2PU9C

Crystal srtucture of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin f
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
EAIVGKVTEVNKDTFWPIVKAAGDKPVVLDMFTQWCGPSKAMAPKYEKLAEEYLDVIFLKLDCNQENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 27
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pu9C00
1R4WA 1Z9HA 2EIOA 4HEA2 3HY2A 1R7HA 2GZZA 1SU9A 2X8CA 3P8WA 4GSTA 4GQCA 2LTKA 4X0XA 3A2VA 3D6IA 3PINA 12GSA 1O8XA 3ZFBA 3KH9A 3VWXA 2H30A 4OFMA 3BBYA 5CNWA 1ZYEA 5GSTA 2N5AA 2P5RA 1K0NA 4POMA 2LRNA 3UBKA 4XHMA 3TCOA 3ZYWA 4KE3A 4GSNA 4FH8A 1TRSA 1JZRA 1EEJA 3FY7A 2IPAA 4WF4A 2P0GA 1YF1A 3EU4A 1RW1A 2YOIA 1SK1A 3F3QA 2FCHA 1YEXA 3NOFA 4IBPA 5H5QA 2BJXA 1XOBA 1Z3EA 5JCWA 5IPGA 1SKRB 4IVFA 5LCZA 4OD7A 4LMVA 1AQWA 2PMTA 3M9JA 1BG5A 5FHIA 3ZREA 4CHSA 4BL7A 2C0GA 3KJYA 3ZVJA 2PUKC 4IKHA 3DXBA 3ZTLA 1TJDA 6GSUA 2M72A 4ZL7A 1PKZA 4XCSA 2XC2A 3QFAC 4HS1A 3WD6A 4X43A 2FLSA 3G7YA 4PQHA 4TXOA 2QKEA 3KMNA 1K3LA 2I4AA 1Z7RA 1QFNA 4YAPA 2OKAA 2LNSA 3O6TA 2JZSA 5IMAA 1PSQA 2B1LA 5DQYA 2MMZA 3H93A 4MJEA 3NZNA 4MCUA 4XS4B 1Q4JA 5KN0A 4MF5A 1N8JA 4GWRA 4EC0A 5CO3A 1EWXA 1XWBA 3EYTA 3IPZA 4EKZA 3QPMA 2H1DA 1SL1B 2FHEA 5DALA 4QL7A 4POKA 1O81A 3VK9A 4OCEA 1E6BA 1YJ6A 4I2UA 3FZ4A 5F0GA 2VCQA 1ZMAA 1YEPA 3HVVA 4XS4A 4NAXA 2O7KA 4KDYA 5A5KA 4PGTA 5ECRB 1B8XA 1MD4A 2VL2C 2YJ7A 5IPHA 1EGRA 1WE0A 2GZYA 1H4OA 3IAM2 2WFCA 5F05A 1WRYA 4JZQA 3V1WA 1GRXA 4POLA 1V9WA 3H1NA 3FHKA 1O6JA 1YF0A 4QQ7A 3TUEA 1NHYA 5B6NA 2WS2A 3C71A 3AY8A 1R5AA 2REMA 4HQZA 1XCCA 2F9SA 4Q5QA 5DCGA 4GCIA 1ZZYA 4WR4A 1AAZA 3O76A 2WZ9A 4HU9A 1F3AA 2LRCA 2BTOT 5D9VA 3E9JB 3BCKA 4RQXA 3ZZXA 3HDCA 1URMA 1XWKA 4OCFA 5F07A 1AC1A 2R6KA 4DSSB 1TU7A 2WJUA 4BWQA 1SL0B 3LJRA 3LXZA 4K7OA 3LYPA 1JZWA 1GNEA 4ZBDA 4IQ1A 5KN2A 3TKRA 4K1FA 4GSSA 5IMZA 1AQVA 2IWTA 1U6TA 3FKFA 3GSSA 4NXIA 2NVLA 4DSRA 2OBIA 3US3A 2E2GA 2LS5A 2XPDA 2OJLA 2FUG2 2YV9A 2GDRA 4HDEA 3BJ5A 3GX8A 1GUKA 3F8UA 3CTGA 5C00A 4WEYA 2CVBA 2LSTA 1HNAA 2KHPA 2ON7A 4TOPA 2D2ZA 4MJAA 3GSTA 3CRUA 4GF0A 3FR6A 2DSAA 1OAZA 2CQ9A 1EOGA 2YN1A 1PD21 3D4TA 5JWOB 1DSBA 2IN3A 4EF0A 2GLRA 4RUVA 1EGOA 4IELA 1R5PA 5D8IA 2DC5A 3PGTA 1GL8A 3BOAA 4GLTA 4LMWA 2VL9A 4MMMA 2HYXA 1SYXA 2L4QA 5FWGA 1TXXA 1WOUA 5H5SA 3D22A 5B6MA 2VLUA 1BX9A 2OACA 1V40A 5CRWA 1QQ2A 1GP1A 3H79A 2L5OA 2RUEA 4O32A 5INYA 4V2MA 4TKYA 4XIHA 4WXTA 3TJJA 3UAPA 2NTOA 4NMUA 4O5RA 4F0BA 2NPBA 2VAFA 5D93A 5C04A 2CZ3A 5AN1A 2JU5A 3APSA 3GFKA 1YDKA 2VUPA 1SKSB 1ACVA 1EOHA 2X8GA 3KZQA 1A24A 3HVSA 3WT1A 5ECIB 4ZBBA 1YZXA 4MLYA 6GSSA 4KGIA 5A4WA 1EV4A 2WDUA 1K0DA 4MPFA 2B7KA 4MZBA 3L9UA 2LJAA 4AJ7A 4MF6A 4MK3A 3EMPA 1EP8A 3GURA 4PNFA 4LA1A 3QFBC 4TR4A 1O85A 1GTBA 2HZFA 2EIQA 4ILFA 1HNBA 1G7OA 1U87A 3A5WA 3ZIVA 4ECIA 2AV4A 3KH7A 4KDUA 4L5OA 2DJ3A 5KN1A 1F3BA 3E3EA 3ZMLA 2HRNA 3I6AA 2DJJA 2IFQB 4ZILA 3C73A 4XRAA 1PMTA 5J9BA 4TN8A 1F6MC 2JSYA 13GSA 5G1LA 1M9AA 1GULA 3TKSE 1EP7A 1ON4A 5HR3A 4XTSA 4K9ZA 2H75A 2XHFA 5ABRA 1NW2A 5CP1A 5JWRB 1XBSA 5JWQB 4O7HA 1K3YA 2FA4A 2JADA 4KAEA 4NWYA 4ECJA 1M2BA 3KMOA 5AIXA 1DBYA 5FT3A 1PKWA 3GL5A 3H4KA 5IOWA 2IFQA 4J2FA 3LQ7A 1XWCA 1HNCA 2WCIA 4PUAA 2LRTA 2OE1A 4MZCA 1VF2A 3HJPA 2H70A 5ECPB 3A2XA 1MD3A 1ZOFA 4YQUA 1KTEA 3EE2A 1YY7A 5J9CA 5HR0A 3CRTA 2FWEA 4FO5A 2E0QA 1AQXA 2E2MA 5JCGA 4EVMA 4HI7A 4CW9A 1FW1A 3I9V2 5ECQB 3F6FA 3Q6OA 2JZRA 1V98A 3VPQA 1YQ1A 3CSIA 3E0UA 1TDIA 1J9BA 2H72A 3DKSA 3TJKA 4ZB6A 3QCPA 4JRRA 4K2DA 2H74A 3D4MA 3NIVA 17GSA 2CVDA 10GSA 4GRFA 1QXHA 4TR3A 2N5BA 2ZNMA 2IJYA 2K6VA 3RPNA 2H71A 4NV5A 3F9UA 1HQOA 3QD9A 2H1GA 3ME8A 3D21A 4AF2A 1FO5A 3IK9A 1VF3A 4IHUA 1B4QA 1GWCA 4HZ2A 3HZ8A 3W6GA 2MZCA 1SJIA 4F9ZA 2C3TA 3UOMA 2FY6A 4WKWA 5HFIA 5CRHA 5J41A 4EDZA 2L6DA 3MAKA 3VI7A 1OKTA 1GUHA 5IO0A 2H6YA 3P90A 2IMDA 3K8NA 3OR5A 2O85A 2OA7A 5ECOB 2ALBA 4ZB8A 6GSVA 8GSSA 1OYJA 3F63A 1O8WA 1GSEA 4RQRA 1TI3A 3ERGA 1FG4A 2VM1A 1BJXA 4PQIA 3L9SA 4WBRD 4YQVA 2HSHA 1SL2B 2CV4A 2IMKA 1THXA 1LJRA 1OE8A 6GSXA 1SK2A 4I2TA 3CSJA 4KX4A 3DIEA 2LKUA 4N0ZA 4NHWA 2NBSA 4TXOB 2I1UA 1MDKA 2YWOA 20GSA 4G10A 4DSQA 1JLWA 2I9HA 3ERWA 2CAQA 3QAGA 3TRQA 4ZB9A 1GH2A 2B1KA 5ECLB 4MH2A 2LNTA 3M8NA 5ID2B 3M9KA 2C3QA 2IMFA 2IMEA 3LG6A 4IS0A 4Q5NA 4OO4A 3VWWA 4BA7A 2AB6A 3GNJA 2HLSA 4IN0A 4NPBA 4AJ8A 4JR4A 5DALB 11GSA 1TRUA 2J9HA 3IR4A 1WWJA 2R2JA 3F4TA 4BVYA 4IP6A 6GSTA 2RM5A 1JFUA 5ID2A 1PN9A 3L4NA 4ACSA 3KTBA 2LV3A 2FA8A 3WT2A 2P5QA 2A4VA 3HZ4A 3ED3A 1LBKA 2DJ1A 5ECMB 18GSA 4K7IA 3TOTA 5IO2A 1SKWB 5ELAA 5HR1A 3HJMA 4HOJA 4MJCA 1VRSD 2YP6A 1FHEA 4NV2A 3FRCA 3IRAA 5AGYA 3QAVA 4KNDA 4MA9A 1K3OA 1W4VA 4G9HA 3FK8A 3L0HA 2YNXA 3FZ9A 16GSA 3DEXA 1XPVA 3DD3A 3GTUA 2VCVA 4PURA 2I3YA 4PQ1A 4LL1B 1XWGA 2YWNA 3F6DA 2VM2A 5DVBA 5D9WA 3S9FA 4N30A 4EO3A 1VF1A 2L59A 3J7Yk 3L78A 1USBA 4EL1A 2VL3A 2NDOA 2GSRA 4PUFC 1ST9A 3KTLA 1J0FA 2M46A 2F8FA 4QL9A 3LGCA 1TTZA 4OO5A 2AYTA 2H73A 4KA0A 5EL8A 3MSZA 4K8MA 2VL2A 3LFLA 4TR1A 1AUCA 3UEMA 4ZL8A 1JZDA 1T4ZA 1FAAA 1OC9B 2O8VB 2AHEA 1R26A 1WJKA 3CBUA 1JHBA 5B8BA 1PGTA 5DCHA 2RUFA 2GSTA 1S3DA 4J57E 2WRTA 3P7XA 4HU7A 1O73A 4KW6A 5D9TA 2H6XA 4IJIA 3UMAA 4YH2A 2C8UA 2PN8A 5EPFA 6GSWA 4KSOA 4LLRA 3LORA 2KOKA 1GSDA 3GL3A 3WYWA 1OC9A 2OADA 4RI6A 5IQYA 2KLXA 3EWLA 4H86A 3HCZA 3EMXA 3HA9A 4FYCA 3CXGA 5A4UA 1ZCPA 1A0FA 2C3NA 5GZZB 2FWHA 2L5LA 1BEDA 1U3IA 2YWIA 4GQFA 1TRVA 2GTUA 4OFTA 4JBBA 1QMVA 2K8VA 2C0EA 1XVQA 5ECNB 4F0CA 2MYGA 1T1VA 1XW6A 1LU4A 2CT6A 2K18A 2J23A 4WR5A 1I9DA 1K0BA 2P31A 3TJFA 5J4UA 1SJZA 1G7EA 2WGRA 1B4PA 4I5QA 2TIRA 4J56E 1EV9A 5IMFA 2B7JA 2OE0A 2GQMA 2G0FA 1GSSA 2B5EA 3M3MA 3DRNA 3ZIJA 2GVPA 1F9MA 2C0DA 3IHQA 2B5XA 3HD5A 4IJ3A 3WGXA 3HHVA 5G2ZA 1F37A 1Z6NA 4WBJA 2H0IA 2OBKA 2YANA 1UC7A 3RBTA 2HFDA 4JU5A 4ID0A 3ZFLA 3MNGA 3DVWA 1TU8A 2RIIA 1E2YA 2QSIA 2PU9C 5B7CA 4Q5RA 2TRXA 3TJGA 2XPEA 1ERUA 1A2JA 4O92A 3Q18A 1ABAA 4D73B 3IBHA 2VIMA 3TB2A 3JCML 1GLPA 1F2EA 3KP9A 5F8BA 1ERWA 1TK5B 4FYBA 5DQSA 2GSQA 3DMLA 1V58A 3Q19A 3P2AA 4ECCA 2CVKA 2FD3A 1O7UA 3GX0A 1XZOA 1K0CA 4IGJA 5AISA 2B6MA 5ECSA 3J7Yb 4D73A 3VWUA 1M2AA 2F3MA 1TK8B 19GSA 1K0AA 1ERTA 3CTFA 4GXZA 3LWAA 4TVEA 1T7PB 4BWSA 1GSFA 2HZEA 1HD2A 4N10A 5CYYA 2MMNA 3QOUA 1Q98A 2YZUA 1V57A 2FGXA 3ZLPA 1OVNA 5IMVA 1NHOA 3FR9A 1BYEA 4EE0A 1QGVA 2VOCA 3UVHA 2YWMA 3VPTA 3TKQA 2CX4A 4I97A 5ECKB 1IYHA 3TRXA 5EY6A 1OC8A 2PPTA 2TRCP 2H1BA 2IMIA 3GKNA 2JL4A 2OE3A 1TP9A 3MWHA 1KBNA 1XOAA 1GUMA 3QDNA 2HXKA 1XIYA 3TKPA 4N0VA 3R2QA 3TRPA 1ZGNA 4ML6A 1DE1A 1SENA 3C7MA 5J3RA 4L8EA 4RI7A 1XW9A 2WB9A 2VD1A 4I6XA 1G0TA 3G7JA 2G2QA 1GTUA 5IM9A 2H0HA 4L0UA 4CDOA 5IIZA 1T8EB 1MEKA 4ISDA 3EC3A 4TW5A 4AJ6A 2GT5A 3KP8A 2DJ0A 4TR0A 4BVXA 2DJKA 5HR2A 5HFKA 3FZ5A 2B5YA 1I5GA 5HFGA 2N5FA 1XVWA 1QUWA 3TGZA 1V2AA 2X64A 2LJKA 1A23A 1WP0A 3UVTA 2LJRA 2DJ2A 2R37A 3I43A 3DGQA 3IV4A 3BD2A 5DAKB 1GSYA 2V6KA 2V6OA 2VCTA 4XRDA 2Z9SA 4NHZA 2PBJA 1GLQA 3IOSA 2VCXA 3C8EA 3GH9A 3Q74A 1DUGA 3QMXA 7GSSA 9GSSA 2BMXA 1A8LA 3ERFA 3UBLA 1VF4A 3FEUA 1Z5YE 5IMCA 2VCZA 4ULXA 2XBIA 1HYUA 1GSQA 5DAKA 3LXTA 2R4VA 2ZUPA 2H01A 2HSYA 5GAND 3GRXA 2K8SA 4HQSA 3KM6A 2WULA 1N2AA 2H1AA 4KSMA 1MDJA 1Y25A 2V2GA 3EURA 1AXDA 5IMDA 1X5CA 1J08A 1M9BA 1GTIA 4I8BA 3APQA 1AIUA 4MZWA 2QC7A 2QGVA 4N11A 2MBSA 5D73A 1CQHA 3IK7A 2AAWA 4ZIJA 2HT9A 1THOA 3RHBA 5CRGA 5JCUA 1A8YA 3A3TA 4TXVA 1Y6EA 3DWVA 2LQOA 1CQGA 2H0GA 2GGTA 3G9BA 4F2IA 1PL2A 3ISOA 2X99A 1G6YA 1VGLA 1A0RP 1XWAA 1X9MB 1XW5A 2O89A 3HKRA 1X5DA 1X5EA 3VURA 1U3AA 2JACA 3KEBA 2KUCA 1A2LA 1X9SB 2KP2A 3GTUB 5H5RA 4DEJA 5E59A 2C4JA 3WGEA 3F0IA 2F51A 3UJ1A 4MJBA 5D96A 2GZPA 5ENUA 5ELGA 2ZCTA 4LL4B 1PL1A 1YKCA 1FVJA 3PR8A 4WF5A 2YV7A 4IW9A 3D5JA 4KCAA 4V1Ap 5G5FA 1TOFA 5G31A 2ON5A 3FW2A 1RK4A 4XS6A 1T4YA 1SK0A 1M99A 1SJ6A 3IC4A 3UL3A 4TR1B 4ZL9A 2FWFA 4KUNA 1C72A 1YKAA 3HXSA 2PERA 1GTAA 2PVQA 2VO4A 3W8JA 3DVXA 1AW9A 4P3YB 2FWGA 5COHA 3A2WA 1H75A 4TRXA 1PX6A 2LEGA 4HJMA 4EDYA 4EXJA 1M2DA 2DMMA 2H76A 2EC4A 3MDKA 1ML6A 4L5LA 6GSYA 2RM6A 1QK8A 4MABA 2R3XA 3QR6A 1KNGA 2GQKA 2YPMA 3SBCA 2A2SA 4JEDA 2AUVA 1M0UA 3D0ZA 3HVXA 1RQMA 3IXRA 4E8HA 2JZTA 4JE1A 1NM3A 5J5NA 5CAXA 14GSA 4YQMA 1FVKA 3VFIA 3QAWA 4Q5FA 3M1GA 4PNGA 4HZ4A 4IP1A 2HNLA 4DSSA 3ZMKA 2IL3A 2A2RA 4HJ2A 1EEMA 1SD9A 2L57A 3F4SA 1K0OA 1UN2A 4ML1A 4G2EA 3CMIA 3RDWA 1BAYA 3EINA 4JR6A 2HRFA 5EVOA 5KEJA 1TW9A 5DJMA 2DMLA 1UVZA 1B9YC 3EU3A 1FB6A 1ILOA 4DVCA 2LQQA 2MBTA 3GUSA 5DJLA 2DIYA 4K7NA 3O3TA 2DIZA 1KEBA 2EIRA 2PGTA 3IE3A 1G6WA 2DLXA 3UARA 2F8AA 3IA1A 3ZVJD 3W8SA 3RPPA 3APOA 2V41A 2XBQA 5F06A 1OC3A 2V32A 1A2MA 4BPYA 2RLIA 5L71A 1MDIA 4KB3A 4FYUA 3M0FA 5A4VA 4E8EA 1FB0A 3VWVA 4OMVA 4AGSA 2HI7A 3GMFA 4Z7XA 5E4WA 3TKSC 4F03A 3KCMA 2C1YA 1T3BA 2K9FA 2C80A 2DBCA 3VLNA 3GKMA 1XXUA 1XFLA 3RAZA 5GSSA 3HYPA 3SWLA 2V1MA 1DE2A 4MP4A 1WPIA 2CZ2A 2KP1A 1ERVA 4V1Ag 5DBQA 1UA5A 4GTUA 1ZL9A 2VCWA 1T00A 3LYKA 4K0GA 4ECBA 1NSWA 4V2LA 5LD0A 2LUSA 3UIWA 5B8AA 1ZYQB 3RHCA 3PH9A 2MMOA 1JLVA 3U6VA 4MH3A 1S3CA 3FR3A 3LSZA 3L9VA 3VI5A 3TKSA 4OFNA 2GQLA 3BCIA 4HUAA 2GS3A 2HZEB 2MMAA 3GIXA 1TI1A 1FOVA 4KCEA 3I69A 5LNKe 1PRXA 1IYIA 4XS1A 3FZAA 3EVIA 3FYGA 1BQ7A 5IOXA 4PXOA 1GNWA 1S3AA 2H19A 2PWJA 1WIKA 4MPGA 5HQPA 1TKDB 2VLVA 2C0FA 3KXOA 2AJQB 3U5RE 3TOUA 2CA8A 2ES7A 2CX3A 3KD0A 3GN3A 3ME7A 1X0RA 4PX1A 4OWYA 4EUYA 5KN3A 4MF7A 4KDXA 2H6ZA 1JZOA 1Z6MA 3GYKA 4V2NA 1K0MA 4ZBAA 5GAPD 3GA4A 2IIYA 4F82A 1M7TA 2YZHA 2E7PA 3IAS2 3C1RA 2GT6A 4K6XA 5G5EA 5AIVA 3F4RA 3TJBA 1OE7A 4K0NA 3GH6A 4MDCA 1SYRA 5D9XA 3IDVA 3GKXA 1Z7PA 3N9JA 4G19A 2O87A 3HJOA 5G30A 3ZL5A 3ZITA 2B3SA 1GSUA 4ZXGA 2VLTA 4KH7A 4FIWA 1OKDA 1B9XC 1EZKA 3CSHA 2YJHA 2FNOA 3N5OA 2M80A 3CYNA 5G1KA 1TRWA 5CREA 3ZRDA 3C1SA 3KIJA 3KGKA 1PX7A 22GSA 1W89A 2R5GA 2H8LA 3GKKA 1MTCA 1PA3A 1U88A 2PVOC 4IQAA 4YAVA 3WGDA 2HE3A 3TDGA 2I81A 2H66A 3LEFA 1WMJA 4POBA 1X9WB 2X8HA 4WETA 3G7IA 1TK0B 2CAIA 2GSSA 2L6CA 1SD8A 3GV1A 5DDLA 5CRDA 2L4CA 3H8QA 3GHAA 5ECHB 2VD0A 4X1UA 4L0WA 2JSZA 3DYRA 1B48A 2YCDA 1PQNA 3F3RA
chains in the Genus database with same CATH superfamily
1R4WA 1Z9HA 2EIOA 4HEA2 3HY2A 1R7HA 2GZZA 1SU9A 2X8CA 3P8WA 4GSTA 4GQCA 2LTKA 4X0XA 3A2VA 3D6IA 3PINA 12GSA 2R0PA 1O8XA 4CY8A 3ZFBA 3KH9A 3VWXA 2H30A 4OFMA 3BBYA 5CNWA 1ZYEA 5GSTA 2N5AA 2P5RA 1K0NA 4POMA 2LRNA 3UBKA 4XHMA 3TCOA 3ZYWA 4KE3A 4BL7B 4GSNA 4FH8A 1TRSA 1JZRA 1EEJA 3FY7A 2IPAA 4WF4A 2P0GA 1YF1A 3EU4A 1RW1A 2YOIA 1SK1A 3F3QA 2FCHA 1YEXA 3NOFA 4IBPA 5H5QA 2BJXA 1XOBA 1Z3EA 5JCWA 5IPGA 1SKRB 4IVFA 5LCZA 4OD7A 4LMVA 1AQWA 2PMTA 3M9JA 4EIPA 1BG5A 5FHIA 3ZREA 4CHSA 4BL7A 2C0GA 3KJYA 3ZVJA 2PUKC 4IKHA 3DXBA 3ZTLA 1TJDA 3MIXA 6GSUA 2M72A 4ZL7A 1PKZA 4XCSA 2XC2A 3QFAC 4HS1A 2HRAA 3WD6A 4X43A 2FLSA 3G7YA 4PQHA 4TXOA 2QKEA 3KMNA 1K3LA 2I4AA 1Z7RA 1QFNA 4YAPA 2OKAA 2LNSA 3O6TA 2JZSA 5IMAA 1PSQA 2B1LA 5DQYA 2MMZA 3H93A 4MJEA 3NZNA 4MCUA 4XS4B 1Q4JA 5KN0A 4MF5A 1N8JA 4GWRA 4EC0A 5CO3A 1EWXA 1XWBA 3EYTA 3IPZA 4EKZA 3QPMA 2H1DA 1SL1B 2FHEA 5DALA 4QL7A 4POKA 1O81A 3VK9A 4OCEA 1E6BA 1YJ6A 4FQUA 4I2UA 3FZ4A 5F0GA 2VCQA 1ZMAA 1YEPA 3HVVA 4XS4A 4NAXA 2O7KA 1PN0A 4KDYA 5A5KA 4PGTA 5ECRB 1B8XA 1MD4A 2VL2C 2YJ7A 5IPHA 1EGRA 1WE0A 2GZYA 1H4OA 3IAM2 2WFCA 5F05A 1WRYA 4JZQA 3V1WA 1GRXA 4POLA 1V9WA 3H1NA 3FHKA 1O6JA 1YF0A 4QQ7A 3TUEA 1NHYA 5B6NA 2WS2A 3C71A 3AY8A 1R5AA 2REMA 4HQZA 1XCCA 2F9SA 5KOXA 4Q5QA 5DCGA 4GCIA 4K2XA 1ZZYA 4WR4A 1AAZA 3O76A 2WZ9A 4HU9A 1F3AA 2LRCA 2BTOT 5D9VA 3E9JB 3BCKA 4RQXA 3ZZXA 3HDCA 1URMA 1XWKA 4OCFA 5F07A 1AC1A 1M3JA 2R6KA 4DSSB 1TU7A 2WJUA 4BWQA 1SL0B 3LJRA 3LXZA 4K7OA 3LYPA 1JZWA 1GNEA 4ZBDA 4IQ1A 5KN2A 3TKRA 4K1FA 4GSSA 5IMZA 1AQVA 2IWTA 1U6TA 3FKFA 3GSSA 4NXIA 2NVLA 4DSRA 2OBIA 3US3A 2E2GA 2LS5A 2XPDA 2OJLA 2FUG2 4YKFA 2YV9A 2GDRA 4MNNA 4HDEA 3BJ5A 3GX8A 1GUKA 3F8UA 3CTGA 5C00A 4G0KA 4WEYA 2CVBA 2LSTA 1HNAA 2KHPA 2ON7A 4O5UA 4TOPA 2D2ZA 4MJAA 3GSTA 3CRUA 4GF0A 3FR6A 2DSAA 1OAZA 2CQ9A 3IHGA 1EOGA 2YN1A 1PD21 3D4TA 5JWOB 1DSBA 2IN3A 4EF0A 2GLRA 2R0CA 4RUVA 1EGOA 4IELA 1R5PA 5D8IA 2DC5A 3PGTA 1GL8A 1XG8A 3BOAA 4GLTA 4PTSA 4LMWA 2VL9A 4MMMA 2HYXA 1SYXA 2L4QA 5FWGA 1TXXA 1WOUA 5H5SA 3D22A 5B6MA 2VLUA 1BX9A 2OACA 1V40A 5CRWA 1QQ2A 1GP1A 3H79A 2L5OA 4CY6A 2RUEA 4O32A 5INYA 4V2MA 4TKYA 4XIHA 4G0IA 4WXTA 3TJJA 3UAPA 2NTOA 4NMUA 4O5RA 4F0BA 2NPBA 2VAFA 5D93A 5C04A 2CZ3A 5AN1A 2JU5A 3APSA 3GFKA 1YDKA 2VUPA 1SKSB 1ACVA 1EOHA 2X8GA 3KZQA 1A24A 3HVSA 3WT1A 5ECIB 4ZBBA 1YZXA 4MLYA 6GSSA 4KGIA 5A4WA 1EV4A 4K5SA 2WDUA 1K0DA 4MPFA 2B7KA 4MZBA 3L9UA 1ZYNA 2LJAA 4AJ7A 4MF6A 4MK3A 3EMPA 1EP8A 3GURA 4PNFA 4LA1A 3QFBC 4TR4A 1O85A 1GTBA 2HZFA 2EIQA 4ILFA 1HNBA 1G7OA 1U87A 3A5WA 3ZIVA 4ECIA 2AV4A 3KH7A 4KDUA 4L5OA 2DJ3A 5KN1A 1F3BA 3E3EA 3ZMLA 2HRNA 3I6AA 2DJJA 2IFQB 4ZILA 3C73A 4XRAA 1PMTA 5J9BA 4TN8A 1F6MC 2JSYA 13GSA 5G1LA 1M9AA 1GULA 3TKSE 1EP7A 1ON4A 5HR3A 4XTSA 4K9ZA 2H75A 2XHFA 5ABRA 1NW2A 5CP1A 5JWRB 1XBSA 5JWQB 4O7HA 1K3YA 2FA4A 2JADA 4KAEA 4NWYA 4ECJA 1M2BA 3KMOA 5AIXA 1DBYA 5FT3A 5KOWA 1PKWA 3GL5A 3H4KA 5IOWA 2IFQA 4J2FA 3LQ7A 1XWCA 1HNCA 2WCIA 4PUAA 2LRTA 2OE1A 4MZCA 1VF2A 3HJPA 2H70A 5ECPB 3A2XA 1MD3A 1ZOFA 4YQUA 1KTEA 3EE2A 1YY7A 5J9CA 5HR0A 3CRTA 2FWEA 4FO5A 2E0QA 1AQXA 2E2MA 5JCGA 4EVMA 4HI7A 4CW9A 1FW1A 3I9V2 5ECQB 3F6FA 3Q6OA 2JZRA 1V98A 3VPQA 1YQ1A 3CSIA 3E0UA 1TDIA 1J9BA 2H72A 3DKSA 3TJKA 4ZB6A 3QCPA 4JRRA 4K2DA 2H74A 3D4MA 3NIVA 1ZYPA 17GSA 2CVDA 10GSA 4GRFA 4HSCX 1QXHA 4TR3A 2N5BA 2ZNMA 2IJYA 2K6VA 3RPNA 3HVNA 2H71A 4NV5A 3F9UA 1HQOA 3QD9A 4ICYA 2H1GA 3ME8A 3D21A 4AF2A 1FO5A 3IK9A 1VF3A 4IHUA 1B4QA 2A4HA 4YKGA 1GWCA 4HZ2A 3HZ8A 3W6GA 2MZCA 1SJIA 4F9ZA 2C3TA 3IC8A 3UOMA 2FY6A 4WKWA 5HFIA 5CRHA 5J41A 4EDZA 2L6DA 3MAKA 3VI7A 1OKTA 1GUHA 5IO0A 2H6YA 3P90A 2IMDA 3K8NA 3OR5A 2O85A 2OA7A 5ECOB 2ALBA 4ZB8A 6GSVA 8GSSA 1OYJA 3F63A 1O8WA 1GSEA 4RQRA 1TI3A 3ERGA 1FG4A 2VM1A 1BJXA 4PQIA 3L9SA 4WBRD 4YQVA 2HSHA 1SL2B 2CV4A 2IMKA 4Z2TA 1THXA 1LJRA 1OE8A 6GSXA 3A5IA 1SK2A 4I2TA 3CSJA 4KX4A 3DIEA 2LKUA 4N0ZA 4NHWA 2NBSA 4TXOB 2I1UA 1MDKA 2YWOA 20GSA 4G10A 4DSQA 1JLWA 2I9HA 3ERWA 2CAQA 3QAGA 3TRQA 4ZB9A 1GH2A 2B1KA 5ECLB 4MH2A 2LNTA 3M8NA 5ID2B 3M9KA 2C3QA 2IMFA 2IMEA 3LG6A 4IS0A 4Q5NA 2QA1A 4OO4A 3VWWA 4BA7A 2AB6A 3GNJA 2HLSA 4IN0A 4NPBA 4AJ8A 4JR4A 5DALB 11GSA 1TRUA 2J9HA 3EPTA 3IR4A 1WWJA 2R2JA 3F4TA 4BVYA 4IP6A 6GSTA 2RM5A 1JFUA 5ID2A 1PN9A 3L4NA 4ACSA 3KTBA 2LV3A 2FA8A 3WT2A 2P5QA 2A4VA 3HZ4A 3ED3A 2DKHA 1LBKA 2DJ1A 5ECMB 18GSA 4K7IA 3TOTA 5IO2A 1SKWB 5ELAA 2X4AA 5HR1A 3HJMA 4HOJA 4MJCA 1VRSD 2YP6A 1FHEA 4NV2A 3FRCA 3IRAA 5AGYA 3QAVA 4KNDA 4MA9A 1K3OA 1W4VA 4G9HA 3FK8A 3L0HA 2YNXA 3FZ9A 16GSA 3DEXA 1XPVA 3DD3A 3GTUA 2VCVA 4K5RA 4PURA 2I3YA 4PQ1A 4LL1B 1XWGA 2YWNA 3F6DA 2VM2A 5DVBA 5D9WA 3S9FA 4N30A 4EO3A 1VF1A 2L59A 3J7Yk 4O5QA 3L78A 1USBA 4EL1A 2VL3A 2NDOA 2GSRA 4PUFC 1ST9A 3KTLA 1J0FA 2M46A 2F8FA 4QL9A 3LGCA 1TTZA 4OO5A 2AYTA 2H73A 4KA0A 5EL8A 3MSZA 4K8MA 2VL2A 3LFLA 5BRTA 4TR1A 1AUCA 3UEMA 5BMUA 4ZL8A 1JZDA 1T4ZA 1FAAA 1OC9B 2O8VB 2AHEA 1R26A 1WJKA 3CBUA 1JHBA 5B8BA 1PGTA 2RUFA 5DCHA 2GSTA 1S3DA 4J57E 2WRTA 3P7XA 4HU7A 1O73A 4KW6A 4KF9A 5D9TA 2H6XA 4IJIA 3UMAA 4YH2A 2C8UA 2PN8A 5EPFA 6GSWA 4KSOA 4LLRA 3LORA 2KOKA 1GSDA 3GL3A 3WYWA 1OC9A 2OADA 4RI6A 5IQYA 2KLXA 3EWLA 4H86A 3HCZA 3EMXA 3HA9A 4FYCA 3CXGA 2R0GA 5A4UA 1ZCPA 1A0FA 2C3NA 5GZZB 2FWHA 2L5LA 1BEDA 1U3IA 2YWIA 3MYDA 4GQFA 1TRVA 2GTUA 4OFTA 4JBBA 1QMVA 2K8VA 2C0EA 1XVQA 5ECNB 4F0CA 2MYGA 1T1VA 1XW6A 1LU4A 2CT6A 2K18A 2J23A 4WR5A 1I9DA 1K0BA 2P31A 3TJFA 5J4UA 1SJZA 1G7EA 2WGRA 1B4PA 4I5QA 2TIRA 4J56E 1EV9A 5IMFA 2B7JA 2OE0A 2GQMA 2G0FA 1GSSA 2B5EA 3M3MA 3DRNA 3ZIJA 2GVPA 1F9MA 2C0DA 3IHQA 2B5XA 3HD5A 4IJ3A 3WGXA 3HHVA 5G2ZA 1F37A 1Z6NA 4WBJA 2H0IA 2OBKA 2YANA 1UC7A 3RBTA 2HFDA 4JU5A 4ID0A 3ZFLA 3MNGA 3DVWA 1TU8A 2RIIA 1E2YA 2QSIA 2PU9C 5B7CA 4Q5RA 2TRXA 3TJGA 2XPEA 1ERUA 1A2JA 4O92A 3Q18A 1ABAA 4D73B 3IBHA 2VIMA 3TB2A 3JCML 1GLPA 1F2EA 3KP9A 5F8BA 1ERWA 1TK5B 4FYBA 5DQSA 2GSQA 3DMLA 1V58A 3Q19A 3P2AA 4ECCA 2CVKA 2FD3A 1O7UA 3GX0A 1XZOA 1K0CA 4IGJA 5AISA 2B6MA 5ECSA 3J7Yb 4D73A 3VWUA 1M2AA 2F3MA 1TK8B 19GSA 1K0AA 1ERTA 3CTFA 4GXZA 3LWAA 4TVEA 1T7PB 4BWSA 4Z2UA 1GSFA 2HZEA 1HD2A 4N10A 5CYYA 2MMNA 3QOUA 1Q98A 2YZUA 1V57A 2FGXA 3ZLPA 1OVNA 5IMVA 1NHOA 3FR9A 1BYEA 4EE0A 1QGVA 2VOCA 3UVHA 2YWMA 3VPTA 3TKQA 2CX4A 4I97A 5ECKB 1IYHA 4X4JA 3TRXA 5EY6A 1OC8A 2PPTA 2TRCP 2H1BA 2IMIA 3GKNA 2JL4A 2OE3A 1TP9A 3MWHA 1KBNA 1XOAA 1GUMA 3QDNA 2HXKA 1XIYA 3TKPA 4BVXB 4N0VA 2QA2A 3R2QA 3TRPA 1ZGNA 4ML6A 1DE1A 1SENA 3C7MA 5J3RA 4L8EA 4RI7A 1XW9A 3FMWA 2WB9A 2VD1A 4I6XA 1G0TA 3G7JA 1S3RA 2G2QA 1GTUA 5IM9A 2H0HA 4L0UA 4CDOA 5IIZA 1T8EB 1MEKA 4ISDA 3EC3A 4TW5A 4AJ6A 2GT5A 3KP8A 2DJ0A 4TR0A 4BVXA 2DJKA 5HR2A 5HFKA 3FZ5A 2B5YA 1I5GA 5HFGA 2N5FA 1XVWA 1QUWA 3TGZA 4A5PA 1V2AA 2X64A 2LJKA 1A23A 1WP0A 3UVTA 2LJRA 2DJ2A 2R37A 3I43A 3DGQA 3IV4A 3BD2A 5DAKB 1GSYA 2V6KA 2V6OA 2VCTA 4XRDA 2Z9SA 4NHZA 2PBJA 1GLQA 3IOSA 2VCXA 3C8EA 3GH9A 3CQFA 3Q74A 1DUGA 3QMXA 7GSSA 9GSSA 2BMXA 1A8LA 3ERFA 3UBLA 1VF4A 3FEUA 1Z5YE 5IMCA 2VCZA 4ULXA 2XBIA 1HYUA 1GSQA 5DAKA 3LXTA 2R4VA 2ZUPA 2H01A 2HSYA 5GAND 3GRXA 2K8SA 4HQSA 3KM6A 2WULA 1N2AA 2H1AA 4KSMA 1MDJA 1Y25A 2V2GA 3EURA 1AXDA 5IMDA 1X5CA 1J08A 1M9BA 1GTIA 4I8BA 3APQA 1M3IA 1AIUA 4BVYB 4MZWA 2QC7A 2QGVA 4N11A 2MBSA 3R3EA 5D73A 1CQHA 3IK7A 2AAWA 4ZIJA 2HT9A 1THOA 3RHBA 5CRGA 5JCUA 1A8YA 3A3TA 4TXVA 1Y6EA 3DWVA 2LQOA 1CQGA 2H0GA 2GGTA 3G9BA 4F2IA 1PL2A 3ISOA 2X99A 1G6YA 1VGLA 1A0RP 1XWAA 4G0LA 1X9MB 1XW5A 2O89A 3HKRA 1X5DA 1X5EA 3VURA 1U3AA 2JACA 3KEBA 2KUCA 1A2LA 1X9SB 2KP2A 3GTUB 5H5RA 4DEJA 5E59A 2C4JA 3WGEA 3F0IA 2F51A 3UJ1A 4MJBA 5D96A 2GZPA 5ENUA 5ELGA 2ZCTA 4LL4B 1PL1A 1YKCA 1FVJA 2DKIA 3PR8A 4WF5A 2YV7A 2HRKA 4IW9A 3D5JA 4KCAA 4V1Ap 5G5FA 1TOFA 5G31A 2ON5A 3FW2A 1RK4A 4XS6A 1T4YA 1SK0A 1M99A 1PFOA 1SJ6A 3IC4A 3UL3A 4TR1B 4ZL9A 2FWFA 4KUNA 1C72A 1YKAA 3HXSA 2PERA 1GTAA 2PVQA 2VO4A 3W8JA 3DVXA 1AW9A 4P3YB 2FWGA 5COHA 3A2WA 1H75A 4TRXA 1PX6A 2LEGA 4HJMA 4EDYA 4EXJA 1M2DA 2DMMA 2H76A 2EC4A 3MDKA 1ML6A 4L5LA 6GSYA 2RM6A 1QK8A 4MABA 2R3XA 3QR6A 1KNGA 2GQKA 2YPMA 3SBCA 2UZ8A 3PPUA 2A2SA 4JEDA 2AUVA 1M0UA 4EIQA 3D0ZA 3HVXA 1RQMA 3IXRA 4E8HA 2JZTA 4JE1A 1NM3A 5J5NA 5CAXA 14GSA 4YQMA 1FVKA 3VFIA 3QAWA 4Q5FA 3M1GA 4PNGA 4HZ4A 4IP1A 2HNLA 4DSSA 3ZMKA 2IL3A 2A2RA 4HJ2A 1EEMA 1SD9A 2L57A 3F4SA 1K0OA 1UN2A 4ML1A 4G2EA 3CMIA 3RDWA 1BAYA 3EINA 4JR6A 2HRFA 5EVOA 5KEJA 1TW9A 5DJMA 2DMLA 1UVZA 1B9YC 3EU3A 1FB6A 1ILOA 4DVCA 2LQQA 2MBTA 3GUSA 5DJLA 2DIYA 4K7NA 3O3TA 2DIZA 1KEBA 2EIRA 2PGTA 3IE3A 1G6WA 2DLXA 3UARA 2F8AA 3IA1A 3ZVJD 3W8SA 3RPPA 3APOA 2V41A 2XBQA 5F06A 1OC3A 2V32A 1A2MA 4BPYA 2RLIA 5L71A 1MDIA 4KB3A 4FYUA 3M0FA 5A4VA 1FOHA 3LW9A 4E8EA 1FB0A 3VWVA 4OMVA 4AGSA 2HI7A 3GMFA 2A2PA 4Z7XA 5E4WA 2HSMA 3TKSC 4F03A 3KCMA 2C1YA 1T3BA 2K9FA 2C80A 2DBCA 3VLNA 3GKMA 1XXUA 1XFLA 3RAZA 5GSSA 3HYPA 3SWLA 2V1MA 1DE2A 4MP4A 1WPIA 2CZ2A 2KP1A 1ERVA 4V1Ag 5DBQA 1UA5A 4GTUA 1ZL9A 2VCWA 1T00A 3LYKA 4K0GA 4ECBA 1NSWA 4V2LA 5LD0A 2LUSA 3UIWA 5B8AA 1ZYQB 3RHCA 3PH9A 2MMOA 1JLVA 3U6VA 4MH3A 1S3CA 3FR3A 3LSZA 3L9VA 3VI5A 3TKSA 4OFNA 2GQLA 3BCIA 4HUAA 2GS3A 2HZEB 2MMAA 3GIXA 1TI1A 1FOVA 4KCEA 3I69A 5LNKe 1PRXA 1IYIA 4XS1A 3FZAA 3EVIA 3FYGA 1BQ7A 5IOXA 4PXOA 1GNWA 1S3AA 2H19A 2PWJA 1WIKA 4MPGA 5HQPA 1TKDB 2VLVA 2C0FA 3KXOA 2AJQB 3U5RE 3TOUA 2CA8A 2ES7A 2CX3A 3KD0A 3GN3A 3ME7A 1X0RA 4PX1A 4OWYA 4EUYA 5KN3A 4MF7A 4KDXA 2H6ZA 1JZOA 1Z6MA 3GYKA 4V2NA 1K0MA 4ZBAA 2X49A 5GAPD 3GA4A 2IIYA 4F82A 1M7TA 2YZHA 2E7PA 3IAS2 3C1RA 2GT6A 4BIKA 4K6XA 5G5EA 5AIVA 3F4RA 3TJBA 1OE7A 4K0NA 3GH6A 4MDCA 1SYRA 5D9XA 3IDVA 3GKXA 1Z7PA 3N9JA 4G19A 2O87A 3HJOA 5G30A 3ZL5A 3ZITA 2B3SA 1GSUA 4ZXGA 2VLTA 4KH7A 4FIWA 1OKDA 1B9XC 1EZKA 3CSHA 2YJHA 2FNOA 3N5OA 2M80A 3CYNA 5G1KA 1TRWA 5CREA 3ZRDA 3C1SA 3KIJA 3KGKA 1PX7A 22GSA 1W89A 2R5GA 2H8LA 3GKKA 1MTCA 1PA3A 1U88A 2PVOC 4IQAA 4Z2RA 4YAVA 3WGDA 2HE3A 3TDGA 2I81A 2H66A 3LEFA 1WMJA 4POBA 4USSA 1X9WB 2X8HA 4WETA 3G7IA 1TK0B 2CAIA 2GSSA 2L6CA 1SD8A 3GV1A 5DDLA 5CRDA 2L4CA 3H8QA 3GHAA 5ECHB 2VD0A 4X1UA 4L0WA 2JSZA 3DYRA 1B48A 2YCDA 1PQNA 3F3RA
chains in the Genus database with same CATH topology
1R4WA 1Z9HA 2EIOA 4HEA2 3HY2A 1R7HA 2GZZA 1SU9A 2X8CA 3P8WA 4GSTA 4GQCA 2LTKA 4X0XA 3A2VA 3D6IA 3PINA 12GSA 2R0PA 1O8XA 4CY8A 3ZFBA 3KH9A 3VWXA 2H30A 4OFMA 3BBYA 5CNWA 1ZYEA 5GSTA 2N5AA 2P5RA 1K0NA 4POMA 2LRNA 3UBKA 4XHMA 3TCOA 3ZYWA 4KE3A 4BL7B 4GSNA 4FH8A 1TRSA 1JZRA 1EEJA 3FY7A 2IPAA 4WF4A 2P0GA 1YF1A 3EU4A 1RW1A 2YOIA 1SK1A 3F3QA 2FCHA 1YEXA 3NOFA 4IBPA 5H5QA 2BJXA 1XOBA 1Z3EA 5JCWA 5IPGA 1SKRB 4IVFA 5LCZA 4OD7A 4LMVA 1AQWA 2PMTA 3M9JA 4EIPA 1BG5A 5FHIA 3ZREA 4CHSA 4BL7A 2C0GA 3KJYA 3ZVJA 2PUKC 4IKHA 3DXBA 3ZTLA 1TJDA 3MIXA 6GSUA 2M72A 4ZL7A 1PKZA 4XCSA 2XC2A 3QFAC 4HS1A 2HRAA 3WD6A 4X43A 2FLSA 3G7YA 4PQHA 4TXOA 2QKEA 3KMNA 1K3LA 2I4AA 1Z7RA 1QFNA 4YAPA 2OKAA 2LNSA 3O6TA 2JZSA 5IMAA 1PSQA 2B1LA 5DQYA 2MMZA 3H93A 4MJEA 3NZNA 4MCUA 4XS4B 1Q4JA 5KN0A 4MF5A 1N8JA 4GWRA 4EC0A 5CO3A 1EWXA 1XWBA 3EYTA 3IPZA 4EKZA 3QPMA 2H1DA 1SL1B 2FHEA 5DALA 4QL7A 4POKA 1O81A 3VK9A 4OCEA 1E6BA 1YJ6A 4FQUA 4I2UA 3FZ4A 5F0GA 2VCQA 1ZMAA 1YEPA 3HVVA 4XS4A 4NAXA 2O7KA 1PN0A 4KDYA 5A5KA 4PGTA 5ECRB 1B8XA 1MD4A 2VL2C 2YJ7A 5IPHA 1EGRA 1WE0A 2GZYA 1H4OA 3IAM2 2WFCA 5F05A 1WRYA 4JZQA 3V1WA 1GRXA 4POLA 1V9WA 3H1NA 3FHKA 1O6JA 1YF0A 4QQ7A 3TUEA 1NHYA 5B6NA 2WS2A 3C71A 3AY8A 1R5AA 2REMA 4HQZA 1XCCA 2F9SA 5KOXA 4Q5QA 5DCGA 4GCIA 4K2XA 1ZZYA 4WR4A 1AAZA 3O76A 2WZ9A 4HU9A 1F3AA 2LRCA 2BTOT 5D9VA 3E9JB 3BCKA 4RQXA 3ZZXA 3HDCA 1URMA 1XWKA 4OCFA 5F07A 1AC1A 2R6KA 4DSSB 1TU7A 2WJUA 4BWQA 1SL0B 3LJRA 3LXZA 4K7OA 3LYPA 1JZWA 1GNEA 4ZBDA 4IQ1A 5KN2A 3TKRA 4K1FA 4GSSA 5IMZA 1AQVA 2IWTA 1U6TA 3FKFA 3GSSA 4NXIA 2NVLA 4DSRA 2OBIA 3US3A 2E2GA 2LS5A 2XPDA 2OJLA 2FUG2 4YKFA 2YV9A 2GDRA 4MNNA 4HDEA 3BJ5A 3GX8A 1GUKA 3F8UA 3CTGA 5C00A 4G0KA 4WEYA 2CVBA 2LSTA 1HNAA 2KHPA 2ON7A 4O5UA 4TOPA 2D2ZA 4MJAA 3GSTA 3CRUA 4GF0A 3FR6A 2DSAA 1OAZA 2CQ9A 3IHGA 1EOGA 2YN1A 1PD21 3D4TA 5JWOB 1DSBA 2IN3A 4EF0A 2GLRA 2R0CA 4RUVA 1EGOA 4IELA 1R5PA 5D8IA 2DC5A 3PGTA 1GL8A 3BOAA 4GLTA 4PTSA 4LMWA 2VL9A 4MMMA 2HYXA 1SYXA 2L4QA 5FWGA 1TXXA 1WOUA 5H5SA 3D22A 5B6MA 2VLUA 1BX9A 2OACA 1V40A 5CRWA 1QQ2A 1GP1A 3H79A 2L5OA 4CY6A 2RUEA 4O32A 5INYA 4V2MA 4TKYA 4XIHA 4G0IA 4WXTA 3TJJA 3UAPA 2NTOA 4NMUA 4O5RA 4F0BA 2NPBA 2VAFA 5D93A 5C04A 2CZ3A 5AN1A 2JU5A 3APSA 3GFKA 1YDKA 2VUPA 1SKSB 1ACVA 1EOHA 2X8GA 3KZQA 1A24A 3HVSA 3WT1A 5ECIB 4ZBBA 1YZXA 4MLYA 6GSSA 4KGIA 5A4WA 1EV4A 4K5SA 2WDUA 1K0DA 4MPFA 2B7KA 4MZBA 3L9UA 1ZYNA 2LJAA 4AJ7A 4MF6A 4MK3A 3EMPA 1EP8A 3GURA 4PNFA 4LA1A 3QFBC 4TR4A 1O85A 1GTBA 2HZFA 2EIQA 4ILFA 1HNBA 1G7OA 1U87A 3A5WA 3ZIVA 4ECIA 2AV4A 3KH7A 4KDUA 4L5OA 2DJ3A 5KN1A 1F3BA 3E3EA 3ZMLA 2HRNA 3I6AA 2DJJA 2IFQB 4ZILA 3C73A 4XRAA 1PMTA 5J9BA 4TN8A 1F6MC 2JSYA 13GSA 5G1LA 1M9AA 1GULA 3TKSE 1EP7A 1ON4A 5HR3A 4XTSA 4K9ZA 2H75A 2XHFA 5ABRA 1NW2A 5CP1A 5JWRB 1XBSA 5JWQB 4O7HA 1K3YA 2FA4A 2JADA 4KAEA 4NWYA 4ECJA 1M2BA 3KMOA 5AIXA 1DBYA 5FT3A 5KOWA 1PKWA 3GL5A 3H4KA 5IOWA 2IFQA 4J2FA 3LQ7A 1XWCA 1HNCA 2WCIA 4PUAA 2LRTA 2OE1A 4MZCA 1VF2A 3HJPA 2H70A 5ECPB 3A2XA 1MD3A 1ZOFA 4YQUA 1KTEA 3EE2A 1YY7A 5J9CA 5HR0A 3CRTA 2FWEA 4FO5A 2E0QA 1AQXA 2E2MA 5JCGA 4EVMA 4HI7A 4CW9A 1FW1A 3I9V2 5ECQB 3F6FA 3Q6OA 2JZRA 1V98A 3VPQA 1YQ1A 3CSIA 3E0UA 1TDIA 1J9BA 2H72A 3DKSA 3TJKA 4ZB6A 3QCPA 4JRRA 4K2DA 2H74A 3D4MA 3NIVA 1ZYPA 17GSA 2CVDA 10GSA 4GRFA 1QXHA 4TR3A 2N5BA 2ZNMA 2IJYA 2K6VA 3RPNA 2H71A 4NV5A 3F9UA 1HQOA 3QD9A 4ICYA 2H1GA 3ME8A 3D21A 4AF2A 1FO5A 3IK9A 1VF3A 4IHUA 1B4QA 2A4HA 4YKGA 1GWCA 4HZ2A 3HZ8A 3W6GA 2MZCA 1SJIA 4F9ZA 2C3TA 3IC8A 3UOMA 2FY6A 4WKWA 5HFIA 5CRHA 5J41A 4EDZA 2L6DA 3MAKA 3VI7A 1OKTA 1GUHA 5IO0A 2H6YA 3P90A 2IMDA 3K8NA 3OR5A 2O85A 2OA7A 5ECOB 2ALBA 4ZB8A 6GSVA 8GSSA 1OYJA 3F63A 1O8WA 1GSEA 4RQRA 1TI3A 3ERGA 1FG4A 2VM1A 1BJXA 4PQIA 3L9SA 4WBRD 4YQVA 2HSHA 1SL2B 2CV4A 2IMKA 4Z2TA 1THXA 1LJRA 1OE8A 6GSXA 3A5IA 1SK2A 4I2TA 3CSJA 4KX4A 3DIEA 2LKUA 4N0ZA 4NHWA 2NBSA 4TXOB 2I1UA 1MDKA 2YWOA 20GSA 4G10A 4DSQA 1JLWA 2I9HA 3ERWA 2CAQA 3QAGA 3TRQA 4ZB9A 1GH2A 2B1KA 5ECLB 4MH2A 2LNTA 3M8NA 5ID2B 3M9KA 2C3QA 2IMFA 2IMEA 3LG6A 4IS0A 4Q5NA 2QA1A 4OO4A 3VWWA 4BA7A 2AB6A 3GNJA 2HLSA 4IN0A 4NPBA 4AJ8A 4JR4A 5DALB 11GSA 1TRUA 2J9HA 3EPTA 3IR4A 1WWJA 2R2JA 3F4TA 4BVYA 4IP6A 6GSTA 2RM5A 1JFUA 5ID2A 1PN9A 3L4NA 4ACSA 3KTBA 2LV3A 2FA8A 3WT2A 2P5QA 2A4VA 3HZ4A 3ED3A 2DKHA 1LBKA 2DJ1A 5ECMB 18GSA 4K7IA 3TOTA 5IO2A 1SKWB 5ELAA 2X4AA 5HR1A 3HJMA 4HOJA 4MJCA 1VRSD 2YP6A 1FHEA 4NV2A 3FRCA 3IRAA 5AGYA 3QAVA 4KNDA 4MA9A 1K3OA 1W4VA 4G9HA 3FK8A 3L0HA 2YNXA 3FZ9A 16GSA 3DEXA 1XPVA 3DD3A 3GTUA 2VCVA 4K5RA 4PURA 2I3YA 4PQ1A 4LL1B 1XWGA 2YWNA 3F6DA 2VM2A 5DVBA 5D9WA 3S9FA 4N30A 4EO3A 1VF1A 2L59A 3J7Yk 4O5QA 3L78A 1USBA 4EL1A 2VL3A 2NDOA 2GSRA 4PUFC 1ST9A 3KTLA 1J0FA 2M46A 2F8FA 4QL9A 3LGCA 1TTZA 4OO5A 2AYTA 2H73A 4KA0A 5EL8A 3MSZA 4K8MA 2VL2A 3LFLA 5BRTA 4TR1A 1AUCA 3UEMA 5BMUA 4ZL8A 1JZDA 1T4ZA 1FAAA 1OC9B 2O8VB 2AHEA 1R26A 1WJKA 3CBUA 1JHBA 5B8BA 1PGTA 2RUFA 5DCHA 2GSTA 1S3DA 4J57E 2WRTA 3P7XA 4HU7A 1O73A 4KW6A 4KF9A 5D9TA 2H6XA 4IJIA 3UMAA 4YH2A 2C8UA 2PN8A 5EPFA 6GSWA 4KSOA 4LLRA 3LORA 2KOKA 1GSDA 3GL3A 3WYWA 1OC9A 2OADA 4RI6A 5IQYA 2KLXA 3EWLA 4H86A 3HCZA 3EMXA 3HA9A 4FYCA 3CXGA 2R0GA 5A4UA 1ZCPA 1A0FA 2C3NA 5GZZB 2FWHA 2L5LA 1BEDA 1U3IA 2YWIA 3MYDA 4GQFA 1TRVA 2GTUA 4OFTA 4JBBA 1QMVA 2K8VA 2C0EA 1XVQA 5ECNB 4F0CA 2MYGA 1T1VA 1XW6A 1LU4A 2CT6A 2K18A 2J23A 4WR5A 1I9DA 1K0BA 2P31A 3TJFA 5J4UA 1SJZA 1G7EA 2WGRA 1B4PA 4I5QA 2TIRA 4J56E 1EV9A 5IMFA 2B7JA 2OE0A 2GQMA 2G0FA 1GSSA 2B5EA 3M3MA 3DRNA 3ZIJA 2GVPA 1F9MA 2C0DA 3IHQA 2B5XA 3HD5A 4IJ3A 3WGXA 3HHVA 5G2ZA 1F37A 1Z6NA 4WBJA 2H0IA 2OBKA 2YANA 1UC7A 3RBTA 2HFDA 4JU5A 4ID0A 3ZFLA 3MNGA 3DVWA 1TU8A 2RIIA 1E2YA 2QSIA 2PU9C 5B7CA 4Q5RA 2TRXA 3TJGA 2XPEA 1ERUA 1A2JA 4O92A 3Q18A 1ABAA 4D73B 3IBHA 2VIMA 3TB2A 3JCML 1GLPA 1F2EA 3KP9A 5F8BA 1ERWA 1TK5B 4FYBA 5DQSA 2GSQA 3DMLA 1V58A 3Q19A 3P2AA 4ECCA 2CVKA 2FD3A 1O7UA 3GX0A 1XZOA 1K0CA 4IGJA 5AISA 2B6MA 5ECSA 3J7Yb 4D73A 3VWUA 1M2AA 2F3MA 1TK8B 19GSA 1K0AA 1ERTA 3CTFA 4GXZA 3LWAA 4TVEA 1T7PB 4BWSA 4Z2UA 1GSFA 2HZEA 1HD2A 4N10A 5CYYA 2MMNA 3QOUA 1Q98A 2YZUA 1V57A 2FGXA 3ZLPA 1OVNA 5IMVA 1NHOA 3FR9A 1BYEA 4EE0A 1QGVA 2VOCA 3UVHA 2YWMA 3VPTA 3TKQA 2CX4A 4I97A 5ECKB 1IYHA 4X4JA 3TRXA 5EY6A 1OC8A 2PPTA 2TRCP 2H1BA 2IMIA 3GKNA 2JL4A 2OE3A 1TP9A 3MWHA 1KBNA 1XOAA 1GUMA 3QDNA 2HXKA 1XIYA 3TKPA 4BVXB 4N0VA 2QA2A 3R2QA 3TRPA 1ZGNA 4ML6A 1DE1A 1SENA 3C7MA 5J3RA 4L8EA 4RI7A 1XW9A 3FMWA 2WB9A 2VD1A 4I6XA 1G0TA 3G7JA 2G2QA 1GTUA 5IM9A 2H0HA 4L0UA 4CDOA 5IIZA 1T8EB 1MEKA 4ISDA 3EC3A 4TW5A 4AJ6A 2GT5A 3KP8A 2DJ0A 4TR0A 4BVXA 2DJKA 5HR2A 5HFKA 3FZ5A 2B5YA 1I5GA 5HFGA 2N5FA 1XVWA 1QUWA 3TGZA 4A5PA 1V2AA 2X64A 2LJKA 1A23A 1WP0A 3UVTA 2LJRA 2DJ2A 2R37A 3I43A 3DGQA 3IV4A 3BD2A 5DAKB 1GSYA 2V6KA 2V6OA 2VCTA 4XRDA 2Z9SA 4NHZA 2PBJA 1GLQA 3IOSA 2VCXA 3C8EA 3GH9A 3Q74A 1DUGA 3QMXA 7GSSA 9GSSA 2BMXA 1A8LA 3ERFA 3UBLA 1VF4A 3FEUA 1Z5YE 5IMCA 2VCZA 4ULXA 2XBIA 1HYUA 1GSQA 5DAKA 3LXTA 2R4VA 2ZUPA 2H01A 2HSYA 5GAND 3GRXA 2K8SA 4HQSA 3KM6A 2WULA 1N2AA 2H1AA 4KSMA 1MDJA 1Y25A 2V2GA 3EURA 1AXDA 5IMDA 1X5CA 1J08A 1M9BA 1GTIA 4I8BA 3APQA 1AIUA 4BVYB 4MZWA 2QC7A 2QGVA 4N11A 2MBSA 3R3EA 5D73A 1CQHA 3IK7A 2AAWA 4ZIJA 2HT9A 1THOA 3RHBA 5CRGA 5JCUA 1A8YA 3A3TA 4TXVA 1Y6EA 3DWVA 2LQOA 1CQGA 2H0GA 2GGTA 3G9BA 4F2IA 1PL2A 3ISOA 2X99A 1G6YA 1VGLA 1A0RP 1XWAA 4G0LA 1X9MB 1XW5A 2O89A 3HKRA 1X5DA 1X5EA 3VURA 1U3AA 2JACA 3KEBA 2KUCA 1A2LA 1X9SB 2KP2A 3GTUB 5H5RA 4DEJA 5E59A 2C4JA 3WGEA 3F0IA 2F51A 3UJ1A 4MJBA 5D96A 2GZPA 5ENUA 5ELGA 2ZCTA 4LL4B 1PL1A 1YKCA 1FVJA 2DKIA 3PR8A 4WF5A 2YV7A 2HRKA 4IW9A 3D5JA 4KCAA 4V1Ap 5G5FA 1TOFA 5G31A 2ON5A 3FW2A 1RK4A 4XS6A 1T4YA 1SK0A 1M99A 1SJ6A 3IC4A 3UL3A 4TR1B 4ZL9A 2FWFA 4KUNA 1C72A 1YKAA 3HXSA 2PERA 1GTAA 2PVQA 2VO4A 3W8JA 3DVXA 1AW9A 4P3YB 2FWGA 5COHA 3A2WA 1H75A 4TRXA 1PX6A 2LEGA 4HJMA 4EDYA 4EXJA 1M2DA 2DMMA 2H76A 2EC4A 3MDKA 1ML6A 4L5LA 6GSYA 2RM6A 1QK8A 4MABA 2R3XA 3QR6A 1KNGA 2GQKA 2YPMA 3SBCA 2UZ8A 3PPUA 2A2SA 4JEDA 2AUVA 1M0UA 4EIQA 3D0ZA 3HVXA 1RQMA 3IXRA 4E8HA 2JZTA 4JE1A 1NM3A 5J5NA 5CAXA 14GSA 4YQMA 1FVKA 3VFIA 3QAWA 4Q5FA 3M1GA 4PNGA 4HZ4A 4IP1A 2HNLA 4DSSA 3ZMKA 2IL3A 2A2RA 4HJ2A 1EEMA 1SD9A 2L57A 3F4SA 1K0OA 1UN2A 4ML1A 4G2EA 3CMIA 3RDWA 1BAYA 3EINA 4JR6A 2HRFA 5EVOA 5KEJA 1TW9A 5DJMA 2DMLA 1UVZA 1B9YC 3EU3A 1FB6A 1ILOA 4DVCA 2LQQA 2MBTA 3GUSA 5DJLA 2DIYA 4K7NA 3O3TA 2DIZA 1KEBA 2EIRA 2PGTA 3IE3A 1G6WA 2DLXA 3UARA 2F8AA 3IA1A 3ZVJD 3W8SA 3RPPA 3APOA 2V41A 2XBQA 5F06A 1OC3A 2V32A 1A2MA 4BPYA 2RLIA 5L71A 1MDIA 4KB3A 4FYUA 3M0FA 5A4VA 1FOHA 3LW9A 4E8EA 1FB0A 3VWVA 4OMVA 4AGSA 2HI7A 3GMFA 2A2PA 4Z7XA 5E4WA 2HSMA 3TKSC 4F03A 3KCMA 2C1YA 1T3BA 2K9FA 2C80A 2DBCA 3VLNA 3GKMA 1XXUA 1XFLA 3RAZA 5GSSA 3HYPA 3SWLA 2V1MA 1DE2A 4MP4A 1WPIA 2CZ2A 2KP1A 1ERVA 4V1Ag 5DBQA 1UA5A 4GTUA 1ZL9A 2VCWA 1T00A 3LYKA 4K0GA 4ECBA 1NSWA 4V2LA 5LD0A 2LUSA 3UIWA 5B8AA 1ZYQB 3RHCA 3PH9A 2MMOA 1JLVA 3U6VA 4MH3A 1S3CA 3FR3A 3LSZA 3L9VA 3VI5A 3TKSA 4OFNA 2GQLA 3BCIA 4HUAA 2GS3A 2HZEB 2MMAA 3GIXA 1TI1A 1FOVA 4KCEA 3I69A 5LNKe 1PRXA 1IYIA 4XS1A 3FZAA 3EVIA 3FYGA 1BQ7A 5IOXA 4PXOA 1GNWA 1S3AA 2H19A 2PWJA 1WIKA 4MPGA 5HQPA 1TKDB 2VLVA 2C0FA 3KXOA 2AJQB 3U5RE 3TOUA 2CA8A 2ES7A 2CX3A 3KD0A 3GN3A 3ME7A 1X0RA 4PX1A 4OWYA 4EUYA 5KN3A 4MF7A 4KDXA 2H6ZA 1JZOA 1Z6MA 3GYKA 4V2NA 1K0MA 4ZBAA 2X49A 5GAPD 3GA4A 2IIYA 4F82A 1M7TA 2YZHA 2E7PA 3IAS2 3C1RA 2GT6A 4K6XA 5G5EA 5AIVA 3F4RA 3TJBA 1OE7A 4K0NA 3GH6A 4MDCA 1SYRA 5D9XA 3IDVA 3GKXA 1Z7PA 3N9JA 4G19A 2O87A 3HJOA 5G30A 3ZL5A 3ZITA 2B3SA 1GSUA 4ZXGA 2VLTA 4KH7A 4FIWA 1OKDA 1B9XC 1EZKA 3CSHA 2YJHA 2FNOA 3N5OA 2M80A 3CYNA 5G1KA 1TRWA 5CREA 3ZRDA 3C1SA 3KIJA 3KGKA 1PX7A 22GSA 1W89A 2R5GA 2H8LA 3GKKA 1MTCA 1PA3A 1U88A 2PVOC 4IQAA 4Z2RA 4YAVA 3WGDA 2HE3A 3TDGA 2I81A 2H66A 3LEFA 1WMJA 4POBA 4USSA 1X9WB 2X8HA 4WETA 3G7IA 1TK0B 2CAIA 2GSSA 2L6CA 1SD8A 3GV1A 5DDLA 5CRDA 2L4CA 3H8QA 3GHAA 5ECHB 2VD0A 4X1UA 4L0WA 2JSZA 3DYRA 1B48A 2YCDA 1PQNA 3F3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4W A;  1Z9H A;  2EIO A;  4HEA 2;  3HY2 A;  1R7H A;  2GZZ A;  1SU9 A;  2X8C A;  3P8W A;  4GST A;  4GQC A;  2LTK A;  4X0X A;  3A2V A;  3D6I A;  3PIN A;  12GS A;  1O8X A;  3ZFB A;  3KH9 A;  3VWX A;  2H30 A;  4OFM A;  3BBY A;  5CNW A;  1ZYE A;  5GST A;  2N5A A;  2P5R A;  1K0N A;  4POM A;  2LRN A;  3UBK A;  4XHM A;  3TCO A;  3ZYW A;  4KE3 A;  4GSN A;  4FH8 A;  1TRS A;  1JZR A;  1EEJ A;  3FY7 A;  2IPA A;  4WF4 A;  2P0G A;  1YF1 A;  3EU4 A;  1RW1 A;  2YOI A;  1SK1 A;  3F3Q A;  2FCH A;  1YEX A;  3NOF A;  4IBP A;  5H5Q A;  2BJX A;  1XOB A;  1Z3E A;  5JCW A;  5IPG A;  1SKR B;  4IVF A;  5LCZ A;  4OD7 A;  4LMV A;  1AQW A;  2PMT A;  3M9J A;  1BG5 A;  5FHI A;  3ZRE A;  4CHS A;  4BL7 A;  2C0G A;  3KJY A;  3ZVJ A;  2PUK C;  4IKH A;  3DXB A;  3ZTL A;  1TJD A;  6GSU A;  2M72 A;  4ZL7 A;  1PKZ A;  4XCS A;  2XC2 A;  3QFA C;  4HS1 A;  3WD6 A;  4X43 A;  2FLS A;  3G7Y A;  4PQH A;  4TXO A;  2QKE A;  3KMN A;  1K3L A;  2I4A A;  1Z7R A;  1QFN A;  4YAP A;  2OKA A;  2LNS A;  3O6T A;  2JZS A;  5IMA A;  1PSQ A;  2B1L A;  5DQY A;  2MMZ A;  3H93 A;  4MJE A;  3NZN A;  4MCU A;  4XS4 B;  1Q4J A;  5KN0 A;  4MF5 A;  1N8J A;  4GWR A;  4EC0 A;  5CO3 A;  1EWX A;  1XWB A;  3EYT A;  3IPZ A;  4EKZ A;  3QPM A;  2H1D A;  1SL1 B;  2FHE A;  5DAL A;  4QL7 A;  4POK A;  1O81 A;  3VK9 A;  4OCE A;  1E6B A;  1YJ6 A;  4I2U A;  3FZ4 A;  5F0G A;  2VCQ A;  1ZMA A;  1YEP A;  3HVV A;  4XS4 A;  4NAX A;  2O7K A;  4KDY A;  5A5K A;  4PGT A;  5ECR B;  1B8X A;  1MD4 A;  2VL2 C;  2YJ7 A;  5IPH A;  1EGR A;  1WE0 A;  2GZY A;  1H4O A;  3IAM 2;  2WFC A;  5F05 A;  1WRY A;  4JZQ A;  3V1W A;  1GRX A;  4POL A;  1V9W A;  3H1N A;  3FHK A;  1O6J A;  1YF0 A;  4QQ7 A;  3TUE A;  1NHY A;  5B6N A;  2WS2 A;  3C71 A;  3AY8 A;  1R5A A;  2REM A;  4HQZ A;  1XCC A;  2F9S A;  4Q5Q A;  5DCG A;  4GCI A;  1ZZY A;  4WR4 A;  1AAZ A;  3O76 A;  2WZ9 A;  4HU9 A;  1F3A A;  2LRC A;  2BTO T;  5D9V A;  3E9J B;  3BCK A;  4RQX A;  3ZZX A;  3HDC A;  1URM A;  1XWK A;  4OCF A;  5F07 A;  1AC1 A;  2R6K A;  4DSS B;  1TU7 A;  2WJU A;  4BWQ A;  1SL0 B;  3LJR A;  3LXZ A;  4K7O A;  3LYP A;  1JZW A;  1GNE A;  4ZBD A;  4IQ1 A;  5KN2 A;  3TKR A;  4K1F A;  4GSS A;  5IMZ A;  1AQV A;  2IWT A;  1U6T A;  3FKF A;  3GSS A;  4NXI A;  2NVL A;  4DSR A;  2OBI A;  3US3 A;  2E2G A;  2LS5 A;  2XPD A;  2OJL A;  2FUG 2;  2YV9 A;  2GDR A;  4HDE A;  3BJ5 A;  3GX8 A;  1GUK A;  3F8U A;  3CTG A;  5C00 A;  4WEY A;  2CVB A;  2LST A;  1HNA A;  2KHP A;  2ON7 A;  4TOP A;  2D2Z A;  4MJA A;  3GST A;  3CRU A;  4GF0 A;  3FR6 A;  2DSA A;  1OAZ A;  2CQ9 A;  1EOG A;  2YN1 A;  1PD2 1;  3D4T A;  5JWO B;  1DSB A;  2IN3 A;  4EF0 A;  2GLR A;  4RUV A;  1EGO A;  4IEL A;  1R5P A;  5D8I A;  2DC5 A;  3PGT A;  1GL8 A;  3BOA A;  4GLT A;  4LMW A;  2VL9 A;  4MMM A;  2HYX A;  1SYX A;  2L4Q A;  5FWG A;  1TXX A;  1WOU A;  5H5S A;  3D22 A;  5B6M A;  2VLU A;  1BX9 A;  2OAC A;  1V40 A;  5CRW A;  1QQ2 A;  1GP1 A;  3H79 A;  2L5O A;  2RUE A;  4O32 A;  5INY A;  4V2M A;  4TKY A;  4XIH A;  4WXT A;  3TJJ A;  3UAP A;  2NTO A;  4NMU A;  4O5R A;  4F0B A;  2NPB A;  2VAF A;  5D93 A;  5C04 A;  2CZ3 A;  5AN1 A;  2JU5 A;  3APS A;  3GFK A;  1YDK A;  2VUP A;  1SKS B;  1ACV A;  1EOH A;  2X8G A;  3KZQ A;  1A24 A;  3HVS A;  3WT1 A;  5ECI B;  4ZBB A;  1YZX A;  4MLY A;  6GSS A;  4KGI A;  5A4W A;  1EV4 A;  2WDU A;  1K0D A;  4MPF A;  2B7K A;  4MZB A;  3L9U A;  2LJA A;  4AJ7 A;  4MF6 A;  4MK3 A;  3EMP A;  1EP8 A;  3GUR A;  4PNF A;  4LA1 A;  3QFB C;  4TR4 A;  1O85 A;  1GTB A;  2HZF A;  2EIQ A;  4ILF A;  1HNB A;  1G7O A;  1U87 A;  3A5W A;  3ZIV A;  4ECI A;  2AV4 A;  3KH7 A;  4KDU A;  4L5O A;  2DJ3 A;  5KN1 A;  1F3B A;  3E3E A;  3ZML A;  2HRN A;  3I6A A;  2DJJ A;  2IFQ B;  4ZIL A;  3C73 A;  4XRA A;  1PMT A;  5J9B A;  4TN8 A;  1F6M C;  2JSY A;  13GS A;  5G1L A;  1M9A A;  1GUL A;  3TKS E;  1EP7 A;  1ON4 A;  5HR3 A;  4XTS A;  4K9Z A;  2H75 A;  2XHF A;  5ABR A;  1NW2 A;  5CP1 A;  5JWR B;  1XBS A;  5JWQ B;  4O7H A;  1K3Y A;  2FA4 A;  2JAD A;  4KAE A;  4NWY A;  4ECJ A;  1M2B A;  3KMO A;  5AIX A;  1DBY A;  5FT3 A;  1PKW A;  3GL5 A;  3H4K A;  5IOW A;  2IFQ A;  4J2F A;  3LQ7 A;  1XWC A;  1HNC A;  2WCI A;  4PUA A;  2LRT A;  2OE1 A;  4MZC A;  1VF2 A;  3HJP A;  2H70 A;  5ECP B;  3A2X A;  1MD3 A;  1ZOF A;  4YQU A;  1KTE A;  3EE2 A;  1YY7 A;  5J9C A;  5HR0 A;  3CRT A;  2FWE A;  4FO5 A;  2E0Q A;  1AQX A;  2E2M A;  5JCG A;  4EVM A;  4HI7 A;  4CW9 A;  1FW1 A;  3I9V 2;  5ECQ B;  3F6F A;  3Q6O A;  2JZR A;  1V98 A;  3VPQ A;  1YQ1 A;  3CSI A;  3E0U A;  1TDI A;  1J9B A;  2H72 A;  3DKS A;  3TJK A;  4ZB6 A;  3QCP A;  4JRR A;  4K2D A;  2H74 A;  3D4M A;  3NIV A;  17GS A;  2CVD A;  10GS A;  4GRF A;  1QXH A;  4TR3 A;  2N5B A;  2ZNM A;  2IJY A;  2K6V A;  3RPN A;  2H71 A;  4NV5 A;  3F9U A;  1HQO A;  3QD9 A;  2H1G A;  3ME8 A;  3D21 A;  4AF2 A;  1FO5 A;  3IK9 A;  1VF3 A;  4IHU A;  1B4Q A;  1GWC A;  4HZ2 A;  3HZ8 A;  3W6G A;  2MZC A;  1SJI A;  4F9Z A;  2C3T A;  3UOM A;  2FY6 A;  4WKW A;  5HFI A;  5CRH A;  5J41 A;  4EDZ A;  2L6D A;  3MAK A;  3VI7 A;  1OKT A;  1GUH A;  5IO0 A;  2H6Y A;  3P90 A;  2IMD A;  3K8N A;  3OR5 A;  2O85 A;  2OA7 A;  5ECO B;  2ALB A;  4ZB8 A;  6GSV A;  8GSS A;  1OYJ A;  3F63 A;  1O8W A;  1GSE A;  4RQR A;  1TI3 A;  3ERG A;  1FG4 A;  2VM1 A;  1BJX A;  4PQI A;  3L9S A;  4WBR D;  4YQV A;  2HSH A;  1SL2 B;  2CV4 A;  2IMK A;  1THX A;  1LJR A;  1OE8 A;  6GSX A;  1SK2 A;  4I2T A;  3CSJ A;  4KX4 A;  3DIE A;  2LKU A;  4N0Z A;  4NHW A;  2NBS A;  4TXO B;  2I1U A;  1MDK A;  2YWO A;  20GS A;  4G10 A;  4DSQ A;  1JLW A;  2I9H A;  3ERW A;  2CAQ A;  3QAG A;  3TRQ A;  4ZB9 A;  1GH2 A;  2B1K A;  5ECL B;  4MH2 A;  2LNT A;  3M8N A;  5ID2 B;  3M9K A;  2C3Q A;  2IMF A;  2IME A;  3LG6 A;  4IS0 A;  4Q5N A;  4OO4 A;  3VWW A;  4BA7 A;  2AB6 A;  3GNJ A;  2HLS A;  4IN0 A;  4NPB A;  4AJ8 A;  4JR4 A;  5DAL B;  11GS A;  1TRU A;  2J9H A;  3IR4 A;  1WWJ A;  2R2J A;  3F4T A;  4BVY A;  4IP6 A;  6GST A;  2RM5 A;  1JFU A;  5ID2 A;  1PN9 A;  3L4N A;  4ACS A;  3KTB A;  2LV3 A;  2FA8 A;  3WT2 A;  2P5Q A;  2A4V A;  3HZ4 A;  3ED3 A;  1LBK A;  2DJ1 A;  5ECM B;  18GS A;  4K7I A;  3TOT A;  5IO2 A;  1SKW B;  5ELA A;  5HR1 A;  3HJM A;  4HOJ A;  4MJC A;  1VRS D;  2YP6 A;  1FHE A;  4NV2 A;  3FRC A;  3IRA A;  5AGY A;  3QAV A;  4KND A;  4MA9 A;  1K3O A;  1W4V A;  4G9H A;  3FK8 A;  3L0H A;  2YNX A;  3FZ9 A;  16GS A;  3DEX A;  1XPV A;  3DD3 A;  3GTU A;  2VCV A;  4PUR A;  2I3Y A;  4PQ1 A;  4LL1 B;  1XWG A;  2YWN A;  3F6D A;  2VM2 A;  5DVB A;  5D9W A;  3S9F A;  4N30 A;  4EO3 A;  1VF1 A;  2L59 A;  3J7Y k;  3L78 A;  1USB A;  4EL1 A;  2VL3 A;  2NDO A;  2GSR A;  4PUF C;  1ST9 A;  3KTL A;  1J0F A;  2M46 A;  2F8F A;  4QL9 A;  3LGC A;  1TTZ A;  4OO5 A;  2AYT A;  2H73 A;  4KA0 A;  5EL8 A;  3MSZ A;  4K8M A;  2VL2 A;  3LFL A;  4TR1 A;  1AUC A;  3UEM A;  4ZL8 A;  1JZD A;  1T4Z A;  1FAA A;  1OC9 B;  2O8V B;  2AHE A;  1R26 A;  1WJK A;  3CBU A;  1JHB A;  5B8B A;  1PGT A;  5DCH A;  2RUF A;  2GST A;  1S3D A;  4J57 E;  2WRT A;  3P7X A;  4HU7 A;  1O73 A;  4KW6 A;  5D9T A;  2H6X A;  4IJI A;  3UMA A;  4YH2 A;  2C8U A;  2PN8 A;  5EPF A;  6GSW A;  4KSO A;  4LLR A;  3LOR A;  2KOK A;  1GSD A;  3GL3 A;  3WYW A;  1OC9 A;  2OAD A;  4RI6 A;  5IQY A;  2KLX A;  3EWL A;  4H86 A;  3HCZ A;  3EMX A;  3HA9 A;  4FYC A;  3CXG A;  5A4U A;  1ZCP A;  1A0F A;  2C3N A;  5GZZ B;  2FWH A;  2L5L A;  1BED A;  1U3I A;  2YWI A;  4GQF A;  1TRV A;  2GTU A;  4OFT A;  4JBB A;  1QMV A;  2K8V A;  2C0E A;  1XVQ A;  5ECN B;  4F0C A;  2MYG A;  1T1V A;  1XW6 A;  1LU4 A;  2CT6 A;  2K18 A;  2J23 A;  4WR5 A;  1I9D A;  1K0B A;  2P31 A;  3TJF A;  5J4U A;  1SJZ A;  1G7E A;  2WGR A;  1B4P A;  4I5Q A;  2TIR A;  4J56 E;  1EV9 A;  5IMF A;  2B7J A;  2OE0 A;  2GQM A;  2G0F A;  1GSS A;  2B5E A;  3M3M A;  3DRN A;  3ZIJ A;  2GVP A;  1F9M A;  2C0D A;  3IHQ A;  2B5X A;  3HD5 A;  4IJ3 A;  3WGX A;  3HHV A;  5G2Z A;  1F37 A;  1Z6N A;  4WBJ A;  2H0I A;  2OBK A;  2YAN A;  1UC7 A;  3RBT A;  2HFD A;  4JU5 A;  4ID0 A;  3ZFL A;  3MNG A;  3DVW A;  1TU8 A;  2RII A;  1E2Y A;  2QSI A;  2PU9 C;  5B7C A;  4Q5R A;  2TRX A;  3TJG A;  2XPE A;  1ERU A;  1A2J A;  4O92 A;  3Q18 A;  1ABA A;  4D73 B;  3IBH A;  2VIM A;  3TB2 A;  3JCM L;  1GLP A;  1F2E A;  3KP9 A;  5F8B A;  1ERW A;  1TK5 B;  4FYB A;  5DQS A;  2GSQ A;  3DML A;  1V58 A;  3Q19 A;  3P2A A;  4ECC A;  2CVK A;  2FD3 A;  1O7U A;  3GX0 A;  1XZO A;  1K0C A;  4IGJ A;  5AIS A;  2B6M A;  5ECS A;  3J7Y b;  4D73 A;  3VWU A;  1M2A A;  2F3M A;  1TK8 B;  19GS A;  1K0A A;  1ERT A;  3CTF A;  4GXZ A;  3LWA A;  4TVE A;  1T7P B;  4BWS A;  1GSF A;  2HZE A;  1HD2 A;  4N10 A;  5CYY A;  2MMN A;  3QOU A;  1Q98 A;  2YZU A;  1V57 A;  2FGX A;  3ZLP A;  1OVN A;  5IMV A;  1NHO A;  3FR9 A;  1BYE A;  4EE0 A;  1QGV A;  2VOC A;  3UVH A;  2YWM A;  3VPT A;  3TKQ A;  2CX4 A;  4I97 A;  5ECK B;  1IYH A;  3TRX A;  5EY6 A;  1OC8 A;  2PPT A;  2TRC P;  2H1B A;  2IMI A;  3GKN A;  2JL4 A;  2OE3 A;  1TP9 A;  3MWH A;  1KBN A;  1XOA A;  1GUM A;  3QDN A;  2HXK A;  1XIY A;  3TKP A;  4N0V A;  3R2Q A;  3TRP A;  1ZGN A;  4ML6 A;  1DE1 A;  1SEN A;  3C7M A;  5J3R A;  4L8E A;  4RI7 A;  1XW9 A;  2WB9 A;  2VD1 A;  4I6X A;  1G0T A;  3G7J A;  2G2Q A;  1GTU A;  5IM9 A;  2H0H A;  4L0U A;  4CDO A;  5IIZ A;  1T8E B;  1MEK A;  4ISD A;  3EC3 A;  4TW5 A;  4AJ6 A;  2GT5 A;  3KP8 A;  2DJ0 A;  4TR0 A;  4BVX A;  2DJK A;  5HR2 A;  5HFK A;  3FZ5 A;  2B5Y A;  1I5G A;  5HFG A;  2N5F A;  1XVW A;  1QUW A;  3TGZ A;  1V2A A;  2X64 A;  2LJK A;  1A23 A;  1WP0 A;  3UVT A;  2LJR A;  2DJ2 A;  2R37 A;  3I43 A;  3DGQ A;  3IV4 A;  3BD2 A;  5DAK B;  1GSY A;  2V6K A;  2V6O A;  2VCT A;  4XRD A;  2Z9S A;  4NHZ A;  2PBJ A;  1GLQ A;  3IOS A;  2VCX A;  3C8E A;  3GH9 A;  3Q74 A;  1DUG A;  3QMX A;  7GSS A;  9GSS A;  2BMX A;  1A8L A;  3ERF A;  3UBL A;  1VF4 A;  3FEU A;  1Z5Y E;  5IMC A;  2VCZ A;  4ULX A;  2XBI A;  1HYU A;  1GSQ A;  5DAK A;  3LXT A;  2R4V A;  2ZUP A;  2H01 A;  2HSY A;  5GAN D;  3GRX A;  2K8S A;  4HQS A;  3KM6 A;  2WUL A;  1N2A A;  2H1A A;  4KSM A;  1MDJ A;  1Y25 A;  2V2G A;  3EUR A;  1AXD A;  5IMD A;  1X5C A;  1J08 A;  1M9B A;  1GTI A;  4I8B A;  3APQ A;  1AIU A;  4MZW A;  2QC7 A;  2QGV A;  4N11 A;  2MBS A;  5D73 A;  1CQH A;  3IK7 A;  2AAW A;  4ZIJ A;  2HT9 A;  1THO A;  3RHB A;  5CRG A;  5JCU A;  1A8Y A;  3A3T A;  4TXV A;  1Y6E A;  3DWV A;  2LQO A;  1CQG A;  2H0G A;  2GGT A;  3G9B A;  4F2I A;  1PL2 A;  3ISO A;  2X99 A;  1G6Y A;  1VGL A;  1A0R P;  1XWA A;  1X9M B;  1XW5 A;  2O89 A;  3HKR A;  1X5D A;  1X5E A;  3VUR A;  1U3A A;  2JAC A;  3KEB A;  2KUC A;  1A2L A;  1X9S B;  2KP2 A;  3GTU B;  5H5R A;  4DEJ A;  5E59 A;  2C4J A;  3WGE A;  3F0I A;  2F51 A;  3UJ1 A;  4MJB A;  5D96 A;  2GZP A;  5ENU A;  5ELG A;  2ZCT A;  4LL4 B;  1PL1 A;  1YKC A;  1FVJ A;  3PR8 A;  4WF5 A;  2YV7 A;  4IW9 A;  3D5J A;  4KCA A;  4V1A p;  5G5F A;  1TOF A;  5G31 A;  2ON5 A;  3FW2 A;  1RK4 A;  4XS6 A;  1T4Y A;  1SK0 A;  1M99 A;  1SJ6 A;  3IC4 A;  3UL3 A;  4TR1 B;  4ZL9 A;  2FWF A;  4KUN A;  1C72 A;  1YKA A;  3HXS A;  2PER A;  1GTA A;  2PVQ A;  2VO4 A;  3W8J A;  3DVX A;  1AW9 A;  4P3Y B;  2FWG A;  5COH A;  3A2W A;  1H75 A;  4TRX A;  1PX6 A;  2LEG A;  4HJM A;  4EDY A;  4EXJ A;  1M2D A;  2DMM A;  2H76 A;  2EC4 A;  3MDK A;  1ML6 A;  4L5L A;  6GSY A;  2RM6 A;  1QK8 A;  4MAB A;  2R3X A;  3QR6 A;  1KNG A;  2GQK A;  2YPM A;  3SBC A;  2A2S A;  4JED A;  2AUV A;  1M0U A;  3D0Z A;  3HVX A;  1RQM A;  3IXR A;  4E8H A;  2JZT A;  4JE1 A;  1NM3 A;  5J5N A;  5CAX A;  14GS A;  4YQM A;  1FVK A;  3VFI A;  3QAW A;  4Q5F A;  3M1G A;  4PNG A;  4HZ4 A;  4IP1 A;  2HNL A;  4DSS A;  3ZMK A;  2IL3 A;  2A2R A;  4HJ2 A;  1EEM A;  1SD9 A;  2L57 A;  3F4S A;  1K0O A;  1UN2 A;  4ML1 A;  4G2E A;  3CMI A;  3RDW A;  1BAY A;  3EIN A;  4JR6 A;  2HRF A;  5EVO A;  5KEJ A;  1TW9 A;  5DJM A;  2DML A;  1UVZ A;  1B9Y C;  3EU3 A;  1FB6 A;  1ILO A;  4DVC A;  2LQQ A;  2MBT A;  3GUS A;  5DJL A;  2DIY A;  4K7N A;  3O3T A;  2DIZ A;  1KEB A;  2EIR A;  2PGT A;  3IE3 A;  1G6W A;  2DLX A;  3UAR A;  2F8A A;  3IA1 A;  3ZVJ D;  3W8S A;  3RPP A;  3APO A;  2V41 A;  2XBQ A;  5F06 A;  1OC3 A;  2V32 A;  1A2M A;  4BPY A;  2RLI A;  5L71 A;  1MDI A;  4KB3 A;  4FYU A;  3M0F A;  5A4V A;  4E8E A;  1FB0 A;  3VWV A;  4OMV A;  4AGS A;  2HI7 A;  3GMF A;  4Z7X A;  5E4W A;  3TKS C;  4F03 A;  3KCM A;  2C1Y A;  1T3B A;  2K9F A;  2C80 A;  2DBC A;  3VLN A;  3GKM A;  1XXU A;  1XFL A;  3RAZ A;  5GSS A;  3HYP A;  3SWL A;  2V1M A;  1DE2 A;  4MP4 A;  1WPI A;  2CZ2 A;  2KP1 A;  1ERV A;  4V1A g;  5DBQ A;  1UA5 A;  4GTU A;  1ZL9 A;  2VCW A;  1T00 A;  3LYK A;  4K0G A;  4ECB A;  1NSW A;  4V2L A;  5LD0 A;  2LUS A;  3UIW A;  5B8A A;  1ZYQ B;  3RHC A;  3PH9 A;  2MMO A;  1JLV A;  3U6V A;  4MH3 A;  1S3C A;  3FR3 A;  3LSZ A;  3L9V A;  3VI5 A;  3TKS A;  4OFN A;  2GQL A;  3BCI A;  4HUA A;  2GS3 A;  2HZE B;  2MMA A;  3GIX A;  1TI1 A;  1FOV A;  4KCE A;  3I69 A;  5LNK e;  1PRX A;  1IYI A;  4XS1 A;  3FZA A;  3EVI A;  3FYG A;  1BQ7 A;  5IOX A;  4PXO A;  1GNW A;  1S3A A;  2H19 A;  2PWJ A;  1WIK A;  4MPG A;  5HQP A;  1TKD B;  2VLV A;  2C0F A;  3KXO A;  2AJQ B;  3U5R E;  3TOU A;  2CA8 A;  2ES7 A;  2CX3 A;  3KD0 A;  3GN3 A;  3ME7 A;  1X0R A;  4PX1 A;  4OWY A;  4EUY A;  5KN3 A;  4MF7 A;  4KDX A;  2H6Z A;  1JZO A;  1Z6M A;  3GYK A;  4V2N A;  1K0M A;  4ZBA A;  5GAP D;  3GA4 A;  2IIY A;  4F82 A;  1M7T A;  2YZH A;  2E7P A;  3IAS 2;  3C1R A;  2GT6 A;  4K6X A;  5G5E A;  5AIV A;  3F4R A;  3TJB A;  1OE7 A;  4K0N A;  3GH6 A;  4MDC A;  1SYR A;  5D9X A;  3IDV A;  3GKX A;  1Z7P A;  3N9J A;  4G19 A;  2O87 A;  3HJO A;  5G30 A;  3ZL5 A;  3ZIT A;  2B3S A;  1GSU A;  4ZXG A;  2VLT A;  4KH7 A;  4FIW A;  1OKD A;  1B9X C;  1EZK A;  3CSH A;  2YJH A;  2FNO A;  3N5O A;  2M80 A;  3CYN A;  5G1K A;  1TRW A;  5CRE A;  3ZRD A;  3C1S A;  3KIJ A;  3KGK A;  1PX7 A;  22GS A;  1W89 A;  2R5G A;  2H8L A;  3GKK A;  1MTC A;  1PA3 A;  1U88 A;  2PVO C;  4IQA A;  4YAV A;  3WGD A;  2HE3 A;  3TDG A;  2I81 A;  2H66 A;  3LEF A;  1WMJ A;  4POB A;  1X9W B;  2X8H A;  4WET A;  3G7I A;  1TK0 B;  2CAI A;  2GSS A;  2L6C A;  1SD8 A;  3GV1 A;  5DDL A;  5CRD A;  2L4C A;  3H8Q A;  3GHA A;  5ECH B;  2VD0 A;  4X1U A;  4L0W A;  2JSZ A;  3DYR A;  1B48 A;  2YCD A;  1PQN A;  3F3R A; 
#chains in the Genus database with same CATH topology
 1R4W A;  1Z9H A;  2EIO A;  4HEA 2;  3HY2 A;  1R7H A;  2GZZ A;  1SU9 A;  2X8C A;  3P8W A;  4GST A;  4GQC A;  2LTK A;  4X0X A;  3A2V A;  3D6I A;  3PIN A;  12GS A;  2R0P A;  1O8X A;  4CY8 A;  3ZFB A;  3KH9 A;  3VWX A;  2H30 A;  4OFM A;  3BBY A;  5CNW A;  1ZYE A;  5GST A;  2N5A A;  2P5R A;  1K0N A;  4POM A;  2LRN A;  3UBK A;  4XHM A;  3TCO A;  3ZYW A;  4KE3 A;  4BL7 B;  4GSN A;  4FH8 A;  1TRS A;  1JZR A;  1EEJ A;  3FY7 A;  2IPA A;  4WF4 A;  2P0G A;  1YF1 A;  3EU4 A;  1RW1 A;  2YOI A;  1SK1 A;  3F3Q A;  2FCH A;  1YEX A;  3NOF A;  4IBP A;  5H5Q A;  2BJX A;  1XOB A;  1Z3E A;  5JCW A;  5IPG A;  1SKR B;  4IVF A;  5LCZ A;  4OD7 A;  4LMV A;  1AQW A;  2PMT A;  3M9J A;  4EIP A;  1BG5 A;  5FHI A;  3ZRE A;  4CHS A;  4BL7 A;  2C0G A;  3KJY A;  3ZVJ A;  2PUK C;  4IKH A;  3DXB A;  3ZTL A;  1TJD A;  3MIX A;  6GSU A;  2M72 A;  4ZL7 A;  1PKZ A;  4XCS A;  2XC2 A;  3QFA C;  4HS1 A;  2HRA A;  3WD6 A;  4X43 A;  2FLS A;  3G7Y A;  4PQH A;  4TXO A;  2QKE A;  3KMN A;  1K3L A;  2I4A A;  1Z7R A;  1QFN A;  4YAP A;  2OKA A;  2LNS A;  3O6T A;  2JZS A;  5IMA A;  1PSQ A;  2B1L A;  5DQY A;  2MMZ A;  3H93 A;  4MJE A;  3NZN A;  4MCU A;  4XS4 B;  1Q4J A;  5KN0 A;  4MF5 A;  1N8J A;  4GWR A;  4EC0 A;  5CO3 A;  1EWX A;  1XWB A;  3EYT A;  3IPZ A;  4EKZ A;  3QPM A;  2H1D A;  1SL1 B;  2FHE A;  5DAL A;  4QL7 A;  4POK A;  1O81 A;  3VK9 A;  4OCE A;  1E6B A;  1YJ6 A;  4FQU A;  4I2U A;  3FZ4 A;  5F0G A;  2VCQ A;  1ZMA A;  1YEP A;  3HVV A;  4XS4 A;  4NAX A;  2O7K A;  1PN0 A;  4KDY A;  5A5K A;  4PGT A;  5ECR B;  1B8X A;  1MD4 A;  2VL2 C;  2YJ7 A;  5IPH A;  1EGR A;  1WE0 A;  2GZY A;  1H4O A;  3IAM 2;  2WFC A;  5F05 A;  1WRY A;  4JZQ A;  3V1W A;  1GRX A;  4POL A;  1V9W A;  3H1N A;  3FHK A;  1O6J A;  1YF0 A;  4QQ7 A;  3TUE A;  1NHY A;  5B6N A;  2WS2 A;  3C71 A;  3AY8 A;  1R5A A;  2REM A;  4HQZ A;  1XCC A;  2F9S A;  5KOX A;  4Q5Q A;  5DCG A;  4GCI A;  4K2X A;  1ZZY A;  4WR4 A;  1AAZ A;  3O76 A;  2WZ9 A;  4HU9 A;  1F3A A;  2LRC A;  2BTO T;  5D9V A;  3E9J B;  3BCK A;  4RQX A;  3ZZX A;  3HDC A;  1URM A;  1XWK A;  4OCF A;  5F07 A;  1AC1 A;  1M3J A;  2R6K A;  4DSS B;  1TU7 A;  2WJU A;  4BWQ A;  1SL0 B;  3LJR A;  3LXZ A;  4K7O A;  3LYP A;  1JZW A;  1GNE A;  4ZBD A;  4IQ1 A;  5KN2 A;  3TKR A;  4K1F A;  4GSS A;  5IMZ A;  1AQV A;  2IWT A;  1U6T A;  3FKF A;  3GSS A;  4NXI A;  2NVL A;  4DSR A;  2OBI A;  3US3 A;  2E2G A;  2LS5 A;  2XPD A;  2OJL A;  2FUG 2;  4YKF A;  2YV9 A;  2GDR A;  4MNN A;  4HDE A;  3BJ5 A;  3GX8 A;  1GUK A;  3F8U A;  3CTG A;  5C00 A;  4G0K A;  4WEY A;  2CVB A;  2LST A;  1HNA A;  2KHP A;  2ON7 A;  4O5U A;  4TOP A;  2D2Z A;  4MJA A;  3GST A;  3CRU A;  4GF0 A;  3FR6 A;  2DSA A;  1OAZ A;  2CQ9 A;  3IHG A;  1EOG A;  2YN1 A;  1PD2 1;  3D4T A;  5JWO B;  1DSB A;  2IN3 A;  4EF0 A;  2GLR A;  2R0C A;  4RUV A;  1EGO A;  4IEL A;  1R5P A;  5D8I A;  2DC5 A;  3PGT A;  1GL8 A;  1XG8 A;  3BOA A;  4GLT A;  4PTS A;  4LMW A;  2VL9 A;  4MMM A;  2HYX A;  1SYX A;  2L4Q A;  5FWG A;  1TXX A;  1WOU A;  5H5S A;  3D22 A;  5B6M A;  2VLU A;  1BX9 A;  2OAC A;  1V40 A;  5CRW A;  1QQ2 A;  1GP1 A;  3H79 A;  2L5O A;  4CY6 A;  2RUE A;  4O32 A;  5INY A;  4V2M A;  4TKY A;  4XIH A;  4G0I A;  4WXT A;  3TJJ A;  3UAP A;  2NTO A;  4NMU A;  4O5R A;  4F0B A;  2NPB A;  2VAF A;  5D93 A;  5C04 A;  2CZ3 A;  5AN1 A;  2JU5 A;  3APS A;  3GFK A;  1YDK A;  2VUP A;  1SKS B;  1ACV A;  1EOH A;  2X8G A;  3KZQ A;  1A24 A;  3HVS A;  3WT1 A;  5ECI B;  4ZBB A;  1YZX A;  4MLY A;  6GSS A;  4KGI A;  5A4W A;  1EV4 A;  4K5S A;  2WDU A;  1K0D A;  4MPF A;  2B7K A;  4MZB A;  3L9U A;  1ZYN A;  2LJA A;  4AJ7 A;  4MF6 A;  4MK3 A;  3EMP A;  1EP8 A;  3GUR A;  4PNF A;  4LA1 A;  3QFB C;  4TR4 A;  1O85 A;  1GTB A;  2HZF A;  2EIQ A;  4ILF A;  1HNB A;  1G7O A;  1U87 A;  3A5W A;  3ZIV A;  4ECI A;  2AV4 A;  3KH7 A;  4KDU A;  4L5O A;  2DJ3 A;  5KN1 A;  1F3B A;  3E3E A;  3ZML A;  2HRN A;  3I6A A;  2DJJ A;  2IFQ B;  4ZIL A;  3C73 A;  4XRA A;  1PMT A;  5J9B A;  4TN8 A;  1F6M C;  2JSY A;  13GS A;  5G1L A;  1M9A A;  1GUL A;  3TKS E;  1EP7 A;  1ON4 A;  5HR3 A;  4XTS A;  4K9Z A;  2H75 A;  2XHF A;  5ABR A;  1NW2 A;  5CP1 A;  5JWR B;  1XBS A;  5JWQ B;  4O7H A;  1K3Y A;  2FA4 A;  2JAD A;  4KAE A;  4NWY A;  4ECJ A;  1M2B A;  3KMO A;  5AIX A;  1DBY A;  5FT3 A;  5KOW A;  1PKW A;  3GL5 A;  3H4K A;  5IOW A;  2IFQ A;  4J2F A;  3LQ7 A;  1XWC A;  1HNC A;  2WCI A;  4PUA A;  2LRT A;  2OE1 A;  4MZC A;  1VF2 A;  3HJP A;  2H70 A;  5ECP B;  3A2X A;  1MD3 A;  1ZOF A;  4YQU A;  1KTE A;  3EE2 A;  1YY7 A;  5J9C A;  5HR0 A;  3CRT A;  2FWE A;  4FO5 A;  2E0Q A;  1AQX A;  2E2M A;  5JCG A;  4EVM A;  4HI7 A;  4CW9 A;  1FW1 A;  3I9V 2;  5ECQ B;  3F6F A;  3Q6O A;  2JZR A;  1V98 A;  3VPQ A;  1YQ1 A;  3CSI A;  3E0U A;  1TDI A;  1J9B A;  2H72 A;  3DKS A;  3TJK A;  4ZB6 A;  3QCP A;  4JRR A;  4K2D A;  2H74 A;  3D4M A;  3NIV A;  1ZYP A;  17GS A;  2CVD A;  10GS A;  4GRF A;  4HSC X;  1QXH A;  4TR3 A;  2N5B A;  2ZNM A;  2IJY A;  2K6V A;  3RPN A;  3HVN A;  2H71 A;  4NV5 A;  3F9U A;  1HQO A;  3QD9 A;  4ICY A;  2H1G A;  3ME8 A;  3D21 A;  4AF2 A;  1FO5 A;  3IK9 A;  1VF3 A;  4IHU A;  1B4Q A;  2A4H A;  4YKG A;  1GWC A;  4HZ2 A;  3HZ8 A;  3W6G A;  2MZC A;  1SJI A;  4F9Z A;  2C3T A;  3IC8 A;  3UOM A;  2FY6 A;  4WKW A;  5HFI A;  5CRH A;  5J41 A;  4EDZ A;  2L6D A;  3MAK A;  3VI7 A;  1OKT A;  1GUH A;  5IO0 A;  2H6Y A;  3P90 A;  2IMD A;  3K8N A;  3OR5 A;  2O85 A;  2OA7 A;  5ECO B;  2ALB A;  4ZB8 A;  6GSV A;  8GSS A;  1OYJ A;  3F63 A;  1O8W A;  1GSE A;  4RQR A;  1TI3 A;  3ERG A;  1FG4 A;  2VM1 A;  1BJX A;  4PQI A;  3L9S A;  4WBR D;  4YQV A;  2HSH A;  1SL2 B;  2CV4 A;  2IMK A;  4Z2T A;  1THX A;  1LJR A;  1OE8 A;  6GSX A;  3A5I A;  1SK2 A;  4I2T A;  3CSJ A;  4KX4 A;  3DIE A;  2LKU A;  4N0Z A;  4NHW A;  2NBS A;  4TXO B;  2I1U A;  1MDK A;  2YWO A;  20GS A;  4G10 A;  4DSQ A;  1JLW A;  2I9H A;  3ERW A;  2CAQ A;  3QAG A;  3TRQ A;  4ZB9 A;  1GH2 A;  2B1K A;  5ECL B;  4MH2 A;  2LNT A;  3M8N A;  5ID2 B;  3M9K A;  2C3Q A;  2IMF A;  2IME A;  3LG6 A;  4IS0 A;  4Q5N A;  2QA1 A;  4OO4 A;  3VWW A;  4BA7 A;  2AB6 A;  3GNJ A;  2HLS A;  4IN0 A;  4NPB A;  4AJ8 A;  4JR4 A;  5DAL B;  11GS A;  1TRU A;  2J9H A;  3EPT A;  3IR4 A;  1WWJ A;  2R2J A;  3F4T A;  4BVY A;  4IP6 A;  6GST A;  2RM5 A;  1JFU A;  5ID2 A;  1PN9 A;  3L4N A;  4ACS A;  3KTB A;  2LV3 A;  2FA8 A;  3WT2 A;  2P5Q A;  2A4V A;  3HZ4 A;  3ED3 A;  2DKH A;  1LBK A;  2DJ1 A;  5ECM B;  18GS A;  4K7I A;  3TOT A;  5IO2 A;  1SKW B;  5ELA A;  2X4A A;  5HR1 A;  3HJM A;  4HOJ A;  4MJC A;  1VRS D;  2YP6 A;  1FHE A;  4NV2 A;  3FRC A;  3IRA A;  5AGY A;  3QAV A;  4KND A;  4MA9 A;  1K3O A;  1W4V A;  4G9H A;  3FK8 A;  3L0H A;  2YNX A;  3FZ9 A;  16GS A;  3DEX A;  1XPV A;  3DD3 A;  3GTU A;  2VCV A;  4K5R A;  4PUR A;  2I3Y A;  4PQ1 A;  4LL1 B;  1XWG A;  2YWN A;  3F6D A;  2VM2 A;  5DVB A;  5D9W A;  3S9F A;  4N30 A;  4EO3 A;  1VF1 A;  2L59 A;  3J7Y k;  4O5Q A;  3L78 A;  1USB A;  4EL1 A;  2VL3 A;  2NDO A;  2GSR A;  4PUF C;  1ST9 A;  3KTL A;  1J0F A;  2M46 A;  2F8F A;  4QL9 A;  3LGC A;  1TTZ A;  4OO5 A;  2AYT A;  2H73 A;  4KA0 A;  5EL8 A;  3MSZ A;  4K8M A;  2VL2 A;  3LFL A;  5BRT A;  4TR1 A;  1AUC A;  3UEM A;  5BMU A;  4ZL8 A;  1JZD A;  1T4Z A;  1FAA A;  1OC9 B;  2O8V B;  2AHE A;  1R26 A;  1WJK A;  3CBU A;  1JHB A;  5B8B A;  1PGT A;  2RUF A;  5DCH A;  2GST A;  1S3D A;  4J57 E;  2WRT A;  3P7X A;  4HU7 A;  1O73 A;  4KW6 A;  4KF9 A;  5D9T A;  2H6X A;  4IJI A;  3UMA A;  4YH2 A;  2C8U A;  2PN8 A;  5EPF A;  6GSW A;  4KSO A;  4LLR A;  3LOR A;  2KOK A;  1GSD A;  3GL3 A;  3WYW A;  1OC9 A;  2OAD A;  4RI6 A;  5IQY A;  2KLX A;  3EWL A;  4H86 A;  3HCZ A;  3EMX A;  3HA9 A;  4FYC A;  3CXG A;  2R0G A;  5A4U A;  1ZCP A;  1A0F A;  2C3N A;  5GZZ B;  2FWH A;  2L5L A;  1BED A;  1U3I A;  2YWI A;  3MYD A;  4GQF A;  1TRV A;  2GTU A;  4OFT A;  4JBB A;  1QMV A;  2K8V A;  2C0E A;  1XVQ A;  5ECN B;  4F0C A;  2MYG A;  1T1V A;  1XW6 A;  1LU4 A;  2CT6 A;  2K18 A;  2J23 A;  4WR5 A;  1I9D A;  1K0B A;  2P31 A;  3TJF A;  5J4U A;  1SJZ A;  1G7E A;  2WGR A;  1B4P A;  4I5Q A;  2TIR A;  4J56 E;  1EV9 A;  5IMF A;  2B7J A;  2OE0 A;  2GQM A;  2G0F A;  1GSS A;  2B5E A;  3M3M A;  3DRN A;  3ZIJ A;  2GVP A;  1F9M A;  2C0D A;  3IHQ A;  2B5X A;  3HD5 A;  4IJ3 A;  3WGX A;  3HHV A;  5G2Z A;  1F37 A;  1Z6N A;  4WBJ A;  2H0I A;  2OBK A;  2YAN A;  1UC7 A;  3RBT A;  2HFD A;  4JU5 A;  4ID0 A;  3ZFL A;  3MNG A;  3DVW A;  1TU8 A;  2RII A;  1E2Y A;  2QSI A;  2PU9 C;  5B7C A;  4Q5R A;  2TRX A;  3TJG A;  2XPE A;  1ERU A;  1A2J A;  4O92 A;  3Q18 A;  1ABA A;  4D73 B;  3IBH A;  2VIM A;  3TB2 A;  3JCM L;  1GLP A;  1F2E A;  3KP9 A;  5F8B A;  1ERW A;  1TK5 B;  4FYB A;  5DQS A;  2GSQ A;  3DML A;  1V58 A;  3Q19 A;  3P2A A;  4ECC A;  2CVK A;  2FD3 A;  1O7U A;  3GX0 A;  1XZO A;  1K0C A;  4IGJ A;  5AIS A;  2B6M A;  5ECS A;  3J7Y b;  4D73 A;  3VWU A;  1M2A A;  2F3M A;  1TK8 B;  19GS A;  1K0A A;  1ERT A;  3CTF A;  4GXZ A;  3LWA A;  4TVE A;  1T7P B;  4BWS A;  4Z2U A;  1GSF A;  2HZE A;  1HD2 A;  4N10 A;  5CYY A;  2MMN A;  3QOU A;  1Q98 A;  2YZU A;  1V57 A;  2FGX A;  3ZLP A;  1OVN A;  5IMV A;  1NHO A;  3FR9 A;  1BYE A;  4EE0 A;  1QGV A;  2VOC A;  3UVH A;  2YWM A;  3VPT A;  3TKQ A;  2CX4 A;  4I97 A;  5ECK B;  1IYH A;  4X4J A;  3TRX A;  5EY6 A;  1OC8 A;  2PPT A;  2TRC P;  2H1B A;  2IMI A;  3GKN A;  2JL4 A;  2OE3 A;  1TP9 A;  3MWH A;  1KBN A;  1XOA A;  1GUM A;  3QDN A;  2HXK A;  1XIY A;  3TKP A;  4BVX B;  4N0V A;  2QA2 A;  3R2Q A;  3TRP A;  1ZGN A;  4ML6 A;  1DE1 A;  1SEN A;  3C7M A;  5J3R A;  4L8E A;  4RI7 A;  1XW9 A;  3FMW A;  2WB9 A;  2VD1 A;  4I6X A;  1G0T A;  3G7J A;  1S3R A;  2G2Q A;  1GTU A;  5IM9 A;  2H0H A;  4L0U A;  4CDO A;  5IIZ A;  1T8E B;  1MEK A;  4ISD A;  3EC3 A;  4TW5 A;  4AJ6 A;  2GT5 A;  3KP8 A;  2DJ0 A;  4TR0 A;  4BVX A;  2DJK A;  5HR2 A;  5HFK A;  3FZ5 A;  2B5Y A;  1I5G A;  5HFG A;  2N5F A;  1XVW A;  1QUW A;  3TGZ A;  4A5P A;  1V2A A;  2X64 A;  2LJK A;  1A23 A;  1WP0 A;  3UVT A;  2LJR A;  2DJ2 A;  2R37 A;  3I43 A;  3DGQ A;  3IV4 A;  3BD2 A;  5DAK B;  1GSY A;  2V6K A;  2V6O A;  2VCT A;  4XRD A;  2Z9S A;  4NHZ A;  2PBJ A;  1GLQ A;  3IOS A;  2VCX A;  3C8E A;  3GH9 A;  3CQF A;  3Q74 A;  1DUG A;  3QMX A;  7GSS A;  9GSS A;  2BMX A;  1A8L A;  3ERF A;  3UBL A;  1VF4 A;  3FEU A;  1Z5Y E;  5IMC A;  2VCZ A;  4ULX A;  2XBI A;  1HYU A;  1GSQ A;  5DAK A;  3LXT A;  2R4V A;  2ZUP A;  2H01 A;  2HSY A;  5GAN D;  3GRX A;  2K8S A;  4HQS A;  3KM6 A;  2WUL A;  1N2A A;  2H1A A;  4KSM A;  1MDJ A;  1Y25 A;  2V2G A;  3EUR A;  1AXD A;  5IMD A;  1X5C A;  1J08 A;  1M9B A;  1GTI A;  4I8B A;  3APQ A;  1M3I A;  1AIU A;  4BVY B;  4MZW A;  2QC7 A;  2QGV A;  4N11 A;  2MBS A;  3R3E A;  5D73 A;  1CQH A;  3IK7 A;  2AAW A;  4ZIJ A;  2HT9 A;  1THO A;  3RHB A;  5CRG A;  5JCU A;  1A8Y A;  3A3T A;  4TXV A;  1Y6E A;  3DWV A;  2LQO A;  1CQG A;  2H0G A;  2GGT A;  3G9B A;  4F2I A;  1PL2 A;  3ISO A;  2X99 A;  1G6Y A;  1VGL A;  1A0R P;  1XWA A;  4G0L A;  1X9M B;  1XW5 A;  2O89 A;  3HKR A;  1X5D A;  1X5E A;  3VUR A;  1U3A A;  2JAC A;  3KEB A;  2KUC A;  1A2L A;  1X9S B;  2KP2 A;  3GTU B;  5H5R A;  4DEJ A;  5E59 A;  2C4J A;  3WGE A;  3F0I A;  2F51 A;  3UJ1 A;  4MJB A;  5D96 A;  2GZP A;  5ENU A;  5ELG A;  2ZCT A;  4LL4 B;  1PL1 A;  1YKC A;  1FVJ A;  2DKI A;  3PR8 A;  4WF5 A;  2YV7 A;  2HRK A;  4IW9 A;  3D5J A;  4KCA A;  4V1A p;  5G5F A;  1TOF A;  5G31 A;  2ON5 A;  3FW2 A;  1RK4 A;  4XS6 A;  1T4Y A;  1SK0 A;  1M99 A;  1PFO A;  1SJ6 A;  3IC4 A;  3UL3 A;  4TR1 B;  4ZL9 A;  2FWF A;  4KUN A;  1C72 A;  1YKA A;  3HXS A;  2PER A;  1GTA A;  2PVQ A;  2VO4 A;  3W8J A;  3DVX A;  1AW9 A;  4P3Y B;  2FWG A;  5COH A;  3A2W A;  1H75 A;  4TRX A;  1PX6 A;  2LEG A;  4HJM A;  4EDY A;  4EXJ A;  1M2D A;  2DMM A;  2H76 A;  2EC4 A;  3MDK A;  1ML6 A;  4L5L A;  6GSY A;  2RM6 A;  1QK8 A;  4MAB A;  2R3X A;  3QR6 A;  1KNG A;  2GQK A;  2YPM A;  3SBC A;  2UZ8 A;  3PPU A;  2A2S A;  4JED A;  2AUV A;  1M0U A;  4EIQ A;  3D0Z A;  3HVX A;  1RQM A;  3IXR A;  4E8H A;  2JZT A;  4JE1 A;  1NM3 A;  5J5N A;  5CAX A;  14GS A;  4YQM A;  1FVK A;  3VFI A;  3QAW A;  4Q5F A;  3M1G A;  4PNG A;  4HZ4 A;  4IP1 A;  2HNL A;  4DSS A;  3ZMK A;  2IL3 A;  2A2R A;  4HJ2 A;  1EEM A;  1SD9 A;  2L57 A;  3F4S A;  1K0O A;  1UN2 A;  4ML1 A;  4G2E A;  3CMI A;  3RDW A;  1BAY A;  3EIN A;  4JR6 A;  2HRF A;  5EVO A;  5KEJ A;  1TW9 A;  5DJM A;  2DML A;  1UVZ A;  1B9Y C;  3EU3 A;  1FB6 A;  1ILO A;  4DVC A;  2LQQ A;  2MBT A;  3GUS A;  5DJL A;  2DIY A;  4K7N A;  3O3T A;  2DIZ A;  1KEB A;  2EIR A;  2PGT A;  3IE3 A;  1G6W A;  2DLX A;  3UAR A;  2F8A A;  3IA1 A;  3ZVJ D;  3W8S A;  3RPP A;  3APO A;  2V41 A;  2XBQ A;  5F06 A;  1OC3 A;  2V32 A;  1A2M A;  4BPY A;  2RLI A;  5L71 A;  1MDI A;  4KB3 A;  4FYU A;  3M0F A;  5A4V A;  1FOH A;  3LW9 A;  4E8E A;  1FB0 A;  3VWV A;  4OMV A;  4AGS A;  2HI7 A;  3GMF A;  2A2P A;  4Z7X A;  5E4W A;  2HSM A;  3TKS C;  4F03 A;  3KCM A;  2C1Y A;  1T3B A;  2K9F A;  2C80 A;  2DBC A;  3VLN A;  3GKM A;  1XXU A;  1XFL A;  3RAZ A;  5GSS A;  3HYP A;  3SWL A;  2V1M A;  1DE2 A;  4MP4 A;  1WPI A;  2CZ2 A;  2KP1 A;  1ERV A;  4V1A g;  5DBQ A;  1UA5 A;  4GTU A;  1ZL9 A;  2VCW A;  1T00 A;  3LYK A;  4K0G A;  4ECB A;  1NSW A;  4V2L A;  5LD0 A;  2LUS A;  3UIW A;  5B8A A;  1ZYQ B;  3RHC A;  3PH9 A;  2MMO A;  1JLV A;  3U6V A;  4MH3 A;  1S3C A;  3FR3 A;  3LSZ A;  3L9V A;  3VI5 A;  3TKS A;  4OFN A;  2GQL A;  3BCI A;  4HUA A;  2GS3 A;  2HZE B;  2MMA A;  3GIX A;  1TI1 A;  1FOV A;  4KCE A;  3I69 A;  5LNK e;  1PRX A;  1IYI A;  4XS1 A;  3FZA A;  3EVI A;  3FYG A;  1BQ7 A;  5IOX A;  4PXO A;  1GNW A;  1S3A A;  2H19 A;  2PWJ A;  1WIK A;  4MPG A;  5HQP A;  1TKD B;  2VLV A;  2C0F A;  3KXO A;  2AJQ B;  3U5R E;  3TOU A;  2CA8 A;  2ES7 A;  2CX3 A;  3KD0 A;  3GN3 A;  3ME7 A;  1X0R A;  4PX1 A;  4OWY A;  4EUY A;  5KN3 A;  4MF7 A;  4KDX A;  2H6Z A;  1JZO A;  1Z6M A;  3GYK A;  4V2N A;  1K0M A;  4ZBA A;  2X49 A;  5GAP D;  3GA4 A;  2IIY A;  4F82 A;  1M7T A;  2YZH A;  2E7P A;  3IAS 2;  3C1R A;  2GT6 A;  4BIK A;  4K6X A;  5G5E A;  5AIV A;  3F4R A;  3TJB A;  1OE7 A;  4K0N A;  3GH6 A;  4MDC A;  1SYR A;  5D9X A;  3IDV A;  3GKX A;  1Z7P A;  3N9J A;  4G19 A;  2O87 A;  3HJO A;  5G30 A;  3ZL5 A;  3ZIT A;  2B3S A;  1GSU A;  4ZXG A;  2VLT A;  4KH7 A;  4FIW A;  1OKD A;  1B9X C;  1EZK A;  3CSH A;  2YJH A;  2FNO A;  3N5O A;  2M80 A;  3CYN A;  5G1K A;  1TRW A;  5CRE A;  3ZRD A;  3C1S A;  3KIJ A;  3KGK A;  1PX7 A;  22GS A;  1W89 A;  2R5G A;  2H8L A;  3GKK A;  1MTC A;  1PA3 A;  1U88 A;  2PVO C;  4IQA A;  4Z2R A;  4YAV A;  3WGD A;  2HE3 A;  3TDG A;  2I81 A;  2H66 A;  3LEF A;  1WMJ A;  4POB A;  4USS A;  1X9W B;  2X8H A;  4WET A;  3G7I A;  1TK0 B;  2CAI A;  2GSS A;  2L6C A;  1SD8 A;  3GV1 A;  5DDL A;  5CRD A;  2L4C A;  3H8Q A;  3GHA A;  5ECH B;  2VD0 A;  4X1U A;  4L0W A;  2JSZ A;  3DYR A;  1B48 A;  2YCD A;  1PQN A;  3F3R A; 
#chains in the Genus database with same CATH homology
 1R4W A;  1Z9H A;  2EIO A;  4HEA 2;  3HY2 A;  1R7H A;  2GZZ A;  1SU9 A;  2X8C A;  3P8W A;  4GST A;  4GQC A;  2LTK A;  4X0X A;  3A2V A;  3D6I A;  3PIN A;  12GS A;  2R0P A;  1O8X A;  4CY8 A;  3ZFB A;  3KH9 A;  3VWX A;  2H30 A;  4OFM A;  3BBY A;  5CNW A;  1ZYE A;  5GST A;  2N5A A;  2P5R A;  1K0N A;  4POM A;  2LRN A;  3UBK A;  4XHM A;  3TCO A;  3ZYW A;  4KE3 A;  4BL7 B;  4GSN A;  4FH8 A;  1TRS A;  1JZR A;  1EEJ A;  3FY7 A;  2IPA A;  4WF4 A;  2P0G A;  1YF1 A;  3EU4 A;  1RW1 A;  2YOI A;  1SK1 A;  3F3Q A;  2FCH A;  1YEX A;  3NOF A;  4IBP A;  5H5Q A;  2BJX A;  1XOB A;  1Z3E A;  5JCW A;  5IPG A;  1SKR B;  4IVF A;  5LCZ A;  4OD7 A;  4LMV A;  1AQW A;  2PMT A;  3M9J A;  4EIP A;  1BG5 A;  5FHI A;  3ZRE A;  4CHS A;  4BL7 A;  2C0G A;  3KJY A;  3ZVJ A;  2PUK C;  4IKH A;  3DXB A;  3ZTL A;  1TJD A;  3MIX A;  6GSU A;  2M72 A;  4ZL7 A;  1PKZ A;  4XCS A;  2XC2 A;  3QFA C;  4HS1 A;  2HRA A;  3WD6 A;  4X43 A;  2FLS A;  3G7Y A;  4PQH A;  4TXO A;  2QKE A;  3KMN A;  1K3L A;  2I4A A;  1Z7R A;  1QFN A;  4YAP A;  2OKA A;  2LNS A;  3O6T A;  2JZS A;  5IMA A;  1PSQ A;  2B1L A;  5DQY A;  2MMZ A;  3H93 A;  4MJE A;  3NZN A;  4MCU A;  4XS4 B;  1Q4J A;  5KN0 A;  4MF5 A;  1N8J A;  4GWR A;  4EC0 A;  5CO3 A;  1EWX A;  1XWB A;  3EYT A;  3IPZ A;  4EKZ A;  3QPM A;  2H1D A;  1SL1 B;  2FHE A;  5DAL A;  4QL7 A;  4POK A;  1O81 A;  3VK9 A;  4OCE A;  1E6B A;  1YJ6 A;  4FQU A;  4I2U A;  3FZ4 A;  5F0G A;  2VCQ A;  1ZMA A;  1YEP A;  3HVV A;  4XS4 A;  4NAX A;  2O7K A;  1PN0 A;  4KDY A;  5A5K A;  4PGT A;  5ECR B;  1B8X A;  1MD4 A;  2VL2 C;  2YJ7 A;  5IPH A;  1EGR A;  1WE0 A;  2GZY A;  1H4O A;  3IAM 2;  2WFC A;  5F05 A;  1WRY A;  4JZQ A;  3V1W A;  1GRX A;  4POL A;  1V9W A;  3H1N A;  3FHK A;  1O6J A;  1YF0 A;  4QQ7 A;  3TUE A;  1NHY A;  5B6N A;  2WS2 A;  3C71 A;  3AY8 A;  1R5A A;  2REM A;  4HQZ A;  1XCC A;  2F9S A;  5KOX A;  4Q5Q A;  5DCG A;  4GCI A;  4K2X A;  1ZZY A;  4WR4 A;  1AAZ A;  3O76 A;  2WZ9 A;  4HU9 A;  1F3A A;  2LRC A;  2BTO T;  5D9V A;  3E9J B;  3BCK A;  4RQX A;  3ZZX A;  3HDC A;  1URM A;  1XWK A;  4OCF A;  5F07 A;  1AC1 A;  2R6K A;  4DSS B;  1TU7 A;  2WJU A;  4BWQ A;  1SL0 B;  3LJR A;  3LXZ A;  4K7O A;  3LYP A;  1JZW A;  1GNE A;  4ZBD A;  4IQ1 A;  5KN2 A;  3TKR A;  4K1F A;  4GSS A;  5IMZ A;  1AQV A;  2IWT A;  1U6T A;  3FKF A;  3GSS A;  4NXI A;  2NVL A;  4DSR A;  2OBI A;  3US3 A;  2E2G A;  2LS5 A;  2XPD A;  2OJL A;  2FUG 2;  4YKF A;  2YV9 A;  2GDR A;  4MNN A;  4HDE A;  3BJ5 A;  3GX8 A;  1GUK A;  3F8U A;  3CTG A;  5C00 A;  4G0K A;  4WEY A;  2CVB A;  2LST A;  1HNA A;  2KHP A;  2ON7 A;  4O5U A;  4TOP A;  2D2Z A;  4MJA A;  3GST A;  3CRU A;  4GF0 A;  3FR6 A;  2DSA A;  1OAZ A;  2CQ9 A;  3IHG A;  1EOG A;  2YN1 A;  1PD2 1;  3D4T A;  5JWO B;  1DSB A;  2IN3 A;  4EF0 A;  2GLR A;  2R0C A;  4RUV A;  1EGO A;  4IEL A;  1R5P A;  5D8I A;  2DC5 A;  3PGT A;  1GL8 A;  3BOA A;  4GLT A;  4PTS A;  4LMW A;  2VL9 A;  4MMM A;  2HYX A;  1SYX A;  2L4Q A;  5FWG A;  1TXX A;  1WOU A;  5H5S A;  3D22 A;  5B6M A;  2VLU A;  1BX9 A;  2OAC A;  1V40 A;  5CRW A;  1QQ2 A;  1GP1 A;  3H79 A;  2L5O A;  4CY6 A;  2RUE A;  4O32 A;  5INY A;  4V2M A;  4TKY A;  4XIH A;  4G0I A;  4WXT A;  3TJJ A;  3UAP A;  2NTO A;  4NMU A;  4O5R A;  4F0B A;  2NPB A;  2VAF A;  5D93 A;  5C04 A;  2CZ3 A;  5AN1 A;  2JU5 A;  3APS A;  3GFK A;  1YDK A;  2VUP A;  1SKS B;  1ACV A;  1EOH A;  2X8G A;  3KZQ A;  1A24 A;  3HVS A;  3WT1 A;  5ECI B;  4ZBB A;  1YZX A;  4MLY A;  6GSS A;  4KGI A;  5A4W A;  1EV4 A;  4K5S A;  2WDU A;  1K0D A;  4MPF A;  2B7K A;  4MZB A;  3L9U A;  1ZYN A;  2LJA A;  4AJ7 A;  4MF6 A;  4MK3 A;  3EMP A;  1EP8 A;  3GUR A;  4PNF A;  4LA1 A;  3QFB C;  4TR4 A;  1O85 A;  1GTB A;  2HZF A;  2EIQ A;  4ILF A;  1HNB A;  1G7O A;  1U87 A;  3A5W A;  3ZIV A;  4ECI A;  2AV4 A;  3KH7 A;  4KDU A;  4L5O A;  2DJ3 A;  5KN1 A;  1F3B A;  3E3E A;  3ZML A;  2HRN A;  3I6A A;  2DJJ A;  2IFQ B;  4ZIL A;  3C73 A;  4XRA A;  1PMT A;  5J9B A;  4TN8 A;  1F6M C;  2JSY A;  13GS A;  5G1L A;  1M9A A;  1GUL A;  3TKS E;  1EP7 A;  1ON4 A;  5HR3 A;  4XTS A;  4K9Z A;  2H75 A;  2XHF A;  5ABR A;  1NW2 A;  5CP1 A;  5JWR B;  1XBS A;  5JWQ B;  4O7H A;  1K3Y A;  2FA4 A;  2JAD A;  4KAE A;  4NWY A;  4ECJ A;  1M2B A;  3KMO A;  5AIX A;  1DBY A;  5FT3 A;  5KOW A;  1PKW A;  3GL5 A;  3H4K A;  5IOW A;  2IFQ A;  4J2F A;  3LQ7 A;  1XWC A;  1HNC A;  2WCI A;  4PUA A;  2LRT A;  2OE1 A;  4MZC A;  1VF2 A;  3HJP A;  2H70 A;  5ECP B;  3A2X A;  1MD3 A;  1ZOF A;  4YQU A;  1KTE A;  3EE2 A;  1YY7 A;  5J9C A;  5HR0 A;  3CRT A;  2FWE A;  4FO5 A;  2E0Q A;  1AQX A;  2E2M A;  5JCG A;  4EVM A;  4HI7 A;  4CW9 A;  1FW1 A;  3I9V 2;  5ECQ B;  3F6F A;  3Q6O A;  2JZR A;  1V98 A;  3VPQ A;  1YQ1 A;  3CSI A;  3E0U A;  1TDI A;  1J9B A;  2H72 A;  3DKS A;  3TJK A;  4ZB6 A;  3QCP A;  4JRR A;  4K2D A;  2H74 A;  3D4M A;  3NIV A;  1ZYP A;  17GS A;  2CVD A;  10GS A;  4GRF A;  1QXH A;  4TR3 A;  2N5B A;  2ZNM A;  2IJY A;  2K6V A;  3RPN A;  2H71 A;  4NV5 A;  3F9U A;  1HQO A;  3QD9 A;  4ICY A;  2H1G A;  3ME8 A;  3D21 A;  4AF2 A;  1FO5 A;  3IK9 A;  1VF3 A;  4IHU A;  1B4Q A;  2A4H A;  4YKG A;  1GWC A;  4HZ2 A;  3HZ8 A;  3W6G A;  2MZC A;  1SJI A;  4F9Z A;  2C3T A;  3IC8 A;  3UOM A;  2FY6 A;  4WKW A;  5HFI A;  5CRH A;  5J41 A;  4EDZ A;  2L6D A;  3MAK A;  3VI7 A;  1OKT A;  1GUH A;  5IO0 A;  2H6Y A;  3P90 A;  2IMD A;  3K8N A;  3OR5 A;  2O85 A;  2OA7 A;  5ECO B;  2ALB A;  4ZB8 A;  6GSV A;  8GSS A;  1OYJ A;  3F63 A;  1O8W A;  1GSE A;  4RQR A;  1TI3 A;  3ERG A;  1FG4 A;  2VM1 A;  1BJX A;  4PQI A;  3L9S A;  4WBR D;  4YQV A;  2HSH A;  1SL2 B;  2CV4 A;  2IMK A;  4Z2T A;  1THX A;  1LJR A;  1OE8 A;  6GSX A;  3A5I A;  1SK2 A;  4I2T A;  3CSJ A;  4KX4 A;  3DIE A;  2LKU A;  4N0Z A;  4NHW A;  2NBS A;  4TXO B;  2I1U A;  1MDK A;  2YWO A;  20GS A;  4G10 A;  4DSQ A;  1JLW A;  2I9H A;  3ERW A;  2CAQ A;  3QAG A;  3TRQ A;  4ZB9 A;  1GH2 A;  2B1K A;  5ECL B;  4MH2 A;  2LNT A;  3M8N A;  5ID2 B;  3M9K A;  2C3Q A;  2IMF A;  2IME A;  3LG6 A;  4IS0 A;  4Q5N A;  2QA1 A;  4OO4 A;  3VWW A;  4BA7 A;  2AB6 A;  3GNJ A;  2HLS A;  4IN0 A;  4NPB A;  4AJ8 A;  4JR4 A;  5DAL B;  11GS A;  1TRU A;  2J9H A;  3EPT A;  3IR4 A;  1WWJ A;  2R2J A;  3F4T A;  4BVY A;  4IP6 A;  6GST A;  2RM5 A;  1JFU A;  5ID2 A;  1PN9 A;  3L4N A;  4ACS A;  3KTB A;  2LV3 A;  2FA8 A;  3WT2 A;  2P5Q A;  2A4V A;  3HZ4 A;  3ED3 A;  2DKH A;  1LBK A;  2DJ1 A;  5ECM B;  18GS A;  4K7I A;  3TOT A;  5IO2 A;  1SKW B;  5ELA A;  2X4A A;  5HR1 A;  3HJM A;  4HOJ A;  4MJC A;  1VRS D;  2YP6 A;  1FHE A;  4NV2 A;  3FRC A;  3IRA A;  5AGY A;  3QAV A;  4KND A;  4MA9 A;  1K3O A;  1W4V A;  4G9H A;  3FK8 A;  3L0H A;  2YNX A;  3FZ9 A;  16GS A;  3DEX A;  1XPV A;  3DD3 A;  3GTU A;  2VCV A;  4K5R A;  4PUR A;  2I3Y A;  4PQ1 A;  4LL1 B;  1XWG A;  2YWN A;  3F6D A;  2VM2 A;  5DVB A;  5D9W A;  3S9F A;  4N30 A;  4EO3 A;  1VF1 A;  2L59 A;  3J7Y k;  4O5Q A;  3L78 A;  1USB A;  4EL1 A;  2VL3 A;  2NDO A;  2GSR A;  4PUF C;  1ST9 A;  3KTL A;  1J0F A;  2M46 A;  2F8F A;  4QL9 A;  3LGC A;  1TTZ A;  4OO5 A;  2AYT A;  2H73 A;  4KA0 A;  5EL8 A;  3MSZ A;  4K8M A;  2VL2 A;  3LFL A;  5BRT A;  4TR1 A;  1AUC A;  3UEM A;  5BMU A;  4ZL8 A;  1JZD A;  1T4Z A;  1FAA A;  1OC9 B;  2O8V B;  2AHE A;  1R26 A;  1WJK A;  3CBU A;  1JHB A;  5B8B A;  1PGT A;  2RUF A;  5DCH A;  2GST A;  1S3D A;  4J57 E;  2WRT A;  3P7X A;  4HU7 A;  1O73 A;  4KW6 A;  4KF9 A;  5D9T A;  2H6X A;  4IJI A;  3UMA A;  4YH2 A;  2C8U A;  2PN8 A;  5EPF A;  6GSW A;  4KSO A;  4LLR A;  3LOR A;  2KOK A;  1GSD A;  3GL3 A;  3WYW A;  1OC9 A;  2OAD A;  4RI6 A;  5IQY A;  2KLX A;  3EWL A;  4H86 A;  3HCZ A;  3EMX A;  3HA9 A;  4FYC A;  3CXG A;  2R0G A;  5A4U A;  1ZCP A;  1A0F A;  2C3N A;  5GZZ B;  2FWH A;  2L5L A;  1BED A;  1U3I A;  2YWI A;  3MYD A;  4GQF A;  1TRV A;  2GTU A;  4OFT A;  4JBB A;  1QMV A;  2K8V A;  2C0E A;  1XVQ A;  5ECN B;  4F0C A;  2MYG A;  1T1V A;  1XW6 A;  1LU4 A;  2CT6 A;  2K18 A;  2J23 A;  4WR5 A;  1I9D A;  1K0B A;  2P31 A;  3TJF A;  5J4U A;  1SJZ A;  1G7E A;  2WGR A;  1B4P A;  4I5Q A;  2TIR A;  4J56 E;  1EV9 A;  5IMF A;  2B7J A;  2OE0 A;  2GQM A;  2G0F A;  1GSS A;  2B5E A;  3M3M A;  3DRN A;  3ZIJ A;  2GVP A;  1F9M A;  2C0D A;  3IHQ A;  2B5X A;  3HD5 A;  4IJ3 A;  3WGX A;  3HHV A;  5G2Z A;  1F37 A;  1Z6N A;  4WBJ A;  2H0I A;  2OBK A;  2YAN A;  1UC7 A;  3RBT A;  2HFD A;  4JU5 A;  4ID0 A;  3ZFL A;  3MNG A;  3DVW A;  1TU8 A;  2RII A;  1E2Y A;  2QSI A;  2PU9 C;  5B7C A;  4Q5R A;  2TRX A;  3TJG A;  2XPE A;  1ERU A;  1A2J A;  4O92 A;  3Q18 A;  1ABA A;  4D73 B;  3IBH A;  2VIM A;  3TB2 A;  3JCM L;  1GLP A;  1F2E A;  3KP9 A;  5F8B A;  1ERW A;  1TK5 B;  4FYB A;  5DQS A;  2GSQ A;  3DML A;  1V58 A;  3Q19 A;  3P2A A;  4ECC A;  2CVK A;  2FD3 A;  1O7U A;  3GX0 A;  1XZO A;  1K0C A;  4IGJ A;  5AIS A;  2B6M A;  5ECS A;  3J7Y b;  4D73 A;  3VWU A;  1M2A A;  2F3M A;  1TK8 B;  19GS A;  1K0A A;  1ERT A;  3CTF A;  4GXZ A;  3LWA A;  4TVE A;  1T7P B;  4BWS A;  4Z2U A;  1GSF A;  2HZE A;  1HD2 A;  4N10 A;  5CYY A;  2MMN A;  3QOU A;  1Q98 A;  2YZU A;  1V57 A;  2FGX A;  3ZLP A;  1OVN A;  5IMV A;  1NHO A;  3FR9 A;  1BYE A;  4EE0 A;  1QGV A;  2VOC A;  3UVH A;  2YWM A;  3VPT A;  3TKQ A;  2CX4 A;  4I97 A;  5ECK B;  1IYH A;  4X4J A;  3TRX A;  5EY6 A;  1OC8 A;  2PPT A;  2TRC P;  2H1B A;  2IMI A;  3GKN A;  2JL4 A;  2OE3 A;  1TP9 A;  3MWH A;  1KBN A;  1XOA A;  1GUM A;  3QDN A;  2HXK A;  1XIY A;  3TKP A;  4BVX B;  4N0V A;  2QA2 A;  3R2Q A;  3TRP A;  1ZGN A;  4ML6 A;  1DE1 A;  1SEN A;  3C7M A;  5J3R A;  4L8E A;  4RI7 A;  1XW9 A;  3FMW A;  2WB9 A;  2VD1 A;  4I6X A;  1G0T A;  3G7J A;  2G2Q A;  1GTU A;  5IM9 A;  2H0H A;  4L0U A;  4CDO A;  5IIZ A;  1T8E B;  1MEK A;  4ISD A;  3EC3 A;  4TW5 A;  4AJ6 A;  2GT5 A;  3KP8 A;  2DJ0 A;  4TR0 A;  4BVX A;  2DJK A;  5HR2 A;  5HFK A;  3FZ5 A;  2B5Y A;  1I5G A;  5HFG A;  2N5F A;  1XVW A;  1QUW A;  3TGZ A;  4A5P A;  1V2A A;  2X64 A;  2LJK A;  1A23 A;  1WP0 A;  3UVT A;  2LJR A;  2DJ2 A;  2R37 A;  3I43 A;  3DGQ A;  3IV4 A;  3BD2 A;  5DAK B;  1GSY A;  2V6K A;  2V6O A;  2VCT A;  4XRD A;  2Z9S A;  4NHZ A;  2PBJ A;  1GLQ A;  3IOS A;  2VCX A;  3C8E A;  3GH9 A;  3Q74 A;  1DUG A;  3QMX A;  7GSS A;  9GSS A;  2BMX A;  1A8L A;  3ERF A;  3UBL A;  1VF4 A;  3FEU A;  1Z5Y E;  5IMC A;  2VCZ A;  4ULX A;  2XBI A;  1HYU A;  1GSQ A;  5DAK A;  3LXT A;  2R4V A;  2ZUP A;  2H01 A;  2HSY A;  5GAN D;  3GRX A;  2K8S A;  4HQS A;  3KM6 A;  2WUL A;  1N2A A;  2H1A A;  4KSM A;  1MDJ A;  1Y25 A;  2V2G A;  3EUR A;  1AXD A;  5IMD A;  1X5C A;  1J08 A;  1M9B A;  1GTI A;  4I8B A;  3APQ A;  1AIU A;  4BVY B;  4MZW A;  2QC7 A;  2QGV A;  4N11 A;  2MBS A;  3R3E A;  5D73 A;  1CQH A;  3IK7 A;  2AAW A;  4ZIJ A;  2HT9 A;  1THO A;  3RHB A;  5CRG A;  5JCU A;  1A8Y A;  3A3T A;  4TXV A;  1Y6E A;  3DWV A;  2LQO A;  1CQG A;  2H0G A;  2GGT A;  3G9B A;  4F2I A;  1PL2 A;  3ISO A;  2X99 A;  1G6Y A;  1VGL A;  1A0R P;  1XWA A;  4G0L A;  1X9M B;  1XW5 A;  2O89 A;  3HKR A;  1X5D A;  1X5E A;  3VUR A;  1U3A A;  2JAC A;  3KEB A;  2KUC A;  1A2L A;  1X9S B;  2KP2 A;  3GTU B;  5H5R A;  4DEJ A;  5E59 A;  2C4J A;  3WGE A;  3F0I A;  2F51 A;  3UJ1 A;  4MJB A;  5D96 A;  2GZP A;  5ENU A;  5ELG A;  2ZCT A;  4LL4 B;  1PL1 A;  1YKC A;  1FVJ A;  2DKI A;  3PR8 A;  4WF5 A;  2YV7 A;  2HRK A;  4IW9 A;  3D5J A;  4KCA A;  4V1A p;  5G5F A;  1TOF A;  5G31 A;  2ON5 A;  3FW2 A;  1RK4 A;  4XS6 A;  1T4Y A;  1SK0 A;  1M99 A;  1SJ6 A;  3IC4 A;  3UL3 A;  4TR1 B;  4ZL9 A;  2FWF A;  4KUN A;  1C72 A;  1YKA A;  3HXS A;  2PER A;  1GTA A;  2PVQ A;  2VO4 A;  3W8J A;  3DVX A;  1AW9 A;  4P3Y B;  2FWG A;  5COH A;  3A2W A;  1H75 A;  4TRX A;  1PX6 A;  2LEG A;  4HJM A;  4EDY A;  4EXJ A;  1M2D A;  2DMM A;  2H76 A;  2EC4 A;  3MDK A;  1ML6 A;  4L5L A;  6GSY A;  2RM6 A;  1QK8 A;  4MAB A;  2R3X A;  3QR6 A;  1KNG A;  2GQK A;  2YPM A;  3SBC A;  2UZ8 A;  3PPU A;  2A2S A;  4JED A;  2AUV A;  1M0U A;  4EIQ A;  3D0Z A;  3HVX A;  1RQM A;  3IXR A;  4E8H A;  2JZT A;  4JE1 A;  1NM3 A;  5J5N A;  5CAX A;  14GS A;  4YQM A;  1FVK A;  3VFI A;  3QAW A;  4Q5F A;  3M1G A;  4PNG A;  4HZ4 A;  4IP1 A;  2HNL A;  4DSS A;  3ZMK A;  2IL3 A;  2A2R A;  4HJ2 A;  1EEM A;  1SD9 A;  2L57 A;  3F4S A;  1K0O A;  1UN2 A;  4ML1 A;  4G2E A;  3CMI A;  3RDW A;  1BAY A;  3EIN A;  4JR6 A;  2HRF A;  5EVO A;  5KEJ A;  1TW9 A;  5DJM A;  2DML A;  1UVZ A;  1B9Y C;  3EU3 A;  1FB6 A;  1ILO A;  4DVC A;  2LQQ A;  2MBT A;  3GUS A;  5DJL A;  2DIY A;  4K7N A;  3O3T A;  2DIZ A;  1KEB A;  2EIR A;  2PGT A;  3IE3 A;  1G6W A;  2DLX A;  3UAR A;  2F8A A;  3IA1 A;  3ZVJ D;  3W8S A;  3RPP A;  3APO A;  2V41 A;  2XBQ A;  5F06 A;  1OC3 A;  2V32 A;  1A2M A;  4BPY A;  2RLI A;  5L71 A;  1MDI A;  4KB3 A;  4FYU A;  3M0F A;  5A4V A;  1FOH A;  3LW9 A;  4E8E A;  1FB0 A;  3VWV A;  4OMV A;  4AGS A;  2HI7 A;  3GMF A;  2A2P A;  4Z7X A;  5E4W A;  2HSM A;  3TKS C;  4F03 A;  3KCM A;  2C1Y A;  1T3B A;  2K9F A;  2C80 A;  2DBC A;  3VLN A;  3GKM A;  1XXU A;  1XFL A;  3RAZ A;  5GSS A;  3HYP A;  3SWL A;  2V1M A;  1DE2 A;  4MP4 A;  1WPI A;  2CZ2 A;  2KP1 A;  1ERV A;  4V1A g;  5DBQ A;  1UA5 A;  4GTU A;  1ZL9 A;  2VCW A;  1T00 A;  3LYK A;  4K0G A;  4ECB A;  1NSW A;  4V2L A;  5LD0 A;  2LUS A;  3UIW A;  5B8A A;  1ZYQ B;  3RHC A;  3PH9 A;  2MMO A;  1JLV A;  3U6V A;  4MH3 A;  1S3C A;  3FR3 A;  3LSZ A;  3L9V A;  3VI5 A;  3TKS A;  4OFN A;  2GQL A;  3BCI A;  4HUA A;  2GS3 A;  2HZE B;  2MMA A;  3GIX A;  1TI1 A;  1FOV A;  4KCE A;  3I69 A;  5LNK e;  1PRX A;  1IYI A;  4XS1 A;  3FZA A;  3EVI A;  3FYG A;  1BQ7 A;  5IOX A;  4PXO A;  1GNW A;  1S3A A;  2H19 A;  2PWJ A;  1WIK A;  4MPG A;  5HQP A;  1TKD B;  2VLV A;  2C0F A;  3KXO A;  2AJQ B;  3U5R E;  3TOU A;  2CA8 A;  2ES7 A;  2CX3 A;  3KD0 A;  3GN3 A;  3ME7 A;  1X0R A;  4PX1 A;  4OWY A;  4EUY A;  5KN3 A;  4MF7 A;  4KDX A;  2H6Z A;  1JZO A;  1Z6M A;  3GYK A;  4V2N A;  1K0M A;  4ZBA A;  2X49 A;  5GAP D;  3GA4 A;  2IIY A;  4F82 A;  1M7T A;  2YZH A;  2E7P A;  3IAS 2;  3C1R A;  2GT6 A;  4K6X A;  5G5E A;  5AIV A;  3F4R A;  3TJB A;  1OE7 A;  4K0N A;  3GH6 A;  4MDC A;  1SYR A;  5D9X A;  3IDV A;  3GKX A;  1Z7P A;  3N9J A;  4G19 A;  2O87 A;  3HJO A;  5G30 A;  3ZL5 A;  3ZIT A;  2B3S A;  1GSU A;  4ZXG A;  2VLT A;  4KH7 A;  4FIW A;  1OKD A;  1B9X C;  1EZK A;  3CSH A;  2YJH A;  2FNO A;  3N5O A;  2M80 A;  3CYN A;  5G1K A;  1TRW A;  5CRE A;  3ZRD A;  3C1S A;  3KIJ A;  3KGK A;  1PX7 A;  22GS A;  1W89 A;  2R5G A;  2H8L A;  3GKK A;  1MTC A;  1PA3 A;  1U88 A;  2PVO C;  4IQA A;  4Z2R A;  4YAV A;  3WGD A;  2HE3 A;  3TDG A;  2I81 A;  2H66 A;  3LEF A;  1WMJ A;  4POB A;  4USS A;  1X9W B;  2X8H A;  4WET A;  3G7I A;  1TK0 B;  2CAI A;  2GSS A;  2L6C A;  1SD8 A;  3GV1 A;  5DDL A;  5CRD A;  2L4C A;  3H8Q A;  3GHA A;  5ECH B;  2VD0 A;  4X1U A;  4L0W A;  2JSZ A;  3DYR A;  1B48 A;  2YCD A;  1PQN A;  3F3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...