2PU9C

Crystal srtucture of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin f
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
EAIVGKVTEVNKDTFWPIVKAAGDKPVVLDMFTQWCGPSKAMAPKYEKLAEEYLDVIFLKLDCNQENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 27
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pu9C00
3DRNA 4HU9A 3VURA 3A5WA 3F8UA 1XOAA 5ECMB 1XW5A 2OACA 1EV4A 5F07A 2PN8A 4BWQA 3WD6A 3KXOA 1MEKA 2DJJA 3EVIA 5H5SA 3L78A 4KB3A 2JADA 4MJCA 3UEMA 3IRAA 4F0CA 5LD0A 1Z3EA 3VWWA 2HZFA 2WZ9A 4LMVA 4WEYA 1DE2A 2VOCA 1SKSB 1Z5YE 3VWVA 1WRYA 2CQ9A 2IL3A 3TDGA 1BQ7A 3P90A 4V2NA 4F03A 2X8HA 4I5QA 3ZFLA 1ABAA 2H0GA 3N9JA 2FGXA 4GLTA 3TCOA 2H1AA 4MLYA 5CRWA 1V9WA 4MJBA 1HNBA 5DAKA 3RDWA 2WJUA 4OD7A 4F2IA 4N0VA 3HVVA 4MA9A 1Z9HA 4BVYA 2YP6A 1DSBA 4OFNA 2AHEA 4MCUA 1SD8A 4MPFA 5DVBA 1EGRA 1EWXA 1XVQA 5B6NA 2CX3A 4KDXA 3ZFBA 4YH2A 3VI7A 2KHPA 2CV4A 2L5OA 3APOA 4IVFA 4G9HA 2RM5A 1ERUA 5ECRB 5ELAA 2A2SA 3ED3A 2REMA 2C3NA 3UOMA 3PINA 4LA1A 1AW9A 2OE1A 1F9MA 3KMNA 5EPFA 5IIZA 3UARA 1GSUA 3CTGA 2GTUA 3KTLA 3CYNA 3ZVJD 2LQOA 1M0UA 3V1WA 2QKEA 4HU7A 4ZB9A 1K0DA 4TR1B 2H0HA 1FG4A 1OE7A 5F06A 2TIRA 1TU8A 3W8JA 1OKDA 5F0GA 3FRCA 3H93A 4IKHA 1ST9A 1A23A 4EVMA 2I81A 3EMPA 2DC5A 3CRTA 4BL7A 4WXTA 5H5QA 2P0GA 1TRWA 4K7IA 5CP1A 1Y25A 5D96A 3TOTA 1LBKA 3ME8A 1GTAA 3VWUA 1T00A 18GSA 3D22A 3UBKA 2EIQA 2O85A 1F37A 4CHSA 5CYYA 5ELGA 2B5EA 2RUEA 1FVJA 2PPTA 4POMA 3HY2A 2GT5A 1A0FA 3O3TA 2NVLA 5DALA 2H01A 5J4UA 3FZAA 1H4OA 4WBRD 3C1SA 5A4UA 3LQ7A 1YDKA 2WDUA 4I2UA 2H71A 2O8VB 2H1BA 2J23A 1XWAA 5AGYA 2JL4A 1XZOA 3CSIA 5JCGA 3D0ZA 2AYTA 1OC8A 5J9CA 1TRVA 3O76A 3E0UA 3IA1A 4NXIA 2L6CA 1MDIA 5L71A 6GSYA 1R5AA 11GSA 2LNTA 1FB0A 2H0IA 3NIVA 2R5GA 3HKRA 5B8BA 5J9BA 5F8BA 3DYRA 4K0GA 3KTBA 2GLRA 2ON5A 2H6ZA 2ZNMA 1B9XC 3UBLA 3LORA 4JU5A 1GUMA 3R2QA 3PGTA 2LJKA 2IIYA 4WR5A 1FHEA 5IM9A 4OCEA 4EE0A 1TU7A 2FUG2 4N10A 4HQZA 3IAM2 3G9BA 3TKRA 1SK2A 2FA4A 4MDCA 1SKRB 3L0HA 1PL1A 4IQ1A 3A2WA 4ZXGA 3EYTA 2CAQA 5EL8A 4NMUA 4KUNA 2HSHA 5G1LA 2LJRA 3GURA 2VL2C 6GSTA 3UAPA 2YV7A 1MD4A 3OR5A 2HLSA 4RUVA 5ID2A 2YJHA 3PR8A 2XPDA 1GL8A 1RQMA 1QUWA 3KP8A 2O7KA 1T8EB 4KDUA 5FHIA 1KBNA 1SKWB 5DQYA 1WOUA 3C7MA 1SL0B 4RI6A 5IQYA 4KSOA 3ZMKA 2YWNA 4I8BA 3W8SA 2H72A 3CRUA 2BMXA 2QC7A 5D9TA 5KEJA 1AC1A 5IOXA 4HUAA 4MK3A 3D5JA 1M2DA 3IHQA 1A2LA 5AIVA 5A4VA 1FAAA 3TUEA 2LRTA 2BJXA 2D2ZA 5ECOB 4YQVA 1JZOA 2GZZA 3TKSC 5C00A 4DSQA 4MZCA 5HQPA 5IOWA 4ZB6A 4V2LA 3Q6OA 4XIHA 2K18A 4GRFA 4HI7A 2IMEA 1PQNA 1MDKA 5ECIB 4YQMA 2EIRA 1M9AA 2NBSA 4L0UA 5D73A 4V1Ap 2LEGA 3APQA 1OC9B 1VF2A 2H74A 1O8XA 2MBSA 1XPVA 2JU5A 2VCVA 3M1GA 2LS5A 3TJKA 2O89A 3LGCA 4TKYA 4YQUA 3TKPA 1OE8A 3UJ1A 1MDJA 4P3YB 1OYJA 3WT1A 3GKKA 5IMVA 3FEUA 5HR2A 3LG6A 4LMWA 2WGRA 5LCZA 6GSXA 2DJ2A 2YJ7A 3KGKA 3GYKA 4KH7A 1PL2A 3FR9A 4I6XA 3TJBA 5B6MA 2PBJA 2YWIA 1EOHA 2H73A 4HS1A 2X99A 1GTUA 2KOKA 5A4WA 4GQFA 3EURA 2IMKA 4KCAA 4OO5A 1ZYQB 4NWYA 2C0FA 4TW5A 1GSSA 2K9FA 4LL1B 3GKXA 4O32A 2PERA 1F2EA 3O6TA 3F0IA 5INYA 4OCFA 4MZWA 3EU4A 5HFKA 1THOA 4FYBA 2C8UA 3H79A 2FD3A 1GLPA 2I3YA 1PX7A 5IMFA 3QAWA 2H6XA 1U3IA 4JR6A 2YWMA 2MYGA 5COHA 2VD1A 3DEXA 2VCWA 2A4VA 4GF0A 2O87A 4GCIA 20GSA 1GULA 2E2GA 3GSTA 4XS4B 1AQWA 5AISA 5D9WA 1AQVA 2JACA 1X9SB 1XOBA 1PX6A 2WRTA 1G7EA 2C0GA 2VLUA 1OKTA 2MZCA 5CNWA 5IO2A 1YEPA 3MWHA 1WP0A 3LXTA 1NW2A 4HEA2 4QL7A 5H5RA 4AJ8A 3J7Yk 2M80A 1TRSA 1XWBA 5G30A 1B4PA 3ZIVA 1W4VA 5HR0A 3BJ5A 3RPPA 3G7IA 1U88A 1EEMA 3DGQA 3ZYWA 3F6DA 2WFCA 3TRQA 4ZL9A 2CZ2A 4GSTA 1ERVA 5ECKB 3M8NA 2C3TA 4QQ7A 1KEBA 4HQSA 4RI7A 2TRCP 2IFQB 2K6VA 1DUGA 2CVKA 3ZVJA 5J3RA 4N30A 2VO4A 4DVCA 2IWTA 1JZRA 3US3A 6GSSA 1GNEA 1THXA 4EC0A 3AY8A 1TKDB 5D9VA 2VL2A 2K8SA 1UVZA 1ZOFA 2A2RA 2FNOA 4N11A 4AJ7A 2B7JA 2B1LA 4ECJA 3U5RE 5DDLA 4NPBA 1TDIA 4OMVA 3UL3A 1OAZA 1GP1A 1F6MC 3DWVA 4JR4A 2L59A 2WULA 3HZ8A 1FB6A 3EINA 5DCGA 1K0BA 1GSYA 3FW2A 1LJRA 1XWCA 3GV1A 3BCKA 3FK8A 4WF4A 1ACVA 3GX0A 2FY6A 4EF0A 3F4TA 3GTUB 1A24A 3IBHA 1TK5B 3TJJA 1XCCA 2DIZA 2IMIA 2IMFA 4OFMA 5CREA 3TKSA 3P7XA 4MMMA 3QFAC 2XC2A 1X5EA 5ABRA 2DJ1A 2CAIA 5DQSA 1EV9A 1XVWA 1X5DA 3TJGA 1B4QA 4ID0A 4IGJA 1E2YA 5JWOB 2CA8A 3L9VA 1Z6NA 1OC3A 3IV4A 3ISOA 3Q19A 2PMTA 2YNXA 4FYCA 4ZB8A 3JCML 4GSNA 3I6AA 3FHKA 4Q5RA 1NHOA 1ZZYA 1GNWA 2JZTA 1Q98A 1Z6MA 4DEJA 1EP8A 4JRRA 3QAGA 3UVHA 2LNSA 3H4KA 5B7CA 3VK9A 2QSIA 2HZEA 5GSTA 1XW9A 2HE3A 4KDYA 1ZGNA 1VGLA 2JSYA 3QPMA 3HCZA 5LNKe 3D4TA 3ZITA 1U3AA 1A8LA 1SYRA 13GSA 3HJPA 1BEDA 3FZ9A 2P31A 4POBA 2N5FA 4MPGA 2HFDA 1SU9A 1O81A 2GT6A 1VF1A 3F63A 4G10A 4IJIA 1K3YA 3VWXA 2HYXA 2FLSA 3RBTA 2HRNA 4ML1A 3BD2A 1O7UA 2YCDA 4MJEA 1V57A 1ERWA 2VL3A 2MMOA 4TN8A 3HA9A 4EDYA 2GSRA 2F8AA 2OE0A 3TJFA 3LYKA 4TR4A 5G5FA 1AXDA 3CMIA 1V40A 4WF5A 5HFIA 2KLXA 3F4SA 3DXBA 3RHCA 1AUCA 14GSA 1Y6EA 1AQXA 4I2TA 4DSSA 5J41A 4E8HA 4EL1A 3UVTA 1GSFA 4O5RA 2I9HA 3F6FA 1SENA 1JZWA 3Q18A 1TP9A 2H1DA 2JZSA 1Z7PA 2OE3A 4D73A 4FIWA 3WT2A 2VL9A 2X8GA 3HVSA 3TOUA 4EKZA 1V58A 2PWJA 2H70A 4ZBAA 1ML6A 3NZNA 1EEJA 3IK7A 9GSSA 1N8JA 3TB2A 3GL3A 3FYGA 1O85A 5B8AA 3HDCA 5JCUA 4BVXA 4L8EA 2WB9A 3D4MA 3HYPA 2AJQB 1YZXA 3QCPA 3MDKA 2YPMA 5IPHA 22GSA 3P8WA 2L6DA 5HR3A 4GQCA 4X0XA 1I9DA 5D93A 4KW6A 3BBYA 2V2GA 2ZUPA 4PGTA 2DJ0A 1EZKA 2IN3A 1ON4A 4HJ2A 1JFUA 4PUAA 3IR4A 2FHEA 4V1Ag 4KX4A 1WPIA 4ACSA 2TRXA 3CTFA 4J2FA 4ZL7A 3DVXA 4NV5A 5CRDA 4MP4A 4NV2A 4DSRA 1RW1A 1G0TA 1RK4A 2RIIA 2VCQA 3HD5A 4TXOA 2VD0A 5DJMA 4L5OA 3TKSE 3FZ5A 4K6XA 1SL1B 1FOVA 1TK8B 2LUSA 5DAKB 6GSWA 4XRDA 2L4CA 1X9MB 4K1FA 1F3AA 1GUKA 1J08A 4IHUA 3CXGA 4H86A 1HNAA 1YF0A 3F3QA 3FZ4A 4XCSA 2KP1A 2WS2A 5E59A 3FR3A 4TR0A 1FVKA 2GQKA 3ZTLA 1XW6A 1NSWA 2ZCTA 3CSJA 1GSDA 2V6KA 3IPZA 4QL9A 4CDOA 3KJYA 4KE3A 2E0QA 5KN1A 1TOFA 1QGVA 3LYPA 3D6IA 1R7HA 1J0FA 1F3BA 4GXZA 1TTZA 5IMZA 1U87A 2PVQA 4KNDA 2VCZA 1PKWA 2DMLA 1B9YC 1G6WA 4X43A 1S3DA 5AN1A 1MD3A 3E3EA 2IMDA 2ALBA 1JLWA 5DBQA 2XHFA 4ECCA 2H6YA 1UC7A 1PD21 3GMFA 1GSEA 5GZZB 3HXSA 1PSQA 6GSUA 4EUYA 1V98A 3KCMA 1NHYA 3M0FA 3IXRA 1WJKA 4TR3A 5FWGA 2FA8A 4WETA 1QMVA 2F9SA 4WBJA 1URMA 2N5BA 2NDOA 2CX4A 1QFNA 3BOAA 1XFLA 1N2AA 1R26A 3M3MA 5G2ZA 3I69A 3A2VA 2XBQA 3TRPA 3GL5A 3DD3A 1HD2A 1DBYA 3GHAA 4TOPA 1SD9A 4K2DA 3W6GA 2B3SA 2E7PA 4IP1A 5ECLB 1JHBA 5DALB 2G2QA 1J9BA 1VF3A 4JE1A 3ZIJA 3PH9A 2I4AA 3KH7A 4KSMA 3ERFA 1TJDA 5D9XA 2MMZA 2RLIA 2GQMA 2CT6A 3DMLA 6GSVA 4HZ2A 4IQAA 1O73A 1QQ2A 5E4WA 2PU9C 3S9FA 2H1GA 3RHBA 2DLXA 5JWRB 3KH9A 2VM2A 3GSSA 3ZZXA 1PRXA 4YAVA 5JCWA 4XTSA 4TVEA 4PQIA 2GGTA 1PN9A 4ZL8A 2AUVA 3QOUA 3HJMA 1M2AA 1JZDA 4TR1A 2CZ3A 4FO5A 4I97A 4ECIA 1XWKA 5HFGA 5CRHA 4ZBBA 4MH2A 2WCIA 2GSQA 3KEBA 2LSTA 1A2JA 4XRAA 5J5NA 4CW9A 2GZPA 2C80A 1XWGA 3IDVA 5EY6A 4ZBDA 3FY7A 2R37A 4F9ZA 1XXUA 3EMXA 3GKNA 1T4YA 3F3RA 1W89A 2DSAA 1BJXA 5IMAA 4ECBA 5ID2B 3SBCA 1SJ6A 1SYXA 2R2JA 3GNJA 5HR1A 2HSYA 1CQHA 4MH3A 1TW9A 1CQGA 4PURA 1K3OA 4JBBA 3LSZA 2OBIA 3GH9A 4IW9A 1SK1A 3GIXA 1M99A 3IOSA 5CRGA 1UN2A 2YN1A 2OADA 3L9SA 3J7Yb 3E9JB 4JEDA 4IJ3A 3L4NA 4BPYA 1U6TA 4IS0A 4JZQA 2NPBA 3IK9A 1S3CA 5F05A 3GA4A 3WGEA 5G1KA 3NOFA 4HOJA 1H75A 4PQ1A 3GUSA 1BAYA 5G5EA 4EXJA 1DE1A 4K0NA 2R4VA 8GSSA 5CO3A 1K0OA 3A3TA 2VLVA 1SJZA 1GRXA 7GSSA 4PNFA 1PA3A 3MSZA 4IBPA 2V41A 2LKUA 2JZRA 1YQ1A 4J56E 1X0RA 3VFIA 3QDNA 4IP6A 2L5LA 2KP2A 3VPQA 2F51A 1JLVA 4LL4B 4GWRA 2P5QA 3ZREA 3BCIA 2FCHA 1TK0B 1HNCA 3HHVA 3GKMA 2H19A 2EIOA 4O92A 1X5CA 2GSSA 4XHMA 1E6BA 4KGIA 2C0EA 1SK0A 3MNGA 3KP9A 3MAKA 2B5XA 4ZILA 5D8IA 1KTEA 2X8CA 1WWJA 3LFLA 1UA5A 2HXKA 1PGTA 2DMMA 4FYUA 2FWEA 2MMAA 1GLQA 5KN3A 1BX9A 1WMJA 3UIWA 19GSA 2VM1A 3LXZA 4V2MA 1QXHA 17GSA 2B6MA 4HZ4A 4KCEA 4PX1A 3G7YA 3TRXA 1GWCA 4K8MA 4RQRA 4K7NA 1I5GA 1T7PB 4ML6A 1R5PA 2LTKA 2C1YA 4GTUA 1YJ6A 1XIYA 1A8YA 3TGZA 5GAND 3GN3A 2E2MA 2M46A 2GSTA 4IN0A 12GSA 1S3AA 2OKAA 4TRXA 3RPNA 2H30A 4L0WA 5EVOA 1M9BA 1HYUA 3H1NA 2HRFA 4L5LA 5G31A 2F8FA 3EWLA 2G0FA 4G19A 4YAPA 5DJLA 3FR6A 3ZLPA 2PGTA 1FO5A 1V2AA 1OC9A 3EU3A 4X1UA 3N5OA 5IO0A 1GSQA 1IYIA 5FT3A 2GQLA 2DIYA 2VUPA 3TKQA 2CVBA 1G6YA 4ULXA 3LEFA 3WGXA 3Q74A 2R3XA 3LWAA 4NHZA 10GSA 1PKZA 4MZBA 3D21A 2XBIA 2FWGA 2B7KA 4KA0A 4ZIJA 1YF1A 5C04A 1T4ZA 4TXVA 3KM6A 1A0RP 4BWSA 1B48A 3M9KA 4ISDA 2GZYA 2LQQA 2Z9SA 3UMAA 5DCHA 1QK8A 2N5AA 2FWHA 2XPEA 1C72A 2QGVA 2KUCA 3DKSA 4NHWA 4POLA 2GDRA 4MF5A 2LRCA 1X9WB 2PUKC 4F82A 4HJMA 1BYEA 1VRSD 1WIKA 3FKFA 3VI5A 1O8WA 3VLNA 5KN0A 2H76A 2CVDA 2VCXA 3ERGA 4XS4A 2YOIA 1WE0A 2MMNA 3QMXA 3RAZA 4O7HA 2P5RA 2H75A 2RM6A 3KD0A 1YEXA 2VIMA 2YWOA 1NM3A 1R4WA 4RQXA 2BTOT 16GSA 3H8QA 2L57A 1USBA 2JSZA 3SWLA 4AGSA 4AJ6A 1ZL9A 2YZUA 3EE2A 2DBCA 4K9ZA 4IELA 2H66A 1PMTA 1ZMAA 1XBSA 1AAZA 1TI1A 3DVWA 4Z7XA 1SL2B 2IFQA 4F0BA 1TXXA 2OBKA 3EC3A 1ERTA 2EC4A 2YZHA 2LJAA 3IAS2 2LRNA 3U6VA 5ECPB 2M72A 4MABA 4MF7A 2AB6A 4Q5NA 2HZEB 1ZYEA 2C4JA 2R6KA 3GX8A 5A5KA 1SJIA 2V6OA 4OWYA 1TRUA 1K0AA 1YKCA 2GVPA 2DJKA 1KNGA 1Z7RA 1IYHA 2ON7A 1AIUA 4ILFA 4HDEA 2L4QA 3QAVA 1ZCPA 4OFTA 4XS1A 3C8EA 3C1RA 2C0DA 1M2BA 1VF4A 1YKAA 4MJAA 1M7TA 4NAXA 4PUFC 3K8NA 1FW1A 2C3QA 1GUHA 3HVXA 5ECNB 3P2AA 3GTUA 3GRXA 4MF6A 5IMDA 4BA7A 3IC4A 2IJYA 1O6JA 5KN2A 4XS6A 2VLTA 3F9UA 4PNGA 4DSSB 4OO4A 2F3MA 4FH8A 2HNLA 5IPGA 3C73A 3WGDA 3M9JA 1GTBA 5GSSA 3QFBC 1A2MA 4WR4A 5ECHB 1EGOA 3CSHA 4WKWA 2VAFA 1HQOA 1B8XA 4D73B 1K0NA 1YY7A 1TI3A 1T3BA 3VPTA 4GSSA 4K7OA 4LLRA 1G7OA 2NTOA 2AAWA 5ECSA 3WYWA 1T1VA 3DIEA 2RUFA 5ECQB 2ES7A 2DJ3A 1GTIA 3IE3A 5GAPD 5IMCA 4J57E 3F4RA 2I1UA 3ME7A 1LU4A 3CBUA 2LV3A 2J9HA 4EDZA 1Q4JA 1EOGA 2K8VA 3A2XA 1OVNA 2OJLA 4EO3A 2H8LA 4KAEA 2OA7A 3LJRA 4POKA 3KZQA 3ZMLA 3QD9A 2HT9A 3KMOA 2VCTA 3C71A 4PXOA 3ZRDA 3G7JA 2B5YA 3HZ4A 3GFKA 3QR6A 3L9UA 3ERWA 3APSA 1BG5A 4N0ZA 4TXOB 4AF2A 3HJOA 1MTCA 4G2EA 2X64A 2AV4A 1K0MA 3I43A 1GH2A 2YANA 2HI7A 2YV9A 4Q5QA 2FWFA 2V32A 5ENUA 2GS3A 2PVOC 5JWQB 1K3LA 1K0CA 5CAXA 1EP7A 3I9V2 1ILOA 2MBTA 2IPAA 2V1MA 4E8EA 3ZL5A 3KIJA 3GH6A 5AIXA 2B1KA 4Q5FA 4PQHA
chains in the Genus database with same CATH superfamily
3DRNA 4HU9A 3VURA 3A5WA 3F8UA 1XOAA 5ECMB 1XW5A 2OACA 1EV4A 5F07A 2PN8A 4BWQA 3WD6A 3KXOA 1MEKA 2DJJA 3EVIA 5H5SA 3L78A 4KB3A 2JADA 4MJCA 3UEMA 3IRAA 4F0CA 5LD0A 1Z3EA 3VWWA 2HZFA 2WZ9A 4LMVA 4WEYA 1DE2A 2VOCA 1SKSB 1Z5YE 3VWVA 1WRYA 2CQ9A 2IL3A 3TDGA 1BQ7A 3IHGA 3P90A 4V2NA 4F03A 2X8HA 4I5QA 3ZFLA 1ABAA 2H0GA 3N9JA 4HSCX 2FGXA 4GLTA 3TCOA 4Z2UA 2X4AA 2H1AA 4MLYA 5CRWA 4ICYA 1V9WA 4MJBA 1HNBA 5DAKA 3RDWA 2WJUA 4OD7A 4F2IA 4N0VA 3HVVA 4MA9A 1Z9HA 4BVYA 2YP6A 1DSBA 4OFNA 2AHEA 4MCUA 1SD8A 4MPFA 5DVBA 1EGRA 1EWXA 1XVQA 5B6NA 2CX3A 4KDXA 3ZFBA 4YH2A 3VI7A 2KHPA 2CV4A 2L5OA 3APOA 4IVFA 4G9HA 2RM5A 1ERUA 5ECRB 5ELAA 2A2SA 3ED3A 2REMA 2C3NA 3UOMA 3PINA 4LA1A 1AW9A 2OE1A 1F9MA 3KMNA 5EPFA 5IIZA 2R0PA 3UARA 1GSUA 3CTGA 2GTUA 3KTLA 3CYNA 4EIQA 3ZVJD 2LQOA 1M0UA 3V1WA 2QKEA 4HU7A 4ZB9A 1K0DA 4TR1B 2H0HA 1FG4A 1OE7A 5F06A 1TU8A 3W8JA 1OKDA 5F0GA 3FRCA 3H93A 4IKHA 1ST9A 1A23A 4EVMA 2I81A 3EMPA 2DC5A 3CRTA 4BL7A 4WXTA 5H5QA 2P0GA 1TRWA 4K7IA 5CP1A 1Y25A 5D96A 3TOTA 1LBKA 3ME8A 1GTAA 3VWUA 1T00A 18GSA 3D22A 3UBKA 2EIQA 2O85A 1F37A 4CHSA 5CYYA 5ELGA 2B5EA 2RUEA 1FVJA 2PPTA 4POMA 3HY2A 2GT5A 1A0FA 3O3TA 2NVLA 5DALA 2H01A 5J4UA 3FZAA 1H4OA 4WBRD 3C1SA 5A4UA 3LQ7A 1YDKA 2WDUA 4I2UA 3CQFA 2H71A 2O8VB 2H1BA 2J23A 1XWAA 5AGYA 2JL4A 1XZOA 3CSIA 5JCGA 3D0ZA 2AYTA 1OC8A 5J9CA 1TRVA 3O76A 3E0UA 3IA1A 4NXIA 2L6CA 1MDIA 5L71A 6GSYA 3IC8A 1R5AA 11GSA 4O5QA 2LNTA 1FB0A 2H0IA 3NIVA 2R5GA 3HKRA 5B8BA 5J9BA 5F8BA 3DYRA 4K0GA 3KTBA 5AIXA 2GLRA 2ON5A 2H6ZA 2ZNMA 1B9XC 3UBLA 3LORA 4JU5A 1GUMA 3R2QA 3PGTA 2LJKA 2IIYA 4WR5A 1FHEA 5KOXA 5IM9A 4OCEA 4EE0A 1TU7A 2FUG2 4N10A 4HQZA 3IAM2 3G9BA 3TKRA 1SK2A 2FA4A 4MDCA 1SKRB 3L0HA 1PL1A 2R0GA 4IQ1A 3A2WA 4ZXGA 3EYTA 2CAQA 5EL8A 4NMUA 4KUNA 2HSHA 5G1LA 2LJRA 3GURA 2VL2C 6GSTA 3UAPA 2YV7A 1MD4A 3OR5A 2HLSA 2A2PA 4RUVA 2YJHA 5ID2A 3PR8A 2XPDA 1GL8A 1RQMA 1QUWA 3KP8A 2O7KA 1T8EB 4KDUA 5FHIA 1KBNA 1SKWB 5DQYA 1WOUA 3C7MA 1SL0B 4RI6A 5IQYA 4KSOA 3ZMKA 2YWNA 4I8BA 3W8SA 2H72A 3CRUA 2BMXA 2QC7A 5D9TA 5KEJA 1AC1A 5IOXA 4HUAA 4MK3A 3D5JA 1M2DA 3IHQA 2QA1A 1A2LA 5AIVA 5A4VA 1FAAA 3TUEA 2LRTA 2BJXA 2D2ZA 5ECOB 4YQVA 1JZOA 1M3JA 4G0IA 2GZZA 3TKSC 5C00A 4DSQA 4MZCA 5HQPA 5IOWA 4ZB6A 4V2LA 3Q6OA 4XIHA 2K18A 4GRFA 4HI7A 2IMEA 1PQNA 1MDKA 5ECIB 4YQMA 2EIRA 1M9AA 2NBSA 4L0UA 5D73A 4V1Ap 2LEGA 3APQA 1OC9B 1VF2A 2H74A 1O8XA 2MBSA 1XPVA 2JU5A 2VCVA 3M1GA 2LS5A 3TJKA 2O89A 3LGCA 4TKYA 4YQUA 3TKPA 1OE8A 3UJ1A 1MDJA 4P3YB 1OYJA 3WT1A 3GKKA 5IMVA 3FEUA 5HR2A 3LG6A 4LMWA 2WGRA 5LCZA 6GSXA 2DJ2A 2YJ7A 3KGKA 3GYKA 4KH7A 1PL2A 1S3RA 3FR9A 4I6XA 3MIXA 3TJBA 5B6MA 2PBJA 2YWIA 1EOHA 2H73A 4HS1A 2X99A 1GTUA 2KOKA 5A4WA 4GQFA 3EURA 2IMKA 4KCAA 4OO5A 1ZYQB 4NWYA 2C0FA 4TW5A 1GSSA 2K9FA 4LL1B 3GKXA 4O32A 2PERA 1F2EA 3O6TA 3F0IA 5INYA 4OCFA 4MZWA 3EU4A 5HFKA 1THOA 4FYBA 2C8UA 3H79A 2FD3A 1GLPA 2I3YA 1PX7A 5IMFA 3QAWA 2H6XA 1U3IA 4JR6A 2YWMA 2MYGA 5COHA 2VD1A 3DEXA 3FMWA 2VCWA 2A4VA 4GF0A 2O87A 4GCIA 20GSA 1GULA 2E2GA 3GSTA 4XS4B 1AQWA 5AISA 5D9WA 1AQVA 2JACA 1X9SB 1XOBA 1PX6A 2WRTA 1G7EA 2C0GA 5KOWA 2VLUA 1OKTA 2MZCA 5CNWA 5IO2A 1YEPA 3MWHA 1WP0A 3LXTA 1NW2A 4HEA2 4QL7A 5H5RA 4AJ8A 3J7Yk 1FOHA 2M80A 1TRSA 1XWBA 5G30A 1B4PA 3ZIVA 1W4VA 5HR0A 3BJ5A 3RPPA 3G7IA 1U88A 1EEMA 3DGQA 3ZYWA 3PPUA 3F6DA 2WFCA 3TRQA 3MYDA 4ZL9A 2CZ2A 4GSTA 1ERVA 5ECKB 3M8NA 2C3TA 4QQ7A 1KEBA 4HQSA 4RI7A 2TRCP 2IFQB 2K6VA 1DUGA 2CVKA 3ZVJA 5J3RA 4N30A 2VO4A 4DVCA 2IWTA 1JZRA 3US3A 6GSSA 1GNEA 1THXA 4EC0A 3AY8A 1TKDB 5D9VA 2VL2A 2K8SA 1UVZA 1ZOFA 2A2RA 4G0KA 2FNOA 4N11A 4AJ7A 2B7JA 2B1LA 4ECJA 3U5RE 5DDLA 4NPBA 1TDIA 4OMVA 3UL3A 1OAZA 1GP1A 1F6MC 3DWVA 4JR4A 2L59A 2HSMA 2WULA 3HZ8A 1FB6A 3EINA 5DCGA 1K0BA 1GSYA 3FW2A 1LJRA 1XWCA 3GV1A 3BCKA 3FK8A 4WF4A 1ACVA 3GX0A 2FY6A 4EF0A 3F4TA 3GTUB 1A24A 3IBHA 1TK5B 3TJJA 1XCCA 2DIZA 2IMIA 2IMFA 4OFMA 5CREA 3TKSA 3P7XA 4MMMA 3QFAC 2XC2A 1X5EA 5ABRA 2DJ1A 2CAIA 5DQSA 1EV9A 1XVWA 1X5DA 3TJGA 1B4QA 4ID0A 4IGJA 1E2YA 5JWOB 2CA8A 3L9VA 1Z6NA 1OC3A 3IV4A 3ISOA 3Q19A 2PMTA 2YNXA 4FYCA 4ZB8A 3JCML 4GSNA 3I6AA 3FHKA 4Q5RA 1NHOA 1ZZYA 1GNWA 2JZTA 1Q98A 1Z6MA 4DEJA 1EP8A 4JRRA 3QAGA 3UVHA 2LNSA 3H4KA 5B7CA 3VK9A 2QSIA 2HZEA 5GSTA 1XW9A 2HE3A 4KDYA 1ZGNA 1VGLA 2JSYA 3QPMA 3HCZA 5LNKe 3D4TA 3ZITA 1U3AA 1A8LA 1SYRA 13GSA 3HJPA 1BEDA 3FZ9A 2P31A 4POBA 2N5FA 4MPGA 2HFDA 1SU9A 1O81A 2GT6A 2HRAA 1VF1A 3F63A 4G10A 4IJIA 4X4JA 1K3YA 3VWXA 2HYXA 2FLSA 3RBTA 1ZYNA 2HRNA 4ML1A 3BD2A 1O7UA 2YCDA 4MJEA 1V57A 1ERWA 2VL3A 1PFOA 2MMOA 4TN8A 3HA9A 4EDYA 2GSRA 2F8AA 2OE0A 3TJFA 3LYKA 4PTSA 4TR4A 5G5FA 1AXDA 3CMIA 1V40A 4WF5A 5BMUA 5HFIA 2KLXA 3F4SA 3DXBA 3RHCA 1AUCA 14GSA 1Y6EA 1PN0A 4YKFA 1AQXA 4I2TA 4DSSA 5J41A 4E8HA 4EL1A 3UVTA 1GSFA 4O5RA 2I9HA 3F6FA 1SENA 1JZWA 3Q18A 1TP9A 2H1DA 2JZSA 1Z7PA 2OE3A 4D73A 4FIWA 3WT2A 2VL9A 2X8GA 3HVSA 4CY6A 3TOUA 4KF9A 4EKZA 1V58A 2PWJA 2H70A 4ZBAA 1ML6A 3NZNA 1EEJA 3IK7A 9GSSA 1N8JA 3TB2A 3GL3A 3FYGA 1O85A 5B8AA 2DKHA 3HDCA 5JCUA 4BVXA 4L8EA 2WB9A 3D4MA 3HYPA 2AJQB 1YZXA 3QCPA 3MDKA 2YPMA 5IPHA 22GSA 3P8WA 2L6DA 5HR3A 4GQCA 4X0XA 1I9DA 5D93A 4KW6A 3BBYA 2V2GA 2ZUPA 4PGTA 2DJ0A 1EZKA 2IN3A 1ON4A 4HJ2A 1JFUA 4PUAA 3IR4A 2FHEA 4V1Ag 4KX4A 1WPIA 4EIPA 4ACSA 2TRXA 3CTFA 4J2FA 4ZL7A 3DVXA 4NV5A 5CRDA 4MP4A 4NV2A 4DSRA 1RW1A 1G0TA 1RK4A 2RIIA 2VCQA 3HD5A 4TXOA 2VD0A 5DJMA 4L5OA 3TKSE 3FZ5A 4K6XA 1SL1B 1FOVA 1TK8B 2LUSA 4MNNA 5DAKB 6GSWA 4XRDA 2L4CA 1X9MB 4K1FA 1F3AA 1GUKA 1J08A 4IHUA 4BVYB 3CXGA 4H86A 1HNAA 1YF0A 3F3QA 3FZ4A 4XCSA 2KP1A 2WS2A 5E59A 3FR3A 4TR0A 1FVKA 2GQKA 3ZTLA 1XW6A 1NSWA 2ZCTA 3CSJA 1GSDA 2V6KA 3IPZA 4QL9A 2R0CA 4CDOA 3KJYA 4KE3A 2E0QA 5KN1A 1TOFA 1QGVA 3LYPA 3D6IA 1R7HA 1J0FA 1F3BA 4GXZA 1TTZA 5IMZA 1U87A 2PVQA 4KNDA 2VCZA 1PKWA 2DMLA 1B9YC 1G6WA 4X43A 1S3DA 5AN1A 1MD3A 3E3EA 2IMDA 2ALBA 1JLWA 5DBQA 2XHFA 4ECCA 2H6YA 1UC7A 1PD21 3GMFA 1GSEA 5GZZB 3HXSA 1PSQA 6GSUA 4EUYA 1V98A 3KCMA 1NHYA 3M0FA 3IXRA 1WJKA 4BL7B 4TR3A 5FWGA 2FA8A 4WETA 1QMVA 2F9SA 4WBJA 1URMA 2N5BA 2NDOA 2CX4A 1QFNA 3BOAA 1XFLA 1N2AA 1R26A 3M3MA 5G2ZA 3I69A 3A2VA 2XBQA 3TRPA 3GL5A 3DD3A 1HD2A 1DBYA 3GHAA 4TOPA 1SD9A 4K2DA 3W6GA 2B3SA 2E7PA 4IP1A 5ECLB 1JHBA 5DALB 2G2QA 1J9BA 1VF3A 4JE1A 3ZIJA 3PH9A 2I4AA 3KH7A 4KSMA 3ERFA 1TJDA 5D9XA 2MMZA 2RLIA 2GQMA 2CT6A 3DMLA 6GSVA 4HZ2A 4IQAA 1O73A 1QQ2A 5E4WA 2PU9C 3S9FA 2H1GA 3RHBA 2DLXA 4A5PA 5JWRB 4Z2TA 3KH9A 2VM2A 3GSSA 3ZZXA 1PRXA 4YAVA 5JCWA 4XTSA 4TVEA 4PQIA 2GGTA 3LW9A 1PN9A 4ZL8A 2AUVA 3QOUA 3HJMA 1M2AA 1JZDA 4TR1A 2CZ3A 4FO5A 4G0LA 4I97A 4ECIA 1XWKA 2HRKA 5HFGA 5CRHA 4ZBBA 4MH2A 2WCIA 2GSQA 3KEBA 2LSTA 1A2JA 4XRAA 5J5NA 4CW9A 2GZPA 2C80A 1XWGA 3IDVA 5EY6A 4ZBDA 3FY7A 2R37A 4K5RA 4F9ZA 1XXUA 3EMXA 3GKNA 1T4YA 3F3RA 1W89A 2DSAA 1BJXA 5IMAA 4ECBA 5ID2B 3SBCA 1SJ6A 1SYXA 2R2JA 3HVNA 3GNJA 5HR1A 2HSYA 1CQHA 4MH3A 1TW9A 1CQGA 4PURA 1K3OA 4FQUA 4JBBA 3LSZA 2OBIA 3GH9A 4IW9A 1SK1A 3GIXA 1M99A 3IOSA 5CRGA 1UN2A 2YN1A 2OADA 3L9SA 3J7Yb 3E9JB 4JEDA 4IJ3A 3L4NA 4BPYA 1U6TA 4IS0A 4JZQA 2NPBA 3IK9A 1S3CA 1XG8A 5F05A 3GA4A 3WGEA 5G1KA 3NOFA 4HOJA 1H75A 4PQ1A 3GUSA 1BAYA 5G5EA 4EXJA 1DE1A 4K0NA 2R4VA 8GSSA 5CO3A 1K0OA 3A3TA 4K2XA 2VLVA 1SJZA 1GRXA 7GSSA 4PNFA 1PA3A 3MSZA 4IBPA 2V41A 2LKUA 2JZRA 1YQ1A 4J56E 1X0RA 3VFIA 3QDNA 4IP6A 2L5LA 2KP2A 3VPQA 2F51A 1JLVA 4LL4B 4GWRA 2P5QA 3ZREA 4USSA 3BCIA 2FCHA 1TK0B 1HNCA 3HHVA 3GKMA 2H19A 2EIOA 4O92A 1X5CA 2GSSA 4XHMA 1E6BA 4KGIA 2C0EA 1SK0A 3MNGA 3KP9A 3MAKA 2B5XA 4ZILA 5D8IA 1KTEA 2X8CA 1WWJA 3LFLA 1UA5A 2HXKA 1PGTA 2DMMA 4FYUA 2FWEA 2MMAA 1GLQA 5KN3A 1BX9A 1WMJA 3UIWA 19GSA 2VM1A 3LXZA 4V2MA 1QXHA 17GSA 2B6MA 4HZ4A 4KCEA 4PX1A 3G7YA 3TRXA 1GWCA 4K8MA 4RQRA 1ZYPA 4O5UA 4K7NA 1I5GA 1T7PB 4ML6A 1R5PA 2LTKA 2C1YA 4GTUA 1YJ6A 1XIYA 1A8YA 3TGZA 5GAND 3GN3A 2QA2A 2E2MA 2M46A 2GSTA 4IN0A 12GSA 1S3AA 2OKAA 4TRXA 3RPNA 2H30A 4YKGA 4L0WA 4BIKA 5EVOA 3R3EA 1M9BA 1HYUA 3H1NA 2HRFA 4L5LA 5G31A 2F8FA 3EWLA 2G0FA 4G19A 4YAPA 5DJLA 3FR6A 3ZLPA 2PGTA 1FO5A 1V2AA 1OC9A 3EU3A 4X1UA 3N5OA 5IO0A 1GSQA 1IYIA 5FT3A 2GQLA 2DIYA 2VUPA 3TKQA 2CVBA 1G6YA 4ULXA 3LEFA 3WGXA 3Q74A 2R3XA 3LWAA 4NHZA 10GSA 1PKZA 4MZBA 3D21A 2XBIA 2FWGA 2B7KA 4KA0A 4ZIJA 1YF1A 5C04A 1T4ZA 4TXVA 3KM6A 1A0RP 4BWSA 1B48A 3M9KA 4ISDA 2GZYA 2LQQA 2Z9SA 3UMAA 5DCHA 1QK8A 2N5AA 2FWHA 2XPEA 1C72A 2QGVA 2KUCA 3DKSA 4NHWA 4POLA 2GDRA 4MF5A 2LRCA 1X9WB 2PUKC 4F82A 4HJMA 1BYEA 1VRSD 1WIKA 3FKFA 3VI5A 1O8WA 3VLNA 5KN0A 2H76A 2CVDA 2VCXA 3ERGA 4XS4A 2YOIA 1WE0A 2MMNA 3QMXA 3RAZA 4O7HA 2P5RA 2H75A 2RM6A 3KD0A 1YEXA 2VIMA 2YWOA 1NM3A 1R4WA 4RQXA 2DKIA 2A4HA 2BTOT 16GSA 3H8QA 2L57A 1USBA 2JSZA 3SWLA 4AGSA 4AJ6A 1ZL9A 2YZUA 3EE2A 2DBCA 4K9ZA 4IELA 2H66A 1PMTA 1ZMAA 1XBSA 1AAZA 2X49A 1TI1A 3DVWA 4Z7XA 1SL2B 2IFQA 4F0BA 1TXXA 2OBKA 3EC3A 1ERTA 2EC4A 2YZHA 2LJAA 3IAS2 2LRNA 3U6VA 2M72A 4MABA 5ECPB 4MF7A 2AB6A 4Q5NA 2HZEB 1ZYEA 2C4JA 2R6KA 3GX8A 5A5KA 1SJIA 2V6OA 4OWYA 1TRUA 3EPTA 1K0AA 1YKCA 2GVPA 2DJKA 1KNGA 1Z7RA 1IYHA 2ON7A 1AIUA 4ILFA 4HDEA 2L4QA 3QAVA 1ZCPA 4OFTA 4XS1A 3C8EA 3C1RA 2C0DA 1M2BA 1VF4A 1YKAA 4MJAA 1M7TA 4NAXA 4PUFC 3K8NA 1FW1A 2C3QA 1GUHA 3HVXA 5ECNB 3P2AA 3GTUA 3GRXA 4MF6A 5IMDA 4BA7A 3IC4A 2IJYA 1O6JA 5KN2A 4XS6A 2VLTA 3F9UA 4PNGA 4DSSB 4OO4A 2F3MA 4FH8A 2HNLA 5IPGA 3C73A 5BRTA 3WGDA 3M9JA 1GTBA 5GSSA 3QFBC 1A2MA 4WR4A 5ECHB 1EGOA 3CSHA 4WKWA 2VAFA 1HQOA 1B8XA 4D73B 1K0NA 1YY7A 1TI3A 4Z2RA 1T3BA 3VPTA 4GSSA 4K7OA 4LLRA 1G7OA 2NTOA 2AAWA 5ECSA 3WYWA 1T1VA 3DIEA 2RUFA 5ECQB 2ES7A 2DJ3A 1GTIA 3IE3A 5GAPD 5IMCA 4J57E 3A5IA 2UZ8A 4BVXB 3F4RA 2I1UA 3ME7A 1LU4A 3CBUA 2LV3A 2J9HA 4EDZA 1Q4JA 1EOGA 2K8VA 4K5SA 3A2XA 1OVNA 2OJLA 4EO3A 2H8LA 4KAEA 2OA7A 3LJRA 4POKA 3KZQA 3ZMLA 3QD9A 2HT9A 3KMOA 2VCTA 3C71A 4PXOA 3ZRDA 3G7JA 4CY8A 2B5YA 3HZ4A 3GFKA 3QR6A 3L9UA 3ERWA 3APSA 1BG5A 4N0ZA 4TXOB 4AF2A 3HJOA 1MTCA 4G2EA 2X64A 2AV4A 1K0MA 3I43A 1GH2A 2YANA 2HI7A 2YV9A 4Q5QA 1M3IA 2FWFA 2V32A 5ENUA 2GS3A 2PVOC 5JWQB 1K3LA 1K0CA 5CAXA 1EP7A 3I9V2 1ILOA 2MBTA 2IPAA 2V1MA 4E8EA 3ZL5A 3KIJA 3GH6A 2TIRA 2B1KA 4Q5FA 4PQHA
chains in the Genus database with same CATH topology
3DRNA 4HU9A 3VURA 3A5WA 3F8UA 1XOAA 5ECMB 1XW5A 2OACA 1EV4A 5F07A 2PN8A 4BWQA 3WD6A 3KXOA 1MEKA 2DJJA 3EVIA 5H5SA 3L78A 4KB3A 2JADA 4MJCA 3UEMA 3IRAA 4F0CA 5LD0A 1Z3EA 3VWWA 2HZFA 2WZ9A 4LMVA 4WEYA 1DE2A 2VOCA 1SKSB 1Z5YE 3VWVA 1WRYA 2CQ9A 2IL3A 3TDGA 1BQ7A 3IHGA 3P90A 4V2NA 4F03A 2X8HA 4I5QA 3ZFLA 1ABAA 2H0GA 3N9JA 4Z2UA 2FGXA 4GLTA 3TCOA 2X4AA 2H1AA 4MLYA 5CRWA 4ICYA 1V9WA 4MJBA 1HNBA 5DAKA 3RDWA 2WJUA 4OD7A 4F2IA 4N0VA 3HVVA 4MA9A 1Z9HA 4BVYA 2YP6A 1DSBA 4OFNA 2AHEA 4MCUA 1SD8A 4MPFA 5DVBA 1EGRA 1EWXA 1XVQA 5B6NA 2CX3A 4KDXA 3ZFBA 4YH2A 3VI7A 2KHPA 2CV4A 2L5OA 3APOA 4IVFA 4G9HA 2RM5A 1ERUA 5ECRB 5ELAA 2A2SA 3ED3A 2REMA 2C3NA 3UOMA 3PINA 4LA1A 1AW9A 2OE1A 1F9MA 3KMNA 5EPFA 5IIZA 2R0PA 3UARA 1GSUA 3CTGA 2GTUA 3KTLA 3CYNA 4EIQA 3ZVJD 2LQOA 1M0UA 3V1WA 2QKEA 4HU7A 4ZB9A 1K0DA 4TR1B 2H0HA 1FG4A 1OE7A 5F06A 2TIRA 1TU8A 3W8JA 1OKDA 5F0GA 3FRCA 3H93A 4IKHA 1ST9A 1A23A 4EVMA 2I81A 3EMPA 2DC5A 3CRTA 4BL7A 4WXTA 5H5QA 2P0GA 1TRWA 4K7IA 5CP1A 1Y25A 5D96A 3TOTA 1LBKA 3ME8A 1GTAA 3VWUA 1T00A 18GSA 3D22A 3UBKA 2EIQA 2O85A 1F37A 4CHSA 5CYYA 5ELGA 2B5EA 2RUEA 1FVJA 2PPTA 4POMA 3HY2A 2GT5A 1A0FA 3O3TA 2NVLA 5DALA 2H01A 5J4UA 3FZAA 1H4OA 4WBRD 3C1SA 5A4UA 3LQ7A 1YDKA 2WDUA 4I2UA 2H71A 2O8VB 2H1BA 2J23A 1XWAA 5AGYA 2JL4A 1XZOA 3CSIA 5JCGA 3D0ZA 2AYTA 1OC8A 5J9CA 1TRVA 3O76A 3E0UA 3IA1A 4NXIA 2L6CA 1MDIA 5L71A 6GSYA 3IC8A 1R5AA 11GSA 4O5QA 2LNTA 1FB0A 2H0IA 3NIVA 2R5GA 3HKRA 5B8BA 5J9BA 5F8BA 3DYRA 4K0GA 3KTBA 2GLRA 2ON5A 2H6ZA 2ZNMA 1B9XC 3UBLA 3LORA 4JU5A 1GUMA 3R2QA 3PGTA 2LJKA 2IIYA 4WR5A 1FHEA 5KOXA 5IM9A 4OCEA 4EE0A 1TU7A 2FUG2 4N10A 4HQZA 3IAM2 3G9BA 3TKRA 1SK2A 2FA4A 4MDCA 1SKRB 3L0HA 1PL1A 2R0GA 4IQ1A 3A2WA 4ZXGA 3EYTA 2CAQA 5EL8A 4NMUA 4KUNA 2HSHA 5G1LA 2LJRA 3GURA 2VL2C 6GSTA 3UAPA 2YV7A 1MD4A 3OR5A 2HLSA 2A2PA 4RUVA 2YJHA 5ID2A 3PR8A 2XPDA 1GL8A 1RQMA 1QUWA 3KP8A 2O7KA 1T8EB 4KDUA 5FHIA 1KBNA 1SKWB 5DQYA 1WOUA 3C7MA 1SL0B 4RI6A 5IQYA 4KSOA 3ZMKA 2YWNA 4I8BA 3W8SA 2H72A 3CRUA 2BMXA 2QC7A 5D9TA 5KEJA 1AC1A 5IOXA 4HUAA 4MK3A 3D5JA 1M2DA 3IHQA 2QA1A 1A2LA 5AIVA 5A4VA 1FAAA 3TUEA 2LRTA 2BJXA 2D2ZA 5ECOB 4YQVA 1JZOA 4G0IA 2GZZA 3TKSC 5C00A 4DSQA 4MZCA 5HQPA 5IOWA 4ZB6A 4V2LA 3Q6OA 4XIHA 2K18A 4GRFA 4HI7A 2IMEA 1PQNA 1MDKA 5ECIB 4YQMA 2EIRA 1M9AA 2NBSA 4L0UA 5D73A 4V1Ap 2LEGA 3APQA 1OC9B 1VF2A 2H74A 1O8XA 2MBSA 1XPVA 2JU5A 2VCVA 3M1GA 2LS5A 3TJKA 2O89A 3LGCA 4TKYA 4YQUA 3TKPA 1OE8A 3UJ1A 1MDJA 4P3YB 1OYJA 3WT1A 3GKKA 5IMVA 3FEUA 5HR2A 3LG6A 4LMWA 2WGRA 5LCZA 6GSXA 2DJ2A 2YJ7A 3KGKA 3GYKA 4KH7A 1PL2A 3FR9A 4I6XA 3MIXA 3TJBA 5B6MA 2PBJA 2YWIA 1EOHA 2H73A 4HS1A 2X99A 1GTUA 2KOKA 5A4WA 4GQFA 3EURA 2IMKA 4KCAA 4OO5A 1ZYQB 4NWYA 2C0FA 4TW5A 1GSSA 2K9FA 4LL1B 3GKXA 4O32A 2PERA 1F2EA 3O6TA 3F0IA 5INYA 4OCFA 4MZWA 3EU4A 5HFKA 1THOA 4FYBA 2C8UA 3H79A 2FD3A 1GLPA 2I3YA 1PX7A 5IMFA 3QAWA 2H6XA 1U3IA 4JR6A 2YWMA 2MYGA 5COHA 2VD1A 3DEXA 3FMWA 2VCWA 2A4VA 4GF0A 2O87A 4GCIA 20GSA 1GULA 2E2GA 3GSTA 4XS4B 1AQWA 5AISA 5D9WA 1AQVA 2JACA 1X9SB 1XOBA 1PX6A 2WRTA 1G7EA 2C0GA 5KOWA 2VLUA 1OKTA 2MZCA 5CNWA 5IO2A 1YEPA 3MWHA 1WP0A 3LXTA 1NW2A 4HEA2 4QL7A 5H5RA 4AJ8A 3J7Yk 1FOHA 2M80A 1TRSA 1XWBA 5G30A 1B4PA 3ZIVA 1W4VA 5HR0A 3BJ5A 3RPPA 3G7IA 1U88A 1EEMA 3DGQA 3ZYWA 3PPUA 3F6DA 2WFCA 3TRQA 3MYDA 4ZL9A 2CZ2A 4GSTA 1ERVA 5ECKB 3M8NA 2C3TA 4QQ7A 1KEBA 4HQSA 4RI7A 2TRCP 2IFQB 2K6VA 1DUGA 2CVKA 3ZVJA 5J3RA 4N30A 2VO4A 4DVCA 2IWTA 1JZRA 3US3A 6GSSA 1GNEA 1THXA 4EC0A 3AY8A 1TKDB 5D9VA 2VL2A 2K8SA 1UVZA 1ZOFA 2A2RA 4G0KA 2FNOA 4N11A 4AJ7A 2B7JA 2B1LA 4ECJA 3U5RE 5DDLA 4NPBA 1TDIA 4OMVA 3UL3A 1OAZA 1GP1A 1F6MC 3DWVA 4JR4A 2L59A 2HSMA 2WULA 3HZ8A 1FB6A 3EINA 5DCGA 1K0BA 1GSYA 3FW2A 1LJRA 1XWCA 3GV1A 3BCKA 3FK8A 4WF4A 1ACVA 3GX0A 2FY6A 4EF0A 3F4TA 3GTUB 1A24A 3IBHA 1TK5B 3TJJA 1XCCA 2DIZA 2IMIA 2IMFA 4OFMA 5CREA 3TKSA 3P7XA 4MMMA 3QFAC 2XC2A 1X5EA 5ABRA 2DJ1A 2CAIA 5DQSA 1EV9A 1XVWA 1X5DA 3TJGA 1B4QA 4ID0A 4IGJA 1E2YA 5JWOB 2CA8A 3L9VA 1Z6NA 1OC3A 3IV4A 3ISOA 3Q19A 2PMTA 2YNXA 4FYCA 4ZB8A 3JCML 4GSNA 3I6AA 3FHKA 4Q5RA 1NHOA 1ZZYA 1GNWA 2JZTA 1Q98A 1Z6MA 4DEJA 1EP8A 4JRRA 3QAGA 3UVHA 2LNSA 3H4KA 5B7CA 3VK9A 2QSIA 2HZEA 5GSTA 1XW9A 2HE3A 4KDYA 1ZGNA 1VGLA 2JSYA 3QPMA 3HCZA 5LNKe 3D4TA 3ZITA 1U3AA 1A8LA 1SYRA 13GSA 3HJPA 1BEDA 3FZ9A 2P31A 4POBA 2N5FA 4MPGA 2HFDA 1SU9A 1O81A 2GT6A 2HRAA 1VF1A 3F63A 4G10A 4IJIA 4X4JA 1K3YA 3VWXA 2HYXA 2FLSA 3RBTA 1ZYNA 2HRNA 4ML1A 3BD2A 1O7UA 2YCDA 4MJEA 1V57A 1ERWA 2VL3A 2MMOA 4TN8A 3HA9A 4EDYA 2GSRA 2F8AA 2OE0A 3TJFA 3LYKA 4PTSA 4TR4A 5G5FA 1AXDA 3CMIA 1V40A 4WF5A 5BMUA 5HFIA 2KLXA 3F4SA 3DXBA 3RHCA 1AUCA 14GSA 1Y6EA 1PN0A 4YKFA 1AQXA 4I2TA 4DSSA 5J41A 4E8HA 4EL1A 3UVTA 1GSFA 4O5RA 2I9HA 3F6FA 1SENA 1JZWA 3Q18A 1TP9A 2H1DA 2JZSA 1Z7PA 2OE3A 4D73A 4FIWA 3WT2A 2VL9A 2X8GA 3HVSA 4CY6A 3TOUA 4KF9A 4EKZA 1V58A 2PWJA 2H70A 4ZBAA 1ML6A 3NZNA 1EEJA 3IK7A 9GSSA 1N8JA 3TB2A 3GL3A 3FYGA 1O85A 5B8AA 2DKHA 3HDCA 5JCUA 4BVXA 4L8EA 2WB9A 3D4MA 3HYPA 2AJQB 1YZXA 3QCPA 3MDKA 2YPMA 5IPHA 22GSA 3P8WA 2L6DA 5HR3A 4GQCA 4X0XA 1I9DA 5D93A 4KW6A 3BBYA 2V2GA 2ZUPA 4PGTA 2DJ0A 1EZKA 2IN3A 1ON4A 4HJ2A 1JFUA 4PUAA 3IR4A 2FHEA 4V1Ag 4KX4A 1WPIA 4EIPA 4ACSA 2TRXA 3CTFA 4J2FA 4ZL7A 3DVXA 4NV5A 5CRDA 4MP4A 4NV2A 4DSRA 1RW1A 1G0TA 1RK4A 2RIIA 2VCQA 3HD5A 4TXOA 2VD0A 5DJMA 4L5OA 3TKSE 3FZ5A 4K6XA 1SL1B 1FOVA 1TK8B 2LUSA 4MNNA 5DAKB 6GSWA 4XRDA 2L4CA 1X9MB 4K1FA 1F3AA 1GUKA 1J08A 4IHUA 4BVYB 3CXGA 4H86A 1HNAA 1YF0A 3F3QA 3FZ4A 4XCSA 2KP1A 2WS2A 5E59A 3FR3A 4TR0A 1FVKA 2GQKA 3ZTLA 1XW6A 1NSWA 2ZCTA 3CSJA 1GSDA 2V6KA 3IPZA 4QL9A 2R0CA 4CDOA 3KJYA 4KE3A 2E0QA 5KN1A 1TOFA 1QGVA 3LYPA 3D6IA 1R7HA 1J0FA 1F3BA 4GXZA 1TTZA 5IMZA 1U87A 2PVQA 4KNDA 2VCZA 1PKWA 2DMLA 1B9YC 1G6WA 4X43A 1S3DA 5AN1A 1MD3A 3E3EA 2IMDA 2ALBA 1JLWA 5DBQA 2XHFA 4ECCA 2H6YA 1UC7A 1PD21 3GMFA 1GSEA 5GZZB 3HXSA 1PSQA 6GSUA 4EUYA 1V98A 3KCMA 1NHYA 3M0FA 3IXRA 1WJKA 4BL7B 4TR3A 5FWGA 2FA8A 4WETA 1QMVA 2F9SA 4WBJA 1URMA 2N5BA 2NDOA 2CX4A 1QFNA 3BOAA 1XFLA 1N2AA 1R26A 3M3MA 5G2ZA 3I69A 3A2VA 2XBQA 3TRPA 3GL5A 3DD3A 1HD2A 1DBYA 3GHAA 4TOPA 1SD9A 4K2DA 3W6GA 2B3SA 2E7PA 4IP1A 5ECLB 1JHBA 5DALB 2G2QA 1J9BA 1VF3A 4JE1A 3ZIJA 3PH9A 2I4AA 3KH7A 4KSMA 3ERFA 1TJDA 5D9XA 2MMZA 2RLIA 2GQMA 2CT6A 3DMLA 6GSVA 4HZ2A 4IQAA 1O73A 1QQ2A 5E4WA 2PU9C 3S9FA 2H1GA 3RHBA 2DLXA 4A5PA 5JWRB 4Z2TA 3KH9A 2VM2A 3GSSA 3ZZXA 1PRXA 4YAVA 5JCWA 4XTSA 4TVEA 4PQIA 2GGTA 3LW9A 1PN9A 4ZL8A 2AUVA 3QOUA 3HJMA 1M2AA 1JZDA 4TR1A 2CZ3A 4FO5A 4G0LA 4I97A 4ECIA 1XWKA 2HRKA 5HFGA 5CRHA 4ZBBA 4MH2A 2WCIA 2GSQA 3KEBA 2LSTA 1A2JA 4XRAA 5J5NA 4CW9A 2GZPA 2C80A 1XWGA 3IDVA 5EY6A 4ZBDA 3FY7A 2R37A 4K5RA 4F9ZA 1XXUA 3EMXA 3GKNA 1T4YA 3F3RA 1W89A 2DSAA 1BJXA 5IMAA 4ECBA 5ID2B 3SBCA 1SJ6A 1SYXA 2R2JA 3GNJA 5HR1A 2HSYA 1CQHA 4MH3A 1TW9A 1CQGA 4PURA 1K3OA 4FQUA 4JBBA 3LSZA 2OBIA 3GH9A 4IW9A 1SK1A 3GIXA 1M99A 3IOSA 5CRGA 1UN2A 2YN1A 2OADA 3L9SA 3J7Yb 3E9JB 4JEDA 4IJ3A 3L4NA 4BPYA 1U6TA 4IS0A 4JZQA 2NPBA 3IK9A 1S3CA 5F05A 3GA4A 3WGEA 5G1KA 3NOFA 4HOJA 1H75A 4PQ1A 3GUSA 1BAYA 5G5EA 4EXJA 1DE1A 4K0NA 2R4VA 8GSSA 5CO3A 1K0OA 3A3TA 4K2XA 2VLVA 1SJZA 1GRXA 7GSSA 4PNFA 1PA3A 3MSZA 4IBPA 2V41A 2LKUA 2JZRA 1YQ1A 4J56E 1X0RA 3VFIA 3QDNA 4IP6A 2L5LA 2KP2A 3VPQA 2F51A 1JLVA 4LL4B 4GWRA 2P5QA 3ZREA 4USSA 3BCIA 2FCHA 1TK0B 1HNCA 3HHVA 3GKMA 2H19A 2EIOA 4O92A 1X5CA 2GSSA 4XHMA 1E6BA 4KGIA 2C0EA 1SK0A 3MNGA 3KP9A 3MAKA 2B5XA 4ZILA 5D8IA 1KTEA 2X8CA 1WWJA 3LFLA 1UA5A 2HXKA 1PGTA 2DMMA 4FYUA 2FWEA 2MMAA 1GLQA 5KN3A 1BX9A 1WMJA 3UIWA 19GSA 2VM1A 3LXZA 4V2MA 1QXHA 17GSA 2B6MA 4HZ4A 4KCEA 4PX1A 3G7YA 3TRXA 1GWCA 4K8MA 4RQRA 1ZYPA 4O5UA 4K7NA 1I5GA 1T7PB 4ML6A 1R5PA 2LTKA 2C1YA 4GTUA 1YJ6A 1XIYA 1A8YA 3TGZA 5GAND 3GN3A 2QA2A 2E2MA 2M46A 2GSTA 4IN0A 12GSA 1S3AA 2OKAA 4TRXA 3RPNA 2H30A 4YKGA 4L0WA 5EVOA 3R3EA 1M9BA 1HYUA 3H1NA 2HRFA 4L5LA 5G31A 2F8FA 3EWLA 2G0FA 4G19A 4YAPA 5DJLA 3FR6A 3ZLPA 2PGTA 1FO5A 1V2AA 1OC9A 3EU3A 4X1UA 3N5OA 5IO0A 1GSQA 1IYIA 5FT3A 2GQLA 2DIYA 2VUPA 3TKQA 2CVBA 1G6YA 4ULXA 3LEFA 3WGXA 3Q74A 2R3XA 3LWAA 4NHZA 10GSA 1PKZA 4MZBA 3D21A 2XBIA 2FWGA 2B7KA 4KA0A 4ZIJA 1YF1A 5C04A 1T4ZA 4TXVA 3KM6A 1A0RP 4BWSA 1B48A 3M9KA 4ISDA 2GZYA 2LQQA 2Z9SA 3UMAA 5DCHA 1QK8A 2N5AA 2FWHA 2XPEA 1C72A 2QGVA 2KUCA 3DKSA 4NHWA 4POLA 2GDRA 4MF5A 2LRCA 1X9WB 2PUKC 4F82A 4HJMA 1BYEA 1VRSD 1WIKA 3FKFA 3VI5A 1O8WA 3VLNA 5KN0A 2H76A 2CVDA 2VCXA 3ERGA 4XS4A 2YOIA 1WE0A 2MMNA 3QMXA 3RAZA 4O7HA 2P5RA 2H75A 2RM6A 3KD0A 1YEXA 2VIMA 2YWOA 1NM3A 1R4WA 4RQXA 2DKIA 2A4HA 2BTOT 16GSA 3H8QA 2L57A 1USBA 2JSZA 3SWLA 4AGSA 4AJ6A 1ZL9A 2YZUA 3EE2A 2DBCA 4K9ZA 4IELA 2H66A 1PMTA 1ZMAA 1XBSA 1AAZA 2X49A 1TI1A 3DVWA 4Z7XA 1SL2B 2IFQA 4F0BA 1TXXA 2OBKA 3EC3A 1ERTA 2EC4A 2YZHA 2LJAA 3IAS2 2LRNA 3U6VA 2M72A 4MABA 5ECPB 4MF7A 2AB6A 4Q5NA 2HZEB 1ZYEA 2C4JA 2R6KA 3GX8A 5A5KA 1SJIA 2V6OA 4OWYA 1TRUA 3EPTA 1K0AA 1YKCA 2GVPA 2DJKA 1KNGA 1Z7RA 1IYHA 2ON7A 1AIUA 4ILFA 4HDEA 2L4QA 3QAVA 1ZCPA 4OFTA 4XS1A 3C8EA 3C1RA 2C0DA 1M2BA 1VF4A 1YKAA 4MJAA 1M7TA 4NAXA 4PUFC 3K8NA 1FW1A 2C3QA 1GUHA 3HVXA 5ECNB 3P2AA 3GTUA 3GRXA 4MF6A 5IMDA 4BA7A 3IC4A 2IJYA 1O6JA 5KN2A 4XS6A 2VLTA 3F9UA 4PNGA 4DSSB 4OO4A 2F3MA 4FH8A 2HNLA 5IPGA 3C73A 5BRTA 3WGDA 3M9JA 1GTBA 5GSSA 3QFBC 1A2MA 4WR4A 5ECHB 1EGOA 3CSHA 4WKWA 2VAFA 1HQOA 1B8XA 4D73B 1K0NA 1YY7A 1TI3A 4Z2RA 1T3BA 3VPTA 4GSSA 4K7OA 4LLRA 1G7OA 2NTOA 2AAWA 5ECSA 3WYWA 1T1VA 3DIEA 2RUFA 5ECQB 2ES7A 2DJ3A 1GTIA 3IE3A 5GAPD 5IMCA 4J57E 3A5IA 2UZ8A 4BVXB 3F4RA 2I1UA 3ME7A 1LU4A 3CBUA 2LV3A 2J9HA 4EDZA 1Q4JA 1EOGA 2K8VA 4K5SA 3A2XA 1OVNA 2OJLA 4EO3A 2H8LA 4KAEA 2OA7A 3LJRA 4POKA 3KZQA 3ZMLA 3QD9A 2HT9A 3KMOA 2VCTA 3C71A 4PXOA 3ZRDA 3G7JA 4CY8A 2B5YA 3HZ4A 3GFKA 3QR6A 3L9UA 3ERWA 3APSA 1BG5A 4N0ZA 4TXOB 4AF2A 3HJOA 1MTCA 4G2EA 2X64A 2AV4A 1K0MA 3I43A 1GH2A 2YANA 2HI7A 2YV9A 4Q5QA 2FWFA 2V32A 5ENUA 2GS3A 2PVOC 5JWQB 1K3LA 1K0CA 5CAXA 1EP7A 3I9V2 1ILOA 2MBTA 2IPAA 2V1MA 4E8EA 3ZL5A 3KIJA 3GH6A 5AIXA 2B1KA 4Q5FA 4PQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DRN A;  4HU9 A;  3VUR A;  3A5W A;  3F8U A;  1XOA A;  5ECM B;  1XW5 A;  2OAC A;  1EV4 A;  5F07 A;  2PN8 A;  4BWQ A;  3WD6 A;  3KXO A;  1MEK A;  2DJJ A;  3EVI A;  5H5S A;  3L78 A;  4KB3 A;  2JAD A;  4MJC A;  3UEM A;  3IRA A;  4F0C A;  5LD0 A;  1Z3E A;  3VWW A;  2HZF A;  2WZ9 A;  4LMV A;  4WEY A;  1DE2 A;  2VOC A;  1SKS B;  1Z5Y E;  3VWV A;  1WRY A;  2CQ9 A;  2IL3 A;  3TDG A;  1BQ7 A;  3P90 A;  4V2N A;  4F03 A;  2X8H A;  4I5Q A;  3ZFL A;  1ABA A;  2H0G A;  3N9J A;  2FGX A;  4GLT A;  3TCO A;  2H1A A;  4MLY A;  5CRW A;  1V9W A;  4MJB A;  1HNB A;  5DAK A;  3RDW A;  2WJU A;  4OD7 A;  4F2I A;  4N0V A;  3HVV A;  4MA9 A;  1Z9H A;  4BVY A;  2YP6 A;  1DSB A;  4OFN A;  2AHE A;  4MCU A;  1SD8 A;  4MPF A;  5DVB A;  1EGR A;  1EWX A;  1XVQ A;  5B6N A;  2CX3 A;  4KDX A;  3ZFB A;  4YH2 A;  3VI7 A;  2KHP A;  2CV4 A;  2L5O A;  3APO A;  4IVF A;  4G9H A;  2RM5 A;  1ERU A;  5ECR B;  5ELA A;  2A2S A;  3ED3 A;  2REM A;  2C3N A;  3UOM A;  3PIN A;  4LA1 A;  1AW9 A;  2OE1 A;  1F9M A;  3KMN A;  5EPF A;  5IIZ A;  3UAR A;  1GSU A;  3CTG A;  2GTU A;  3KTL A;  3CYN A;  3ZVJ D;  2LQO A;  1M0U A;  3V1W A;  2QKE A;  4HU7 A;  4ZB9 A;  1K0D A;  4TR1 B;  2H0H A;  1FG4 A;  1OE7 A;  5F06 A;  2TIR A;  1TU8 A;  3W8J A;  1OKD A;  5F0G A;  3FRC A;  3H93 A;  4IKH A;  1ST9 A;  1A23 A;  4EVM A;  2I81 A;  3EMP A;  2DC5 A;  3CRT A;  4BL7 A;  4WXT A;  5H5Q A;  2P0G A;  1TRW A;  4K7I A;  5CP1 A;  1Y25 A;  5D96 A;  3TOT A;  1LBK A;  3ME8 A;  1GTA A;  3VWU A;  1T00 A;  18GS A;  3D22 A;  3UBK A;  2EIQ A;  2O85 A;  1F37 A;  4CHS A;  5CYY A;  5ELG A;  2B5E A;  2RUE A;  1FVJ A;  2PPT A;  4POM A;  3HY2 A;  2GT5 A;  1A0F A;  3O3T A;  2NVL A;  5DAL A;  2H01 A;  5J4U A;  3FZA A;  1H4O A;  4WBR D;  3C1S A;  5A4U A;  3LQ7 A;  1YDK A;  2WDU A;  4I2U A;  2H71 A;  2O8V B;  2H1B A;  2J23 A;  1XWA A;  5AGY A;  2JL4 A;  1XZO A;  3CSI A;  5JCG A;  3D0Z A;  2AYT A;  1OC8 A;  5J9C A;  1TRV A;  3O76 A;  3E0U A;  3IA1 A;  4NXI A;  2L6C A;  1MDI A;  5L71 A;  6GSY A;  1R5A A;  11GS A;  2LNT A;  1FB0 A;  2H0I A;  3NIV A;  2R5G A;  3HKR A;  5B8B A;  5J9B A;  5F8B A;  3DYR A;  4K0G A;  3KTB A;  2GLR A;  2ON5 A;  2H6Z A;  2ZNM A;  1B9X C;  3UBL A;  3LOR A;  4JU5 A;  1GUM A;  3R2Q A;  3PGT A;  2LJK A;  2IIY A;  4WR5 A;  1FHE A;  5IM9 A;  4OCE A;  4EE0 A;  1TU7 A;  2FUG 2;  4N10 A;  4HQZ A;  3IAM 2;  3G9B A;  3TKR A;  1SK2 A;  2FA4 A;  4MDC A;  1SKR B;  3L0H A;  1PL1 A;  4IQ1 A;  3A2W A;  4ZXG A;  3EYT A;  2CAQ A;  5EL8 A;  4NMU A;  4KUN A;  2HSH A;  5G1L A;  2LJR A;  3GUR A;  2VL2 C;  6GST A;  3UAP A;  2YV7 A;  1MD4 A;  3OR5 A;  2HLS A;  4RUV A;  5ID2 A;  2YJH A;  3PR8 A;  2XPD A;  1GL8 A;  1RQM A;  1QUW A;  3KP8 A;  2O7K A;  1T8E B;  4KDU A;  5FHI A;  1KBN A;  1SKW B;  5DQY A;  1WOU A;  3C7M A;  1SL0 B;  4RI6 A;  5IQY A;  4KSO A;  3ZMK A;  2YWN A;  4I8B A;  3W8S A;  2H72 A;  3CRU A;  2BMX A;  2QC7 A;  5D9T A;  5KEJ A;  1AC1 A;  5IOX A;  4HUA A;  4MK3 A;  3D5J A;  1M2D A;  3IHQ A;  1A2L A;  5AIV A;  5A4V A;  1FAA A;  3TUE A;  2LRT A;  2BJX A;  2D2Z A;  5ECO B;  4YQV A;  1JZO A;  2GZZ A;  3TKS C;  5C00 A;  4DSQ A;  4MZC A;  5HQP A;  5IOW A;  4ZB6 A;  4V2L A;  3Q6O A;  4XIH A;  2K18 A;  4GRF A;  4HI7 A;  2IME A;  1PQN A;  1MDK A;  5ECI B;  4YQM A;  2EIR A;  1M9A A;  2NBS A;  4L0U A;  5D73 A;  4V1A p;  2LEG A;  3APQ A;  1OC9 B;  1VF2 A;  2H74 A;  1O8X A;  2MBS A;  1XPV A;  2JU5 A;  2VCV A;  3M1G A;  2LS5 A;  3TJK A;  2O89 A;  3LGC A;  4TKY A;  4YQU A;  3TKP A;  1OE8 A;  3UJ1 A;  1MDJ A;  4P3Y B;  1OYJ A;  3WT1 A;  3GKK A;  5IMV A;  3FEU A;  5HR2 A;  3LG6 A;  4LMW A;  2WGR A;  5LCZ A;  6GSX A;  2DJ2 A;  2YJ7 A;  3KGK A;  3GYK A;  4KH7 A;  1PL2 A;  3FR9 A;  4I6X A;  3TJB A;  5B6M A;  2PBJ A;  2YWI A;  1EOH A;  2H73 A;  4HS1 A;  2X99 A;  1GTU A;  2KOK A;  5A4W A;  4GQF A;  3EUR A;  2IMK A;  4KCA A;  4OO5 A;  1ZYQ B;  4NWY A;  2C0F A;  4TW5 A;  1GSS A;  2K9F A;  4LL1 B;  3GKX A;  4O32 A;  2PER A;  1F2E A;  3O6T A;  3F0I A;  5INY A;  4OCF A;  4MZW A;  3EU4 A;  5HFK A;  1THO A;  4FYB A;  2C8U A;  3H79 A;  2FD3 A;  1GLP A;  2I3Y A;  1PX7 A;  5IMF A;  3QAW A;  2H6X A;  1U3I A;  4JR6 A;  2YWM A;  2MYG A;  5COH A;  2VD1 A;  3DEX A;  2VCW A;  2A4V A;  4GF0 A;  2O87 A;  4GCI A;  20GS A;  1GUL A;  2E2G A;  3GST A;  4XS4 B;  1AQW A;  5AIS A;  5D9W A;  1AQV A;  2JAC A;  1X9S B;  1XOB A;  1PX6 A;  2WRT A;  1G7E A;  2C0G A;  2VLU A;  1OKT A;  2MZC A;  5CNW A;  5IO2 A;  1YEP A;  3MWH A;  1WP0 A;  3LXT A;  1NW2 A;  4HEA 2;  4QL7 A;  5H5R A;  4AJ8 A;  3J7Y k;  2M80 A;  1TRS A;  1XWB A;  5G30 A;  1B4P A;  3ZIV A;  1W4V A;  5HR0 A;  3BJ5 A;  3RPP A;  3G7I A;  1U88 A;  1EEM A;  3DGQ A;  3ZYW A;  3F6D A;  2WFC A;  3TRQ A;  4ZL9 A;  2CZ2 A;  4GST A;  1ERV A;  5ECK B;  3M8N A;  2C3T A;  4QQ7 A;  1KEB A;  4HQS A;  4RI7 A;  2TRC P;  2IFQ B;  2K6V A;  1DUG A;  2CVK A;  3ZVJ A;  5J3R A;  4N30 A;  2VO4 A;  4DVC A;  2IWT A;  1JZR A;  3US3 A;  6GSS A;  1GNE A;  1THX A;  4EC0 A;  3AY8 A;  1TKD B;  5D9V A;  2VL2 A;  2K8S A;  1UVZ A;  1ZOF A;  2A2R A;  2FNO A;  4N11 A;  4AJ7 A;  2B7J A;  2B1L A;  4ECJ A;  3U5R E;  5DDL A;  4NPB A;  1TDI A;  4OMV A;  3UL3 A;  1OAZ A;  1GP1 A;  1F6M C;  3DWV A;  4JR4 A;  2L59 A;  2WUL A;  3HZ8 A;  1FB6 A;  3EIN A;  5DCG A;  1K0B A;  1GSY A;  3FW2 A;  1LJR A;  1XWC A;  3GV1 A;  3BCK A;  3FK8 A;  4WF4 A;  1ACV A;  3GX0 A;  2FY6 A;  4EF0 A;  3F4T A;  3GTU B;  1A24 A;  3IBH A;  1TK5 B;  3TJJ A;  1XCC A;  2DIZ A;  2IMI A;  2IMF A;  4OFM A;  5CRE A;  3TKS A;  3P7X A;  4MMM A;  3QFA C;  2XC2 A;  1X5E A;  5ABR A;  2DJ1 A;  2CAI A;  5DQS A;  1EV9 A;  1XVW A;  1X5D A;  3TJG A;  1B4Q A;  4ID0 A;  4IGJ A;  1E2Y A;  5JWO B;  2CA8 A;  3L9V A;  1Z6N A;  1OC3 A;  3IV4 A;  3ISO A;  3Q19 A;  2PMT A;  2YNX A;  4FYC A;  4ZB8 A;  3JCM L;  4GSN A;  3I6A A;  3FHK A;  4Q5R A;  1NHO A;  1ZZY A;  1GNW A;  2JZT A;  1Q98 A;  1Z6M A;  4DEJ A;  1EP8 A;  4JRR A;  3QAG A;  3UVH A;  2LNS A;  3H4K A;  5B7C A;  3VK9 A;  2QSI A;  2HZE A;  5GST A;  1XW9 A;  2HE3 A;  4KDY A;  1ZGN A;  1VGL A;  2JSY A;  3QPM A;  3HCZ A;  5LNK e;  3D4T A;  3ZIT A;  1U3A A;  1A8L A;  1SYR A;  13GS A;  3HJP A;  1BED A;  3FZ9 A;  2P31 A;  4POB A;  2N5F A;  4MPG A;  2HFD A;  1SU9 A;  1O81 A;  2GT6 A;  1VF1 A;  3F63 A;  4G10 A;  4IJI A;  1K3Y A;  3VWX A;  2HYX A;  2FLS A;  3RBT A;  2HRN A;  4ML1 A;  3BD2 A;  1O7U A;  2YCD A;  4MJE A;  1V57 A;  1ERW A;  2VL3 A;  2MMO A;  4TN8 A;  3HA9 A;  4EDY A;  2GSR A;  2F8A A;  2OE0 A;  3TJF A;  3LYK A;  4TR4 A;  5G5F A;  1AXD A;  3CMI A;  1V40 A;  4WF5 A;  5HFI A;  2KLX A;  3F4S A;  3DXB A;  3RHC A;  1AUC A;  14GS A;  1Y6E A;  1AQX A;  4I2T A;  4DSS A;  5J41 A;  4E8H A;  4EL1 A;  3UVT A;  1GSF A;  4O5R A;  2I9H A;  3F6F A;  1SEN A;  1JZW A;  3Q18 A;  1TP9 A;  2H1D A;  2JZS A;  1Z7P A;  2OE3 A;  4D73 A;  4FIW A;  3WT2 A;  2VL9 A;  2X8G A;  3HVS A;  3TOU A;  4EKZ A;  1V58 A;  2PWJ A;  2H70 A;  4ZBA A;  1ML6 A;  3NZN A;  1EEJ A;  3IK7 A;  9GSS A;  1N8J A;  3TB2 A;  3GL3 A;  3FYG A;  1O85 A;  5B8A A;  3HDC A;  5JCU A;  4BVX A;  4L8E A;  2WB9 A;  3D4M A;  3HYP A;  2AJQ B;  1YZX A;  3QCP A;  3MDK A;  2YPM A;  5IPH A;  22GS A;  3P8W A;  2L6D A;  5HR3 A;  4GQC A;  4X0X A;  1I9D A;  5D93 A;  4KW6 A;  3BBY A;  2V2G A;  2ZUP A;  4PGT A;  2DJ0 A;  1EZK A;  2IN3 A;  1ON4 A;  4HJ2 A;  1JFU A;  4PUA A;  3IR4 A;  2FHE A;  4V1A g;  4KX4 A;  1WPI A;  4ACS A;  2TRX A;  3CTF A;  4J2F A;  4ZL7 A;  3DVX A;  4NV5 A;  5CRD A;  4MP4 A;  4NV2 A;  4DSR A;  1RW1 A;  1G0T A;  1RK4 A;  2RII A;  2VCQ A;  3HD5 A;  4TXO A;  2VD0 A;  5DJM A;  4L5O A;  3TKS E;  3FZ5 A;  4K6X A;  1SL1 B;  1FOV A;  1TK8 B;  2LUS A;  5DAK B;  6GSW A;  4XRD A;  2L4C A;  1X9M B;  4K1F A;  1F3A A;  1GUK A;  1J08 A;  4IHU A;  3CXG A;  4H86 A;  1HNA A;  1YF0 A;  3F3Q A;  3FZ4 A;  4XCS A;  2KP1 A;  2WS2 A;  5E59 A;  3FR3 A;  4TR0 A;  1FVK A;  2GQK A;  3ZTL A;  1XW6 A;  1NSW A;  2ZCT A;  3CSJ A;  1GSD A;  2V6K A;  3IPZ A;  4QL9 A;  4CDO A;  3KJY A;  4KE3 A;  2E0Q A;  5KN1 A;  1TOF A;  1QGV A;  3LYP A;  3D6I A;  1R7H A;  1J0F A;  1F3B A;  4GXZ A;  1TTZ A;  5IMZ A;  1U87 A;  2PVQ A;  4KND A;  2VCZ A;  1PKW A;  2DML A;  1B9Y C;  1G6W A;  4X43 A;  1S3D A;  5AN1 A;  1MD3 A;  3E3E A;  2IMD A;  2ALB A;  1JLW A;  5DBQ A;  2XHF A;  4ECC A;  2H6Y A;  1UC7 A;  1PD2 1;  3GMF A;  1GSE A;  5GZZ B;  3HXS A;  1PSQ A;  6GSU A;  4EUY A;  1V98 A;  3KCM A;  1NHY A;  3M0F A;  3IXR A;  1WJK A;  4TR3 A;  5FWG A;  2FA8 A;  4WET A;  1QMV A;  2F9S A;  4WBJ A;  1URM A;  2N5B A;  2NDO A;  2CX4 A;  1QFN A;  3BOA A;  1XFL A;  1N2A A;  1R26 A;  3M3M A;  5G2Z A;  3I69 A;  3A2V A;  2XBQ A;  3TRP A;  3GL5 A;  3DD3 A;  1HD2 A;  1DBY A;  3GHA A;  4TOP A;  1SD9 A;  4K2D A;  3W6G A;  2B3S A;  2E7P A;  4IP1 A;  5ECL B;  1JHB A;  5DAL B;  2G2Q A;  1J9B A;  1VF3 A;  4JE1 A;  3ZIJ A;  3PH9 A;  2I4A A;  3KH7 A;  4KSM A;  3ERF A;  1TJD A;  5D9X A;  2MMZ A;  2RLI A;  2GQM A;  2CT6 A;  3DML A;  6GSV A;  4HZ2 A;  4IQA A;  1O73 A;  1QQ2 A;  5E4W A;  2PU9 C;  3S9F A;  2H1G A;  3RHB A;  2DLX A;  5JWR B;  3KH9 A;  2VM2 A;  3GSS A;  3ZZX A;  1PRX A;  4YAV A;  5JCW A;  4XTS A;  4TVE A;  4PQI A;  2GGT A;  1PN9 A;  4ZL8 A;  2AUV A;  3QOU A;  3HJM A;  1M2A A;  1JZD A;  4TR1 A;  2CZ3 A;  4FO5 A;  4I97 A;  4ECI A;  1XWK A;  5HFG A;  5CRH A;  4ZBB A;  4MH2 A;  2WCI A;  2GSQ A;  3KEB A;  2LST A;  1A2J A;  4XRA A;  5J5N A;  4CW9 A;  2GZP A;  2C80 A;  1XWG A;  3IDV A;  5EY6 A;  4ZBD A;  3FY7 A;  2R37 A;  4F9Z A;  1XXU A;  3EMX A;  3GKN A;  1T4Y A;  3F3R A;  1W89 A;  2DSA A;  1BJX A;  5IMA A;  4ECB A;  5ID2 B;  3SBC A;  1SJ6 A;  1SYX A;  2R2J A;  3GNJ A;  5HR1 A;  2HSY A;  1CQH A;  4MH3 A;  1TW9 A;  1CQG A;  4PUR A;  1K3O A;  4JBB A;  3LSZ A;  2OBI A;  3GH9 A;  4IW9 A;  1SK1 A;  3GIX A;  1M99 A;  3IOS A;  5CRG A;  1UN2 A;  2YN1 A;  2OAD A;  3L9S A;  3J7Y b;  3E9J B;  4JED A;  4IJ3 A;  3L4N A;  4BPY A;  1U6T A;  4IS0 A;  4JZQ A;  2NPB A;  3IK9 A;  1S3C A;  5F05 A;  3GA4 A;  3WGE A;  5G1K A;  3NOF A;  4HOJ A;  1H75 A;  4PQ1 A;  3GUS A;  1BAY A;  5G5E A;  4EXJ A;  1DE1 A;  4K0N A;  2R4V A;  8GSS A;  5CO3 A;  1K0O A;  3A3T A;  2VLV A;  1SJZ A;  1GRX A;  7GSS A;  4PNF A;  1PA3 A;  3MSZ A;  4IBP A;  2V41 A;  2LKU A;  2JZR A;  1YQ1 A;  4J56 E;  1X0R A;  3VFI A;  3QDN A;  4IP6 A;  2L5L A;  2KP2 A;  3VPQ A;  2F51 A;  1JLV A;  4LL4 B;  4GWR A;  2P5Q A;  3ZRE A;  3BCI A;  2FCH A;  1TK0 B;  1HNC A;  3HHV A;  3GKM A;  2H19 A;  2EIO A;  4O92 A;  1X5C A;  2GSS A;  4XHM A;  1E6B A;  4KGI A;  2C0E A;  1SK0 A;  3MNG A;  3KP9 A;  3MAK A;  2B5X A;  4ZIL A;  5D8I A;  1KTE A;  2X8C A;  1WWJ A;  3LFL A;  1UA5 A;  2HXK A;  1PGT A;  2DMM A;  4FYU A;  2FWE A;  2MMA A;  1GLQ A;  5KN3 A;  1BX9 A;  1WMJ A;  3UIW A;  19GS A;  2VM1 A;  3LXZ A;  4V2M A;  1QXH A;  17GS A;  2B6M A;  4HZ4 A;  4KCE A;  4PX1 A;  3G7Y A;  3TRX A;  1GWC A;  4K8M A;  4RQR A;  4K7N A;  1I5G A;  1T7P B;  4ML6 A;  1R5P A;  2LTK A;  2C1Y A;  4GTU A;  1YJ6 A;  1XIY A;  1A8Y A;  3TGZ A;  5GAN D;  3GN3 A;  2E2M A;  2M46 A;  2GST A;  4IN0 A;  12GS A;  1S3A A;  2OKA A;  4TRX A;  3RPN A;  2H30 A;  4L0W A;  5EVO A;  1M9B A;  1HYU A;  3H1N A;  2HRF A;  4L5L A;  5G31 A;  2F8F A;  3EWL A;  2G0F A;  4G19 A;  4YAP A;  5DJL A;  3FR6 A;  3ZLP A;  2PGT A;  1FO5 A;  1V2A A;  1OC9 A;  3EU3 A;  4X1U A;  3N5O A;  5IO0 A;  1GSQ A;  1IYI A;  5FT3 A;  2GQL A;  2DIY A;  2VUP A;  3TKQ A;  2CVB A;  1G6Y A;  4ULX A;  3LEF A;  3WGX A;  3Q74 A;  2R3X A;  3LWA A;  4NHZ A;  10GS A;  1PKZ A;  4MZB A;  3D21 A;  2XBI A;  2FWG A;  2B7K A;  4KA0 A;  4ZIJ A;  1YF1 A;  5C04 A;  1T4Z A;  4TXV A;  3KM6 A;  1A0R P;  4BWS A;  1B48 A;  3M9K A;  4ISD A;  2GZY A;  2LQQ A;  2Z9S A;  3UMA A;  5DCH A;  1QK8 A;  2N5A A;  2FWH A;  2XPE A;  1C72 A;  2QGV A;  2KUC A;  3DKS A;  4NHW A;  4POL A;  2GDR A;  4MF5 A;  2LRC A;  1X9W B;  2PUK C;  4F82 A;  4HJM A;  1BYE A;  1VRS D;  1WIK A;  3FKF A;  3VI5 A;  1O8W A;  3VLN A;  5KN0 A;  2H76 A;  2CVD A;  2VCX A;  3ERG A;  4XS4 A;  2YOI A;  1WE0 A;  2MMN A;  3QMX A;  3RAZ A;  4O7H A;  2P5R A;  2H75 A;  2RM6 A;  3KD0 A;  1YEX A;  2VIM A;  2YWO A;  1NM3 A;  1R4W A;  4RQX A;  2BTO T;  16GS A;  3H8Q A;  2L57 A;  1USB A;  2JSZ A;  3SWL A;  4AGS A;  4AJ6 A;  1ZL9 A;  2YZU A;  3EE2 A;  2DBC A;  4K9Z A;  4IEL A;  2H66 A;  1PMT A;  1ZMA A;  1XBS A;  1AAZ A;  1TI1 A;  3DVW A;  4Z7X A;  1SL2 B;  2IFQ A;  4F0B A;  1TXX A;  2OBK A;  3EC3 A;  1ERT A;  2EC4 A;  2YZH A;  2LJA A;  3IAS 2;  2LRN A;  3U6V A;  5ECP B;  2M72 A;  4MAB A;  4MF7 A;  2AB6 A;  4Q5N A;  2HZE B;  1ZYE A;  2C4J A;  2R6K A;  3GX8 A;  5A5K A;  1SJI A;  2V6O A;  4OWY A;  1TRU A;  1K0A A;  1YKC A;  2GVP A;  2DJK A;  1KNG A;  1Z7R A;  1IYH A;  2ON7 A;  1AIU A;  4ILF A;  4HDE A;  2L4Q A;  3QAV A;  1ZCP A;  4OFT A;  4XS1 A;  3C8E A;  3C1R A;  2C0D A;  1M2B A;  1VF4 A;  1YKA A;  4MJA A;  1M7T A;  4NAX A;  4PUF C;  3K8N A;  1FW1 A;  2C3Q A;  1GUH A;  3HVX A;  5ECN B;  3P2A A;  3GTU A;  3GRX A;  4MF6 A;  5IMD A;  4BA7 A;  3IC4 A;  2IJY A;  1O6J A;  5KN2 A;  4XS6 A;  2VLT A;  3F9U A;  4PNG A;  4DSS B;  4OO4 A;  2F3M A;  4FH8 A;  2HNL A;  5IPG A;  3C73 A;  3WGD A;  3M9J A;  1GTB A;  5GSS A;  3QFB C;  1A2M A;  4WR4 A;  5ECH B;  1EGO A;  3CSH A;  4WKW A;  2VAF A;  1HQO A;  1B8X A;  4D73 B;  1K0N A;  1YY7 A;  1TI3 A;  1T3B A;  3VPT A;  4GSS A;  4K7O A;  4LLR A;  1G7O A;  2NTO A;  2AAW A;  5ECS A;  3WYW A;  1T1V A;  3DIE A;  2RUF A;  5ECQ B;  2ES7 A;  2DJ3 A;  1GTI A;  3IE3 A;  5GAP D;  5IMC A;  4J57 E;  3F4R A;  2I1U A;  3ME7 A;  1LU4 A;  3CBU A;  2LV3 A;  2J9H A;  4EDZ A;  1Q4J A;  1EOG A;  2K8V A;  3A2X A;  1OVN A;  2OJL A;  4EO3 A;  2H8L A;  4KAE A;  2OA7 A;  3LJR A;  4POK A;  3KZQ A;  3ZML A;  3QD9 A;  2HT9 A;  3KMO A;  2VCT A;  3C71 A;  4PXO A;  3ZRD A;  3G7J A;  2B5Y A;  3HZ4 A;  3GFK A;  3QR6 A;  3L9U A;  3ERW A;  3APS A;  1BG5 A;  4N0Z A;  4TXO B;  4AF2 A;  3HJO A;  1MTC A;  4G2E A;  2X64 A;  2AV4 A;  1K0M A;  3I43 A;  1GH2 A;  2YAN A;  2HI7 A;  2YV9 A;  4Q5Q A;  2FWF A;  2V32 A;  5ENU A;  2GS3 A;  2PVO C;  5JWQ B;  1K3L A;  1K0C A;  5CAX A;  1EP7 A;  3I9V 2;  1ILO A;  2MBT A;  2IPA A;  2V1M A;  4E8E A;  3ZL5 A;  3KIJ A;  3GH6 A;  5AIX A;  2B1K A;  4Q5F A;  4PQH A; 
#chains in the Genus database with same CATH topology
 3DRN A;  4HU9 A;  3VUR A;  3A5W A;  3F8U A;  1XOA A;  5ECM B;  1XW5 A;  2OAC A;  1EV4 A;  5F07 A;  2PN8 A;  4BWQ A;  3WD6 A;  3KXO A;  1MEK A;  2DJJ A;  3EVI A;  5H5S A;  3L78 A;  4KB3 A;  2JAD A;  4MJC A;  3UEM A;  3IRA A;  4F0C A;  5LD0 A;  1Z3E A;  3VWW A;  2HZF A;  2WZ9 A;  4LMV A;  4WEY A;  1DE2 A;  2VOC A;  1SKS B;  1Z5Y E;  3VWV A;  1WRY A;  2CQ9 A;  2IL3 A;  3TDG A;  1BQ7 A;  3IHG A;  3P90 A;  4V2N A;  4F03 A;  2X8H A;  4I5Q A;  3ZFL A;  1ABA A;  2H0G A;  3N9J A;  4HSC X;  2FGX A;  4GLT A;  3TCO A;  4Z2U A;  2X4A A;  2H1A A;  4MLY A;  5CRW A;  4ICY A;  1V9W A;  4MJB A;  1HNB A;  5DAK A;  3RDW A;  2WJU A;  4OD7 A;  4F2I A;  4N0V A;  3HVV A;  4MA9 A;  1Z9H A;  4BVY A;  2YP6 A;  1DSB A;  4OFN A;  2AHE A;  4MCU A;  1SD8 A;  4MPF A;  5DVB A;  1EGR A;  1EWX A;  1XVQ A;  5B6N A;  2CX3 A;  4KDX A;  3ZFB A;  4YH2 A;  3VI7 A;  2KHP A;  2CV4 A;  2L5O A;  3APO A;  4IVF A;  4G9H A;  2RM5 A;  1ERU A;  5ECR B;  5ELA A;  2A2S A;  3ED3 A;  2REM A;  2C3N A;  3UOM A;  3PIN A;  4LA1 A;  1AW9 A;  2OE1 A;  1F9M A;  3KMN A;  5EPF A;  5IIZ A;  2R0P A;  3UAR A;  1GSU A;  3CTG A;  2GTU A;  3KTL A;  3CYN A;  4EIQ A;  3ZVJ D;  2LQO A;  1M0U A;  3V1W A;  2QKE A;  4HU7 A;  4ZB9 A;  1K0D A;  4TR1 B;  2H0H A;  1FG4 A;  1OE7 A;  5F06 A;  1TU8 A;  3W8J A;  1OKD A;  5F0G A;  3FRC A;  3H93 A;  4IKH A;  1ST9 A;  1A23 A;  4EVM A;  2I81 A;  3EMP A;  2DC5 A;  3CRT A;  4BL7 A;  4WXT A;  5H5Q A;  2P0G A;  1TRW A;  4K7I A;  5CP1 A;  1Y25 A;  5D96 A;  3TOT A;  1LBK A;  3ME8 A;  1GTA A;  3VWU A;  1T00 A;  18GS A;  3D22 A;  3UBK A;  2EIQ A;  2O85 A;  1F37 A;  4CHS A;  5CYY A;  5ELG A;  2B5E A;  2RUE A;  1FVJ A;  2PPT A;  4POM A;  3HY2 A;  2GT5 A;  1A0F A;  3O3T A;  2NVL A;  5DAL A;  2H01 A;  5J4U A;  3FZA A;  1H4O A;  4WBR D;  3C1S A;  5A4U A;  3LQ7 A;  1YDK A;  2WDU A;  4I2U A;  3CQF A;  2H71 A;  2O8V B;  2H1B A;  2J23 A;  1XWA A;  5AGY A;  2JL4 A;  1XZO A;  3CSI A;  5JCG A;  3D0Z A;  2AYT A;  1OC8 A;  5J9C A;  1TRV A;  3O76 A;  3E0U A;  3IA1 A;  4NXI A;  2L6C A;  1MDI A;  5L71 A;  6GSY A;  3IC8 A;  1R5A A;  11GS A;  4O5Q A;  2LNT A;  1FB0 A;  2H0I A;  3NIV A;  2R5G A;  3HKR A;  5B8B A;  5J9B A;  5F8B A;  3DYR A;  4K0G A;  3KTB A;  5AIX A;  2GLR A;  2ON5 A;  2H6Z A;  2ZNM A;  1B9X C;  3UBL A;  3LOR A;  4JU5 A;  1GUM A;  3R2Q A;  3PGT A;  2LJK A;  2IIY A;  4WR5 A;  1FHE A;  5KOX A;  5IM9 A;  4OCE A;  4EE0 A;  1TU7 A;  2FUG 2;  4N10 A;  4HQZ A;  3IAM 2;  3G9B A;  3TKR A;  1SK2 A;  2FA4 A;  4MDC A;  1SKR B;  3L0H A;  1PL1 A;  2R0G A;  4IQ1 A;  3A2W A;  4ZXG A;  3EYT A;  2CAQ A;  5EL8 A;  4NMU A;  4KUN A;  2HSH A;  5G1L A;  2LJR A;  3GUR A;  2VL2 C;  6GST A;  3UAP A;  2YV7 A;  1MD4 A;  3OR5 A;  2HLS A;  2A2P A;  4RUV A;  2YJH A;  5ID2 A;  3PR8 A;  2XPD A;  1GL8 A;  1RQM A;  1QUW A;  3KP8 A;  2O7K A;  1T8E B;  4KDU A;  5FHI A;  1KBN A;  1SKW B;  5DQY A;  1WOU A;  3C7M A;  1SL0 B;  4RI6 A;  5IQY A;  4KSO A;  3ZMK A;  2YWN A;  4I8B A;  3W8S A;  2H72 A;  3CRU A;  2BMX A;  2QC7 A;  5D9T A;  5KEJ A;  1AC1 A;  5IOX A;  4HUA A;  4MK3 A;  3D5J A;  1M2D A;  3IHQ A;  2QA1 A;  1A2L A;  5AIV A;  5A4V A;  1FAA A;  3TUE A;  2LRT A;  2BJX A;  2D2Z A;  5ECO B;  4YQV A;  1JZO A;  1M3J A;  4G0I A;  2GZZ A;  3TKS C;  5C00 A;  4DSQ A;  4MZC A;  5HQP A;  5IOW A;  4ZB6 A;  4V2L A;  3Q6O A;  4XIH A;  2K18 A;  4GRF A;  4HI7 A;  2IME A;  1PQN A;  1MDK A;  5ECI B;  4YQM A;  2EIR A;  1M9A A;  2NBS A;  4L0U A;  5D73 A;  4V1A p;  2LEG A;  3APQ A;  1OC9 B;  1VF2 A;  2H74 A;  1O8X A;  2MBS A;  1XPV A;  2JU5 A;  2VCV A;  3M1G A;  2LS5 A;  3TJK A;  2O89 A;  3LGC A;  4TKY A;  4YQU A;  3TKP A;  1OE8 A;  3UJ1 A;  1MDJ A;  4P3Y B;  1OYJ A;  3WT1 A;  3GKK A;  5IMV A;  3FEU A;  5HR2 A;  3LG6 A;  4LMW A;  2WGR A;  5LCZ A;  6GSX A;  2DJ2 A;  2YJ7 A;  3KGK A;  3GYK A;  4KH7 A;  1PL2 A;  1S3R A;  3FR9 A;  4I6X A;  3MIX A;  3TJB A;  5B6M A;  2PBJ A;  2YWI A;  1EOH A;  2H73 A;  4HS1 A;  2X99 A;  1GTU A;  2KOK A;  5A4W A;  4GQF A;  3EUR A;  2IMK A;  4KCA A;  4OO5 A;  1ZYQ B;  4NWY A;  2C0F A;  4TW5 A;  1GSS A;  2K9F A;  4LL1 B;  3GKX A;  4O32 A;  2PER A;  1F2E A;  3O6T A;  3F0I A;  5INY A;  4OCF A;  4MZW A;  3EU4 A;  5HFK A;  1THO A;  4FYB A;  2C8U A;  3H79 A;  2FD3 A;  1GLP A;  2I3Y A;  1PX7 A;  5IMF A;  3QAW A;  2H6X A;  1U3I A;  4JR6 A;  2YWM A;  2MYG A;  5COH A;  2VD1 A;  3DEX A;  3FMW A;  2VCW A;  2A4V A;  4GF0 A;  2O87 A;  4GCI A;  20GS A;  1GUL A;  2E2G A;  3GST A;  4XS4 B;  1AQW A;  5AIS A;  5D9W A;  1AQV A;  2JAC A;  1X9S B;  1XOB A;  1PX6 A;  2WRT A;  1G7E A;  2C0G A;  5KOW A;  2VLU A;  1OKT A;  2MZC A;  5CNW A;  5IO2 A;  1YEP A;  3MWH A;  1WP0 A;  3LXT A;  1NW2 A;  4HEA 2;  4QL7 A;  5H5R A;  4AJ8 A;  3J7Y k;  1FOH A;  2M80 A;  1TRS A;  1XWB A;  5G30 A;  1B4P A;  3ZIV A;  1W4V A;  5HR0 A;  3BJ5 A;  3RPP A;  3G7I A;  1U88 A;  1EEM A;  3DGQ A;  3ZYW A;  3PPU A;  3F6D A;  2WFC A;  3TRQ A;  3MYD A;  4ZL9 A;  2CZ2 A;  4GST A;  1ERV A;  5ECK B;  3M8N A;  2C3T A;  4QQ7 A;  1KEB A;  4HQS A;  4RI7 A;  2TRC P;  2IFQ B;  2K6V A;  1DUG A;  2CVK A;  3ZVJ A;  5J3R A;  4N30 A;  2VO4 A;  4DVC A;  2IWT A;  1JZR A;  3US3 A;  6GSS A;  1GNE A;  1THX A;  4EC0 A;  3AY8 A;  1TKD B;  5D9V A;  2VL2 A;  2K8S A;  1UVZ A;  1ZOF A;  2A2R A;  4G0K A;  2FNO A;  4N11 A;  4AJ7 A;  2B7J A;  2B1L A;  4ECJ A;  3U5R E;  5DDL A;  4NPB A;  1TDI A;  4OMV A;  3UL3 A;  1OAZ A;  1GP1 A;  1F6M C;  3DWV A;  4JR4 A;  2L59 A;  2HSM A;  2WUL A;  3HZ8 A;  1FB6 A;  3EIN A;  5DCG A;  1K0B A;  1GSY A;  3FW2 A;  1LJR A;  1XWC A;  3GV1 A;  3BCK A;  3FK8 A;  4WF4 A;  1ACV A;  3GX0 A;  2FY6 A;  4EF0 A;  3F4T A;  3GTU B;  1A24 A;  3IBH A;  1TK5 B;  3TJJ A;  1XCC A;  2DIZ A;  2IMI A;  2IMF A;  4OFM A;  5CRE A;  3TKS A;  3P7X A;  4MMM A;  3QFA C;  2XC2 A;  1X5E A;  5ABR A;  2DJ1 A;  2CAI A;  5DQS A;  1EV9 A;  1XVW A;  1X5D A;  3TJG A;  1B4Q A;  4ID0 A;  4IGJ A;  1E2Y A;  5JWO B;  2CA8 A;  3L9V A;  1Z6N A;  1OC3 A;  3IV4 A;  3ISO A;  3Q19 A;  2PMT A;  2YNX A;  4FYC A;  4ZB8 A;  3JCM L;  4GSN A;  3I6A A;  3FHK A;  4Q5R A;  1NHO A;  1ZZY A;  1GNW A;  2JZT A;  1Q98 A;  1Z6M A;  4DEJ A;  1EP8 A;  4JRR A;  3QAG A;  3UVH A;  2LNS A;  3H4K A;  5B7C A;  3VK9 A;  2QSI A;  2HZE A;  5GST A;  1XW9 A;  2HE3 A;  4KDY A;  1ZGN A;  1VGL A;  2JSY A;  3QPM A;  3HCZ A;  5LNK e;  3D4T A;  3ZIT A;  1U3A A;  1A8L A;  1SYR A;  13GS A;  3HJP A;  1BED A;  3FZ9 A;  2P31 A;  4POB A;  2N5F A;  4MPG A;  2HFD A;  1SU9 A;  1O81 A;  2GT6 A;  2HRA A;  1VF1 A;  3F63 A;  4G10 A;  4IJI A;  4X4J A;  1K3Y A;  3VWX A;  2HYX A;  2FLS A;  3RBT A;  1ZYN A;  2HRN A;  4ML1 A;  3BD2 A;  1O7U A;  2YCD A;  4MJE A;  1V57 A;  1ERW A;  2VL3 A;  1PFO A;  2MMO A;  4TN8 A;  3HA9 A;  4EDY A;  2GSR A;  2F8A A;  2OE0 A;  3TJF A;  3LYK A;  4PTS A;  4TR4 A;  5G5F A;  1AXD A;  3CMI A;  1V40 A;  4WF5 A;  5BMU A;  5HFI A;  2KLX A;  3F4S A;  3DXB A;  3RHC A;  1AUC A;  14GS A;  1Y6E A;  1PN0 A;  4YKF A;  1AQX A;  4I2T A;  4DSS A;  5J41 A;  4E8H A;  4EL1 A;  3UVT A;  1GSF A;  4O5R A;  2I9H A;  3F6F A;  1SEN A;  1JZW A;  3Q18 A;  1TP9 A;  2H1D A;  2JZS A;  1Z7P A;  2OE3 A;  4D73 A;  4FIW A;  3WT2 A;  2VL9 A;  2X8G A;  3HVS A;  4CY6 A;  3TOU A;  4KF9 A;  4EKZ A;  1V58 A;  2PWJ A;  2H70 A;  4ZBA A;  1ML6 A;  3NZN A;  1EEJ A;  3IK7 A;  9GSS A;  1N8J A;  3TB2 A;  3GL3 A;  3FYG A;  1O85 A;  5B8A A;  2DKH A;  3HDC A;  5JCU A;  4BVX A;  4L8E A;  2WB9 A;  3D4M A;  3HYP A;  2AJQ B;  1YZX A;  3QCP A;  3MDK A;  2YPM A;  5IPH A;  22GS A;  3P8W A;  2L6D A;  5HR3 A;  4GQC A;  4X0X A;  1I9D A;  5D93 A;  4KW6 A;  3BBY A;  2V2G A;  2ZUP A;  4PGT A;  2DJ0 A;  1EZK A;  2IN3 A;  1ON4 A;  4HJ2 A;  1JFU A;  4PUA A;  3IR4 A;  2FHE A;  4V1A g;  4KX4 A;  1WPI A;  4EIP A;  4ACS A;  2TRX A;  3CTF A;  4J2F A;  4ZL7 A;  3DVX A;  4NV5 A;  5CRD A;  4MP4 A;  4NV2 A;  4DSR A;  1RW1 A;  1G0T A;  1RK4 A;  2RII A;  2VCQ A;  3HD5 A;  4TXO A;  2VD0 A;  5DJM A;  4L5O A;  3TKS E;  3FZ5 A;  4K6X A;  1SL1 B;  1FOV A;  1TK8 B;  2LUS A;  4MNN A;  5DAK B;  6GSW A;  4XRD A;  2L4C A;  1X9M B;  4K1F A;  1F3A A;  1GUK A;  1J08 A;  4IHU A;  4BVY B;  3CXG A;  4H86 A;  1HNA A;  1YF0 A;  3F3Q A;  3FZ4 A;  4XCS A;  2KP1 A;  2WS2 A;  5E59 A;  3FR3 A;  4TR0 A;  1FVK A;  2GQK A;  3ZTL A;  1XW6 A;  1NSW A;  2ZCT A;  3CSJ A;  1GSD A;  2V6K A;  3IPZ A;  4QL9 A;  2R0C A;  4CDO A;  3KJY A;  4KE3 A;  2E0Q A;  5KN1 A;  1TOF A;  1QGV A;  3LYP A;  3D6I A;  1R7H A;  1J0F A;  1F3B A;  4GXZ A;  1TTZ A;  5IMZ A;  1U87 A;  2PVQ A;  4KND A;  2VCZ A;  1PKW A;  2DML A;  1B9Y C;  1G6W A;  4X43 A;  1S3D A;  5AN1 A;  1MD3 A;  3E3E A;  2IMD A;  2ALB A;  1JLW A;  5DBQ A;  2XHF A;  4ECC A;  2H6Y A;  1UC7 A;  1PD2 1;  3GMF A;  1GSE A;  5GZZ B;  3HXS A;  1PSQ A;  6GSU A;  4EUY A;  1V98 A;  3KCM A;  1NHY A;  3M0F A;  3IXR A;  1WJK A;  4BL7 B;  4TR3 A;  5FWG A;  2FA8 A;  4WET A;  1QMV A;  2F9S A;  4WBJ A;  1URM A;  2N5B A;  2NDO A;  2CX4 A;  1QFN A;  3BOA A;  1XFL A;  1N2A A;  1R26 A;  3M3M A;  5G2Z A;  3I69 A;  3A2V A;  2XBQ A;  3TRP A;  3GL5 A;  3DD3 A;  1HD2 A;  1DBY A;  3GHA A;  4TOP A;  1SD9 A;  4K2D A;  3W6G A;  2B3S A;  2E7P A;  4IP1 A;  5ECL B;  1JHB A;  5DAL B;  2G2Q A;  1J9B A;  1VF3 A;  4JE1 A;  3ZIJ A;  3PH9 A;  2I4A A;  3KH7 A;  4KSM A;  3ERF A;  1TJD A;  5D9X A;  2MMZ A;  2RLI A;  2GQM A;  2CT6 A;  3DML A;  6GSV A;  4HZ2 A;  4IQA A;  1O73 A;  1QQ2 A;  5E4W A;  2PU9 C;  3S9F A;  2H1G A;  3RHB A;  2DLX A;  4A5P A;  5JWR B;  4Z2T A;  3KH9 A;  2VM2 A;  3GSS A;  3ZZX A;  1PRX A;  4YAV A;  5JCW A;  4XTS A;  4TVE A;  4PQI A;  2GGT A;  3LW9 A;  1PN9 A;  4ZL8 A;  2AUV A;  3QOU A;  3HJM A;  1M2A A;  1JZD A;  4TR1 A;  2CZ3 A;  4FO5 A;  4G0L A;  4I97 A;  4ECI A;  1XWK A;  2HRK A;  5HFG A;  5CRH A;  4ZBB A;  4MH2 A;  2WCI A;  2GSQ A;  3KEB A;  2LST A;  1A2J A;  4XRA A;  5J5N A;  4CW9 A;  2GZP A;  2C80 A;  1XWG A;  3IDV A;  5EY6 A;  4ZBD A;  3FY7 A;  2R37 A;  4K5R A;  4F9Z A;  1XXU A;  3EMX A;  3GKN A;  1T4Y A;  3F3R A;  1W89 A;  2DSA A;  1BJX A;  5IMA A;  4ECB A;  5ID2 B;  3SBC A;  1SJ6 A;  1SYX A;  2R2J A;  3HVN A;  3GNJ A;  5HR1 A;  2HSY A;  1CQH A;  4MH3 A;  1TW9 A;  1CQG A;  4PUR A;  1K3O A;  4FQU A;  4JBB A;  3LSZ A;  2OBI A;  3GH9 A;  4IW9 A;  1SK1 A;  3GIX A;  1M99 A;  3IOS A;  5CRG A;  1UN2 A;  2YN1 A;  2OAD A;  3L9S A;  3J7Y b;  3E9J B;  4JED A;  4IJ3 A;  3L4N A;  4BPY A;  1U6T A;  4IS0 A;  4JZQ A;  2NPB A;  3IK9 A;  1S3C A;  1XG8 A;  5F05 A;  3GA4 A;  3WGE A;  5G1K A;  3NOF A;  4HOJ A;  1H75 A;  4PQ1 A;  3GUS A;  1BAY A;  5G5E A;  4EXJ A;  1DE1 A;  4K0N A;  2R4V A;  8GSS A;  5CO3 A;  1K0O A;  3A3T A;  4K2X A;  2VLV A;  1SJZ A;  1GRX A;  7GSS A;  4PNF A;  1PA3 A;  3MSZ A;  4IBP A;  2V41 A;  2LKU A;  2JZR A;  1YQ1 A;  4J56 E;  1X0R A;  3VFI A;  3QDN A;  4IP6 A;  2L5L A;  2KP2 A;  3VPQ A;  2F51 A;  1JLV A;  4LL4 B;  4GWR A;  2P5Q A;  3ZRE A;  4USS A;  3BCI A;  2FCH A;  1TK0 B;  1HNC A;  3HHV A;  3GKM A;  2H19 A;  2EIO A;  4O92 A;  1X5C A;  2GSS A;  4XHM A;  1E6B A;  4KGI A;  2C0E A;  1SK0 A;  3MNG A;  3KP9 A;  3MAK A;  2B5X A;  4ZIL A;  5D8I A;  1KTE A;  2X8C A;  1WWJ A;  3LFL A;  1UA5 A;  2HXK A;  1PGT A;  2DMM A;  4FYU A;  2FWE A;  2MMA A;  1GLQ A;  5KN3 A;  1BX9 A;  1WMJ A;  3UIW A;  19GS A;  2VM1 A;  3LXZ A;  4V2M A;  1QXH A;  17GS A;  2B6M A;  4HZ4 A;  4KCE A;  4PX1 A;  3G7Y A;  3TRX A;  1GWC A;  4K8M A;  4RQR A;  1ZYP A;  4O5U A;  4K7N A;  1I5G A;  1T7P B;  4ML6 A;  1R5P A;  2LTK A;  2C1Y A;  4GTU A;  1YJ6 A;  1XIY A;  1A8Y A;  3TGZ A;  5GAN D;  3GN3 A;  2QA2 A;  2E2M A;  2M46 A;  2GST A;  4IN0 A;  12GS A;  1S3A A;  2OKA A;  4TRX A;  3RPN A;  2H30 A;  4YKG A;  4L0W A;  4BIK A;  5EVO A;  3R3E A;  1M9B A;  1HYU A;  3H1N A;  2HRF A;  4L5L A;  5G31 A;  2F8F A;  3EWL A;  2G0F A;  4G19 A;  4YAP A;  5DJL A;  3FR6 A;  3ZLP A;  2PGT A;  1FO5 A;  1V2A A;  1OC9 A;  3EU3 A;  4X1U A;  3N5O A;  5IO0 A;  1GSQ A;  1IYI A;  5FT3 A;  2GQL A;  2DIY A;  2VUP A;  3TKQ A;  2CVB A;  1G6Y A;  4ULX A;  3LEF A;  3WGX A;  3Q74 A;  2R3X A;  3LWA A;  4NHZ A;  10GS A;  1PKZ A;  4MZB A;  3D21 A;  2XBI A;  2FWG A;  2B7K A;  4KA0 A;  4ZIJ A;  1YF1 A;  5C04 A;  1T4Z A;  4TXV A;  3KM6 A;  1A0R P;  4BWS A;  1B48 A;  3M9K A;  4ISD A;  2GZY A;  2LQQ A;  2Z9S A;  3UMA A;  5DCH A;  1QK8 A;  2N5A A;  2FWH A;  2XPE A;  1C72 A;  2QGV A;  2KUC A;  3DKS A;  4NHW A;  4POL A;  2GDR A;  4MF5 A;  2LRC A;  1X9W B;  2PUK C;  4F82 A;  4HJM A;  1BYE A;  1VRS D;  1WIK A;  3FKF A;  3VI5 A;  1O8W A;  3VLN A;  5KN0 A;  2H76 A;  2CVD A;  2VCX A;  3ERG A;  4XS4 A;  2YOI A;  1WE0 A;  2MMN A;  3QMX A;  3RAZ A;  4O7H A;  2P5R A;  2H75 A;  2RM6 A;  3KD0 A;  1YEX A;  2VIM A;  2YWO A;  1NM3 A;  1R4W A;  4RQX A;  2DKI A;  2A4H A;  2BTO T;  16GS A;  3H8Q A;  2L57 A;  1USB A;  2JSZ A;  3SWL A;  4AGS A;  4AJ6 A;  1ZL9 A;  2YZU A;  3EE2 A;  2DBC A;  4K9Z A;  4IEL A;  2H66 A;  1PMT A;  1ZMA A;  1XBS A;  1AAZ A;  2X49 A;  1TI1 A;  3DVW A;  4Z7X A;  1SL2 B;  2IFQ A;  4F0B A;  1TXX A;  2OBK A;  3EC3 A;  1ERT A;  2EC4 A;  2YZH A;  2LJA A;  3IAS 2;  2LRN A;  3U6V A;  2M72 A;  4MAB A;  5ECP B;  4MF7 A;  2AB6 A;  4Q5N A;  2HZE B;  1ZYE A;  2C4J A;  2R6K A;  3GX8 A;  5A5K A;  1SJI A;  2V6O A;  4OWY A;  1TRU A;  3EPT A;  1K0A A;  1YKC A;  2GVP A;  2DJK A;  1KNG A;  1Z7R A;  1IYH A;  2ON7 A;  1AIU A;  4ILF A;  4HDE A;  2L4Q A;  3QAV A;  1ZCP A;  4OFT A;  4XS1 A;  3C8E A;  3C1R A;  2C0D A;  1M2B A;  1VF4 A;  1YKA A;  4MJA A;  1M7T A;  4NAX A;  4PUF C;  3K8N A;  1FW1 A;  2C3Q A;  1GUH A;  3HVX A;  5ECN B;  3P2A A;  3GTU A;  3GRX A;  4MF6 A;  5IMD A;  4BA7 A;  3IC4 A;  2IJY A;  1O6J A;  5KN2 A;  4XS6 A;  2VLT A;  3F9U A;  4PNG A;  4DSS B;  4OO4 A;  2F3M A;  4FH8 A;  2HNL A;  5IPG A;  3C73 A;  5BRT A;  3WGD A;  3M9J A;  1GTB A;  5GSS A;  3QFB C;  1A2M A;  4WR4 A;  5ECH B;  1EGO A;  3CSH A;  4WKW A;  2VAF A;  1HQO A;  1B8X A;  4D73 B;  1K0N A;  1YY7 A;  1TI3 A;  4Z2R A;  1T3B A;  3VPT A;  4GSS A;  4K7O A;  4LLR A;  1G7O A;  2NTO A;  2AAW A;  5ECS A;  3WYW A;  1T1V A;  3DIE A;  2RUF A;  5ECQ B;  2ES7 A;  2DJ3 A;  1GTI A;  3IE3 A;  5GAP D;  5IMC A;  4J57 E;  3A5I A;  2UZ8 A;  4BVX B;  3F4R A;  2I1U A;  3ME7 A;  1LU4 A;  3CBU A;  2LV3 A;  2J9H A;  4EDZ A;  1Q4J A;  1EOG A;  2K8V A;  4K5S A;  3A2X A;  1OVN A;  2OJL A;  4EO3 A;  2H8L A;  4KAE A;  2OA7 A;  3LJR A;  4POK A;  3KZQ A;  3ZML A;  3QD9 A;  2HT9 A;  3KMO A;  2VCT A;  3C71 A;  4PXO A;  3ZRD A;  3G7J A;  4CY8 A;  2B5Y A;  3HZ4 A;  3GFK A;  3QR6 A;  3L9U A;  3ERW A;  3APS A;  1BG5 A;  4N0Z A;  4TXO B;  4AF2 A;  3HJO A;  1MTC A;  4G2E A;  2X64 A;  2AV4 A;  1K0M A;  3I43 A;  1GH2 A;  2YAN A;  2HI7 A;  2YV9 A;  4Q5Q A;  1M3I A;  2FWF A;  2V32 A;  5ENU A;  2GS3 A;  2PVO C;  5JWQ B;  1K3L A;  1K0C A;  5CAX A;  1EP7 A;  3I9V 2;  1ILO A;  2MBT A;  2IPA A;  2V1M A;  4E8E A;  3ZL5 A;  3KIJ A;  3GH6 A;  2TIR A;  2B1K A;  4Q5F A;  4PQH A; 
#chains in the Genus database with same CATH homology
 3DRN A;  4HU9 A;  3VUR A;  3A5W A;  3F8U A;  1XOA A;  5ECM B;  1XW5 A;  2OAC A;  1EV4 A;  5F07 A;  2PN8 A;  4BWQ A;  3WD6 A;  3KXO A;  1MEK A;  2DJJ A;  3EVI A;  5H5S A;  3L78 A;  4KB3 A;  2JAD A;  4MJC A;  3UEM A;  3IRA A;  4F0C A;  5LD0 A;  1Z3E A;  3VWW A;  2HZF A;  2WZ9 A;  4LMV A;  4WEY A;  1DE2 A;  2VOC A;  1SKS B;  1Z5Y E;  3VWV A;  1WRY A;  2CQ9 A;  2IL3 A;  3TDG A;  1BQ7 A;  3IHG A;  3P90 A;  4V2N A;  4F03 A;  2X8H A;  4I5Q A;  3ZFL A;  1ABA A;  2H0G A;  3N9J A;  4Z2U A;  2FGX A;  4GLT A;  3TCO A;  2X4A A;  2H1A A;  4MLY A;  5CRW A;  4ICY A;  1V9W A;  4MJB A;  1HNB A;  5DAK A;  3RDW A;  2WJU A;  4OD7 A;  4F2I A;  4N0V A;  3HVV A;  4MA9 A;  1Z9H A;  4BVY A;  2YP6 A;  1DSB A;  4OFN A;  2AHE A;  4MCU A;  1SD8 A;  4MPF A;  5DVB A;  1EGR A;  1EWX A;  1XVQ A;  5B6N A;  2CX3 A;  4KDX A;  3ZFB A;  4YH2 A;  3VI7 A;  2KHP A;  2CV4 A;  2L5O A;  3APO A;  4IVF A;  4G9H A;  2RM5 A;  1ERU A;  5ECR B;  5ELA A;  2A2S A;  3ED3 A;  2REM A;  2C3N A;  3UOM A;  3PIN A;  4LA1 A;  1AW9 A;  2OE1 A;  1F9M A;  3KMN A;  5EPF A;  5IIZ A;  2R0P A;  3UAR A;  1GSU A;  3CTG A;  2GTU A;  3KTL A;  3CYN A;  4EIQ A;  3ZVJ D;  2LQO A;  1M0U A;  3V1W A;  2QKE A;  4HU7 A;  4ZB9 A;  1K0D A;  4TR1 B;  2H0H A;  1FG4 A;  1OE7 A;  5F06 A;  2TIR A;  1TU8 A;  3W8J A;  1OKD A;  5F0G A;  3FRC A;  3H93 A;  4IKH A;  1ST9 A;  1A23 A;  4EVM A;  2I81 A;  3EMP A;  2DC5 A;  3CRT A;  4BL7 A;  4WXT A;  5H5Q A;  2P0G A;  1TRW A;  4K7I A;  5CP1 A;  1Y25 A;  5D96 A;  3TOT A;  1LBK A;  3ME8 A;  1GTA A;  3VWU A;  1T00 A;  18GS A;  3D22 A;  3UBK A;  2EIQ A;  2O85 A;  1F37 A;  4CHS A;  5CYY A;  5ELG A;  2B5E A;  2RUE A;  1FVJ A;  2PPT A;  4POM A;  3HY2 A;  2GT5 A;  1A0F A;  3O3T A;  2NVL A;  5DAL A;  2H01 A;  5J4U A;  3FZA A;  1H4O A;  4WBR D;  3C1S A;  5A4U A;  3LQ7 A;  1YDK A;  2WDU A;  4I2U A;  2H71 A;  2O8V B;  2H1B A;  2J23 A;  1XWA A;  5AGY A;  2JL4 A;  1XZO A;  3CSI A;  5JCG A;  3D0Z A;  2AYT A;  1OC8 A;  5J9C A;  1TRV A;  3O76 A;  3E0U A;  3IA1 A;  4NXI A;  2L6C A;  1MDI A;  5L71 A;  6GSY A;  3IC8 A;  1R5A A;  11GS A;  4O5Q A;  2LNT A;  1FB0 A;  2H0I A;  3NIV A;  2R5G A;  3HKR A;  5B8B A;  5J9B A;  5F8B A;  3DYR A;  4K0G A;  3KTB A;  2GLR A;  2ON5 A;  2H6Z A;  2ZNM A;  1B9X C;  3UBL A;  3LOR A;  4JU5 A;  1GUM A;  3R2Q A;  3PGT A;  2LJK A;  2IIY A;  4WR5 A;  1FHE A;  5KOX A;  5IM9 A;  4OCE A;  4EE0 A;  1TU7 A;  2FUG 2;  4N10 A;  4HQZ A;  3IAM 2;  3G9B A;  3TKR A;  1SK2 A;  2FA4 A;  4MDC A;  1SKR B;  3L0H A;  1PL1 A;  2R0G A;  4IQ1 A;  3A2W A;  4ZXG A;  3EYT A;  2CAQ A;  5EL8 A;  4NMU A;  4KUN A;  2HSH A;  5G1L A;  2LJR A;  3GUR A;  2VL2 C;  6GST A;  3UAP A;  2YV7 A;  1MD4 A;  3OR5 A;  2HLS A;  2A2P A;  4RUV A;  2YJH A;  5ID2 A;  3PR8 A;  2XPD A;  1GL8 A;  1RQM A;  1QUW A;  3KP8 A;  2O7K A;  1T8E B;  4KDU A;  5FHI A;  1KBN A;  1SKW B;  5DQY A;  1WOU A;  3C7M A;  1SL0 B;  4RI6 A;  5IQY A;  4KSO A;  3ZMK A;  2YWN A;  4I8B A;  3W8S A;  2H72 A;  3CRU A;  2BMX A;  2QC7 A;  5D9T A;  5KEJ A;  1AC1 A;  5IOX A;  4HUA A;  4MK3 A;  3D5J A;  1M2D A;  3IHQ A;  2QA1 A;  1A2L A;  5AIV A;  5A4V A;  1FAA A;  3TUE A;  2LRT A;  2BJX A;  2D2Z A;  5ECO B;  4YQV A;  1JZO A;  4G0I A;  2GZZ A;  3TKS C;  5C00 A;  4DSQ A;  4MZC A;  5HQP A;  5IOW A;  4ZB6 A;  4V2L A;  3Q6O A;  4XIH A;  2K18 A;  4GRF A;  4HI7 A;  2IME A;  1PQN A;  1MDK A;  5ECI B;  4YQM A;  2EIR A;  1M9A A;  2NBS A;  4L0U A;  5D73 A;  4V1A p;  2LEG A;  3APQ A;  1OC9 B;  1VF2 A;  2H74 A;  1O8X A;  2MBS A;  1XPV A;  2JU5 A;  2VCV A;  3M1G A;  2LS5 A;  3TJK A;  2O89 A;  3LGC A;  4TKY A;  4YQU A;  3TKP A;  1OE8 A;  3UJ1 A;  1MDJ A;  4P3Y B;  1OYJ A;  3WT1 A;  3GKK A;  5IMV A;  3FEU A;  5HR2 A;  3LG6 A;  4LMW A;  2WGR A;  5LCZ A;  6GSX A;  2DJ2 A;  2YJ7 A;  3KGK A;  3GYK A;  4KH7 A;  1PL2 A;  3FR9 A;  4I6X A;  3MIX A;  3TJB A;  5B6M A;  2PBJ A;  2YWI A;  1EOH A;  2H73 A;  4HS1 A;  2X99 A;  1GTU A;  2KOK A;  5A4W A;  4GQF A;  3EUR A;  2IMK A;  4KCA A;  4OO5 A;  1ZYQ B;  4NWY A;  2C0F A;  4TW5 A;  1GSS A;  2K9F A;  4LL1 B;  3GKX A;  4O32 A;  2PER A;  1F2E A;  3O6T A;  3F0I A;  5INY A;  4OCF A;  4MZW A;  3EU4 A;  5HFK A;  1THO A;  4FYB A;  2C8U A;  3H79 A;  2FD3 A;  1GLP A;  2I3Y A;  1PX7 A;  5IMF A;  3QAW A;  2H6X A;  1U3I A;  4JR6 A;  2YWM A;  2MYG A;  5COH A;  2VD1 A;  3DEX A;  3FMW A;  2VCW A;  2A4V A;  4GF0 A;  2O87 A;  4GCI A;  20GS A;  1GUL A;  2E2G A;  3GST A;  4XS4 B;  1AQW A;  5AIS A;  5D9W A;  1AQV A;  2JAC A;  1X9S B;  1XOB A;  1PX6 A;  2WRT A;  1G7E A;  2C0G A;  5KOW A;  2VLU A;  1OKT A;  2MZC A;  5CNW A;  5IO2 A;  1YEP A;  3MWH A;  1WP0 A;  3LXT A;  1NW2 A;  4HEA 2;  4QL7 A;  5H5R A;  4AJ8 A;  3J7Y k;  1FOH A;  2M80 A;  1TRS A;  1XWB A;  5G30 A;  1B4P A;  3ZIV A;  1W4V A;  5HR0 A;  3BJ5 A;  3RPP A;  3G7I A;  1U88 A;  1EEM A;  3DGQ A;  3ZYW A;  3PPU A;  3F6D A;  2WFC A;  3TRQ A;  3MYD A;  4ZL9 A;  2CZ2 A;  4GST A;  1ERV A;  5ECK B;  3M8N A;  2C3T A;  4QQ7 A;  1KEB A;  4HQS A;  4RI7 A;  2TRC P;  2IFQ B;  2K6V A;  1DUG A;  2CVK A;  3ZVJ A;  5J3R A;  4N30 A;  2VO4 A;  4DVC A;  2IWT A;  1JZR A;  3US3 A;  6GSS A;  1GNE A;  1THX A;  4EC0 A;  3AY8 A;  1TKD B;  5D9V A;  2VL2 A;  2K8S A;  1UVZ A;  1ZOF A;  2A2R A;  4G0K A;  2FNO A;  4N11 A;  4AJ7 A;  2B7J A;  2B1L A;  4ECJ A;  3U5R E;  5DDL A;  4NPB A;  1TDI A;  4OMV A;  3UL3 A;  1OAZ A;  1GP1 A;  1F6M C;  3DWV A;  4JR4 A;  2L59 A;  2HSM A;  2WUL A;  3HZ8 A;  1FB6 A;  3EIN A;  5DCG A;  1K0B A;  1GSY A;  3FW2 A;  1LJR A;  1XWC A;  3GV1 A;  3BCK A;  3FK8 A;  4WF4 A;  1ACV A;  3GX0 A;  2FY6 A;  4EF0 A;  3F4T A;  3GTU B;  1A24 A;  3IBH A;  1TK5 B;  3TJJ A;  1XCC A;  2DIZ A;  2IMI A;  2IMF A;  4OFM A;  5CRE A;  3TKS A;  3P7X A;  4MMM A;  3QFA C;  2XC2 A;  1X5E A;  5ABR A;  2DJ1 A;  2CAI A;  5DQS A;  1EV9 A;  1XVW A;  1X5D A;  3TJG A;  1B4Q A;  4ID0 A;  4IGJ A;  1E2Y A;  5JWO B;  2CA8 A;  3L9V A;  1Z6N A;  1OC3 A;  3IV4 A;  3ISO A;  3Q19 A;  2PMT A;  2YNX A;  4FYC A;  4ZB8 A;  3JCM L;  4GSN A;  3I6A A;  3FHK A;  4Q5R A;  1NHO A;  1ZZY A;  1GNW A;  2JZT A;  1Q98 A;  1Z6M A;  4DEJ A;  1EP8 A;  4JRR A;  3QAG A;  3UVH A;  2LNS A;  3H4K A;  5B7C A;  3VK9 A;  2QSI A;  2HZE A;  5GST A;  1XW9 A;  2HE3 A;  4KDY A;  1ZGN A;  1VGL A;  2JSY A;  3QPM A;  3HCZ A;  5LNK e;  3D4T A;  3ZIT A;  1U3A A;  1A8L A;  1SYR A;  13GS A;  3HJP A;  1BED A;  3FZ9 A;  2P31 A;  4POB A;  2N5F A;  4MPG A;  2HFD A;  1SU9 A;  1O81 A;  2GT6 A;  2HRA A;  1VF1 A;  3F63 A;  4G10 A;  4IJI A;  4X4J A;  1K3Y A;  3VWX A;  2HYX A;  2FLS A;  3RBT A;  1ZYN A;  2HRN A;  4ML1 A;  3BD2 A;  1O7U A;  2YCD A;  4MJE A;  1V57 A;  1ERW A;  2VL3 A;  2MMO A;  4TN8 A;  3HA9 A;  4EDY A;  2GSR A;  2F8A A;  2OE0 A;  3TJF A;  3LYK A;  4PTS A;  4TR4 A;  5G5F A;  1AXD A;  3CMI A;  1V40 A;  4WF5 A;  5BMU A;  5HFI A;  2KLX A;  3F4S A;  3DXB A;  3RHC A;  1AUC A;  14GS A;  1Y6E A;  1PN0 A;  4YKF A;  1AQX A;  4I2T A;  4DSS A;  5J41 A;  4E8H A;  4EL1 A;  3UVT A;  1GSF A;  4O5R A;  2I9H A;  3F6F A;  1SEN A;  1JZW A;  3Q18 A;  1TP9 A;  2H1D A;  2JZS A;  1Z7P A;  2OE3 A;  4D73 A;  4FIW A;  3WT2 A;  2VL9 A;  2X8G A;  3HVS A;  4CY6 A;  3TOU A;  4KF9 A;  4EKZ A;  1V58 A;  2PWJ A;  2H70 A;  4ZBA A;  1ML6 A;  3NZN A;  1EEJ A;  3IK7 A;  9GSS A;  1N8J A;  3TB2 A;  3GL3 A;  3FYG A;  1O85 A;  5B8A A;  2DKH A;  3HDC A;  5JCU A;  4BVX A;  4L8E A;  2WB9 A;  3D4M A;  3HYP A;  2AJQ B;  1YZX A;  3QCP A;  3MDK A;  2YPM A;  5IPH A;  22GS A;  3P8W A;  2L6D A;  5HR3 A;  4GQC A;  4X0X A;  1I9D A;  5D93 A;  4KW6 A;  3BBY A;  2V2G A;  2ZUP A;  4PGT A;  2DJ0 A;  1EZK A;  2IN3 A;  1ON4 A;  4HJ2 A;  1JFU A;  4PUA A;  3IR4 A;  2FHE A;  4V1A g;  4KX4 A;  1WPI A;  4EIP A;  4ACS A;  2TRX A;  3CTF A;  4J2F A;  4ZL7 A;  3DVX A;  4NV5 A;  5CRD A;  4MP4 A;  4NV2 A;  4DSR A;  1RW1 A;  1G0T A;  1RK4 A;  2RII A;  2VCQ A;  3HD5 A;  4TXO A;  2VD0 A;  5DJM A;  4L5O A;  3TKS E;  3FZ5 A;  4K6X A;  1SL1 B;  1FOV A;  1TK8 B;  2LUS A;  4MNN A;  5DAK B;  6GSW A;  4XRD A;  2L4C A;  1X9M B;  4K1F A;  1F3A A;  1GUK A;  1J08 A;  4IHU A;  4BVY B;  3CXG A;  4H86 A;  1HNA A;  1YF0 A;  3F3Q A;  3FZ4 A;  4XCS A;  2KP1 A;  2WS2 A;  5E59 A;  3FR3 A;  4TR0 A;  1FVK A;  2GQK A;  3ZTL A;  1XW6 A;  1NSW A;  2ZCT A;  3CSJ A;  1GSD A;  2V6K A;  3IPZ A;  4QL9 A;  2R0C A;  4CDO A;  3KJY A;  4KE3 A;  2E0Q A;  5KN1 A;  1TOF A;  1QGV A;  3LYP A;  3D6I A;  1R7H A;  1J0F A;  1F3B A;  4GXZ A;  1TTZ A;  5IMZ A;  1U87 A;  2PVQ A;  4KND A;  2VCZ A;  1PKW A;  2DML A;  1B9Y C;  1G6W A;  4X43 A;  1S3D A;  5AN1 A;  1MD3 A;  3E3E A;  2IMD A;  2ALB A;  1JLW A;  5DBQ A;  2XHF A;  4ECC A;  2H6Y A;  1UC7 A;  1PD2 1;  3GMF A;  1GSE A;  5GZZ B;  3HXS A;  1PSQ A;  6GSU A;  4EUY A;  1V98 A;  3KCM A;  1NHY A;  3M0F A;  3IXR A;  1WJK A;  4BL7 B;  4TR3 A;  5FWG A;  2FA8 A;  4WET A;  1QMV A;  2F9S A;  4WBJ A;  1URM A;  2N5B A;  2NDO A;  2CX4 A;  1QFN A;  3BOA A;  1XFL A;  1N2A A;  1R26 A;  3M3M A;  5G2Z A;  3I69 A;  3A2V A;  2XBQ A;  3TRP A;  3GL5 A;  3DD3 A;  1HD2 A;  1DBY A;  3GHA A;  4TOP A;  1SD9 A;  4K2D A;  3W6G A;  2B3S A;  2E7P A;  4IP1 A;  5ECL B;  1JHB A;  5DAL B;  2G2Q A;  1J9B A;  1VF3 A;  4JE1 A;  3ZIJ A;  3PH9 A;  2I4A A;  3KH7 A;  4KSM A;  3ERF A;  1TJD A;  5D9X A;  2MMZ A;  2RLI A;  2GQM A;  2CT6 A;  3DML A;  6GSV A;  4HZ2 A;  4IQA A;  1O73 A;  1QQ2 A;  5E4W A;  2PU9 C;  3S9F A;  2H1G A;  3RHB A;  2DLX A;  4A5P A;  5JWR B;  4Z2T A;  3KH9 A;  2VM2 A;  3GSS A;  3ZZX A;  1PRX A;  4YAV A;  5JCW A;  4XTS A;  4TVE A;  4PQI A;  2GGT A;  3LW9 A;  1PN9 A;  4ZL8 A;  2AUV A;  3QOU A;  3HJM A;  1M2A A;  1JZD A;  4TR1 A;  2CZ3 A;  4FO5 A;  4G0L A;  4I97 A;  4ECI A;  1XWK A;  2HRK A;  5HFG A;  5CRH A;  4ZBB A;  4MH2 A;  2WCI A;  2GSQ A;  3KEB A;  2LST A;  1A2J A;  4XRA A;  5J5N A;  4CW9 A;  2GZP A;  2C80 A;  1XWG A;  3IDV A;  5EY6 A;  4ZBD A;  3FY7 A;  2R37 A;  4K5R A;  4F9Z A;  1XXU A;  3EMX A;  3GKN A;  1T4Y A;  3F3R A;  1W89 A;  2DSA A;  1BJX A;  5IMA A;  4ECB A;  5ID2 B;  3SBC A;  1SJ6 A;  1SYX A;  2R2J A;  3GNJ A;  5HR1 A;  2HSY A;  1CQH A;  4MH3 A;  1TW9 A;  1CQG A;  4PUR A;  1K3O A;  4FQU A;  4JBB A;  3LSZ A;  2OBI A;  3GH9 A;  4IW9 A;  1SK1 A;  3GIX A;  1M99 A;  3IOS A;  5CRG A;  1UN2 A;  2YN1 A;  2OAD A;  3L9S A;  3J7Y b;  3E9J B;  4JED A;  4IJ3 A;  3L4N A;  4BPY A;  1U6T A;  4IS0 A;  4JZQ A;  2NPB A;  3IK9 A;  1S3C A;  5F05 A;  3GA4 A;  3WGE A;  5G1K A;  3NOF A;  4HOJ A;  1H75 A;  4PQ1 A;  3GUS A;  1BAY A;  5G5E A;  4EXJ A;  1DE1 A;  4K0N A;  2R4V A;  8GSS A;  5CO3 A;  1K0O A;  3A3T A;  4K2X A;  2VLV A;  1SJZ A;  1GRX A;  7GSS A;  4PNF A;  1PA3 A;  3MSZ A;  4IBP A;  2V41 A;  2LKU A;  2JZR A;  1YQ1 A;  4J56 E;  1X0R A;  3VFI A;  3QDN A;  4IP6 A;  2L5L A;  2KP2 A;  3VPQ A;  2F51 A;  1JLV A;  4LL4 B;  4GWR A;  2P5Q A;  3ZRE A;  4USS A;  3BCI A;  2FCH A;  1TK0 B;  1HNC A;  3HHV A;  3GKM A;  2H19 A;  2EIO A;  4O92 A;  1X5C A;  2GSS A;  4XHM A;  1E6B A;  4KGI A;  2C0E A;  1SK0 A;  3MNG A;  3KP9 A;  3MAK A;  2B5X A;  4ZIL A;  5D8I A;  1KTE A;  2X8C A;  1WWJ A;  3LFL A;  1UA5 A;  2HXK A;  1PGT A;  2DMM A;  4FYU A;  2FWE A;  2MMA A;  1GLQ A;  5KN3 A;  1BX9 A;  1WMJ A;  3UIW A;  19GS A;  2VM1 A;  3LXZ A;  4V2M A;  1QXH A;  17GS A;  2B6M A;  4HZ4 A;  4KCE A;  4PX1 A;  3G7Y A;  3TRX A;  1GWC A;  4K8M A;  4RQR A;  1ZYP A;  4O5U A;  4K7N A;  1I5G A;  1T7P B;  4ML6 A;  1R5P A;  2LTK A;  2C1Y A;  4GTU A;  1YJ6 A;  1XIY A;  1A8Y A;  3TGZ A;  5GAN D;  3GN3 A;  2QA2 A;  2E2M A;  2M46 A;  2GST A;  4IN0 A;  12GS A;  1S3A A;  2OKA A;  4TRX A;  3RPN A;  2H30 A;  4YKG A;  4L0W A;  5EVO A;  3R3E A;  1M9B A;  1HYU A;  3H1N A;  2HRF A;  4L5L A;  5G31 A;  2F8F A;  3EWL A;  2G0F A;  4G19 A;  4YAP A;  5DJL A;  3FR6 A;  3ZLP A;  2PGT A;  1FO5 A;  1V2A A;  1OC9 A;  3EU3 A;  4X1U A;  3N5O A;  5IO0 A;  1GSQ A;  1IYI A;  5FT3 A;  2GQL A;  2DIY A;  2VUP A;  3TKQ A;  2CVB A;  1G6Y A;  4ULX A;  3LEF A;  3WGX A;  3Q74 A;  2R3X A;  3LWA A;  4NHZ A;  10GS A;  1PKZ A;  4MZB A;  3D21 A;  2XBI A;  2FWG A;  2B7K A;  4KA0 A;  4ZIJ A;  1YF1 A;  5C04 A;  1T4Z A;  4TXV A;  3KM6 A;  1A0R P;  4BWS A;  1B48 A;  3M9K A;  4ISD A;  2GZY A;  2LQQ A;  2Z9S A;  3UMA A;  5DCH A;  1QK8 A;  2N5A A;  2FWH A;  2XPE A;  1C72 A;  2QGV A;  2KUC A;  3DKS A;  4NHW A;  4POL A;  2GDR A;  4MF5 A;  2LRC A;  1X9W B;  2PUK C;  4F82 A;  4HJM A;  1BYE A;  1VRS D;  1WIK A;  3FKF A;  3VI5 A;  1O8W A;  3VLN A;  5KN0 A;  2H76 A;  2CVD A;  2VCX A;  3ERG A;  4XS4 A;  2YOI A;  1WE0 A;  2MMN A;  3QMX A;  3RAZ A;  4O7H A;  2P5R A;  2H75 A;  2RM6 A;  3KD0 A;  1YEX A;  2VIM A;  2YWO A;  1NM3 A;  1R4W A;  4RQX A;  2DKI A;  2A4H A;  2BTO T;  16GS A;  3H8Q A;  2L57 A;  1USB A;  2JSZ A;  3SWL A;  4AGS A;  4AJ6 A;  1ZL9 A;  2YZU A;  3EE2 A;  2DBC A;  4K9Z A;  4IEL A;  2H66 A;  1PMT A;  1ZMA A;  1XBS A;  1AAZ A;  2X49 A;  1TI1 A;  3DVW A;  4Z7X A;  1SL2 B;  2IFQ A;  4F0B A;  1TXX A;  2OBK A;  3EC3 A;  1ERT A;  2EC4 A;  2YZH A;  2LJA A;  3IAS 2;  2LRN A;  3U6V A;  2M72 A;  4MAB A;  5ECP B;  4MF7 A;  2AB6 A;  4Q5N A;  2HZE B;  1ZYE A;  2C4J A;  2R6K A;  3GX8 A;  5A5K A;  1SJI A;  2V6O A;  4OWY A;  1TRU A;  3EPT A;  1K0A A;  1YKC A;  2GVP A;  2DJK A;  1KNG A;  1Z7R A;  1IYH A;  2ON7 A;  1AIU A;  4ILF A;  4HDE A;  2L4Q A;  3QAV A;  1ZCP A;  4OFT A;  4XS1 A;  3C8E A;  3C1R A;  2C0D A;  1M2B A;  1VF4 A;  1YKA A;  4MJA A;  1M7T A;  4NAX A;  4PUF C;  3K8N A;  1FW1 A;  2C3Q A;  1GUH A;  3HVX A;  5ECN B;  3P2A A;  3GTU A;  3GRX A;  4MF6 A;  5IMD A;  4BA7 A;  3IC4 A;  2IJY A;  1O6J A;  5KN2 A;  4XS6 A;  2VLT A;  3F9U A;  4PNG A;  4DSS B;  4OO4 A;  2F3M A;  4FH8 A;  2HNL A;  5IPG A;  3C73 A;  5BRT A;  3WGD A;  3M9J A;  1GTB A;  5GSS A;  3QFB C;  1A2M A;  4WR4 A;  5ECH B;  1EGO A;  3CSH A;  4WKW A;  2VAF A;  1HQO A;  1B8X A;  4D73 B;  1K0N A;  1YY7 A;  1TI3 A;  4Z2R A;  1T3B A;  3VPT A;  4GSS A;  4K7O A;  4LLR A;  1G7O A;  2NTO A;  2AAW A;  5ECS A;  3WYW A;  1T1V A;  3DIE A;  2RUF A;  5ECQ B;  2ES7 A;  2DJ3 A;  1GTI A;  3IE3 A;  5GAP D;  5IMC A;  4J57 E;  3A5I A;  2UZ8 A;  4BVX B;  3F4R A;  2I1U A;  3ME7 A;  1LU4 A;  3CBU A;  2LV3 A;  2J9H A;  4EDZ A;  1Q4J A;  1EOG A;  2K8V A;  4K5S A;  3A2X A;  1OVN A;  2OJL A;  4EO3 A;  2H8L A;  4KAE A;  2OA7 A;  3LJR A;  4POK A;  3KZQ A;  3ZML A;  3QD9 A;  2HT9 A;  3KMO A;  2VCT A;  3C71 A;  4PXO A;  3ZRD A;  3G7J A;  4CY8 A;  2B5Y A;  3HZ4 A;  3GFK A;  3QR6 A;  3L9U A;  3ERW A;  3APS A;  1BG5 A;  4N0Z A;  4TXO B;  4AF2 A;  3HJO A;  1MTC A;  4G2E A;  2X64 A;  2AV4 A;  1K0M A;  3I43 A;  1GH2 A;  2YAN A;  2HI7 A;  2YV9 A;  4Q5Q A;  2FWF A;  2V32 A;  5ENU A;  2GS3 A;  2PVO C;  5JWQ B;  1K3L A;  1K0C A;  5CAX A;  1EP7 A;  3I9V 2;  1ILO A;  2MBT A;  2IPA A;  2V1M A;  4E8E A;  3ZL5 A;  3KIJ A;  3GH6 A;  5AIX A;  2B1K A;  4Q5F A;  4PQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...