS A;  3GUS A;  2YJH A;  3KGK A;  1V57 A;  3MWH A;  4IHU A;  2I3Y A;  3GRX A;  1JZD A;  1NW2 A;  2MMN A;  4TW5 A;  1VF3 A;  2DJ1 A;  1UA5 A;  2JZR A;  1F3B A;  3FZA A;  3A5W A;  1FAA A;  3S9F A;  2KOK A;  3EMX A;  3KZQ A;  1R5A A;  4HS1 A;  1NHY A;  2R37 A;  1ZYN A;  4MF6 A;  5JCU A;  3UBK A;  4WF4 A;  1T4Y A;  4K1F A;  3IK9 A;  3LJR A;  3GKX A;  4HZ2 A;  4Q5R A;  4YKG A;  2IIY A;  3QR6 A;  1HNC A;  1PL2 A;  4G10 A;  2JZS A;  2KP1 A;  6GSU A;  4KCA A;  2WB9 A;  4IP6 A;  4KA0 A;  2B6M A;  1ON4 A;  1RW1 A;  3ZIJ A;  8GSS A;  2YOI A;  5B6M A;  4EF0 A;  5KEJ A;  2FWG A;  4BWS A;  5ECQ B;  4PNF A;  2H6X A;  3GTU A;  3EIN A;  3HYP A;  1PKZ A;  2OKA A;  2CA8 A;  2WRT A;  3IXR A;  4POL A;  2GST A;  2JSZ A;  2YPM A;  4XHM A;  4NWY A;  2DMM A;  2GVP A;  3P7X A;  2VOC A;  2P5R A;  4NV2 A;  4LL4 B;  2OBK A;  2LJR A;  1SYX A;  2CV4 A;  3IAS 2;  2IL3 A;  2JSY A;  1QK8 A;  3L9U A;  3TOT A;  5C00 A;  5JWO B;  5LCZ A;  2VCW A;  3HVX A;  3KP8 A;  4RQX A;  3M9J A;  2O89 A;  3ZL5 A;  4KW6 A;  1ILO A;  2LRN A;  3VI5 A;  1XWA A;  3LGC A;  4CY8 A;  1BAY A;  1JLV A;  2A2P A;  2YNX A;  1SKS B;  3UVT A;  3I6A A;  3DYR A;  3I9V 2;  1ACV A;  2IFQ B;  3IA1 A;  12GS A;  4K9Z A;  2A4V A;  4X0X A;  4ML6 A;  1ZOF A;  4YKF A;  3LQ7 A;  2HXK A;  3G9B A;  6GSS A;  1ABA A;  4RI7 A;  5IMZ A;  3KD0 A;  4ZIL A;  4KDX A;  3TUE A;  3C7M A;  2DBC A;  3M9K A;  7GSS A;  1MDK A;  1PL1 A;  2JL4 A;  2MZC A;  1CQG A;  1K3O A;  3CYN A;  5ECS A;  1GUK A;  1M2A A;  2YP6 A;  2C4J A;  2VUP A;  2WDU A;  5EVO A;  3DVX A;  2HFD A;  4MJE A;  2VCX A;  4I5Q A;  3GFK A;  1XWK A;  5A4U A;  2X8G A;  4MH2 A;  3P90 A;  4Z2T A;  4KCE A;  2YWM A;  3NZN A;  2FWH A;  3W6G A;  3TDG A;  1PRX A;  3H1N A;  3KTL A;  3KMO A;  5G31 A;  4GXZ A;  1WJK A;  1DSB A;  5A4W A;  5E4W A;  2K8V A;  2R5G A;  2X4A A;  4X4J A;  3U6V A;  5BMU A;  2X99 A;  1HYU A;  2GZZ A;  2HZF A;  1V58 A;  2CQ9 A;  3P2A A;  2A2S A;  1B9Y C;  3GA4 A;  5A5K A;  4LMV A;  4PX1 A;  2K8S A;  5JWR B;  4ZB9 A;  3CSH A;  3M1G A;  2F8F A;  4ICY A;  5IQY A;  1B4P A;  5DVB A;  1XVW A;  3L9V A;  4NHZ A;  2E0Q A;  2HZE A;  1UC7 A;  3PH9 A;  1OC9 A;  3KTB A;  4TR0 A;  2WGR A;  4DSR A;  1GL8 A;  3QCP A;  5ABR A;  1PN0 A;  3IV4 A;  3HVV A;  3NOF A;  4XTS A;  2DJ3 A;  1T8E B;  4J57 E;  2B5X A;  3F3Q A;  1GWC A;  4K8M A;  3HY2 A;  3CRU A;  1B8X A;  4KND A;  1O7U A;  3VPT A;  3F8U A;  4MLY A;  2TRX A;  1R7H A;  3F4T A;  2QA2 A;  3CBU A;  4KX4 A;  3W8S A;  2AB6 A;  2P0G A;  4ZBD A;  5DAL A;  3HJP A;  1PMT A;  4WET A;  1GSE A;  4WXT A;  2E2G A;  3HZ4 A;  1YJ6 A;  1SK2 A;  1XOB A;  2C80 A;  1WE0 A;  4MJA A;  4Q5N A;  3RPP A;  2ON5 A;  4LLR A;  4QQ7 A;  2LV3 A;  2CX4 A;  1TU7 A;  2N5A A;  1THX A;  4P3Y B;  1GTI A;  3UMA A;  2QKE A;  1K0A A;  1TP9 A;  5IM9 A;  5CRE A;  4HDE A;  4PUA A;  5LNK e;  4K5S A;  2AYT A;  3F0I A;  4EUY A;  1EEM A;  1GUL A;  1U88 A;  5DCH A;  3DML A;  4I97 A;  4TR4 A;  2FA8 A;  4ECI A;  1XZO A;  3TKS A;  4TVE A;  4AF2 A;  1OC3 A;  2MMZ A;  4ZL8 A;  3FW2 A;  4KB3 A;  2HZE B;  1WOU A;  3Q18 A;  4OFM A;  4G9H A;  2L6C A;  1QMV A;  4ZBA A;  3F9U A;  2H66 A;  2V32 A;  16GS A;  3EWL A;  5HR2 A;  4ULX A;  2XPD A;  4IQ1 A;  4N0Z A;  4XCS A;  4IJI A;  2RUE A;  3H4K A;  1M3I A;  1EP7 A;  2PBJ A;  2C0G A;  2F51 A;  1ERT A;  3H8Q A;  5A4V A;  1PX6 A;  4H86 A;  2L59 A;  4MF5 A;  1BX9 A;  4O5Q A;  1CQH A;  2AV4 A;  3N9J A;  3FZ4 A;  1E2Y A;  2R4V A;  4Z2U A;  3BBY A;  5J5N A;  1YF0 A;  3APQ A;  1WPI A;  4MPF A;  3BCK A;  3LEF A;  2OBI A;  4OMV A;  5ECI B;  5EPF A;  5IPH A;  2LNS A;  4BVY A;  1MD4 A;  5IMC A;  3A3T A;  1XXU A;  1FO5 A;  3A2V A;  2C0E A;  3ME7 A;  3ZVJ A;  1FOV A;  4GLT A;  1KTE A;  3WGX A;  18GS A;  4Z2R A;  1AAZ A;  1Z5Y E;  1A24 A;  2H1D A;  2DJ0 A;  2D2Z A;  2GT6 A;  1TRU A;  2X64 A;  5DAK A;  3F6F A;  1F3A A;  3VWW A;  2B7J A;  1XWB A;  1WMJ A;  1IYH A;  2PGT A;  2FWF A;  3FZ5 A;  3EE2 A;  3MNG A;  4O5U A;  3ZMK A;  3PIN A;  5DQY A;  1TK0 B;  5D9V A;  4AJ6 A;  1RK4 A;  2XC2 A;  1V40 A;  2VM1 A;  1Z3E A;  5H5S A;  2E7P A;  2CVB A;  3TOU A;  4WBJ A;  4F03 A;  1ZZY A;  2VLT A;  2CVK A;  3LWA A;  1TRV A;  3KEB A;  4YQM A;  1K0B A;  4OO5 A;  3KP9 A;  4G0L A;  4OD7 A;  2JAC A;  3LSZ A;  1W89 A;  1O8X A;  1AQX A;  4O32 A;  1K3Y A;  3WYW A;  3D22 A;  2AJQ B;  2PU9 C;  5JCG A;  3R2Q A;  2HSM A;  6GST A;  1JZR A;  3OR5 A;  1XWG A;  5CRG A;  3TRQ A;  1XIY A;  3A5I A;  4BVY B;  3TRX A;  1QGV A;  5CRW A;  2GSQ A;  1NM3 A;  2IMK A;  3VK9 A;  2ZNM A;  1XBS A;  4TN8 A;  1VGL A;  3CTG A;  3CRT A;  3IRA A;  3FKF A;  4K2D A;  4ZXG A;  2CAQ A;  1USB A;  2LST A;  2A2R A;  1GH2 A;  1F9M A;  3VPQ A;  2WFC A;  3GST A;  3LXZ A;  2ES7 A;  3I69 A;  1B4Q A;  2LNT A;  4ACS A;  2GZP A;  1O6J A;  1S3R A;  2H1B A;  4I8B A;  4N11 A;  4OO4 A;  4V2M A;  1GUH A;  1F6M C;  2O85 A;  3EYT A;  3G7Y A;  5DCG A;  2H19 A;  3UEM A;  1SK0 A;  2VL3 A;  2IMF A;  4USS A;  4KDY A;  1A23 A;  2ZCT A;  3UVH A;  4ZL9 A;  3APS A;  3EPT A;  3IDV A;  4KSM A;  4JU5 A;  3D5J A;  4K6X A;  4WR4 A;  4DSS B;  1SL2 B;  4EIQ A;  2MYG A;  1TI1 A;  2DKI A;  1VF1 A;  4AGS A;  1LU4 A;  2H70 A;  2RLI A;  4MDC A;  1XFL A;  4I2T A;  3UOM A;  1G6Y A;  5B6N A;  1X5E A;  3GMF A;  2GTU A;  2X49 A;  1B48 A;  4WR5 A;  1YZX A;  1H4O A;  4RI6 A;  2F8A A;  2H75 A;  1PD2 1;  2YZU A;  4YH2 A;  5J9C A;  4O7H A;  2LRC A;  1GSY A;  5J4U A;  4MCU A;  2J23 A;  2C3T A;  1OAZ A;  1URM A;  5L71 A;  2MMA A;  5COH A;  1M9B A;  1WRY A;  4BVX B;  2L5O A;  5G5F A;  6GSY A;  5D96 A;  2V2G A;  2LJA A;  4GRF A;  3GL5 A;  3VUR A;  4K2X A;  4E8H A;  3MYD A;  4POM A;  1PKW A;  4G0I A;  5KN1 A;  2JZT A;  4G0K A;  3VLN A;  1EV9 A;  4IKH A;  1QXH A;  2VCZ A;  4NAX A;  4ML1 A;  1MTC A;  4E8E A;  4ECJ A;  4PTS A;  6GSW A;  1YKC A;  4EL1 A;  4MP4 A;  2OAD A;  4DVC A;  2MMO A;  4JRR A;  1KNG A;  5KOW A;  1T1V A;  4HEA 2;  1GTB A;  2R0C A;  2N5F A;  1V98 A;  2G0F A;  3CXG A;  1GSS A;  3WGE A;  2F3M A;  3M0F A;  1JLW A;  1NHO A;  5D8I A;  1EP8 A;  3RDW A;  2O7K A;  1SL1 B;  2EIR A;  3GX8 A;  5G30 A;  5ECM B;  1SJ6 A;  4D73 A;  3Q74 A;  2HRA A;  2GQM A;  5D9W A;  2M72 A;  4G2E A;  3EU4 A;  5ECH B;  4FO5 A;  5EY6 A;  5IMF A;  3RBT A;  1AIU A;  4K0N A;  5CRD A;  2VAF A;  3F63 A;  3W8J A;  2NVL A;  2HE3 A;  2HI7 A;  2FY6 A;  5KN0 A;  2C0F A;  2DJJ A;  5AIS A;  1BED A;  2GSS A;  1MEK A;  5ENU A;  2R6K A;  3GTU B;  1OE8 A;  3F3R A;  1A8L A;  2FD3 A;  1AC1 A;  1AW9 A;  2GGT A;  1HNB A;  1O73 A;  2YV7 A;  2FCH A;  2KUC A;  1AQW A;  1GRX A;  1X0R A;  2HLS A;  4IW9 A;  1XW9 A;  3GN3 A;  3ME8 A;  3HKR A;  4CW9 A;  5IMD A;  2YCD A;  2OAC A;  2DIZ A;  1Z6N A;  1SJZ A;  1A0F A;  1J0F A;  2YN1 A;  4NHW A;  2B7K A;  4BIK A;  2H6Y A;  3UAP A;  5FWG A;  3DWV A;  4A5P A;  1Q4J A;  3ZTL A;  1QFN A;  4TR3 A;  3HD5 A;  2L6D A;  4WBR D;  2YJ7 A;  4OWY A;  1WWJ A;  5DJL A;  3P8W A;  5HFG A;  6GSX A;  3KJY A;  4DEJ A;  3UIW A;  4HSC X;  1THO A;  5D73 A;  1Q98 A;  1T3B A;  2LS5 A;  5IOX A;  1ZMA A;  4FQU A;  1X5C A;  4V2N A;  4XS6 A;  2LQO A;  4QL7 A;  1AXD A;  2WS2 A;  4ECC A;  4N0V A;  3IR4 A;  1GLP A;  14GS A;  1O8W A;  3TKS E;  3QD9 A;  1W4V A;  3D6I A;  3TGZ A;  1M9A A;  1K0N A;  2DLX A;  4HU9 A;  3HXS A;  4ID0 A;  4POK A;  2PPT A;  5ID2 A;  4JR6 A;  1JZO A;  3EUR A;  3EVI A;  2LTK A;  2H76 A;  3C8E A;  4YQV A;  3CQF A;  1ST9 A;  3BCI A;  5GAN D;  3H93 A;  4Z7X A;  5F07 A;  1A2M A;  4F82 A;  3LXT A;  2QGV A;  2H1A A;  4KE3 A;  4J56 E;  3GX0 A;  4LA1 A;  2IMI A;  2H01 A;  2OE1 A;  3ZRD A;  5C04 A;  3F4S A;  5D9T A;  3UJ1 A;  2FA4 A;  4I2U A;  1GUM A;  3KH7 A;  4XIH A;  2BTO T;  2WCI A;  2AHE A;  1X9W B;  2K9F A; 
#chains in the Genus database with same CATH homology
 1XCC A;  4MJB A;  5B8A A;  2I4A A;  1OC9 B;  5IMA A;  2X8H A;  1U3I A;  4PNG A;  5ECP B;  3APO A;  1A8Y A;  3WD6 A;  4GF0 A;  2F9S A;  1SYR A;  3UAR A;  1JZW A;  3IOS A;  2VO4 A;  1S3C A;  5HR3 A;  2L5L A;  1K3L A;  4HQZ A;  3JCM L;  3V1W A;  1PX7 A;  3FYG A;  4JR4 A;  5CNW A;  5DAL B;  4TXO A;  2H1G A;  2H73 A;  2O8V B;  3G7J A;  3PPU A;  2GSR A;  3HA9 A;  1XVQ A;  1PQN A;  1K0M A;  3GH9 A;  3LW9 A;  5AIX A;  1N8J A;  1V9W A;  1GTA A;  4K5R A;  1GTU A;  5ID2 B;  1GSU A;  2EC4 A;  3ZLP A;  4PUF C;  3FY7 A;  2YWO A;  5F0G A;  3M8N A;  4IVF A;  2CT6 A;  1T4Z A;  1X9M B;  2PN8 A;  3RHC A;  1R26 A;  1TDI A;  3WT2 A;  2ON7 A;  5BRT A;  2XBQ A;  4JE1 A;  2K18 A;  5ECO B;  4V1A p;  4WEY A;  4TR1 A;  2I81 A;  4PXO A;  2L4Q A;  3N5O A;  13GS A;  2QA1 A;  2ALB A;  1WIK A;  3LOR A;  3TJG A;  2CX3 A;  3FMW A;  2G2Q A;  2RM6 A;  4DSQ A;  4RUV A;  4L0U A;  2GQL A;  1TKD B;  1K0C A;  1T7P B;  3RHB A;  1SEN A;  3ZML A;  4EXJ A;  3D0Z A;  4X1U A;  2IPA A;  5GAP D;  1AUC A;  1AQV A;  2VCT A;  1GLQ A;  2HNL A;  1S3A A;  2RUF A;  5J3R A;  4IN0 A;  1M7T A;  3L0H A;  3C71 A;  4IP1 A;  4L5O A;  2VD0 A;  5ECL B;  1DUG A;  1TW9 A;  4FYC A;  4TXO B;  3C73 A;  1YKA A;  4BWQ A;  1UVZ A;  1KEB A;  2CAI A;  4NV5 A;  5JCW A;  2TRC P;  5F06 A;  2VLV A;  2FUG 2;  1QUW A;  3MAK A;  1EOG A;  1A2J A;  1SL0 B;  3VI7 A;  3RPN A;  2PMT A;  1M99 A;  1A2L A;  1K0O A;  4TR1 B;  1G6W A;  2LEG A;  3K8N A;  4GTU A;  2VCV A;  1X9S B;  4CHS A;  1DE1 A;  1J08 A;  2PUK C;  1IYI A;  2OE0 A;  3LG6 A;  3QPM A;  19GS A;  1YF1 A;  3DIE A;  5DAK B;  3DEX A;  1H75 A;  2FWE A;  4HJM A;  4ISD A;  4BL7 A;  3VWX A;  2B3S A;  2C3N A;  2R0P A;  4MZC A;  5HFI A;  1E6B A;  4ILF A;  4K7I A;  3IHG A;  3IC4 A;  5CO3 A;  1YQ1 A;  3QFA C;  2EIO A;  1YEX A;  5CYY A;  4F2I A;  1SJI A;  3AY8 A;  3Q6O A;  1EWX A;  3BD2 A;  2K6V A;  3HZ8 A;  3EMP A;  5IPG A;  2NPB A;  5ELA A;  2WUL A;  1Z7P A;  2LUS A;  1KBN A;  3EC3 A;  3ZFL A;  3LYP A;  3TJJ A;  2LJK A;  2VIM A;  5AGY A;  5G1K A;  2C8U A;  1A0R P;  3O6T A;  1YEP A;  1EGO A;  4L5L A;  3CMI A;  2VLU A;  3KXO A;  2V41 A;  5AIV A;  2VL2 C;  5DDL A;  17GS A;  5ECN B;  2WJU A;  3GUR A;  3ZRE A;  1XOA A;  3E0U A;  3HVS A;  3GL3 A;  2AUV A;  3ZVJ D;  3NIV A;  3QMX A;  4J2F A;  1GNW A;  2REM A;  4AJ7 A;  4EIP A;  1OKT A;  2BMX A;  4IS0 A;  4CDO A;  4F0C A;  4TKY A;  5IIZ A;  2R0G A;  4GQF A;  1GSD A;  3VWU A;  2IFQ A;  5IOW A;  5HFK A;  1Z6M A;  1SKR B;  2GZY A;  2J9H A;  4BL7 B;  3HJM A;  2FLS A;  1FHE A;  1ERU A;  3GYK A;  3TJF A;  1Z9H A;  3TKQ A;  4N30 A;  4KGI A;  1ZYP A;  3CSJ A;  2HSH A;  2LRT A;  1SK1 A;  2O87 A;  5E59 A;  1MDJ A;  4MJC A;  4NXI A;  4MH3 A;  4JZQ A;  1BG5 A;  2XHF A;  4KDU A;  2X8C A;  1EGR A;  5FHI A;  2PER A;  2C3Q A;  1DBY A;  4WF5 A;  5D9X A;  3WT1 A;  3KM6 A;  4MMM A;  1SD9 A;  3LYK A;  2H8L A;  1J9B A;  5D93 A;  2GQK A;  2TIR A;  3KH9 A;  4L0W A;  4TOP A;  2DC5 A;  1FW1 A;  1MD3 A;  5J9B A;  4EC0 A;  2A4H A;  3CSI A;  3VFI A;  1ZL9 A;  1MDI A;  2IN3 A;  1SU9 A;  4LMW A;  1TK5 B;  4HUA A;  4HI7 A;  2GLR A;  5G1L A;  5B7C A;  3QOU A;  1I5G A;  3FHK A;  4MK3 A;  5GST A;  3R3E A;  4XS4 A;  4EE0 A;  1M2B A;  1FG4 A;  4PQI A;  1TK8 B;  3IHQ A;  3D4M A;  1EEJ A;  4KF9 A;  5B8B A;  2H0G A;  5DBQ A;  3HJO A;  1HQO A;  1Y25 A;  1DE2 A;  1TRS A;  3ZFB A;  4BA7 A;  4PGT A;  2V6K A;  1U87 A;  2CVD A;  3PR8 A;  1G7E A;  4MNN A;  2KHP A;  3A2X A;  1GP1 A;  2KLX A;  3J7Y k;  5KOX A;  2YV9 A;  1TXX A;  2H6Z A;  2LKU A;  5HR0 A;  2I9H A;  1M0U A;  4OFT A;  5IO0 A;  4OCE A;  1OVN A;  5INY A;  1QQ2 A;  4MZB A;  2E2M A;  3TB2 A;  1EZK A;  2HRK A;  1ERW A;  1TOF A;  1F37 A;  2C0D A;  2FGX A;  3WGD A;  2DIY A;  1JFU A;  3M3M A;  2M80 A;  3Q19 A;  3GHA A;  3D21 A;  1OKD A;  1RQM A;  4Q5F A;  2DJK A;  1T00 A;  2NDO A;  1ZYE A;  1GSF A;  4FIW A;  4EVM A;  1LBK A;  4O92 A;  3L9S A;  5JWQ B;  2R2J A;  3TJK A;  4JBB A;  3F4R A;  20GS A;  4NPB A;  9GSS A;  2P5Q A;  4CY6 A;  4MA9 A;  3KCM A;  4KH7 A;  3GH6 A;  3DXB A;  1HD2 A;  4XS1 A;  1C72 A;  4XS4 B;  2MBS A;  3TJB A;  4D73 B;  1PGT A;  3MSZ A;  1GSQ A;  1ML6 A;  2PWJ A;  1F2E A;  22GS A;  3ERW A;  4GSS A;  5KN2 A;  5HQP A;  4K7N A;  3BJ5 A;  4GST A;  3IE3 A;  2C1Y A;  2H0H A;  4L8E A;  1VF2 A;  4MF7 A;  4PUR A;  1GNE A;  3KMN A;  4K7O A;  1G7O A;  4KAE A;  1O85 A;  4RQR A;  2DML A;  3I43 A;  4HOJ A;  5KN3 A;  2OE3 A;  4MPG A;  4HJ2 A;  4HQS A;  5DQS A;  3TRP A;  2MBT A;  4TXV A;  4FH8 A;  3DD3 A;  4FYU A;  3SWL A;  1FVK A;  3L4N A;  3J7Y b;  4F9Z A;  2FNO A;  2QC7 A;  2DKH A;  2I1U A;  3G7I A;  1ZYQ B;  3DVW A;  5G5E A;  3ZIV A;  2H0I A;  5G2Z A;  2RM5 A;  3FEU A;  3IC8 A;  6GSV A;  1FOH A;  2XBI A;  3CTF A;  2IJY A;  3A2W A;  3PGT A;  2FHE A;  5ECR B;  2GDR A;  4GWR A;  3L78 A;  2XPE A;  4QL9 A;  1R5P A;  5GZZ B;  5F8B A;  1U3A A;  3GKN A;  3TKR A;  2EIQ A;  2ZUP A;  5DJM A;  2JAD A;  1OYJ A;  3FR9 A;  5EL8 A;  1WP0 A;  1YDK A;  3FK8 A;  2LQQ A;  3UBL A;  1YY7 A;  5F05 A;  4IGJ A;  2YZH A;  1PN9 A;  1Z7R A;  1TU8 A;  4XRA A;  2VL9 A;  1VF4 A;  4WKW A;  4IQA A;  4HU7 A;  1SD8 A;  2DJ2 A;  2HYX A;  3FR3 A;  4N10 A;  1FB6 A;  4GCI A;  5HR1 A;  2CZ2 A;  2B1K A;  2VL2 A;  1I9D A;  4BPY A;  10GS A;  4PQH A;  3GKK A;  2DSA A;  3DGQ A;  2H74 A;  3BOA A;  2YWN A;  2IME A;  1V2A A;  2B5Y A;  4EO3 A;  3TKP A;  3E9J B;  3UL3 A;  2HRN A;  3QFB C;  4G19 A;  4V1A g;  2NTO A;  1XW6 A;  2P31 A;  4X43 A;  1TJD A;  1Y6E A;  1K0D A;  1M2D A;  1ZCP A;  1FB0 A;  4MAB A;  5IMV A;  2N5B A;  3IPZ A;  1ERV A;  3IK7 A;  2VCQ A;  1ZGN A;  3EU3 A;  4XRD A;  2B5E A;  4AJ8 A;  1XWC A;  2H30 A;  3QDN A;  2GS3 A;  3ISO A;  2RII A;  3QAW A;  5H5Q A;  4IJ3 A;  4OFN A;  2OA7 A;  2QSI A;  3O3T A;  3U5R E;  4ECB A;  4EDY A;  1VRS D;  1U6T A;  1XPV A;  5J41 A;  3ED3 A;  1FVJ A;  2PVQ A;  3DRN A;  5FT3 A;  2AAW A;  3ZIT A;  3C1S A;  4ZL7 A;  4HZ4 A;  1X5D A;  4TRX A;  4EDZ A;  4KSO A;  4V2L A;  3TCO A;  3KIJ A;  3D4T A;  5AN1 A;  2Z9S A;  4F0B A;  2H71 A;  11GS A;  4EKZ A;  3GIX A;  4YAP A;  5H5R A;  2UZ8 A;  2BJX A;  1EOH A;  2YAN A;  1R4W A;  5CRH A;  2WZ9 A;  2V6O A;  1BQ7 A;  4LL1 B;  4NMU A;  3GSS A;  2VD1 A;  3SBC A;  3US3 A;  1N2A A;  2OJL A;  2L4C A;  1OE7 A;  1PSQ A;  2R3X A;  4JED A;  2VM2 A;  3C1R A;  3QAG A;  5LD0 A;  3E3E A;  2L57 A;  5CP1 A;  4FYB A;  4MZW A;  4OCF A;  2HT9 A;  2B1L A;  2IMD A;  3HHV A;  3IAM 2;  1LJR A;  1UN2 A;  3FRC A;  1SKW B;  4YQU A;  4ZBB A;  1S3D A;  1TTZ A;  1BYE A;  3HCZ A;  3GNJ A;  5ELG A;  3HDC A;  2H72 A;  3F6D A;  4Q5Q A;  3RAZ A;  1B9X C;  3ZYW A;  2HSY A;  2PVO C;  3IBH A;  1TI3 A;  3VWV A;  4DSS A;  3ERF A;  4POB A;  1G0T A;  3MDK A;  4GSN A;  4K0G A;  1EV4 A;  4IBP A;  2KP2 A;  3FR6 A;  5IO2 A;  5ECK B;  4O5R A;  4PQ1 A;  4ZB6 A;  3GV1 A;  1PA3 A;  5CAX A;  5GSS A;  1OC8 A;  4KUN A;  2YWI A;  4GQC A;  4I6X A;  3GKM A;  3H79 A;  1O81 A;  4ZB8 A;  4ZIJ A;  1JHB A;  2JU5 A;  2HRF A;  1NSW A;  4BVX A;  2CZ3 A;  2NBS A;  1HNA A;  2IWT A;  3MIX A;  1XW5 A;  1BJX A;  4IEL A;  4YAV A;  3ZZX A;  2V1M A;  3QAV A;  2M46 A;  3O76 A;  3FZ9 A;  3ERG A;  3LFL A;  2GT5 A;  3TKS C;  1TRW A;  3DKS A;  3GUS A;  2YJH A;  3KGK A;  1V57 A;  3MWH A;  4IHU A;  2I3Y A;  3GRX A;  1JZD A;  1NW2 A;  2MMN A;  4TW5 A;  1VF3 A;  2DJ1 A;  1UA5 A;  2JZR A;  1F3B A;  3FZA A;  3A5W A;  1FAA A;  3S9F A;  2KOK A;  3EMX A;  3KZQ A;  1R5A A;  4HS1 A;  1NHY A;  2R37 A;  1ZYN A;  4MF6 A;  5JCU A;  3UBK A;  4WF4 A;  1T4Y A;  4K1F A;  3IK9 A;  3LJR A;  3GKX A;  4HZ2 A;  4Q5R A;  4YKG A;  2IIY A;  3QR6 A;  1HNC A;  1PL2 A;  4G10 A;  2JZS A;  2KP1 A;  6GSU A;  4KCA A;  2WB9 A;  4IP6 A;  4KA0 A;  2B6M A;  1ON4 A;  1RW1 A;  3ZIJ A;  8GSS A;  2YOI A;  5B6M A;  4EF0 A;  5KEJ A;  2FWG A;  4BWS A;  5ECQ B;  4PNF A;  2H6X A;  3GTU A;  3EIN A;  3HYP A;  1PKZ A;  2OKA A;  2CA8 A;  2WRT A;  3IXR A;  4POL A;  2GST A;  2JSZ A;  2YPM A;  4XHM A;  4NWY A;  2DMM A;  2GVP A;  3P7X A;  2VOC A;  2P5R A;  4NV2 A;  4LL4 B;  2OBK A;  2LJR A;  1SYX A;  2CV4 A;  3IAS 2;  2IL3 A;  2JSY A;  1QK8 A;  3L9U A;  3TOT A;  5C00 A;  5JWO B;  5LCZ A;  2VCW A;  3HVX A;  3KP8 A;  4RQX A;  3M9J A;  2O89 A;  3ZL5 A;  4KW6 A;  1ILO A;  2LRN A;  3VI5 A;  1XWA A;  3LGC A;  4CY8 A;  1BAY A;  1JLV A;  2A2P A;  2YNX A;  1SKS B;  3UVT A;  3I6A A;  3DYR A;  3I9V 2;  1ACV A;  2IFQ B;  3IA1 A;  12GS A;  4K9Z A;  2A4V A;  4X0X A;  4ML6 A;  1ZOF A;  4YKF A;  3LQ7 A;  2HXK A;  3G9B A;  6GSS A;  1ABA A;  4RI7 A;  5IMZ A;  3KD0 A;  4ZIL A;  4KDX A;  3TUE A;  3C7M A;  2DBC A;  3M9K A;  7GSS A;  1MDK A;  1PL1 A;  2JL4 A;  2MZC A;  1CQG A;  1K3O A;  3CYN A;  5ECS A;  1GUK A;  1M2A A;  2YP6 A;  2C4J A;  2VUP A;  2WDU A;  5EVO A;  3DVX A;  2HFD A;  4MJE A;  2VCX A;  4I5Q A;  3GFK A;  1XWK A;  5A4U A;  2X8G A;  4MH2 A;  3P90 A;  4Z2T A;  4KCE A;  2YWM A;  3NZN A;  2FWH A;  3W6G A;  3TDG A;  1PRX A;  3H1N A;  3KTL A;  3KMO A;  5G31 A;  4GXZ A;  1WJK A;  1DSB A;  5A4W A;  5E4W A;  2K8V A;  2R5G A;  2X4A A;  4X4J A;  3U6V A;  5BMU A;  2X99 A;  1HYU A;  2GZZ A;  2HZF A;  1V58 A;  2CQ9 A;  3P2A A;  2A2S A;  1B9Y C;  3GA4 A;  5A5K A;  4LMV A;  4PX1 A;  2K8S A;  5JWR B;  4ZB9 A;  3CSH A;  3M1G A;  2F8F A;  4ICY A;  5IQY A;  1B4P A;  5DVB A;  1XVW A;  3L9V A;  4NHZ A;  2E0Q A;  2HZE A;  1UC7 A;  3PH9 A;  1OC9 A;  3KTB A;  4TR0 A;  2WGR A;  4DSR A;  1GL8 A;  3QCP A;  5ABR A;  1PN0 A;  3IV4 A;  3HVV A;  3NOF A;  4XTS A;  2DJ3 A;  1T8E B;  4J57 E;  2B5X A;  3F3Q A;  1GWC A;  4K8M A;  3HY2 A;  3CRU A;  1B8X A;  4KND A;  1O7U A;  3VPT A;  3F8U A;  4MLY A;  2TRX A;  1R7H A;  3F4T A;  2QA2 A;  3CBU A;  4KX4 A;  3W8S A;  2AB6 A;  2P0G A;  4ZBD A;  5DAL A;  3HJP A;  1PMT A;  4WET A;  1GSE A;  4WXT A;  2E2G A;  3HZ4 A;  1YJ6 A;  1SK2 A;  1XOB A;  2C80 A;  1WE0 A;  4MJA A;  4Q5N A;  3RPP A;  2ON5 A;  4LLR A;  4QQ7 A;  2LV3 A;  2CX4 A;  1TU7 A;  2N5A A;  1THX A;  4P3Y B;  1GTI A;  3UMA A;  2QKE A;  1K0A A;  1TP9 A;  5IM9 A;  5CRE A;  4HDE A;  4PUA A;  5LNK e;  4K5S A;  2AYT A;  3F0I A;  4EUY A;  1EEM A;  1GUL A;  1U88 A;  5DCH A;  3DML A;  4I97 A;  4TR4 A;  2FA8 A;  4ECI A;  1XZO A;  3TKS A;  4TVE A;  4AF2 A;  1OC3 A;  2MMZ A;  4ZL8 A;  3FW2 A;  4KB3 A;  2HZE B;  1WOU A;  3Q18 A;  4OFM A;  4G9H A;  2L6C A;  1QMV A;  4ZBA A;  3F9U A;  2H66 A;  2V32 A;  16GS A;  3EWL A;  5HR2 A;  4ULX A;  2XPD A;  4IQ1 A;  4N0Z A;  4XCS A;  4IJI A;  2RUE A;  3H4K A;  1EP7 A;  2PBJ A;  2C0G A;  2F51 A;  1ERT A;  3H8Q A;  5A4V A;  1PX6 A;  4H86 A;  2L59 A;  4MF5 A;  1BX9 A;  4O5Q A;  1CQH A;  2AV4 A;  3N9J A;  3FZ4 A;  1E2Y A;  2R4V A;  4Z2U A;  3BBY A;  5J5N A;  1YF0 A;  3APQ A;  1WPI A;  4MPF A;  3BCK A;  3LEF A;  2OBI A;  4OMV A;  5ECI B;  5EPF A;  5IPH A;  2LNS A;  4BVY A;  1MD4 A;  5IMC A;  3A3T A;  1XXU A;  1FO5 A;  3A2V A;  2C0E A;  3ME7 A;  3ZVJ A;  1FOV A;  4GLT A;  1KTE A;  3WGX A;  18GS A;  4Z2R A;  1AAZ A;  1Z5Y E;  1A24 A;  2H1D A;  2DJ0 A;  2D2Z A;  2GT6 A;  1TRU A;  2X64 A;  5DAK A;  3F6F A;  1F3A A;  3VWW A;  2B7J A;  1XWB A;  1WMJ A;  1IYH A;  2PGT A;  2FWF A;  3FZ5 A;  3EE2 A;  3MNG A;  4O5U A;  3ZMK A;  3PIN A;  5DQY A;  1TK0 B;  5D9V A;  4AJ6 A;  1RK4 A;  2XC2 A;  1V40 A;  2VM1 A;  1Z3E A;  5H5S A;  2E7P A;  2CVB A;  3TOU A;  4WBJ A;  4F03 A;  1ZZY A;  2VLT A;  2CVK A;  3LWA A;  1TRV A;  3KEB A;  4YQM A;  1K0B A;  4OO5 A;  3KP9 A;  4G0L A;  4OD7 A;  2JAC A;  3LSZ A;  1W89 A;  1O8X A;  1AQX A;  4O32 A;  1K3Y A;  3WYW A;  3D22 A;  2AJQ B;  2PU9 C;  5JCG A;  3R2Q A;  2HSM A;  6GST A;  1JZR A;  3OR5 A;  1XWG A;  5CRG A;  3TRQ A;  1XIY A;  3A5I A;  4BVY B;  3TRX A;  1QGV A;  5CRW A;  2GSQ A;  1NM3 A;  2IMK A;  3VK9 A;  2ZNM A;  1XBS A;  4TN8 A;  1VGL A;  3CTG A;  3CRT A;  3IRA A;  3FKF A;  4K2D A;  4ZXG A;  2CAQ A;  1USB A;  2LST A;  2A2R A;  1GH2 A;  1F9M A;  3VPQ A;  2WFC A;  3GST A;  3LXZ A;  2ES7 A;  3I69 A;  1B4Q A;  2LNT A;  4ACS A;  2GZP A;  1O6J A;  2H1B A;  4I8B A;  4N11 A;  4OO4 A;  4V2M A;  1GUH A;  1F6M C;  2O85 A;  3EYT A;  3G7Y A;  5DCG A;  2H19 A;  3UEM A;  1SK0 A;  2VL3 A;  2IMF A;  4USS A;  4KDY A;  1A23 A;  2ZCT A;  3UVH A;  4ZL9 A;  3APS A;  3EPT A;  3IDV A;  4KSM A;  4JU5 A;  3D5J A;  4K6X A;  4WR4 A;  4DSS B;  1SL2 B;  4EIQ A;  2MYG A;  1TI1 A;  2DKI A;  1VF1 A;  4AGS A;  1LU4 A;  2H70 A;  2RLI A;  4MDC A;  1XFL A;  4I2T A;  3UOM A;  1G6Y A;  5B6N A;  1X5E A;  3GMF A;  2GTU A;  2X49 A;  1B48 A;  4WR5 A;  1YZX A;  1H4O A;  4RI6 A;  2F8A A;  2H75 A;  1PD2 1;  2YZU A;  4YH2 A;  5J9C A;  4O7H A;  2LRC A;  1GSY A;  5J4U A;  4MCU A;  2J23 A;  2C3T A;  1OAZ A;  1URM A;  5L71 A;  2MMA A;  5COH A;  1M9B A;  1WRY A;  4BVX B;  2L5O A;  5G5F A;  6GSY A;  5D96 A;  2V2G A;  2LJA A;  4GRF A;  3GL5 A;  3VUR A;  4K2X A;  4E8H A;  3MYD A;  4POM A;  1PKW A;  4G0I A;  5KN1 A;  2JZT A;  4G0K A;  3VLN A;  1EV9 A;  4IKH A;  1QXH A;  2VCZ A;  4NAX A;  4ML1 A;  1MTC A;  4E8E A;  4ECJ A;  4PTS A;  6GSW A;  1YKC A;  4EL1 A;  4MP4 A;  2OAD A;  4DVC A;  2MMO A;  4JRR A;  1KNG A;  5KOW A;  1T1V A;  4HEA 2;  1GTB A;  2R0C A;  2N5F A;  1V98 A;  2G0F A;  3CXG A;  1GSS A;  3WGE A;  2F3M A;  3M0F A;  1JLW A;  1NHO A;  5D8I A;  1EP8 A;  3RDW A;  2O7K A;  1SL1 B;  2EIR A;  3GX8 A;  5G30 A;  5ECM B;  1SJ6 A;  4D73 A;  3Q74 A;  2HRA A;  2GQM A;  5D9W A;  2M72 A;  4G2E A;  3EU4 A;  5ECH B;  4FO5 A;  5EY6 A;  5IMF A;  3RBT A;  1AIU A;  4K0N A;  5CRD A;  2VAF A;  3F63 A;  3W8J A;  2NVL A;  2HE3 A;  2HI7 A;  2FY6 A;  5KN0 A;  2C0F A;  2DJJ A;  5AIS A;  1BED A;  2GSS A;  1MEK A;  5ENU A;  2R6K A;  3GTU B;  1OE8 A;  3F3R A;  1A8L A;  2FD3 A;  1AC1 A;  1AW9 A;  2GGT A;  1HNB A;  1O73 A;  2YV7 A;  2FCH A;  2KUC A;  1AQW A;  1GRX A;  1X0R A;  2HLS A;  4IW9 A;  1XW9 A;  3GN3 A;  3ME8 A;  3HKR A;  4CW9 A;  5IMD A;  2YCD A;  2OAC A;  2DIZ A;  1Z6N A;  1SJZ A;  1A0F A;  1J0F A;  2YN1 A;  4NHW A;  2B7K A;  2H6Y A;  3UAP A;  5FWG A;  3DWV A;  4A5P A;  1Q4J A;  3ZTL A;  1QFN A;  4TR3 A;  3HD5 A;  2L6D A;  4WBR D;  2YJ7 A;  4OWY A;  1WWJ A;  5DJL A;  3P8W A;  5HFG A;  6GSX A;  3KJY A;  4DEJ A;  3UIW A;  1THO A;  5D73 A;  1Q98 A;  1T3B A;  2LS5 A;  5IOX A;  1ZMA A;  4FQU A;  1X5C A;  4V2N A;  4XS6 A;  2LQO A;  4QL7 A;  1AXD A;  2WS2 A;  4ECC A;  4N0V A;  3IR4 A;  1GLP A;  14GS A;  1O8W A;  3TKS E;  3QD9 A;  1W4V A;  3D6I A;  3TGZ A;  1M9A A;  1K0N A;  2DLX A;  4HU9 A;  3HXS A;  4ID0 A;  4POK A;  2PPT A;  5ID2 A;  4JR6 A;  1JZO A;  3EUR A;  3EVI A;  2LTK A;  2H76 A;  3C8E A;  4YQV A;  1ST9 A;  3BCI A;  5GAN D;  3H93 A;  4Z7X A;  5F07 A;  1A2M A;  4F82 A;  3LXT A;  2QGV A;  2H1A A;  4KE3 A;  4J56 E;  3GX0 A;  4LA1 A;  2IMI A;  2H01 A;  2OE1 A;  3ZRD A;  5C04 A;  3F4S A;  5D9T A;  3UJ1 A;  2FA4 A;  4I2U A;  1GUM A;  3KH7 A;  4XIH A;  2BTO T;  2WCI A;  2AHE A;  1X9W B;  2K9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...