1M2DA

Crystal structure at 1.05 angstroms resolution of the cys59ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
101
structure length
101
Chain Sequence
FKHVFVCVQDRPPGHPQGSCAQRGSREVFQAFMEKIQTDPQLFMTTVITPTGCMNASMMGPVVVVYPDGVWYGQVKPEDVDEIVEKHLKGGEPVERLVISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords [2Fe-2S] ferredoxin
publication title High-resolution crystal structures of the wild type and Cys-55-->Ser and Cys-59-->Ser variants of the thioredoxin-like [2Fe-2S] ferredoxin from Aquifex aeolicus
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 34
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1m2dA00
2AUVA 2R3XA 3DVWA 4RQXA 3ERGA 2QC7A 3FHKA 5D9TA 3CBUA 4WETA 3A2VA 1B4PA 3GTUA 4HDEA 3TJBA 20GSA 1X9SB 3AY8A 4F03A 1UA5A 4MH3A 2HI7A 4OFMA 1JZWA 3Q18A 3CRTA 5E59A 5IO0A 1Q4JA 2PU9C 11GSA 3RPPA 1GWCA 4K7IA 3WT2A 3GYKA 2V2GA 3PH9A 2IMKA 1PSQA 1H4OA 2IPAA 1X9WB 18GSA 5D9XA 2LQOA 1XCCA 2TIRA 4MF5A 5IOWA 3E3EA 1E2YA 4WXTA 2H1DA 4J57E 3H4KA 2V1MA 2MMNA 4POMA 16GSA 1F37A 1YEXA 4WKWA 3BCIA 1TDIA 4POBA 1T7PB 1C72A 1TRWA 3LXTA 3IXRA 3TB2A 5F05A 1OKTA 2P5QA 3EVIA 4KAEA 2MMOA 1LJRA 4TR1A 2H71A 3E9JB 2OA7A 3IOSA 2C80A 4ID0A 4I2TA 3CRUA 3I43A 4PGTA 5JWRB 1G6WA 2VL9A 3GNJA 4MJEA 1U6TA 3FEUA 1T1VA 1T4YA 2DJ3A 3CMIA 10GSA 3TKSE 5H5RA 1M2BA 3ZRDA 1GSYA 4XS4A 3H8QA 5G31A 2GS3A 5JWQB 1XWAA 2KP2A 3TJKA 2VD1A 1TJDA 3FY7A 2YN1A 1GNEA 4H86A 3WT1A 4FYCA 2ZNMA 3GX0A 2RLIA 4MDCA 2VL2A 1ML6A 4MMMA 4JBBA 3TKQA 1PD21 2FNOA 1K0CA 1K0DA 4GWRA 2OACA 2LV3A 5HQPA 4JR4A 5KN3A 3CSJA 1BQ7A 4IBPA 2I81A 3KD0A 3WYWA 2GDRA 1WOUA 1GUHA 2GZZA 1V40A 2YWIA 4TVEA 3M8NA 2H72A 1E6BA 2HRNA 5CRDA 2KOKA 1A23A 3TDGA 5LD0A 4L5OA 1PKZA 2VCWA 4K0NA 3DGQA 5L71A 1OC3A 1RW1A 3QFBC 5FT3A 1FVJA 4MCUA 1K0MA 5JWOB 1Z3EA 3ERFA 1VF3A 2L6CA 1PL1A 1S3DA 4I5QA 5G30A 1NW2A 2LNSA 2LEGA 4TR3A 3WGXA 3O6TA 2WGRA 3LXZA 4KGIA 12GSA 1EEMA 2RM6A 4HQSA 2JACA 4ZBAA 2L6DA 4O92A 3HKRA 3QAGA 1XFLA 3HA9A 3VFIA 6GSYA 6GSUA 1TRSA 1A0RP 2OADA 4MJCA 3LJRA 4D73B 1JZOA 1YKCA 2J23A 4GXZA 1TK5B 2V32A 2PWJA 6GSVA 9GSSA 3IC4A 4FO5A 3UVHA 1O85A 1FB6A 2WCIA 2E7PA 4K9ZA 1GSSA 4OFTA 3WGDA 5DQSA 4IVFA 3UBLA 2VUPA 4WF5A 2X8HA 5EVOA 4TXOB 5D96A 1AUCA 1K0AA 4X0XA 1MDKA 1M2AA 2H76A 2RUFA 4G19A 4OCEA 1QQ2A 4TN8A 4GSSA 4OD7A 3FZ9A 2AB6A 4DSRA 1K3LA 1FO5A 1A2LA 1O81A 1OC9A 1SKRB 1F2EA 14GSA 2KUCA 2ON5A 1IYHA 4LMVA 2CVDA 1X5DA 2LRCA 1BJXA 4N10A 4HUAA 1LBKA 4LA1A 4PUAA 4TR4A 2L57A 3FZAA 1GSEA 1ZOFA 2EIOA 1XW6A 2FD3A 2C0DA 1KEBA 3ZYWA 3KXOA 1GP1A 1TTZA 4TOPA 4ZL9A 3LEFA 1FAAA 2DIZA 4KE3A 4YAVA 2H1AA 4I97A 4J56E 5G5FA 1IYIA 4WBRD 3LYKA 3BD2A 3HYPA 2VM1A 3J7Yk 3TJGA 2TRCP 3L9SA 2PUKC 3D0ZA 13GSA 5CREA 2H30A 3VWVA 1YZXA 5A4WA 2YV7A 2R4VA 3BCKA 5ECRB 3I69A 2LSTA 4XHMA 3IAM2 3GURA 1W4VA 3PINA 5GAND 3QAVA 3LORA 2VO4A 1K3YA 2C0GA 5J3RA 3MAKA 3F8UA 4MF6A 5DAKA 1PMTA 1SD8A 3JCML 2H74A 1NM3A 4OFNA 1HD2A 2JZSA 3D4TA 4BPYA 3KTLA 1T3BA 4EO3A 1K0OA 3DKSA 3VI7A 3HVVA 4IGJA 3ZTLA 5KEJA 2OJLA 4MABA 1F3BA 4HZ2A 5ABRA 4BVYA 2GZPA 3GKMA 4GLTA 5B8AA 5KN2A 3I6AA 1SJZA 2IMFA 1UN2A 1SYXA 1SKWB 2G2QA 4EF0A 2H6XA 2CT6A 4ECJA 1KNGA 1Y6EA 4MJAA 3P90A 6GSWA 3GKNA 2F51A 4CDOA 5ECKB 3IK7A 3VWXA 4G10A 3N9JA 5EY6A 2H0HA 1JFUA 3Q19A 4LL4B 3LYPA 5ECIB 2GZYA 1B8XA 2MMAA 1VF4A 5IIZA 4K6XA 2DJ1A 1ZYEA 1TKDB 1KBNA 2N5BA 4TW5A 5HR2A 4AJ7A 4MZWA 2K8VA 4MZBA 1M99A 1GSFA 2IWTA 2HFDA 4GQCA 4L0UA 3ZREA 3IK9A 3HHVA 2PPTA 7GSSA 3HVXA 3MWHA 3C1SA 3RBTA 3L78A 3UVTA 1PKWA 1GRXA 2OBIA 1EP7A 2F8AA 1R5AA 4YAPA 2B1KA 3DMLA 2HRFA 3G7JA 2ALBA 1OAZA 2NTOA 4V2LA 3EMXA 1TP9A 1PQNA 4KDXA 2XC2A 4ZXGA 3GHAA 1O6JA 2NVLA 4IP6A 3ZFBA 1U88A 1A24A 3C7MA 1CQGA 4POKA 3C8EA 4F0BA 3VLNA 1QXHA 1TU8A 4EDZA 2LJAA 3ZIJA 3QMXA 2DMLA 4V1Ap 3TKPA 4GSNA 1USBA 3ZMLA 2HSYA 1U3IA 4GTUA 2C3NA 3M0FA 3V1WA 5F8BA 2B7JA 3F4TA 3ME8A 5ECNB 1JLWA 2QSIA 2MMZA 1FOVA 4WBJA 3A5WA 5B7CA 1SJIA 4IELA 1PRXA 4HZ4A 4PXOA 1Z6MA 2VL3A 1A8LA 3HJOA 2R6KA 5IPHA 1N2AA 3L9VA 1J9BA 5CP1A 4O7HA 2ES7A 1ERTA 4E8HA 5J9CA 3DEXA 1DBYA 4K0GA 2Z9SA 1XZOA 2VCZA 1F9MA 4Q5RA 2B7KA 4V2NA 3IRAA 3GL3A 5A4VA 5HFKA 4GSTA 5COHA 1M9AA 4TRXA 2VAFA 4IS0A 1R4WA 4WR5A 2FWHA 3APSA 2FY6A 2MZCA 4KDUA 4Q5NA 4ZBBA 4ZL8A 5J5NA 3ZVJA 5IMCA 1O8XA 4GF0A 2FA8A 22GSA 5B6MA 3EYTA 1X9MB 4I8BA 5G2ZA 2YWMA 1SK2A 1XWBA 2CV4A 3GL5A 1TI1A 2O87A 3CXGA 3IHQA 3IAS2 1A8YA 1SJ6A 4HU9A 1R26A 4IHUA 1HNBA 17GSA 4TKYA 4ECIA 4JEDA 2WULA 2L5LA 3H93A 5GSTA 3TKSA 2X8CA 1EGOA 1GULA 1NSWA 3HCZA 2QGVA 3CYNA 1FHEA 5ECQB 4K7NA 1WRYA 1GUKA 1YEPA 3NIVA 5IMZA 3SWLA 2WRTA 3HD5A 4O5RA 1SKSB 3P7XA 3S9FA 4X43A 1EGRA 2C0EA 3TCOA 4FYUA 1GSQA 2VCQA 1ZZYA 1B9XC 4BL7A 2N5FA 4WEYA 2X8GA 4HI7A 2V6OA 2YANA 3EU3A 1B48A 5CRWA 1HNAA 2CZ2A 2A2SA 3DVXA 1EV9A 2L5OA 2YPMA 1MD4A 2HZEB 4XIHA 2AYTA 3GN3A 3M9JA 4AJ8A 3D6IA 2J9HA 4Z7XA 2FUG2 1THOA 1M2DA 4X1UA 2WFCA 1AXDA 3GIXA 3SBCA 5ENUA 4HJ2A 4MH2A 3DYRA 1Z6NA 5DALB 3CTFA 5D8IA 2P0GA 3IDVA 1XW9A 3UJ1A 3ZLPA 4YQMA 2H01A 1M9BA 4KNDA 3ZIVA 1QFNA 3M9KA 3FK8A 3OR5A 3QOUA 2LRTA 4K2DA 4RI6A 1SL1B 1GNWA 3N5OA 1R5PA 2GQLA 2GSQA 1F3AA 3W8SA 1W89A 2HT9A 4YH2A 4OO4A 2L4CA 1YF1A 2C3QA 4XRDA 5C00A 2DJKA 4PUFC 1SK0A 1DUGA 1Z5YE 2YWNA 1MTCA 3BBYA 3G7YA 3NOFA 2B5EA 2FWGA 2GVPA 1TI3A 2A4VA 5IQYA 1SL0B 4MLYA 1YDKA 3FW2A 4JRRA 3RDWA 4XS1A 4AJ6A 3F3QA 3RHCA 4YQVA 2NPBA 3BOAA 1VF1A 2TRXA 3QFAC 5DJLA 1GTUA 1MDIA 3E0UA 3VPTA 2CX3A 3HY2A 1X0RA 1XPVA 3FKFA 4KCAA 3HJPA 4ZL7A 2GSRA 4KH7A 4DEJA 2PERA 3F4SA 2PMTA 2JZRA 2H66A 3TOUA 4JU5A 3HVSA 4DSSB 3QAWA 5ECPB 1YJ6A 2O89A 4NV5A 5LCZA 1EEJA 5IOXA 2FCHA 2CAIA 1YKAA 5IMVA 4PNFA 3ED3A 4IKHA 1X5CA 1SENA 4FYBA 3PR8A 5ECLB 3LQ7A 2ON7A 2BJXA 2C8UA 5ID2B 3F3RA 2VD0A 2E0QA 3GSTA 1WIKA 1ERWA 3I9V2 19GSA 5EL8A 5HFIA 4NHZA 3ERWA 2H0IA 2OKAA 2H6YA 2R5GA 2VIMA 3Q74A 4MP4A 5EPFA 2E2MA 1THXA 4RI7A 3UAPA 2FHEA 5F07A 4BWQA 4NHWA 4HU7A 3FZ5A 3MDKA 3KH7A 5INYA 3QD9A 5H5QA 3VPQA 4I2UA 1FVKA 5DJMA 6GSSA 4ISDA 2GT6A 2PVQA 1ZL9A 2X64A 3GKKA 3F6FA 3GMFA 4JZQA 2IFQB 4GRFA 1SYRA 3TUEA 1JZDA 3FRCA 1OVNA 1Z7RA 3K8NA 1Q98A 4MPFA 2BMXA 1ZGNA 3IR4A 2RM5A 3Q6OA 3M3MA 4DSQA 1KTEA 3VWWA 1GLQA 5GAPD 4L0WA 1PA3A 3GTUB 2EC4A 2B1LA 2K18A 5D9VA 5DCHA 4JE1A 1HQOA 2H19A 2XHFA 2YCDA 3DD3A 1GSUA 1BAYA 3TJJA 1PN9A 4OWYA 4NWYA 2K8SA 4L8EA 3GSSA 2E2GA 3ZMKA 5JCWA 4ML1A 3A2XA 1FB0A 1QGVA 4AGSA 1I9DA 4D73A 4EVMA 1DSBA 1XVQA 4NXIA 2WJUA 4ZBDA 3KP8A 3EC3A 1V57A 4QL7A 1O8WA 2IMEA 3GFKA 3WGEA 5DCGA 3GH6A 2HYXA 2D2ZA 3ME7A 1G0TA 4CW9A 2AAWA 4TXOA 4KSOA 2YOIA 2K9FA 2FWEA 2R37A 4F82A 2CZ3A 2MBTA 2F9SA 2YZUA 2H70A 2DSAA 4HQZA 2HLSA 4IQAA 4NMUA 1AQXA 4TR1B 3FR9A 2CQ9A 1AIUA 2LQQA 4HS1A 5D9WA 4PURA 2IL3A 1XVWA 4LMWA 2M72A 3DIEA 1TK8B 3QDNA 2IIYA 3GX8A 1O73A 2DLXA 3GKXA 4Q5FA 1XIYA 4KB3A 1ZYQB 4E8EA 2I4AA 4XS4B 3EINA 1JZRA 2I9HA 3W8JA 1OYJA 4G9HA 1U87A 4IJIA 1PX7A 2EIRA 2IJYA 2VCTA 2LNTA 1Z7PA 1AAZA 1XXUA 5AGYA 4ZB6A 1YF0A 5G5EA 4N30A 4OCFA 3G7IA 5J4UA 1S3AA 1FW1A 3EE2A 4MJBA 4BWSA 2LJRA 2VCXA 4ECCA 2GTUA 4ILFA 4F9ZA 3RAZA 1M0UA 4IQ1A 2I1UA 4EKZA 5AN1A 2JSYA 2M46A 1SK1A 3KMNA 2RIIA 1GLPA 2HE3A 4BA7A 5FHIA 2VL2C 3FYGA 1N8JA 5DQYA 5E4WA 3FR6A 1EV4A 4AF2A 2NBSA 2FGXA 5IO2A 1URMA 2YNXA 4TR0A 1NHYA 3MNGA 4LL1B 2AHEA 1J0FA 3HXSA 4KCEA 1OE7A 2DIYA 4IN0A 3WD6A 3DRNA 4XCSA 1GH2A 1J08A 3QPMA 2PBJA 1WP0A 2LRNA 5DDLA 2P5RA 4N0ZA 1XOAA 1YQ1A 2WB9A 3TRPA 3L0HA 8GSSA 1BG5A 3LSZA 1AW9A 4ULXA 3ZVJD 5A4UA 1XW5A 1GUMA 3F4RA 5B8BA 1JHBA 2VLTA 2VM2A 2FA4A 4K1FA 1O7UA 2OE1A 1TW9A 4EL1A 5AIXA 3C73A 3F6DA 3L9UA 1S3CA 2QKEA 3EWLA 4KW6A 1EP8A 3LFLA 3KM6A 2KHPA 4IP1A 4ZB9A 2JZTA 5A5KA 4G2EA 2EIQA 3VURA 2PGTA 5IM9A 2LJKA 3IBHA 3LGCA 1ST9A 2GQKA 1TRVA 2LTKA 2ZUPA 5KN1A 3CSHA 1ZCPA 2WS2A 2CAQA 5HFGA 4I6XA 4MPGA 1YY7A 1TOFA 2IN3A 1I5GA 2WDUA 3TRXA 4RUVA 2HZFA 4F2IA 3HZ8A 4GCIA 3UBKA 2C0FA 3IE3A 3LWAA 4NV2A 1HNCA 2VLVA 3GA4A 1OC9B 1HYUA 1VRSD 4HEA2 2YV9A 1TRUA 3UL3A 4MK3A 1ZMAA 2YWOA 3A3TA 2DJ2A 4K8MA 5CNWA 4KSMA 3D4MA 2C4JA 4MZCA 5JCGA 2REMA 4MA9A 1GTBA 2N5AA 4WR4A 1T00A 1ILOA 4XRAA 2XPEA 3CSIA 3GV1A 1V98A 5IMDA 2CVBA 2O85A 2JU5A 2CX4A 5CAXA 1QMVA 1MD3A 5ECHB 1PX6A 3KH9A 4LLRA 3IV4A 1OE8A 1PGTA 3APOA 5D93A 3VI5A 4OMVA 3KGKA 5ELAA 4NAXA 3KCMA 1T8EB 3HZ4A 5IMAA 3J7Yb 2LS5A 1V2AA 4XS6A 3US3A 1RK4A 3F63A 1VGLA 3P2AA 3FR3A 2F3MA 1G7EA 2GLRA 5DAKB 3VK9A 2PN8A 1QK8A 1K0NA 4HOJA 1XOBA 3TRQA 3IA1A 2LKUA 1WMJA 1BEDA 2DMMA 1ERVA 2WZ9A 5AIVA 1R7HA 2ZCTA 5CRHA 4CHSA 2YP6A 4XTSA 4FIWA 4MF7A 1WE0A 1VF2A 1ERUA 2YZHA 2JADA 2RUEA 4KX4A 1G6YA 3ZFLA 1WPIA 2JL4A 3GH9A 1ON4A 1EOHA 5HR1A 3QCPA 1BYEA 1F6MC 5CRGA 3D22A 3W6GA 3KZQA 4V2MA 1TXXA 2XBQA 1K0BA 3C71A 1AC1A 1SD9A 2FWFA 3EU4A 1GL8A 1X5EA 1AQWA 2KP1A 4L5LA 4EE0A 3DXBA 2DJJA 1A2MA 5ECSA 4HJMA 5J9BA 5G1KA 2IMDA 1U3AA 1PL2A 3O3TA 1DE1A 2KLXA 3UEMA 1SU9A 2P31A 3GUSA 5LNKe 5CO3A 2GT5A 2H1BA 2MBSA 2OE3A 2H8LA 3HJMA 3RPNA 4GQFA 3TKRA 2C1YA 2V41A 1GTAA 3R2QA 3TOTA 1MEKA 2CVKA 2H1GA 2L59A 4ZILA 3UARA 5KN0A 4KDYA 4POLA 1NHOA 3ZL5A 2H75A 3MSZA 3KP9A 2VCVA 1WJKA 2H0GA 2MYGA 1FG4A 2B5YA 2K6VA 2X99A 1UC7A 2I3YA 2AV4A 3DWVA 1XWCA 4J2FA 2XBIA 1TU7A 3L4NA 3RHBA 2DJ0A 1GTIA 5JCUA 1EWXA 2H6ZA 5FWGA 1EZKA 1UVZA 2YJ7A 4IJ3A 5ECMB 4EXJA 2IMIA 2HZEA 2GQMA 5H5SA 5AISA 3UMAA 2M80A 3NZNA 2NDOA 3F9UA 2A2RA 2HXKA 1OC8A 4N11A 4NPBA 1EOGA 3APQA 4EDYA 2B6MA 5ECOB 4ECBA 3C1RA 4ZB8A 5HR3A 2GSTA 1T4ZA 2XPDA 2R2JA 4K7OA 3ZZXA 4PQIA 2YJHA 4QL9A 1G7OA 1H75A 4PNGA 5DALA 4JR6A 4YQUA 3EURA 5D73A 1DE2A 1B4QA 5F06A 4Q5QA 1XBSA 1K3OA 3FZ4A 1V58A 6GSTA 2CA8A 2HSHA 1A0FA 1B9YC 1RQMA 5IPGA 1WWJA 2BTOT 5C04A 6GSXA 5G1LA 4V1Ag 2DBCA 4QQ7A 2VOCA 1ABAA 3TJFA 1QUWA 4ACSA 3HDCA 3H79A 4N0VA 3G9BA 2C3TA 1ACVA 3UIWA 2F8FA 2V6KA 3KTBA 1CQHA 4PQ1A 1BX9A 1AQVA 3ISOA 1XWGA 3EMPA 3O76A 1TK0B 5GSSA 4O32A 4DVCA 3F0IA 4KUNA 4P3YB 3VWUA 2LUSA 4PQHA 2OE0A 2B3SA 3KJYA 2B5XA 3KMOA 3UOMA 1V9WA 4ZIJA 2O8VB 3D5JA 4DSSA 1GSDA 1SL2B 3U6VA 3IPZA 3A2WA 1A2JA 2JSZA 4TXVA 2H73A 2HNLA 3U5RE 5CYYA 5GZZB 4OO5A 5B6NA 3KEBA 4BVXA 3H1NA 1XWKA 1OKDA 5ID2A 2VLUA 1JLVA 4IW9A 3TGZA 3PGTA 2O7KA 2GSSA 5ELGA 3CTGA 1Z9HA 1M7TA 4FH8A 5DBQA 3TKSC 3D21A 5J41A 1MDJA 3M1GA 4ML6A 4EUYA 2L4QA 4EC0A 5F0GA 2DC5A 2FLSA 3GRXA 3P8WA 1LU4A 2OBKA 5IMFA 4F0CA 4KA0A 3KIJA 4PX1A 2G0FA 5DVBA 3QR6A 5HR0A 2AJQB 2PVOC 2GGTA 3ZITA 3BJ5A 2IFQA 1Y25A 4RQRA 3LG6A 4WF4A
chains in the Genus database with same CATH superfamily
2AUVA 2R3XA 3DVWA 4RQXA 3ERGA 2QC7A 4G0IA 3FHKA 5D9TA 4HSCX 3CBUA 4WETA 3A2VA 1B4PA 3GTUA 4HDEA 3TJBA 20GSA 1X9SB 3AY8A 4F03A 1UA5A 4MH3A 2HI7A 4OFMA 1JZWA 3Q18A 3CRTA 5E59A 5IO0A 1Q4JA 2PU9C 11GSA 3RPPA 3HVNA 1GWCA 4K7IA 3WT2A 3GYKA 2V2GA 3PH9A 2IMKA 1PSQA 1H4OA 2IPAA 1X9WB 18GSA 5D9XA 2LQOA 1XCCA 2TIRA 4MF5A 5IOWA 3E3EA 1E2YA 4WXTA 2H1DA 4J57E 3H4KA 2V1MA 2MMNA 4POMA 16GSA 1F37A 1YEXA 4WKWA 4K5RA 3BCIA 1TDIA 4POBA 1T7PB 1C72A 1TRWA 3LXTA 3IXRA 3TB2A 5F05A 1OKTA 2P5QA 3EVIA 4KAEA 2MMOA 1LJRA 4TR1A 2H71A 3E9JB 2OA7A 5KOWA 3IOSA 2C80A 4ID0A 4I2TA 3CRUA 3I43A 4PGTA 5JWRB 1G6WA 2VL9A 3GNJA 4MJEA 1U6TA 3FEUA 1T1VA 1T4YA 2DJ3A 3CMIA 10GSA 3TKSE 5H5RA 1M2BA 3ZRDA 1GSYA 4XS4A 3H8QA 5G31A 2GS3A 5JWQB 1XWAA 2KP2A 3TJKA 2VD1A 1TJDA 3FY7A 2YN1A 1GNEA 4H86A 3WT1A 4FYCA 2ZNMA 3GX0A 2RLIA 4MDCA 2VL2A 1ML6A 4MMMA 4JBBA 3TKQA 1PD21 2FNOA 1K0CA 1K0DA 4GWRA 2OACA 2LV3A 5HQPA 4YKGA 4JR4A 5KN3A 3CSJA 1BQ7A 4IBPA 2I81A 3KD0A 3WYWA 2GDRA 1WOUA 1GUHA 2GZZA 1V40A 2YWIA 4TVEA 4KF9A 3M8NA 3MIXA 4EIPA 2H72A 1E6BA 2HRNA 5CRDA 2KOKA 1A23A 3TDGA 5LD0A 4L5OA 1PKZA 2VCWA 4K0NA 3DGQA 5L71A 4G0KA 1OC3A 1RW1A 3QFBC 5FT3A 1FVJA 4MCUA 1K0MA 5JWOB 1Z3EA 3ERFA 1VF3A 2L6CA 1PL1A 1S3DA 4I5QA 5G30A 1NW2A 2LNSA 2LEGA 4TR3A 3WGXA 3O6TA 2WGRA 3LXZA 4KGIA 12GSA 1EEMA 2RM6A 4HQSA 2JACA 4ZBAA 2L6DA 4O92A 3HKRA 3QAGA 1XFLA 3HA9A 3VFIA 6GSYA 6GSUA 1TRSA 1A0RP 2OADA 4MJCA 3LJRA 4D73B 1JZOA 1YKCA 2J23A 4GXZA 1TK5B 2V32A 2PWJA 6GSVA 9GSSA 3IC4A 4FO5A 3UVHA 1O85A 1FB6A 2WCIA 2E7PA 4K9ZA 1GSSA 4OFTA 3WGDA 5DQSA 4IVFA 2HSMA 3UBLA 2VUPA 4WF5A 2X8HA 5EVOA 2X4AA 4TXOB 5D96A 1AUCA 1K0AA 1PN0A 4X0XA 1MDKA 1M2AA 2H76A 2RUFA 4G19A 4OCEA 1QQ2A 4TN8A 4GSSA 4OD7A 3FZ9A 2AB6A 4DSRA 1K3LA 1FO5A 1A2LA 1O81A 1OC9A 1SKRB 1F2EA 14GSA 2KUCA 2ON5A 1IYHA 4LMVA 2CVDA 1X5DA 2LRCA 1BJXA 4N10A 4HUAA 1LBKA 4LA1A 4PUAA 4TR4A 2L57A 3FZAA 1GSEA 4K2XA 1ZOFA 2EIOA 1XW6A 2FD3A 2C0DA 1KEBA 3ZYWA 3KXOA 1GP1A 1TTZA 4TOPA 4ZL9A 3LEFA 1FAAA 2DIZA 4KE3A 4YAVA 2H1AA 4I97A 4J56E 5G5FA 1IYIA 4WBRD 3LYKA 3BD2A 3HYPA 2VM1A 3J7Yk 3TJGA 2TRCP 3L9SA 2PUKC 3D0ZA 13GSA 5CREA 2H30A 3VWVA 1YZXA 5A4WA 2YV7A 2R4VA 3BCKA 5ECRB 3I69A 2LSTA 4XHMA 3IAM2 3GURA 1M3JA 1W4VA 3PINA 5GAND 3QAVA 1XG8A 3LORA 2VO4A 1K3YA 2C0GA 5J3RA 3MAKA 3F8UA 4MF6A 5DAKA 1PMTA 1SD8A 3JCML 2H74A 1NM3A 4OFNA 1HD2A 2JZSA 3D4TA 4BPYA 3KTLA 1T3BA 4EO3A 1K0OA 3DKSA 3VI7A 3HVVA 4IGJA 3ZTLA 5KEJA 2OJLA 4MABA 1F3BA 4HZ2A 5ABRA 4BVYA 2GZPA 3GKMA 4GLTA 5B8AA 5KN2A 3I6AA 1SJZA 2IMFA 1UN2A 4PTSA 1SYXA 1SKWB 2G2QA 4EF0A 2H6XA 2CT6A 4ECJA 1KNGA 1Y6EA 4MJAA 3P90A 6GSWA 3GKNA 2F51A 4CDOA 5ECKB 3IK7A 2QA1A 3VWXA 4G10A 3N9JA 5EY6A 2H0HA 1JFUA 3Q19A 4LL4B 3LYPA 5ECIB 2GZYA 1B8XA 2MMAA 1VF4A 5IIZA 4K6XA 2DJ1A 1ZYEA 1TKDB 1KBNA 2N5BA 4TW5A 5HR2A 4AJ7A 4MZWA 2K8VA 4MZBA 1M99A 1GSFA 2IWTA 2HFDA 4GQCA 4L0UA 3ZREA 3IK9A 3HHVA 2PPTA 7GSSA 3HVXA 3MWHA 3C1SA 3RBTA 3L78A 3UVTA 1PKWA 1GRXA 2OBIA 5BRTA 1EP7A 4EIQA 2F8AA 1R5AA 4YAPA 2B1KA 3DMLA 2HRFA 3G7JA 2ALBA 1OAZA 2NTOA 4V2LA 3EMXA 1TP9A 1PQNA 4KDXA 2XC2A 4ZXGA 3GHAA 1O6JA 2NVLA 4IP6A 3ZFBA 4Z2UA 1U88A 1A24A 3C7MA 1CQGA 4POKA 3C8EA 4F0BA 3VLNA 1QXHA 1TU8A 4EDZA 2LJAA 3ZIJA 3QMXA 2DMLA 4V1Ap 3TKPA 4A5PA 4O5QA 4GSNA 1USBA 3ZMLA 2HSYA 1U3IA 4GTUA 2C3NA 3M0FA 3V1WA 5F8BA 2B7JA 3F4TA 3ME8A 5ECNB 1JLWA 1M3IA 2QSIA 2MMZA 1FOVA 4WBJA 3A5WA 3A5IA 5B7CA 1SJIA 4IELA 1PRXA 4HZ4A 4PXOA 1Z6MA 2VL3A 1A8LA 3HJOA 2R6KA 5IPHA 1N2AA 3L9VA 1J9BA 5CP1A 4O7HA 2ES7A 1ERTA 4E8HA 5J9CA 3DEXA 1DBYA 4K0GA 2Z9SA 1XZOA 2VCZA 1F9MA 4Q5RA 2B7KA 4V2NA 3IRAA 3GL3A 5A4VA 5HFKA 4GSTA 5COHA 1M9AA 4TRXA 2VAFA 4IS0A 1R4WA 4WR5A 2FWHA 3APSA 4X4JA 2FY6A 2MZCA 4KDUA 4Q5NA 4ZBBA 4ZL8A 5J5NA 2DKHA 3ZVJA 5IMCA 5BMUA 1O8XA 4GF0A 2FA8A 22GSA 5B6MA 3EYTA 1X9MB 4I8BA 5G2ZA 2YWMA 1SK2A 1XWBA 2CV4A 3GL5A 4FQUA 1TI1A 2O87A 3CXGA 3IHQA 3IAS2 1A8YA 1SJ6A 4HU9A 1R26A 4IHUA 1HNBA 17GSA 4TKYA 4ECIA 4JEDA 4YKFA 2WULA 2L5LA 3H93A 5GSTA 3TKSA 2X8CA 1EGOA 1GULA 1NSWA 3HCZA 2QGVA 3CYNA 1FHEA 5ECQB 4K7NA 1WRYA 1GUKA 1YEPA 3NIVA 5IMZA 3SWLA 2WRTA 3HD5A 4O5RA 3CQFA 1SKSB 2X49A 3P7XA 3S9FA 4X43A 1EGRA 2C0EA 3TCOA 4FYUA 1GSQA 2VCQA 1ZZYA 1B9XC 4BL7A 2N5FA 4WEYA 2X8GA 4HI7A 2V6OA 2YANA 3EU3A 1B48A 5CRWA 1HNAA 2CZ2A 2A2SA 3DVXA 1EV9A 2L5OA 2YPMA 1MD4A 2HZEB 4XIHA 2AYTA 3GN3A 3M9JA 4AJ8A 3D6IA 2J9HA 4Z7XA 2FUG2 1THOA 1M2DA 4X1UA 2WFCA 1AXDA 3GIXA 3SBCA 5ENUA 4HJ2A 4MH2A 3DYRA 1Z6NA 5DALB 3CTFA 2P0GA 5D8IA 3IDVA 1XW9A 3UJ1A 3ZLPA 4YQMA 2H01A 1M9BA 4KNDA 3ZIVA 1QFNA 3M9KA 3FK8A 3OR5A 3QOUA 2LRTA 4K2DA 4RI6A 1SL1B 1GNWA 3N5OA 1R5PA 4MNNA 2GQLA 2GSQA 1F3AA 3W8SA 1W89A 2HT9A 4YH2A 4OO4A 2L4CA 1YF1A 2C3QA 4XRDA 5C00A 2DJKA 4PUFC 1SK0A 1DUGA 1Z5YE 2YWNA 1MTCA 3BBYA 3G7YA 3NOFA 2B5EA 2FWGA 2GVPA 1TI3A 2A4VA 5IQYA 1ZYPA 1SL0B 4MLYA 1YDKA 3FW2A 4JRRA 3RDWA 4XS1A 4AJ6A 3F3QA 3RHCA 4YQVA 2NPBA 3BOAA 1VF1A 2TRXA 3QFAC 5DJLA 4O5UA 1GTUA 1MDIA 3E0UA 3VPTA 2CX3A 3HY2A 1X0RA 1XPVA 3FKFA 4KCAA 3HJPA 4ZL7A 2GSRA 4KH7A 4DEJA 2PERA 3F4SA 2PMTA 2JZRA 2H66A 3TOUA 2DKIA 4JU5A 3HVSA 4DSSB 3QAWA 5ECPB 1YJ6A 2O89A 4NV5A 5LCZA 1EEJA 5IOXA 2FCHA 2CAIA 1YKAA 5IMVA 4PNFA 3ED3A 4IKHA 1X5CA 1SENA 4FYBA 3PR8A 5ECLB 4BVXB 3LQ7A 2ON7A 2BJXA 2C8UA 5ID2B 3F3RA 2VD0A 4USSA 2E0QA 3GSTA 2HRAA 1WIKA 1ERWA 3I9V2 19GSA 5EL8A 5HFIA 4NHZA 3ERWA 2H0IA 2OKAA 2H6YA 2R5GA 2VIMA 3Q74A 4MP4A 5EPFA 2E2MA 1THXA 4RI7A 3UAPA 2FHEA 5F07A 4BWQA 4NHWA 4HU7A 3FZ5A 3MDKA 3KH7A 5INYA 3QD9A 5H5QA 3VPQA 4I2UA 1FVKA 5DJMA 6GSSA 4ISDA 2GT6A 2PVQA 2R0GA 1ZL9A 2X64A 3GKKA 3F6FA 3GMFA 4JZQA 2IFQB 3R3EA 4GRFA 1SYRA 3TUEA 1JZDA 3FRCA 1OVNA 1Z7RA 3K8NA 1Q98A 4MPFA 2BMXA 1ZGNA 3IR4A 2RM5A 3Q6OA 3M3MA 4DSQA 1KTEA 3VWWA 1GLQA 5GAPD 4L0WA 1PA3A 3GTUB 2EC4A 2B1LA 2K18A 5D9VA 5DCHA 4JE1A 1HQOA 2H19A 2XHFA 2YCDA 3DD3A 1GSUA 1BAYA 3TJJA 1PN9A 4OWYA 4NWYA 2K8SA 4L8EA 3GSSA 2E2GA 3ZMKA 5JCWA 4ML1A 3A2XA 1FB0A 1QGVA 4AGSA 1I9DA 4D73A 4EVMA 1DSBA 1XVQA 4NXIA 2WJUA 4ZBDA 3KP8A 3EC3A 1V57A 4QL7A 1O8WA 2IMEA 3GFKA 3WGEA 5DCGA 3GH6A 2HYXA 2D2ZA 3ME7A 1G0TA 4CW9A 2AAWA 4TXOA 4KSOA 2YOIA 2K9FA 2FWEA 2R37A 4F82A 2CZ3A 2MBTA 2F9SA 1S3RA 2YZUA 2H70A 2DSAA 4HQZA 2HLSA 4IQAA 4NMUA 1AQXA 4TR1B 3FR9A 2CQ9A 1AIUA 2LQQA 4HS1A 5D9WA 4PURA 2IL3A 1XVWA 4LMWA 2M72A 3DIEA 1TK8B 3QDNA 2IIYA 3GX8A 1O73A 2DLXA 3GKXA 4Q5FA 1XIYA 4KB3A 1ZYQB 4E8EA 1PFOA 2I4AA 4XS4B 3EINA 1JZRA 2I9HA 3W8JA 1OYJA 4G9HA 1U87A 4IJIA 1PX7A 2EIRA 2IJYA 2VCTA 2LNTA 1Z7PA 1AAZA 1XXUA 5AGYA 4ZB6A 1YF0A 5G5EA 4N30A 4OCFA 3G7IA 5J4UA 1S3AA 1FW1A 3EE2A 4MJBA 4BWSA 2LJRA 2VCXA 4ECCA 2GTUA 4ILFA 4F9ZA 3RAZA 1M0UA 4IQ1A 2I1UA 4EKZA 5AN1A 2JSYA 2M46A 1SK1A 3KMNA 2RIIA 1GLPA 2HE3A 4BA7A 5FHIA 2VL2C 3FYGA 1N8JA 5DQYA 5E4WA 3FR6A 1EV4A 4AF2A 2NBSA 2FGXA 5IO2A 1URMA 2YNXA 4TR0A 1NHYA 3MNGA 4LL1B 2AHEA 1J0FA 3HXSA 4KCEA 1OE7A 2DIYA 4IN0A 3WD6A 3DRNA 4XCSA 1GH2A 1J08A 3QPMA 2PBJA 1WP0A 2LRNA 5DDLA 4CY8A 2P5RA 4N0ZA 1XOAA 1YQ1A 2WB9A 3TRPA 3L0HA 8GSSA 1BG5A 3LSZA 1AW9A 4ULXA 3ZVJD 5A4UA 1XW5A 1GUMA 3F4RA 5B8BA 1JHBA 2VLTA 2VM2A 2FA4A 4K1FA 1O7UA 2OE1A 1TW9A 4EL1A 5AIXA 3C73A 3F6DA 3L9UA 1S3CA 2QKEA 3EWLA 4KW6A 1EP8A 3LFLA 3KM6A 2KHPA 4IP1A 4ZB9A 2JZTA 5A5KA 4G2EA 2EIQA 4Z2RA 2UZ8A 3VURA 2PGTA 5IM9A 2LJKA 3IBHA 3LGCA 1ST9A 2GQKA 1TRVA 2LTKA 2ZUPA 5KN1A 3CSHA 1ZCPA 2WS2A 2CAQA 5HFGA 4I6XA 4MPGA 1YY7A 1TOFA 2IN3A 1I5GA 2WDUA 4K5SA 3TRXA 4RUVA 2HZFA 4F2IA 3HZ8A 4GCIA 3UBKA 2C0FA 3IE3A 3LWAA 4NV2A 1HNCA 2VLVA 3GA4A 1OC9B 1HYUA 1VRSD 4HEA2 2YV9A 1TRUA 3UL3A 4MK3A 1ZMAA 2YWOA 3A3TA 2DJ2A 4K8MA 5CNWA 4KSMA 3D4MA 2C4JA 4MZCA 5JCGA 2REMA 4MA9A 5KOXA 1GTBA 2N5AA 4WR4A 3FMWA 1T00A 1ILOA 4XRAA 1ZYNA 2XPEA 3CSIA 3GV1A 1V98A 5IMDA 2CVBA 2O85A 2JU5A 2CX4A 5CAXA 1QMVA 1MD3A 5ECHB 1PX6A 3KH9A 4LLRA 3IV4A 1OE8A 1PGTA 3APOA 5D93A 3VI5A 4OMVA 3KGKA 5ELAA 4NAXA 3KCMA 1T8EB 3HZ4A 3LW9A 5IMAA 3J7Yb 2LS5A 1V2AA 4XS6A 3US3A 1RK4A 3F63A 1VGLA 3P2AA 3FR3A 2F3MA 1G7EA 2GLRA 5DAKB 3VK9A 2PN8A 1QK8A 1K0NA 4HOJA 1XOBA 3TRQA 3IA1A 2LKUA 1WMJA 1BEDA 2DMMA 1ERVA 2WZ9A 5AIVA 1R7HA 2ZCTA 5CRHA 4BVYB 2YP6A 4CHSA 4XTSA 4FIWA 4MF7A 1WE0A 1VF2A 1ERUA 2YZHA 2JADA 2RUEA 4KX4A 1G6YA 3ZFLA 1WPIA 2JL4A 3GH9A 1ON4A 1EOHA 3MYDA 5HR1A 3QCPA 1BYEA 1F6MC 5CRGA 3IHGA 3D22A 3W6GA 3KZQA 4V2MA 1TXXA 2XBQA 1K0BA 3C71A 1AC1A 1SD9A 3PPUA 2FWFA 3EU4A 1GL8A 1X5EA 1AQWA 2KP1A 4L5LA 4EE0A 3DXBA 2DJJA 1A2MA 5ECSA 4HJMA 5J9BA 5G1KA 2A2PA 2IMDA 1U3AA 1PL2A 3O3TA 1DE1A 2KLXA 3UEMA 1SU9A 2P31A 3GUSA 5LNKe 5CO3A 2GT5A 2H1BA 2MBSA 2OE3A 2H8LA 3HJMA 3RPNA 4GQFA 3TKRA 2C1YA 2HRKA 1GTAA 2V41A 3R2QA 3TOTA 1MEKA 2CVKA 2H1GA 2L59A 4ZILA 3UARA 5KN0A 4KDYA 4POLA 1NHOA 3ZL5A 2H75A 3MSZA 3KP9A 2VCVA 1WJKA 2H0GA 2MYGA 1FG4A 2B5YA 2K6VA 2X99A 1UC7A 2I3YA 2AV4A 3DWVA 1XWCA 4J2FA 2XBIA 1TU7A 3L4NA 3RHBA 2DJ0A 1GTIA 5JCUA 1EWXA 2H6ZA 5FWGA 1EZKA 1UVZA 2YJ7A 4IJ3A 5ECMB 4BIKA 4EXJA 2IMIA 2HZEA 4G0LA 2GQMA 5H5SA 5AISA 3UMAA 2M80A 3NZNA 2NDOA 3F9UA 2A2RA 4Z2TA 2HXKA 1OC8A 4N11A 4NPBA 1EOGA 3APQA 1FOHA 4EDYA 2B6MA 5ECOB 4ECBA 3C1RA 4ZB8A 5HR3A 4ICYA 2GSTA 1T4ZA 2XPDA 2R2JA 4K7OA 3ZZXA 4PQIA 2YJHA 4QL9A 1G7OA 1H75A 4PNGA 5DALA 4JR6A 4YQUA 3EURA 5D73A 1DE2A 1B4QA 5F06A 4Q5QA 1XBSA 1K3OA 2R0CA 3FZ4A 1V58A 6GSTA 2CA8A 2HSHA 1A0FA 1B9YC 1RQMA 5IPGA 1WWJA 2BTOT 5C04A 6GSXA 5G1LA 4V1Ag 2DBCA 4QQ7A 2VOCA 1ABAA 3TJFA 1QUWA 4ACSA 3HDCA 3H79A 4N0VA 3G9BA 2C3TA 1ACVA 3UIWA 2F8FA 2V6KA 3KTBA 1CQHA 4PQ1A 1BX9A 1AQVA 3ISOA 1XWGA 3EMPA 3O76A 1TK0B 5GSSA 4O32A 3IC8A 4DVCA 3F0IA 4KUNA 4P3YB 3VWUA 2LUSA 4PQHA 2QA2A 2OE0A 2B3SA 3KJYA 2B5XA 3KMOA 3UOMA 1V9WA 4ZIJA 2O8VB 3D5JA 4DSSA 1GSDA 1SL2B 3U6VA 3IPZA 3A2WA 1A2JA 2JSZA 4TXVA 2H73A 2HNLA 3U5RE 5CYYA 5GZZB 4OO5A 5B6NA 2A4HA 3KEBA 4BVXA 3H1NA 1XWKA 1OKDA 5ID2A 2VLUA 1JLVA 4IW9A 3TGZA 3PGTA 2O7KA 2GSSA 2R0PA 5ELGA 3CTGA 1Z9HA 1M7TA 4FH8A 5DBQA 3TKSC 3D21A 5J41A 1MDJA 3M1GA 4BL7B 4ML6A 4EUYA 3EPTA 2L4QA 4EC0A 5F0GA 2DC5A 2FLSA 3GRXA 3P8WA 1LU4A 2OBKA 5IMFA 4F0CA 4KA0A 3KIJA 4PX1A 2G0FA 5DVBA 3QR6A 5HR0A 2AJQB 2PVOC 2GGTA 3ZITA 3BJ5A 2IFQA 1Y25A 4CY6A 4RQRA 3LG6A 4WF4A
chains in the Genus database with same CATH topology
2AUVA 2R3XA 3DVWA 4RQXA 3ERGA 2QC7A 4G0IA 3FHKA 5D9TA 3CBUA 4WETA 3A2VA 1B4PA 3GTUA 4HDEA 3TJBA 20GSA 1X9SB 3AY8A 4F03A 1UA5A 4MH3A 2HI7A 4OFMA 1JZWA 3Q18A 3CRTA 5E59A 5IO0A 1Q4JA 2PU9C 11GSA 3RPPA 1GWCA 4K7IA 3WT2A 3GYKA 2V2GA 3PH9A 2IMKA 1PSQA 1H4OA 2IPAA 1X9WB 18GSA 5D9XA 2LQOA 1XCCA 2TIRA 4MF5A 5IOWA 3E3EA 1E2YA 4WXTA 2H1DA 4J57E 3H4KA 2V1MA 2MMNA 4POMA 16GSA 1F37A 1YEXA 4WKWA 4K5RA 3BCIA 1TDIA 4POBA 1T7PB 1C72A 1TRWA 3LXTA 3IXRA 3TB2A 5F05A 1OKTA 2P5QA 3EVIA 4KAEA 2MMOA 1LJRA 4TR1A 2H71A 3E9JB 2OA7A 5KOWA 3IOSA 2C80A 4ID0A 4I2TA 3CRUA 3I43A 4PGTA 5JWRB 1G6WA 2VL9A 3GNJA 4MJEA 1U6TA 3FEUA 1T1VA 1T4YA 2DJ3A 3CMIA 10GSA 3TKSE 5H5RA 1M2BA 3ZRDA 1GSYA 4XS4A 3H8QA 5G31A 2GS3A 5JWQB 1XWAA 2KP2A 3TJKA 2VD1A 1TJDA 3FY7A 2YN1A 1GNEA 4H86A 3WT1A 4FYCA 2ZNMA 3GX0A 2RLIA 4MDCA 2VL2A 1ML6A 4MMMA 4JBBA 3TKQA 1PD21 2FNOA 1K0CA 1K0DA 4GWRA 2OACA 2LV3A 5HQPA 4YKGA 4JR4A 5KN3A 3CSJA 1BQ7A 4IBPA 2I81A 3KD0A 3WYWA 2GDRA 1WOUA 1GUHA 2GZZA 1V40A 2YWIA 4TVEA 4KF9A 3M8NA 3MIXA 4EIPA 2H72A 1E6BA 2HRNA 5CRDA 2KOKA 1A23A 3TDGA 5LD0A 4L5OA 1PKZA 2VCWA 4K0NA 3DGQA 5L71A 4G0KA 1OC3A 1RW1A 3QFBC 5FT3A 1FVJA 4MCUA 1K0MA 5JWOB 1Z3EA 3ERFA 1VF3A 2L6CA 1PL1A 1S3DA 4I5QA 5G30A 1NW2A 2LNSA 2LEGA 4TR3A 3WGXA 3O6TA 2WGRA 3LXZA 4KGIA 12GSA 1EEMA 2RM6A 4HQSA 2JACA 4ZBAA 2L6DA 4O92A 3HKRA 3QAGA 1XFLA 3HA9A 3VFIA 6GSYA 6GSUA 1TRSA 1A0RP 2OADA 4MJCA 3LJRA 4D73B 1JZOA 1YKCA 2J23A 4GXZA 1TK5B 2V32A 2PWJA 6GSVA 9GSSA 3IC4A 4FO5A 3UVHA 1O85A 1FB6A 2WCIA 2E7PA 4K9ZA 1GSSA 4OFTA 3WGDA 5DQSA 4IVFA 2HSMA 3UBLA 2VUPA 4WF5A 2X8HA 5EVOA 2X4AA 4TXOB 5D96A 1AUCA 1K0AA 1PN0A 4X0XA 1MDKA 1M2AA 2H76A 2RUFA 4G19A 4OCEA 1QQ2A 4TN8A 4GSSA 4OD7A 3FZ9A 2AB6A 4DSRA 1K3LA 1FO5A 1A2LA 1O81A 1OC9A 1SKRB 1F2EA 14GSA 2KUCA 2ON5A 1IYHA 4LMVA 2CVDA 1X5DA 2LRCA 1BJXA 4N10A 4HUAA 1LBKA 4LA1A 4PUAA 4TR4A 2L57A 3FZAA 1GSEA 4K2XA 1ZOFA 2EIOA 1XW6A 2FD3A 2C0DA 1KEBA 3ZYWA 3KXOA 1GP1A 1TTZA 4TOPA 4ZL9A 3LEFA 1FAAA 2DIZA 4KE3A 4YAVA 2H1AA 4I97A 4J56E 5G5FA 1IYIA 4WBRD 3LYKA 3BD2A 3HYPA 2VM1A 3J7Yk 3TJGA 2TRCP 3L9SA 2PUKC 3D0ZA 13GSA 5CREA 2H30A 3VWVA 1YZXA 5A4WA 2YV7A 2R4VA 3BCKA 5ECRB 3I69A 2LSTA 4XHMA 3IAM2 3GURA 1W4VA 3PINA 5GAND 3QAVA 3LORA 2VO4A 1K3YA 2C0GA 5J3RA 3MAKA 3F8UA 4MF6A 5DAKA 1PMTA 1SD8A 3JCML 2H74A 1NM3A 4OFNA 1HD2A 2JZSA 3D4TA 4BPYA 3KTLA 1T3BA 4EO3A 1K0OA 3DKSA 3VI7A 3HVVA 4IGJA 3ZTLA 5KEJA 2OJLA 4MABA 1F3BA 4HZ2A 5ABRA 4BVYA 2GZPA 3GKMA 4GLTA 5B8AA 5KN2A 3I6AA 1SJZA 2IMFA 1UN2A 4PTSA 1SYXA 1SKWB 2G2QA 4EF0A 2H6XA 2CT6A 4ECJA 1KNGA 1Y6EA 4MJAA 3P90A 6GSWA 3GKNA 2F51A 4CDOA 5ECKB 3IK7A 2QA1A 3VWXA 4G10A 3N9JA 5EY6A 2H0HA 1JFUA 3Q19A 4LL4B 3LYPA 5ECIB 2GZYA 1B8XA 2MMAA 1VF4A 5IIZA 4K6XA 2DJ1A 1ZYEA 1TKDB 1KBNA 2N5BA 4TW5A 5HR2A 4AJ7A 4MZWA 2K8VA 4MZBA 1M99A 1GSFA 2IWTA 2HFDA 4GQCA 4L0UA 3ZREA 3IK9A 3HHVA 2PPTA 7GSSA 3HVXA 3MWHA 3C1SA 3RBTA 3L78A 3UVTA 1PKWA 1GRXA 2OBIA 5BRTA 1EP7A 4EIQA 2F8AA 1R5AA 4YAPA 2B1KA 3DMLA 2HRFA 3G7JA 2ALBA 1OAZA 2NTOA 4V2LA 3EMXA 1TP9A 1PQNA 4KDXA 2XC2A 4ZXGA 3GHAA 1O6JA 2NVLA 4IP6A 3ZFBA 4Z2UA 1U88A 1A24A 3C7MA 1CQGA 4POKA 3C8EA 4F0BA 3VLNA 1QXHA 1TU8A 4EDZA 2LJAA 3ZIJA 3QMXA 2DMLA 4V1Ap 3TKPA 4A5PA 4O5QA 4GSNA 1USBA 3ZMLA 2HSYA 1U3IA 4GTUA 2C3NA 3M0FA 3V1WA 5F8BA 2B7JA 3F4TA 3ME8A 5ECNB 1JLWA 2QSIA 2MMZA 1FOVA 4WBJA 3A5WA 3A5IA 5B7CA 1SJIA 4IELA 1PRXA 4HZ4A 4PXOA 1Z6MA 2VL3A 1A8LA 3HJOA 2R6KA 5IPHA 1N2AA 3L9VA 1J9BA 5CP1A 4O7HA 2ES7A 1ERTA 4E8HA 5J9CA 3DEXA 1DBYA 4K0GA 2Z9SA 1XZOA 2VCZA 1F9MA 4Q5RA 2B7KA 4V2NA 3IRAA 3GL3A 5A4VA 5HFKA 4GSTA 5COHA 1M9AA 4TRXA 2VAFA 4IS0A 1R4WA 4WR5A 2FWHA 3APSA 4X4JA 2FY6A 2MZCA 4KDUA 4Q5NA 4ZBBA 4ZL8A 5J5NA 2DKHA 3ZVJA 5IMCA 5BMUA 1O8XA 4GF0A 2FA8A 22GSA 5B6MA 3EYTA 1X9MB 4I8BA 5G2ZA 2YWMA 1SK2A 1XWBA 2CV4A 3GL5A 4FQUA 1TI1A 2O87A 3CXGA 3IHQA 3IAS2 1A8YA 1SJ6A 4HU9A 1R26A 4IHUA 1HNBA 17GSA 4TKYA 4ECIA 4JEDA 4YKFA 2WULA 2L5LA 3H93A 5GSTA 3TKSA 2X8CA 1EGOA 1GULA 1NSWA 3HCZA 2QGVA 3CYNA 1FHEA 5ECQB 4K7NA 1WRYA 1GUKA 1YEPA 3NIVA 5IMZA 3SWLA 2WRTA 3HD5A 4O5RA 1SKSB 2X49A 3P7XA 3S9FA 4X43A 1EGRA 2C0EA 3TCOA 4FYUA 1GSQA 2VCQA 1ZZYA 1B9XC 4BL7A 2N5FA 4WEYA 2X8GA 4HI7A 2V6OA 2YANA 3EU3A 1B48A 5CRWA 1HNAA 2CZ2A 2A2SA 3DVXA 1EV9A 2L5OA 2YPMA 1MD4A 2HZEB 4XIHA 2AYTA 3GN3A 3M9JA 4AJ8A 3D6IA 2J9HA 4Z7XA 2FUG2 1THOA 1M2DA 4X1UA 2WFCA 1AXDA 3GIXA 3SBCA 5ENUA 4HJ2A 4MH2A 3DYRA 1Z6NA 5DALB 3CTFA 2P0GA 5D8IA 3IDVA 1XW9A 3UJ1A 3ZLPA 4YQMA 2H01A 1M9BA 4KNDA 3ZIVA 1QFNA 3M9KA 3FK8A 3OR5A 3QOUA 2LRTA 4K2DA 4RI6A 1SL1B 1GNWA 3N5OA 1R5PA 4MNNA 2GQLA 2GSQA 1F3AA 3W8SA 1W89A 2HT9A 4YH2A 4OO4A 2L4CA 1YF1A 2C3QA 4XRDA 5C00A 2DJKA 4PUFC 1SK0A 1DUGA 1Z5YE 2YWNA 1MTCA 3BBYA 3G7YA 3NOFA 2B5EA 2FWGA 2GVPA 1TI3A 2A4VA 5IQYA 1ZYPA 1SL0B 4MLYA 1YDKA 3FW2A 4JRRA 3RDWA 4XS1A 4AJ6A 3F3QA 3RHCA 4YQVA 2NPBA 3BOAA 1VF1A 2TRXA 3QFAC 5DJLA 4O5UA 1GTUA 1MDIA 3E0UA 3VPTA 2CX3A 3HY2A 1X0RA 1XPVA 3FKFA 4KCAA 3HJPA 4ZL7A 2GSRA 4KH7A 4DEJA 2PERA 3F4SA 2PMTA 2JZRA 2H66A 3TOUA 2DKIA 4JU5A 3HVSA 4DSSB 3QAWA 5ECPB 1YJ6A 2O89A 4NV5A 5LCZA 1EEJA 5IOXA 2FCHA 2CAIA 1YKAA 5IMVA 4PNFA 3ED3A 4IKHA 1X5CA 1SENA 4FYBA 3PR8A 5ECLB 4BVXB 3LQ7A 2ON7A 2BJXA 2C8UA 5ID2B 3F3RA 2VD0A 4USSA 2E0QA 3GSTA 2HRAA 1WIKA 1ERWA 3I9V2 19GSA 5EL8A 5HFIA 4NHZA 3ERWA 2H0IA 2OKAA 2H6YA 2R5GA 2VIMA 3Q74A 4MP4A 5EPFA 2E2MA 1THXA 4RI7A 3UAPA 2FHEA 5F07A 4BWQA 4NHWA 4HU7A 3FZ5A 3MDKA 3KH7A 5INYA 3QD9A 5H5QA 3VPQA 4I2UA 1FVKA 5DJMA 6GSSA 4ISDA 2GT6A 2PVQA 2R0GA 1ZL9A 2X64A 3GKKA 3F6FA 3GMFA 4JZQA 2IFQB 3R3EA 4GRFA 1SYRA 3TUEA 1JZDA 3FRCA 1OVNA 1Z7RA 3K8NA 1Q98A 4MPFA 2BMXA 1ZGNA 3IR4A 2RM5A 3Q6OA 3M3MA 4DSQA 1KTEA 3VWWA 1GLQA 5GAPD 4L0WA 1PA3A 3GTUB 2EC4A 2B1LA 2K18A 5D9VA 5DCHA 4JE1A 1HQOA 2H19A 2XHFA 2YCDA 3DD3A 1GSUA 1BAYA 3TJJA 1PN9A 4OWYA 4NWYA 2K8SA 4L8EA 3GSSA 2E2GA 3ZMKA 5JCWA 4ML1A 3A2XA 1FB0A 1QGVA 4AGSA 1I9DA 4D73A 4EVMA 1DSBA 1XVQA 4NXIA 2WJUA 4ZBDA 3KP8A 3EC3A 1V57A 4QL7A 1O8WA 2IMEA 3GFKA 3WGEA 5DCGA 3GH6A 2HYXA 2D2ZA 3ME7A 1G0TA 4CW9A 2AAWA 4TXOA 4KSOA 2YOIA 2K9FA 2FWEA 2R37A 4F82A 2CZ3A 2MBTA 2F9SA 2YZUA 2H70A 2DSAA 4HQZA 2HLSA 4IQAA 4NMUA 1AQXA 4TR1B 3FR9A 2CQ9A 1AIUA 2LQQA 4HS1A 5D9WA 4PURA 2IL3A 1XVWA 4LMWA 2M72A 3DIEA 1TK8B 3QDNA 2IIYA 3GX8A 1O73A 2DLXA 3GKXA 4Q5FA 1XIYA 4KB3A 1ZYQB 4E8EA 2I4AA 4XS4B 3EINA 1JZRA 2I9HA 3W8JA 1OYJA 4G9HA 1U87A 4IJIA 1PX7A 2EIRA 2IJYA 2VCTA 2LNTA 1Z7PA 1AAZA 1XXUA 5AGYA 4ZB6A 1YF0A 5G5EA 4N30A 4OCFA 3G7IA 5J4UA 1S3AA 1FW1A 3EE2A 4MJBA 4BWSA 2LJRA 2VCXA 4ECCA 2GTUA 4ILFA 4F9ZA 3RAZA 1M0UA 4IQ1A 2I1UA 4EKZA 5AN1A 2JSYA 2M46A 1SK1A 3KMNA 2RIIA 1GLPA 2HE3A 4BA7A 5FHIA 2VL2C 3FYGA 1N8JA 5DQYA 5E4WA 3FR6A 1EV4A 4AF2A 2NBSA 2FGXA 5IO2A 1URMA 2YNXA 4TR0A 1NHYA 3MNGA 4LL1B 2AHEA 1J0FA 3HXSA 4KCEA 1OE7A 2DIYA 4IN0A 3WD6A 3DRNA 4XCSA 1GH2A 1J08A 3QPMA 2PBJA 1WP0A 2LRNA 5DDLA 4CY8A 2P5RA 4N0ZA 1XOAA 1YQ1A 2WB9A 3TRPA 3L0HA 8GSSA 1BG5A 3LSZA 1AW9A 4ULXA 3ZVJD 5A4UA 1XW5A 1GUMA 3F4RA 5B8BA 1JHBA 2VLTA 2VM2A 2FA4A 4K1FA 1O7UA 2OE1A 1TW9A 4EL1A 5AIXA 3C73A 3F6DA 3L9UA 1S3CA 2QKEA 3EWLA 4KW6A 1EP8A 3LFLA 3KM6A 2KHPA 4IP1A 4ZB9A 2JZTA 5A5KA 4G2EA 2EIQA 4Z2RA 2UZ8A 3VURA 2PGTA 5IM9A 2LJKA 3IBHA 3LGCA 1ST9A 2GQKA 1TRVA 2LTKA 2ZUPA 5KN1A 3CSHA 1ZCPA 2WS2A 2CAQA 5HFGA 4I6XA 4MPGA 1YY7A 1TOFA 2IN3A 1I5GA 2WDUA 4K5SA 3TRXA 4RUVA 2HZFA 4F2IA 3HZ8A 4GCIA 3UBKA 2C0FA 3IE3A 3LWAA 4NV2A 1HNCA 2VLVA 3GA4A 1OC9B 1HYUA 1VRSD 4HEA2 2YV9A 1TRUA 3UL3A 4MK3A 1ZMAA 2YWOA 3A3TA 2DJ2A 4K8MA 5CNWA 4KSMA 3D4MA 2C4JA 4MZCA 5JCGA 2REMA 4MA9A 5KOXA 1GTBA 2N5AA 4WR4A 3FMWA 1T00A 1ILOA 4XRAA 1ZYNA 2XPEA 3CSIA 3GV1A 1V98A 5IMDA 2CVBA 2O85A 2JU5A 2CX4A 5CAXA 1QMVA 1MD3A 5ECHB 1PX6A 3KH9A 4LLRA 3IV4A 1OE8A 1PGTA 3APOA 5D93A 3VI5A 4OMVA 3KGKA 5ELAA 4NAXA 3KCMA 1T8EB 3HZ4A 3LW9A 5IMAA 3J7Yb 2LS5A 1V2AA 4XS6A 3US3A 1RK4A 3F63A 1VGLA 3P2AA 3FR3A 2F3MA 1G7EA 2GLRA 5DAKB 3VK9A 2PN8A 1QK8A 1K0NA 4HOJA 1XOBA 3TRQA 3IA1A 2LKUA 1WMJA 1BEDA 2DMMA 1ERVA 2WZ9A 5AIVA 1R7HA 2ZCTA 5CRHA 4BVYB 2YP6A 4CHSA 4XTSA 4FIWA 4MF7A 1WE0A 1VF2A 1ERUA 2YZHA 2JADA 2RUEA 4KX4A 1G6YA 3ZFLA 1WPIA 2JL4A 3GH9A 1ON4A 1EOHA 3MYDA 5HR1A 3QCPA 1BYEA 1F6MC 5CRGA 3IHGA 3D22A 3W6GA 3KZQA 4V2MA 1TXXA 2XBQA 1K0BA 3C71A 1AC1A 1SD9A 3PPUA 2FWFA 3EU4A 1GL8A 1X5EA 1AQWA 2KP1A 4L5LA 4EE0A 3DXBA 2DJJA 1A2MA 5ECSA 4HJMA 5J9BA 5G1KA 2A2PA 2IMDA 1U3AA 1PL2A 3O3TA 1DE1A 2KLXA 3UEMA 1SU9A 2P31A 3GUSA 5LNKe 5CO3A 2GT5A 2H1BA 2MBSA 2OE3A 2H8LA 3HJMA 3RPNA 4GQFA 3TKRA 2C1YA 2HRKA 1GTAA 2V41A 3R2QA 3TOTA 1MEKA 2CVKA 2H1GA 2L59A 4ZILA 3UARA 5KN0A 4KDYA 4POLA 1NHOA 3ZL5A 2H75A 3MSZA 3KP9A 2VCVA 1WJKA 2H0GA 2MYGA 1FG4A 2B5YA 2K6VA 2X99A 1UC7A 2I3YA 2AV4A 3DWVA 1XWCA 4J2FA 2XBIA 1TU7A 3L4NA 3RHBA 2DJ0A 1GTIA 5JCUA 1EWXA 2H6ZA 5FWGA 1EZKA 1UVZA 2YJ7A 4IJ3A 5ECMB 4EXJA 2IMIA 2HZEA 4G0LA 2GQMA 5H5SA 5AISA 3UMAA 2M80A 3NZNA 2NDOA 3F9UA 2A2RA 4Z2TA 2HXKA 1OC8A 4N11A 4NPBA 1EOGA 3APQA 1FOHA 4EDYA 2B6MA 5ECOB 4ECBA 3C1RA 4ZB8A 5HR3A 4ICYA 2GSTA 1T4ZA 2XPDA 2R2JA 4K7OA 3ZZXA 4PQIA 2YJHA 4QL9A 1G7OA 1H75A 4PNGA 5DALA 4JR6A 4YQUA 3EURA 5D73A 1DE2A 1B4QA 5F06A 4Q5QA 1XBSA 1K3OA 2R0CA 3FZ4A 1V58A 6GSTA 2CA8A 2HSHA 1A0FA 1B9YC 1RQMA 5IPGA 1WWJA 2BTOT 5C04A 6GSXA 5G1LA 4V1Ag 2DBCA 4QQ7A 2VOCA 1ABAA 3TJFA 1QUWA 4ACSA 3HDCA 3H79A 4N0VA 3G9BA 2C3TA 1ACVA 3UIWA 2F8FA 2V6KA 3KTBA 1CQHA 4PQ1A 1BX9A 1AQVA 3ISOA 1XWGA 3EMPA 3O76A 1TK0B 5GSSA 4O32A 3IC8A 4DVCA 3F0IA 4KUNA 4P3YB 3VWUA 2LUSA 4PQHA 2QA2A 2OE0A 2B3SA 3KJYA 2B5XA 3KMOA 3UOMA 1V9WA 4ZIJA 2O8VB 3D5JA 4DSSA 1GSDA 1SL2B 3U6VA 3IPZA 3A2WA 1A2JA 2JSZA 4TXVA 2H73A 2HNLA 3U5RE 5CYYA 5GZZB 4OO5A 5B6NA 2A4HA 3KEBA 4BVXA 3H1NA 1XWKA 1OKDA 5ID2A 2VLUA 1JLVA 4IW9A 3TGZA 3PGTA 2O7KA 2GSSA 2R0PA 5ELGA 3CTGA 1Z9HA 1M7TA 4FH8A 5DBQA 3TKSC 3D21A 5J41A 1MDJA 3M1GA 4BL7B 4ML6A 4EUYA 3EPTA 2L4QA 4EC0A 5F0GA 2DC5A 2FLSA 3GRXA 3P8WA 1LU4A 2OBKA 5IMFA 4F0CA 4KA0A 3KIJA 4PX1A 2G0FA 5DVBA 3QR6A 5HR0A 2AJQB 2PVOC 2GGTA 3ZITA 3BJ5A 2IFQA 1Y25A 4CY6A 4RQRA 3LG6A 4WF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUV A;  2R3X A;  3DVW A;  4RQX A;  3ERG A;  2QC7 A;  3FHK A;  5D9T A;  3CBU A;  4WET A;  3A2V A;  1B4P A;  3GTU A;  4HDE A;  3TJB A;  20GS A;  1X9S B;  3AY8 A;  4F03 A;  1UA5 A;  4MH3 A;  2HI7 A;  4OFM A;  1JZW A;  3Q18 A;  3CRT A;  5E59 A;  5IO0 A;  1Q4J A;  2PU9 C;  11GS A;  3RPP A;  1GWC A;  4K7I A;  3WT2 A;  3GYK A;  2V2G A;  3PH9 A;  2IMK A;  1PSQ A;  1H4O A;  2IPA A;  1X9W B;  18GS A;  5D9X A;  2LQO A;  1XCC A;  2TIR A;  4MF5 A;  5IOW A;  3E3E A;  1E2Y A;  4WXT A;  2H1D A;  4J57 E;  3H4K A;  2V1M A;  2MMN A;  4POM A;  16GS A;  1F37 A;  1YEX A;  4WKW A;  3BCI A;  1TDI A;  4POB A;  1T7P B;  1C72 A;  1TRW A;  3LXT A;  3IXR A;  3TB2 A;  5F05 A;  1OKT A;  2P5Q A;  3EVI A;  4KAE A;  2MMO A;  1LJR A;  4TR1 A;  2H71 A;  3E9J B;  2OA7 A;  3IOS A;  2C80 A;  4ID0 A;  4I2T A;  3CRU A;  3I43 A;  4PGT A;  5JWR B;  1G6W A;  2VL9 A;  3GNJ A;  4MJE A;  1U6T A;  3FEU A;  1T1V A;  1T4Y A;  2DJ3 A;  3CMI A;  10GS A;  3TKS E;  5H5R A;  1M2B A;  3ZRD A;  1GSY A;  4XS4 A;  3H8Q A;  5G31 A;  2GS3 A;  5JWQ B;  1XWA A;  2KP2 A;  3TJK A;  2VD1 A;  1TJD A;  3FY7 A;  2YN1 A;  1GNE A;  4H86 A;  3WT1 A;  4FYC A;  2ZNM A;  3GX0 A;  2RLI A;  4MDC A;  2VL2 A;  1ML6 A;  4MMM A;  4JBB A;  3TKQ A;  1PD2 1;  2FNO A;  1K0C A;  1K0D A;  4GWR A;  2OAC A;  2LV3 A;  5HQP A;  4JR4 A;  5KN3 A;  3CSJ A;  1BQ7 A;  4IBP A;  2I81 A;  3KD0 A;  3WYW A;  2GDR A;  1WOU A;  1GUH A;  2GZZ A;  1V40 A;  2YWI A;  4TVE A;  3M8N A;  2H72 A;  1E6B A;  2HRN A;  5CRD A;  2KOK A;  1A23 A;  3TDG A;  5LD0 A;  4L5O A;  1PKZ A;  2VCW A;  4K0N A;  3DGQ A;  5L71 A;  1OC3 A;  1RW1 A;  3QFB C;  5FT3 A;  1FVJ A;  4MCU A;  1K0M A;  5JWO B;  1Z3E A;  3ERF A;  1VF3 A;  2L6C A;  1PL1 A;  1S3D A;  4I5Q A;  5G30 A;  1NW2 A;  2LNS A;  2LEG A;  4TR3 A;  3WGX A;  3O6T A;  2WGR A;  3LXZ A;  4KGI A;  12GS A;  1EEM A;  2RM6 A;  4HQS A;  2JAC A;  4ZBA A;  2L6D A;  4O92 A;  3HKR A;  3QAG A;  1XFL A;  3HA9 A;  3VFI A;  6GSY A;  6GSU A;  1TRS A;  1A0R P;  2OAD A;  4MJC A;  3LJR A;  4D73 B;  1JZO A;  1YKC A;  2J23 A;  4GXZ A;  1TK5 B;  2V32 A;  2PWJ A;  6GSV A;  9GSS A;  3IC4 A;  4FO5 A;  3UVH A;  1O85 A;  1FB6 A;  2WCI A;  2E7P A;  4K9Z A;  1GSS A;  4OFT A;  3WGD A;  5DQS A;  4IVF A;  3UBL A;  2VUP A;  4WF5 A;  2X8H A;  5EVO A;  4TXO B;  5D96 A;  1AUC A;  1K0A A;  4X0X A;  1MDK A;  1M2A A;  2H76 A;  2RUF A;  4G19 A;  4OCE A;  1QQ2 A;  4TN8 A;  4GSS A;  4OD7 A;  3FZ9 A;  2AB6 A;  4DSR A;  1K3L A;  1FO5 A;  1A2L A;  1O81 A;  1OC9 A;  1SKR B;  1F2E A;  14GS A;  2KUC A;  2ON5 A;  1IYH A;  4LMV A;  2CVD A;  1X5D A;  2LRC A;  1BJX A;  4N10 A;  4HUA A;  1LBK A;  4LA1 A;  4PUA A;  4TR4 A;  2L57 A;  3FZA A;  1GSE A;  1ZOF A;  2EIO A;  1XW6 A;  2FD3 A;  2C0D A;  1KEB A;  3ZYW A;  3KXO A;  1GP1 A;  1TTZ A;  4TOP A;  4ZL9 A;  3LEF A;  1FAA A;  2DIZ A;  4KE3 A;  4YAV A;  2H1A A;  4I97 A;  4J56 E;  5G5F A;  1IYI A;  4WBR D;  3LYK A;  3BD2 A;  3HYP A;  2VM1 A;  3J7Y k;  3TJG A;  2TRC P;  3L9S A;  2PUK C;  3D0Z A;  13GS A;  5CRE A;  2H30 A;  3VWV A;  1YZX A;  5A4W A;  2YV7 A;  2R4V A;  3BCK A;  5ECR B;  3I69 A;  2LST A;  4XHM A;  3IAM 2;  3GUR A;  1W4V A;  3PIN A;  5GAN D;  3QAV A;  3LOR A;  2VO4 A;  1K3Y A;  2C0G A;  5J3R A;  3MAK A;  3F8U A;  4MF6 A;  5DAK A;  1PMT A;  1SD8 A;  3JCM L;  2H74 A;  1NM3 A;  4OFN A;  1HD2 A;  2JZS A;  3D4T A;  4BPY A;  3KTL A;  1T3B A;  4EO3 A;  1K0O A;  3DKS A;  3VI7 A;  3HVV A;  4IGJ A;  3ZTL A;  5KEJ A;  2OJL A;  4MAB A;  1F3B A;  4HZ2 A;  5ABR A;  4BVY A;  2GZP A;  3GKM A;  4GLT A;  5B8A A;  5KN2 A;  3I6A A;  1SJZ A;  2IMF A;  1UN2 A;  1SYX A;  1SKW B;  2G2Q A;  4EF0 A;  2H6X A;  2CT6 A;  4ECJ A;  1KNG A;  1Y6E A;  4MJA A;  3P90 A;  6GSW A;  3GKN A;  2F51 A;  4CDO A;  5ECK B;  3IK7 A;  3VWX A;  4G10 A;  3N9J A;  5EY6 A;  2H0H A;  1JFU A;  3Q19 A;  4LL4 B;  3LYP A;  5ECI B;  2GZY A;  1B8X A;  2MMA A;  1VF4 A;  5IIZ A;  4K6X A;  2DJ1 A;  1ZYE A;  1TKD B;  1KBN A;  2N5B A;  4TW5 A;  5HR2 A;  4AJ7 A;  4MZW A;  2K8V A;  4MZB A;  1M99 A;  1GSF A;  2IWT A;  2HFD A;  4GQC A;  4L0U A;  3ZRE A;  3IK9 A;  3HHV A;  2PPT A;  7GSS A;  3HVX A;  3MWH A;  3C1S A;  3RBT A;  3L78 A;  3UVT A;  1PKW A;  1GRX A;  2OBI A;  1EP7 A;  2F8A A;  1R5A A;  4YAP A;  2B1K A;  3DML A;  2HRF A;  3G7J A;  2ALB A;  1OAZ A;  2NTO A;  4V2L A;  3EMX A;  1TP9 A;  1PQN A;  4KDX A;  2XC2 A;  4ZXG A;  3GHA A;  1O6J A;  2NVL A;  4IP6 A;  3ZFB A;  1U88 A;  1A24 A;  3C7M A;  1CQG A;  4POK A;  3C8E A;  4F0B A;  3VLN A;  1QXH A;  1TU8 A;  4EDZ A;  2LJA A;  3ZIJ A;  3QMX A;  2DML A;  4V1A p;  3TKP A;  4GSN A;  1USB A;  3ZML A;  2HSY A;  1U3I A;  4GTU A;  2C3N A;  3M0F A;  3V1W A;  5F8B A;  2B7J A;  3F4T A;  3ME8 A;  5ECN B;  1JLW A;  2QSI A;  2MMZ A;  1FOV A;  4WBJ A;  3A5W A;  5B7C A;  1SJI A;  4IEL A;  1PRX A;  4HZ4 A;  4PXO A;  1Z6M A;  2VL3 A;  1A8L A;  3HJO A;  2R6K A;  5IPH A;  1N2A A;  3L9V A;  1J9B A;  5CP1 A;  4O7H A;  2ES7 A;  1ERT A;  4E8H A;  5J9C A;  3DEX A;  1DBY A;  4K0G A;  2Z9S A;  1XZO A;  2VCZ A;  1F9M A;  4Q5R A;  2B7K A;  4V2N A;  3IRA A;  3GL3 A;  5A4V A;  5HFK A;  4GST A;  5COH A;  1M9A A;  4TRX A;  2VAF A;  4IS0 A;  1R4W A;  4WR5 A;  2FWH A;  3APS A;  2FY6 A;  2MZC A;  4KDU A;  4Q5N A;  4ZBB A;  4ZL8 A;  5J5N A;  3ZVJ A;  5IMC A;  1O8X A;  4GF0 A;  2FA8 A;  22GS A;  5B6M A;  3EYT A;  1X9M B;  4I8B A;  5G2Z A;  2YWM A;  1SK2 A;  1XWB A;  2CV4 A;  3GL5 A;  1TI1 A;  2O87 A;  3CXG A;  3IHQ A;  3IAS 2;  1A8Y A;  1SJ6 A;  4HU9 A;  1R26 A;  4IHU A;  1HNB A;  17GS A;  4TKY A;  4ECI A;  4JED A;  2WUL A;  2L5L A;  3H93 A;  5GST A;  3TKS A;  2X8C A;  1EGO A;  1GUL A;  1NSW A;  3HCZ A;  2QGV A;  3CYN A;  1FHE A;  5ECQ B;  4K7N A;  1WRY A;  1GUK A;  1YEP A;  3NIV A;  5IMZ A;  3SWL A;  2WRT A;  3HD5 A;  4O5R A;  1SKS B;  3P7X A;  3S9F A;  4X43 A;  1EGR A;  2C0E A;  3TCO A;  4FYU A;  1GSQ A;  2VCQ A;  1ZZY A;  1B9X C;  4BL7 A;  2N5F A;  4WEY A;  2X8G A;  4HI7 A;  2V6O A;  2YAN A;  3EU3 A;  1B48 A;  5CRW A;  1HNA A;  2CZ2 A;  2A2S A;  3DVX A;  1EV9 A;  2L5O A;  2YPM A;  1MD4 A;  2HZE B;  4XIH A;  2AYT A;  3GN3 A;  3M9J A;  4AJ8 A;  3D6I A;  2J9H A;  4Z7X A;  2FUG 2;  1THO A;  1M2D A;  4X1U A;  2WFC A;  1AXD A;  3GIX A;  3SBC A;  5ENU A;  4HJ2 A;  4MH2 A;  3DYR A;  1Z6N A;  5DAL B;  3CTF A;  5D8I A;  2P0G A;  3IDV A;  1XW9 A;  3UJ1 A;  3ZLP A;  4YQM A;  2H01 A;  1M9B A;  4KND A;  3ZIV A;  1QFN A;  3M9K A;  3FK8 A;  3OR5 A;  3QOU A;  2LRT A;  4K2D A;  4RI6 A;  1SL1 B;  1GNW A;  3N5O A;  1R5P A;  2GQL A;  2GSQ A;  1F3A A;  3W8S A;  1W89 A;  2HT9 A;  4YH2 A;  4OO4 A;  2L4C A;  1YF1 A;  2C3Q A;  4XRD A;  5C00 A;  2DJK A;  4PUF C;  1SK0 A;  1DUG A;  1Z5Y E;  2YWN A;  1MTC A;  3BBY A;  3G7Y A;  3NOF A;  2B5E A;  2FWG A;  2GVP A;  1TI3 A;  2A4V A;  5IQY A;  1SL0 B;  4MLY A;  1YDK A;  3FW2 A;  4JRR A;  3RDW A;  4XS1 A;  4AJ6 A;  3F3Q A;  3RHC A;  4YQV A;  2NPB A;  3BOA A;  1VF1 A;  2TRX A;  3QFA C;  5DJL A;  1GTU A;  1MDI A;  3E0U A;  3VPT A;  2CX3 A;  3HY2 A;  1X0R A;  1XPV A;  3FKF A;  4KCA A;  3HJP A;  4ZL7 A;  2GSR A;  4KH7 A;  4DEJ A;  2PER A;  3F4S A;  2PMT A;  2JZR A;  2H66 A;  3TOU A;  4JU5 A;  3HVS A;  4DSS B;  3QAW A;  5ECP B;  1YJ6 A;  2O89 A;  4NV5 A;  5LCZ A;  1EEJ A;  5IOX A;  2FCH A;  2CAI A;  1YKA A;  5IMV A;  4PNF A;  3ED3 A;  4IKH A;  1X5C A;  1SEN A;  4FYB A;  3PR8 A;  5ECL B;  3LQ7 A;  2ON7 A;  2BJX A;  2C8U A;  5ID2 B;  3F3R A;  2VD0 A;  2E0Q A;  3GST A;  1WIK A;  1ERW A;  3I9V 2;  19GS A;  5EL8 A;  5HFI A;  4NHZ A;  3ERW A;  2H0I A;  2OKA A;  2H6Y A;  2R5G A;  2VIM A;  3Q74 A;  4MP4 A;  5EPF A;  2E2M A;  1THX A;  4RI7 A;  3UAP A;  2FHE A;  5F07 A;  4BWQ A;  4NHW A;  4HU7 A;  3FZ5 A;  3MDK A;  3KH7 A;  5INY A;  3QD9 A;  5H5Q A;  3VPQ A;  4I2U A;  1FVK A;  5DJM A;  6GSS A;  4ISD A;  2GT6 A;  2PVQ A;  1ZL9 A;  2X64 A;  3GKK A;  3F6F A;  3GMF A;  4JZQ A;  2IFQ B;  4GRF A;  1SYR A;  3TUE A;  1JZD A;  3FRC A;  1OVN A;  1Z7R A;  3K8N A;  1Q98 A;  4MPF A;  2BMX A;  1ZGN A;  3IR4 A;  2RM5 A;  3Q6O A;  3M3M A;  4DSQ A;  1KTE A;  3VWW A;  1GLQ A;  5GAP D;  4L0W A;  1PA3 A;  3GTU B;  2EC4 A;  2B1L A;  2K18 A;  5D9V A;  5DCH A;  4JE1 A;  1HQO A;  2H19 A;  2XHF A;  2YCD A;  3DD3 A;  1GSU A;  1BAY A;  3TJJ A;  1PN9 A;  4OWY A;  4NWY A;  2K8S A;  4L8E A;  3GSS A;  2E2G A;  3ZMK A;  5JCW A;  4ML1 A;  3A2X A;  1FB0 A;  1QGV A;  4AGS A;  1I9D A;  4D73 A;  4EVM A;  1DSB A;  1XVQ A;  4NXI A;  2WJU A;  4ZBD A;  3KP8 A;  3EC3 A;  1V57 A;  4QL7 A;  1O8W A;  2IME A;  3GFK A;  3WGE A;  5DCG A;  3GH6 A;  2HYX A;  2D2Z A;  3ME7 A;  1G0T A;  4CW9 A;  2AAW A;  4TXO A;  4KSO A;  2YOI A;  2K9F A;  2FWE A;  2R37 A;  4F82 A;  2CZ3 A;  2MBT A;  2F9S A;  2YZU A;  2H70 A;  2DSA A;  4HQZ A;  2HLS A;  4IQA A;  4NMU A;  1AQX A;  4TR1 B;  3FR9 A;  2CQ9 A;  1AIU A;  2LQQ A;  4HS1 A;  5D9W A;  4PUR A;  2IL3 A;  1XVW A;  4LMW A;  2M72 A;  3DIE A;  1TK8 B;  3QDN A;  2IIY A;  3GX8 A;  1O73 A;  2DLX A;  3GKX A;  4Q5F A;  1XIY A;  4KB3 A;  1ZYQ B;  4E8E A;  2I4A A;  4XS4 B;  3EIN A;  1JZR A;  2I9H A;  3W8J A;  1OYJ A;  4G9H A;  1U87 A;  4IJI A;  1PX7 A;  2EIR A;  2IJY A;  2VCT A;  2LNT A;  1Z7P A;  1AAZ A;  1XXU A;  5AGY A;  4ZB6 A;  1YF0 A;  5G5E A;  4N30 A;  4OCF A;  3G7I A;  5J4U A;  1S3A A;  1FW1 A;  3EE2 A;  4MJB A;  4BWS A;  2LJR A;  2VCX A;  4ECC A;  2GTU A;  4ILF A;  4F9Z A;  3RAZ A;  1M0U A;  4IQ1 A;  2I1U A;  4EKZ A;  5AN1 A;  2JSY A;  2M46 A;  1SK1 A;  3KMN A;  2RII A;  1GLP A;  2HE3 A;  4BA7 A;  5FHI A;  2VL2 C;  3FYG A;  1N8J A;  5DQY A;  5E4W A;  3FR6 A;  1EV4 A;  4AF2 A;  2NBS A;  2FGX A;  5IO2 A;  1URM A;  2YNX A;  4TR0 A;  1NHY A;  3MNG A;  4LL1 B;  2AHE A;  1J0F A;  3HXS A;  4KCE A;  1OE7 A;  2DIY A;  4IN0 A;  3WD6 A;  3DRN A;  4XCS A;  1GH2 A;  1J08 A;  3QPM A;  2PBJ A;  1WP0 A;  2LRN A;  5DDL A;  2P5R A;  4N0Z A;  1XOA A;  1YQ1 A;  2WB9 A;  3TRP A;  3L0H A;  8GSS A;  1BG5 A;  3LSZ A;  1AW9 A;  4ULX A;  3ZVJ D;  5A4U A;  1XW5 A;  1GUM A;  3F4R A;  5B8B A;  1JHB A;  2VLT A;  2VM2 A;  2FA4 A;  4K1F A;  1O7U A;  2OE1 A;  1TW9 A;  4EL1 A;  5AIX A;  3C73 A;  3F6D A;  3L9U A;  1S3C A;  2QKE A;  3EWL A;  4KW6 A;  1EP8 A;  3LFL A;  3KM6 A;  2KHP A;  4IP1 A;  4ZB9 A;  2JZT A;  5A5K A;  4G2E A;  2EIQ A;  3VUR A;  2PGT A;  5IM9 A;  2LJK A;  3IBH A;  3LGC A;  1ST9 A;  2GQK A;  1TRV A;  2LTK A;  2ZUP A;  5KN1 A;  3CSH A;  1ZCP A;  2WS2 A;  2CAQ A;  5HFG A;  4I6X A;  4MPG A;  1YY7 A;  1TOF A;  2IN3 A;  1I5G A;  2WDU A;  3TRX A;  4RUV A;  2HZF A;  4F2I A;  3HZ8 A;  4GCI A;  3UBK A;  2C0F A;  3IE3 A;  3LWA A;  4NV2 A;  1HNC A;  2VLV A;  3GA4 A;  1OC9 B;  1HYU A;  1VRS D;  4HEA 2;  2YV9 A;  1TRU A;  3UL3 A;  4MK3 A;  1ZMA A;  2YWO A;  3A3T A;  2DJ2 A;  4K8M A;  5CNW A;  4KSM A;  3D4M A;  2C4J A;  4MZC A;  5JCG A;  2REM A;  4MA9 A;  1GTB A;  2N5A A;  4WR4 A;  1T00 A;  1ILO A;  4XRA A;  2XPE A;  3CSI A;  3GV1 A;  1V98 A;  5IMD A;  2CVB A;  2O85 A;  2JU5 A;  2CX4 A;  5CAX A;  1QMV A;  1MD3 A;  5ECH B;  1PX6 A;  3KH9 A;  4LLR A;  3IV4 A;  1OE8 A;  1PGT A;  3APO A;  5D93 A;  3VI5 A;  4OMV A;  3KGK A;  5ELA A;  4NAX A;  3KCM A;  1T8E B;  3HZ4 A;  5IMA A;  3J7Y b;  2LS5 A;  1V2A A;  4XS6 A;  3US3 A;  1RK4 A;  3F63 A;  1VGL A;  3P2A A;  3FR3 A;  2F3M A;  1G7E A;  2GLR A;  5DAK B;  3VK9 A;  2PN8 A;  1QK8 A;  1K0N A;  4HOJ A;  1XOB A;  3TRQ A;  3IA1 A;  2LKU A;  1WMJ A;  1BED A;  2DMM A;  1ERV A;  2WZ9 A;  5AIV A;  1R7H A;  2ZCT A;  5CRH A;  4CHS A;  2YP6 A;  4XTS A;  4FIW A;  4MF7 A;  1WE0 A;  1VF2 A;  1ERU A;  2YZH A;  2JAD A;  2RUE A;  4KX4 A;  1G6Y A;  3ZFL A;  1WPI A;  2JL4 A;  3GH9 A;  1ON4 A;  1EOH A;  5HR1 A;  3QCP A;  1BYE A;  1F6M C;  5CRG A;  3D22 A;  3W6G A;  3KZQ A;  4V2M A;  1TXX A;  2XBQ A;  1K0B A;  3C71 A;  1AC1 A;  1SD9 A;  2FWF A;  3EU4 A;  1GL8 A;  1X5E A;  1AQW A;  2KP1 A;  4L5L A;  4EE0 A;  3DXB A;  2DJJ A;  1A2M A;  5ECS A;  4HJM A;  5J9B A;  5G1K A;  2IMD A;  1U3A A;  1PL2 A;  3O3T A;  1DE1 A;  2KLX A;  3UEM A;  1SU9 A;  2P31 A;  3GUS A;  5LNK e;  5CO3 A;  2GT5 A;  2H1B A;  2MBS A;  2OE3 A;  2H8L A;  3HJM A;  3RPN A;  4GQF A;  3TKR A;  2C1Y A;  2V41 A;  1GTA A;  3R2Q A;  3TOT A;  1MEK A;  2CVK A;  2H1G A;  2L59 A;  4ZIL A;  3UAR A;  5KN0 A;  4KDY A;  4POL A;  1NHO A;  3ZL5 A;  2H75 A;  3MSZ A;  3KP9 A;  2VCV A;  1WJK A;  2H0G A;  2MYG A;  1FG4 A;  2B5Y A;  2K6V A;  2X99 A;  1UC7 A;  2I3Y A;  2AV4 A;  3DWV A;  1XWC A;  4J2F A;  2XBI A;  1TU7 A;  3L4N A;  3RHB A;  2DJ0 A;  1GTI A;  5JCU A;  1EWX A;  2H6Z A;  5FWG A;  1EZK A;  1UVZ A;  2YJ7 A;  4IJ3 A;  5ECM B;  4EXJ A;  2IMI A;  2HZE A;  2GQM A;  5H5S A;  5AIS A;  3UMA A;  2M80 A;  3NZN A;  2NDO A;  3F9U A;  2A2R A;  2HXK A;  1OC8 A;  4N11 A;  4NPB A;  1EOG A;  3APQ A;  4EDY A;  2B6M A;  5ECO B;  4ECB A;  3C1R A;  4ZB8 A;  5HR3 A;  2GST A;  1T4Z A;  2XPD A;  2R2J A;  4K7O A;  3ZZX A;  4PQI A;  2YJH A;  4QL9 A;  1G7O A;  1H75 A;  4PNG A;  5DAL A;  4JR6 A;  4YQU A;  3EUR A;  5D73 A;  1DE2 A;  1B4Q A;  5F06 A;  4Q5Q A;  1XBS A;  1K3O A;  3FZ4 A;  1V58 A;  6GST A;  2CA8 A;  2HSH A;  1A0F A;  1B9Y C;  1RQM A;  5IPG A;  1WWJ A;  2BTO T;  5C04 A;  6GSX A;  5G1L A;  4V1A g;  2DBC A;  4QQ7 A;  2VOC A;  1ABA A;  3TJF A;  1QUW A;  4ACS A;  3HDC A;  3H79 A;  4N0V A;  3G9B A;  2C3T A;  1ACV A;  3UIW A;  2F8F A;  2V6K A;  3KTB A;  1CQH A;  4PQ1 A;  1BX9 A;  1AQV A;  3ISO A;  1XWG A;  3EMP A;  3O76 A;  1TK0 B;  5GSS A;  4O32 A;  4DVC A;  3F0I A;  4KUN A;  4P3Y B;  3VWU A;  2LUS A;  4PQH A;  2OE0 A;  2B3S A;  3KJY A;  2B5X A;  3KMO A;  3UOM A;  1V9W A;  4ZIJ A;  2O8V B;  3D5J A;  4DSS A;  1GSD A;  1SL2 B;  3U6V A;  3IPZ A;  3A2W A;  1A2J A;  2JSZ A;  4TXV A;  2H73 A;  2HNL A;  3U5R E;  5CYY A;  5GZZ B;  4OO5 A;  5B6N A;  3KEB A;  4BVX A;  3H1N A;  1XWK A;  1OKD A;  5ID2 A;  2VLU A;  1JLV A;  4IW9 A;  3TGZ A;  3PGT A;  2O7K A;  2GSS A;  5ELG A;  3CTG A;  1Z9H A;  1M7T A;  4FH8 A;  5DBQ A;  3TKS C;  3D21 A;  5J41 A;  1MDJ A;  3M1G A;  4ML6 A;  4EUY A;  2L4Q A;  4EC0 A;  5F0G A;  2DC5 A;  2FLS A;  3GRX A;  3P8W A;  1LU4 A;  2OBK A;  5IMF A;  4F0C A;  4KA0 A;  3KIJ A;  4PX1 A;  2G0F A;  5DVB A;  3QR6 A;  5HR0 A;  2AJQ B;  2PVO C;  2GGT A;  3ZIT A;  3BJ5 A;  2IFQ A;  1Y25 A;  4RQR A;  3LG6 A;  4WF4 A; 
#chains in the Genus database with same CATH topology
 2AUV A;  2R3X A;  3DVW A;  4RQX A;  3ERG A;  2QC7 A;  4G0I A;  3FHK A;  5D9T A;  4HSC X;  3CBU A;  4WET A;  3A2V A;  1B4P A;  3GTU A;  4HDE A;  3TJB A;  20GS A;  1X9S B;  3AY8 A;  4F03 A;  1UA5 A;  4MH3 A;  2HI7 A;  4OFM A;  1JZW A;  3Q18 A;  3CRT A;  5E59 A;  5IO0 A;  1Q4J A;  2PU9 C;  11GS A;  3RPP A;  3HVN A;  1GWC A;  4K7I A;  3WT2 A;  3GYK A;  2V2G A;  3PH9 A;  2IMK A;  1PSQ A;  1H4O A;  2IPA A;  1X9W B;  18GS A;  5D9X A;  2LQO A;  1XCC A;  2TIR A;  4MF5 A;  5IOW A;  3E3E A;  1E2Y A;  4WXT A;  2H1D A;  4J57 E;  3H4K A;  2V1M A;  2MMN A;  4POM A;  16GS A;  1F37 A;  1YEX A;  4WKW A;  4K5R A;  3BCI A;  1TDI A;  4POB A;  1T7P B;  1C72 A;  1TRW A;  3LXT A;  3IXR A;  3TB2 A;  5F05 A;  1OKT A;  2P5Q A;  3EVI A;  4KAE A;  2MMO A;  1LJR A;  4TR1 A;  2H71 A;  3E9J B;  2OA7 A;  5KOW A;  3IOS A;  2C80 A;  4ID0 A;  4I2T A;  3CRU A;  3I43 A;  4PGT A;  5JWR B;  1G6W A;  2VL9 A;  3GNJ A;  4MJE A;  1U6T A;  3FEU A;  1T1V A;  1T4Y A;  2DJ3 A;  3CMI A;  10GS A;  3TKS E;  5H5R A;  1M2B A;  3ZRD A;  1GSY A;  4XS4 A;  3H8Q A;  5G31 A;  2GS3 A;  5JWQ B;  1XWA A;  2KP2 A;  3TJK A;  2VD1 A;  1TJD A;  3FY7 A;  2YN1 A;  1GNE A;  4H86 A;  3WT1 A;  4FYC A;  2ZNM A;  3GX0 A;  2RLI A;  4MDC A;  2VL2 A;  1ML6 A;  4MMM A;  4JBB A;  3TKQ A;  1PD2 1;  2FNO A;  1K0C A;  1K0D A;  4GWR A;  2OAC A;  2LV3 A;  5HQP A;  4YKG A;  4JR4 A;  5KN3 A;  3CSJ A;  1BQ7 A;  4IBP A;  2I81 A;  3KD0 A;  3WYW A;  2GDR A;  1WOU A;  1GUH A;  2GZZ A;  1V40 A;  2YWI A;  4TVE A;  4KF9 A;  3M8N A;  3MIX A;  4EIP A;  2H72 A;  1E6B A;  2HRN A;  5CRD A;  2KOK A;  1A23 A;  3TDG A;  5LD0 A;  4L5O A;  1PKZ A;  2VCW A;  4K0N A;  3DGQ A;  5L71 A;  4G0K A;  1OC3 A;  1RW1 A;  3QFB C;  5FT3 A;  1FVJ A;  4MCU A;  1K0M A;  5JWO B;  1Z3E A;  3ERF A;  1VF3 A;  2L6C A;  1PL1 A;  1S3D A;  4I5Q A;  5G30 A;  1NW2 A;  2LNS A;  2LEG A;  4TR3 A;  3WGX A;  3O6T A;  2WGR A;  3LXZ A;  4KGI A;  12GS A;  1EEM A;  2RM6 A;  4HQS A;  2JAC A;  4ZBA A;  2L6D A;  4O92 A;  3HKR A;  3QAG A;  1XFL A;  3HA9 A;  3VFI A;  6GSY A;  6GSU A;  1TRS A;  1A0R P;  2OAD A;  4MJC A;  3LJR A;  4D73 B;  1JZO A;  1YKC A;  2J23 A;  4GXZ A;  1TK5 B;  2V32 A;  2PWJ A;  6GSV A;  9GSS A;  3IC4 A;  4FO5 A;  3UVH A;  1O85 A;  1FB6 A;  2WCI A;  2E7P A;  4K9Z A;  1GSS A;  4OFT A;  3WGD A;  5DQS A;  4IVF A;  2HSM A;  3UBL A;  2VUP A;  4WF5 A;  2X8H A;  5EVO A;  2X4A A;  4TXO B;  5D96 A;  1AUC A;  1K0A A;  1PN0 A;  4X0X A;  1MDK A;  1M2A A;  2H76 A;  2RUF A;  4G19 A;  4OCE A;  1QQ2 A;  4TN8 A;  4GSS A;  4OD7 A;  3FZ9 A;  2AB6 A;  4DSR A;  1K3L A;  1FO5 A;  1A2L A;  1O81 A;  1OC9 A;  1SKR B;  1F2E A;  14GS A;  2KUC A;  2ON5 A;  1IYH A;  4LMV A;  2CVD A;  1X5D A;  2LRC A;  1BJX A;  4N10 A;  4HUA A;  1LBK A;  4LA1 A;  4PUA A;  4TR4 A;  2L57 A;  3FZA A;  1GSE A;  4K2X A;  1ZOF A;  2EIO A;  1XW6 A;  2FD3 A;  2C0D A;  1KEB A;  3ZYW A;  3KXO A;  1GP1 A;  1TTZ A;  4TOP A;  4ZL9 A;  3LEF A;  1FAA A;  2DIZ A;  4KE3 A;  4YAV A;  2H1A A;  4I97 A;  4J56 E;  5G5F A;  1IYI A;  4WBR D;  3LYK A;  3BD2 A;  3HYP A;  2VM1 A;  3J7Y k;  3TJG A;  2TRC P;  3L9S A;  2PUK C;  3D0Z A;  13GS A;  5CRE A;  2H30 A;  3VWV A;  1YZX A;  5A4W A;  2YV7 A;  2R4V A;  3BCK A;  5ECR B;  3I69 A;  2LST A;  4XHM A;  3IAM 2;  3GUR A;  1M3J A;  1W4V A;  3PIN A;  5GAN D;  3QAV A;  1XG8 A;  3LOR A;  2VO4 A;  1K3Y A;  2C0G A;  5J3R A;  3MAK A;  3F8U A;  4MF6 A;  5DAK A;  1PMT A;  1SD8 A;  3JCM L;  2H74 A;  1NM3 A;  4OFN A;  1HD2 A;  2JZS A;  3D4T A;  4BPY A;  3KTL A;  1T3B A;  4EO3 A;  1K0O A;  3DKS A;  3VI7 A;  3HVV A;  4IGJ A;  3ZTL A;  5KEJ A;  2OJL A;  4MAB A;  1F3B A;  4HZ2 A;  5ABR A;  4BVY A;  2GZP A;  3GKM A;  4GLT A;  5B8A A;  5KN2 A;  3I6A A;  1SJZ A;  2IMF A;  1UN2 A;  4PTS A;  1SYX A;  1SKW B;  2G2Q A;  4EF0 A;  2H6X A;  2CT6 A;  4ECJ A;  1KNG A;  1Y6E A;  4MJA A;  3P90 A;  6GSW A;  3GKN A;  2F51 A;  4CDO A;  5ECK B;  3IK7 A;  2QA1 A;  3VWX A;  4G10 A;  3N9J A;  5EY6 A;  2H0H A;  1JFU A;  3Q19 A;  4LL4 B;  3LYP A;  5ECI B;  2GZY A;  1B8X A;  2MMA A;  1VF4 A;  5IIZ A;  4K6X A;  2DJ1 A;  1ZYE A;  1TKD B;  1KBN A;  2N5B A;  4TW5 A;  5HR2 A;  4AJ7 A;  4MZW A;  2K8V A;  4MZB A;  1M99 A;  1GSF A;  2IWT A;  2HFD A;  4GQC A;  4L0U A;  3ZRE A;  3IK9 A;  3HHV A;  2PPT A;  7GSS A;  3HVX A;  3MWH A;  3C1S A;  3RBT A;  3L78 A;  3UVT A;  1PKW A;  1GRX A;  2OBI A;  5BRT A;  1EP7 A;  4EIQ A;  2F8A A;  1R5A A;  4YAP A;  2B1K A;  3DML A;  2HRF A;  3G7J A;  2ALB A;  1OAZ A;  2NTO A;  4V2L A;  3EMX A;  1TP9 A;  1PQN A;  4KDX A;  2XC2 A;  4ZXG A;  3GHA A;  1O6J A;  2NVL A;  4IP6 A;  3ZFB A;  4Z2U A;  1U88 A;  1A24 A;  3C7M A;  1CQG A;  4POK A;  3C8E A;  4F0B A;  3VLN A;  1QXH A;  1TU8 A;  4EDZ A;  2LJA A;  3ZIJ A;  3QMX A;  2DML A;  4V1A p;  3TKP A;  4A5P A;  4O5Q A;  4GSN A;  1USB A;  3ZML A;  2HSY A;  1U3I A;  4GTU A;  2C3N A;  3M0F A;  3V1W A;  5F8B A;  2B7J A;  3F4T A;  3ME8 A;  5ECN B;  1JLW A;  1M3I A;  2QSI A;  2MMZ A;  1FOV A;  4WBJ A;  3A5W A;  3A5I A;  5B7C A;  1SJI A;  4IEL A;  1PRX A;  4HZ4 A;  4PXO A;  1Z6M A;  2VL3 A;  1A8L A;  3HJO A;  2R6K A;  5IPH A;  1N2A A;  3L9V A;  1J9B A;  5CP1 A;  4O7H A;  2ES7 A;  1ERT A;  4E8H A;  5J9C A;  3DEX A;  1DBY A;  4K0G A;  2Z9S A;  1XZO A;  2VCZ A;  1F9M A;  4Q5R A;  2B7K A;  4V2N A;  3IRA A;  3GL3 A;  5A4V A;  5HFK A;  4GST A;  5COH A;  1M9A A;  4TRX A;  2VAF A;  4IS0 A;  1R4W A;  4WR5 A;  2FWH A;  3APS A;  4X4J A;  2FY6 A;  2MZC A;  4KDU A;  4Q5N A;  4ZBB A;  4ZL8 A;  5J5N A;  2DKH A;  3ZVJ A;  5IMC A;  5BMU A;  1O8X A;  4GF0 A;  2FA8 A;  22GS A;  5B6M A;  3EYT A;  1X9M B;  4I8B A;  5G2Z A;  2YWM A;  1SK2 A;  1XWB A;  2CV4 A;  3GL5 A;  4FQU A;  1TI1 A;  2O87 A;  3CXG A;  3IHQ A;  3IAS 2;  1A8Y A;  1SJ6 A;  4HU9 A;  1R26 A;  4IHU A;  1HNB A;  17GS A;  4TKY A;  4ECI A;  4JED A;  4YKF A;  2WUL A;  2L5L A;  3H93 A;  5GST A;  3TKS A;  2X8C A;  1EGO A;  1GUL A;  1NSW A;  3HCZ A;  2QGV A;  3CYN A;  1FHE A;  5ECQ B;  4K7N A;  1WRY A;  1GUK A;  1YEP A;  3NIV A;  5IMZ A;  3SWL A;  2WRT A;  3HD5 A;  4O5R A;  3CQF A;  1SKS B;  2X49 A;  3P7X A;  3S9F A;  4X43 A;  1EGR A;  2C0E A;  3TCO A;  4FYU A;  1GSQ A;  2VCQ A;  1ZZY A;  1B9X C;  4BL7 A;  2N5F A;  4WEY A;  2X8G A;  4HI7 A;  2V6O A;  2YAN A;  3EU3 A;  1B48 A;  5CRW A;  1HNA A;  2CZ2 A;  2A2S A;  3DVX A;  1EV9 A;  2L5O A;  2YPM A;  1MD4 A;  2HZE B;  4XIH A;  2AYT A;  3GN3 A;  3M9J A;  4AJ8 A;  3D6I A;  2J9H A;  4Z7X A;  2FUG 2;  1THO A;  1M2D A;  4X1U A;  2WFC A;  1AXD A;  3GIX A;  3SBC A;  5ENU A;  4HJ2 A;  4MH2 A;  3DYR A;  1Z6N A;  5DAL B;  3CTF A;  2P0G A;  5D8I A;  3IDV A;  1XW9 A;  3UJ1 A;  3ZLP A;  4YQM A;  2H01 A;  1M9B A;  4KND A;  3ZIV A;  1QFN A;  3M9K A;  3FK8 A;  3OR5 A;  3QOU A;  2LRT A;  4K2D A;  4RI6 A;  1SL1 B;  1GNW A;  3N5O A;  1R5P A;  4MNN A;  2GQL A;  2GSQ A;  1F3A A;  3W8S A;  1W89 A;  2HT9 A;  4YH2 A;  4OO4 A;  2L4C A;  1YF1 A;  2C3Q A;  4XRD A;  5C00 A;  2DJK A;  4PUF C;  1SK0 A;  1DUG A;  1Z5Y E;  2YWN A;  1MTC A;  3BBY A;  3G7Y A;  3NOF A;  2B5E A;  2FWG A;  2GVP A;  1TI3 A;  2A4V A;  5IQY A;  1ZYP A;  1SL0 B;  4MLY A;  1YDK A;  3FW2 A;  4JRR A;  3RDW A;  4XS1 A;  4AJ6 A;  3F3Q A;  3RHC A;  4YQV A;  2NPB A;  3BOA A;  1VF1 A;  2TRX A;  3QFA C;  5DJL A;  4O5U A;  1GTU A;  1MDI A;  3E0U A;  3VPT A;  2CX3 A;  3HY2 A;  1X0R A;  1XPV A;  3FKF A;  4KCA A;  3HJP A;  4ZL7 A;  2GSR A;  4KH7 A;  4DEJ A;  2PER A;  3F4S A;  2PMT A;  2JZR A;  2H66 A;  3TOU A;  2DKI A;  4JU5 A;  3HVS A;  4DSS B;  3QAW A;  5ECP B;  1YJ6 A;  2O89 A;  4NV5 A;  5LCZ A;  1EEJ A;  5IOX A;  2FCH A;  2CAI A;  1YKA A;  5IMV A;  4PNF A;  3ED3 A;  4IKH A;  1X5C A;  1SEN A;  4FYB A;  3PR8 A;  5ECL B;  4BVX B;  3LQ7 A;  2ON7 A;  2BJX A;  2C8U A;  5ID2 B;  3F3R A;  2VD0 A;  4USS A;  2E0Q A;  3GST A;  2HRA A;  1WIK A;  1ERW A;  3I9V 2;  19GS A;  5EL8 A;  5HFI A;  4NHZ A;  3ERW A;  2H0I A;  2OKA A;  2H6Y A;  2R5G A;  2VIM A;  3Q74 A;  4MP4 A;  5EPF A;  2E2M A;  1THX A;  4RI7 A;  3UAP A;  2FHE A;  5F07 A;  4BWQ A;  4NHW A;  4HU7 A;  3FZ5 A;  3MDK A;  3KH7 A;  5INY A;  3QD9 A;  5H5Q A;  3VPQ A;  4I2U A;  1FVK A;  5DJM A;  6GSS A;  4ISD A;  2GT6 A;  2PVQ A;  2R0G A;  1ZL9 A;  2X64 A;  3GKK A;  3F6F A;  3GMF A;  4JZQ A;  2IFQ B;  3R3E A;  4GRF A;  1SYR A;  3TUE A;  1JZD A;  3FRC A;  1OVN A;  1Z7R A;  3K8N A;  1Q98 A;  4MPF A;  2BMX A;  1ZGN A;  3IR4 A;  2RM5 A;  3Q6O A;  3M3M A;  4DSQ A;  1KTE A;  3VWW A;  1GLQ A;  5GAP D;  4L0W A;  1PA3 A;  3GTU B;  2EC4 A;  2B1L A;  2K18 A;  5D9V A;  5DCH A;  4JE1 A;  1HQO A;  2H19 A;  2XHF A;  2YCD A;  3DD3 A;  1GSU A;  1BAY A;  3TJJ A;  1PN9 A;  4OWY A;  4NWY A;  2K8S A;  4L8E A;  3GSS A;  2E2G A;  3ZMK A;  5JCW A;  4ML1 A;  3A2X A;  1FB0 A;  1QGV A;  4AGS A;  1I9D A;  4D73 A;  4EVM A;  1DSB A;  1XVQ A;  4NXI A;  2WJU A;  4ZBD A;  3KP8 A;  3EC3 A;  1V57 A;  4QL7 A;  1O8W A;  2IME A;  3GFK A;  3WGE A;  5DCG A;  3GH6 A;  2HYX A;  2D2Z A;  3ME7 A;  1G0T A;  4CW9 A;  2AAW A;  4TXO A;  4KSO A;  2YOI A;  2K9F A;  2FWE A;  2R37 A;  4F82 A;  2CZ3 A;  2MBT A;  2F9S A;  1S3R A;  2YZU A;  2H70 A;  2DSA A;  4HQZ A;  2HLS A;  4IQA A;  4NMU A;  1AQX A;  4TR1 B;  3FR9 A;  2CQ9 A;  1AIU A;  2LQQ A;  4HS1 A;  5D9W A;  4PUR A;  2IL3 A;  1XVW A;  4LMW A;  2M72 A;  3DIE A;  1TK8 B;  3QDN A;  2IIY A;  3GX8 A;  1O73 A;  2DLX A;  3GKX A;  4Q5F A;  1XIY A;  4KB3 A;  1ZYQ B;  4E8E A;  1PFO A;  2I4A A;  4XS4 B;  3EIN A;  1JZR A;  2I9H A;  3W8J A;  1OYJ A;  4G9H A;  1U87 A;  4IJI A;  1PX7 A;  2EIR A;  2IJY A;  2VCT A;  2LNT A;  1Z7P A;  1AAZ A;  1XXU A;  5AGY A;  4ZB6 A;  1YF0 A;  5G5E A;  4N30 A;  4OCF A;  3G7I A;  5J4U A;  1S3A A;  1FW1 A;  3EE2 A;  4MJB A;  4BWS A;  2LJR A;  2VCX A;  4ECC A;  2GTU A;  4ILF A;  4F9Z A;  3RAZ A;  1M0U A;  4IQ1 A;  2I1U A;  4EKZ A;  5AN1 A;  2JSY A;  2M46 A;  1SK1 A;  3KMN A;  2RII A;  1GLP A;  2HE3 A;  4BA7 A;  5FHI A;  2VL2 C;  3FYG A;  1N8J A;  5DQY A;  5E4W A;  3FR6 A;  1EV4 A;  4AF2 A;  2NBS A;  2FGX A;  5IO2 A;  1URM A;  2YNX A;  4TR0 A;  1NHY A;  3MNG A;  4LL1 B;  2AHE A;  1J0F A;  3HXS A;  4KCE A;  1OE7 A;  2DIY A;  4IN0 A;  3WD6 A;  3DRN A;  4XCS A;  1GH2 A;  1J08 A;  3QPM A;  2PBJ A;  1WP0 A;  2LRN A;  5DDL A;  4CY8 A;  2P5R A;  4N0Z A;  1XOA A;  1YQ1 A;  2WB9 A;  3TRP A;  3L0H A;  8GSS A;  1BG5 A;  3LSZ A;  1AW9 A;  4ULX A;  3ZVJ D;  5A4U A;  1XW5 A;  1GUM A;  3F4R A;  5B8B A;  1JHB A;  2VLT A;  2VM2 A;  2FA4 A;  4K1F A;  1O7U A;  2OE1 A;  1TW9 A;  4EL1 A;  5AIX A;  3C73 A;  3F6D A;  3L9U A;  1S3C A;  2QKE A;  3EWL A;  4KW6 A;  1EP8 A;  3LFL A;  3KM6 A;  2KHP A;  4IP1 A;  4ZB9 A;  2JZT A;  5A5K A;  4G2E A;  2EIQ A;  4Z2R A;  2UZ8 A;  3VUR A;  2PGT A;  5IM9 A;  2LJK A;  3IBH A;  3LGC A;  1ST9 A;  2GQK A;  1TRV A;  2LTK A;  2ZUP A;  5KN1 A;  3CSH A;  1ZCP A;  2WS2 A;  2CAQ A;  5HFG A;  4I6X A;  4MPG A;  1YY7 A;  1TOF A;  2IN3 A;  1I5G A;  2WDU A;  4K5S A;  3TRX A;  4RUV A;  2HZF A;  4F2I A;  3HZ8 A;  4GCI A;  3UBK A;  2C0F A;  3IE3 A;  3LWA A;  4NV2 A;  1HNC A;  2VLV A;  3GA4 A;  1OC9 B;  1HYU A;  1VRS D;  4HEA 2;  2YV9 A;  1TRU A;  3UL3 A;  4MK3 A;  1ZMA A;  2YWO A;  3A3T A;  2DJ2 A;  4K8M A;  5CNW A;  4KSM A;  3D4M A;  2C4J A;  4MZC A;  5JCG A;  2REM A;  4MA9 A;  5KOX A;  1GTB A;  2N5A A;  4WR4 A;  3FMW A;  1T00 A;  1ILO A;  4XRA A;  1ZYN A;  2XPE A;  3CSI A;  3GV1 A;  1V98 A;  5IMD A;  2CVB A;  2O85 A;  2JU5 A;  2CX4 A;  5CAX A;  1QMV A;  1MD3 A;  5ECH B;  1PX6 A;  3KH9 A;  4LLR A;  3IV4 A;  1OE8 A;  1PGT A;  3APO A;  5D93 A;  3VI5 A;  4OMV A;  3KGK A;  5ELA A;  4NAX A;  3KCM A;  1T8E B;  3HZ4 A;  3LW9 A;  5IMA A;  3J7Y b;  2LS5 A;  1V2A A;  4XS6 A;  3US3 A;  1RK4 A;  3F63 A;  1VGL A;  3P2A A;  3FR3 A;  2F3M A;  1G7E A;  2GLR A;  5DAK B;  3VK9 A;  2PN8 A;  1QK8 A;  1K0N A;  4HOJ A;  1XOB A;  3TRQ A;  3IA1 A;  2LKU A;  1WMJ A;  1BED A;  2DMM A;  1ERV A;  2WZ9 A;  5AIV A;  1R7H A;  2ZCT A;  5CRH A;  4BVY B;  2YP6 A;  4CHS A;  4XTS A;  4FIW A;  4MF7 A;  1WE0 A;  1VF2 A;  1ERU A;  2YZH A;  2JAD A;  2RUE A;  4KX4 A;  1G6Y A;  3ZFL A;  1WPI A;  2JL4 A;  3GH9 A;  1ON4 A;  1EOH A;  3MYD A;  5HR1 A;  3QCP A;  1BYE A;  1F6M C;  5CRG A;  3IHG A;  3D22 A;  3W6G A;  3KZQ A;  4V2M A;  1TXX A;  2XBQ A;  1K0B A;  3C71 A;  1AC1 A;  1SD9 A;  3PPU A;  2FWF A;  3EU4 A;  1GL8 A;  1X5E A;  1AQW A;  2KP1 A;  4L5L A;  4EE0 A;  3DXB A;  2DJJ A;  1A2M A;  5ECS A;  4HJM A;  5J9B A;  5G1K A;  2A2P A;  2IMD A;  1U3A A;  1PL2 A;  3O3T A;  1DE1 A;  2KLX A;  3UEM A;  1SU9 A;  2P31 A;  3GUS A;  5LNK e;  5CO3 A;  2GT5 A;  2H1B A;  2MBS A;  2OE3 A;  2H8L A;  3HJM A;  3RPN A;  4GQF A;  3TKR A;  2C1Y A;  2HRK A;  1GTA A;  2V41 A;  3R2Q A;  3TOT A;  1MEK A;  2CVK A;  2H1G A;  2L59 A;  4ZIL A;  3UAR A;  5KN0 A;  4KDY A;  4POL A;  1NHO A;  3ZL5 A;  2H75 A;  3MSZ A;  3KP9 A;  2VCV A;  1WJK A;  2H0G A;  2MYG A;  1FG4 A;  2B5Y A;  2K6V A;  2X99 A;  1UC7 A;  2I3Y A;  2AV4 A;  3DWV A;  1XWC A;  4J2F A;  2XBI A;  1TU7 A;  3L4N A;  3RHB A;  2DJ0 A;  1GTI A;  5JCU A;  1EWX A;  2H6Z A;  5FWG A;  1EZK A;  1UVZ A;  2YJ7 A;  4IJ3 A;  5ECM B;  4BIK A;  4EXJ A;  2IMI A;  2HZE A;  4G0L A;  2GQM A;  5H5S A;  5AIS A;  3UMA A;  2M80 A;  3NZN A;  2NDO A;  3F9U A;  2A2R A;  4Z2T A;  2HXK A;  1OC8 A;  4N11 A;  4NPB A;  1EOG A;  3APQ A;  1FOH A;  4EDY A;  2B6M A;  5ECO B;  4ECB A;  3C1R A;  4ZB8 A;  5HR3 A;  4ICY A;  2GST A;  1T4Z A;  2XPD A;  2R2J A;  4K7O A;  3ZZX A;  4PQI A;  2YJH A;  4QL9 A;  1G7O A;  1H75 A;  4PNG A;  5DAL A;  4JR6 A;  4YQU A;  3EUR A;  5D73 A;  1DE2 A;  1B4Q A;  5F06 A;  4Q5Q A;  1XBS A;  1K3O A;  2R0C A;  3FZ4 A;  1V58 A;  6GST A;  2CA8 A;  2HSH A;  1A0F A;  1B9Y C;  1RQM A;  5IPG A;  1WWJ A;  2BTO T;  5C04 A;  6GSX A;  5G1L A;  4V1A g;  2DBC A;  4QQ7 A;  2VOC A;  1ABA A;  3TJF A;  1QUW A;  4ACS A;  3HDC A;  3H79 A;  4N0V A;  3G9B A;  2C3T A;  1ACV A;  3UIW A;  2F8F A;  2V6K A;  3KTB A;  1CQH A;  4PQ1 A;  1BX9 A;  1AQV A;  3ISO A;  1XWG A;  3EMP A;  3O76 A;  1TK0 B;  5GSS A;  4O32 A;  3IC8 A;  4DVC A;  3F0I A;  4KUN A;  4P3Y B;  3VWU A;  2LUS A;  4PQH A;  2QA2 A;  2OE0 A;  2B3S A;  3KJY A;  2B5X A;  3KMO A;  3UOM A;  1V9W A;  4ZIJ A;  2O8V B;  3D5J A;  4DSS A;  1GSD A;  1SL2 B;  3U6V A;  3IPZ A;  3A2W A;  1A2J A;  2JSZ A;  4TXV A;  2H73 A;  2HNL A;  3U5R E;  5CYY A;  5GZZ B;  4OO5 A;  5B6N A;  2A4H A;  3KEB A;  4BVX A;  3H1N A;  1XWK A;  1OKD A;  5ID2 A;  2VLU A;  1JLV A;  4IW9 A;  3TGZ A;  3PGT A;  2O7K A;  2GSS A;  2R0P A;  5ELG A;  3CTG A;  1Z9H A;  1M7T A;  4FH8 A;  5DBQ A;  3TKS C;  3D21 A;  5J41 A;  1MDJ A;  3M1G A;  4BL7 B;  4ML6 A;  4EUY A;  3EPT A;  2L4Q A;  4EC0 A;  5F0G A;  2DC5 A;  2FLS A;  3GRX A;  3P8W A;  1LU4 A;  2OBK A;  5IMF A;  4F0C A;  4KA0 A;  3KIJ A;  4PX1 A;  2G0F A;  5DVB A;  3QR6 A;  5HR0 A;  2AJQ B;  2PVO C;  2GGT A;  3ZIT A;  3BJ5 A;  2IFQ A;  1Y25 A;  4CY6 A;  4RQR A;  3LG6 A;  4WF4 A; 
#chains in the Genus database with same CATH homology
 2AUV A;  2R3X A;  3DVW A;  4RQX A;  3ERG A;  2QC7 A;  4G0I A;  3FHK A;  5D9T A;  3CBU A;  4WET A;  3A2V A;  1B4P A;  3GTU A;  4HDE A;  3TJB A;  20GS A;  1X9S B;  3AY8 A;  4F03 A;  1UA5 A;  4MH3 A;  2HI7 A;  4OFM A;  1JZW A;  3Q18 A;  3CRT A;  5E59 A;  5IO0 A;  1Q4J A;  2PU9 C;  11GS A;  3RPP A;  1GWC A;  4K7I A;  3WT2 A;  3GYK A;  2V2G A;  3PH9 A;  2IMK A;  1PSQ A;  1H4O A;  2IPA A;  1X9W B;  18GS A;  5D9X A;  2LQO A;  1XCC A;  2TIR A;  4MF5 A;  5IOW A;  3E3E A;  1E2Y A;  4WXT A;  2H1D A;  4J57 E;  3H4K A;  2V1M A;  2MMN A;  4POM A;  16GS A;  1F37 A;  1YEX A;  4WKW A;  4K5R A;  3BCI A;  1TDI A;  4POB A;  1T7P B;  1C72 A;  1TRW A;  3LXT A;  3IXR A;  3TB2 A;  5F05 A;  1OKT A;  2P5Q A;  3EVI A;  4KAE A;  2MMO A;  1LJR A;  4TR1 A;  2H71 A;  3E9J B;  2OA7 A;  5KOW A;  3IOS A;  2C80 A;  4ID0 A;  4I2T A;  3CRU A;  3I43 A;  4PGT A;  5JWR B;  1G6W A;  2VL9 A;  3GNJ A;  4MJE A;  1U6T A;  3FEU A;  1T1V A;  1T4Y A;  2DJ3 A;  3CMI A;  10GS A;  3TKS E;  5H5R A;  1M2B A;  3ZRD A;  1GSY A;  4XS4 A;  3H8Q A;  5G31 A;  2GS3 A;  5JWQ B;  1XWA A;  2KP2 A;  3TJK A;  2VD1 A;  1TJD A;  3FY7 A;  2YN1 A;  1GNE A;  4H86 A;  3WT1 A;  4FYC A;  2ZNM A;  3GX0 A;  2RLI A;  4MDC A;  2VL2 A;  1ML6 A;  4MMM A;  4JBB A;  3TKQ A;  1PD2 1;  2FNO A;  1K0C A;  1K0D A;  4GWR A;  2OAC A;  2LV3 A;  5HQP A;  4YKG A;  4JR4 A;  5KN3 A;  3CSJ A;  1BQ7 A;  4IBP A;  2I81 A;  3KD0 A;  3WYW A;  2GDR A;  1WOU A;  1GUH A;  2GZZ A;  1V40 A;  2YWI A;  4TVE A;  4KF9 A;  3M8N A;  3MIX A;  4EIP A;  2H72 A;  1E6B A;  2HRN A;  5CRD A;  2KOK A;  1A23 A;  3TDG A;  5LD0 A;  4L5O A;  1PKZ A;  2VCW A;  4K0N A;  3DGQ A;  5L71 A;  4G0K A;  1OC3 A;  1RW1 A;  3QFB C;  5FT3 A;  1FVJ A;  4MCU A;  1K0M A;  5JWO B;  1Z3E A;  3ERF A;  1VF3 A;  2L6C A;  1PL1 A;  1S3D A;  4I5Q A;  5G30 A;  1NW2 A;  2LNS A;  2LEG A;  4TR3 A;  3WGX A;  3O6T A;  2WGR A;  3LXZ A;  4KGI A;  12GS A;  1EEM A;  2RM6 A;  4HQS A;  2JAC A;  4ZBA A;  2L6D A;  4O92 A;  3HKR A;  3QAG A;  1XFL A;  3HA9 A;  3VFI A;  6GSY A;  6GSU A;  1TRS A;  1A0R P;  2OAD A;  4MJC A;  3LJR A;  4D73 B;  1JZO A;  1YKC A;  2J23 A;  4GXZ A;  1TK5 B;  2V32 A;  2PWJ A;  6GSV A;  9GSS A;  3IC4 A;  4FO5 A;  3UVH A;  1O85 A;  1FB6 A;  2WCI A;  2E7P A;  4K9Z A;  1GSS A;  4OFT A;  3WGD A;  5DQS A;  4IVF A;  2HSM A;  3UBL A;  2VUP A;  4WF5 A;  2X8H A;  5EVO A;  2X4A A;  4TXO B;  5D96 A;  1AUC A;  1K0A A;  1PN0 A;  4X0X A;  1MDK A;  1M2A A;  2H76 A;  2RUF A;  4G19 A;  4OCE A;  1QQ2 A;  4TN8 A;  4GSS A;  4OD7 A;  3FZ9 A;  2AB6 A;  4DSR A;  1K3L A;  1FO5 A;  1A2L A;  1O81 A;  1OC9 A;  1SKR B;  1F2E A;  14GS A;  2KUC A;  2ON5 A;  1IYH A;  4LMV A;  2CVD A;  1X5D A;  2LRC A;  1BJX A;  4N10 A;  4HUA A;  1LBK A;  4LA1 A;  4PUA A;  4TR4 A;  2L57 A;  3FZA A;  1GSE A;  4K2X A;  1ZOF A;  2EIO A;  1XW6 A;  2FD3 A;  2C0D A;  1KEB A;  3ZYW A;  3KXO A;  1GP1 A;  1TTZ A;  4TOP A;  4ZL9 A;  3LEF A;  1FAA A;  2DIZ A;  4KE3 A;  4YAV A;  2H1A A;  4I97 A;  4J56 E;  5G5F A;  1IYI A;  4WBR D;  3LYK A;  3BD2 A;  3HYP A;  2VM1 A;  3J7Y k;  3TJG A;  2TRC P;  3L9S A;  2PUK C;  3D0Z A;  13GS A;  5CRE A;  2H30 A;  3VWV A;  1YZX A;  5A4W A;  2YV7 A;  2R4V A;  3BCK A;  5ECR B;  3I69 A;  2LST A;  4XHM A;  3IAM 2;  3GUR A;  1W4V A;  3PIN A;  5GAN D;  3QAV A;  3LOR A;  2VO4 A;  1K3Y A;  2C0G A;  5J3R A;  3MAK A;  3F8U A;  4MF6 A;  5DAK A;  1PMT A;  1SD8 A;  3JCM L;  2H74 A;  1NM3 A;  4OFN A;  1HD2 A;  2JZS A;  3D4T A;  4BPY A;  3KTL A;  1T3B A;  4EO3 A;  1K0O A;  3DKS A;  3VI7 A;  3HVV A;  4IGJ A;  3ZTL A;  5KEJ A;  2OJL A;  4MAB A;  1F3B A;  4HZ2 A;  5ABR A;  4BVY A;  2GZP A;  3GKM A;  4GLT A;  5B8A A;  5KN2 A;  3I6A A;  1SJZ A;  2IMF A;  1UN2 A;  4PTS A;  1SYX A;  1SKW B;  2G2Q A;  4EF0 A;  2H6X A;  2CT6 A;  4ECJ A;  1KNG A;  1Y6E A;  4MJA A;  3P90 A;  6GSW A;  3GKN A;  2F51 A;  4CDO A;  5ECK B;  3IK7 A;  2QA1 A;  3VWX A;  4G10 A;  3N9J A;  5EY6 A;  2H0H A;  1JFU A;  3Q19 A;  4LL4 B;  3LYP A;  5ECI B;  2GZY A;  1B8X A;  2MMA A;  1VF4 A;  5IIZ A;  4K6X A;  2DJ1 A;  1ZYE A;  1TKD B;  1KBN A;  2N5B A;  4TW5 A;  5HR2 A;  4AJ7 A;  4MZW A;  2K8V A;  4MZB A;  1M99 A;  1GSF A;  2IWT A;  2HFD A;  4GQC A;  4L0U A;  3ZRE A;  3IK9 A;  3HHV A;  2PPT A;  7GSS A;  3HVX A;  3MWH A;  3C1S A;  3RBT A;  3L78 A;  3UVT A;  1PKW A;  1GRX A;  2OBI A;  5BRT A;  1EP7 A;  4EIQ A;  2F8A A;  1R5A A;  4YAP A;  2B1K A;  3DML A;  2HRF A;  3G7J A;  2ALB A;  1OAZ A;  2NTO A;  4V2L A;  3EMX A;  1TP9 A;  1PQN A;  4KDX A;  2XC2 A;  4ZXG A;  3GHA A;  1O6J A;  2NVL A;  4IP6 A;  3ZFB A;  4Z2U A;  1U88 A;  1A24 A;  3C7M A;  1CQG A;  4POK A;  3C8E A;  4F0B A;  3VLN A;  1QXH A;  1TU8 A;  4EDZ A;  2LJA A;  3ZIJ A;  3QMX A;  2DML A;  4V1A p;  3TKP A;  4A5P A;  4O5Q A;  4GSN A;  1USB A;  3ZML A;  2HSY A;  1U3I A;  4GTU A;  2C3N A;  3M0F A;  3V1W A;  5F8B A;  2B7J A;  3F4T A;  3ME8 A;  5ECN B;  1JLW A;  2QSI A;  2MMZ A;  1FOV A;  4WBJ A;  3A5W A;  3A5I A;  5B7C A;  1SJI A;  4IEL A;  1PRX A;  4HZ4 A;  4PXO A;  1Z6M A;  2VL3 A;  1A8L A;  3HJO A;  2R6K A;  5IPH A;  1N2A A;  3L9V A;  1J9B A;  5CP1 A;  4O7H A;  2ES7 A;  1ERT A;  4E8H A;  5J9C A;  3DEX A;  1DBY A;  4K0G A;  2Z9S A;  1XZO A;  2VCZ A;  1F9M A;  4Q5R A;  2B7K A;  4V2N A;  3IRA A;  3GL3 A;  5A4V A;  5HFK A;  4GST A;  5COH A;  1M9A A;  4TRX A;  2VAF A;  4IS0 A;  1R4W A;  4WR5 A;  2FWH A;  3APS A;  4X4J A;  2FY6 A;  2MZC A;  4KDU A;  4Q5N A;  4ZBB A;  4ZL8 A;  5J5N A;  2DKH A;  3ZVJ A;  5IMC A;  5BMU A;  1O8X A;  4GF0 A;  2FA8 A;  22GS A;  5B6M A;  3EYT A;  1X9M B;  4I8B A;  5G2Z A;  2YWM A;  1SK2 A;  1XWB A;  2CV4 A;  3GL5 A;  4FQU A;  1TI1 A;  2O87 A;  3CXG A;  3IHQ A;  3IAS 2;  1A8Y A;  1SJ6 A;  4HU9 A;  1R26 A;  4IHU A;  1HNB A;  17GS A;  4TKY A;  4ECI A;  4JED A;  4YKF A;  2WUL A;  2L5L A;  3H93 A;  5GST A;  3TKS A;  2X8C A;  1EGO A;  1GUL A;  1NSW A;  3HCZ A;  2QGV A;  3CYN A;  1FHE A;  5ECQ B;  4K7N A;  1WRY A;  1GUK A;  1YEP A;  3NIV A;  5IMZ A;  3SWL A;  2WRT A;  3HD5 A;  4O5R A;  1SKS B;  2X49 A;  3P7X A;  3S9F A;  4X43 A;  1EGR A;  2C0E A;  3TCO A;  4FYU A;  1GSQ A;  2VCQ A;  1ZZY A;  1B9X C;  4BL7 A;  2N5F A;  4WEY A;  2X8G A;  4HI7 A;  2V6O A;  2YAN A;  3EU3 A;  1B48 A;  5CRW A;  1HNA A;  2CZ2 A;  2A2S A;  3DVX A;  1EV9 A;  2L5O A;  2YPM A;  1MD4 A;  2HZE B;  4XIH A;  2AYT A;  3GN3 A;  3M9J A;  4AJ8 A;  3D6I A;  2J9H A;  4Z7X A;  2FUG 2;  1THO A;  1M2D A;  4X1U A;  2WFC A;  1AXD A;  3GIX A;  3SBC A;  5ENU A;  4HJ2 A;  4MH2 A;  3DYR A;  1Z6N A;  5DAL B;  3CTF A;  2P0G A;  5D8I A;  3IDV A;  1XW9 A;  3UJ1 A;  3ZLP A;  4YQM A;  2H01 A;  1M9B A;  4KND A;  3ZIV A;  1QFN A;  3M9K A;  3FK8 A;  3OR5 A;  3QOU A;  2LRT A;  4K2D A;  4RI6 A;  1SL1 B;  1GNW A;  3N5O A;  1R5P A;  4MNN A;  2GQL A;  2GSQ A;  1F3A A;  3W8S A;  1W89 A;  2HT9 A;  4YH2 A;  4OO4 A;  2L4C A;  1YF1 A;  2C3Q A;  4XRD A;  5C00 A;  2DJK A;  4PUF C;  1SK0 A;  1DUG A;  1Z5Y E;  2YWN A;  1MTC A;  3BBY A;  3G7Y A;  3NOF A;  2B5E A;  2FWG A;  2GVP A;  1TI3 A;  2A4V A;  5IQY A;  1ZYP A;  1SL0 B;  4MLY A;  1YDK A;  3FW2 A;  4JRR A;  3RDW A;  4XS1 A;  4AJ6 A;  3F3Q A;  3RHC A;  4YQV A;  2NPB A;  3BOA A;  1VF1 A;  2TRX A;  3QFA C;  5DJL A;  4O5U A;  1GTU A;  1MDI A;  3E0U A;  3VPT A;  2CX3 A;  3HY2 A;  1X0R A;  1XPV A;  3FKF A;  4KCA A;  3HJP A;  4ZL7 A;  2GSR A;  4KH7 A;  4DEJ A;  2PER A;  3F4S A;  2PMT A;  2JZR A;  2H66 A;  3TOU A;  2DKI A;  4JU5 A;  3HVS A;  4DSS B;  3QAW A;  5ECP B;  1YJ6 A;  2O89 A;  4NV5 A;  5LCZ A;  1EEJ A;  5IOX A;  2FCH A;  2CAI A;  1YKA A;  5IMV A;  4PNF A;  3ED3 A;  4IKH A;  1X5C A;  1SEN A;  4FYB A;  3PR8 A;  5ECL B;  4BVX B;  3LQ7 A;  2ON7 A;  2BJX A;  2C8U A;  5ID2 B;  3F3R A;  2VD0 A;  4USS A;  2E0Q A;  3GST A;  2HRA A;  1WIK A;  1ERW A;  3I9V 2;  19GS A;  5EL8 A;  5HFI A;  4NHZ A;  3ERW A;  2H0I A;  2OKA A;  2H6Y A;  2R5G A;  2VIM A;  3Q74 A;  4MP4 A;  5EPF A;  2E2M A;  1THX A;  4RI7 A;  3UAP A;  2FHE A;  5F07 A;  4BWQ A;  4NHW A;  4HU7 A;  3FZ5 A;  3MDK A;  3KH7 A;  5INY A;  3QD9 A;  5H5Q A;  3VPQ A;  4I2U A;  1FVK A;  5DJM A;  6GSS A;  4ISD A;  2GT6 A;  2PVQ A;  2R0G A;  1ZL9 A;  2X64 A;  3GKK A;  3F6F A;  3GMF A;  4JZQ A;  2IFQ B;  3R3E A;  4GRF A;  1SYR A;  3TUE A;  1JZD A;  3FRC A;  1OVN A;  1Z7R A;  3K8N A;  1Q98 A;  4MPF A;  2BMX A;  1ZGN A;  3IR4 A;  2RM5 A;  3Q6O A;  3M3M A;  4DSQ A;  1KTE A;  3VWW A;  1GLQ A;  5GAP D;  4L0W A;  1PA3 A;  3GTU B;  2EC4 A;  2B1L A;  2K18 A;  5D9V A;  5DCH A;  4JE1 A;  1HQO A;  2H19 A;  2XHF A;  2YCD A;  3DD3 A;  1GSU A;  1BAY A;  3TJJ A;  1PN9 A;  4OWY A;  4NWY A;  2K8S A;  4L8E A;  3GSS A;  2E2G A;  3ZMK A;  5JCW A;  4ML1 A;  3A2X A;  1FB0 A;  1QGV A;  4AGS A;  1I9D A;  4D73 A;  4EVM A;  1DSB A;  1XVQ A;  4NXI A;  2WJU A;  4ZBD A;  3KP8 A;  3EC3 A;  1V57 A;  4QL7 A;  1O8W A;  2IME A;  3GFK A;  3WGE A;  5DCG A;  3GH6 A;  2HYX A;  2D2Z A;  3ME7 A;  1G0T A;  4CW9 A;  2AAW A;  4TXO A;  4KSO A;  2YOI A;  2K9F A;  2FWE A;  2R37 A;  4F82 A;  2CZ3 A;  2MBT A;  2F9S A;  2YZU A;  2H70 A;  2DSA A;  4HQZ A;  2HLS A;  4IQA A;  4NMU A;  1AQX A;  4TR1 B;  3FR9 A;  2CQ9 A;  1AIU A;  2LQQ A;  4HS1 A;  5D9W A;  4PUR A;  2IL3 A;  1XVW A;  4LMW A;  2M72 A;  3DIE A;  1TK8 B;  3QDN A;  2IIY A;  3GX8 A;  1O73 A;  2DLX A;  3GKX A;  4Q5F A;  1XIY A;  4KB3 A;  1ZYQ B;  4E8E A;  2I4A A;  4XS4 B;  3EIN A;  1JZR A;  2I9H A;  3W8J A;  1OYJ A;  4G9H A;  1U87 A;  4IJI A;  1PX7 A;  2EIR A;  2IJY A;  2VCT A;  2LNT A;  1Z7P A;  1AAZ A;  1XXU A;  5AGY A;  4ZB6 A;  1YF0 A;  5G5E A;  4N30 A;  4OCF A;  3G7I A;  5J4U A;  1S3A A;  1FW1 A;  3EE2 A;  4MJB A;  4BWS A;  2LJR A;  2VCX A;  4ECC A;  2GTU A;  4ILF A;  4F9Z A;  3RAZ A;  1M0U A;  4IQ1 A;  2I1U A;  4EKZ A;  5AN1 A;  2JSY A;  2M46 A;  1SK1 A;  3KMN A;  2RII A;  1GLP A;  2HE3 A;  4BA7 A;  5FHI A;  2VL2 C;  3FYG A;  1N8J A;  5DQY A;  5E4W A;  3FR6 A;  1EV4 A;  4AF2 A;  2NBS A;  2FGX A;  5IO2 A;  1URM A;  2YNX A;  4TR0 A;  1NHY A;  3MNG A;  4LL1 B;  2AHE A;  1J0F A;  3HXS A;  4KCE A;  1OE7 A;  2DIY A;  4IN0 A;  3WD6 A;  3DRN A;  4XCS A;  1GH2 A;  1J08 A;  3QPM A;  2PBJ A;  1WP0 A;  2LRN A;  5DDL A;  4CY8 A;  2P5R A;  4N0Z A;  1XOA A;  1YQ1 A;  2WB9 A;  3TRP A;  3L0H A;  8GSS A;  1BG5 A;  3LSZ A;  1AW9 A;  4ULX A;  3ZVJ D;  5A4U A;  1XW5 A;  1GUM A;  3F4R A;  5B8B A;  1JHB A;  2VLT A;  2VM2 A;  2FA4 A;  4K1F A;  1O7U A;  2OE1 A;  1TW9 A;  4EL1 A;  5AIX A;  3C73 A;  3F6D A;  3L9U A;  1S3C A;  2QKE A;  3EWL A;  4KW6 A;  1EP8 A;  3LFL A;  3KM6 A;  2KHP A;  4IP1 A;  4ZB9 A;  2JZT A;  5A5K A;  4G2E A;  2EIQ A;  4Z2R A;  2UZ8 A;  3VUR A;  2PGT A;  5IM9 A;  2LJK A;  3IBH A;  3LGC A;  1ST9 A;  2GQK A;  1TRV A;  2LTK A;  2ZUP A;  5KN1 A;  3CSH A;  1ZCP A;  2WS2 A;  2CAQ A;  5HFG A;  4I6X A;  4MPG A;  1YY7 A;  1TOF A;  2IN3 A;  1I5G A;  2WDU A;  4K5S A;  3TRX A;  4RUV A;  2HZF A;  4F2I A;  3HZ8 A;  4GCI A;  3UBK A;  2C0F A;  3IE3 A;  3LWA A;  4NV2 A;  1HNC A;  2VLV A;  3GA4 A;  1OC9 B;  1HYU A;  1VRS D;  4HEA 2;  2YV9 A;  1TRU A;  3UL3 A;  4MK3 A;  1ZMA A;  2YWO A;  3A3T A;  2DJ2 A;  4K8M A;  5CNW A;  4KSM A;  3D4M A;  2C4J A;  4MZC A;  5JCG A;  2REM A;  4MA9 A;  5KOX A;  1GTB A;  2N5A A;  4WR4 A;  3FMW A;  1T00 A;  1ILO A;  4XRA A;  1ZYN A;  2XPE A;  3CSI A;  3GV1 A;  1V98 A;  5IMD A;  2CVB A;  2O85 A;  2JU5 A;  2CX4 A;  5CAX A;  1QMV A;  1MD3 A;  5ECH B;  1PX6 A;  3KH9 A;  4LLR A;  3IV4 A;  1OE8 A;  1PGT A;  3APO A;  5D93 A;  3VI5 A;  4OMV A;  3KGK A;  5ELA A;  4NAX A;  3KCM A;  1T8E B;  3HZ4 A;  3LW9 A;  5IMA A;  3J7Y b;  2LS5 A;  1V2A A;  4XS6 A;  3US3 A;  1RK4 A;  3F63 A;  1VGL A;  3P2A A;  3FR3 A;  2F3M A;  1G7E A;  2GLR A;  5DAK B;  3VK9 A;  2PN8 A;  1QK8 A;  1K0N A;  4HOJ A;  1XOB A;  3TRQ A;  3IA1 A;  2LKU A;  1WMJ A;  1BED A;  2DMM A;  1ERV A;  2WZ9 A;  5AIV A;  1R7H A;  2ZCT A;  5CRH A;  4BVY B;  2YP6 A;  4CHS A;  4XTS A;  4FIW A;  4MF7 A;  1WE0 A;  1VF2 A;  1ERU A;  2YZH A;  2JAD A;  2RUE A;  4KX4 A;  1G6Y A;  3ZFL A;  1WPI A;  2JL4 A;  3GH9 A;  1ON4 A;  1EOH A;  3MYD A;  5HR1 A;  3QCP A;  1BYE A;  1F6M C;  5CRG A;  3IHG A;  3D22 A;  3W6G A;  3KZQ A;  4V2M A;  1TXX A;  2XBQ A;  1K0B A;  3C71 A;  1AC1 A;  1SD9 A;  3PPU A;  2FWF A;  3EU4 A;  1GL8 A;  1X5E A;  1AQW A;  2KP1 A;  4L5L A;  4EE0 A;  3DXB A;  2DJJ A;  1A2M A;  5ECS A;  4HJM A;  5J9B A;  5G1K A;  2A2P A;  2IMD A;  1U3A A;  1PL2 A;  3O3T A;  1DE1 A;  2KLX A;  3UEM A;  1SU9 A;  2P31 A;  3GUS A;  5LNK e;  5CO3 A;  2GT5 A;  2H1B A;  2MBS A;  2OE3 A;  2H8L A;  3HJM A;  3RPN A;  4GQF A;  3TKR A;  2C1Y A;  2HRK A;  1GTA A;  2V41 A;  3R2Q A;  3TOT A;  1MEK A;  2CVK A;  2H1G A;  2L59 A;  4ZIL A;  3UAR A;  5KN0 A;  4KDY A;  4POL A;  1NHO A;  3ZL5 A;  2H75 A;  3MSZ A;  3KP9 A;  2VCV A;  1WJK A;  2H0G A;  2MYG A;  1FG4 A;  2B5Y A;  2K6V A;  2X99 A;  1UC7 A;  2I3Y A;  2AV4 A;  3DWV A;  1XWC A;  4J2F A;  2XBI A;  1TU7 A;  3L4N A;  3RHB A;  2DJ0 A;  1GTI A;  5JCU A;  1EWX A;  2H6Z A;  5FWG A;  1EZK A;  1UVZ A;  2YJ7 A;  4IJ3 A;  5ECM B;  4EXJ A;  2IMI A;  2HZE A;  4G0L A;  2GQM A;  5H5S A;  5AIS A;  3UMA A;  2M80 A;  3NZN A;  2NDO A;  3F9U A;  2A2R A;  4Z2T A;  2HXK A;  1OC8 A;  4N11 A;  4NPB A;  1EOG A;  3APQ A;  1FOH A;  4EDY A;  2B6M A;  5ECO B;  4ECB A;  3C1R A;  4ZB8 A;  5HR3 A;  4ICY A;  2GST A;  1T4Z A;  2XPD A;  2R2J A;  4K7O A;  3ZZX A;  4PQI A;  2YJH A;  4QL9 A;  1G7O A;  1H75 A;  4PNG A;  5DAL A;  4JR6 A;  4YQU A;  3EUR A;  5D73 A;  1DE2 A;  1B4Q A;  5F06 A;  4Q5Q A;  1XBS A;  1K3O A;  2R0C A;  3FZ4 A;  1V58 A;  6GST A;  2CA8 A;  2HSH A;  1A0F A;  1B9Y C;  1RQM A;  5IPG A;  1WWJ A;  2BTO T;  5C04 A;  6GSX A;  5G1L A;  4V1A g;  2DBC A;  4QQ7 A;  2VOC A;  1ABA A;  3TJF A;  1QUW A;  4ACS A;  3HDC A;  3H79 A;  4N0V A;  3G9B A;  2C3T A;  1ACV A;  3UIW A;  2F8F A;  2V6K A;  3KTB A;  1CQH A;  4PQ1 A;  1BX9 A;  1AQV A;  3ISO A;  1XWG A;  3EMP A;  3O76 A;  1TK0 B;  5GSS A;  4O32 A;  3IC8 A;  4DVC A;  3F0I A;  4KUN A;  4P3Y B;  3VWU A;  2LUS A;  4PQH A;  2QA2 A;  2OE0 A;  2B3S A;  3KJY A;  2B5X A;  3KMO A;  3UOM A;  1V9W A;  4ZIJ A;  2O8V B;  3D5J A;  4DSS A;  1GSD A;  1SL2 B;  3U6V A;  3IPZ A;  3A2W A;  1A2J A;  2JSZ A;  4TXV A;  2H73 A;  2HNL A;  3U5R E;  5CYY A;  5GZZ B;  4OO5 A;  5B6N A;  2A4H A;  3KEB A;  4BVX A;  3H1N A;  1XWK A;  1OKD A;  5ID2 A;  2VLU A;  1JLV A;  4IW9 A;  3TGZ A;  3PGT A;  2O7K A;  2GSS A;  2R0P A;  5ELG A;  3CTG A;  1Z9H A;  1M7T A;  4FH8 A;  5DBQ A;  3TKS C;  3D21 A;  5J41 A;  1MDJ A;  3M1G A;  4BL7 B;  4ML6 A;  4EUY A;  3EPT A;  2L4Q A;  4EC0 A;  5F0G A;  2DC5 A;  2FLS A;  3GRX A;  3P8W A;  1LU4 A;  2OBK A;  5IMF A;  4F0C A;  4KA0 A;  3KIJ A;  4PX1 A;  2G0F A;  5DVB A;  3QR6 A;  5HR0 A;  2AJQ B;  2PVO C;  2GGT A;  3ZIT A;  3BJ5 A;  2IFQ A;  1Y25 A;  4CY6 A;  4RQR A;  3LG6 A;  4WF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...