3RHBA

Crystal structure of the apo form of glutaredoxin c5 from arabidopsis thaliana
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
100
structure length
100
Chain Sequence
SRMEESIRKTVTENTVVIYSKTWCSYCTEVKTLFKRLGVQPLVVELDQLGPQGPQLQKVLERLTGQHTVPNVFVCGKHIGGCTDTVKLNRKGDLELMLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin-C5, chloroplastic
publication title Arabidopsis chloroplastic glutaredoxin c5 as a model to explore molecular determinants for iron-sulfur cluster binding into glutaredoxins.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 37
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3rhbA00
5D8IA 4WBJA 7GSSA 3G7IA 17GSA 1EOHA 4K2DA 3VWUA 3HA9A 4ZBBA 1XVWA 3APSA 2PUKC 3RHCA 4I2TA 3TGZA 2GSRA 1SENA 2HSHA 3L9UA 2DJKA 4F9ZA 3F4TA 4GQFA 2IMEA 2FCHA 1OC8A 2CX3A 2R6KA 1VF2A 2ON5A 3CRUA 4P3YB 1XFLA 1T3BA 2VD1A 3GURA 3UARA 4GSSA 3TKSE 4EL1A 2HE3A 2OJLA 1XWGA 3H79A 4NXIA 4WR5A 3MNGA 3HCZA 1W4VA 2OE0A 1S3AA 2IMIA 2V6KA 4POBA 2GLRA 2I1UA 5DQSA 4TKYA 2QGVA 5DALA 2IIYA 4ML6A 5F07A 3E3EA 2HLSA 4HZ2A 4KGIA 2REMA 18GSA 1X5DA 4ULXA 3TB2A 4IQ1A 4K7OA 4TRXA 1Y25A 1MD4A 4IS0A 5ECKB 3QMXA 3C1SA 4BWSA 20GSA 3QDNA 4YAVA 1B8XA 1EGRA 1K0BA 3ZMLA 3IV4A 2VCQA 3D0ZA 2O89A 1K0CA 4MF5A 5FHIA 4TR1A 3TKSC 2C1YA 1JHBA 2HRFA 4OD7A 1Z6NA 1GSQA 3U6VA 5EPFA 2LQOA 3IK7A 5IQYA 3QR6A 3FK8A 3I6AA 3KD0A 3LYKA 4MCUA 3I9V2 2I3YA 3IOSA 1BG5A 1G0TA 1QUWA 2VL3A 1PQNA 1ERWA 2PMTA 4K8MA 1VF1A 4XS4A 3ERFA 2FY6A 2H70A 2TRXA 1ZZYA 1XCCA 2ES7A 5DBQA 4J56E 1B4PA 4KDXA 4LLRA 3GH6A 3ME8A 2FWHA 4X1UA 2HZEA 4DSSA 1SK2A 2MMNA 3TJGA 5H5SA 5DVBA 2WCIA 1XXUA 2VLUA 2NDOA 1SKSB 4XTSA 2JSZA 3DRNA 1G6WA 5HFKA 5ECIB 1ZL9A 4N10A 2LNSA 3MWHA 3GKMA 5IOXA 2R3XA 1Z3EA 3W8JA 2H1DA 1ZOFA 3FYGA 1YF0A 3QAVA 1FVKA 1SJIA 4EXJA 4MZBA 3TKPA 4EF0A 3A2XA 3ZITA 1ZMAA 3MSZA 4KCAA 2M80A 2YP6A 3M1GA 3BD2A 3Q19A 1HYUA 1XWKA 3QCPA 1T8EB 1DE2A 1GSFA 4I6XA 1GTAA 2ON7A 4TN8A 1BYEA 4Q5NA 1MTCA 3A2WA 2LUSA 3HY2A 3D4TA 1FVJA 2AUVA 3FZ4A 1YEPA 4N11A 1EOGA 1EV9A 3C1RA 4POKA 1R7HA 4L8EA 1EP7A 3KP8A 1EWXA 3PR8A 1KEBA 3GTUB 5AGYA 3HVXA 4IQAA 3VWXA 1GSSA 2C3NA 1YKAA 5E59A 4CW9A 4GSNA 4ISDA 1GL8A 3HHVA 2RUFA 1TK0B 4KDUA 2CVDA 2H66A 2IPAA 1JZWA 4XHMA 2LEGA 4EKZA 5LCZA 2O85A 4F0BA 3P90A 3VURA 4EVMA 4MF7A 3GA4A 3C71A 1Z5YE 3IBHA 2B7KA 2DJ3A 2DLXA 1TRWA 1TRUA 1NW2A 2O7KA 1YY7A 2H0IA 3VLNA 6GSTA 5GSSA 2PPTA 1K0MA 1BAYA 2FLSA 3ZREA 4G19A 2GSSA 2YANA 2WRTA 3EU3A 1TXXA 4EDYA 2KP2A 3VPQA 3IAM2 1M2DA 1UVZA 3IRAA 2AHEA 5F8BA 5D9TA 1KBNA 5HQPA 4JR4A 2Z9SA 4NMUA 1YQ1A 6GSWA 3F4SA 5GAPD 2OADA 4AF2A 2IJYA 5JCWA 4D73B 4FO5A 3RAZA 3GN3A 1H75A 3HJPA 3RPNA 2B1KA 2GVPA 3H4KA 1XWCA 2HYXA 2B5YA 4PQHA 3LG6A 2HXKA 2QSIA 2VCTA 3TCOA 4KCEA 1X5EA 2KUCA 2WGRA 2RUEA 1WE0A 4G2EA 5IOWA 4WF5A 1SJZA 4RQXA 4QL7A 1GSYA 4GXZA 1GSDA 1Q98A 3FW2A 2DJ1A 5ELGA 2YV9A 3TOUA 3GKNA 2R37A 3QOUA 5J4UA 4XCSA 1QGVA 3WD6A 19GSA 4G9HA 5FWGA 1A24A 3TJJA 4IGJA 2YNXA 2YWNA 1XW9A 1TRVA 1TW9A 2E0QA 3KMNA 2RM5A 1OC9A 2CAIA 3CXGA 2HFDA 4FYBA 2A2RA 3UIWA 4GCIA 5F0GA 4X0XA 3RPPA 2DSAA 1M2BA 1BX9A 4I8BA 4ZB6A 1WJKA 3O3TA 5A4VA 2CV4A 4JE1A 22GSA 2GT5A 4HDEA 3BCKA 3LSZA 1G7OA 2KOKA 2VAFA 2ZNMA 4RI6A 1TTZA 1G7EA 3DIEA 4TOPA 2K6VA 4XS1A 1DUGA 5AIXA 3GX0A 3ERWA 3DXBA 3KP9A 5DAKA 3EWLA 2IFQB 1WP0A 1RK4A 2BJXA 4AGSA 1SU9A 3FRCA 3ERGA 3CBUA 2F8AA 2KLXA 1QQ2A 4L0UA 16GSA 1LBKA 4TW5A 2YJ7A 2VLVA 4MPFA 2PU9C 4LMVA 2DMMA 3ZYWA 2RM6A 3VI5A 5ECPB 4PXOA 5J9CA 4N0ZA 5KN2A 2P5QA 2FUG2 2V6OA 3QFAC 5JCGA 4HZ4A 4V2MA 2MYGA 3R2QA 2PGTA 1AUCA 1YDKA 2WFCA 2H75A 4WBRD 3CTFA 4ZIJA 4V2NA 2MBSA 4DEJA 3EMPA 3MDKA 1QMVA 4PNGA 3TKRA 3APQA 2CA8A 2AB6A 1U88A 4KSOA 1A0FA 2FWFA 4YQVA 4XS6A 2GT6A 2GSQA 1TK8B 1U6TA 2GTUA 1O8WA 4HJMA 2AYTA 13GSA 2JZTA 2XPEA 2PERA 2NPBA 5IO0A 3F3QA 1B4QA 3UBKA 1J9BA 5CP1A 2YWOA 1DE1A 1SKRB 3LGCA 1F6MC 4WETA 4EE0A 1M9BA 3LFLA 4FIWA 4WEYA 1TRSA 2GSTA 3V1WA 1AQXA 3GSTA 3QD9A 3E9JB 2V2GA 3LEFA 3M3MA 6GSXA 4GQCA 5DJMA 3EURA 1V58A 5IMAA 3TJKA 4TXOA 2YN1A 3KTLA 2WS2A 2C0GA 2AAWA 4NHZA 2WULA 4BVYA 1PKZA 2L57A 2N5BA 5G2ZA 1A0RP 3IDVA 3L9VA 3HZ4A 3FZ9A 2LV3A 2RIIA 3D21A 2F8FA 4AJ6A 5DDLA 1EGOA 1OVNA 5D96A 2L4CA 4ZB9A 4IP6A 4PUAA 4ZB8A 3F0IA 4POMA 3ZL5A 4HUAA 4RI7A 2JL4A 4JBBA 4ZL9A 2H8LA 2GDRA 12GSA 3H93A 3GKKA 3M9KA 1V2AA 2C80A 3ISOA 4BL7A 2B7JA 2IMDA 2YV7A 2FNOA 2ALBA 1TJDA 5ECQB 2IL3A 1A2LA 5ELAA 2B6MA 1Z7PA 1V57A 2OBIA 4KSMA 3GKXA 2KHPA 4ECCA 2EIQA 3UBLA 3G7JA 2C8UA 1GULA 4XRAA 1DSBA 1N8JA 14GSA 5G31A 2D2ZA 1O85A 2VUPA 2V41A 3VK9A 1GUMA 1ON4A 2P31A 5DCHA 5IMDA 4OO4A 3TJFA 3KXOA 4TVEA 5B7CA 5INYA 1ZCPA 2H76A 4ML1A 5IPHA 3A5WA 5B8AA 4H86A 2M72A 2JZSA 3KJYA 4KH7A 3D5JA 3TUEA 4JZQA 2KP1A 1THOA 4GLTA 3KGKA 1EZKA 3GX8A 1YZXA 1N2AA 1WPIA 1K3OA 2LKUA 3BJ5A 1ACVA 4MP4A 1AW9A 1O6JA 2MMAA 2GS3A 3SBCA 1R5PA 3UJ1A 3IPZA 3CSHA 3TDGA 3IXRA 5CRHA 5E4WA 3C73A 1PL2A 4L5LA 5GAND 2L4QA 4KW6A 2X99A 1PKWA 1MEKA 3KH9A 3EYTA 5ID2B 4K7IA 5G5FA 1OYJA 2LJAA 2LRTA 4K6XA 4L0WA 2G0FA 2XPDA 3WGXA 3APOA 4J57E 1B9YC 1HNBA 2GZPA 3WYWA 3CRTA 1M9AA 4NV2A 2J23A 1O8XA 1XVQA 1H4OA 4J2FA 6GSYA 1NSWA 5EL8A 3F6DA 1USBA 1SKWB 3J7Yk 2C0FA 1T1VA 4NV5A 2C3TA 1J08A 1TI3A 2TRCP 1XPVA 1B9XC 4F0CA 2F9SA 4MK3A 2JU5A 5A5KA 3AY8A 4HQSA 4DVCA 1PGTA 1TK5B 3HDCA 3L4NA 3M0FA 2B5XA 1AC1A 3G7YA 4YH2A 2DC5A 3KTBA 3GL3A 2OKAA 4K7NA 2BMXA 1XWAA 2VM2A 4BVXA 4FYCA 3HJMA 1Z9HA 3TRPA 1B48A 1FB0A 1GSEA 2CX4A 3FY7A 1TKDB 2YCDA 3ED3A 4IP1A 1OAZA 1GRXA 2YJHA 5CAXA 1K3YA 4GRFA 1XWBA 2VO4A 1FW1A 1WIKA 4K0GA 4K1FA 2IWTA 4JR6A 1GLQA 3EVIA 1ML6A 1A8LA 2H71A 2MBTA 3GH9A 3KZQA 1T4YA 3N5OA 3J7Yb 4ECJA 3GTUA 3CSJA 2HI7A 2HZFA 2CVKA 1XOAA 1UA5A 2CAQA 4GTUA 3EE2A 3RDWA 1E2YA 5J3RA 3DKSA 1GTIA 3K8NA 1KNGA 3ZIVA 2LJKA 2H72A 5HR1A 2XC2A 2OE3A 1ERUA 4MLYA 1PX6A 2VD0A 5IMVA 3FR3A 1Z6MA 3UMAA 2LSTA 4RUVA 5G1KA 3TRXA 1SD9A 3BCIA 2R5GA 4JU5A 1TU8A 1THXA 2H01A 1FOVA 2GGTA 2CT6A 3DYRA 3F3RA 5HFGA 3UAPA 2VOCA 3LXTA 1U87A 4ZBAA 3ZTLA 1R5AA 1ZGNA 2MMZA 2FGXA 1VF4A 2H1GA 4OO5A 3E0UA 5CRDA 5JWQB 5F06A 1JZDA 1FO5A 4MJCA 4TR4A 1XZOA 3H8QA 4D73A 5H5RA 3QFBC 3DGQA 1NHYA 4ZBDA 5DJLA 5DCGA 3UVTA 1GNEA 3KM6A 2G2QA 4KAEA 1ERVA 1A2JA 2LS5A 1O7UA 3LXZA 1GUKA 4OMVA 5C00A 4V1Ap 2F3MA 4DSRA 3GV1A 4PGTA 5JWOB 1F3BA 2LRNA 3VWVA 2VCWA 3DVXA 2YWIA 1VGLA 4ZL7A 4F03A 2ZCTA 2YPMA 1QFNA 3EMXA 4KE3A 4I97A 5ECNB 1F9MA 2VM1A 2JSYA 5D73A 1QK8A 5CNWA 2DJ2A 11GSA 4O92A 2JACA 4MH2A 3C7MA 2V32A 2K8SA 3JCML 5B8BA 4KB3A 3IE3A 4KX4A 4OCFA 4WR4A 4XIHA 2AV4A 1X0RA 1URMA 3D22A 1VF3A 2IMKA 1HQOA 2VL9A 1M0UA 3DWVA 4NPBA 1RW1A 3WT1A 4KNDA 3G9BA 2WZ9A 2X8GA 1U3AA 2IFQA 1OKDA 1XIYA 1V40A 3HKRA 4HU9A 5CRGA 1R26A 2BTOT 4O5RA 1C72A 2IN3A 3ZZXA 3O76A 1OKTA 1TDIA 4WKWA 4IJ3A 1VRSD 4KDYA 3DMLA 5FT3A 3FZ5A 4MJBA 3P2AA 3RHBA 4EC0A 1AQWA 1SYXA 4O32A 4ACSA 4ECIA 3KH7A 2VCVA 1MDIA 1K0OA 4MH3A 4MZCA 4MZWA 5EVOA 1DBYA 1FB6A 2LTKA 2F51A 4QQ7A 4NHWA 3O6TA 4Q5RA 5KEJA 5ENUA 1MDKA 3CMIA 4OCEA 3KCMA 3UOMA 5ECRB 2IMFA 5G5EA 9GSSA 1F3AA 1XW5A 5ECOB 5DALB 5G1LA 3WGDA 3HD5A 2GQMA 4ZL8A 2H73A 2PVQA 1XOBA 4AJ8A 3IR4A 1SJ6A 2YWMA 1LJRA 4ILFA 4PQ1A 10GSA 1PL1A 1FHEA 1F37A 4HU7A 4MMMA 2X8HA 3ZVJA 3EC3A 3FHKA 1TU7A 1YJ6A 1JLWA 3TKSA 2FA8A 3KMOA 1IYHA 3I69A 1UC7A 3S9FA 5IIZA 1HNCA 1EV4A 2QKEA 3U5RE 3F6FA 1W89A 2E2MA 2QC7A 4MABA 3ZFLA 2X64A 5ECHB 1Y6EA 2OACA 1IYIA 5IMZA 4TR1B 1V9WA 4EUYA 2O8VB 3D4MA 3UL3A 4K0NA 2FA4A 3FR9A 3HVSA 3P8WA 3VPTA 3HVVA 4NWYA 2YZUA 4HS1A 3L0HA 3ZFBA 5ABRA 1ERTA 4PQIA 5EY6A 2HNLA 4YQMA 1PMTA 4PX1A 4XS4B 3Q74A 5ECLB 4K9ZA 2GZZA 3TJBA 2L6DA 1X9WB 5A4WA 3GMFA 3MAKA 6GSVA 3ZLPA 2AJQB 5JCUA 1X9MB 1BJXA 1RQMA 1I5GA 2L5OA 4V2LA 4LL4B 2HZEB 2CVBA 4DSSB 4TXVA 1WRYA 2FWGA 1SL1B 5CRWA 5C04A 2B5EA 2A2SA 5AISA 3F8UA 2XBQA 3WGEA 1YKCA 3LWAA 2CQ9A 5IM9A 5HFIA 5GSTA 4HQZA 1YF1A 1G6YA 4LMWA 3QAWA 4Z7XA 2OE1A 1OC3A 3DVWA 1GH2A 4CHSA 4FH8A 4FYUA 3IAS2 4MA9A 3GSSA 1PA3A 2NVLA 3GUSA 3TOTA 3TRQA 2N5FA 5KN1A 5G30A 1CQHA 3FR6A 2DBCA 1XBSA 3D6IA 1FG4A 1K0AA 1J0FA 4I5QA 5D9VA 2EIOA 1GLPA 3NIVA 2YOIA 4WF4A 2H0HA 5D9XA 3H1NA 4L5OA 2K9FA 4ID0A 1GWCA 2L5LA 2B1LA 3GRXA 1BEDA 1EEMA 1MD3A 1SL2B 1M2AA 1E6BA 1Z7RA 5D93A 1T4ZA 1M99A 3UEMA 5LD0A 4IW9A 1K0DA 2L6CA 3GHAA 2V1MA 1GTBA 2PVOC 5KN0A 5D9WA 3W8SA 1BQ7A 4CDOA 2HSYA 2H6YA 3WT2A 4PUFC 4LA1A 1HD2A 2VL2A 1WMJA 4OWYA 2H1AA 4YAPA 2K8VA 4TR3A 3RBTA 4YQUA 1WWJA 3ME7A 3LQ7A 3BOAA 1Q4JA 3DD3A 4JRRA 4ECBA 2I9HA 2PN8A 4HOJA 1T00A 2A4VA 5AIVA 2H6ZA 3L78A 2H19A 1JZRA 3M9JA 2K18A 1SYRA 4HJ2A 1YEXA 4LL1B 3Q18A 4MJEA 5ID2A 2C4JA 4X43A 3GNJA 6GSUA 5COHA 1A8YA 1PX7A 2H6XA 2VCXA 3KIJA 2JADA 4XRDA 5J9BA 5B6MA 5L71A 2PBJA 4Q5FA 1SK0A 4F2IA 5HR0A 3BBYA 3ZVJD 4BA7A 1M7TA 1WOUA 3N9JA 2L59A 1NHOA 1TOFA 1K0NA 3IA1A 4AJ7A 5IMCA 5HR2A 3W6GA 4KA0A 3IC4A 2DIYA 5A4UA 2N5AA 5CO3A 2H1BA 3F9UA 4EO3A 4MDCA 3CSIA 1XW6A 5ECMB 2I4AA 2VL2C 1X5CA 3HJOA 1UN2A 3M8NA 3PINA 1GNWA 4E8EA 3KEBA 2WJUA 1SK1A 4WXTA 1T7PB 2DMLA 4OFMA 2GZYA 3GIXA 1A23A 2E7PA 2X8CA 3OR5A 1OC9B 1EEJA 1JZOA 4G10A 5LNKe 2LJRA 1O81A 4PNFA 1R4WA 1GTUA 1SL0B 3F4RA 3EINA 5H5QA 1JFUA 1AQVA 3HZ8A 1X9SB 2VLTA 2WDUA 2CZ3A 2GQLA 3NOFA 4KUNA 2H30A 2ZUPA 1K3LA 2OBKA 5ECSA 5HR3A 1F2EA 2P0GA 2VCZA 5J5NA 1GSUA 2H0GA 3DEXA 1SD8A 1NM3A 5B6NA 4V1Ag 4GF0A 2RLIA 2B3SA 4IKHA 5DAKB 1U3IA 1ST9A 5CYYA 5AN1A 8GSSA 4MPGA 2CZ2A 3GL5A 2VIMA 1PRXA 2XHFA 2M46A 4MJAA 4EDZA 3PGTA 1TP9A 4PURA 4BPYA 2XBIA 2I81A 1EP8A 4N30A 5DQYA 3L9SA 4HI7A 4GSTA 4OFNA 2E2GA 2R2JA 2YZHA 4QL9A 3UVHA 3F63A 4GWRA 5JWRB 3QPMA 2PWJA 1OE8A 4IJIA 3PH9A 3VFIA 4IN0A 4E8HA 2FHEA 1MDJA 4IBPA 3Q6OA 2EIRA 3P7XA 1PD21 1V98A 2OA7A 1HNAA 3QAGA 5IPGA 3NZNA 3A3TA 2P5RA 1JLVA 4TR0A 2FWEA 2LNTA 2MZCA 5IO2A 4MF6A 3LYPA 3FZAA 4OFTA 4ZILA 1AIUA 2WB9A 3GFKA 1CQGA 4DSQA 1ABAA 3VWWA 1TI1A 1AAZA 4Q5QA 1ZYQB 2H74A 1FAAA 4POLA 2C0DA 3TKQA 2NTOA 1LU4A 4N0VA 3EU4A 2DJJA 2FD3A 1GUHA 6GSSA 2C3QA 2TIRA 1PSQA 2HRNA 3FKFA 2DJ0A 1A2MA 4JEDA 3VI7A 3FEUA 3IHQA 4BWQA 4ZXGA 2EC4A 2NBSA 2MMOA 5CREA 1KTEA 2C0EA 1QXHA 3CYNA 4I2UA 1S3CA 2JZRA 4IELA 5GZZB 3GYKA 1AXDA 4NAXA 2O87A 1OE7A 1GP1A 2HT9A 4IHUA 2J9HA 1ZYEA 3I43A 5J41A 2GQKA 1ILOA 3ZMKA 1PN9A 3CTGA 5KN3A 1O73A 3IK9A 3HYPA 4HEA2 3ZRDA 3LORA 4TXOB 3ZIJA 2DIZA 4O7HA 3C8EA 2LQQA 5IMFA 3SWLA 4RQRA 3HXSA 1I9DA 1S3DA 3LJRA 5F05A 4F82A 2LRCA 4IVFA 3A2VA 3US3A 2R4VA
chains in the Genus database with same CATH superfamily
5D8IA 4WBJA 7GSSA 3G7IA 17GSA 1EOHA 4K2DA 3VWUA 3HA9A 4ZBBA 1XVWA 3APSA 2PUKC 3RHCA 4I2TA 3TGZA 2GSRA 1SENA 2HSHA 3L9UA 2DJKA 4F9ZA 3F4TA 4GQFA 2IMEA 2FCHA 1OC8A 2CX3A 2R6KA 1VF2A 4BL7B 2ON5A 3CRUA 4P3YB 1XFLA 1T3BA 2VD1A 3GURA 3UARA 4GSSA 3TKSE 4YKGA 4EL1A 2HE3A 2OJLA 2HRKA 1XWGA 3H79A 4NXIA 4WR5A 3MNGA 3HCZA 1W4VA 2OE0A 1S3AA 2IMIA 2V6KA 4POBA 2GLRA 2I1UA 5DQSA 4TKYA 2QGVA 5DALA 2IIYA 4ML6A 5BMUA 5F07A 3E3EA 2HLSA 4HZ2A 4KGIA 2REMA 18GSA 1X5DA 4ULXA 3TB2A 4IQ1A 4K7OA 4TRXA 1Y25A 1MD4A 4IS0A 5ECKB 3QMXA 3C1SA 4BWSA 20GSA 3QDNA 4YAVA 1B8XA 1EGRA 1K0BA 3ZMLA 3IV4A 2VCQA 3D0ZA 2O89A 1K0CA 4MF5A 5FHIA 4TR1A 3TKSC 2C1YA 1JHBA 2HRFA 4OD7A 1Z6NA 1GSQA 3U6VA 5EPFA 2LQOA 2A4HA 3IK7A 5IQYA 3QR6A 3FK8A 3I6AA 3KD0A 3LYKA 4MCUA 3I9V2 2I3YA 3IOSA 1BG5A 1G0TA 1QUWA 2VL3A 1PQNA 1ERWA 2PMTA 4K8MA 1VF1A 4XS4A 3ERFA 2FY6A 4CY8A 2H70A 2TRXA 1ZZYA 1XCCA 2ES7A 5DBQA 4J56E 1B4PA 4KDXA 4LLRA 3GH6A 3ME8A 2FWHA 4X1UA 2HZEA 4DSSA 1SK2A 2MMNA 3TJGA 5H5SA 5DVBA 2WCIA 1XXUA 2VLUA 2NDOA 4X4JA 1SKSB 4XTSA 2JSZA 3DRNA 1G6WA 5HFKA 5ECIB 1ZL9A 4N10A 2LNSA 3MWHA 3GKMA 5IOXA 2R3XA 1Z3EA 3A5IA 3W8JA 2H1DA 1ZOFA 3FYGA 1YF0A 3QAVA 1FVKA 1SJIA 4EXJA 4MZBA 3TKPA 4EF0A 3A2XA 3ZITA 1ZMAA 3MSZA 4KCAA 2M80A 2YP6A 3M1GA 3BD2A 3Q19A 1HYUA 1XWKA 3QCPA 1T8EB 1DE2A 1GSFA 4I6XA 1GTAA 2ON7A 4Z2UA 4TN8A 1BYEA 4Q5NA 1MTCA 3A2WA 2LUSA 3HY2A 3D4TA 1FVJA 2AUVA 3FZ4A 1YEPA 4N11A 1EOGA 1EV9A 3C1RA 4POKA 4ICYA 2HSMA 1R7HA 4L8EA 1EP7A 3KP8A 1EWXA 3PR8A 1KEBA 3GTUB 5AGYA 3HVXA 4IQAA 3VWXA 1GSSA 2C3NA 1YKAA 5E59A 4CW9A 4GSNA 4ISDA 1GL8A 1XG8A 3HHVA 2RUFA 1TK0B 4KDUA 2CVDA 2H66A 2IPAA 1JZWA 4XHMA 2LEGA 4EKZA 5LCZA 2O85A 4F0BA 3P90A 3VURA 4EVMA 4MF7A 3GA4A 3C71A 1Z5YE 3IBHA 2B7KA 2DJ3A 2DLXA 1TRWA 1TRUA 1NW2A 2O7KA 1YY7A 2H0IA 3VLNA 6GSTA 5GSSA 2PPTA 1K0MA 1BAYA 2FLSA 3ZREA 4G19A 2GSSA 2YANA 2WRTA 3EU3A 1TXXA 4EDYA 2KP2A 3VPQA 3IAM2 1M2DA 1UVZA 3IRAA 2AHEA 5F8BA 5D9TA 1KBNA 5HQPA 4JR4A 2Z9SA 4NMUA 1YQ1A 6GSWA 3F4SA 5GAPD 2OADA 4AF2A 2IJYA 5JCWA 4D73B 4FO5A 3RAZA 3GN3A 1H75A 3HJPA 3RPNA 2B1KA 2GVPA 3H4KA 1XWCA 2HYXA 2B5YA 4PQHA 3LG6A 2HXKA 2QSIA 2VCTA 3TCOA 4KCEA 1X5EA 2KUCA 2WGRA 2RUEA 1WE0A 4G2EA 5IOWA 4WF5A 1SJZA 4RQXA 4QL7A 1GSYA 4GXZA 1GSDA 1Q98A 3FW2A 3PPUA 2DJ1A 4G0KA 5ELGA 2YV9A 3TOUA 3GKNA 2R37A 3QOUA 5J4UA 4XCSA 1QGVA 3WD6A 19GSA 4G9HA 5FWGA 1A24A 3TJJA 4IGJA 2YNXA 2YWNA 1XW9A 2R0CA 1TRVA 1TW9A 2E0QA 3KMNA 2RM5A 1OC9A 2CAIA 3CXGA 2HFDA 4FYBA 2A2RA 4K2XA 3UIWA 4GCIA 5F0GA 4X0XA 3RPPA 2DSAA 1M2BA 1BX9A 4I8BA 4ZB6A 1WJKA 3O3TA 5A4VA 2CV4A 4JE1A 22GSA 2GT5A 4HDEA 3BCKA 4CY6A 3LSZA 1G7OA 2KOKA 2VAFA 2ZNMA 4RI6A 1TTZA 1G7EA 3DIEA 4TOPA 2K6VA 4XS1A 1DUGA 5AIXA 3GX0A 3ERWA 3DXBA 3KP9A 5DAKA 3EWLA 2IFQB 1WP0A 1RK4A 2BJXA 4AGSA 1SU9A 3FRCA 3ERGA 3CBUA 2F8AA 2KLXA 1QQ2A 4L0UA 16GSA 1LBKA 4TW5A 2YJ7A 2VLVA 4MPFA 2PU9C 4LMVA 2DMMA 3ZYWA 2RM6A 3VI5A 5ECPB 4PXOA 5J9CA 4N0ZA 5KN2A 2P5QA 2FUG2 2V6OA 3QFAC 5JCGA 4HZ4A 4V2MA 2MYGA 3R2QA 2PGTA 1AUCA 1YDKA 2WFCA 2H75A 4WBRD 4A5PA 3CTFA 4ZIJA 4V2NA 2MBSA 4DEJA 3EMPA 3MDKA 1QMVA 4PNGA 3TKRA 3APQA 2CA8A 2AB6A 1U88A 4KSOA 1A0FA 2FWFA 4YQVA 4XS6A 2GT6A 2GSQA 1TK8B 1U6TA 5KOWA 2GTUA 1O8WA 4HJMA 2AYTA 13GSA 2JZTA 2XPEA 2PERA 2NPBA 5IO0A 3F3QA 1B4QA 3UBKA 1J9BA 2UZ8A 5CP1A 2YWOA 1DE1A 1SKRB 3LGCA 1F6MC 4WETA 4EE0A 1M9BA 3LFLA 4FIWA 4WEYA 1TRSA 2GSTA 3V1WA 1AQXA 3GSTA 3QD9A 3E9JB 2V2GA 3LEFA 3M3MA 6GSXA 4GQCA 5DJMA 3EURA 1V58A 5IMAA 3TJKA 4TXOA 2YN1A 3KTLA 2WS2A 2C0GA 2AAWA 4NHZA 2WULA 4BVYA 1PKZA 2L57A 2N5BA 5G2ZA 1A0RP 3IDVA 3L9VA 3HZ4A 3FZ9A 2LV3A 2RIIA 3IHGA 3D21A 2F8FA 4AJ6A 5DDLA 1EGOA 1OVNA 5D96A 2L4CA 4ZB9A 1PFOA 4IP6A 4PUAA 4ZB8A 3F0IA 4POMA 3ZL5A 4HUAA 4RI7A 2JL4A 4JBBA 4ZL9A 2H8LA 2GDRA 12GSA 3H93A 3GKKA 3M9KA 4BIKA 4KF9A 1V2AA 2C80A 3ISOA 4BL7A 2B7JA 2IMDA 2YV7A 1ZYNA 2ALBA 2FNOA 1TJDA 5ECQB 2IL3A 1A2LA 5ELAA 2B6MA 1Z7PA 1V57A 2OBIA 4KSMA 2DKHA 3GKXA 2KHPA 4ECCA 2EIQA 3UBLA 3G7JA 2C8UA 1GULA 4XRAA 1DSBA 1N8JA 14GSA 5G31A 2D2ZA 1O85A 2VUPA 2V41A 3VK9A 1GUMA 3HVNA 1ON4A 2P31A 5DCHA 5IMDA 4OO4A 3IC8A 3TJFA 3KXOA 4TVEA 5B7CA 5INYA 1ZCPA 2H76A 4ML1A 5IPHA 3A5WA 5B8AA 4H86A 2M72A 2JZSA 3KJYA 4KH7A 3D5JA 3TUEA 4JZQA 2KP1A 1THOA 4GLTA 3KGKA 1EZKA 3GX8A 1YZXA 1N2AA 1WPIA 1K3OA 2LKUA 3BJ5A 1ACVA 4MP4A 1AW9A 1O6JA 2MMAA 2GS3A 3SBCA 1R5PA 3UJ1A 3IPZA 3CSHA 3TDGA 3IXRA 5CRHA 5E4WA 3C73A 1PL2A 4L5LA 5GAND 2L4QA 4KW6A 2X99A 1PKWA 1MEKA 3KH9A 3EYTA 5ID2B 4K7IA 5G5FA 4BVXB 1OYJA 2LJAA 2LRTA 4K6XA 4L0WA 2G0FA 2XPDA 3WGXA 3APOA 4J57E 1B9YC 1HNBA 2GZPA 3WYWA 3CRTA 1M9AA 4NV2A 2J23A 1O8XA 1XVQA 1H4OA 4J2FA 6GSYA 1NSWA 3F6DA 1USBA 5EL8A 1SKWB 3J7Yk 2C0FA 1M3IA 1T1VA 4NV5A 2C3TA 1J08A 1TI3A 2TRCP 1XPVA 1M3JA 1B9XC 4F0CA 2F9SA 4MK3A 2JU5A 5A5KA 4Z2RA 3AY8A 4HQSA 4DVCA 3CQFA 1PGTA 1TK5B 3HDCA 3L4NA 3M0FA 2B5XA 1AC1A 3G7YA 4YH2A 2DC5A 4K5SA 3KTBA 3GL3A 2OKAA 4K7NA 2BMXA 1XWAA 2VM2A 4BVXA 4FYCA 2DKIA 3HJMA 1Z9HA 3TRPA 1B48A 1FB0A 1GSEA 2CX4A 3FY7A 1TKDB 2YCDA 3ED3A 4IP1A 1OAZA 1GRXA 2YJHA 5CAXA 1K3YA 4GRFA 1XWBA 2QA2A 2VO4A 1FW1A 1WIKA 4K0GA 4K1FA 2IWTA 4JR6A 1GLQA 3EVIA 1ML6A 1A8LA 4MNNA 2H71A 2MBTA 3GH9A 3KZQA 1T4YA 3N5OA 3J7Yb 4ECJA 3GTUA 3CSJA 2HI7A 2HZFA 2CVKA 1XOAA 1UA5A 2CAQA 4GTUA 3EE2A 3RDWA 1E2YA 5J3RA 3DKSA 1GTIA 3K8NA 1KNGA 3ZIVA 2LJKA 2H72A 5HR1A 2XC2A 2OE3A 1ERUA 4MLYA 1PX6A 2VD0A 5IMVA 3FR3A 1Z6MA 3UMAA 2LSTA 4RUVA 5G1KA 3TRXA 1SD9A 3BCIA 2R5GA 4JU5A 1TU8A 1THXA 2H01A 1FOVA 2GGTA 2CT6A 3DYRA 3F3RA 5HFGA 3UAPA 2VOCA 3LXTA 1U87A 4ZBAA 3ZTLA 1R5AA 1ZGNA 2MMZA 2FGXA 1VF4A 2H1GA 4OO5A 3E0UA 5CRDA 2HRAA 5JWQB 5F06A 1JZDA 1FO5A 4MJCA 4TR4A 1XZOA 3H8QA 4D73A 5H5RA 3QFBC 3DGQA 1NHYA 4ZBDA 5DJLA 5DCGA 3UVTA 1GNEA 3KM6A 2G2QA 4KAEA 1ERVA 1A2JA 2LS5A 1O7UA 3LXZA 1GUKA 4OMVA 5C00A 4V1Ap 2F3MA 4DSRA 3GV1A 4PGTA 5JWOB 1F3BA 2LRNA 3VWVA 2VCWA 3DVXA 2YWIA 1VGLA 4ZL7A 4F03A 4K5RA 3LW9A 2ZCTA 2YPMA 1QFNA 3EMXA 4KE3A 4I97A 5ECNB 1F9MA 2VM1A 2JSYA 5D73A 1QK8A 5CNWA 2DJ2A 11GSA 4O92A 2JACA 4MH2A 3C7MA 1FOHA 2V32A 2K8SA 3JCML 5B8BA 4KB3A 3IE3A 4KX4A 4OCFA 4WR4A 4XIHA 2AV4A 1X0RA 1URMA 3D22A 1VF3A 2IMKA 1HQOA 2VL9A 1M0UA 3DWVA 4NPBA 1RW1A 3WT1A 4KNDA 3G9BA 2WZ9A 2X8GA 1U3AA 2IFQA 1OKDA 1XIYA 1V40A 3HKRA 4HU9A 5CRGA 2R0GA 1R26A 2BTOT 4O5RA 1C72A 2IN3A 3ZZXA 3O76A 1OKTA 1TDIA 4WKWA 4IJ3A 1VRSD 4KDYA 3DMLA 5FT3A 3FZ5A 4MJBA 3P2AA 3RHBA 4EC0A 1AQWA 1SYXA 4O32A 4ACSA 4ECIA 2X4AA 4PTSA 3KH7A 2VCVA 1MDIA 1K0OA 4MH3A 4MZCA 4MZWA 5EVOA 1DBYA 1FB6A 2LTKA 2F51A 3MYDA 4QQ7A 4NHWA 3O6TA 4Q5RA 5KEJA 5ENUA 4YKFA 1MDKA 3CMIA 4OCEA 3KCMA 3UOMA 5ECRB 2IMFA 5G5EA 9GSSA 1F3AA 1XW5A 5ECOB 5DALB 5G1LA 3WGDA 3HD5A 2GQMA 4ZL8A 2H73A 2PVQA 1XOBA 4AJ8A 3IR4A 1SJ6A 2YWMA 1LJRA 4ILFA 4PQ1A 4FQUA 10GSA 1PL1A 1FHEA 1F37A 4HU7A 4MMMA 2X8HA 3ZVJA 3EC3A 3FHKA 1TU7A 1YJ6A 1JLWA 3TKSA 2FA8A 3KMOA 1IYHA 3I69A 1UC7A 4O5UA 3S9FA 5IIZA 1HNCA 1EV4A 2QKEA 3U5RE 3F6FA 1W89A 2E2MA 2QC7A 4MABA 3ZFLA 2X64A 5ECHB 1Y6EA 2OACA 1IYIA 5IMZA 4TR1B 1V9WA 4EUYA 2O8VB 3D4MA 3UL3A 4K0NA 2FA4A 3FR9A 3HVSA 3P8WA 3VPTA 3HVVA 4O5QA 4NWYA 2YZUA 4HS1A 3L0HA 1S3RA 3ZFBA 5ABRA 1ERTA 4PQIA 2A2PA 5EY6A 1ZYPA 2HNLA 4YQMA 1PMTA 4PX1A 4XS4B 3Q74A 5ECLB 4K9ZA 2GZZA 3TJBA 5BRTA 2L6DA 1X9WB 5A4WA 3GMFA 3MAKA 6GSVA 3ZLPA 2AJQB 5JCUA 1X9MB 1BJXA 1RQMA 1I5GA 2L5OA 4V2LA 4LL4B 2HZEB 2X49A 2CVBA 4DSSB 4TXVA 1WRYA 2FWGA 1SL1B 5CRWA 4USSA 5C04A 2B5EA 4Z2TA 2A2SA 5AISA 3F8UA 2XBQA 3WGEA 1YKCA 3LWAA 2CQ9A 5IM9A 5HFIA 5GSTA 4HQZA 1YF1A 1G6YA 4LMWA 3QAWA 4Z7XA 2OE1A 1OC3A 3DVWA 1GH2A 4CHSA 4FH8A 4FYUA 3IAS2 4MA9A 3GSSA 1PA3A 2NVLA 3GUSA 3TOTA 3TRQA 2N5FA 5KN1A 5G30A 1CQHA 3FR6A 2DBCA 1XBSA 3D6IA 1FG4A 1K0AA 1J0FA 4I5QA 5D9VA 2EIOA 1GLPA 3NIVA 2YOIA 4WF4A 2H0HA 5D9XA 3H1NA 4L5OA 2K9FA 4ID0A 1GWCA 2L5LA 2B1LA 3GRXA 1BEDA 1EEMA 1MD3A 1SL2B 1M2AA 1E6BA 1Z7RA 5D93A 1T4ZA 1M99A 3UEMA 5LD0A 4IW9A 1K0DA 2L6CA 3GHAA 2V1MA 1GTBA 2PVOC 5KN0A 5D9WA 3W8SA 1BQ7A 4CDOA 2HSYA 2H6YA 3WT2A 4PUFC 3R3EA 4LA1A 1HD2A 2VL2A 1WMJA 4OWYA 2H1AA 4YAPA 2K8VA 4TR3A 3RBTA 4YQUA 1WWJA 3ME7A 3LQ7A 3BOAA 1Q4JA 3DD3A 4JRRA 4ECBA 2I9HA 2PN8A 4HOJA 1T00A 2A4VA 5AIVA 2H6ZA 3L78A 2H19A 1JZRA 3M9JA 2K18A 3EPTA 1SYRA 4HJ2A 1YEXA 4LL1B 3Q18A 4MJEA 5ID2A 2C4JA 4X43A 3GNJA 4EIPA 6GSUA 5COHA 1A8YA 1PX7A 2H6XA 2VCXA 3KIJA 2JADA 4XRDA 5J9BA 5B6MA 1PN0A 5L71A 2PBJA 4Q5FA 1SK0A 4F2IA 5HR0A 3BBYA 3ZVJD 4BA7A 1M7TA 1WOUA 3N9JA 2L59A 1NHOA 1TOFA 1K0NA 3IA1A 4AJ7A 5IMCA 5HR2A 3W6GA 4KA0A 3IC4A 2DIYA 5A4UA 2N5AA 5CO3A 2H1BA 3F9UA 5KOXA 4EO3A 4MDCA 3CSIA 1XW6A 5ECMB 2I4AA 2VL2C 1X5CA 3HJOA 1UN2A 3M8NA 3PINA 1GNWA 4E8EA 3KEBA 2WJUA 1SK1A 4WXTA 1T7PB 2DMLA 4OFMA 2GZYA 3GIXA 1A23A 2E7PA 2X8CA 3OR5A 1OC9B 1EEJA 1JZOA 4G10A 5LNKe 2LJRA 1O81A 4PNFA 1R4WA 1GTUA 1SL0B 3F4RA 3EINA 5H5QA 1JFUA 1AQVA 3HZ8A 1X9SB 2VLTA 2WDUA 2CZ3A 2GQLA 3NOFA 4KUNA 2H30A 2ZUPA 1K3LA 2OBKA 5ECSA 5HR3A 1F2EA 2P0GA 2QA1A 2VCZA 5J5NA 1GSUA 2H0GA 3DEXA 1SD8A 1NM3A 5B6NA 4V1Ag 4EIQA 4GF0A 3MIXA 2RLIA 2B3SA 4IKHA 5DAKB 1U3IA 1ST9A 5CYYA 5AN1A 8GSSA 4G0LA 4MPGA 2CZ2A 3GL5A 2VIMA 1PRXA 2XHFA 2M46A 4MJAA 4EDZA 3PGTA 1TP9A 4PURA 4BPYA 2XBIA 2I81A 1EP8A 4N30A 5DQYA 3L9SA 4HI7A 4GSTA 4OFNA 2E2GA 2R2JA 2YZHA 4QL9A 3UVHA 3F63A 4GWRA 5JWRB 3QPMA 2PWJA 1OE8A 3FMWA 4IJIA 3PH9A 3VFIA 4IN0A 4E8HA 2FHEA 1MDJA 4IBPA 3Q6OA 2EIRA 3P7XA 1PD21 1V98A 2OA7A 1HNAA 3QAGA 5IPGA 3NZNA 3A3TA 2P5RA 1JLVA 4TR0A 2FWEA 2LNTA 2MZCA 5IO2A 4MF6A 3LYPA 3FZAA 4OFTA 4ZILA 1AIUA 2WB9A 3GFKA 1CQGA 4DSQA 1ABAA 3VWWA 1TI1A 1AAZA 4Q5QA 1ZYQB 2H74A 1FAAA 4POLA 2C0DA 3TKQA 2NTOA 1LU4A 4N0VA 3EU4A 2DJJA 2FD3A 1GUHA 6GSSA 2C3QA 2TIRA 1PSQA 2HRNA 3FKFA 2DJ0A 1A2MA 4JEDA 3VI7A 3FEUA 3IHQA 4BWQA 4HSCX 4ZXGA 2EC4A 2NBSA 2MMOA 5CREA 1KTEA 2C0EA 1QXHA 4G0IA 3CYNA 4I2UA 1S3CA 2JZRA 4IELA 5GZZB 3GYKA 1AXDA 4NAXA 2O87A 1OE7A 1GP1A 2HT9A 4IHUA 2J9HA 1ZYEA 3I43A 5J41A 2GQKA 1ILOA 3ZMKA 1PN9A 3CTGA 5KN3A 1O73A 3IK9A 3HYPA 4HEA2 3ZRDA 3LORA 4TXOB 3ZIJA 2DIZA 4O7HA 2R0PA 3C8EA 2LQQA 4BVYB 5IMFA 3SWLA 4RQRA 3HXSA 1I9DA 1S3DA 3LJRA 5F05A 4F82A 2LRCA 4IVFA 3A2VA 3US3A 2R4VA
chains in the Genus database with same CATH topology
5D8IA 4WBJA 7GSSA 3G7IA 17GSA 1EOHA 4K2DA 3VWUA 3HA9A 4ZBBA 1XVWA 3APSA 2PUKC 3RHCA 4I2TA 3TGZA 2GSRA 1SENA 2HSHA 3L9UA 2DJKA 4F9ZA 3F4TA 4GQFA 2IMEA 2FCHA 1OC8A 2CX3A 2R6KA 1VF2A 4BL7B 2ON5A 3CRUA 4P3YB 1XFLA 1T3BA 2VD1A 3GURA 3UARA 4GSSA 3TKSE 4YKGA 4EL1A 2HE3A 2OJLA 2HRKA 1XWGA 3H79A 4NXIA 4WR5A 3MNGA 3HCZA 1W4VA 2OE0A 1S3AA 2IMIA 2V6KA 4POBA 2GLRA 2I1UA 5DQSA 4TKYA 2QGVA 5DALA 2IIYA 4ML6A 5BMUA 5F07A 3E3EA 2HLSA 4HZ2A 4KGIA 2REMA 18GSA 1X5DA 4ULXA 3TB2A 4IQ1A 4K7OA 4TRXA 1Y25A 1MD4A 4IS0A 5ECKB 3QMXA 3C1SA 4BWSA 20GSA 3QDNA 4YAVA 1B8XA 1EGRA 1K0BA 3ZMLA 3IV4A 2VCQA 3D0ZA 2O89A 1K0CA 4MF5A 5FHIA 4TR1A 3TKSC 2C1YA 1JHBA 2HRFA 4OD7A 1Z6NA 1GSQA 3U6VA 5EPFA 2LQOA 2A4HA 3IK7A 5IQYA 3QR6A 3FK8A 3I6AA 3KD0A 3LYKA 4MCUA 3I9V2 2I3YA 3IOSA 1BG5A 1G0TA 1QUWA 2VL3A 1PQNA 1ERWA 2PMTA 4K8MA 1VF1A 4XS4A 3ERFA 2FY6A 4CY8A 2H70A 2TRXA 1ZZYA 1XCCA 2ES7A 5DBQA 4J56E 1B4PA 4KDXA 4LLRA 3GH6A 3ME8A 2FWHA 4X1UA 2HZEA 4DSSA 1SK2A 2MMNA 3TJGA 5H5SA 5DVBA 2WCIA 1XXUA 2VLUA 2NDOA 4X4JA 1SKSB 4XTSA 2JSZA 3DRNA 1G6WA 5HFKA 5ECIB 1ZL9A 4N10A 2LNSA 3MWHA 3GKMA 5IOXA 2R3XA 1Z3EA 3A5IA 3W8JA 2H1DA 1ZOFA 3FYGA 1YF0A 3QAVA 1FVKA 1SJIA 4EXJA 4MZBA 3TKPA 4EF0A 3A2XA 3ZITA 1ZMAA 3MSZA 4KCAA 2M80A 2YP6A 3M1GA 3BD2A 3Q19A 1HYUA 1XWKA 3QCPA 1T8EB 1DE2A 1GSFA 4I6XA 1GTAA 2ON7A 4Z2UA 4TN8A 1BYEA 4Q5NA 1MTCA 3A2WA 2LUSA 3HY2A 3D4TA 1FVJA 2AUVA 3FZ4A 1YEPA 4N11A 1EOGA 1EV9A 3C1RA 4POKA 4ICYA 2HSMA 1R7HA 4L8EA 1EP7A 3KP8A 1EWXA 3PR8A 1KEBA 3GTUB 5AGYA 3HVXA 4IQAA 3VWXA 1GSSA 2C3NA 1YKAA 5E59A 4CW9A 4GSNA 4ISDA 1GL8A 3HHVA 2RUFA 1TK0B 4KDUA 2CVDA 2H66A 2IPAA 1JZWA 4XHMA 2LEGA 4EKZA 5LCZA 2O85A 4F0BA 3P90A 3VURA 4EVMA 4MF7A 3GA4A 3C71A 1Z5YE 3IBHA 2B7KA 2DJ3A 2DLXA 1TRWA 1TRUA 1NW2A 2O7KA 1YY7A 2H0IA 3VLNA 6GSTA 5GSSA 2PPTA 1K0MA 1BAYA 2FLSA 3ZREA 4G19A 2GSSA 2YANA 2WRTA 3EU3A 1TXXA 4EDYA 2KP2A 3VPQA 3IAM2 1M2DA 1UVZA 3IRAA 2AHEA 5F8BA 5D9TA 1KBNA 5HQPA 4JR4A 2Z9SA 4NMUA 1YQ1A 6GSWA 3F4SA 5GAPD 2OADA 4AF2A 2IJYA 5JCWA 4D73B 4FO5A 3RAZA 3GN3A 1H75A 3HJPA 3RPNA 2B1KA 2GVPA 3H4KA 1XWCA 2HYXA 2B5YA 4PQHA 3LG6A 2HXKA 2QSIA 2VCTA 3TCOA 4KCEA 1X5EA 2KUCA 2WGRA 2RUEA 1WE0A 4G2EA 5IOWA 4WF5A 1SJZA 4RQXA 4QL7A 1GSYA 4GXZA 1GSDA 1Q98A 3FW2A 3PPUA 2DJ1A 4G0KA 5ELGA 2YV9A 3TOUA 3GKNA 2R37A 3QOUA 5J4UA 4XCSA 1QGVA 3WD6A 19GSA 4G9HA 5FWGA 1A24A 3TJJA 4IGJA 2YNXA 2YWNA 1XW9A 2R0CA 1TRVA 1TW9A 2E0QA 3KMNA 2RM5A 1OC9A 2CAIA 3CXGA 2HFDA 4FYBA 2A2RA 4K2XA 3UIWA 4GCIA 5F0GA 4X0XA 3RPPA 2DSAA 1M2BA 1BX9A 4I8BA 4ZB6A 1WJKA 3O3TA 5A4VA 2CV4A 4JE1A 22GSA 2GT5A 4HDEA 3BCKA 4CY6A 3LSZA 1G7OA 2KOKA 2VAFA 2ZNMA 4RI6A 1TTZA 1G7EA 3DIEA 4TOPA 2K6VA 4XS1A 1DUGA 5AIXA 3GX0A 3ERWA 3DXBA 3KP9A 5DAKA 3EWLA 2IFQB 1WP0A 1RK4A 2BJXA 4AGSA 1SU9A 3FRCA 3ERGA 3CBUA 2F8AA 2KLXA 1QQ2A 4L0UA 16GSA 1LBKA 4TW5A 2YJ7A 2VLVA 4MPFA 2PU9C 4LMVA 2DMMA 3ZYWA 2RM6A 3VI5A 5ECPB 4PXOA 5J9CA 4N0ZA 5KN2A 2P5QA 2FUG2 2V6OA 3QFAC 5JCGA 4HZ4A 4V2MA 2MYGA 3R2QA 2PGTA 1AUCA 1YDKA 2WFCA 2H75A 4WBRD 4A5PA 3CTFA 4ZIJA 4V2NA 2MBSA 4DEJA 3EMPA 3MDKA 1QMVA 4PNGA 3TKRA 3APQA 2CA8A 2AB6A 1U88A 4KSOA 1A0FA 2FWFA 4YQVA 4XS6A 2GT6A 2GSQA 1TK8B 1U6TA 5KOWA 2GTUA 1O8WA 4HJMA 2AYTA 13GSA 2JZTA 2XPEA 2PERA 2NPBA 5IO0A 3F3QA 1B4QA 3UBKA 1J9BA 2UZ8A 5CP1A 2YWOA 1DE1A 1SKRB 3LGCA 1F6MC 4WETA 4EE0A 1M9BA 3LFLA 4FIWA 4WEYA 1TRSA 2GSTA 3V1WA 1AQXA 3GSTA 3QD9A 3E9JB 2V2GA 3LEFA 3M3MA 6GSXA 4GQCA 5DJMA 3EURA 1V58A 5IMAA 3TJKA 4TXOA 2YN1A 3KTLA 2WS2A 2C0GA 2AAWA 4NHZA 2WULA 4BVYA 1PKZA 2L57A 2N5BA 5G2ZA 1A0RP 3IDVA 3L9VA 3HZ4A 3FZ9A 2LV3A 2RIIA 3IHGA 3D21A 2F8FA 4AJ6A 5DDLA 1EGOA 1OVNA 5D96A 2L4CA 4ZB9A 4IP6A 4PUAA 4ZB8A 3F0IA 4POMA 3ZL5A 4HUAA 4RI7A 2JL4A 4JBBA 4ZL9A 2H8LA 2GDRA 12GSA 3H93A 3GKKA 3M9KA 4KF9A 1V2AA 2C80A 3ISOA 4BL7A 2B7JA 2IMDA 2YV7A 1ZYNA 2ALBA 2FNOA 1TJDA 5ECQB 2IL3A 1A2LA 5ELAA 2B6MA 1Z7PA 1V57A 2OBIA 4KSMA 2DKHA 3GKXA 2KHPA 4ECCA 2EIQA 3UBLA 3G7JA 2C8UA 1GULA 4XRAA 1DSBA 1N8JA 14GSA 5G31A 2D2ZA 1O85A 2VUPA 2V41A 3VK9A 1GUMA 1ON4A 2P31A 5DCHA 5IMDA 4OO4A 3IC8A 3TJFA 3KXOA 4TVEA 5B7CA 5INYA 1ZCPA 2H76A 4ML1A 5IPHA 3A5WA 5B8AA 4H86A 2M72A 2JZSA 3KJYA 4KH7A 3D5JA 3TUEA 4JZQA 2KP1A 1THOA 4GLTA 3KGKA 1EZKA 3GX8A 1YZXA 1N2AA 1WPIA 1K3OA 2LKUA 3BJ5A 1ACVA 4MP4A 1AW9A 1O6JA 2MMAA 2GS3A 3SBCA 1R5PA 3UJ1A 3IPZA 3CSHA 3TDGA 3IXRA 5CRHA 5E4WA 3C73A 1PL2A 4L5LA 5GAND 2L4QA 4KW6A 2X99A 1PKWA 1MEKA 3KH9A 3EYTA 5ID2B 4K7IA 5G5FA 4BVXB 1OYJA 2LJAA 2LRTA 4K6XA 4L0WA 2G0FA 2XPDA 3WGXA 3APOA 4J57E 1B9YC 1HNBA 2GZPA 3WYWA 3CRTA 1M9AA 4NV2A 2J23A 1O8XA 1XVQA 1H4OA 4J2FA 6GSYA 1NSWA 3F6DA 1USBA 5EL8A 1SKWB 3J7Yk 2C0FA 1T1VA 4NV5A 2C3TA 1J08A 1TI3A 2TRCP 1XPVA 1B9XC 4F0CA 2F9SA 4MK3A 2JU5A 5A5KA 4Z2RA 3AY8A 4HQSA 4DVCA 1PGTA 1TK5B 3HDCA 3L4NA 3M0FA 2B5XA 1AC1A 3G7YA 4YH2A 2DC5A 4K5SA 3KTBA 3GL3A 2OKAA 4K7NA 2BMXA 1XWAA 2VM2A 4BVXA 4FYCA 2DKIA 3HJMA 1Z9HA 3TRPA 1B48A 1FB0A 1GSEA 2CX4A 3FY7A 1TKDB 2YCDA 3ED3A 4IP1A 1OAZA 1GRXA 2YJHA 5CAXA 1K3YA 4GRFA 1XWBA 2QA2A 2VO4A 1FW1A 1WIKA 4K0GA 4K1FA 2IWTA 4JR6A 1GLQA 3EVIA 1ML6A 1A8LA 4MNNA 2H71A 2MBTA 3GH9A 3KZQA 1T4YA 3N5OA 3J7Yb 4ECJA 3GTUA 3CSJA 2HI7A 2HZFA 2CVKA 1XOAA 1UA5A 2CAQA 4GTUA 3EE2A 3RDWA 1E2YA 5J3RA 3DKSA 1GTIA 3K8NA 1KNGA 3ZIVA 2LJKA 2H72A 5HR1A 2XC2A 2OE3A 1ERUA 4MLYA 1PX6A 2VD0A 5IMVA 3FR3A 1Z6MA 3UMAA 2LSTA 4RUVA 5G1KA 3TRXA 1SD9A 3BCIA 2R5GA 4JU5A 1TU8A 1THXA 2H01A 1FOVA 2GGTA 2CT6A 3DYRA 3F3RA 5HFGA 3UAPA 2VOCA 3LXTA 1U87A 4ZBAA 3ZTLA 1R5AA 1ZGNA 2MMZA 2FGXA 1VF4A 2H1GA 4OO5A 3E0UA 5CRDA 2HRAA 5JWQB 5F06A 1JZDA 1FO5A 4MJCA 4TR4A 1XZOA 3H8QA 4D73A 5H5RA 3QFBC 3DGQA 1NHYA 4ZBDA 5DJLA 5DCGA 3UVTA 1GNEA 3KM6A 2G2QA 4KAEA 1ERVA 1A2JA 2LS5A 1O7UA 3LXZA 1GUKA 4OMVA 5C00A 4V1Ap 2F3MA 4DSRA 3GV1A 4PGTA 5JWOB 1F3BA 2LRNA 3VWVA 2VCWA 3DVXA 2YWIA 1VGLA 4ZL7A 4F03A 4K5RA 3LW9A 2ZCTA 2YPMA 1QFNA 3EMXA 4KE3A 4I97A 5ECNB 1F9MA 2VM1A 2JSYA 5D73A 1QK8A 5CNWA 2DJ2A 11GSA 4O92A 2JACA 4MH2A 3C7MA 1FOHA 2V32A 2K8SA 3JCML 5B8BA 4KB3A 3IE3A 4KX4A 4OCFA 4WR4A 4XIHA 2AV4A 1X0RA 1URMA 3D22A 1VF3A 2IMKA 1HQOA 2VL9A 1M0UA 3DWVA 4NPBA 1RW1A 3WT1A 4KNDA 3G9BA 2WZ9A 2X8GA 1U3AA 2IFQA 1OKDA 1XIYA 1V40A 3HKRA 4HU9A 5CRGA 2R0GA 1R26A 2BTOT 4O5RA 1C72A 2IN3A 3ZZXA 3O76A 1OKTA 1TDIA 4WKWA 4IJ3A 1VRSD 4KDYA 3DMLA 5FT3A 3FZ5A 4MJBA 3P2AA 3RHBA 4EC0A 1AQWA 1SYXA 4O32A 4ACSA 4ECIA 2X4AA 4PTSA 3KH7A 2VCVA 1MDIA 1K0OA 4MH3A 4MZCA 4MZWA 5EVOA 1DBYA 1FB6A 2LTKA 2F51A 3MYDA 4QQ7A 4NHWA 3O6TA 4Q5RA 5KEJA 5ENUA 4YKFA 1MDKA 3CMIA 4OCEA 3KCMA 3UOMA 5ECRB 2IMFA 5G5EA 9GSSA 1F3AA 1XW5A 5ECOB 5DALB 5G1LA 3WGDA 3HD5A 2GQMA 4ZL8A 2H73A 2PVQA 1XOBA 4AJ8A 3IR4A 1SJ6A 2YWMA 1LJRA 4ILFA 4PQ1A 4FQUA 10GSA 1PL1A 1FHEA 1F37A 4HU7A 4MMMA 2X8HA 3ZVJA 3EC3A 3FHKA 1TU7A 1YJ6A 1JLWA 3TKSA 2FA8A 3KMOA 1IYHA 3I69A 1UC7A 4O5UA 3S9FA 5IIZA 1HNCA 1EV4A 2QKEA 3U5RE 3F6FA 1W89A 2E2MA 2QC7A 4MABA 3ZFLA 2X64A 5ECHB 1Y6EA 2OACA 1IYIA 5IMZA 4TR1B 1V9WA 4EUYA 2O8VB 3D4MA 3UL3A 4K0NA 2FA4A 3FR9A 3HVSA 3P8WA 3VPTA 3HVVA 4O5QA 4NWYA 2YZUA 4HS1A 3L0HA 3ZFBA 5ABRA 1ERTA 4PQIA 2A2PA 5EY6A 1ZYPA 2HNLA 4YQMA 1PMTA 4PX1A 4XS4B 3Q74A 5ECLB 4K9ZA 2GZZA 3TJBA 5BRTA 2L6DA 1X9WB 5A4WA 3GMFA 3MAKA 6GSVA 3ZLPA 2AJQB 5JCUA 1X9MB 1BJXA 1RQMA 1I5GA 2L5OA 4V2LA 4LL4B 2HZEB 2X49A 2CVBA 4DSSB 4TXVA 1WRYA 2FWGA 1SL1B 5CRWA 4USSA 5C04A 2B5EA 4Z2TA 2A2SA 5AISA 3F8UA 2XBQA 3WGEA 1YKCA 3LWAA 2CQ9A 5IM9A 5HFIA 5GSTA 4HQZA 1YF1A 1G6YA 4LMWA 3QAWA 4Z7XA 2OE1A 1OC3A 3DVWA 1GH2A 4CHSA 4FH8A 4FYUA 3IAS2 4MA9A 3GSSA 1PA3A 2NVLA 3GUSA 3TOTA 3TRQA 2N5FA 5KN1A 5G30A 1CQHA 3FR6A 2DBCA 1XBSA 3D6IA 1FG4A 1K0AA 1J0FA 4I5QA 5D9VA 2EIOA 1GLPA 3NIVA 2YOIA 4WF4A 2H0HA 5D9XA 3H1NA 4L5OA 2K9FA 4ID0A 1GWCA 2L5LA 2B1LA 3GRXA 1BEDA 1EEMA 1MD3A 1SL2B 1M2AA 1E6BA 1Z7RA 5D93A 1T4ZA 1M99A 3UEMA 5LD0A 4IW9A 1K0DA 2L6CA 3GHAA 2V1MA 1GTBA 2PVOC 5KN0A 5D9WA 3W8SA 1BQ7A 4CDOA 2HSYA 2H6YA 3WT2A 4PUFC 3R3EA 4LA1A 1HD2A 2VL2A 1WMJA 4OWYA 2H1AA 4YAPA 2K8VA 4TR3A 3RBTA 4YQUA 1WWJA 3ME7A 3LQ7A 3BOAA 1Q4JA 3DD3A 4JRRA 4ECBA 2I9HA 2PN8A 4HOJA 1T00A 2A4VA 5AIVA 2H6ZA 3L78A 2H19A 1JZRA 3M9JA 2K18A 3EPTA 1SYRA 4HJ2A 1YEXA 4LL1B 3Q18A 4MJEA 5ID2A 2C4JA 4X43A 3GNJA 4EIPA 6GSUA 5COHA 1A8YA 1PX7A 2H6XA 2VCXA 3KIJA 2JADA 4XRDA 5J9BA 5B6MA 1PN0A 5L71A 2PBJA 4Q5FA 1SK0A 4F2IA 5HR0A 3BBYA 3ZVJD 4BA7A 1M7TA 1WOUA 3N9JA 2L59A 1NHOA 1TOFA 1K0NA 3IA1A 4AJ7A 5IMCA 5HR2A 3W6GA 4KA0A 3IC4A 2DIYA 5A4UA 2N5AA 5CO3A 2H1BA 3F9UA 5KOXA 4EO3A 4MDCA 3CSIA 1XW6A 5ECMB 2I4AA 2VL2C 1X5CA 3HJOA 1UN2A 3M8NA 3PINA 1GNWA 4E8EA 3KEBA 2WJUA 1SK1A 4WXTA 1T7PB 2DMLA 4OFMA 2GZYA 3GIXA 1A23A 2E7PA 2X8CA 3OR5A 1OC9B 1EEJA 1JZOA 4G10A 5LNKe 2LJRA 1O81A 4PNFA 1R4WA 1GTUA 1SL0B 3F4RA 3EINA 5H5QA 1JFUA 1AQVA 3HZ8A 1X9SB 2VLTA 2WDUA 2CZ3A 2GQLA 3NOFA 4KUNA 2H30A 2ZUPA 1K3LA 2OBKA 5ECSA 5HR3A 1F2EA 2P0GA 2QA1A 2VCZA 5J5NA 1GSUA 2H0GA 3DEXA 1SD8A 1NM3A 5B6NA 4V1Ag 4EIQA 4GF0A 3MIXA 2RLIA 2B3SA 4IKHA 5DAKB 1U3IA 1ST9A 5CYYA 5AN1A 8GSSA 4G0LA 4MPGA 2CZ2A 3GL5A 2VIMA 1PRXA 2XHFA 2M46A 4MJAA 4EDZA 3PGTA 1TP9A 4PURA 4BPYA 2XBIA 2I81A 1EP8A 4N30A 5DQYA 3L9SA 4HI7A 4GSTA 4OFNA 2E2GA 2R2JA 2YZHA 4QL9A 3UVHA 3F63A 4GWRA 5JWRB 3QPMA 2PWJA 1OE8A 3FMWA 4IJIA 3PH9A 3VFIA 4IN0A 4E8HA 2FHEA 1MDJA 4IBPA 3Q6OA 2EIRA 3P7XA 1PD21 1V98A 2OA7A 1HNAA 3QAGA 5IPGA 3NZNA 3A3TA 2P5RA 1JLVA 4TR0A 2FWEA 2LNTA 2MZCA 5IO2A 4MF6A 3LYPA 3FZAA 4OFTA 4ZILA 1AIUA 2WB9A 3GFKA 1CQGA 4DSQA 1ABAA 3VWWA 1TI1A 1AAZA 4Q5QA 1ZYQB 2H74A 1FAAA 4POLA 2C0DA 3TKQA 2NTOA 1LU4A 4N0VA 3EU4A 2DJJA 2FD3A 1GUHA 6GSSA 2C3QA 2TIRA 1PSQA 2HRNA 3FKFA 2DJ0A 1A2MA 4JEDA 3VI7A 3FEUA 3IHQA 4BWQA 4ZXGA 2EC4A 2NBSA 2MMOA 5CREA 1KTEA 2C0EA 1QXHA 4G0IA 3CYNA 4I2UA 1S3CA 2JZRA 4IELA 5GZZB 3GYKA 1AXDA 4NAXA 2O87A 1OE7A 1GP1A 2HT9A 4IHUA 2J9HA 1ZYEA 3I43A 5J41A 2GQKA 1ILOA 3ZMKA 1PN9A 3CTGA 5KN3A 1O73A 3IK9A 3HYPA 4HEA2 3ZRDA 3LORA 4TXOB 3ZIJA 2DIZA 4O7HA 2R0PA 3C8EA 2LQQA 4BVYB 5IMFA 3SWLA 4RQRA 3HXSA 1I9DA 1S3DA 3LJRA 5F05A 4F82A 2LRCA 4IVFA 3A2VA 3US3A 2R4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D8I A;  4WBJ A;  7GSS A;  3G7I A;  17GS A;  1EOH A;  4K2D A;  3VWU A;  3HA9 A;  4ZBB A;  1XVW A;  3APS A;  2PUK C;  3RHC A;  4I2T A;  3TGZ A;  2GSR A;  1SEN A;  2HSH A;  3L9U A;  2DJK A;  4F9Z A;  3F4T A;  4GQF A;  2IME A;  2FCH A;  1OC8 A;  2CX3 A;  2R6K A;  1VF2 A;  2ON5 A;  3CRU A;  4P3Y B;  1XFL A;  1T3B A;  2VD1 A;  3GUR A;  3UAR A;  4GSS A;  3TKS E;  4EL1 A;  2HE3 A;  2OJL A;  1XWG A;  3H79 A;  4NXI A;  4WR5 A;  3MNG A;  3HCZ A;  1W4V A;  2OE0 A;  1S3A A;  2IMI A;  2V6K A;  4POB A;  2GLR A;  2I1U A;  5DQS A;  4TKY A;  2QGV A;  5DAL A;  2IIY A;  4ML6 A;  5F07 A;  3E3E A;  2HLS A;  4HZ2 A;  4KGI A;  2REM A;  18GS A;  1X5D A;  4ULX A;  3TB2 A;  4IQ1 A;  4K7O A;  4TRX A;  1Y25 A;  1MD4 A;  4IS0 A;  5ECK B;  3QMX A;  3C1S A;  4BWS A;  20GS A;  3QDN A;  4YAV A;  1B8X A;  1EGR A;  1K0B A;  3ZML A;  3IV4 A;  2VCQ A;  3D0Z A;  2O89 A;  1K0C A;  4MF5 A;  5FHI A;  4TR1 A;  3TKS C;  2C1Y A;  1JHB A;  2HRF A;  4OD7 A;  1Z6N A;  1GSQ A;  3U6V A;  5EPF A;  2LQO A;  3IK7 A;  5IQY A;  3QR6 A;  3FK8 A;  3I6A A;  3KD0 A;  3LYK A;  4MCU A;  3I9V 2;  2I3Y A;  3IOS A;  1BG5 A;  1G0T A;  1QUW A;  2VL3 A;  1PQN A;  1ERW A;  2PMT A;  4K8M A;  1VF1 A;  4XS4 A;  3ERF A;  2FY6 A;  2H70 A;  2TRX A;  1ZZY A;  1XCC A;  2ES7 A;  5DBQ A;  4J56 E;  1B4P A;  4KDX A;  4LLR A;  3GH6 A;  3ME8 A;  2FWH A;  4X1U A;  2HZE A;  4DSS A;  1SK2 A;  2MMN A;  3TJG A;  5H5S A;  5DVB A;  2WCI A;  1XXU A;  2VLU A;  2NDO A;  1SKS B;  4XTS A;  2JSZ A;  3DRN A;  1G6W A;  5HFK A;  5ECI B;  1ZL9 A;  4N10 A;  2LNS A;  3MWH A;  3GKM A;  5IOX A;  2R3X A;  1Z3E A;  3W8J A;  2H1D A;  1ZOF A;  3FYG A;  1YF0 A;  3QAV A;  1FVK A;  1SJI A;  4EXJ A;  4MZB A;  3TKP A;  4EF0 A;  3A2X A;  3ZIT A;  1ZMA A;  3MSZ A;  4KCA A;  2M80 A;  2YP6 A;  3M1G A;  3BD2 A;  3Q19 A;  1HYU A;  1XWK A;  3QCP A;  1T8E B;  1DE2 A;  1GSF A;  4I6X A;  1GTA A;  2ON7 A;  4TN8 A;  1BYE A;  4Q5N A;  1MTC A;  3A2W A;  2LUS A;  3HY2 A;  3D4T A;  1FVJ A;  2AUV A;  3FZ4 A;  1YEP A;  4N11 A;  1EOG A;  1EV9 A;  3C1R A;  4POK A;  1R7H A;  4L8E A;  1EP7 A;  3KP8 A;  1EWX A;  3PR8 A;  1KEB A;  3GTU B;  5AGY A;  3HVX A;  4IQA A;  3VWX A;  1GSS A;  2C3N A;  1YKA A;  5E59 A;  4CW9 A;  4GSN A;  4ISD A;  1GL8 A;  3HHV A;  2RUF A;  1TK0 B;  4KDU A;  2CVD A;  2H66 A;  2IPA A;  1JZW A;  4XHM A;  2LEG A;  4EKZ A;  5LCZ A;  2O85 A;  4F0B A;  3P90 A;  3VUR A;  4EVM A;  4MF7 A;  3GA4 A;  3C71 A;  1Z5Y E;  3IBH A;  2B7K A;  2DJ3 A;  2DLX A;  1TRW A;  1TRU A;  1NW2 A;  2O7K A;  1YY7 A;  2H0I A;  3VLN A;  6GST A;  5GSS A;  2PPT A;  1K0M A;  1BAY A;  2FLS A;  3ZRE A;  4G19 A;  2GSS A;  2YAN A;  2WRT A;  3EU3 A;  1TXX A;  4EDY A;  2KP2 A;  3VPQ A;  3IAM 2;  1M2D A;  1UVZ A;  3IRA A;  2AHE A;  5F8B A;  5D9T A;  1KBN A;  5HQP A;  4JR4 A;  2Z9S A;  4NMU A;  1YQ1 A;  6GSW A;  3F4S A;  5GAP D;  2OAD A;  4AF2 A;  2IJY A;  5JCW A;  4D73 B;  4FO5 A;  3RAZ A;  3GN3 A;  1H75 A;  3HJP A;  3RPN A;  2B1K A;  2GVP A;  3H4K A;  1XWC A;  2HYX A;  2B5Y A;  4PQH A;  3LG6 A;  2HXK A;  2QSI A;  2VCT A;  3TCO A;  4KCE A;  1X5E A;  2KUC A;  2WGR A;  2RUE A;  1WE0 A;  4G2E A;  5IOW A;  4WF5 A;  1SJZ A;  4RQX A;  4QL7 A;  1GSY A;  4GXZ A;  1GSD A;  1Q98 A;  3FW2 A;  2DJ1 A;  5ELG A;  2YV9 A;  3TOU A;  3GKN A;  2R37 A;  3QOU A;  5J4U A;  4XCS A;  1QGV A;  3WD6 A;  19GS A;  4G9H A;  5FWG A;  1A24 A;  3TJJ A;  4IGJ A;  2YNX A;  2YWN A;  1XW9 A;  1TRV A;  1TW9 A;  2E0Q A;  3KMN A;  2RM5 A;  1OC9 A;  2CAI A;  3CXG A;  2HFD A;  4FYB A;  2A2R A;  3UIW A;  4GCI A;  5F0G A;  4X0X A;  3RPP A;  2DSA A;  1M2B A;  1BX9 A;  4I8B A;  4ZB6 A;  1WJK A;  3O3T A;  5A4V A;  2CV4 A;  4JE1 A;  22GS A;  2GT5 A;  4HDE A;  3BCK A;  3LSZ A;  1G7O A;  2KOK A;  2VAF A;  2ZNM A;  4RI6 A;  1TTZ A;  1G7E A;  3DIE A;  4TOP A;  2K6V A;  4XS1 A;  1DUG A;  5AIX A;  3GX0 A;  3ERW A;  3DXB A;  3KP9 A;  5DAK A;  3EWL A;  2IFQ B;  1WP0 A;  1RK4 A;  2BJX A;  4AGS A;  1SU9 A;  3FRC A;  3ERG A;  3CBU A;  2F8A A;  2KLX A;  1QQ2 A;  4L0U A;  16GS A;  1LBK A;  4TW5 A;  2YJ7 A;  2VLV A;  4MPF A;  2PU9 C;  4LMV A;  2DMM A;  3ZYW A;  2RM6 A;  3VI5 A;  5ECP B;  4PXO A;  5J9C A;  4N0Z A;  5KN2 A;  2P5Q A;  2FUG 2;  2V6O A;  3QFA C;  5JCG A;  4HZ4 A;  4V2M A;  2MYG A;  3R2Q A;  2PGT A;  1AUC A;  1YDK A;  2WFC A;  2H75 A;  4WBR D;  3CTF A;  4ZIJ A;  4V2N A;  2MBS A;  4DEJ A;  3EMP A;  3MDK A;  1QMV A;  4PNG A;  3TKR A;  3APQ A;  2CA8 A;  2AB6 A;  1U88 A;  4KSO A;  1A0F A;  2FWF A;  4YQV A;  4XS6 A;  2GT6 A;  2GSQ A;  1TK8 B;  1U6T A;  2GTU A;  1O8W A;  4HJM A;  2AYT A;  13GS A;  2JZT A;  2XPE A;  2PER A;  2NPB A;  5IO0 A;  3F3Q A;  1B4Q A;  3UBK A;  1J9B A;  5CP1 A;  2YWO A;  1DE1 A;  1SKR B;  3LGC A;  1F6M C;  4WET A;  4EE0 A;  1M9B A;  3LFL A;  4FIW A;  4WEY A;  1TRS A;  2GST A;  3V1W A;  1AQX A;  3GST A;  3QD9 A;  3E9J B;  2V2G A;  3LEF A;  3M3M A;  6GSX A;  4GQC A;  5DJM A;  3EUR A;  1V58 A;  5IMA A;  3TJK A;  4TXO A;  2YN1 A;  3KTL A;  2WS2 A;  2C0G A;  2AAW A;  4NHZ A;  2WUL A;  4BVY A;  1PKZ A;  2L57 A;  2N5B A;  5G2Z A;  1A0R P;  3IDV A;  3L9V A;  3HZ4 A;  3FZ9 A;  2LV3 A;  2RII A;  3D21 A;  2F8F A;  4AJ6 A;  5DDL A;  1EGO A;  1OVN A;  5D96 A;  2L4C A;  4ZB9 A;  4IP6 A;  4PUA A;  4ZB8 A;  3F0I A;  4POM A;  3ZL5 A;  4HUA A;  4RI7 A;  2JL4 A;  4JBB A;  4ZL9 A;  2H8L A;  2GDR A;  12GS A;  3H93 A;  3GKK A;  3M9K A;  1V2A A;  2C80 A;  3ISO A;  4BL7 A;  2B7J A;  2IMD A;  2YV7 A;  2FNO A;  2ALB A;  1TJD A;  5ECQ B;  2IL3 A;  1A2L A;  5ELA A;  2B6M A;  1Z7P A;  1V57 A;  2OBI A;  4KSM A;  3GKX A;  2KHP A;  4ECC A;  2EIQ A;  3UBL A;  3G7J A;  2C8U A;  1GUL A;  4XRA A;  1DSB A;  1N8J A;  14GS A;  5G31 A;  2D2Z A;  1O85 A;  2VUP A;  2V41 A;  3VK9 A;  1GUM A;  1ON4 A;  2P31 A;  5DCH A;  5IMD A;  4OO4 A;  3TJF A;  3KXO A;  4TVE A;  5B7C A;  5INY A;  1ZCP A;  2H76 A;  4ML1 A;  5IPH A;  3A5W A;  5B8A A;  4H86 A;  2M72 A;  2JZS A;  3KJY A;  4KH7 A;  3D5J A;  3TUE A;  4JZQ A;  2KP1 A;  1THO A;  4GLT A;  3KGK A;  1EZK A;  3GX8 A;  1YZX A;  1N2A A;  1WPI A;  1K3O A;  2LKU A;  3BJ5 A;  1ACV A;  4MP4 A;  1AW9 A;  1O6J A;  2MMA A;  2GS3 A;  3SBC A;  1R5P A;  3UJ1 A;  3IPZ A;  3CSH A;  3TDG A;  3IXR A;  5CRH A;  5E4W A;  3C73 A;  1PL2 A;  4L5L A;  5GAN D;  2L4Q A;  4KW6 A;  2X99 A;  1PKW A;  1MEK A;  3KH9 A;  3EYT A;  5ID2 B;  4K7I A;  5G5F A;  1OYJ A;  2LJA A;  2LRT A;  4K6X A;  4L0W A;  2G0F A;  2XPD A;  3WGX A;  3APO A;  4J57 E;  1B9Y C;  1HNB A;  2GZP A;  3WYW A;  3CRT A;  1M9A A;  4NV2 A;  2J23 A;  1O8X A;  1XVQ A;  1H4O A;  4J2F A;  6GSY A;  1NSW A;  5EL8 A;  3F6D A;  1USB A;  1SKW B;  3J7Y k;  2C0F A;  1T1V A;  4NV5 A;  2C3T A;  1J08 A;  1TI3 A;  2TRC P;  1XPV A;  1B9X C;  4F0C A;  2F9S A;  4MK3 A;  2JU5 A;  5A5K A;  3AY8 A;  4HQS A;  4DVC A;  1PGT A;  1TK5 B;  3HDC A;  3L4N A;  3M0F A;  2B5X A;  1AC1 A;  3G7Y A;  4YH2 A;  2DC5 A;  3KTB A;  3GL3 A;  2OKA A;  4K7N A;  2BMX A;  1XWA A;  2VM2 A;  4BVX A;  4FYC A;  3HJM A;  1Z9H A;  3TRP A;  1B48 A;  1FB0 A;  1GSE A;  2CX4 A;  3FY7 A;  1TKD B;  2YCD A;  3ED3 A;  4IP1 A;  1OAZ A;  1GRX A;  2YJH A;  5CAX A;  1K3Y A;  4GRF A;  1XWB A;  2VO4 A;  1FW1 A;  1WIK A;  4K0G A;  4K1F A;  2IWT A;  4JR6 A;  1GLQ A;  3EVI A;  1ML6 A;  1A8L A;  2H71 A;  2MBT A;  3GH9 A;  3KZQ A;  1T4Y A;  3N5O A;  3J7Y b;  4ECJ A;  3GTU A;  3CSJ A;  2HI7 A;  2HZF A;  2CVK A;  1XOA A;  1UA5 A;  2CAQ A;  4GTU A;  3EE2 A;  3RDW A;  1E2Y A;  5J3R A;  3DKS A;  1GTI A;  3K8N A;  1KNG A;  3ZIV A;  2LJK A;  2H72 A;  5HR1 A;  2XC2 A;  2OE3 A;  1ERU A;  4MLY A;  1PX6 A;  2VD0 A;  5IMV A;  3FR3 A;  1Z6M A;  3UMA A;  2LST A;  4RUV A;  5G1K A;  3TRX A;  1SD9 A;  3BCI A;  2R5G A;  4JU5 A;  1TU8 A;  1THX A;  2H01 A;  1FOV A;  2GGT A;  2CT6 A;  3DYR A;  3F3R A;  5HFG A;  3UAP A;  2VOC A;  3LXT A;  1U87 A;  4ZBA A;  3ZTL A;  1R5A A;  1ZGN A;  2MMZ A;  2FGX A;  1VF4 A;  2H1G A;  4OO5 A;  3E0U A;  5CRD A;  5JWQ B;  5F06 A;  1JZD A;  1FO5 A;  4MJC A;  4TR4 A;  1XZO A;  3H8Q A;  4D73 A;  5H5R A;  3QFB C;  3DGQ A;  1NHY A;  4ZBD A;  5DJL A;  5DCG A;  3UVT A;  1GNE A;  3KM6 A;  2G2Q A;  4KAE A;  1ERV A;  1A2J A;  2LS5 A;  1O7U A;  3LXZ A;  1GUK A;  4OMV A;  5C00 A;  4V1A p;  2F3M A;  4DSR A;  3GV1 A;  4PGT A;  5JWO B;  1F3B A;  2LRN A;  3VWV A;  2VCW A;  3DVX A;  2YWI A;  1VGL A;  4ZL7 A;  4F03 A;  2ZCT A;  2YPM A;  1QFN A;  3EMX A;  4KE3 A;  4I97 A;  5ECN B;  1F9M A;  2VM1 A;  2JSY A;  5D73 A;  1QK8 A;  5CNW A;  2DJ2 A;  11GS A;  4O92 A;  2JAC A;  4MH2 A;  3C7M A;  2V32 A;  2K8S A;  3JCM L;  5B8B A;  4KB3 A;  3IE3 A;  4KX4 A;  4OCF A;  4WR4 A;  4XIH A;  2AV4 A;  1X0R A;  1URM A;  3D22 A;  1VF3 A;  2IMK A;  1HQO A;  2VL9 A;  1M0U A;  3DWV A;  4NPB A;  1RW1 A;  3WT1 A;  4KND A;  3G9B A;  2WZ9 A;  2X8G A;  1U3A A;  2IFQ A;  1OKD A;  1XIY A;  1V40 A;  3HKR A;  4HU9 A;  5CRG A;  1R26 A;  2BTO T;  4O5R A;  1C72 A;  2IN3 A;  3ZZX A;  3O76 A;  1OKT A;  1TDI A;  4WKW A;  4IJ3 A;  1VRS D;  4KDY A;  3DML A;  5FT3 A;  3FZ5 A;  4MJB A;  3P2A A;  3RHB A;  4EC0 A;  1AQW A;  1SYX A;  4O32 A;  4ACS A;  4ECI A;  3KH7 A;  2VCV A;  1MDI A;  1K0O A;  4MH3 A;  4MZC A;  4MZW A;  5EVO A;  1DBY A;  1FB6 A;  2LTK A;  2F51 A;  4QQ7 A;  4NHW A;  3O6T A;  4Q5R A;  5KEJ A;  5ENU A;  1MDK A;  3CMI A;  4OCE A;  3KCM A;  3UOM A;  5ECR B;  2IMF A;  5G5E A;  9GSS A;  1F3A A;  1XW5 A;  5ECO B;  5DAL B;  5G1L A;  3WGD A;  3HD5 A;  2GQM A;  4ZL8 A;  2H73 A;  2PVQ A;  1XOB A;  4AJ8 A;  3IR4 A;  1SJ6 A;  2YWM A;  1LJR A;  4ILF A;  4PQ1 A;  10GS A;  1PL1 A;  1FHE A;  1F37 A;  4HU7 A;  4MMM A;  2X8H A;  3ZVJ A;  3EC3 A;  3FHK A;  1TU7 A;  1YJ6 A;  1JLW A;  3TKS A;  2FA8 A;  3KMO A;  1IYH A;  3I69 A;  1UC7 A;  3S9F A;  5IIZ A;  1HNC A;  1EV4 A;  2QKE A;  3U5R E;  3F6F A;  1W89 A;  2E2M A;  2QC7 A;  4MAB A;  3ZFL A;  2X64 A;  5ECH B;  1Y6E A;  2OAC A;  1IYI A;  5IMZ A;  4TR1 B;  1V9W A;  4EUY A;  2O8V B;  3D4M A;  3UL3 A;  4K0N A;  2FA4 A;  3FR9 A;  3HVS A;  3P8W A;  3VPT A;  3HVV A;  4NWY A;  2YZU A;  4HS1 A;  3L0H A;  3ZFB A;  5ABR A;  1ERT A;  4PQI A;  5EY6 A;  2HNL A;  4YQM A;  1PMT A;  4PX1 A;  4XS4 B;  3Q74 A;  5ECL B;  4K9Z A;  2GZZ A;  3TJB A;  2L6D A;  1X9W B;  5A4W A;  3GMF A;  3MAK A;  6GSV A;  3ZLP A;  2AJQ B;  5JCU A;  1X9M B;  1BJX A;  1RQM A;  1I5G A;  2L5O A;  4V2L A;  4LL4 B;  2HZE B;  2CVB A;  4DSS B;  4TXV A;  1WRY A;  2FWG A;  1SL1 B;  5CRW A;  5C04 A;  2B5E A;  2A2S A;  5AIS A;  3F8U A;  2XBQ A;  3WGE A;  1YKC A;  3LWA A;  2CQ9 A;  5IM9 A;  5HFI A;  5GST A;  4HQZ A;  1YF1 A;  1G6Y A;  4LMW A;  3QAW A;  4Z7X A;  2OE1 A;  1OC3 A;  3DVW A;  1GH2 A;  4CHS A;  4FH8 A;  4FYU A;  3IAS 2;  4MA9 A;  3GSS A;  1PA3 A;  2NVL A;  3GUS A;  3TOT A;  3TRQ A;  2N5F A;  5KN1 A;  5G30 A;  1CQH A;  3FR6 A;  2DBC A;  1XBS A;  3D6I A;  1FG4 A;  1K0A A;  1J0F A;  4I5Q A;  5D9V A;  2EIO A;  1GLP A;  3NIV A;  2YOI A;  4WF4 A;  2H0H A;  5D9X A;  3H1N A;  4L5O A;  2K9F A;  4ID0 A;  1GWC A;  2L5L A;  2B1L A;  3GRX A;  1BED A;  1EEM A;  1MD3 A;  1SL2 B;  1M2A A;  1E6B A;  1Z7R A;  5D93 A;  1T4Z A;  1M99 A;  3UEM A;  5LD0 A;  4IW9 A;  1K0D A;  2L6C A;  3GHA A;  2V1M A;  1GTB A;  2PVO C;  5KN0 A;  5D9W A;  3W8S A;  1BQ7 A;  4CDO A;  2HSY A;  2H6Y A;  3WT2 A;  4PUF C;  4LA1 A;  1HD2 A;  2VL2 A;  1WMJ A;  4OWY A;  2H1A A;  4YAP A;  2K8V A;  4TR3 A;  3RBT A;  4YQU A;  1WWJ A;  3ME7 A;  3LQ7 A;  3BOA A;  1Q4J A;  3DD3 A;  4JRR A;  4ECB A;  2I9H A;  2PN8 A;  4HOJ A;  1T00 A;  2A4V A;  5AIV A;  2H6Z A;  3L78 A;  2H19 A;  1JZR A;  3M9J A;  2K18 A;  1SYR A;  4HJ2 A;  1YEX A;  4LL1 B;  3Q18 A;  4MJE A;  5ID2 A;  2C4J A;  4X43 A;  3GNJ A;  6GSU A;  5COH A;  1A8Y A;  1PX7 A;  2H6X A;  2VCX A;  3KIJ A;  2JAD A;  4XRD A;  5J9B A;  5B6M A;  5L71 A;  2PBJ A;  4Q5F A;  1SK0 A;  4F2I A;  5HR0 A;  3BBY A;  3ZVJ D;  4BA7 A;  1M7T A;  1WOU A;  3N9J A;  2L59 A;  1NHO A;  1TOF A;  1K0N A;  3IA1 A;  4AJ7 A;  5IMC A;  5HR2 A;  3W6G A;  4KA0 A;  3IC4 A;  2DIY A;  5A4U A;  2N5A A;  5CO3 A;  2H1B A;  3F9U A;  4EO3 A;  4MDC A;  3CSI A;  1XW6 A;  5ECM B;  2I4A A;  2VL2 C;  1X5C A;  3HJO A;  1UN2 A;  3M8N A;  3PIN A;  1GNW A;  4E8E A;  3KEB A;  2WJU A;  1SK1 A;  4WXT A;  1T7P B;  2DML A;  4OFM A;  2GZY A;  3GIX A;  1A23 A;  2E7P A;  2X8C A;  3OR5 A;  1OC9 B;  1EEJ A;  1JZO A;  4G10 A;  5LNK e;  2LJR A;  1O81 A;  4PNF A;  1R4W A;  1GTU A;  1SL0 B;  3F4R A;  3EIN A;  5H5Q A;  1JFU A;  1AQV A;  3HZ8 A;  1X9S B;  2VLT A;  2WDU A;  2CZ3 A;  2GQL A;  3NOF A;  4KUN A;  2H30 A;  2ZUP A;  1K3L A;  2OBK A;  5ECS A;  5HR3 A;  1F2E A;  2P0G A;  2VCZ A;  5J5N A;  1GSU A;  2H0G A;  3DEX A;  1SD8 A;  1NM3 A;  5B6N A;  4V1A g;  4GF0 A;  2RLI A;  2B3S A;  4IKH A;  5DAK B;  1U3I A;  1ST9 A;  5CYY A;  5AN1 A;  8GSS A;  4MPG A;  2CZ2 A;  3GL5 A;  2VIM A;  1PRX A;  2XHF A;  2M46 A;  4MJA A;  4EDZ A;  3PGT A;  1TP9 A;  4PUR A;  4BPY A;  2XBI A;  2I81 A;  1EP8 A;  4N30 A;  5DQY A;  3L9S A;  4HI7 A;  4GST A;  4OFN A;  2E2G A;  2R2J A;  2YZH A;  4QL9 A;  3UVH A;  3F63 A;  4GWR A;  5JWR B;  3QPM A;  2PWJ A;  1OE8 A;  4IJI A;  3PH9 A;  3VFI A;  4IN0 A;  4E8H A;  2FHE A;  1MDJ A;  4IBP A;  3Q6O A;  2EIR A;  3P7X A;  1PD2 1;  1V98 A;  2OA7 A;  1HNA A;  3QAG A;  5IPG A;  3NZN A;  3A3T A;  2P5R A;  1JLV A;  4TR0 A;  2FWE A;  2LNT A;  2MZC A;  5IO2 A;  4MF6 A;  3LYP A;  3FZA A;  4OFT A;  4ZIL A;  1AIU A;  2WB9 A;  3GFK A;  1CQG A;  4DSQ A;  1ABA A;  3VWW A;  1TI1 A;  1AAZ A;  4Q5Q A;  1ZYQ B;  2H74 A;  1FAA A;  4POL A;  2C0D A;  3TKQ A;  2NTO A;  1LU4 A;  4N0V A;  3EU4 A;  2DJJ A;  2FD3 A;  1GUH A;  6GSS A;  2C3Q A;  2TIR A;  1PSQ A;  2HRN A;  3FKF A;  2DJ0 A;  1A2M A;  4JED A;  3VI7 A;  3FEU A;  3IHQ A;  4BWQ A;  4ZXG A;  2EC4 A;  2NBS A;  2MMO A;  5CRE A;  1KTE A;  2C0E A;  1QXH A;  3CYN A;  4I2U A;  1S3C A;  2JZR A;  4IEL A;  5GZZ B;  3GYK A;  1AXD A;  4NAX A;  2O87 A;  1OE7 A;  1GP1 A;  2HT9 A;  4IHU A;  2J9H A;  1ZYE A;  3I43 A;  5J41 A;  2GQK A;  1ILO A;  3ZMK A;  1PN9 A;  3CTG A;  5KN3 A;  1O73 A;  3IK9 A;  3HYP A;  4HEA 2;  3ZRD A;  3LOR A;  4TXO B;  3ZIJ A;  2DIZ A;  4O7H A;  3C8E A;  2LQQ A;  5IMF A;  3SWL A;  4RQR A;  3HXS A;  1I9D A;  1S3D A;  3LJR A;  5F05 A;  4F82 A;  2LRC A;  4IVF A;  3A2V A;  3US3 A;  2R4V A; 
#chains in the Genus database with same CATH topology
 5D8I A;  4WBJ A;  7GSS A;  3G7I A;  17GS A;  1EOH A;  4K2D A;  3VWU A;  3HA9 A;  4ZBB A;  1XVW A;  3APS A;  2PUK C;  3RHC A;  4I2T A;  3TGZ A;  2GSR A;  1SEN A;  2HSH A;  3L9U A;  2DJK A;  4F9Z A;  3F4T A;  4GQF A;  2IME A;  2FCH A;  1OC8 A;  2CX3 A;  2R6K A;  1VF2 A;  4BL7 B;  2ON5 A;  3CRU A;  4P3Y B;  1XFL A;  1T3B A;  2VD1 A;  3GUR A;  3UAR A;  4GSS A;  3TKS E;  4YKG A;  4EL1 A;  2HE3 A;  2OJL A;  2HRK A;  1XWG A;  3H79 A;  4NXI A;  4WR5 A;  3MNG A;  3HCZ A;  1W4V A;  2OE0 A;  1S3A A;  2IMI A;  2V6K A;  4POB A;  2GLR A;  2I1U A;  5DQS A;  4TKY A;  2QGV A;  5DAL A;  2IIY A;  4ML6 A;  5BMU A;  5F07 A;  3E3E A;  2HLS A;  4HZ2 A;  4KGI A;  2REM A;  18GS A;  1X5D A;  4ULX A;  3TB2 A;  4IQ1 A;  4K7O A;  4TRX A;  1Y25 A;  1MD4 A;  4IS0 A;  5ECK B;  3QMX A;  3C1S A;  4BWS A;  20GS A;  3QDN A;  4YAV A;  1B8X A;  1EGR A;  1K0B A;  3ZML A;  3IV4 A;  2VCQ A;  3D0Z A;  2O89 A;  1K0C A;  4MF5 A;  5FHI A;  4TR1 A;  3TKS C;  2C1Y A;  1JHB A;  2HRF A;  4OD7 A;  1Z6N A;  1GSQ A;  3U6V A;  5EPF A;  2LQO A;  2A4H A;  3IK7 A;  5IQY A;  3QR6 A;  3FK8 A;  3I6A A;  3KD0 A;  3LYK A;  4MCU A;  3I9V 2;  2I3Y A;  3IOS A;  1BG5 A;  1G0T A;  1QUW A;  2VL3 A;  1PQN A;  1ERW A;  2PMT A;  4K8M A;  1VF1 A;  4XS4 A;  3ERF A;  2FY6 A;  4CY8 A;  2H70 A;  2TRX A;  1ZZY A;  1XCC A;  2ES7 A;  5DBQ A;  4J56 E;  1B4P A;  4KDX A;  4LLR A;  3GH6 A;  3ME8 A;  2FWH A;  4X1U A;  2HZE A;  4DSS A;  1SK2 A;  2MMN A;  3TJG A;  5H5S A;  5DVB A;  2WCI A;  1XXU A;  2VLU A;  2NDO A;  4X4J A;  1SKS B;  4XTS A;  2JSZ A;  3DRN A;  1G6W A;  5HFK A;  5ECI B;  1ZL9 A;  4N10 A;  2LNS A;  3MWH A;  3GKM A;  5IOX A;  2R3X A;  1Z3E A;  3A5I A;  3W8J A;  2H1D A;  1ZOF A;  3FYG A;  1YF0 A;  3QAV A;  1FVK A;  1SJI A;  4EXJ A;  4MZB A;  3TKP A;  4EF0 A;  3A2X A;  3ZIT A;  1ZMA A;  3MSZ A;  4KCA A;  2M80 A;  2YP6 A;  3M1G A;  3BD2 A;  3Q19 A;  1HYU A;  1XWK A;  3QCP A;  1T8E B;  1DE2 A;  1GSF A;  4I6X A;  1GTA A;  2ON7 A;  4Z2U A;  4TN8 A;  1BYE A;  4Q5N A;  1MTC A;  3A2W A;  2LUS A;  3HY2 A;  3D4T A;  1FVJ A;  2AUV A;  3FZ4 A;  1YEP A;  4N11 A;  1EOG A;  1EV9 A;  3C1R A;  4POK A;  4ICY A;  2HSM A;  1R7H A;  4L8E A;  1EP7 A;  3KP8 A;  1EWX A;  3PR8 A;  1KEB A;  3GTU B;  5AGY A;  3HVX A;  4IQA A;  3VWX A;  1GSS A;  2C3N A;  1YKA A;  5E59 A;  4CW9 A;  4GSN A;  4ISD A;  1GL8 A;  1XG8 A;  3HHV A;  2RUF A;  1TK0 B;  4KDU A;  2CVD A;  2H66 A;  2IPA A;  1JZW A;  4XHM A;  2LEG A;  4EKZ A;  5LCZ A;  2O85 A;  4F0B A;  3P90 A;  3VUR A;  4EVM A;  4MF7 A;  3GA4 A;  3C71 A;  1Z5Y E;  3IBH A;  2B7K A;  2DJ3 A;  2DLX A;  1TRW A;  1TRU A;  1NW2 A;  2O7K A;  1YY7 A;  2H0I A;  3VLN A;  6GST A;  5GSS A;  2PPT A;  1K0M A;  1BAY A;  2FLS A;  3ZRE A;  4G19 A;  2GSS A;  2YAN A;  2WRT A;  3EU3 A;  1TXX A;  4EDY A;  2KP2 A;  3VPQ A;  3IAM 2;  1M2D A;  1UVZ A;  3IRA A;  2AHE A;  5F8B A;  5D9T A;  1KBN A;  5HQP A;  4JR4 A;  2Z9S A;  4NMU A;  1YQ1 A;  6GSW A;  3F4S A;  5GAP D;  2OAD A;  4AF2 A;  2IJY A;  5JCW A;  4D73 B;  4FO5 A;  3RAZ A;  3GN3 A;  1H75 A;  3HJP A;  3RPN A;  2B1K A;  2GVP A;  3H4K A;  1XWC A;  2HYX A;  2B5Y A;  4PQH A;  3LG6 A;  2HXK A;  2QSI A;  2VCT A;  3TCO A;  4KCE A;  1X5E A;  2KUC A;  2WGR A;  2RUE A;  1WE0 A;  4G2E A;  5IOW A;  4WF5 A;  1SJZ A;  4RQX A;  4QL7 A;  1GSY A;  4GXZ A;  1GSD A;  1Q98 A;  3FW2 A;  3PPU A;  2DJ1 A;  4G0K A;  5ELG A;  2YV9 A;  3TOU A;  3GKN A;  2R37 A;  3QOU A;  5J4U A;  4XCS A;  1QGV A;  3WD6 A;  19GS A;  4G9H A;  5FWG A;  1A24 A;  3TJJ A;  4IGJ A;  2YNX A;  2YWN A;  1XW9 A;  2R0C A;  1TRV A;  1TW9 A;  2E0Q A;  3KMN A;  2RM5 A;  1OC9 A;  2CAI A;  3CXG A;  2HFD A;  4FYB A;  2A2R A;  4K2X A;  3UIW A;  4GCI A;  5F0G A;  4X0X A;  3RPP A;  2DSA A;  1M2B A;  1BX9 A;  4I8B A;  4ZB6 A;  1WJK A;  3O3T A;  5A4V A;  2CV4 A;  4JE1 A;  22GS A;  2GT5 A;  4HDE A;  3BCK A;  4CY6 A;  3LSZ A;  1G7O A;  2KOK A;  2VAF A;  2ZNM A;  4RI6 A;  1TTZ A;  1G7E A;  3DIE A;  4TOP A;  2K6V A;  4XS1 A;  1DUG A;  5AIX A;  3GX0 A;  3ERW A;  3DXB A;  3KP9 A;  5DAK A;  3EWL A;  2IFQ B;  1WP0 A;  1RK4 A;  2BJX A;  4AGS A;  1SU9 A;  3FRC A;  3ERG A;  3CBU A;  2F8A A;  2KLX A;  1QQ2 A;  4L0U A;  16GS A;  1LBK A;  4TW5 A;  2YJ7 A;  2VLV A;  4MPF A;  2PU9 C;  4LMV A;  2DMM A;  3ZYW A;  2RM6 A;  3VI5 A;  5ECP B;  4PXO A;  5J9C A;  4N0Z A;  5KN2 A;  2P5Q A;  2FUG 2;  2V6O A;  3QFA C;  5JCG A;  4HZ4 A;  4V2M A;  2MYG A;  3R2Q A;  2PGT A;  1AUC A;  1YDK A;  2WFC A;  2H75 A;  4WBR D;  4A5P A;  3CTF A;  4ZIJ A;  4V2N A;  2MBS A;  4DEJ A;  3EMP A;  3MDK A;  1QMV A;  4PNG A;  3TKR A;  3APQ A;  2CA8 A;  2AB6 A;  1U88 A;  4KSO A;  1A0F A;  2FWF A;  4YQV A;  4XS6 A;  2GT6 A;  2GSQ A;  1TK8 B;  1U6T A;  5KOW A;  2GTU A;  1O8W A;  4HJM A;  2AYT A;  13GS A;  2JZT A;  2XPE A;  2PER A;  2NPB A;  5IO0 A;  3F3Q A;  1B4Q A;  3UBK A;  1J9B A;  2UZ8 A;  5CP1 A;  2YWO A;  1DE1 A;  1SKR B;  3LGC A;  1F6M C;  4WET A;  4EE0 A;  1M9B A;  3LFL A;  4FIW A;  4WEY A;  1TRS A;  2GST A;  3V1W A;  1AQX A;  3GST A;  3QD9 A;  3E9J B;  2V2G A;  3LEF A;  3M3M A;  6GSX A;  4GQC A;  5DJM A;  3EUR A;  1V58 A;  5IMA A;  3TJK A;  4TXO A;  2YN1 A;  3KTL A;  2WS2 A;  2C0G A;  2AAW A;  4NHZ A;  2WUL A;  4BVY A;  1PKZ A;  2L57 A;  2N5B A;  5G2Z A;  1A0R P;  3IDV A;  3L9V A;  3HZ4 A;  3FZ9 A;  2LV3 A;  2RII A;  3IHG A;  3D21 A;  2F8F A;  4AJ6 A;  5DDL A;  1EGO A;  1OVN A;  5D96 A;  2L4C A;  4ZB9 A;  1PFO A;  4IP6 A;  4PUA A;  4ZB8 A;  3F0I A;  4POM A;  3ZL5 A;  4HUA A;  4RI7 A;  2JL4 A;  4JBB A;  4ZL9 A;  2H8L A;  2GDR A;  12GS A;  3H93 A;  3GKK A;  3M9K A;  4BIK A;  4KF9 A;  1V2A A;  2C80 A;  3ISO A;  4BL7 A;  2B7J A;  2IMD A;  2YV7 A;  1ZYN A;  2ALB A;  2FNO A;  1TJD A;  5ECQ B;  2IL3 A;  1A2L A;  5ELA A;  2B6M A;  1Z7P A;  1V57 A;  2OBI A;  4KSM A;  2DKH A;  3GKX A;  2KHP A;  4ECC A;  2EIQ A;  3UBL A;  3G7J A;  2C8U A;  1GUL A;  4XRA A;  1DSB A;  1N8J A;  14GS A;  5G31 A;  2D2Z A;  1O85 A;  2VUP A;  2V41 A;  3VK9 A;  1GUM A;  3HVN A;  1ON4 A;  2P31 A;  5DCH A;  5IMD A;  4OO4 A;  3IC8 A;  3TJF A;  3KXO A;  4TVE A;  5B7C A;  5INY A;  1ZCP A;  2H76 A;  4ML1 A;  5IPH A;  3A5W A;  5B8A A;  4H86 A;  2M72 A;  2JZS A;  3KJY A;  4KH7 A;  3D5J A;  3TUE A;  4JZQ A;  2KP1 A;  1THO A;  4GLT A;  3KGK A;  1EZK A;  3GX8 A;  1YZX A;  1N2A A;  1WPI A;  1K3O A;  2LKU A;  3BJ5 A;  1ACV A;  4MP4 A;  1AW9 A;  1O6J A;  2MMA A;  2GS3 A;  3SBC A;  1R5P A;  3UJ1 A;  3IPZ A;  3CSH A;  3TDG A;  3IXR A;  5CRH A;  5E4W A;  3C73 A;  1PL2 A;  4L5L A;  5GAN D;  2L4Q A;  4KW6 A;  2X99 A;  1PKW A;  1MEK A;  3KH9 A;  3EYT A;  5ID2 B;  4K7I A;  5G5F A;  4BVX B;  1OYJ A;  2LJA A;  2LRT A;  4K6X A;  4L0W A;  2G0F A;  2XPD A;  3WGX A;  3APO A;  4J57 E;  1B9Y C;  1HNB A;  2GZP A;  3WYW A;  3CRT A;  1M9A A;  4NV2 A;  2J23 A;  1O8X A;  1XVQ A;  1H4O A;  4J2F A;  6GSY A;  1NSW A;  3F6D A;  1USB A;  5EL8 A;  1SKW B;  3J7Y k;  2C0F A;  1M3I A;  1T1V A;  4NV5 A;  2C3T A;  1J08 A;  1TI3 A;  2TRC P;  1XPV A;  1M3J A;  1B9X C;  4F0C A;  2F9S A;  4MK3 A;  2JU5 A;  5A5K A;  4Z2R A;  3AY8 A;  4HQS A;  4DVC A;  3CQF A;  1PGT A;  1TK5 B;  3HDC A;  3L4N A;  3M0F A;  2B5X A;  1AC1 A;  3G7Y A;  4YH2 A;  2DC5 A;  4K5S A;  3KTB A;  3GL3 A;  2OKA A;  4K7N A;  2BMX A;  1XWA A;  2VM2 A;  4BVX A;  4FYC A;  2DKI A;  3HJM A;  1Z9H A;  3TRP A;  1B48 A;  1FB0 A;  1GSE A;  2CX4 A;  3FY7 A;  1TKD B;  2YCD A;  3ED3 A;  4IP1 A;  1OAZ A;  1GRX A;  2YJH A;  5CAX A;  1K3Y A;  4GRF A;  1XWB A;  2QA2 A;  2VO4 A;  1FW1 A;  1WIK A;  4K0G A;  4K1F A;  2IWT A;  4JR6 A;  1GLQ A;  3EVI A;  1ML6 A;  1A8L A;  4MNN A;  2H71 A;  2MBT A;  3GH9 A;  3KZQ A;  1T4Y A;  3N5O A;  3J7Y b;  4ECJ A;  3GTU A;  3CSJ A;  2HI7 A;  2HZF A;  2CVK A;  1XOA A;  1UA5 A;  2CAQ A;  4GTU A;  3EE2 A;  3RDW A;  1E2Y A;  5J3R A;  3DKS A;  1GTI A;  3K8N A;  1KNG A;  3ZIV A;  2LJK A;  2H72 A;  5HR1 A;  2XC2 A;  2OE3 A;  1ERU A;  4MLY A;  1PX6 A;  2VD0 A;  5IMV A;  3FR3 A;  1Z6M A;  3UMA A;  2LST A;  4RUV A;  5G1K A;  3TRX A;  1SD9 A;  3BCI A;  2R5G A;  4JU5 A;  1TU8 A;  1THX A;  2H01 A;  1FOV A;  2GGT A;  2CT6 A;  3DYR A;  3F3R A;  5HFG A;  3UAP A;  2VOC A;  3LXT A;  1U87 A;  4ZBA A;  3ZTL A;  1R5A A;  1ZGN A;  2MMZ A;  2FGX A;  1VF4 A;  2H1G A;  4OO5 A;  3E0U A;  5CRD A;  2HRA A;  5JWQ B;  5F06 A;  1JZD A;  1FO5 A;  4MJC A;  4TR4 A;  1XZO A;  3H8Q A;  4D73 A;  5H5R A;  3QFB C;  3DGQ A;  1NHY A;  4ZBD A;  5DJL A;  5DCG A;  3UVT A;  1GNE A;  3KM6 A;  2G2Q A;  4KAE A;  1ERV A;  1A2J A;  2LS5 A;  1O7U A;  3LXZ A;  1GUK A;  4OMV A;  5C00 A;  4V1A p;  2F3M A;  4DSR A;  3GV1 A;  4PGT A;  5JWO B;  1F3B A;  2LRN A;  3VWV A;  2VCW A;  3DVX A;  2YWI A;  1VGL A;  4ZL7 A;  4F03 A;  4K5R A;  3LW9 A;  2ZCT A;  2YPM A;  1QFN A;  3EMX A;  4KE3 A;  4I97 A;  5ECN B;  1F9M A;  2VM1 A;  2JSY A;  5D73 A;  1QK8 A;  5CNW A;  2DJ2 A;  11GS A;  4O92 A;  2JAC A;  4MH2 A;  3C7M A;  1FOH A;  2V32 A;  2K8S A;  3JCM L;  5B8B A;  4KB3 A;  3IE3 A;  4KX4 A;  4OCF A;  4WR4 A;  4XIH A;  2AV4 A;  1X0R A;  1URM A;  3D22 A;  1VF3 A;  2IMK A;  1HQO A;  2VL9 A;  1M0U A;  3DWV A;  4NPB A;  1RW1 A;  3WT1 A;  4KND A;  3G9B A;  2WZ9 A;  2X8G A;  1U3A A;  2IFQ A;  1OKD A;  1XIY A;  1V40 A;  3HKR A;  4HU9 A;  5CRG A;  2R0G A;  1R26 A;  2BTO T;  4O5R A;  1C72 A;  2IN3 A;  3ZZX A;  3O76 A;  1OKT A;  1TDI A;  4WKW A;  4IJ3 A;  1VRS D;  4KDY A;  3DML A;  5FT3 A;  3FZ5 A;  4MJB A;  3P2A A;  3RHB A;  4EC0 A;  1AQW A;  1SYX A;  4O32 A;  4ACS A;  4ECI A;  2X4A A;  4PTS A;  3KH7 A;  2VCV A;  1MDI A;  1K0O A;  4MH3 A;  4MZC A;  4MZW A;  5EVO A;  1DBY A;  1FB6 A;  2LTK A;  2F51 A;  3MYD A;  4QQ7 A;  4NHW A;  3O6T A;  4Q5R A;  5KEJ A;  5ENU A;  4YKF A;  1MDK A;  3CMI A;  4OCE A;  3KCM A;  3UOM A;  5ECR B;  2IMF A;  5G5E A;  9GSS A;  1F3A A;  1XW5 A;  5ECO B;  5DAL B;  5G1L A;  3WGD A;  3HD5 A;  2GQM A;  4ZL8 A;  2H73 A;  2PVQ A;  1XOB A;  4AJ8 A;  3IR4 A;  1SJ6 A;  2YWM A;  1LJR A;  4ILF A;  4PQ1 A;  4FQU A;  10GS A;  1PL1 A;  1FHE A;  1F37 A;  4HU7 A;  4MMM A;  2X8H A;  3ZVJ A;  3EC3 A;  3FHK A;  1TU7 A;  1YJ6 A;  1JLW A;  3TKS A;  2FA8 A;  3KMO A;  1IYH A;  3I69 A;  1UC7 A;  4O5U A;  3S9F A;  5IIZ A;  1HNC A;  1EV4 A;  2QKE A;  3U5R E;  3F6F A;  1W89 A;  2E2M A;  2QC7 A;  4MAB A;  3ZFL A;  2X64 A;  5ECH B;  1Y6E A;  2OAC A;  1IYI A;  5IMZ A;  4TR1 B;  1V9W A;  4EUY A;  2O8V B;  3D4M A;  3UL3 A;  4K0N A;  2FA4 A;  3FR9 A;  3HVS A;  3P8W A;  3VPT A;  3HVV A;  4O5Q A;  4NWY A;  2YZU A;  4HS1 A;  3L0H A;  1S3R A;  3ZFB A;  5ABR A;  1ERT A;  4PQI A;  2A2P A;  5EY6 A;  1ZYP A;  2HNL A;  4YQM A;  1PMT A;  4PX1 A;  4XS4 B;  3Q74 A;  5ECL B;  4K9Z A;  2GZZ A;  3TJB A;  5BRT A;  2L6D A;  1X9W B;  5A4W A;  3GMF A;  3MAK A;  6GSV A;  3ZLP A;  2AJQ B;  5JCU A;  1X9M B;  1BJX A;  1RQM A;  1I5G A;  2L5O A;  4V2L A;  4LL4 B;  2HZE B;  2X49 A;  2CVB A;  4DSS B;  4TXV A;  1WRY A;  2FWG A;  1SL1 B;  5CRW A;  4USS A;  5C04 A;  2B5E A;  4Z2T A;  2A2S A;  5AIS A;  3F8U A;  2XBQ A;  3WGE A;  1YKC A;  3LWA A;  2CQ9 A;  5IM9 A;  5HFI A;  5GST A;  4HQZ A;  1YF1 A;  1G6Y A;  4LMW A;  3QAW A;  4Z7X A;  2OE1 A;  1OC3 A;  3DVW A;  1GH2 A;  4CHS A;  4FH8 A;  4FYU A;  3IAS 2;  4MA9 A;  3GSS A;  1PA3 A;  2NVL A;  3GUS A;  3TOT A;  3TRQ A;  2N5F A;  5KN1 A;  5G30 A;  1CQH A;  3FR6 A;  2DBC A;  1XBS A;  3D6I A;  1FG4 A;  1K0A A;  1J0F A;  4I5Q A;  5D9V A;  2EIO A;  1GLP A;  3NIV A;  2YOI A;  4WF4 A;  2H0H A;  5D9X A;  3H1N A;  4L5O A;  2K9F A;  4ID0 A;  1GWC A;  2L5L A;  2B1L A;  3GRX A;  1BED A;  1EEM A;  1MD3 A;  1SL2 B;  1M2A A;  1E6B A;  1Z7R A;  5D93 A;  1T4Z A;  1M99 A;  3UEM A;  5LD0 A;  4IW9 A;  1K0D A;  2L6C A;  3GHA A;  2V1M A;  1GTB A;  2PVO C;  5KN0 A;  5D9W A;  3W8S A;  1BQ7 A;  4CDO A;  2HSY A;  2H6Y A;  3WT2 A;  4PUF C;  3R3E A;  4LA1 A;  1HD2 A;  2VL2 A;  1WMJ A;  4OWY A;  2H1A A;  4YAP A;  2K8V A;  4TR3 A;  3RBT A;  4YQU A;  1WWJ A;  3ME7 A;  3LQ7 A;  3BOA A;  1Q4J A;  3DD3 A;  4JRR A;  4ECB A;  2I9H A;  2PN8 A;  4HOJ A;  1T00 A;  2A4V A;  5AIV A;  2H6Z A;  3L78 A;  2H19 A;  1JZR A;  3M9J A;  2K18 A;  3EPT A;  1SYR A;  4HJ2 A;  1YEX A;  4LL1 B;  3Q18 A;  4MJE A;  5ID2 A;  2C4J A;  4X43 A;  3GNJ A;  4EIP A;  6GSU A;  5COH A;  1A8Y A;  1PX7 A;  2H6X A;  2VCX A;  3KIJ A;  2JAD A;  4XRD A;  5J9B A;  5B6M A;  1PN0 A;  5L71 A;  2PBJ A;  4Q5F A;  1SK0 A;  4F2I A;  5HR0 A;  3BBY A;  3ZVJ D;  4BA7 A;  1M7T A;  1WOU A;  3N9J A;  2L59 A;  1NHO A;  1TOF A;  1K0N A;  3IA1 A;  4AJ7 A;  5IMC A;  5HR2 A;  3W6G A;  4KA0 A;  3IC4 A;  2DIY A;  5A4U A;  2N5A A;  5CO3 A;  2H1B A;  3F9U A;  5KOX A;  4EO3 A;  4MDC A;  3CSI A;  1XW6 A;  5ECM B;  2I4A A;  2VL2 C;  1X5C A;  3HJO A;  1UN2 A;  3M8N A;  3PIN A;  1GNW A;  4E8E A;  3KEB A;  2WJU A;  1SK1 A;  4WXT A;  1T7P B;  2DML A;  4OFM A;  2GZY A;  3GIX A;  1A23 A;  2E7P A;  2X8C A;  3OR5 A;  1OC9 B;  1EEJ A;  1JZO A;  4G10 A;  5LNK e;  2LJR A;  1O81 A;  4PNF A;  1R4W A;  1GTU A;  1SL0 B;  3F4R A;  3EIN A;  5H5Q A;  1JFU A;  1AQV A;  3HZ8 A;  1X9S B;  2VLT A;  2WDU A;  2CZ3 A;  2GQL A;  3NOF A;  4KUN A;  2H30 A;  2ZUP A;  1K3L A;  2OBK A;  5ECS A;  5HR3 A;  1F2E A;  2P0G A;  2QA1 A;  2VCZ A;  5J5N A;  1GSU A;  2H0G A;  3DEX A;  1SD8 A;  1NM3 A;  5B6N A;  4V1A g;  4EIQ A;  4GF0 A;  3MIX A;  2RLI A;  2B3S A;  4IKH A;  5DAK B;  1U3I A;  1ST9 A;  5CYY A;  5AN1 A;  8GSS A;  4G0L A;  4MPG A;  2CZ2 A;  3GL5 A;  2VIM A;  1PRX A;  2XHF A;  2M46 A;  4MJA A;  4EDZ A;  3PGT A;  1TP9 A;  4PUR A;  4BPY A;  2XBI A;  2I81 A;  1EP8 A;  4N30 A;  5DQY A;  3L9S A;  4HI7 A;  4GST A;  4OFN A;  2E2G A;  2R2J A;  2YZH A;  4QL9 A;  3UVH A;  3F63 A;  4GWR A;  5JWR B;  3QPM A;  2PWJ A;  1OE8 A;  3FMW A;  4IJI A;  3PH9 A;  3VFI A;  4IN0 A;  4E8H A;  2FHE A;  1MDJ A;  4IBP A;  3Q6O A;  2EIR A;  3P7X A;  1PD2 1;  1V98 A;  2OA7 A;  1HNA A;  3QAG A;  5IPG A;  3NZN A;  3A3T A;  2P5R A;  1JLV A;  4TR0 A;  2FWE A;  2LNT A;  2MZC A;  5IO2 A;  4MF6 A;  3LYP A;  3FZA A;  4OFT A;  4ZIL A;  1AIU A;  2WB9 A;  3GFK A;  1CQG A;  4DSQ A;  1ABA A;  3VWW A;  1TI1 A;  1AAZ A;  4Q5Q A;  1ZYQ B;  2H74 A;  1FAA A;  4POL A;  2C0D A;  3TKQ A;  2NTO A;  1LU4 A;  4N0V A;  3EU4 A;  2DJJ A;  2FD3 A;  1GUH A;  6GSS A;  2C3Q A;  2TIR A;  1PSQ A;  2HRN A;  3FKF A;  2DJ0 A;  1A2M A;  4JED A;  3VI7 A;  3FEU A;  3IHQ A;  4BWQ A;  4HSC X;  4ZXG A;  2EC4 A;  2NBS A;  2MMO A;  5CRE A;  1KTE A;  2C0E A;  1QXH A;  4G0I A;  3CYN A;  4I2U A;  1S3C A;  2JZR A;  4IEL A;  5GZZ B;  3GYK A;  1AXD A;  4NAX A;  2O87 A;  1OE7 A;  1GP1 A;  2HT9 A;  4IHU A;  2J9H A;  1ZYE A;  3I43 A;  5J41 A;  2GQK A;  1ILO A;  3ZMK A;  1PN9 A;  3CTG A;  5KN3 A;  1O73 A;  3IK9 A;  3HYP A;  4HEA 2;  3ZRD A;  3LOR A;  4TXO B;  3ZIJ A;  2DIZ A;  4O7H A;  2R0P A;  3C8E A;  2LQQ A;  4BVY B;  5IMF A;  3SWL A;  4RQR A;  3HXS A;  1I9D A;  1S3D A;  3LJR A;  5F05 A;  4F82 A;  2LRC A;  4IVF A;  3A2V A;  3US3 A;  2R4V A; 
#chains in the Genus database with same CATH homology
 5D8I A;  4WBJ A;  7GSS A;  3G7I A;  17GS A;  1EOH A;  4K2D A;  3VWU A;  3HA9 A;  4ZBB A;  1XVW A;  3APS A;  2PUK C;  3RHC A;  4I2T A;  3TGZ A;  2GSR A;  1SEN A;  2HSH A;  3L9U A;  2DJK A;  4F9Z A;  3F4T A;  4GQF A;  2IME A;  2FCH A;  1OC8 A;  2CX3 A;  2R6K A;  1VF2 A;  4BL7 B;  2ON5 A;  3CRU A;  4P3Y B;  1XFL A;  1T3B A;  2VD1 A;  3GUR A;  3UAR A;  4GSS A;  3TKS E;  4YKG A;  4EL1 A;  2HE3 A;  2OJL A;  2HRK A;  1XWG A;  3H79 A;  4NXI A;  4WR5 A;  3MNG A;  3HCZ A;  1W4V A;  2OE0 A;  1S3A A;  2IMI A;  2V6K A;  4POB A;  2GLR A;  2I1U A;  5DQS A;  4TKY A;  2QGV A;  5DAL A;  2IIY A;  4ML6 A;  5BMU A;  5F07 A;  3E3E A;  2HLS A;  4HZ2 A;  4KGI A;  2REM A;  18GS A;  1X5D A;  4ULX A;  3TB2 A;  4IQ1 A;  4K7O A;  4TRX A;  1Y25 A;  1MD4 A;  4IS0 A;  5ECK B;  3QMX A;  3C1S A;  4BWS A;  20GS A;  3QDN A;  4YAV A;  1B8X A;  1EGR A;  1K0B A;  3ZML A;  3IV4 A;  2VCQ A;  3D0Z A;  2O89 A;  1K0C A;  4MF5 A;  5FHI A;  4TR1 A;  3TKS C;  2C1Y A;  1JHB A;  2HRF A;  4OD7 A;  1Z6N A;  1GSQ A;  3U6V A;  5EPF A;  2LQO A;  2A4H A;  3IK7 A;  5IQY A;  3QR6 A;  3FK8 A;  3I6A A;  3KD0 A;  3LYK A;  4MCU A;  3I9V 2;  2I3Y A;  3IOS A;  1BG5 A;  1G0T A;  1QUW A;  2VL3 A;  1PQN A;  1ERW A;  2PMT A;  4K8M A;  1VF1 A;  4XS4 A;  3ERF A;  2FY6 A;  4CY8 A;  2H70 A;  2TRX A;  1ZZY A;  1XCC A;  2ES7 A;  5DBQ A;  4J56 E;  1B4P A;  4KDX A;  4LLR A;  3GH6 A;  3ME8 A;  2FWH A;  4X1U A;  2HZE A;  4DSS A;  1SK2 A;  2MMN A;  3TJG A;  5H5S A;  5DVB A;  2WCI A;  1XXU A;  2VLU A;  2NDO A;  4X4J A;  1SKS B;  4XTS A;  2JSZ A;  3DRN A;  1G6W A;  5HFK A;  5ECI B;  1ZL9 A;  4N10 A;  2LNS A;  3MWH A;  3GKM A;  5IOX A;  2R3X A;  1Z3E A;  3A5I A;  3W8J A;  2H1D A;  1ZOF A;  3FYG A;  1YF0 A;  3QAV A;  1FVK A;  1SJI A;  4EXJ A;  4MZB A;  3TKP A;  4EF0 A;  3A2X A;  3ZIT A;  1ZMA A;  3MSZ A;  4KCA A;  2M80 A;  2YP6 A;  3M1G A;  3BD2 A;  3Q19 A;  1HYU A;  1XWK A;  3QCP A;  1T8E B;  1DE2 A;  1GSF A;  4I6X A;  1GTA A;  2ON7 A;  4Z2U A;  4TN8 A;  1BYE A;  4Q5N A;  1MTC A;  3A2W A;  2LUS A;  3HY2 A;  3D4T A;  1FVJ A;  2AUV A;  3FZ4 A;  1YEP A;  4N11 A;  1EOG A;  1EV9 A;  3C1R A;  4POK A;  4ICY A;  2HSM A;  1R7H A;  4L8E A;  1EP7 A;  3KP8 A;  1EWX A;  3PR8 A;  1KEB A;  3GTU B;  5AGY A;  3HVX A;  4IQA A;  3VWX A;  1GSS A;  2C3N A;  1YKA A;  5E59 A;  4CW9 A;  4GSN A;  4ISD A;  1GL8 A;  3HHV A;  2RUF A;  1TK0 B;  4KDU A;  2CVD A;  2H66 A;  2IPA A;  1JZW A;  4XHM A;  2LEG A;  4EKZ A;  5LCZ A;  2O85 A;  4F0B A;  3P90 A;  3VUR A;  4EVM A;  4MF7 A;  3GA4 A;  3C71 A;  1Z5Y E;  3IBH A;  2B7K A;  2DJ3 A;  2DLX A;  1TRW A;  1TRU A;  1NW2 A;  2O7K A;  1YY7 A;  2H0I A;  3VLN A;  6GST A;  5GSS A;  2PPT A;  1K0M A;  1BAY A;  2FLS A;  3ZRE A;  4G19 A;  2GSS A;  2YAN A;  2WRT A;  3EU3 A;  1TXX A;  4EDY A;  2KP2 A;  3VPQ A;  3IAM 2;  1M2D A;  1UVZ A;  3IRA A;  2AHE A;  5F8B A;  5D9T A;  1KBN A;  5HQP A;  4JR4 A;  2Z9S A;  4NMU A;  1YQ1 A;  6GSW A;  3F4S A;  5GAP D;  2OAD A;  4AF2 A;  2IJY A;  5JCW A;  4D73 B;  4FO5 A;  3RAZ A;  3GN3 A;  1H75 A;  3HJP A;  3RPN A;  2B1K A;  2GVP A;  3H4K A;  1XWC A;  2HYX A;  2B5Y A;  4PQH A;  3LG6 A;  2HXK A;  2QSI A;  2VCT A;  3TCO A;  4KCE A;  1X5E A;  2KUC A;  2WGR A;  2RUE A;  1WE0 A;  4G2E A;  5IOW A;  4WF5 A;  1SJZ A;  4RQX A;  4QL7 A;  1GSY A;  4GXZ A;  1GSD A;  1Q98 A;  3FW2 A;  3PPU A;  2DJ1 A;  4G0K A;  5ELG A;  2YV9 A;  3TOU A;  3GKN A;  2R37 A;  3QOU A;  5J4U A;  4XCS A;  1QGV A;  3WD6 A;  19GS A;  4G9H A;  5FWG A;  1A24 A;  3TJJ A;  4IGJ A;  2YNX A;  2YWN A;  1XW9 A;  2R0C A;  1TRV A;  1TW9 A;  2E0Q A;  3KMN A;  2RM5 A;  1OC9 A;  2CAI A;  3CXG A;  2HFD A;  4FYB A;  2A2R A;  4K2X A;  3UIW A;  4GCI A;  5F0G A;  4X0X A;  3RPP A;  2DSA A;  1M2B A;  1BX9 A;  4I8B A;  4ZB6 A;  1WJK A;  3O3T A;  5A4V A;  2CV4 A;  4JE1 A;  22GS A;  2GT5 A;  4HDE A;  3BCK A;  4CY6 A;  3LSZ A;  1G7O A;  2KOK A;  2VAF A;  2ZNM A;  4RI6 A;  1TTZ A;  1G7E A;  3DIE A;  4TOP A;  2K6V A;  4XS1 A;  1DUG A;  5AIX A;  3GX0 A;  3ERW A;  3DXB A;  3KP9 A;  5DAK A;  3EWL A;  2IFQ B;  1WP0 A;  1RK4 A;  2BJX A;  4AGS A;  1SU9 A;  3FRC A;  3ERG A;  3CBU A;  2F8A A;  2KLX A;  1QQ2 A;  4L0U A;  16GS A;  1LBK A;  4TW5 A;  2YJ7 A;  2VLV A;  4MPF A;  2PU9 C;  4LMV A;  2DMM A;  3ZYW A;  2RM6 A;  3VI5 A;  5ECP B;  4PXO A;  5J9C A;  4N0Z A;  5KN2 A;  2P5Q A;  2FUG 2;  2V6O A;  3QFA C;  5JCG A;  4HZ4 A;  4V2M A;  2MYG A;  3R2Q A;  2PGT A;  1AUC A;  1YDK A;  2WFC A;  2H75 A;  4WBR D;  4A5P A;  3CTF A;  4ZIJ A;  4V2N A;  2MBS A;  4DEJ A;  3EMP A;  3MDK A;  1QMV A;  4PNG A;  3TKR A;  3APQ A;  2CA8 A;  2AB6 A;  1U88 A;  4KSO A;  1A0F A;  2FWF A;  4YQV A;  4XS6 A;  2GT6 A;  2GSQ A;  1TK8 B;  1U6T A;  5KOW A;  2GTU A;  1O8W A;  4HJM A;  2AYT A;  13GS A;  2JZT A;  2XPE A;  2PER A;  2NPB A;  5IO0 A;  3F3Q A;  1B4Q A;  3UBK A;  1J9B A;  2UZ8 A;  5CP1 A;  2YWO A;  1DE1 A;  1SKR B;  3LGC A;  1F6M C;  4WET A;  4EE0 A;  1M9B A;  3LFL A;  4FIW A;  4WEY A;  1TRS A;  2GST A;  3V1W A;  1AQX A;  3GST A;  3QD9 A;  3E9J B;  2V2G A;  3LEF A;  3M3M A;  6GSX A;  4GQC A;  5DJM A;  3EUR A;  1V58 A;  5IMA A;  3TJK A;  4TXO A;  2YN1 A;  3KTL A;  2WS2 A;  2C0G A;  2AAW A;  4NHZ A;  2WUL A;  4BVY A;  1PKZ A;  2L57 A;  2N5B A;  5G2Z A;  1A0R P;  3IDV A;  3L9V A;  3HZ4 A;  3FZ9 A;  2LV3 A;  2RII A;  3IHG A;  3D21 A;  2F8F A;  4AJ6 A;  5DDL A;  1EGO A;  1OVN A;  5D96 A;  2L4C A;  4ZB9 A;  4IP6 A;  4PUA A;  4ZB8 A;  3F0I A;  4POM A;  3ZL5 A;  4HUA A;  4RI7 A;  2JL4 A;  4JBB A;  4ZL9 A;  2H8L A;  2GDR A;  12GS A;  3H93 A;  3GKK A;  3M9K A;  4KF9 A;  1V2A A;  2C80 A;  3ISO A;  4BL7 A;  2B7J A;  2IMD A;  2YV7 A;  1ZYN A;  2ALB A;  2FNO A;  1TJD A;  5ECQ B;  2IL3 A;  1A2L A;  5ELA A;  2B6M A;  1Z7P A;  1V57 A;  2OBI A;  4KSM A;  2DKH A;  3GKX A;  2KHP A;  4ECC A;  2EIQ A;  3UBL A;  3G7J A;  2C8U A;  1GUL A;  4XRA A;  1DSB A;  1N8J A;  14GS A;  5G31 A;  2D2Z A;  1O85 A;  2VUP A;  2V41 A;  3VK9 A;  1GUM A;  1ON4 A;  2P31 A;  5DCH A;  5IMD A;  4OO4 A;  3IC8 A;  3TJF A;  3KXO A;  4TVE A;  5B7C A;  5INY A;  1ZCP A;  2H76 A;  4ML1 A;  5IPH A;  3A5W A;  5B8A A;  4H86 A;  2M72 A;  2JZS A;  3KJY A;  4KH7 A;  3D5J A;  3TUE A;  4JZQ A;  2KP1 A;  1THO A;  4GLT A;  3KGK A;  1EZK A;  3GX8 A;  1YZX A;  1N2A A;  1WPI A;  1K3O A;  2LKU A;  3BJ5 A;  1ACV A;  4MP4 A;  1AW9 A;  1O6J A;  2MMA A;  2GS3 A;  3SBC A;  1R5P A;  3UJ1 A;  3IPZ A;  3CSH A;  3TDG A;  3IXR A;  5CRH A;  5E4W A;  3C73 A;  1PL2 A;  4L5L A;  5GAN D;  2L4Q A;  4KW6 A;  2X99 A;  1PKW A;  1MEK A;  3KH9 A;  3EYT A;  5ID2 B;  4K7I A;  5G5F A;  4BVX B;  1OYJ A;  2LJA A;  2LRT A;  4K6X A;  4L0W A;  2G0F A;  2XPD A;  3WGX A;  3APO A;  4J57 E;  1B9Y C;  1HNB A;  2GZP A;  3WYW A;  3CRT A;  1M9A A;  4NV2 A;  2J23 A;  1O8X A;  1XVQ A;  1H4O A;  4J2F A;  6GSY A;  1NSW A;  3F6D A;  1USB A;  5EL8 A;  1SKW B;  3J7Y k;  2C0F A;  1T1V A;  4NV5 A;  2C3T A;  1J08 A;  1TI3 A;  2TRC P;  1XPV A;  1B9X C;  4F0C A;  2F9S A;  4MK3 A;  2JU5 A;  5A5K A;  4Z2R A;  3AY8 A;  4HQS A;  4DVC A;  1PGT A;  1TK5 B;  3HDC A;  3L4N A;  3M0F A;  2B5X A;  1AC1 A;  3G7Y A;  4YH2 A;  2DC5 A;  4K5S A;  3KTB A;  3GL3 A;  2OKA A;  4K7N A;  2BMX A;  1XWA A;  2VM2 A;  4BVX A;  4FYC A;  2DKI A;  3HJM A;  1Z9H A;  3TRP A;  1B48 A;  1FB0 A;  1GSE A;  2CX4 A;  3FY7 A;  1TKD B;  2YCD A;  3ED3 A;  4IP1 A;  1OAZ A;  1GRX A;  2YJH A;  5CAX A;  1K3Y A;  4GRF A;  1XWB A;  2QA2 A;  2VO4 A;  1FW1 A;  1WIK A;  4K0G A;  4K1F A;  2IWT A;  4JR6 A;  1GLQ A;  3EVI A;  1ML6 A;  1A8L A;  4MNN A;  2H71 A;  2MBT A;  3GH9 A;  3KZQ A;  1T4Y A;  3N5O A;  3J7Y b;  4ECJ A;  3GTU A;  3CSJ A;  2HI7 A;  2HZF A;  2CVK A;  1XOA A;  1UA5 A;  2CAQ A;  4GTU A;  3EE2 A;  3RDW A;  1E2Y A;  5J3R A;  3DKS A;  1GTI A;  3K8N A;  1KNG A;  3ZIV A;  2LJK A;  2H72 A;  5HR1 A;  2XC2 A;  2OE3 A;  1ERU A;  4MLY A;  1PX6 A;  2VD0 A;  5IMV A;  3FR3 A;  1Z6M A;  3UMA A;  2LST A;  4RUV A;  5G1K A;  3TRX A;  1SD9 A;  3BCI A;  2R5G A;  4JU5 A;  1TU8 A;  1THX A;  2H01 A;  1FOV A;  2GGT A;  2CT6 A;  3DYR A;  3F3R A;  5HFG A;  3UAP A;  2VOC A;  3LXT A;  1U87 A;  4ZBA A;  3ZTL A;  1R5A A;  1ZGN A;  2MMZ A;  2FGX A;  1VF4 A;  2H1G A;  4OO5 A;  3E0U A;  5CRD A;  2HRA A;  5JWQ B;  5F06 A;  1JZD A;  1FO5 A;  4MJC A;  4TR4 A;  1XZO A;  3H8Q A;  4D73 A;  5H5R A;  3QFB C;  3DGQ A;  1NHY A;  4ZBD A;  5DJL A;  5DCG A;  3UVT A;  1GNE A;  3KM6 A;  2G2Q A;  4KAE A;  1ERV A;  1A2J A;  2LS5 A;  1O7U A;  3LXZ A;  1GUK A;  4OMV A;  5C00 A;  4V1A p;  2F3M A;  4DSR A;  3GV1 A;  4PGT A;  5JWO B;  1F3B A;  2LRN A;  3VWV A;  2VCW A;  3DVX A;  2YWI A;  1VGL A;  4ZL7 A;  4F03 A;  4K5R A;  3LW9 A;  2ZCT A;  2YPM A;  1QFN A;  3EMX A;  4KE3 A;  4I97 A;  5ECN B;  1F9M A;  2VM1 A;  2JSY A;  5D73 A;  1QK8 A;  5CNW A;  2DJ2 A;  11GS A;  4O92 A;  2JAC A;  4MH2 A;  3C7M A;  1FOH A;  2V32 A;  2K8S A;  3JCM L;  5B8B A;  4KB3 A;  3IE3 A;  4KX4 A;  4OCF A;  4WR4 A;  4XIH A;  2AV4 A;  1X0R A;  1URM A;  3D22 A;  1VF3 A;  2IMK A;  1HQO A;  2VL9 A;  1M0U A;  3DWV A;  4NPB A;  1RW1 A;  3WT1 A;  4KND A;  3G9B A;  2WZ9 A;  2X8G A;  1U3A A;  2IFQ A;  1OKD A;  1XIY A;  1V40 A;  3HKR A;  4HU9 A;  5CRG A;  2R0G A;  1R26 A;  2BTO T;  4O5R A;  1C72 A;  2IN3 A;  3ZZX A;  3O76 A;  1OKT A;  1TDI A;  4WKW A;  4IJ3 A;  1VRS D;  4KDY A;  3DML A;  5FT3 A;  3FZ5 A;  4MJB A;  3P2A A;  3RHB A;  4EC0 A;  1AQW A;  1SYX A;  4O32 A;  4ACS A;  4ECI A;  2X4A A;  4PTS A;  3KH7 A;  2VCV A;  1MDI A;  1K0O A;  4MH3 A;  4MZC A;  4MZW A;  5EVO A;  1DBY A;  1FB6 A;  2LTK A;  2F51 A;  3MYD A;  4QQ7 A;  4NHW A;  3O6T A;  4Q5R A;  5KEJ A;  5ENU A;  4YKF A;  1MDK A;  3CMI A;  4OCE A;  3KCM A;  3UOM A;  5ECR B;  2IMF A;  5G5E A;  9GSS A;  1F3A A;  1XW5 A;  5ECO B;  5DAL B;  5G1L A;  3WGD A;  3HD5 A;  2GQM A;  4ZL8 A;  2H73 A;  2PVQ A;  1XOB A;  4AJ8 A;  3IR4 A;  1SJ6 A;  2YWM A;  1LJR A;  4ILF A;  4PQ1 A;  4FQU A;  10GS A;  1PL1 A;  1FHE A;  1F37 A;  4HU7 A;  4MMM A;  2X8H A;  3ZVJ A;  3EC3 A;  3FHK A;  1TU7 A;  1YJ6 A;  1JLW A;  3TKS A;  2FA8 A;  3KMO A;  1IYH A;  3I69 A;  1UC7 A;  4O5U A;  3S9F A;  5IIZ A;  1HNC A;  1EV4 A;  2QKE A;  3U5R E;  3F6F A;  1W89 A;  2E2M A;  2QC7 A;  4MAB A;  3ZFL A;  2X64 A;  5ECH B;  1Y6E A;  2OAC A;  1IYI A;  5IMZ A;  4TR1 B;  1V9W A;  4EUY A;  2O8V B;  3D4M A;  3UL3 A;  4K0N A;  2FA4 A;  3FR9 A;  3HVS A;  3P8W A;  3VPT A;  3HVV A;  4O5Q A;  4NWY A;  2YZU A;  4HS1 A;  3L0H A;  3ZFB A;  5ABR A;  1ERT A;  4PQI A;  2A2P A;  5EY6 A;  1ZYP A;  2HNL A;  4YQM A;  1PMT A;  4PX1 A;  4XS4 B;  3Q74 A;  5ECL B;  4K9Z A;  2GZZ A;  3TJB A;  5BRT A;  2L6D A;  1X9W B;  5A4W A;  3GMF A;  3MAK A;  6GSV A;  3ZLP A;  2AJQ B;  5JCU A;  1X9M B;  1BJX A;  1RQM A;  1I5G A;  2L5O A;  4V2L A;  4LL4 B;  2HZE B;  2X49 A;  2CVB A;  4DSS B;  4TXV A;  1WRY A;  2FWG A;  1SL1 B;  5CRW A;  4USS A;  5C04 A;  2B5E A;  4Z2T A;  2A2S A;  5AIS A;  3F8U A;  2XBQ A;  3WGE A;  1YKC A;  3LWA A;  2CQ9 A;  5IM9 A;  5HFI A;  5GST A;  4HQZ A;  1YF1 A;  1G6Y A;  4LMW A;  3QAW A;  4Z7X A;  2OE1 A;  1OC3 A;  3DVW A;  1GH2 A;  4CHS A;  4FH8 A;  4FYU A;  3IAS 2;  4MA9 A;  3GSS A;  1PA3 A;  2NVL A;  3GUS A;  3TOT A;  3TRQ A;  2N5F A;  5KN1 A;  5G30 A;  1CQH A;  3FR6 A;  2DBC A;  1XBS A;  3D6I A;  1FG4 A;  1K0A A;  1J0F A;  4I5Q A;  5D9V A;  2EIO A;  1GLP A;  3NIV A;  2YOI A;  4WF4 A;  2H0H A;  5D9X A;  3H1N A;  4L5O A;  2K9F A;  4ID0 A;  1GWC A;  2L5L A;  2B1L A;  3GRX A;  1BED A;  1EEM A;  1MD3 A;  1SL2 B;  1M2A A;  1E6B A;  1Z7R A;  5D93 A;  1T4Z A;  1M99 A;  3UEM A;  5LD0 A;  4IW9 A;  1K0D A;  2L6C A;  3GHA A;  2V1M A;  1GTB A;  2PVO C;  5KN0 A;  5D9W A;  3W8S A;  1BQ7 A;  4CDO A;  2HSY A;  2H6Y A;  3WT2 A;  4PUF C;  3R3E A;  4LA1 A;  1HD2 A;  2VL2 A;  1WMJ A;  4OWY A;  2H1A A;  4YAP A;  2K8V A;  4TR3 A;  3RBT A;  4YQU A;  1WWJ A;  3ME7 A;  3LQ7 A;  3BOA A;  1Q4J A;  3DD3 A;  4JRR A;  4ECB A;  2I9H A;  2PN8 A;  4HOJ A;  1T00 A;  2A4V A;  5AIV A;  2H6Z A;  3L78 A;  2H19 A;  1JZR A;  3M9J A;  2K18 A;  3EPT A;  1SYR A;  4HJ2 A;  1YEX A;  4LL1 B;  3Q18 A;  4MJE A;  5ID2 A;  2C4J A;  4X43 A;  3GNJ A;  4EIP A;  6GSU A;  5COH A;  1A8Y A;  1PX7 A;  2H6X A;  2VCX A;  3KIJ A;  2JAD A;  4XRD A;  5J9B A;  5B6M A;  1PN0 A;  5L71 A;  2PBJ A;  4Q5F A;  1SK0 A;  4F2I A;  5HR0 A;  3BBY A;  3ZVJ D;  4BA7 A;  1M7T A;  1WOU A;  3N9J A;  2L59 A;  1NHO A;  1TOF A;  1K0N A;  3IA1 A;  4AJ7 A;  5IMC A;  5HR2 A;  3W6G A;  4KA0 A;  3IC4 A;  2DIY A;  5A4U A;  2N5A A;  5CO3 A;  2H1B A;  3F9U A;  5KOX A;  4EO3 A;  4MDC A;  3CSI A;  1XW6 A;  5ECM B;  2I4A A;  2VL2 C;  1X5C A;  3HJO A;  1UN2 A;  3M8N A;  3PIN A;  1GNW A;  4E8E A;  3KEB A;  2WJU A;  1SK1 A;  4WXT A;  1T7P B;  2DML A;  4OFM A;  2GZY A;  3GIX A;  1A23 A;  2E7P A;  2X8C A;  3OR5 A;  1OC9 B;  1EEJ A;  1JZO A;  4G10 A;  5LNK e;  2LJR A;  1O81 A;  4PNF A;  1R4W A;  1GTU A;  1SL0 B;  3F4R A;  3EIN A;  5H5Q A;  1JFU A;  1AQV A;  3HZ8 A;  1X9S B;  2VLT A;  2WDU A;  2CZ3 A;  2GQL A;  3NOF A;  4KUN A;  2H30 A;  2ZUP A;  1K3L A;  2OBK A;  5ECS A;  5HR3 A;  1F2E A;  2P0G A;  2QA1 A;  2VCZ A;  5J5N A;  1GSU A;  2H0G A;  3DEX A;  1SD8 A;  1NM3 A;  5B6N A;  4V1A g;  4EIQ A;  4GF0 A;  3MIX A;  2RLI A;  2B3S A;  4IKH A;  5DAK B;  1U3I A;  1ST9 A;  5CYY A;  5AN1 A;  8GSS A;  4G0L A;  4MPG A;  2CZ2 A;  3GL5 A;  2VIM A;  1PRX A;  2XHF A;  2M46 A;  4MJA A;  4EDZ A;  3PGT A;  1TP9 A;  4PUR A;  4BPY A;  2XBI A;  2I81 A;  1EP8 A;  4N30 A;  5DQY A;  3L9S A;  4HI7 A;  4GST A;  4OFN A;  2E2G A;  2R2J A;  2YZH A;  4QL9 A;  3UVH A;  3F63 A;  4GWR A;  5JWR B;  3QPM A;  2PWJ A;  1OE8 A;  3FMW A;  4IJI A;  3PH9 A;  3VFI A;  4IN0 A;  4E8H A;  2FHE A;  1MDJ A;  4IBP A;  3Q6O A;  2EIR A;  3P7X A;  1PD2 1;  1V98 A;  2OA7 A;  1HNA A;  3QAG A;  5IPG A;  3NZN A;  3A3T A;  2P5R A;  1JLV A;  4TR0 A;  2FWE A;  2LNT A;  2MZC A;  5IO2 A;  4MF6 A;  3LYP A;  3FZA A;  4OFT A;  4ZIL A;  1AIU A;  2WB9 A;  3GFK A;  1CQG A;  4DSQ A;  1ABA A;  3VWW A;  1TI1 A;  1AAZ A;  4Q5Q A;  1ZYQ B;  2H74 A;  1FAA A;  4POL A;  2C0D A;  3TKQ A;  2NTO A;  1LU4 A;  4N0V A;  3EU4 A;  2DJJ A;  2FD3 A;  1GUH A;  6GSS A;  2C3Q A;  2TIR A;  1PSQ A;  2HRN A;  3FKF A;  2DJ0 A;  1A2M A;  4JED A;  3VI7 A;  3FEU A;  3IHQ A;  4BWQ A;  4ZXG A;  2EC4 A;  2NBS A;  2MMO A;  5CRE A;  1KTE A;  2C0E A;  1QXH A;  4G0I A;  3CYN A;  4I2U A;  1S3C A;  2JZR A;  4IEL A;  5GZZ B;  3GYK A;  1AXD A;  4NAX A;  2O87 A;  1OE7 A;  1GP1 A;  2HT9 A;  4IHU A;  2J9H A;  1ZYE A;  3I43 A;  5J41 A;  2GQK A;  1ILO A;  3ZMK A;  1PN9 A;  3CTG A;  5KN3 A;  1O73 A;  3IK9 A;  3HYP A;  4HEA 2;  3ZRD A;  3LOR A;  4TXO B;  3ZIJ A;  2DIZ A;  4O7H A;  2R0P A;  3C8E A;  2LQQ A;  4BVY B;  5IMF A;  3SWL A;  4RQR A;  3HXS A;  1I9D A;  1S3D A;  3LJR A;  5F05 A;  4F82 A;  2LRC A;  4IVF A;  3A2V A;  3US3 A;  2R4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...