4RUVA

Crystal structure of thioredoxin 2 from staphylococcus aureus nctc8325
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
MQSIKSNESFKSVINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQYNDYQWYTVNRDELEDVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSPEQVESFLAETFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin
publication title Elucidation of the mechanism of disulfide exchange between staphylococcal thioredoxin2 and thioredoxin reductase2: a structural insight.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2014-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ruvA00
3OR5A 2BMXA 4MF7A 2G2QA 2XPDA 2FNOA 4GRFA 3W8JA 5JWQB 3HVSA 2VM2A 3HVVA 4JU5A 1TK5B 5KN3A 1CQHA 1JLVA 1SL0B 2KHPA 3UMAA 1TK8B 2VLVA 4IGJA 1K3LA 1VRSD 2TRXA 4ZB8A 4YAVA 2H75A 4MCUA 1XOAA 1TU7A 2CV4A 3IRAA 1S3AA 1GULA 1BYEA 4KUNA 4MJCA 5FWGA 7GSSA 2H66A 5IO0A 1O6JA 2L6CA 2LTKA 2WCIA 5D73A 2VL9A 3UEMA 4K9ZA 2A2SA 2R3XA 3WGEA 1X5CA 5DJLA 3M1GA 1XW6A 1V9WA 2DJ1A 1TDIA 3QCPA 3QAVA 4LMWA 3CRUA 3Q18A 4CHSA 1XWKA 4J57E 1K3OA 3CBUA 4N10A 1QXHA 3US3A 1U3IA 3GTUA 2VL2A 5A4UA 1PA3A 1M2BA 3NOFA 4XS6A 5IOXA 1GP1A 2YZUA 2P31A 5AN1A 3GMFA 2I4AA 4EL1A 3APSA 4GXZA 4KSMA 3QAWA 2H0GA 2YOIA 2AYTA 4KDUA 1UC7A 3FZ4A 3VWXA 5A5KA 2I9HA 1PD21 3GKKA 4K0GA 4I2TA 2R37A 4L5LA 4F0CA 3RHCA 4BWSA 2ALBA 3VK9A 3D0ZA 3KP8A 2R6KA 3A2WA 1QMVA 5HR0A 3ZFLA 5AIXA 3E3EA 3CTGA 2H6XA 1ZCPA 3HCZA 2KUCA 1HNBA 4XCSA 1XPVA 2JADA 4KAEA 3H79A 3TJBA 4GLTA 2NPBA 4QQ7A 3GH9A 2RIIA 1XXUA 3BCKA 3CMIA 4Z7XA 2GS3A 2P5RA 4XS1A 5E59A 2X8HA 3QPMA 5B6MA 3HJPA 4NV2A 3TRXA 3GKMA 4L0WA 3H93A 2HXKA 1A2MA 5L71A 1TI3A 2H1GA 2GSSA 1SL1B 1Z7RA 5AGYA 5CRWA 3LXZA 3GYKA 2F8FA 1GL8A 2KLXA 4YQMA 4G9HA 2CX4A 13GSA 3U5RE 1T4YA 6GSSA 4YQUA 1EOHA 1SK2A 5CNWA 2V2GA 2V41A 1ERUA 3HJOA 1YJ6A 2CVBA 1LJRA 2IFQB 4D73B 1Z9HA 1EV9A 2GTUA 4PGTA 4GCIA 3PINA 2H0HA 1DUGA 4ZBAA 2I1UA 1K0DA 3DRNA 3LORA 2EIRA 1GSFA 4WETA 2NDOA 1X9SB 2FA4A 3GL5A 5DALA 1WOUA 3ZIVA 2L6DA 1YDKA 1GTUA 4LLRA 1GTIA 2F9SA 2HYXA 5HR1A 3GL3A 5J3RA 1TI1A 3WGDA 1T1VA 2CX3A 1SK1A 1EP8A 3EMXA 3H8QA 2GQMA 3DIEA 3IBHA 2H0IA 5G1KA 2DJ3A 2VCVA 2JACA 5ELAA 1SYRA 3GX8A 2XBQA 3GFKA 2OJLA 3KJYA 4J2FA 1FVKA 2XPEA 1UA5A 4N0VA 1Q98A 2CAQA 5ECSA 1U87A 3ME7A 4N0ZA 2YN1A 1M9AA 1H4OA 3TJKA 2JZTA 2PN8A 4EDYA 3KXOA 2NVLA 3F6FA 2K8VA 1OC3A 1ZYEA 3IK7A 3ZREA 2FHEA 1M2AA 4K2DA 3KMNA 3TCOA 2C8UA 5G30A 3I69A 2FGXA 1X9MB 4OFTA 1BAYA 2H1AA 2ZNMA 1BEDA 2WRTA 3HYPA 22GSA 2HRFA 2MMAA 3QMXA 2HZFA 3TRQA 2MYGA 4ZBDA 5F05A 3E0UA 1TJDA 3QFAC 6GSTA 2KOKA 1QUWA 2PUKC 3DVWA 5A4VA 4TXVA 4I5QA 2FWHA 5EY6A 3C73A 3FY7A 4HEA2 4EVMA 3QAGA 4WXTA 5IMFA 2ZUPA 4BVXA 3QD9A 5IO2A 3IK9A 3TKPA 3O76A 2H76A 4Q5QA 4TN8A 4V1Ag 4DSRA 1B9YC 2QKEA 3P7XA 2IMFA 2BTOT 4ZILA 1K0MA 2C1YA 1G6YA 3F4SA 1U6TA 1A23A 4AF2A 5HR2A 4DSSB 4N11A 4V2MA 3D4TA 1FW1A 4L8EA 1EWXA 4K7NA 2VCTA 2LRNA 5ELGA 4MMMA 5J9BA 1X9WB 1PL2A 2TIRA 2GZZA 3TUEA 3RAZA 3IOSA 1ABAA 4OWYA 1H75A 2K8SA 1DSBA 2IMIA 1G0TA 3RBTA 4K6XA 1GNWA 3Q74A 2YWIA 2HT9A 3HXSA 2C0EA 5ABRA 1RW1A 3UARA 5C00A 6GSYA 1ZYQB 2AUVA 3IR4A 2D2ZA 4CW9A 1MEKA 5ECMB 4NHZA 1NW2A 5G1LA 1K3YA 1YKAA 1TRWA 3RDWA 1ERWA 5F07A 1XOBA 2X64A 3DYRA 2RUEA 4IJIA 2H1BA 2DMLA 2WGRA 4AJ6A 5DAKB 3BCIA 2YANA 3IAM2 2DJ2A 4BPYA 5GSSA 2OBIA 1N8JA 4QL9A 5ECRB 2CZ2A 1G7OA 1K0OA 1Z6NA 2K18A 3L9UA 4ACSA 4KGIA 2XC2A 2IIYA 5DQSA 2FD3A 4L5OA 3MSZA 2K6VA 3M8NA 3KCMA 3IDVA 1GSEA 1FAAA 1M0UA 4JEDA 1GWCA 5JWRB 2VAFA 5IPHA 1MDIA 5CO3A 2HZEA 2OBKA 2PWJA 1GSDA 2PGTA 1JLWA 4KB3A 1VF3A 6GSUA 3J7Yb 5H5QA 3BOAA 4TR0A 1DE2A 5CRHA 1FB6A 5KN1A 3TOUA 3HVXA 3HD5A 2C0DA 1Z6MA 1B48A 3BBYA 3PH9A 4V2LA 4OO4A 2YWOA 3GIXA 5D8IA 1GRXA 1FG4A 3UL3A 5EL8A 3IV4A 4LA1A 2C3TA 2GSRA 4ULXA 2H74A 4OCFA 3VI5A 1M2DA 1GSQA 8GSSA 2MMNA 3ERWA 4ECIA 2QSIA 2KP2A 5AISA 1TK0B 4LL4B 3FZ5A 2EIOA 3N9JA 2OADA 3VFIA 3GURA 3L78A 3I6AA 4K7OA 18GSA 1URMA 4EE0A 2RM5A 1K0CA 3PGTA 2H73A 2PVOC 4EUYA 1OC9B 2YV7A 1N2AA 4PUAA 5LNKe 4BA7A 2IFQA 5ID2A 4GTUA 2FY6A 1OE7A 3I9V2 1EEJA 4HU7A 2MMZA 4ZXGA 1V58A 4E8EA 4TOPA 4K0NA 3A5WA 4LL1B 3QFBC 4XS4B 4O92A 3CSIA 2K9FA 1SKSB 1M99A 1O81A 2ON7A 3KTLA 3EMPA 1KTEA 4MLYA 5JCUA 4WBJA 2IMKA 3L9VA 3WT2A 2LV3A 1TRSA 3IPZA 4MH3A 2CVKA 5ECPB 3IAS2 4MPGA 4TKYA 1AW9A 3Q6OA 2YJ7A 4IBPA 2YJHA 3GUSA 3F63A 1J0FA 5IQYA 3HY2A 4NWYA 1USBA 1EOGA 1ZMAA 2IMDA 4CDOA 3F3QA 3GV1A 5D9TA 1AC1A 1O8XA 1XWGA 3LXTA 20GSA 4HUAA 1AQXA 1U88A 2JSYA 2LSTA 3FR9A 4I2UA 2YNXA 4MABA 2VOCA 2H6YA 4BWQA 4I8BA 2R5GA 5EPFA 3EINA 1YF1A 4TXOB 4GWRA 2O89A 2C4JA 1PN9A 4WR4A 1B4PA 3TKSC 3EU3A 1E6BA 2LRCA 1R26A 1X0RA 4POLA 3FZ9A 3TKQA 4WEYA 3ZFBA 1A2JA 5H5RA 3LYPA 2H6ZA 1HYUA 4POBA 1ZGNA 3IE3A 2CVDA 2IMEA 2ES7A 2H01A 2YZHA 5D9WA 3W6GA 4TVEA 5LD0A 3E9JB 2C0FA 2B5YA 1AQWA 4ECCA 5HFKA 1FB0A 3KZQA 3TDGA 1F9MA 1OAZA 4EKZA 4TR1A 4WKWA 2V6KA 1A8LA 2RLIA 1QK8A 1VGLA 1I5GA 4N30A 2JZRA 2M80A 1MDKA 1T8EB 1CQGA 2OA7A 4ZL7A 1OKDA 1GTAA 2C3NA 4Q5FA 1EZKA 3ZLPA 2OE1A 5DVBA 2WDUA 1ML6A 1YKCA 5J5NA 2PU9C 1PX7A 3G9BA 1O7UA 2DJJA 2ZCTA 3ZTLA 4PNGA 4HZ4A 4BVYA 2GQKA 4DVCA 4ECJA 4IQAA 3J7Yk 3FZAA 5COHA 3QR6A 1NHYA 3FRCA 5HFIA 3UJ1A 1BG5A 1W89A 1UN2A 1IYHA 4ILFA 5J41A 5INYA 4ZBBA 1PGTA 3P8WA 2L4QA 2H8LA 3KM6A 2B5EA 2M72A 5J9CA 5FT3A 5GZZB 3KP9A 4XHMA 5IMVA 1R4WA 3F4RA 3H1NA 4MF5A 4HQSA 3NIVA 2YV9A 5IMDA 4ML1A 1SKRB 1U3AA 3G7JA 3MDKA 2HI7A 2AHEA 2HSYA 3LEFA 4WF5A 1AXDA 1XIYA 1J9BA 2C0GA 2DJKA 4JZQA 2VCXA 2LQOA 1PQNA 1WPIA 1JZWA 2VCZA 3HHVA 1BX9A 5F06A 1F2EA 3H4KA 3KEBA 4GSTA 2GGTA 1JZOA 3EURA 5JCGA 3EWLA 3GTUB 3W8SA 3A3TA 5KN0A 4F2IA 4MK3A 2FCHA 5A4WA 3APQA 4Q5NA 4IELA 2WS2A 3LJRA 4L0UA 2A4VA 2F8AA 4IKHA 4FYUA 1RQMA 1JHBA 1GSSA 3TB2A 2O85A 1GLQA 4IJ3A 1R7HA 1SD8A 3FYGA 3L9SA 4HQZA 1SENA 1T00A 3IHQA 1B8XA 3N5OA 2L57A 2H70A 3KIJA 4PUFC 3GNJA 2P0GA 5B6NA 3ZZXA 1XVQA 1THXA 4KDYA 1XCCA 3KD0A 5IIZA 3VURA 3F6DA 5ECOB 4KH7A 3D5JA 5KN2A 4ID0A 5C04A 1FVJA 1LU4A 2LJAA 1TP9A 1WRYA 1PSQA 4OFNA 3BJ5A 2LQQA 1SD9A 3LFLA 3TKSE 2HRNA 2OE0A 4H86A 1GSUA 4OFMA 2WULA 4PQ1A 1XW5A 2XBIA 1PKZA 2IWTA 4LMVA 4EXJA 3FEUA 1WP0A 4GSNA 4G2EA 4MZWA 2GSTA 4AGSA 1HQOA 1BJXA 4MF6A 1J08A 4QL7A 5KEJA 4F9ZA 4V1Ap 2GZPA 2JL4A 1Q4JA 5DBQA 2DIZA 3VPTA 2DJ0A 3F9UA 5IMCA 2VCQA 4X0XA 1OE8A 19GSA 2C80A 4NAXA 1TU8A 1S3DA 2VD0A 2PBJA 3KH9A 2J23A 2LUSA 2MZCA 2WZ9A 1SJZA 3MAKA 2QGVA 2XHFA 1SKWB 2B1LA 1TRVA 5DALB 1XWAA 3FR3A 3HZ4A 1ZZYA 1I9DA 4AJ7A 2LNSA 1XBSA 4O7HA 2LJRA 1GSYA 2B7KA 3HJMA 3TJFA 3DMLA 2FWGA 5CAXA 2V1MA 1F3BA 3HDCA 4MPFA 3U6VA 1ZL9A 2GT5A 12GSA 2H19A 4FYBA 4IS0A 1QFNA 2HSHA 5HFGA 1RK4A 3KGKA 4NXIA 5ECLB 1PKWA 2CT6A 3D22A 1MD4A 3CTFA 5IMZA 5B7CA 5ECKB 3ZVJA 3LSZA 3GKNA 2DLXA 4XRDA 3M0FA 3GX0A 1PL1A 3RPNA 4HS1A 5D96A 1O73A 3KTBA 5G31A 1F3AA 2TRCP 4I6XA 5DJMA 2L4CA 1W4VA 1EP7A 4DSQA 4NHWA 2CA8A 1Z5YE 3CSHA 3CYNA 1MTCA 2GDRA 5FHIA 4K7IA 4TR3A 3IXRA 1E2YA 1GUHA 2O87A 1WIKA 3TKSA 2GLRA 2NBSA 3VI7A 17GSA 3EVIA 3M9JA 1JFUA 3PR8A 2GQLA 2VCWA 1VF2A 3ERGA 1K0BA 4ZB6A 5DDLA 3UAPA 2L5LA 1TXXA 5IM9A 3UVHA 1R5AA 5J4UA 4I97A 4XIHA 2IPAA 3DXBA 6GSXA 2OE3A 2B3SA 2VD1A 4OO5A 1VF4A 4V2NA 4D73A 1WWJA 3F3RA 4GQCA 3WYWA 2H30A 3S9FA 4O32A 4RI7A 4MJBA 3MNGA 2QC7A 2H1DA 1GNEA 3NZNA 2LRTA 2GSQA 1TTZA 10GSA 4KSOA 2LEGA 3ZRDA 5GAND 4G19A 4FIWA 3DGQA 2WFCA 2WJUA 2J9HA 3RHBA 2JU5A 3GHAA 3FHKA 1OC8A 2M46A 4MA9A 1WJKA 1KBNA 1Z7PA 5JCWA 2REMA 4JRRA 1XVWA 5F0GA 3QOUA 1SYXA 1ZOFA 4RUVA 5JWOB 2JZSA 5EVOA 3SBCA 2E7PA 3UBKA 3KH7A 3DWVA 2DBCA 3ZMLA 1A8YA 3ZYWA 4NV5A 2AB6A 4E8HA 4POKA 3FKFA 4HI7A 2V32A 5DCHA 3ZVJD 1G6WA 1HD2A 3IC4A 4IP6A 3LGCA 4HU9A 1BQ7A 5CRGA 4JE1A 4KDXA 4XRAA 3RPPA 1YF0A 3DKSA 4MZCA 3GSSA 1A0FA 4RQRA 2HZEB 2X8GA 2R4VA 3P2AA 4O5RA 2HFDA 5DCGA 3EC3A 1NSWA 2N5FA 2YWNA 4IN0A 2JSZA 3BD2A 1SJIA 1MD3A 2DC5A 2GVPA 4KW6A 4X43A 1O8WA 2LKUA 1EGOA 4RI6A 3GH6A 5GSTA 3I43A 3VWVA 3LYKA 3HZ8A 3GN3A 1EV4A 2HLSA 4MJAA 1QGVA 3GKXA 1V40A 2I3YA 1B9XC 5D93A 3ZITA 2LS5A 2AV4A 3ZIJA 11GSA 3FW2A 4OD7A 1C72A 2PERA 5AIVA 1XZOA 1XFLA 5IMAA 6GSWA 3LG6A 5H5SA 2VIMA 4DSSA 2X99A 3L0HA 1SK0A 1TW9A 1XWBA 2DMMA 1K0NA 2YCDA 3EU4A 3HA9A 3ERFA 1JZDA 3D6IA 1MDJA 2BJXA 4GQFA 4F82A 2EIQA 2IN3A 4F0BA 2MBTA 1TOFA 5E4WA 5HR3A 2B1KA 4NMUA 2DIYA 1TRUA 1XW9A 3GA4A 2CZ3A 4HZ2A 2I81A 2LNTA 2G0FA 1YEPA 4G10A 1GTBA 3UVTA 4EDZA 5GAPD 2FA8A 3AY8A 3ISOA 1IYIA 2YP6A 4ZL8A 5ID2B 2B7JA 3O3TA 4WR5A 2CQ9A 1GLPA 2O8VB 1X5DA 4IW9A 1PRXA 2N5AA 3CSJA 3C71A 4HOJA 1YEXA 2VLUA 4TRXA 1DE1A 4AJ8A 5HQPA 1A24A 1AUCA 5CRDA 2CAIA 2FWFA 1ERTA 2FWEA 3WT1A 2VL2C 5DAKA 2VL3A 5ECQB 1VF1A 2IJYA 4ISDA 4JR6A 3D4MA 4RQXA 5DQYA 4ZL9A 2EC4A 4PXOA 3WD6A 1WMJA 2F3MA 2IL3A 4FH8A 2C3QA 1F6MC 2VO4A 4K8MA 3TRPA 3F4TA 4EC0A 1YQ1A 4KCEA 4HDEA 1B4QA 1UVZA 2AJQB 5B8BA 4ECBA 4TW5A 2GT6A 1OVNA 2RUFA 3WGXA 2OKAA 3A2VA 5IPGA 2PVQA 3C8EA 3IA1A 2E2MA 1T7PB 5ECIB 2B5XA 4NPBA 4TR4A 3M9KA 3APOA 3UOMA 2A2RA 1NM3A 3DD3A 1V98A 1Z3EA 5G5FA 4EF0A 5IOWA 2L5OA 3K8NA 3FK8A 1AIUA 1AQVA 3ZMKA 2VUPA 3F8UA 4F03A 1HNCA 4PNFA 1NHOA 2RM6A 3EE2A 2FLSA 1K0AA 2AAWA 2E2GA 2LJKA 2GZYA 14GSA 1FO5A 1QQ2A 2H72A 1GH2A 1AAZA 3ZL5A 4TR1B 1A2LA 2HNLA 2N5BA 1OC9A 2MMOA 1DBYA 1YZXA 3L4NA 4PQHA 4ZIJA 5B8AA 4FYCA 1FOVA 3JCML 4GSSA 3VWUA 4EO3A 5D9VA 5ECHB 3F0IA 3UIWA 1ST9A 1F37A 3MWHA 5G2ZA 5CREA 1OYJA 2FUG2 4POMA 3TJJA 4XS4A 9GSSA 3C1RA 1PX6A 2L59A 3VLNA 3TJGA 4WF4A 3QDNA 3A2XA 4KA0A 5F8BA 1GUMA 4GF0A 2KP1A 3KMOA 2WB9A 3G7YA 1KNGA 2DSAA 4ZB9A 4K1FA 1YY7A 1SU9A 2PPTA 4MH2A 3R2QA 3VPQA 3TOTA 1G7EA 1OKTA 4WBRD 2E0QA 2YWMA 3UBLA 3FR6A 3LWAA 2MBSA 1ERVA 1O85A 1SJ6A 2Z9SA 4ML6A 1Y6EA 2P5QA 1ON4A 1KEBA 4KE3A 2HE3A 4JBBA 1M9BA 4MP4A 2F51A 3CXGA 3EYTA 4FO5A 4YQVA 1GUKA 2H71A 1T4ZA 1R5PA 3C7MA 3D21A 1PMTA 4YH2A 1XWCA 4IQ1A 4OMVA 4PQIA 2VLTA 3TKRA 2X8CA 4J56E 1ACVA 1HNAA 1TKDB 1EEMA 3SWLA 1FHEA 5G5EA 1JZRA 4YAPA 1ILOA 3O6TA 1S3CA 2O7KA 2YPMA 3Q19A 4TXOA 1WE0A 3ME8A 16GSA 4BL7A 3G7IA 2PMTA 5D9XA 4KX4A 3HKRA 5LCZA 2OACA 5CYYA 1X5EA 3GSTA 4MZBA 4X1UA 4PURA 4HJMA 2VM1A 4KNDA 3DEXA 2V6OA 3DVXA 3ED3A 1LBKA 2NTOA 4KCAA 3VWWA 2R2JA 4MJEA 4PX1A 1V2AA 3M3MA 3LQ7A 1V57A 4HJ2A 2ON5A 3GRXA 1M7TA 4XTSA 4Q5RA 6GSVA 3C1SA 5CP1A 4IP1A 3CRTA 4P3YB 3P90A 5ECNB 1EGRA 4IHUA 4OCEA 1THOA 4JR4A 1SL2B 4IVFA 4DEJA 1T3BA 1A0RP 5ENUA 4MDCA 3TGZA 2B6MA 1Y25A 3V1WA
chains in the Genus database with same CATH superfamily
3OR5A 2BMXA 4MF7A 2G2QA 2XPDA 2FNOA 4GRFA 3W8JA 5JWQB 3HVSA 2VM2A 3HVVA 4JU5A 1TK5B 5KN3A 1CQHA 1JLVA 1SL0B 2KHPA 3UMAA 1TK8B 3HVNA 2VLVA 4IGJA 1K3LA 1VRSD 2TRXA 4ZB8A 4YAVA 2H75A 4MCUA 1XOAA 1TU7A 2CV4A 3IRAA 1S3AA 1GULA 1BYEA 4O5QA 4KUNA 4MJCA 4K5SA 5FWGA 7GSSA 2H66A 5IO0A 1O6JA 2L6CA 2LTKA 2R0PA 2WCIA 5D73A 2VL9A 3UEMA 4K9ZA 2A2SA 2R3XA 3WGEA 1X5CA 5DJLA 3M1GA 1XW6A 1V9WA 2DJ1A 1TDIA 3QCPA 3QAVA 4LMWA 3CRUA 3Q18A 4CHSA 1XWKA 4J57E 1K3OA 3CBUA 4N10A 1QXHA 4MNNA 3US3A 1U3IA 3GTUA 2VL2A 5A4UA 1PA3A 1PFOA 1M2BA 3NOFA 4XS6A 5IOXA 1GP1A 2YZUA 2P31A 5AN1A 3GMFA 2I4AA 4EL1A 3APSA 4GXZA 4KSMA 3QAWA 2H0GA 2YOIA 2AYTA 4KDUA 1UC7A 3FZ4A 4BIKA 3VWXA 5A5KA 2I9HA 1PD21 3GKKA 4K0GA 4I2TA 2R37A 4L5LA 4F0CA 3RHCA 4BWSA 2ALBA 3VK9A 3D0ZA 3KP8A 2R6KA 3A2WA 1QMVA 5HR0A 3ZFLA 5AIXA 3E3EA 4G0LA 3CTGA 2H6XA 1ZCPA 3HCZA 2KUCA 1HNBA 4XCSA 1XPVA 2JADA 4KAEA 4EIQA 3H79A 3TJBA 4GLTA 2NPBA 4QQ7A 3GH9A 2RIIA 1XXUA 3BCKA 4K2XA 1ZYNA 3CMIA 4Z7XA 2GS3A 2P5RA 4XS1A 5E59A 2X8HA 3QPMA 5B6MA 3HJPA 4NV2A 3TRXA 3GKMA 4L0WA 3H93A 2HXKA 1A2MA 5L71A 1TI3A 2H1GA 2GSSA 1SL1B 1Z7RA 5AGYA 5CRWA 3LXZA 3GYKA 2F8FA 1GL8A 2KLXA 4YQMA 4G9HA 2CX4A 13GSA 3U5RE 3FMWA 1T4YA 6GSSA 4YQUA 1EOHA 1SK2A 5CNWA 2V2GA 2V41A 1ERUA 3HJOA 1YJ6A 2CVBA 1LJRA 2IFQB 4D73B 1Z9HA 1EV9A 2GTUA 4PGTA 4GCIA 3PINA 2H0HA 1DUGA 4ZBAA 2I1UA 1K0DA 3DRNA 3LORA 2EIRA 1GSFA 4WETA 2NDOA 1X9SB 2FA4A 3GL5A 5DALA 1WOUA 3ZIVA 2L6DA 1YDKA 1GTUA 4LLRA 1GTIA 2F9SA 2HYXA 5HR1A 3GL3A 5J3RA 1TI1A 2UZ8A 3WGDA 1T1VA 2CX3A 1SK1A 1EP8A 3EMXA 3H8QA 2GQMA 3DIEA 3IBHA 2H0IA 5G1KA 2DJ3A 2VCVA 2JACA 5ELAA 1SYRA 3GX8A 2XBQA 3GFKA 2OJLA 3KJYA 4J2FA 1FVKA 2XPEA 1UA5A 4N0VA 1Q98A 2CAQA 5ECSA 1U87A 3ME7A 4N0ZA 2YN1A 1M9AA 1H4OA 3TJKA 2JZTA 1PN0A 2PN8A 4EDYA 3KXOA 2NVLA 3F6FA 2K8VA 1OC3A 1ZYEA 3IK7A 3ZREA 2FHEA 1M2AA 4K2DA 3KMNA 3TCOA 2C8UA 5G30A 3I69A 2FGXA 1X9MB 4OFTA 1BAYA 2H1AA 2ZNMA 1BEDA 2WRTA 3HYPA 22GSA 2HRFA 2MMAA 3QMXA 2HZFA 3TRQA 2MYGA 4ZBDA 5F05A 3E0UA 1TJDA 3QFAC 6GSTA 2KOKA 1QUWA 2PUKC 3DVWA 5A4VA 4TXVA 4I5QA 2FWHA 5EY6A 3C73A 3FY7A 4HEA2 4EVMA 3QAGA 4WXTA 5IMFA 2ZUPA 4BVXA 3QD9A 5IO2A 3IK9A 3TKPA 3O76A 2H76A 4Q5QA 4TN8A 4V1Ag 4DSRA 1B9YC 2QKEA 3P7XA 2IMFA 2BTOT 4ZILA 1K0MA 2C1YA 1G6YA 3F4SA 1U6TA 1A23A 4AF2A 5HR2A 4DSSB 4N11A 4G0IA 2R0CA 4V2MA 3D4TA 1FW1A 4L8EA 1EWXA 4K7NA 2VCTA 2LRNA 5ELGA 4MMMA 5J9BA 1X9WB 1PL2A 2TIRA 2GZZA 3TUEA 3RAZA 3IOSA 1ABAA 3R3EA 4OWYA 1H75A 2K8SA 1DSBA 2IMIA 1G0TA 3RBTA 4K6XA 1GNWA 3Q74A 2YWIA 2HRAA 2HT9A 3HXSA 2C0EA 5ABRA 1RW1A 3UARA 5C00A 6GSYA 1ZYQB 2AUVA 3IR4A 2D2ZA 4CW9A 1MEKA 5ECMB 4NHZA 1NW2A 5G1LA 1K3YA 1YKAA 1TRWA 2QA1A 3RDWA 1ERWA 5F07A 1XOBA 2X64A 3DYRA 2RUEA 3MIXA 4IJIA 2H1BA 2DMLA 2WGRA 4AJ6A 5DAKB 2A4HA 3BCIA 2YANA 3IAM2 2DJ2A 4BPYA 5GSSA 2OBIA 1N8JA 4QL9A 5ECRB 2CZ2A 1G7OA 1K0OA 1Z6NA 2K18A 3L9UA 4ACSA 4KGIA 2XC2A 2IIYA 1ZYPA 5DQSA 2FD3A 4L5OA 3MSZA 2K6VA 3M8NA 3KCMA 3IDVA 1GSEA 1FAAA 1M0UA 4JEDA 2DKIA 1GWCA 5JWRB 2VAFA 5IPHA 1MDIA 5CO3A 2HZEA 2OBKA 2PWJA 5KOXA 1GSDA 2PGTA 1JLWA 4KB3A 1VF3A 6GSUA 3J7Yb 5H5QA 3BOAA 4TR0A 1DE2A 5CRHA 1FB6A 5KN1A 3TOUA 3HVXA 3HD5A 2C0DA 1Z6MA 1B48A 3BBYA 3PH9A 4V2LA 4OO4A 2YWOA 4USSA 3GIXA 5D8IA 1GRXA 1FG4A 3UL3A 5EL8A 3IV4A 4LA1A 2C3TA 2GSRA 4ULXA 2H74A 4OCFA 3VI5A 1M2DA 4X4JA 1GSQA 8GSSA 2MMNA 3ERWA 4ECIA 2QSIA 2KP2A 4Z2UA 5AISA 1TK0B 4LL4B 4Z2TA 3FZ5A 2EIOA 3N9JA 2OADA 3VFIA 3GURA 3L78A 3I6AA 4K7OA 18GSA 1URMA 4EE0A 1M3JA 2RM5A 1K0CA 3PGTA 2H73A 2PVOC 4EUYA 1OC9B 2YV7A 1N2AA 4PUAA 3IC8A 5LNKe 4BA7A 2IFQA 5ID2A 4GTUA 2FY6A 1OE7A 3I9V2 1EEJA 4HU7A 2MMZA 4ZXGA 1V58A 2HSMA 4E8EA 4TOPA 4K0NA 3A5WA 4LL1B 3QFBC 4XS4B 4O92A 3CSIA 2K9FA 1SKSB 1M99A 1O81A 2ON7A 3KTLA 3EMPA 1KTEA 4MLYA 5JCUA 4WBJA 2IMKA 3L9VA 3WT2A 2LV3A 1TRSA 3IPZA 4MH3A 2CVKA 5ECPB 3IAS2 4MPGA 4TKYA 1AW9A 3Q6OA 2YJ7A 4IBPA 2YJHA 3GUSA 3F63A 1J0FA 5IQYA 3HY2A 4NWYA 1USBA 1EOGA 1ZMAA 2IMDA 4CDOA 3F3QA 3GV1A 5D9TA 1AC1A 1O8XA 1XWGA 3LXTA 20GSA 4HUAA 1AQXA 1U88A 2JSYA 2LSTA 3FR9A 4I2UA 2YNXA 4MABA 2VOCA 2H6YA 4BWQA 4I8BA 2R5GA 5EPFA 1S3RA 3EINA 1YF1A 4TXOB 4GWRA 4BL7B 2O89A 2C4JA 1PN9A 4WR4A 1B4PA 3TKSC 3EU3A 1E6BA 2LRCA 1R26A 1X0RA 4POLA 3FZ9A 3TKQA 4WEYA 3ZFBA 1A2JA 5H5RA 3LYPA 2H6ZA 1HYUA 4POBA 1ZGNA 3IE3A 2CVDA 2IMEA 2ES7A 2H01A 2YZHA 5D9WA 3W6GA 4TVEA 5LD0A 3E9JB 2C0FA 2B5YA 1AQWA 4ECCA 5HFKA 1FB0A 3KZQA 3TDGA 1F9MA 1OAZA 4EKZA 4TR1A 4WKWA 2V6KA 1A8LA 2RLIA 1QK8A 1VGLA 1XG8A 1I5GA 4N30A 2JZRA 2M80A 1MDKA 1T8EB 4K5RA 1CQGA 2OA7A 4ZL7A 1OKDA 1GTAA 2C3NA 4Q5FA 1EZKA 3ZLPA 2OE1A 5DVBA 2WDUA 1ML6A 1YKCA 5J5NA 2PU9C 1PX7A 3G9BA 1O7UA 2DJJA 2ZCTA 3ZTLA 4PNGA 4HZ4A 4BVYA 2GQKA 4DVCA 4ECJA 4IQAA 3J7Yk 3FZAA 5COHA 3QR6A 1NHYA 3FRCA 5HFIA 3UJ1A 1BG5A 1W89A 4PTSA 1UN2A 1IYHA 4ILFA 5J41A 5INYA 4ZBBA 1PGTA 3P8WA 2L4QA 2H8LA 3KM6A 2B5EA 2M72A 5J9CA 2A2PA 5FT3A 5GZZB 3KP9A 4XHMA 5IMVA 1R4WA 3F4RA 3H1NA 4MF5A 4HQSA 3NIVA 2YV9A 5IMDA 4ML1A 1SKRB 1U3AA 3G7JA 3MDKA 2HI7A 2AHEA 2HSYA 3LEFA 4WF5A 1AXDA 1XIYA 1J9BA 2C0GA 2DJKA 4JZQA 2VCXA 2LQOA 1PQNA 1WPIA 1JZWA 2VCZA 3HHVA 1BX9A 5F06A 1F2EA 3H4KA 3KEBA 4GSTA 2GGTA 1JZOA 3EURA 5JCGA 3EWLA 3GTUB 3W8SA 3A3TA 5KN0A 2X4AA 4F2IA 4MK3A 2FCHA 5A4WA 3APQA 4Q5NA 4IELA 2WS2A 3LJRA 4L0UA 2A4VA 2F8AA 4IKHA 4FYUA 1RQMA 1JHBA 1GSSA 3TB2A 2O85A 1GLQA 4IJ3A 1R7HA 1SD8A 3FYGA 3L9SA 4HQZA 1SENA 1T00A 3IHQA 1B8XA 3N5OA 2L57A 2H70A 3KIJA 4PUFC 3GNJA 2P0GA 5B6NA 3ZZXA 1XVQA 1THXA 4KDYA 1XCCA 3KD0A 5IIZA 3VURA 3F6DA 5ECOB 4KH7A 3D5JA 4YKFA 5KN2A 4ID0A 5C04A 1FVJA 1LU4A 2LJAA 1TP9A 1WRYA 1PSQA 4OFNA 3BJ5A 2LQQA 1SD9A 3LFLA 3TKSE 2HRNA 2OE0A 4H86A 1GSUA 4OFMA 2WULA 4PQ1A 1XW5A 2XBIA 1PKZA 2IWTA 4Z2RA 4LMVA 4EXJA 3FEUA 1WP0A 4GSNA 4G2EA 4MZWA 2GSTA 4AGSA 1HQOA 1BJXA 4MF6A 1J08A 4QL7A 5KEJA 4F9ZA 4V1Ap 2GZPA 4YKGA 2JL4A 1Q4JA 5DBQA 2DIZA 3VPTA 2DJ0A 3F9UA 5IMCA 2VCQA 4X0XA 1OE8A 19GSA 2C80A 4NAXA 1TU8A 1S3DA 2VD0A 2PBJA 3KH9A 2J23A 2LUSA 2MZCA 3LW9A 2WZ9A 1SJZA 3MAKA 2QGVA 2XHFA 1SKWB 2B1LA 1TRVA 5DALB 1XWAA 3FR3A 3HZ4A 1ZZYA 1I9DA 4AJ7A 2LNSA 4G0KA 1XBSA 4O7HA 2LJRA 1GSYA 2B7KA 3HJMA 4CY8A 3TJFA 3DMLA 2FWGA 5CAXA 2V1MA 1F3BA 3HDCA 4MPFA 3U6VA 1ZL9A 2GT5A 12GSA 2H19A 4FYBA 4IS0A 1QFNA 2HSHA 5HFGA 1RK4A 3KGKA 4NXIA 5ECLB 1PKWA 2CT6A 3D22A 1MD4A 3CTFA 5IMZA 5B7CA 5ECKB 3ZVJA 3LSZA 3GKNA 2DLXA 4XRDA 3M0FA 3GX0A 1PL1A 3RPNA 4HS1A 5D96A 1O73A 3KTBA 5G31A 1F3AA 2TRCP 4I6XA 5DJMA 2L4CA 1W4VA 1EP7A 4DSQA 4NHWA 2CA8A 1Z5YE 3CSHA 3CYNA 1MTCA 2GDRA 5FHIA 4K7IA 4TR3A 3IXRA 1E2YA 1GUHA 2O87A 1WIKA 3TKSA 2GLRA 2NBSA 3VI7A 17GSA 3EVIA 3M9JA 1JFUA 3PR8A 2GQLA 2VCWA 4BVXB 1VF2A 3ERGA 1K0BA 4ZB6A 5DDLA 3UAPA 2L5LA 1TXXA 5IM9A 3UVHA 1R5AA 5J4UA 4I97A 4O5UA 4XIHA 2IPAA 3DXBA 6GSXA 2OE3A 2B3SA 2VD1A 4OO5A 4FQUA 1VF4A 4V2NA 4D73A 1WWJA 3F3RA 4GQCA 3MYDA 3WYWA 2H30A 5BMUA 3S9FA 4O32A 3PPUA 4RI7A 4MJBA 3MNGA 2QC7A 2H1DA 1GNEA 3NZNA 2LRTA 2GSQA 1TTZA 10GSA 4KSOA 2LEGA 3ZRDA 5GAND 4G19A 4FIWA 3DGQA 2WFCA 2DKHA 2WJUA 2J9HA 3RHBA 2JU5A 3GHAA 3FHKA 1OC8A 2M46A 4MA9A 1WJKA 1KBNA 3A5IA 1Z7PA 5JCWA 2REMA 4JRRA 1XVWA 3QOUA 5F0GA 1SYXA 1ZOFA 4RUVA 5JWOB 2JZSA 5EVOA 3SBCA 2E7PA 3UBKA 3KH7A 3DWVA 2DBCA 3ZMLA 1A8YA 3ZYWA 4NV5A 2AB6A 4E8HA 4POKA 3FKFA 4HI7A 2V32A 5DCHA 3ZVJD 1G6WA 1HD2A 3IC4A 3EPTA 4IP6A 3LGCA 4HU9A 1BQ7A 5CRGA 4JE1A 4CY6A 2QA2A 4KDXA 4XRAA 3RPPA 2R0GA 1YF0A 3DKSA 4MZCA 3GSSA 1A0FA 4RQRA 2HZEB 2X8GA 2R4VA 3P2AA 4O5RA 2HFDA 5DCGA 3EC3A 1NSWA 2N5FA 2YWNA 4IN0A 2JSZA 3BD2A 1SJIA 1MD3A 2DC5A 2GVPA 4KW6A 4X43A 1O8WA 2LKUA 1EGOA 4RI6A 3GH6A 5GSTA 3I43A 3VWVA 3LYKA 3HZ8A 3GN3A 1EV4A 2HLSA 4MJAA 1QGVA 3GKXA 1V40A 2I3YA 1B9XC 5D93A 3ZITA 2LS5A 2AV4A 3ZIJA 11GSA 3FW2A 4OD7A 1C72A 2PERA 5AIVA 1XZOA 1XFLA 5IMAA 6GSWA 3LG6A 5H5SA 2VIMA 4DSSA 2X99A 3L0HA 1SK0A 1TW9A 1XWBA 2DMMA 1K0NA 2YCDA 3EU4A 3HA9A 3ERFA 1JZDA 3D6IA 1MDJA 4ICYA 2BJXA 4GQFA 4F82A 2EIQA 2IN3A 4F0BA 2MBTA 1TOFA 5E4WA 5HR3A 2B1KA 4NMUA 2DIYA 1TRUA 1XW9A 3GA4A 2CZ3A 4HZ2A 2I81A 2LNTA 2G0FA 1YEPA 4G10A 1GTBA 3UVTA 2HRKA 4EDZA 5GAPD 2FA8A 3AY8A 3ISOA 1IYIA 2YP6A 4ZL8A 5ID2B 2B7JA 3O3TA 4WR5A 2CQ9A 1GLPA 2O8VB 1X5DA 4IW9A 1PRXA 2N5AA 3CSJA 3C71A 4HOJA 1YEXA 2VLUA 4TRXA 1DE1A 4AJ8A 5HQPA 1A24A 1AUCA 5CRDA 2CAIA 2FWFA 1ERTA 2FWEA 3WT1A 2VL2C 5DAKA 2VL3A 5ECQB 5KOWA 1VF1A 2IJYA 4ISDA 4JR6A 3D4MA 4RQXA 5DQYA 4ZL9A 2EC4A 4PXOA 3WD6A 1WMJA 3IHGA 2F3MA 2IL3A 4FH8A 2C3QA 1F6MC 2VO4A 4K8MA 3TRPA 3F4TA 4EC0A 1YQ1A 4KCEA 4HDEA 1B4QA 1UVZA 2AJQB 5B8BA 4A5PA 4ECBA 4TW5A 2GT6A 1OVNA 2RUFA 3WGXA 2OKAA 3A2VA 5IPGA 2PVQA 3C8EA 3IA1A 2E2MA 1T7PB 5ECIB 2B5XA 4NPBA 4TR4A 3M9KA 3APOA 3UOMA 2A2RA 1NM3A 3DD3A 1V98A 1Z3EA 5G5FA 4EF0A 5IOWA 2L5OA 3K8NA 3FK8A 1AIUA 1AQVA 3ZMKA 2VUPA 3F8UA 4F03A 1HNCA 4PNFA 1NHOA 2RM6A 3EE2A 4HSCX 2FLSA 1K0AA 2AAWA 2E2GA 2LJKA 2GZYA 14GSA 1FO5A 1QQ2A 2H72A 1GH2A 1AAZA 1M3IA 3ZL5A 4TR1B 1A2LA 2HNLA 2N5BA 1OC9A 2MMOA 1DBYA 1YZXA 3L4NA 4PQHA 4ZIJA 5B8AA 4FYCA 1FOVA 3JCML 4GSSA 3VWUA 4EO3A 5D9VA 5ECHB 3F0IA 3UIWA 1ST9A 1F37A 3MWHA 5G2ZA 5CREA 1OYJA 2FUG2 4POMA 3TJJA 4EIPA 4XS4A 9GSSA 3C1RA 1PX6A 2L59A 3VLNA 3TJGA 4WF4A 3QDNA 3A2XA 4KA0A 5F8BA 1GUMA 4GF0A 4BVYB 2KP1A 3KMOA 4KF9A 2WB9A 3G7YA 1KNGA 2DSAA 4ZB9A 4K1FA 1YY7A 1SU9A 2PPTA 4MH2A 5BRTA 3R2QA 3VPQA 3TOTA 1G7EA 1OKTA 4WBRD 2E0QA 2YWMA 3UBLA 3FR6A 3LWAA 2MBSA 1ERVA 1O85A 1SJ6A 2Z9SA 4ML6A 1Y6EA 2P5QA 1ON4A 3CQFA 1KEBA 4KE3A 2HE3A 4JBBA 1M9BA 4MP4A 2F51A 2X49A 3CXGA 3EYTA 4FO5A 4YQVA 1GUKA 2H71A 1T4ZA 1R5PA 3C7MA 3D21A 1PMTA 4YH2A 1XWCA 4IQ1A 4OMVA 4PQIA 2VLTA 3TKRA 2X8CA 4J56E 1ACVA 1HNAA 1TKDB 1EEMA 3SWLA 1FHEA 5G5EA 1JZRA 4YAPA 1ILOA 3O6TA 1S3CA 2O7KA 2YPMA 3Q19A 4TXOA 1WE0A 3ME8A 16GSA 4BL7A 3G7IA 2PMTA 5D9XA 4KX4A 3HKRA 5LCZA 2OACA 5CYYA 1X5EA 3GSTA 4MZBA 4X1UA 4PURA 4HJMA 2VM1A 4KNDA 3DEXA 2V6OA 3DVXA 3ED3A 1LBKA 2NTOA 1FOHA 4KCAA 3VWWA 2R2JA 4MJEA 4PX1A 1V2AA 3M3MA 3LQ7A 1V57A 4HJ2A 2ON5A 3GRXA 1M7TA 4XTSA 4Q5RA 6GSVA 3C1SA 5CP1A 4IP1A 3CRTA 4P3YB 3P90A 5ECNB 1EGRA 4IHUA 4OCEA 1THOA 4JR4A 1SL2B 4IVFA 4DEJA 1T3BA 1A0RP 5ENUA 4MDCA 3TGZA 2B6MA 1Y25A 3V1WA
chains in the Genus database with same CATH topology
3OR5A 2BMXA 4MF7A 2G2QA 2XPDA 2FNOA 4GRFA 3W8JA 5JWQB 3HVSA 2VM2A 3HVVA 4JU5A 1TK5B 5KN3A 1CQHA 1JLVA 1SL0B 2KHPA 3UMAA 1TK8B 2VLVA 4IGJA 1K3LA 1VRSD 2TRXA 4ZB8A 4YAVA 2H75A 4MCUA 1XOAA 1TU7A 2CV4A 3IRAA 1S3AA 1GULA 1BYEA 4O5QA 4KUNA 4MJCA 4K5SA 5FWGA 7GSSA 2H66A 5IO0A 1O6JA 2L6CA 2LTKA 2R0PA 2WCIA 5D73A 2VL9A 3UEMA 4K9ZA 2A2SA 2R3XA 3WGEA 1X5CA 5DJLA 3M1GA 1XW6A 1V9WA 2DJ1A 1TDIA 3QCPA 3QAVA 4LMWA 3CRUA 3Q18A 4CHSA 1XWKA 4J57E 1K3OA 3CBUA 4N10A 1QXHA 4MNNA 3US3A 1U3IA 3GTUA 2VL2A 5A4UA 1PA3A 1M2BA 3NOFA 4XS6A 5IOXA 1GP1A 2YZUA 2P31A 5AN1A 3GMFA 2I4AA 4EL1A 3APSA 4GXZA 4KSMA 3QAWA 2H0GA 2YOIA 2AYTA 4KDUA 1UC7A 3FZ4A 3VWXA 5A5KA 2I9HA 1PD21 3GKKA 4K0GA 4I2TA 2R37A 4L5LA 4F0CA 3RHCA 4BWSA 2ALBA 3VK9A 3D0ZA 3KP8A 2R6KA 3A2WA 1QMVA 5HR0A 3ZFLA 5AIXA 3E3EA 4G0LA 3CTGA 2H6XA 1ZCPA 3HCZA 2KUCA 1HNBA 4XCSA 1XPVA 2JADA 4KAEA 4EIQA 3H79A 3TJBA 4GLTA 2NPBA 4QQ7A 3GH9A 2RIIA 1XXUA 3BCKA 4K2XA 1ZYNA 3CMIA 4Z7XA 2GS3A 2P5RA 4XS1A 5E59A 2X8HA 3QPMA 5B6MA 3HJPA 4NV2A 3TRXA 3GKMA 4L0WA 3H93A 2HXKA 1A2MA 5L71A 1TI3A 2H1GA 2GSSA 1SL1B 1Z7RA 5AGYA 5CRWA 3LXZA 3GYKA 2F8FA 1GL8A 2KLXA 4YQMA 4G9HA 2CX4A 13GSA 3U5RE 3FMWA 1T4YA 6GSSA 4YQUA 1EOHA 1SK2A 5CNWA 2V2GA 2V41A 1ERUA 3HJOA 1YJ6A 2CVBA 1LJRA 2IFQB 4D73B 1Z9HA 1EV9A 2GTUA 4PGTA 4GCIA 3PINA 2H0HA 1DUGA 4ZBAA 2I1UA 1K0DA 3DRNA 3LORA 2EIRA 1GSFA 4WETA 2NDOA 1X9SB 2FA4A 3GL5A 5DALA 1WOUA 3ZIVA 2L6DA 1YDKA 1GTUA 4LLRA 1GTIA 2F9SA 2HYXA 5HR1A 3GL3A 5J3RA 1TI1A 2UZ8A 3WGDA 1T1VA 2CX3A 1SK1A 1EP8A 3EMXA 3H8QA 2GQMA 3DIEA 3IBHA 2H0IA 5G1KA 2DJ3A 2VCVA 2JACA 5ELAA 1SYRA 3GX8A 2XBQA 3GFKA 2OJLA 3KJYA 4J2FA 1FVKA 2XPEA 1UA5A 4N0VA 1Q98A 2CAQA 5ECSA 1U87A 3ME7A 4N0ZA 2YN1A 1M9AA 1H4OA 3TJKA 2JZTA 1PN0A 2PN8A 4EDYA 3KXOA 2NVLA 3F6FA 2K8VA 1OC3A 1ZYEA 3IK7A 3ZREA 2FHEA 1M2AA 4K2DA 3KMNA 3TCOA 2C8UA 5G30A 3I69A 2FGXA 1X9MB 4OFTA 1BAYA 2H1AA 2ZNMA 1BEDA 2WRTA 3HYPA 22GSA 2HRFA 2MMAA 3QMXA 2HZFA 3TRQA 2MYGA 4ZBDA 5F05A 3E0UA 1TJDA 3QFAC 6GSTA 2KOKA 1QUWA 2PUKC 3DVWA 5A4VA 4TXVA 4I5QA 2FWHA 5EY6A 3C73A 3FY7A 4HEA2 4EVMA 3QAGA 4WXTA 5IMFA 2ZUPA 4BVXA 3QD9A 5IO2A 3IK9A 3TKPA 3O76A 2H76A 4Q5QA 4TN8A 4V1Ag 4DSRA 1B9YC 2QKEA 3P7XA 2IMFA 2BTOT 4ZILA 1K0MA 2C1YA 1G6YA 3F4SA 1U6TA 1A23A 4AF2A 5HR2A 4DSSB 4N11A 4G0IA 2R0CA 4V2MA 3D4TA 1FW1A 4L8EA 1EWXA 4K7NA 2VCTA 2LRNA 5ELGA 4MMMA 5J9BA 1X9WB 1PL2A 2TIRA 2GZZA 3TUEA 3RAZA 3IOSA 1ABAA 3R3EA 4OWYA 1H75A 2K8SA 1DSBA 2IMIA 1G0TA 3RBTA 4K6XA 1GNWA 3Q74A 2YWIA 2HRAA 2HT9A 3HXSA 2C0EA 5ABRA 1RW1A 3UARA 5C00A 6GSYA 1ZYQB 2AUVA 3IR4A 2D2ZA 4CW9A 1MEKA 5ECMB 4NHZA 1NW2A 5G1LA 1K3YA 1YKAA 1TRWA 2QA1A 3RDWA 1ERWA 5F07A 1XOBA 2X64A 3DYRA 2RUEA 3MIXA 4IJIA 2H1BA 2DMLA 2WGRA 4AJ6A 5DAKB 2A4HA 3BCIA 2YANA 3IAM2 2DJ2A 4BPYA 5GSSA 2OBIA 1N8JA 4QL9A 5ECRB 2CZ2A 1G7OA 1K0OA 1Z6NA 2K18A 3L9UA 4ACSA 4KGIA 2XC2A 2IIYA 1ZYPA 5DQSA 2FD3A 4L5OA 3MSZA 2K6VA 3M8NA 3KCMA 3IDVA 1GSEA 1FAAA 1M0UA 4JEDA 2DKIA 1GWCA 5JWRB 2VAFA 5IPHA 1MDIA 5CO3A 2HZEA 2OBKA 2PWJA 5KOXA 1GSDA 2PGTA 1JLWA 4KB3A 1VF3A 6GSUA 3J7Yb 5H5QA 3BOAA 4TR0A 1DE2A 5CRHA 1FB6A 5KN1A 3TOUA 3HVXA 3HD5A 2C0DA 1Z6MA 1B48A 3BBYA 3PH9A 4V2LA 4OO4A 2YWOA 4USSA 3GIXA 5D8IA 1GRXA 1FG4A 3UL3A 5EL8A 3IV4A 4LA1A 2C3TA 2GSRA 4ULXA 2H74A 4OCFA 3VI5A 1M2DA 4X4JA 1GSQA 8GSSA 2MMNA 3ERWA 4ECIA 2QSIA 2KP2A 4Z2UA 5AISA 1TK0B 4LL4B 4Z2TA 3FZ5A 2EIOA 3N9JA 2OADA 3VFIA 3GURA 3L78A 3I6AA 4K7OA 18GSA 1URMA 4EE0A 2RM5A 1K0CA 3PGTA 2H73A 2PVOC 4EUYA 1OC9B 2YV7A 1N2AA 4PUAA 3IC8A 5LNKe 4BA7A 2IFQA 5ID2A 4GTUA 2FY6A 1OE7A 3I9V2 1EEJA 4HU7A 2MMZA 4ZXGA 1V58A 2HSMA 4E8EA 4TOPA 4K0NA 3A5WA 4LL1B 3QFBC 4XS4B 4O92A 3CSIA 2K9FA 1SKSB 1M99A 1O81A 2ON7A 3KTLA 3EMPA 1KTEA 4MLYA 5JCUA 4WBJA 2IMKA 3L9VA 3WT2A 2LV3A 1TRSA 3IPZA 4MH3A 2CVKA 5ECPB 3IAS2 4MPGA 4TKYA 1AW9A 3Q6OA 2YJ7A 4IBPA 2YJHA 3GUSA 3F63A 1J0FA 5IQYA 3HY2A 4NWYA 1USBA 1EOGA 1ZMAA 2IMDA 4CDOA 3F3QA 3GV1A 5D9TA 1AC1A 1O8XA 1XWGA 3LXTA 20GSA 4HUAA 1AQXA 1U88A 2JSYA 2LSTA 3FR9A 4I2UA 2YNXA 4MABA 2VOCA 2H6YA 4BWQA 4I8BA 2R5GA 5EPFA 3EINA 1YF1A 4TXOB 4GWRA 4BL7B 2O89A 2C4JA 1PN9A 4WR4A 1B4PA 3TKSC 3EU3A 1E6BA 2LRCA 1R26A 1X0RA 4POLA 3FZ9A 3TKQA 4WEYA 3ZFBA 1A2JA 5H5RA 3LYPA 2H6ZA 1HYUA 4POBA 1ZGNA 3IE3A 2CVDA 2IMEA 2ES7A 2H01A 2YZHA 5D9WA 3W6GA 4TVEA 5LD0A 3E9JB 2C0FA 2B5YA 1AQWA 4ECCA 5HFKA 1FB0A 3KZQA 3TDGA 1F9MA 1OAZA 4EKZA 4TR1A 4WKWA 2V6KA 1A8LA 2RLIA 1QK8A 1VGLA 1I5GA 4N30A 2JZRA 2M80A 1MDKA 1T8EB 4K5RA 1CQGA 2OA7A 4ZL7A 1OKDA 1GTAA 2C3NA 4Q5FA 1EZKA 3ZLPA 2OE1A 5DVBA 2WDUA 1ML6A 1YKCA 5J5NA 2PU9C 1PX7A 3G9BA 1O7UA 2DJJA 2ZCTA 3ZTLA 4PNGA 4HZ4A 4BVYA 2GQKA 4DVCA 4ECJA 4IQAA 3J7Yk 3FZAA 5COHA 3QR6A 1NHYA 3FRCA 5HFIA 3UJ1A 1BG5A 1W89A 4PTSA 1UN2A 1IYHA 4ILFA 5J41A 5INYA 4ZBBA 1PGTA 3P8WA 2L4QA 2H8LA 3KM6A 2B5EA 2M72A 5J9CA 2A2PA 5FT3A 5GZZB 3KP9A 4XHMA 5IMVA 1R4WA 3F4RA 3H1NA 4MF5A 4HQSA 3NIVA 2YV9A 5IMDA 4ML1A 1SKRB 1U3AA 3G7JA 3MDKA 2HI7A 2AHEA 2HSYA 3LEFA 4WF5A 1AXDA 1XIYA 1J9BA 2C0GA 2DJKA 4JZQA 2VCXA 2LQOA 1PQNA 1WPIA 1JZWA 2VCZA 3HHVA 1BX9A 5F06A 1F2EA 3H4KA 3KEBA 4GSTA 2GGTA 1JZOA 3EURA 5JCGA 3EWLA 3GTUB 3W8SA 3A3TA 5KN0A 2X4AA 4F2IA 4MK3A 2FCHA 5A4WA 3APQA 4Q5NA 4IELA 2WS2A 3LJRA 4L0UA 2A4VA 2F8AA 4IKHA 4FYUA 1RQMA 1JHBA 1GSSA 3TB2A 2O85A 1GLQA 4IJ3A 1R7HA 1SD8A 3FYGA 3L9SA 4HQZA 1SENA 1T00A 3IHQA 1B8XA 3N5OA 2L57A 2H70A 3KIJA 4PUFC 3GNJA 2P0GA 5B6NA 3ZZXA 1XVQA 1THXA 4KDYA 1XCCA 3KD0A 5IIZA 3VURA 3F6DA 5ECOB 4KH7A 3D5JA 4YKFA 5KN2A 4ID0A 5C04A 1FVJA 1LU4A 2LJAA 1TP9A 1WRYA 1PSQA 4OFNA 3BJ5A 2LQQA 1SD9A 3LFLA 3TKSE 2HRNA 2OE0A 4H86A 1GSUA 4OFMA 2WULA 4PQ1A 1XW5A 2XBIA 1PKZA 2IWTA 4Z2RA 4LMVA 4EXJA 3FEUA 1WP0A 4GSNA 4G2EA 4MZWA 2GSTA 4AGSA 1HQOA 1BJXA 4MF6A 1J08A 4QL7A 5KEJA 4F9ZA 4V1Ap 2GZPA 4YKGA 2JL4A 1Q4JA 5DBQA 2DIZA 3VPTA 2DJ0A 3F9UA 5IMCA 2VCQA 4X0XA 1OE8A 19GSA 2C80A 4NAXA 1TU8A 1S3DA 2VD0A 2PBJA 3KH9A 2J23A 2LUSA 2MZCA 3LW9A 2WZ9A 1SJZA 3MAKA 2QGVA 2XHFA 1SKWB 2B1LA 1TRVA 5DALB 1XWAA 3FR3A 3HZ4A 1ZZYA 1I9DA 4AJ7A 2LNSA 4G0KA 1XBSA 4O7HA 2LJRA 1GSYA 2B7KA 3HJMA 4CY8A 3TJFA 3DMLA 2FWGA 5CAXA 2V1MA 1F3BA 3HDCA 4MPFA 3U6VA 1ZL9A 2GT5A 12GSA 2H19A 4FYBA 4IS0A 1QFNA 2HSHA 5HFGA 1RK4A 3KGKA 4NXIA 5ECLB 1PKWA 2CT6A 3D22A 1MD4A 3CTFA 5IMZA 5B7CA 5ECKB 3ZVJA 3LSZA 3GKNA 2DLXA 4XRDA 3M0FA 3GX0A 1PL1A 3RPNA 4HS1A 5D96A 1O73A 3KTBA 5G31A 1F3AA 2TRCP 4I6XA 5DJMA 2L4CA 1W4VA 1EP7A 4DSQA 4NHWA 2CA8A 1Z5YE 3CSHA 3CYNA 1MTCA 2GDRA 5FHIA 4K7IA 4TR3A 3IXRA 1E2YA 1GUHA 2O87A 1WIKA 3TKSA 2GLRA 2NBSA 3VI7A 17GSA 3EVIA 3M9JA 1JFUA 3PR8A 2GQLA 2VCWA 4BVXB 1VF2A 3ERGA 1K0BA 4ZB6A 5DDLA 3UAPA 2L5LA 1TXXA 5IM9A 3UVHA 1R5AA 5J4UA 4I97A 4O5UA 4XIHA 2IPAA 3DXBA 6GSXA 2OE3A 2B3SA 2VD1A 4OO5A 4FQUA 1VF4A 4V2NA 4D73A 1WWJA 3F3RA 4GQCA 3MYDA 3WYWA 2H30A 5BMUA 3S9FA 4O32A 3PPUA 4RI7A 4MJBA 3MNGA 2QC7A 2H1DA 1GNEA 3NZNA 2LRTA 2GSQA 1TTZA 10GSA 4KSOA 2LEGA 3ZRDA 5GAND 4G19A 4FIWA 3DGQA 2WFCA 2DKHA 2WJUA 2J9HA 3RHBA 2JU5A 3GHAA 3FHKA 1OC8A 2M46A 4MA9A 1WJKA 1KBNA 3A5IA 1Z7PA 5JCWA 2REMA 4JRRA 1XVWA 3QOUA 5F0GA 1SYXA 1ZOFA 4RUVA 5JWOB 2JZSA 5EVOA 3SBCA 2E7PA 3UBKA 3KH7A 3DWVA 2DBCA 3ZMLA 1A8YA 3ZYWA 4NV5A 2AB6A 4E8HA 4POKA 3FKFA 4HI7A 2V32A 5DCHA 3ZVJD 1G6WA 1HD2A 3IC4A 3EPTA 4IP6A 3LGCA 4HU9A 1BQ7A 5CRGA 4JE1A 4CY6A 2QA2A 4KDXA 4XRAA 3RPPA 2R0GA 1YF0A 3DKSA 4MZCA 3GSSA 1A0FA 4RQRA 2HZEB 2X8GA 2R4VA 3P2AA 4O5RA 2HFDA 5DCGA 3EC3A 1NSWA 2N5FA 2YWNA 4IN0A 2JSZA 3BD2A 1SJIA 1MD3A 2DC5A 2GVPA 4KW6A 4X43A 1O8WA 2LKUA 1EGOA 4RI6A 3GH6A 5GSTA 3I43A 3VWVA 3LYKA 3HZ8A 3GN3A 1EV4A 2HLSA 4MJAA 1QGVA 3GKXA 1V40A 2I3YA 1B9XC 5D93A 3ZITA 2LS5A 2AV4A 3ZIJA 11GSA 3FW2A 4OD7A 1C72A 2PERA 5AIVA 1XZOA 1XFLA 5IMAA 6GSWA 3LG6A 5H5SA 2VIMA 4DSSA 2X99A 3L0HA 1SK0A 1TW9A 1XWBA 2DMMA 1K0NA 2YCDA 3EU4A 3HA9A 3ERFA 1JZDA 3D6IA 1MDJA 4ICYA 2BJXA 4GQFA 4F82A 2EIQA 2IN3A 4F0BA 2MBTA 1TOFA 5E4WA 5HR3A 2B1KA 4NMUA 2DIYA 1TRUA 1XW9A 3GA4A 2CZ3A 4HZ2A 2I81A 2LNTA 2G0FA 1YEPA 4G10A 1GTBA 3UVTA 2HRKA 4EDZA 5GAPD 2FA8A 3AY8A 3ISOA 1IYIA 2YP6A 4ZL8A 5ID2B 2B7JA 3O3TA 4WR5A 2CQ9A 1GLPA 2O8VB 1X5DA 4IW9A 1PRXA 2N5AA 3CSJA 3C71A 4HOJA 1YEXA 2VLUA 4TRXA 1DE1A 4AJ8A 5HQPA 1A24A 1AUCA 5CRDA 2CAIA 2FWFA 1ERTA 2FWEA 3WT1A 2VL2C 5DAKA 2VL3A 5ECQB 5KOWA 1VF1A 2IJYA 4ISDA 4JR6A 3D4MA 4RQXA 5DQYA 4ZL9A 2EC4A 4PXOA 3WD6A 1WMJA 3IHGA 2F3MA 2IL3A 4FH8A 2C3QA 1F6MC 2VO4A 4K8MA 3TRPA 3F4TA 4EC0A 1YQ1A 4KCEA 4HDEA 1B4QA 1UVZA 2AJQB 5B8BA 4A5PA 4ECBA 4TW5A 2GT6A 1OVNA 2RUFA 3WGXA 2OKAA 3A2VA 5IPGA 2PVQA 3C8EA 3IA1A 2E2MA 1T7PB 5ECIB 2B5XA 4NPBA 4TR4A 3M9KA 3APOA 3UOMA 2A2RA 1NM3A 3DD3A 1V98A 1Z3EA 5G5FA 4EF0A 5IOWA 2L5OA 3K8NA 3FK8A 1AIUA 1AQVA 3ZMKA 2VUPA 3F8UA 4F03A 1HNCA 4PNFA 1NHOA 2RM6A 3EE2A 2FLSA 1K0AA 2AAWA 2E2GA 2LJKA 2GZYA 14GSA 1FO5A 1QQ2A 2H72A 1GH2A 1AAZA 3ZL5A 4TR1B 1A2LA 2HNLA 2N5BA 1OC9A 2MMOA 1DBYA 1YZXA 3L4NA 4PQHA 4ZIJA 5B8AA 4FYCA 1FOVA 3JCML 4GSSA 3VWUA 4EO3A 5D9VA 5ECHB 3F0IA 3UIWA 1ST9A 1F37A 3MWHA 5G2ZA 5CREA 1OYJA 2FUG2 4POMA 3TJJA 4EIPA 4XS4A 9GSSA 3C1RA 1PX6A 2L59A 3VLNA 3TJGA 4WF4A 3QDNA 3A2XA 4KA0A 5F8BA 1GUMA 4GF0A 4BVYB 2KP1A 3KMOA 4KF9A 2WB9A 3G7YA 1KNGA 2DSAA 4ZB9A 4K1FA 1YY7A 1SU9A 2PPTA 4MH2A 5BRTA 3R2QA 3VPQA 3TOTA 1G7EA 1OKTA 4WBRD 2E0QA 2YWMA 3UBLA 3FR6A 3LWAA 2MBSA 1ERVA 1O85A 1SJ6A 2Z9SA 4ML6A 1Y6EA 2P5QA 1ON4A 1KEBA 4KE3A 2HE3A 4JBBA 1M9BA 4MP4A 2F51A 2X49A 3CXGA 3EYTA 4FO5A 4YQVA 1GUKA 2H71A 1T4ZA 1R5PA 3C7MA 3D21A 1PMTA 4YH2A 1XWCA 4IQ1A 4OMVA 4PQIA 2VLTA 3TKRA 2X8CA 4J56E 1ACVA 1HNAA 1TKDB 1EEMA 3SWLA 1FHEA 5G5EA 1JZRA 4YAPA 1ILOA 3O6TA 1S3CA 2O7KA 2YPMA 3Q19A 4TXOA 1WE0A 3ME8A 16GSA 4BL7A 3G7IA 2PMTA 5D9XA 4KX4A 3HKRA 5LCZA 2OACA 5CYYA 1X5EA 3GSTA 4MZBA 4X1UA 4PURA 4HJMA 2VM1A 4KNDA 3DEXA 2V6OA 3DVXA 3ED3A 1LBKA 2NTOA 1FOHA 4KCAA 3VWWA 2R2JA 4MJEA 4PX1A 1V2AA 3M3MA 3LQ7A 1V57A 4HJ2A 2ON5A 3GRXA 1M7TA 4XTSA 4Q5RA 6GSVA 3C1SA 5CP1A 4IP1A 3CRTA 4P3YB 3P90A 5ECNB 1EGRA 4IHUA 4OCEA 1THOA 4JR4A 1SL2B 4IVFA 4DEJA 1T3BA 1A0RP 5ENUA 4MDCA 3TGZA 2B6MA 1Y25A 3V1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OR5 A;  2BMX A;  4MF7 A;  2G2Q A;  2XPD A;  2FNO A;  4GRF A;  3W8J A;  5JWQ B;  3HVS A;  2VM2 A;  3HVV A;  4JU5 A;  1TK5 B;  5KN3 A;  1CQH A;  1JLV A;  1SL0 B;  2KHP A;  3UMA A;  1TK8 B;  2VLV A;  4IGJ A;  1K3L A;  1VRS D;  2TRX A;  4ZB8 A;  4YAV A;  2H75 A;  4MCU A;  1XOA A;  1TU7 A;  2CV4 A;  3IRA A;  1S3A A;  1GUL A;  1BYE A;  4KUN A;  4MJC A;  5FWG A;  7GSS A;  2H66 A;  5IO0 A;  1O6J A;  2L6C A;  2LTK A;  2WCI A;  5D73 A;  2VL9 A;  3UEM A;  4K9Z A;  2A2S A;  2R3X A;  3WGE A;  1X5C A;  5DJL A;  3M1G A;  1XW6 A;  1V9W A;  2DJ1 A;  1TDI A;  3QCP A;  3QAV A;  4LMW A;  3CRU A;  3Q18 A;  4CHS A;  1XWK A;  4J57 E;  1K3O A;  3CBU A;  4N10 A;  1QXH A;  3US3 A;  1U3I A;  3GTU A;  2VL2 A;  5A4U A;  1PA3 A;  1M2B A;  3NOF A;  4XS6 A;  5IOX A;  1GP1 A;  2YZU A;  2P31 A;  5AN1 A;  3GMF A;  2I4A A;  4EL1 A;  3APS A;  4GXZ A;  4KSM A;  3QAW A;  2H0G A;  2YOI A;  2AYT A;  4KDU A;  1UC7 A;  3FZ4 A;  3VWX A;  5A5K A;  2I9H A;  1PD2 1;  3GKK A;  4K0G A;  4I2T A;  2R37 A;  4L5L A;  4F0C A;  3RHC A;  4BWS A;  2ALB A;  3VK9 A;  3D0Z A;  3KP8 A;  2R6K A;  3A2W A;  1QMV A;  5HR0 A;  3ZFL A;  5AIX A;  3E3E A;  3CTG A;  2H6X A;  1ZCP A;  3HCZ A;  2KUC A;  1HNB A;  4XCS A;  1XPV A;  2JAD A;  4KAE A;  3H79 A;  3TJB A;  4GLT A;  2NPB A;  4QQ7 A;  3GH9 A;  2RII A;  1XXU A;  3BCK A;  3CMI A;  4Z7X A;  2GS3 A;  2P5R A;  4XS1 A;  5E59 A;  2X8H A;  3QPM A;  5B6M A;  3HJP A;  4NV2 A;  3TRX A;  3GKM A;  4L0W A;  3H93 A;  2HXK A;  1A2M A;  5L71 A;  1TI3 A;  2H1G A;  2GSS A;  1SL1 B;  1Z7R A;  5AGY A;  5CRW A;  3LXZ A;  3GYK A;  2F8F A;  1GL8 A;  2KLX A;  4YQM A;  4G9H A;  2CX4 A;  13GS A;  3U5R E;  1T4Y A;  6GSS A;  4YQU A;  1EOH A;  1SK2 A;  5CNW A;  2V2G A;  2V41 A;  1ERU A;  3HJO A;  1YJ6 A;  2CVB A;  1LJR A;  2IFQ B;  4D73 B;  1Z9H A;  1EV9 A;  2GTU A;  4PGT A;  4GCI A;  3PIN A;  2H0H A;  1DUG A;  4ZBA A;  2I1U A;  1K0D A;  3DRN A;  3LOR A;  2EIR A;  1GSF A;  4WET A;  2NDO A;  1X9S B;  2FA4 A;  3GL5 A;  5DAL A;  1WOU A;  3ZIV A;  2L6D A;  1YDK A;  1GTU A;  4LLR A;  1GTI A;  2F9S A;  2HYX A;  5HR1 A;  3GL3 A;  5J3R A;  1TI1 A;  3WGD A;  1T1V A;  2CX3 A;  1SK1 A;  1EP8 A;  3EMX A;  3H8Q A;  2GQM A;  3DIE A;  3IBH A;  2H0I A;  5G1K A;  2DJ3 A;  2VCV A;  2JAC A;  5ELA A;  1SYR A;  3GX8 A;  2XBQ A;  3GFK A;  2OJL A;  3KJY A;  4J2F A;  1FVK A;  2XPE A;  1UA5 A;  4N0V A;  1Q98 A;  2CAQ A;  5ECS A;  1U87 A;  3ME7 A;  4N0Z A;  2YN1 A;  1M9A A;  1H4O A;  3TJK A;  2JZT A;  2PN8 A;  4EDY A;  3KXO A;  2NVL A;  3F6F A;  2K8V A;  1OC3 A;  1ZYE A;  3IK7 A;  3ZRE A;  2FHE A;  1M2A A;  4K2D A;  3KMN A;  3TCO A;  2C8U A;  5G30 A;  3I69 A;  2FGX A;  1X9M B;  4OFT A;  1BAY A;  2H1A A;  2ZNM A;  1BED A;  2WRT A;  3HYP A;  22GS A;  2HRF A;  2MMA A;  3QMX A;  2HZF A;  3TRQ A;  2MYG A;  4ZBD A;  5F05 A;  3E0U A;  1TJD A;  3QFA C;  6GST A;  2KOK A;  1QUW A;  2PUK C;  3DVW A;  5A4V A;  4TXV A;  4I5Q A;  2FWH A;  5EY6 A;  3C73 A;  3FY7 A;  4HEA 2;  4EVM A;  3QAG A;  4WXT A;  5IMF A;  2ZUP A;  4BVX A;  3QD9 A;  5IO2 A;  3IK9 A;  3TKP A;  3O76 A;  2H76 A;  4Q5Q A;  4TN8 A;  4V1A g;  4DSR A;  1B9Y C;  2QKE A;  3P7X A;  2IMF A;  2BTO T;  4ZIL A;  1K0M A;  2C1Y A;  1G6Y A;  3F4S A;  1U6T A;  1A23 A;  4AF2 A;  5HR2 A;  4DSS B;  4N11 A;  4V2M A;  3D4T A;  1FW1 A;  4L8E A;  1EWX A;  4K7N A;  2VCT A;  2LRN A;  5ELG A;  4MMM A;  5J9B A;  1X9W B;  1PL2 A;  2TIR A;  2GZZ A;  3TUE A;  3RAZ A;  3IOS A;  1ABA A;  4OWY A;  1H75 A;  2K8S A;  1DSB A;  2IMI A;  1G0T A;  3RBT A;  4K6X A;  1GNW A;  3Q74 A;  2YWI A;  2HT9 A;  3HXS A;  2C0E A;  5ABR A;  1RW1 A;  3UAR A;  5C00 A;  6GSY A;  1ZYQ B;  2AUV A;  3IR4 A;  2D2Z A;  4CW9 A;  1MEK A;  5ECM B;  4NHZ A;  1NW2 A;  5G1L A;  1K3Y A;  1YKA A;  1TRW A;  3RDW A;  1ERW A;  5F07 A;  1XOB A;  2X64 A;  3DYR A;  2RUE A;  4IJI A;  2H1B A;  2DML A;  2WGR A;  4AJ6 A;  5DAK B;  3BCI A;  2YAN A;  3IAM 2;  2DJ2 A;  4BPY A;  5GSS A;  2OBI A;  1N8J A;  4QL9 A;  5ECR B;  2CZ2 A;  1G7O A;  1K0O A;  1Z6N A;  2K18 A;  3L9U A;  4ACS A;  4KGI A;  2XC2 A;  2IIY A;  5DQS A;  2FD3 A;  4L5O A;  3MSZ A;  2K6V A;  3M8N A;  3KCM A;  3IDV A;  1GSE A;  1FAA A;  1M0U A;  4JED A;  1GWC A;  5JWR B;  2VAF A;  5IPH A;  1MDI A;  5CO3 A;  2HZE A;  2OBK A;  2PWJ A;  1GSD A;  2PGT A;  1JLW A;  4KB3 A;  1VF3 A;  6GSU A;  3J7Y b;  5H5Q A;  3BOA A;  4TR0 A;  1DE2 A;  5CRH A;  1FB6 A;  5KN1 A;  3TOU A;  3HVX A;  3HD5 A;  2C0D A;  1Z6M A;  1B48 A;  3BBY A;  3PH9 A;  4V2L A;  4OO4 A;  2YWO A;  3GIX A;  5D8I A;  1GRX A;  1FG4 A;  3UL3 A;  5EL8 A;  3IV4 A;  4LA1 A;  2C3T A;  2GSR A;  4ULX A;  2H74 A;  4OCF A;  3VI5 A;  1M2D A;  1GSQ A;  8GSS A;  2MMN A;  3ERW A;  4ECI A;  2QSI A;  2KP2 A;  5AIS A;  1TK0 B;  4LL4 B;  3FZ5 A;  2EIO A;  3N9J A;  2OAD A;  3VFI A;  3GUR A;  3L78 A;  3I6A A;  4K7O A;  18GS A;  1URM A;  4EE0 A;  2RM5 A;  1K0C A;  3PGT A;  2H73 A;  2PVO C;  4EUY A;  1OC9 B;  2YV7 A;  1N2A A;  4PUA A;  5LNK e;  4BA7 A;  2IFQ A;  5ID2 A;  4GTU A;  2FY6 A;  1OE7 A;  3I9V 2;  1EEJ A;  4HU7 A;  2MMZ A;  4ZXG A;  1V58 A;  4E8E A;  4TOP A;  4K0N A;  3A5W A;  4LL1 B;  3QFB C;  4XS4 B;  4O92 A;  3CSI A;  2K9F A;  1SKS B;  1M99 A;  1O81 A;  2ON7 A;  3KTL A;  3EMP A;  1KTE A;  4MLY A;  5JCU A;  4WBJ A;  2IMK A;  3L9V A;  3WT2 A;  2LV3 A;  1TRS A;  3IPZ A;  4MH3 A;  2CVK A;  5ECP B;  3IAS 2;  4MPG A;  4TKY A;  1AW9 A;  3Q6O A;  2YJ7 A;  4IBP A;  2YJH A;  3GUS A;  3F63 A;  1J0F A;  5IQY A;  3HY2 A;  4NWY A;  1USB A;  1EOG A;  1ZMA A;  2IMD A;  4CDO A;  3F3Q A;  3GV1 A;  5D9T A;  1AC1 A;  1O8X A;  1XWG A;  3LXT A;  20GS A;  4HUA A;  1AQX A;  1U88 A;  2JSY A;  2LST A;  3FR9 A;  4I2U A;  2YNX A;  4MAB A;  2VOC A;  2H6Y A;  4BWQ A;  4I8B A;  2R5G A;  5EPF A;  3EIN A;  1YF1 A;  4TXO B;  4GWR A;  2O89 A;  2C4J A;  1PN9 A;  4WR4 A;  1B4P A;  3TKS C;  3EU3 A;  1E6B A;  2LRC A;  1R26 A;  1X0R A;  4POL A;  3FZ9 A;  3TKQ A;  4WEY A;  3ZFB A;  1A2J A;  5H5R A;  3LYP A;  2H6Z A;  1HYU A;  4POB A;  1ZGN A;  3IE3 A;  2CVD A;  2IME A;  2ES7 A;  2H01 A;  2YZH A;  5D9W A;  3W6G A;  4TVE A;  5LD0 A;  3E9J B;  2C0F A;  2B5Y A;  1AQW A;  4ECC A;  5HFK A;  1FB0 A;  3KZQ A;  3TDG A;  1F9M A;  1OAZ A;  4EKZ A;  4TR1 A;  4WKW A;  2V6K A;  1A8L A;  2RLI A;  1QK8 A;  1VGL A;  1I5G A;  4N30 A;  2JZR A;  2M80 A;  1MDK A;  1T8E B;  1CQG A;  2OA7 A;  4ZL7 A;  1OKD A;  1GTA A;  2C3N A;  4Q5F A;  1EZK A;  3ZLP A;  2OE1 A;  5DVB A;  2WDU A;  1ML6 A;  1YKC A;  5J5N A;  2PU9 C;  1PX7 A;  3G9B A;  1O7U A;  2DJJ A;  2ZCT A;  3ZTL A;  4PNG A;  4HZ4 A;  4BVY A;  2GQK A;  4DVC A;  4ECJ A;  4IQA A;  3J7Y k;  3FZA A;  5COH A;  3QR6 A;  1NHY A;  3FRC A;  5HFI A;  3UJ1 A;  1BG5 A;  1W89 A;  1UN2 A;  1IYH A;  4ILF A;  5J41 A;  5INY A;  4ZBB A;  1PGT A;  3P8W A;  2L4Q A;  2H8L A;  3KM6 A;  2B5E A;  2M72 A;  5J9C A;  5FT3 A;  5GZZ B;  3KP9 A;  4XHM A;  5IMV A;  1R4W A;  3F4R A;  3H1N A;  4MF5 A;  4HQS A;  3NIV A;  2YV9 A;  5IMD A;  4ML1 A;  1SKR B;  1U3A A;  3G7J A;  3MDK A;  2HI7 A;  2AHE A;  2HSY A;  3LEF A;  4WF5 A;  1AXD A;  1XIY A;  1J9B A;  2C0G A;  2DJK A;  4JZQ A;  2VCX A;  2LQO A;  1PQN A;  1WPI A;  1JZW A;  2VCZ A;  3HHV A;  1BX9 A;  5F06 A;  1F2E A;  3H4K A;  3KEB A;  4GST A;  2GGT A;  1JZO A;  3EUR A;  5JCG A;  3EWL A;  3GTU B;  3W8S A;  3A3T A;  5KN0 A;  4F2I A;  4MK3 A;  2FCH A;  5A4W A;  3APQ A;  4Q5N A;  4IEL A;  2WS2 A;  3LJR A;  4L0U A;  2A4V A;  2F8A A;  4IKH A;  4FYU A;  1RQM A;  1JHB A;  1GSS A;  3TB2 A;  2O85 A;  1GLQ A;  4IJ3 A;  1R7H A;  1SD8 A;  3FYG A;  3L9S A;  4HQZ A;  1SEN A;  1T00 A;  3IHQ A;  1B8X A;  3N5O A;  2L57 A;  2H70 A;  3KIJ A;  4PUF C;  3GNJ A;  2P0G A;  5B6N A;  3ZZX A;  1XVQ A;  1THX A;  4KDY A;  1XCC A;  3KD0 A;  5IIZ A;  3VUR A;  3F6D A;  5ECO B;  4KH7 A;  3D5J A;  5KN2 A;  4ID0 A;  5C04 A;  1FVJ A;  1LU4 A;  2LJA A;  1TP9 A;  1WRY A;  1PSQ A;  4OFN A;  3BJ5 A;  2LQQ A;  1SD9 A;  3LFL A;  3TKS E;  2HRN A;  2OE0 A;  4H86 A;  1GSU A;  4OFM A;  2WUL A;  4PQ1 A;  1XW5 A;  2XBI A;  1PKZ A;  2IWT A;  4LMV A;  4EXJ A;  3FEU A;  1WP0 A;  4GSN A;  4G2E A;  4MZW A;  2GST A;  4AGS A;  1HQO A;  1BJX A;  4MF6 A;  1J08 A;  4QL7 A;  5KEJ A;  4F9Z A;  4V1A p;  2GZP A;  2JL4 A;  1Q4J A;  5DBQ A;  2DIZ A;  3VPT A;  2DJ0 A;  3F9U A;  5IMC A;  2VCQ A;  4X0X A;  1OE8 A;  19GS A;  2C80 A;  4NAX A;  1TU8 A;  1S3D A;  2VD0 A;  2PBJ A;  3KH9 A;  2J23 A;  2LUS A;  2MZC A;  2WZ9 A;  1SJZ A;  3MAK A;  2QGV A;  2XHF A;  1SKW B;  2B1L A;  1TRV A;  5DAL B;  1XWA A;  3FR3 A;  3HZ4 A;  1ZZY A;  1I9D A;  4AJ7 A;  2LNS A;  1XBS A;  4O7H A;  2LJR A;  1GSY A;  2B7K A;  3HJM A;  3TJF A;  3DML A;  2FWG A;  5CAX A;  2V1M A;  1F3B A;  3HDC A;  4MPF A;  3U6V A;  1ZL9 A;  2GT5 A;  12GS A;  2H19 A;  4FYB A;  4IS0 A;  1QFN A;  2HSH A;  5HFG A;  1RK4 A;  3KGK A;  4NXI A;  5ECL B;  1PKW A;  2CT6 A;  3D22 A;  1MD4 A;  3CTF A;  5IMZ A;  5B7C A;  5ECK B;  3ZVJ A;  3LSZ A;  3GKN A;  2DLX A;  4XRD A;  3M0F A;  3GX0 A;  1PL1 A;  3RPN A;  4HS1 A;  5D96 A;  1O73 A;  3KTB A;  5G31 A;  1F3A A;  2TRC P;  4I6X A;  5DJM A;  2L4C A;  1W4V A;  1EP7 A;  4DSQ A;  4NHW A;  2CA8 A;  1Z5Y E;  3CSH A;  3CYN A;  1MTC A;  2GDR A;  5FHI A;  4K7I A;  4TR3 A;  3IXR A;  1E2Y A;  1GUH A;  2O87 A;  1WIK A;  3TKS A;  2GLR A;  2NBS A;  3VI7 A;  17GS A;  3EVI A;  3M9J A;  1JFU A;  3PR8 A;  2GQL A;  2VCW A;  1VF2 A;  3ERG A;  1K0B A;  4ZB6 A;  5DDL A;  3UAP A;  2L5L A;  1TXX A;  5IM9 A;  3UVH A;  1R5A A;  5J4U A;  4I97 A;  4XIH A;  2IPA A;  3DXB A;  6GSX A;  2OE3 A;  2B3S A;  2VD1 A;  4OO5 A;  1VF4 A;  4V2N A;  4D73 A;  1WWJ A;  3F3R A;  4GQC A;  3WYW A;  2H30 A;  3S9F A;  4O32 A;  4RI7 A;  4MJB A;  3MNG A;  2QC7 A;  2H1D A;  1GNE A;  3NZN A;  2LRT A;  2GSQ A;  1TTZ A;  10GS A;  4KSO A;  2LEG A;  3ZRD A;  5GAN D;  4G19 A;  4FIW A;  3DGQ A;  2WFC A;  2WJU A;  2J9H A;  3RHB A;  2JU5 A;  3GHA A;  3FHK A;  1OC8 A;  2M46 A;  4MA9 A;  1WJK A;  1KBN A;  1Z7P A;  5JCW A;  2REM A;  4JRR A;  1XVW A;  5F0G A;  3QOU A;  1SYX A;  1ZOF A;  4RUV A;  5JWO B;  2JZS A;  5EVO A;  3SBC A;  2E7P A;  3UBK A;  3KH7 A;  3DWV A;  2DBC A;  3ZML A;  1A8Y A;  3ZYW A;  4NV5 A;  2AB6 A;  4E8H A;  4POK A;  3FKF A;  4HI7 A;  2V32 A;  5DCH A;  3ZVJ D;  1G6W A;  1HD2 A;  3IC4 A;  4IP6 A;  3LGC A;  4HU9 A;  1BQ7 A;  5CRG A;  4JE1 A;  4KDX A;  4XRA A;  3RPP A;  1YF0 A;  3DKS A;  4MZC A;  3GSS A;  1A0F A;  4RQR A;  2HZE B;  2X8G A;  2R4V A;  3P2A A;  4O5R A;  2HFD A;  5DCG A;  3EC3 A;  1NSW A;  2N5F A;  2YWN A;  4IN0 A;  2JSZ A;  3BD2 A;  1SJI A;  1MD3 A;  2DC5 A;  2GVP A;  4KW6 A;  4X43 A;  1O8W A;  2LKU A;  1EGO A;  4RI6 A;  3GH6 A;  5GST A;  3I43 A;  3VWV A;  3LYK A;  3HZ8 A;  3GN3 A;  1EV4 A;  2HLS A;  4MJA A;  1QGV A;  3GKX A;  1V40 A;  2I3Y A;  1B9X C;  5D93 A;  3ZIT A;  2LS5 A;  2AV4 A;  3ZIJ A;  11GS A;  3FW2 A;  4OD7 A;  1C72 A;  2PER A;  5AIV A;  1XZO A;  1XFL A;  5IMA A;  6GSW A;  3LG6 A;  5H5S A;  2VIM A;  4DSS A;  2X99 A;  3L0H A;  1SK0 A;  1TW9 A;  1XWB A;  2DMM A;  1K0N A;  2YCD A;  3EU4 A;  3HA9 A;  3ERF A;  1JZD A;  3D6I A;  1MDJ A;  2BJX A;  4GQF A;  4F82 A;  2EIQ A;  2IN3 A;  4F0B A;  2MBT A;  1TOF A;  5E4W A;  5HR3 A;  2B1K A;  4NMU A;  2DIY A;  1TRU A;  1XW9 A;  3GA4 A;  2CZ3 A;  4HZ2 A;  2I81 A;  2LNT A;  2G0F A;  1YEP A;  4G10 A;  1GTB A;  3UVT A;  4EDZ A;  5GAP D;  2FA8 A;  3AY8 A;  3ISO A;  1IYI A;  2YP6 A;  4ZL8 A;  5ID2 B;  2B7J A;  3O3T A;  4WR5 A;  2CQ9 A;  1GLP A;  2O8V B;  1X5D A;  4IW9 A;  1PRX A;  2N5A A;  3CSJ A;  3C71 A;  4HOJ A;  1YEX A;  2VLU A;  4TRX A;  1DE1 A;  4AJ8 A;  5HQP A;  1A24 A;  1AUC A;  5CRD A;  2CAI A;  2FWF A;  1ERT A;  2FWE A;  3WT1 A;  2VL2 C;  5DAK A;  2VL3 A;  5ECQ B;  1VF1 A;  2IJY A;  4ISD A;  4JR6 A;  3D4M A;  4RQX A;  5DQY A;  4ZL9 A;  2EC4 A;  4PXO A;  3WD6 A;  1WMJ A;  2F3M A;  2IL3 A;  4FH8 A;  2C3Q A;  1F6M C;  2VO4 A;  4K8M A;  3TRP A;  3F4T A;  4EC0 A;  1YQ1 A;  4KCE A;  4HDE A;  1B4Q A;  1UVZ A;  2AJQ B;  5B8B A;  4ECB A;  4TW5 A;  2GT6 A;  1OVN A;  2RUF A;  3WGX A;  2OKA A;  3A2V A;  5IPG A;  2PVQ A;  3C8E A;  3IA1 A;  2E2M A;  1T7P B;  5ECI B;  2B5X A;  4NPB A;  4TR4 A;  3M9K A;  3APO A;  3UOM A;  2A2R A;  1NM3 A;  3DD3 A;  1V98 A;  1Z3E A;  5G5F A;  4EF0 A;  5IOW A;  2L5O A;  3K8N A;  3FK8 A;  1AIU A;  1AQV A;  3ZMK A;  2VUP A;  3F8U A;  4F03 A;  1HNC A;  4PNF A;  1NHO A;  2RM6 A;  3EE2 A;  2FLS A;  1K0A A;  2AAW A;  2E2G A;  2LJK A;  2GZY A;  14GS A;  1FO5 A;  1QQ2 A;  2H72 A;  1GH2 A;  1AAZ A;  3ZL5 A;  4TR1 B;  1A2L A;  2HNL A;  2N5B A;  1OC9 A;  2MMO A;  1DBY A;  1YZX A;  3L4N A;  4PQH A;  4ZIJ A;  5B8A A;  4FYC A;  1FOV A;  3JCM L;  4GSS A;  3VWU A;  4EO3 A;  5D9V A;  5ECH B;  3F0I A;  3UIW A;  1ST9 A;  1F37 A;  3MWH A;  5G2Z A;  5CRE A;  1OYJ A;  2FUG 2;  4POM A;  3TJJ A;  4XS4 A;  9GSS A;  3C1R A;  1PX6 A;  2L59 A;  3VLN A;  3TJG A;  4WF4 A;  3QDN A;  3A2X A;  4KA0 A;  5F8B A;  1GUM A;  4GF0 A;  2KP1 A;  3KMO A;  2WB9 A;  3G7Y A;  1KNG A;  2DSA A;  4ZB9 A;  4K1F A;  1YY7 A;  1SU9 A;  2PPT A;  4MH2 A;  3R2Q A;  3VPQ A;  3TOT A;  1G7E A;  1OKT A;  4WBR D;  2E0Q A;  2YWM A;  3UBL A;  3FR6 A;  3LWA A;  2MBS A;  1ERV A;  1O85 A;  1SJ6 A;  2Z9S A;  4ML6 A;  1Y6E A;  2P5Q A;  1ON4 A;  1KEB A;  4KE3 A;  2HE3 A;  4JBB A;  1M9B A;  4MP4 A;  2F51 A;  3CXG A;  3EYT A;  4FO5 A;  4YQV A;  1GUK A;  2H71 A;  1T4Z A;  1R5P A;  3C7M A;  3D21 A;  1PMT A;  4YH2 A;  1XWC A;  4IQ1 A;  4OMV A;  4PQI A;  2VLT A;  3TKR A;  2X8C A;  4J56 E;  1ACV A;  1HNA A;  1TKD B;  1EEM A;  3SWL A;  1FHE A;  5G5E A;  1JZR A;  4YAP A;  1ILO A;  3O6T A;  1S3C A;  2O7K A;  2YPM A;  3Q19 A;  4TXO A;  1WE0 A;  3ME8 A;  16GS A;  4BL7 A;  3G7I A;  2PMT A;  5D9X A;  4KX4 A;  3HKR A;  5LCZ A;  2OAC A;  5CYY A;  1X5E A;  3GST A;  4MZB A;  4X1U A;  4PUR A;  4HJM A;  2VM1 A;  4KND A;  3DEX A;  2V6O A;  3DVX A;  3ED3 A;  1LBK A;  2NTO A;  4KCA A;  3VWW A;  2R2J A;  4MJE A;  4PX1 A;  1V2A A;  3M3M A;  3LQ7 A;  1V57 A;  4HJ2 A;  2ON5 A;  3GRX A;  1M7T A;  4XTS A;  4Q5R A;  6GSV A;  3C1S A;  5CP1 A;  4IP1 A;  3CRT A;  4P3Y B;  3P90 A;  5ECN B;  1EGR A;  4IHU A;  4OCE A;  1THO A;  4JR4 A;  1SL2 B;  4IVF A;  4DEJ A;  1T3B A;  1A0R P;  5ENU A;  4MDC A;  3TGZ A;  2B6M A;  1Y25 A;  3V1W A; 
#chains in the Genus database with same CATH topology
 3OR5 A;  2BMX A;  4MF7 A;  2G2Q A;  2XPD A;  2FNO A;  4GRF A;  3W8J A;  5JWQ B;  3HVS A;  2VM2 A;  3HVV A;  4JU5 A;  1TK5 B;  5KN3 A;  1CQH A;  1JLV A;  1SL0 B;  2KHP A;  3UMA A;  1TK8 B;  3HVN A;  2VLV A;  4IGJ A;  1K3L A;  1VRS D;  2TRX A;  4ZB8 A;  4YAV A;  2H75 A;  4MCU A;  1XOA A;  1TU7 A;  2CV4 A;  3IRA A;  1S3A A;  1GUL A;  1BYE A;  4O5Q A;  4KUN A;  4MJC A;  4K5S A;  5FWG A;  7GSS A;  2H66 A;  5IO0 A;  1O6J A;  2L6C A;  2LTK A;  2R0P A;  2WCI A;  5D73 A;  2VL9 A;  3UEM A;  4K9Z A;  2A2S A;  2R3X A;  3WGE A;  1X5C A;  5DJL A;  3M1G A;  1XW6 A;  1V9W A;  2DJ1 A;  1TDI A;  3QCP A;  3QAV A;  4LMW A;  3CRU A;  3Q18 A;  4CHS A;  1XWK A;  4J57 E;  1K3O A;  3CBU A;  4N10 A;  1QXH A;  4MNN A;  3US3 A;  1U3I A;  3GTU A;  2VL2 A;  5A4U A;  1PA3 A;  1PFO A;  1M2B A;  3NOF A;  4XS6 A;  5IOX A;  1GP1 A;  2YZU A;  2P31 A;  5AN1 A;  3GMF A;  2I4A A;  4EL1 A;  3APS A;  4GXZ A;  4KSM A;  3QAW A;  2H0G A;  2YOI A;  2AYT A;  4KDU A;  1UC7 A;  3FZ4 A;  4BIK A;  3VWX A;  5A5K A;  2I9H A;  1PD2 1;  3GKK A;  4K0G A;  4I2T A;  2R37 A;  4L5L A;  4F0C A;  3RHC A;  4BWS A;  2ALB A;  3VK9 A;  3D0Z A;  3KP8 A;  2R6K A;  3A2W A;  1QMV A;  5HR0 A;  3ZFL A;  5AIX A;  3E3E A;  4G0L A;  3CTG A;  2H6X A;  1ZCP A;  3HCZ A;  2KUC A;  1HNB A;  4XCS A;  1XPV A;  2JAD A;  4KAE A;  4EIQ A;  3H79 A;  3TJB A;  4GLT A;  2NPB A;  4QQ7 A;  3GH9 A;  2RII A;  1XXU A;  3BCK A;  4K2X A;  1ZYN A;  3CMI A;  4Z7X A;  2GS3 A;  2P5R A;  4XS1 A;  5E59 A;  2X8H A;  3QPM A;  5B6M A;  3HJP A;  4NV2 A;  3TRX A;  3GKM A;  4L0W A;  3H93 A;  2HXK A;  1A2M A;  5L71 A;  1TI3 A;  2H1G A;  2GSS A;  1SL1 B;  1Z7R A;  5AGY A;  5CRW A;  3LXZ A;  3GYK A;  2F8F A;  1GL8 A;  2KLX A;  4YQM A;  4G9H A;  2CX4 A;  13GS A;  3U5R E;  3FMW A;  1T4Y A;  6GSS A;  4YQU A;  1EOH A;  1SK2 A;  5CNW A;  2V2G A;  2V41 A;  1ERU A;  3HJO A;  1YJ6 A;  2CVB A;  1LJR A;  2IFQ B;  4D73 B;  1Z9H A;  1EV9 A;  2GTU A;  4PGT A;  4GCI A;  3PIN A;  2H0H A;  1DUG A;  4ZBA A;  2I1U A;  1K0D A;  3DRN A;  3LOR A;  2EIR A;  1GSF A;  4WET A;  2NDO A;  1X9S B;  2FA4 A;  3GL5 A;  5DAL A;  1WOU A;  3ZIV A;  2L6D A;  1YDK A;  1GTU A;  4LLR A;  1GTI A;  2F9S A;  2HYX A;  5HR1 A;  3GL3 A;  5J3R A;  1TI1 A;  2UZ8 A;  3WGD A;  1T1V A;  2CX3 A;  1SK1 A;  1EP8 A;  3EMX A;  3H8Q A;  2GQM A;  3DIE A;  3IBH A;  2H0I A;  5G1K A;  2DJ3 A;  2VCV A;  2JAC A;  5ELA A;  1SYR A;  3GX8 A;  2XBQ A;  3GFK A;  2OJL A;  3KJY A;  4J2F A;  1FVK A;  2XPE A;  1UA5 A;  4N0V A;  1Q98 A;  2CAQ A;  5ECS A;  1U87 A;  3ME7 A;  4N0Z A;  2YN1 A;  1M9A A;  1H4O A;  3TJK A;  2JZT A;  1PN0 A;  2PN8 A;  4EDY A;  3KXO A;  2NVL A;  3F6F A;  2K8V A;  1OC3 A;  1ZYE A;  3IK7 A;  3ZRE A;  2FHE A;  1M2A A;  4K2D A;  3KMN A;  3TCO A;  2C8U A;  5G30 A;  3I69 A;  2FGX A;  1X9M B;  4OFT A;  1BAY A;  2H1A A;  2ZNM A;  1BED A;  2WRT A;  3HYP A;  22GS A;  2HRF A;  2MMA A;  3QMX A;  2HZF A;  3TRQ A;  2MYG A;  4ZBD A;  5F05 A;  3E0U A;  1TJD A;  3QFA C;  6GST A;  2KOK A;  1QUW A;  2PUK C;  3DVW A;  5A4V A;  4TXV A;  4I5Q A;  2FWH A;  5EY6 A;  3C73 A;  3FY7 A;  4HEA 2;  4EVM A;  3QAG A;  4WXT A;  5IMF A;  2ZUP A;  4BVX A;  3QD9 A;  5IO2 A;  3IK9 A;  3TKP A;  3O76 A;  2H76 A;  4Q5Q A;  4TN8 A;  4V1A g;  4DSR A;  1B9Y C;  2QKE A;  3P7X A;  2IMF A;  2BTO T;  4ZIL A;  1K0M A;  2C1Y A;  1G6Y A;  3F4S A;  1U6T A;  1A23 A;  4AF2 A;  5HR2 A;  4DSS B;  4N11 A;  4G0I A;  2R0C A;  4V2M A;  3D4T A;  1FW1 A;  4L8E A;  1EWX A;  4K7N A;  2VCT A;  2LRN A;  5ELG A;  4MMM A;  5J9B A;  1X9W B;  1PL2 A;  2TIR A;  2GZZ A;  3TUE A;  3RAZ A;  3IOS A;  1ABA A;  3R3E A;  4OWY A;  1H75 A;  2K8S A;  1DSB A;  2IMI A;  1G0T A;  3RBT A;  4K6X A;  1GNW A;  3Q74 A;  2YWI A;  2HRA A;  2HT9 A;  3HXS A;  2C0E A;  5ABR A;  1RW1 A;  3UAR A;  5C00 A;  6GSY A;  1ZYQ B;  2AUV A;  3IR4 A;  2D2Z A;  4CW9 A;  1MEK A;  5ECM B;  4NHZ A;  1NW2 A;  5G1L A;  1K3Y A;  1YKA A;  1TRW A;  2QA1 A;  3RDW A;  1ERW A;  5F07 A;  1XOB A;  2X64 A;  3DYR A;  2RUE A;  3MIX A;  4IJI A;  2H1B A;  2DML A;  2WGR A;  4AJ6 A;  5DAK B;  2A4H A;  3BCI A;  2YAN A;  3IAM 2;  2DJ2 A;  4BPY A;  5GSS A;  2OBI A;  1N8J A;  4QL9 A;  5ECR B;  2CZ2 A;  1G7O A;  1K0O A;  1Z6N A;  2K18 A;  3L9U A;  4ACS A;  4KGI A;  2XC2 A;  2IIY A;  1ZYP A;  5DQS A;  2FD3 A;  4L5O A;  3MSZ A;  2K6V A;  3M8N A;  3KCM A;  3IDV A;  1GSE A;  1FAA A;  1M0U A;  4JED A;  2DKI A;  1GWC A;  5JWR B;  2VAF A;  5IPH A;  1MDI A;  5CO3 A;  2HZE A;  2OBK A;  2PWJ A;  5KOX A;  1GSD A;  2PGT A;  1JLW A;  4KB3 A;  1VF3 A;  6GSU A;  3J7Y b;  5H5Q A;  3BOA A;  4TR0 A;  1DE2 A;  5CRH A;  1FB6 A;  5KN1 A;  3TOU A;  3HVX A;  3HD5 A;  2C0D A;  1Z6M A;  1B48 A;  3BBY A;  3PH9 A;  4V2L A;  4OO4 A;  2YWO A;  4USS A;  3GIX A;  5D8I A;  1GRX A;  1FG4 A;  3UL3 A;  5EL8 A;  3IV4 A;  4LA1 A;  2C3T A;  2GSR A;  4ULX A;  2H74 A;  4OCF A;  3VI5 A;  1M2D A;  4X4J A;  1GSQ A;  8GSS A;  2MMN A;  3ERW A;  4ECI A;  2QSI A;  2KP2 A;  4Z2U A;  5AIS A;  1TK0 B;  4LL4 B;  4Z2T A;  3FZ5 A;  2EIO A;  3N9J A;  2OAD A;  3VFI A;  3GUR A;  3L78 A;  3I6A A;  4K7O A;  18GS A;  1URM A;  4EE0 A;  1M3J A;  2RM5 A;  1K0C A;  3PGT A;  2H73 A;  2PVO C;  4EUY A;  1OC9 B;  2YV7 A;  1N2A A;  4PUA A;  3IC8 A;  5LNK e;  4BA7 A;  2IFQ A;  5ID2 A;  4GTU A;  2FY6 A;  1OE7 A;  3I9V 2;  1EEJ A;  4HU7 A;  2MMZ A;  4ZXG A;  1V58 A;  2HSM A;  4E8E A;  4TOP A;  4K0N A;  3A5W A;  4LL1 B;  3QFB C;  4XS4 B;  4O92 A;  3CSI A;  2K9F A;  1SKS B;  1M99 A;  1O81 A;  2ON7 A;  3KTL A;  3EMP A;  1KTE A;  4MLY A;  5JCU A;  4WBJ A;  2IMK A;  3L9V A;  3WT2 A;  2LV3 A;  1TRS A;  3IPZ A;  4MH3 A;  2CVK A;  5ECP B;  3IAS 2;  4MPG A;  4TKY A;  1AW9 A;  3Q6O A;  2YJ7 A;  4IBP A;  2YJH A;  3GUS A;  3F63 A;  1J0F A;  5IQY A;  3HY2 A;  4NWY A;  1USB A;  1EOG A;  1ZMA A;  2IMD A;  4CDO A;  3F3Q A;  3GV1 A;  5D9T A;  1AC1 A;  1O8X A;  1XWG A;  3LXT A;  20GS A;  4HUA A;  1AQX A;  1U88 A;  2JSY A;  2LST A;  3FR9 A;  4I2U A;  2YNX A;  4MAB A;  2VOC A;  2H6Y A;  4BWQ A;  4I8B A;  2R5G A;  5EPF A;  1S3R A;  3EIN A;  1YF1 A;  4TXO B;  4GWR A;  4BL7 B;  2O89 A;  2C4J A;  1PN9 A;  4WR4 A;  1B4P A;  3TKS C;  3EU3 A;  1E6B A;  2LRC A;  1R26 A;  1X0R A;  4POL A;  3FZ9 A;  3TKQ A;  4WEY A;  3ZFB A;  1A2J A;  5H5R A;  3LYP A;  2H6Z A;  1HYU A;  4POB A;  1ZGN A;  3IE3 A;  2CVD A;  2IME A;  2ES7 A;  2H01 A;  2YZH A;  5D9W A;  3W6G A;  4TVE A;  5LD0 A;  3E9J B;  2C0F A;  2B5Y A;  1AQW A;  4ECC A;  5HFK A;  1FB0 A;  3KZQ A;  3TDG A;  1F9M A;  1OAZ A;  4EKZ A;  4TR1 A;  4WKW A;  2V6K A;  1A8L A;  2RLI A;  1QK8 A;  1VGL A;  1XG8 A;  1I5G A;  4N30 A;  2JZR A;  2M80 A;  1MDK A;  1T8E B;  4K5R A;  1CQG A;  2OA7 A;  4ZL7 A;  1OKD A;  1GTA A;  2C3N A;  4Q5F A;  1EZK A;  3ZLP A;  2OE1 A;  5DVB A;  2WDU A;  1ML6 A;  1YKC A;  5J5N A;  2PU9 C;  1PX7 A;  3G9B A;  1O7U A;  2DJJ A;  2ZCT A;  3ZTL A;  4PNG A;  4HZ4 A;  4BVY A;  2GQK A;  4DVC A;  4ECJ A;  4IQA A;  3J7Y k;  3FZA A;  5COH A;  3QR6 A;  1NHY A;  3FRC A;  5HFI A;  3UJ1 A;  1BG5 A;  1W89 A;  4PTS A;  1UN2 A;  1IYH A;  4ILF A;  5J41 A;  5INY A;  4ZBB A;  1PGT A;  3P8W A;  2L4Q A;  2H8L A;  3KM6 A;  2B5E A;  2M72 A;  5J9C A;  2A2P A;  5FT3 A;  5GZZ B;  3KP9 A;  4XHM A;  5IMV A;  1R4W A;  3F4R A;  3H1N A;  4MF5 A;  4HQS A;  3NIV A;  2YV9 A;  5IMD A;  4ML1 A;  1SKR B;  1U3A A;  3G7J A;  3MDK A;  2HI7 A;  2AHE A;  2HSY A;  3LEF A;  4WF5 A;  1AXD A;  1XIY A;  1J9B A;  2C0G A;  2DJK A;  4JZQ A;  2VCX A;  2LQO A;  1PQN A;  1WPI A;  1JZW A;  2VCZ A;  3HHV A;  1BX9 A;  5F06 A;  1F2E A;  3H4K A;  3KEB A;  4GST A;  2GGT A;  1JZO A;  3EUR A;  5JCG A;  3EWL A;  3GTU B;  3W8S A;  3A3T A;  5KN0 A;  2X4A A;  4F2I A;  4MK3 A;  2FCH A;  5A4W A;  3APQ A;  4Q5N A;  4IEL A;  2WS2 A;  3LJR A;  4L0U A;  2A4V A;  2F8A A;  4IKH A;  4FYU A;  1RQM A;  1JHB A;  1GSS A;  3TB2 A;  2O85 A;  1GLQ A;  4IJ3 A;  1R7H A;  1SD8 A;  3FYG A;  3L9S A;  4HQZ A;  1SEN A;  1T00 A;  3IHQ A;  1B8X A;  3N5O A;  2L57 A;  2H70 A;  3KIJ A;  4PUF C;  3GNJ A;  2P0G A;  5B6N A;  3ZZX A;  1XVQ A;  1THX A;  4KDY A;  1XCC A;  3KD0 A;  5IIZ A;  3VUR A;  3F6D A;  5ECO B;  4KH7 A;  3D5J A;  4YKF A;  5KN2 A;  4ID0 A;  5C04 A;  1FVJ A;  1LU4 A;  2LJA A;  1TP9 A;  1WRY A;  1PSQ A;  4OFN A;  3BJ5 A;  2LQQ A;  1SD9 A;  3LFL A;  3TKS E;  2HRN A;  2OE0 A;  4H86 A;  1GSU A;  4OFM A;  2WUL A;  4PQ1 A;  1XW5 A;  2XBI A;  1PKZ A;  2IWT A;  4Z2R A;  4LMV A;  4EXJ A;  3FEU A;  1WP0 A;  4GSN A;  4G2E A;  4MZW A;  2GST A;  4AGS A;  1HQO A;  1BJX A;  4MF6 A;  1J08 A;  4QL7 A;  5KEJ A;  4F9Z A;  4V1A p;  2GZP A;  4YKG A;  2JL4 A;  1Q4J A;  5DBQ A;  2DIZ A;  3VPT A;  2DJ0 A;  3F9U A;  5IMC A;  2VCQ A;  4X0X A;  1OE8 A;  19GS A;  2C80 A;  4NAX A;  1TU8 A;  1S3D A;  2VD0 A;  2PBJ A;  3KH9 A;  2J23 A;  2LUS A;  2MZC A;  3LW9 A;  2WZ9 A;  1SJZ A;  3MAK A;  2QGV A;  2XHF A;  1SKW B;  2B1L A;  1TRV A;  5DAL B;  1XWA A;  3FR3 A;  3HZ4 A;  1ZZY A;  1I9D A;  4AJ7 A;  2LNS A;  4G0K A;  1XBS A;  4O7H A;  2LJR A;  1GSY A;  2B7K A;  3HJM A;  4CY8 A;  3TJF A;  3DML A;  2FWG A;  5CAX A;  2V1M A;  1F3B A;  3HDC A;  4MPF A;  3U6V A;  1ZL9 A;  2GT5 A;  12GS A;  2H19 A;  4FYB A;  4IS0 A;  1QFN A;  2HSH A;  5HFG A;  1RK4 A;  3KGK A;  4NXI A;  5ECL B;  1PKW A;  2CT6 A;  3D22 A;  1MD4 A;  3CTF A;  5IMZ A;  5B7C A;  5ECK B;  3ZVJ A;  3LSZ A;  3GKN A;  2DLX A;  4XRD A;  3M0F A;  3GX0 A;  1PL1 A;  3RPN A;  4HS1 A;  5D96 A;  1O73 A;  3KTB A;  5G31 A;  1F3A A;  2TRC P;  4I6X A;  5DJM A;  2L4C A;  1W4V A;  1EP7 A;  4DSQ A;  4NHW A;  2CA8 A;  1Z5Y E;  3CSH A;  3CYN A;  1MTC A;  2GDR A;  5FHI A;  4K7I A;  4TR3 A;  3IXR A;  1E2Y A;  1GUH A;  2O87 A;  1WIK A;  3TKS A;  2GLR A;  2NBS A;  3VI7 A;  17GS A;  3EVI A;  3M9J A;  1JFU A;  3PR8 A;  2GQL A;  2VCW A;  4BVX B;  1VF2 A;  3ERG A;  1K0B A;  4ZB6 A;  5DDL A;  3UAP A;  2L5L A;  1TXX A;  5IM9 A;  3UVH A;  1R5A A;  5J4U A;  4I97 A;  4O5U A;  4XIH A;  2IPA A;  3DXB A;  6GSX A;  2OE3 A;  2B3S A;  2VD1 A;  4OO5 A;  4FQU A;  1VF4 A;  4V2N A;  4D73 A;  1WWJ A;  3F3R A;  4GQC A;  3MYD A;  3WYW A;  2H30 A;  5BMU A;  3S9F A;  4O32 A;  3PPU A;  4RI7 A;  4MJB A;  3MNG A;  2QC7 A;  2H1D A;  1GNE A;  3NZN A;  2LRT A;  2GSQ A;  1TTZ A;  10GS A;  4KSO A;  2LEG A;  3ZRD A;  5GAN D;  4G19 A;  4FIW A;  3DGQ A;  2WFC A;  2DKH A;  2WJU A;  2J9H A;  3RHB A;  2JU5 A;  3GHA A;  3FHK A;  1OC8 A;  2M46 A;  4MA9 A;  1WJK A;  1KBN A;  3A5I A;  1Z7P A;  5JCW A;  2REM A;  4JRR A;  1XVW A;  3QOU A;  5F0G A;  1SYX A;  1ZOF A;  4RUV A;  5JWO B;  2JZS A;  5EVO A;  3SBC A;  2E7P A;  3UBK A;  3KH7 A;  3DWV A;  2DBC A;  3ZML A;  1A8Y A;  3ZYW A;  4NV5 A;  2AB6 A;  4E8H A;  4POK A;  3FKF A;  4HI7 A;  2V32 A;  5DCH A;  3ZVJ D;  1G6W A;  1HD2 A;  3IC4 A;  3EPT A;  4IP6 A;  3LGC A;  4HU9 A;  1BQ7 A;  5CRG A;  4JE1 A;  4CY6 A;  2QA2 A;  4KDX A;  4XRA A;  3RPP A;  2R0G A;  1YF0 A;  3DKS A;  4MZC A;  3GSS A;  1A0F A;  4RQR A;  2HZE B;  2X8G A;  2R4V A;  3P2A A;  4O5R A;  2HFD A;  5DCG A;  3EC3 A;  1NSW A;  2N5F A;  2YWN A;  4IN0 A;  2JSZ A;  3BD2 A;  1SJI A;  1MD3 A;  2DC5 A;  2GVP A;  4KW6 A;  4X43 A;  1O8W A;  2LKU A;  1EGO A;  4RI6 A;  3GH6 A;  5GST A;  3I43 A;  3VWV A;  3LYK A;  3HZ8 A;  3GN3 A;  1EV4 A;  2HLS A;  4MJA A;  1QGV A;  3GKX A;  1V40 A;  2I3Y A;  1B9X C;  5D93 A;  3ZIT A;  2LS5 A;  2AV4 A;  3ZIJ A;  11GS A;  3FW2 A;  4OD7 A;  1C72 A;  2PER A;  5AIV A;  1XZO A;  1XFL A;  5IMA A;  6GSW A;  3LG6 A;  5H5S A;  2VIM A;  4DSS A;  2X99 A;  3L0H A;  1SK0 A;  1TW9 A;  1XWB A;  2DMM A;  1K0N A;  2YCD A;  3EU4 A;  3HA9 A;  3ERF A;  1JZD A;  3D6I A;  1MDJ A;  4ICY A;  2BJX A;  4GQF A;  4F82 A;  2EIQ A;  2IN3 A;  4F0B A;  2MBT A;  1TOF A;  5E4W A;  5HR3 A;  2B1K A;  4NMU A;  2DIY A;  1TRU A;  1XW9 A;  3GA4 A;  2CZ3 A;  4HZ2 A;  2I81 A;  2LNT A;  2G0F A;  1YEP A;  4G10 A;  1GTB A;  3UVT A;  2HRK A;  4EDZ A;  5GAP D;  2FA8 A;  3AY8 A;  3ISO A;  1IYI A;  2YP6 A;  4ZL8 A;  5ID2 B;  2B7J A;  3O3T A;  4WR5 A;  2CQ9 A;  1GLP A;  2O8V B;  1X5D A;  4IW9 A;  1PRX A;  2N5A A;  3CSJ A;  3C71 A;  4HOJ A;  1YEX A;  2VLU A;  4TRX A;  1DE1 A;  4AJ8 A;  5HQP A;  1A24 A;  1AUC A;  5CRD A;  2CAI A;  2FWF A;  1ERT A;  2FWE A;  3WT1 A;  2VL2 C;  5DAK A;  2VL3 A;  5ECQ B;  5KOW A;  1VF1 A;  2IJY A;  4ISD A;  4JR6 A;  3D4M A;  4RQX A;  5DQY A;  4ZL9 A;  2EC4 A;  4PXO A;  3WD6 A;  1WMJ A;  3IHG A;  2F3M A;  2IL3 A;  4FH8 A;  2C3Q A;  1F6M C;  2VO4 A;  4K8M A;  3TRP A;  3F4T A;  4EC0 A;  1YQ1 A;  4KCE A;  4HDE A;  1B4Q A;  1UVZ A;  2AJQ B;  5B8B A;  4A5P A;  4ECB A;  4TW5 A;  2GT6 A;  1OVN A;  2RUF A;  3WGX A;  2OKA A;  3A2V A;  5IPG A;  2PVQ A;  3C8E A;  3IA1 A;  2E2M A;  1T7P B;  5ECI B;  2B5X A;  4NPB A;  4TR4 A;  3M9K A;  3APO A;  3UOM A;  2A2R A;  1NM3 A;  3DD3 A;  1V98 A;  1Z3E A;  5G5F A;  4EF0 A;  5IOW A;  2L5O A;  3K8N A;  3FK8 A;  1AIU A;  1AQV A;  3ZMK A;  2VUP A;  3F8U A;  4F03 A;  1HNC A;  4PNF A;  1NHO A;  2RM6 A;  3EE2 A;  4HSC X;  2FLS A;  1K0A A;  2AAW A;  2E2G A;  2LJK A;  2GZY A;  14GS A;  1FO5 A;  1QQ2 A;  2H72 A;  1GH2 A;  1AAZ A;  1M3I A;  3ZL5 A;  4TR1 B;  1A2L A;  2HNL A;  2N5B A;  1OC9 A;  2MMO A;  1DBY A;  1YZX A;  3L4N A;  4PQH A;  4ZIJ A;  5B8A A;  4FYC A;  1FOV A;  3JCM L;  4GSS A;  3VWU A;  4EO3 A;  5D9V A;  5ECH B;  3F0I A;  3UIW A;  1ST9 A;  1F37 A;  3MWH A;  5G2Z A;  5CRE A;  1OYJ A;  2FUG 2;  4POM A;  3TJJ A;  4EIP A;  4XS4 A;  9GSS A;  3C1R A;  1PX6 A;  2L59 A;  3VLN A;  3TJG A;  4WF4 A;  3QDN A;  3A2X A;  4KA0 A;  5F8B A;  1GUM A;  4GF0 A;  4BVY B;  2KP1 A;  3KMO A;  4KF9 A;  2WB9 A;  3G7Y A;  1KNG A;  2DSA A;  4ZB9 A;  4K1F A;  1YY7 A;  1SU9 A;  2PPT A;  4MH2 A;  5BRT A;  3R2Q A;  3VPQ A;  3TOT A;  1G7E A;  1OKT A;  4WBR D;  2E0Q A;  2YWM A;  3UBL A;  3FR6 A;  3LWA A;  2MBS A;  1ERV A;  1O85 A;  1SJ6 A;  2Z9S A;  4ML6 A;  1Y6E A;  2P5Q A;  1ON4 A;  3CQF A;  1KEB A;  4KE3 A;  2HE3 A;  4JBB A;  1M9B A;  4MP4 A;  2F51 A;  2X49 A;  3CXG A;  3EYT A;  4FO5 A;  4YQV A;  1GUK A;  2H71 A;  1T4Z A;  1R5P A;  3C7M A;  3D21 A;  1PMT A;  4YH2 A;  1XWC A;  4IQ1 A;  4OMV A;  4PQI A;  2VLT A;  3TKR A;  2X8C A;  4J56 E;  1ACV A;  1HNA A;  1TKD B;  1EEM A;  3SWL A;  1FHE A;  5G5E A;  1JZR A;  4YAP A;  1ILO A;  3O6T A;  1S3C A;  2O7K A;  2YPM A;  3Q19 A;  4TXO A;  1WE0 A;  3ME8 A;  16GS A;  4BL7 A;  3G7I A;  2PMT A;  5D9X A;  4KX4 A;  3HKR A;  5LCZ A;  2OAC A;  5CYY A;  1X5E A;  3GST A;  4MZB A;  4X1U A;  4PUR A;  4HJM A;  2VM1 A;  4KND A;  3DEX A;  2V6O A;  3DVX A;  3ED3 A;  1LBK A;  2NTO A;  1FOH A;  4KCA A;  3VWW A;  2R2J A;  4MJE A;  4PX1 A;  1V2A A;  3M3M A;  3LQ7 A;  1V57 A;  4HJ2 A;  2ON5 A;  3GRX A;  1M7T A;  4XTS A;  4Q5R A;  6GSV A;  3C1S A;  5CP1 A;  4IP1 A;  3CRT A;  4P3Y B;  3P90 A;  5ECN B;  1EGR A;  4IHU A;  4OCE A;  1THO A;  4JR4 A;  1SL2 B;  4IVF A;  4DEJ A;  1T3B A;  1A0R P;  5ENU A;  4MDC A;  3TGZ A;  2B6M A;  1Y25 A;  3V1W A; 
#chains in the Genus database with same CATH homology
 3OR5 A;  2BMX A;  4MF7 A;  2G2Q A;  2XPD A;  2FNO A;  4GRF A;  3W8J A;  5JWQ B;  3HVS A;  2VM2 A;  3HVV A;  4JU5 A;  1TK5 B;  5KN3 A;  1CQH A;  1JLV A;  1SL0 B;  2KHP A;  3UMA A;  1TK8 B;  2VLV A;  4IGJ A;  1K3L A;  1VRS D;  2TRX A;  4ZB8 A;  4YAV A;  2H75 A;  4MCU A;  1XOA A;  1TU7 A;  2CV4 A;  3IRA A;  1S3A A;  1GUL A;  1BYE A;  4O5Q A;  4KUN A;  4MJC A;  4K5S A;  5FWG A;  7GSS A;  2H66 A;  5IO0 A;  1O6J A;  2L6C A;  2LTK A;  2R0P A;  2WCI A;  5D73 A;  2VL9 A;  3UEM A;  4K9Z A;  2A2S A;  2R3X A;  3WGE A;  1X5C A;  5DJL A;  3M1G A;  1XW6 A;  1V9W A;  2DJ1 A;  1TDI A;  3QCP A;  3QAV A;  4LMW A;  3CRU A;  3Q18 A;  4CHS A;  1XWK A;  4J57 E;  1K3O A;  3CBU A;  4N10 A;  1QXH A;  4MNN A;  3US3 A;  1U3I A;  3GTU A;  2VL2 A;  5A4U A;  1PA3 A;  1M2B A;  3NOF A;  4XS6 A;  5IOX A;  1GP1 A;  2YZU A;  2P31 A;  5AN1 A;  3GMF A;  2I4A A;  4EL1 A;  3APS A;  4GXZ A;  4KSM A;  3QAW A;  2H0G A;  2YOI A;  2AYT A;  4KDU A;  1UC7 A;  3FZ4 A;  3VWX A;  5A5K A;  2I9H A;  1PD2 1;  3GKK A;  4K0G A;  4I2T A;  2R37 A;  4L5L A;  4F0C A;  3RHC A;  4BWS A;  2ALB A;  3VK9 A;  3D0Z A;  3KP8 A;  2R6K A;  3A2W A;  1QMV A;  5HR0 A;  3ZFL A;  5AIX A;  3E3E A;  4G0L A;  3CTG A;  2H6X A;  1ZCP A;  3HCZ A;  2KUC A;  1HNB A;  4XCS A;  1XPV A;  2JAD A;  4KAE A;  4EIQ A;  3H79 A;  3TJB A;  4GLT A;  2NPB A;  4QQ7 A;  3GH9 A;  2RII A;  1XXU A;  3BCK A;  4K2X A;  1ZYN A;  3CMI A;  4Z7X A;  2GS3 A;  2P5R A;  4XS1 A;  5E59 A;  2X8H A;  3QPM A;  5B6M A;  3HJP A;  4NV2 A;  3TRX A;  3GKM A;  4L0W A;  3H93 A;  2HXK A;  1A2M A;  5L71 A;  1TI3 A;  2H1G A;  2GSS A;  1SL1 B;  1Z7R A;  5AGY A;  5CRW A;  3LXZ A;  3GYK A;  2F8F A;  1GL8 A;  2KLX A;  4YQM A;  4G9H A;  2CX4 A;  13GS A;  3U5R E;  3FMW A;  1T4Y A;  6GSS A;  4YQU A;  1EOH A;  1SK2 A;  5CNW A;  2V2G A;  2V41 A;  1ERU A;  3HJO A;  1YJ6 A;  2CVB A;  1LJR A;  2IFQ B;  4D73 B;  1Z9H A;  1EV9 A;  2GTU A;  4PGT A;  4GCI A;  3PIN A;  2H0H A;  1DUG A;  4ZBA A;  2I1U A;  1K0D A;  3DRN A;  3LOR A;  2EIR A;  1GSF A;  4WET A;  2NDO A;  1X9S B;  2FA4 A;  3GL5 A;  5DAL A;  1WOU A;  3ZIV A;  2L6D A;  1YDK A;  1GTU A;  4LLR A;  1GTI A;  2F9S A;  2HYX A;  5HR1 A;  3GL3 A;  5J3R A;  1TI1 A;  2UZ8 A;  3WGD A;  1T1V A;  2CX3 A;  1SK1 A;  1EP8 A;  3EMX A;  3H8Q A;  2GQM A;  3DIE A;  3IBH A;  2H0I A;  5G1K A;  2DJ3 A;  2VCV A;  2JAC A;  5ELA A;  1SYR A;  3GX8 A;  2XBQ A;  3GFK A;  2OJL A;  3KJY A;  4J2F A;  1FVK A;  2XPE A;  1UA5 A;  4N0V A;  1Q98 A;  2CAQ A;  5ECS A;  1U87 A;  3ME7 A;  4N0Z A;  2YN1 A;  1M9A A;  1H4O A;  3TJK A;  2JZT A;  1PN0 A;  2PN8 A;  4EDY A;  3KXO A;  2NVL A;  3F6F A;  2K8V A;  1OC3 A;  1ZYE A;  3IK7 A;  3ZRE A;  2FHE A;  1M2A A;  4K2D A;  3KMN A;  3TCO A;  2C8U A;  5G30 A;  3I69 A;  2FGX A;  1X9M B;  4OFT A;  1BAY A;  2H1A A;  2ZNM A;  1BED A;  2WRT A;  3HYP A;  22GS A;  2HRF A;  2MMA A;  3QMX A;  2HZF A;  3TRQ A;  2MYG A;  4ZBD A;  5F05 A;  3E0U A;  1TJD A;  3QFA C;  6GST A;  2KOK A;  1QUW A;  2PUK C;  3DVW A;  5A4V A;  4TXV A;  4I5Q A;  2FWH A;  5EY6 A;  3C73 A;  3FY7 A;  4HEA 2;  4EVM A;  3QAG A;  4WXT A;  5IMF A;  2ZUP A;  4BVX A;  3QD9 A;  5IO2 A;  3IK9 A;  3TKP A;  3O76 A;  2H76 A;  4Q5Q A;  4TN8 A;  4V1A g;  4DSR A;  1B9Y C;  2QKE A;  3P7X A;  2IMF A;  2BTO T;  4ZIL A;  1K0M A;  2C1Y A;  1G6Y A;  3F4S A;  1U6T A;  1A23 A;  4AF2 A;  5HR2 A;  4DSS B;  4N11 A;  4G0I A;  2R0C A;  4V2M A;  3D4T A;  1FW1 A;  4L8E A;  1EWX A;  4K7N A;  2VCT A;  2LRN A;  5ELG A;  4MMM A;  5J9B A;  1X9W B;  1PL2 A;  2TIR A;  2GZZ A;  3TUE A;  3RAZ A;  3IOS A;  1ABA A;  3R3E A;  4OWY A;  1H75 A;  2K8S A;  1DSB A;  2IMI A;  1G0T A;  3RBT A;  4K6X A;  1GNW A;  3Q74 A;  2YWI A;  2HRA A;  2HT9 A;  3HXS A;  2C0E A;  5ABR A;  1RW1 A;  3UAR A;  5C00 A;  6GSY A;  1ZYQ B;  2AUV A;  3IR4 A;  2D2Z A;  4CW9 A;  1MEK A;  5ECM B;  4NHZ A;  1NW2 A;  5G1L A;  1K3Y A;  1YKA A;  1TRW A;  2QA1 A;  3RDW A;  1ERW A;  5F07 A;  1XOB A;  2X64 A;  3DYR A;  2RUE A;  3MIX A;  4IJI A;  2H1B A;  2DML A;  2WGR A;  4AJ6 A;  5DAK B;  2A4H A;  3BCI A;  2YAN A;  3IAM 2;  2DJ2 A;  4BPY A;  5GSS A;  2OBI A;  1N8J A;  4QL9 A;  5ECR B;  2CZ2 A;  1G7O A;  1K0O A;  1Z6N A;  2K18 A;  3L9U A;  4ACS A;  4KGI A;  2XC2 A;  2IIY A;  1ZYP A;  5DQS A;  2FD3 A;  4L5O A;  3MSZ A;  2K6V A;  3M8N A;  3KCM A;  3IDV A;  1GSE A;  1FAA A;  1M0U A;  4JED A;  2DKI A;  1GWC A;  5JWR B;  2VAF A;  5IPH A;  1MDI A;  5CO3 A;  2HZE A;  2OBK A;  2PWJ A;  5KOX A;  1GSD A;  2PGT A;  1JLW A;  4KB3 A;  1VF3 A;  6GSU A;  3J7Y b;  5H5Q A;  3BOA A;  4TR0 A;  1DE2 A;  5CRH A;  1FB6 A;  5KN1 A;  3TOU A;  3HVX A;  3HD5 A;  2C0D A;  1Z6M A;  1B48 A;  3BBY A;  3PH9 A;  4V2L A;  4OO4 A;  2YWO A;  4USS A;  3GIX A;  5D8I A;  1GRX A;  1FG4 A;  3UL3 A;  5EL8 A;  3IV4 A;  4LA1 A;  2C3T A;  2GSR A;  4ULX A;  2H74 A;  4OCF A;  3VI5 A;  1M2D A;  4X4J A;  1GSQ A;  8GSS A;  2MMN A;  3ERW A;  4ECI A;  2QSI A;  2KP2 A;  4Z2U A;  5AIS A;  1TK0 B;  4LL4 B;  4Z2T A;  3FZ5 A;  2EIO A;  3N9J A;  2OAD A;  3VFI A;  3GUR A;  3L78 A;  3I6A A;  4K7O A;  18GS A;  1URM A;  4EE0 A;  2RM5 A;  1K0C A;  3PGT A;  2H73 A;  2PVO C;  4EUY A;  1OC9 B;  2YV7 A;  1N2A A;  4PUA A;  3IC8 A;  5LNK e;  4BA7 A;  2IFQ A;  5ID2 A;  4GTU A;  2FY6 A;  1OE7 A;  3I9V 2;  1EEJ A;  4HU7 A;  2MMZ A;  4ZXG A;  1V58 A;  2HSM A;  4E8E A;  4TOP A;  4K0N A;  3A5W A;  4LL1 B;  3QFB C;  4XS4 B;  4O92 A;  3CSI A;  2K9F A;  1SKS B;  1M99 A;  1O81 A;  2ON7 A;  3KTL A;  3EMP A;  1KTE A;  4MLY A;  5JCU A;  4WBJ A;  2IMK A;  3L9V A;  3WT2 A;  2LV3 A;  1TRS A;  3IPZ A;  4MH3 A;  2CVK A;  5ECP B;  3IAS 2;  4MPG A;  4TKY A;  1AW9 A;  3Q6O A;  2YJ7 A;  4IBP A;  2YJH A;  3GUS A;  3F63 A;  1J0F A;  5IQY A;  3HY2 A;  4NWY A;  1USB A;  1EOG A;  1ZMA A;  2IMD A;  4CDO A;  3F3Q A;  3GV1 A;  5D9T A;  1AC1 A;  1O8X A;  1XWG A;  3LXT A;  20GS A;  4HUA A;  1AQX A;  1U88 A;  2JSY A;  2LST A;  3FR9 A;  4I2U A;  2YNX A;  4MAB A;  2VOC A;  2H6Y A;  4BWQ A;  4I8B A;  2R5G A;  5EPF A;  3EIN A;  1YF1 A;  4TXO B;  4GWR A;  4BL7 B;  2O89 A;  2C4J A;  1PN9 A;  4WR4 A;  1B4P A;  3TKS C;  3EU3 A;  1E6B A;  2LRC A;  1R26 A;  1X0R A;  4POL A;  3FZ9 A;  3TKQ A;  4WEY A;  3ZFB A;  1A2J A;  5H5R A;  3LYP A;  2H6Z A;  1HYU A;  4POB A;  1ZGN A;  3IE3 A;  2CVD A;  2IME A;  2ES7 A;  2H01 A;  2YZH A;  5D9W A;  3W6G A;  4TVE A;  5LD0 A;  3E9J B;  2C0F A;  2B5Y A;  1AQW A;  4ECC A;  5HFK A;  1FB0 A;  3KZQ A;  3TDG A;  1F9M A;  1OAZ A;  4EKZ A;  4TR1 A;  4WKW A;  2V6K A;  1A8L A;  2RLI A;  1QK8 A;  1VGL A;  1I5G A;  4N30 A;  2JZR A;  2M80 A;  1MDK A;  1T8E B;  4K5R A;  1CQG A;  2OA7 A;  4ZL7 A;  1OKD A;  1GTA A;  2C3N A;  4Q5F A;  1EZK A;  3ZLP A;  2OE1 A;  5DVB A;  2WDU A;  1ML6 A;  1YKC A;  5J5N A;  2PU9 C;  1PX7 A;  3G9B A;  1O7U A;  2DJJ A;  2ZCT A;  3ZTL A;  4PNG A;  4HZ4 A;  4BVY A;  2GQK A;  4DVC A;  4ECJ A;  4IQA A;  3J7Y k;  3FZA A;  5COH A;  3QR6 A;  1NHY A;  3FRC A;  5HFI A;  3UJ1 A;  1BG5 A;  1W89 A;  4PTS A;  1UN2 A;  1IYH A;  4ILF A;  5J41 A;  5INY A;  4ZBB A;  1PGT A;  3P8W A;  2L4Q A;  2H8L A;  3KM6 A;  2B5E A;  2M72 A;  5J9C A;  2A2P A;  5FT3 A;  5GZZ B;  3KP9 A;  4XHM A;  5IMV A;  1R4W A;  3F4R A;  3H1N A;  4MF5 A;  4HQS A;  3NIV A;  2YV9 A;  5IMD A;  4ML1 A;  1SKR B;  1U3A A;  3G7J A;  3MDK A;  2HI7 A;  2AHE A;  2HSY A;  3LEF A;  4WF5 A;  1AXD A;  1XIY A;  1J9B A;  2C0G A;  2DJK A;  4JZQ A;  2VCX A;  2LQO A;  1PQN A;  1WPI A;  1JZW A;  2VCZ A;  3HHV A;  1BX9 A;  5F06 A;  1F2E A;  3H4K A;  3KEB A;  4GST A;  2GGT A;  1JZO A;  3EUR A;  5JCG A;  3EWL A;  3GTU B;  3W8S A;  3A3T A;  5KN0 A;  2X4A A;  4F2I A;  4MK3 A;  2FCH A;  5A4W A;  3APQ A;  4Q5N A;  4IEL A;  2WS2 A;  3LJR A;  4L0U A;  2A4V A;  2F8A A;  4IKH A;  4FYU A;  1RQM A;  1JHB A;  1GSS A;  3TB2 A;  2O85 A;  1GLQ A;  4IJ3 A;  1R7H A;  1SD8 A;  3FYG A;  3L9S A;  4HQZ A;  1SEN A;  1T00 A;  3IHQ A;  1B8X A;  3N5O A;  2L57 A;  2H70 A;  3KIJ A;  4PUF C;  3GNJ A;  2P0G A;  5B6N A;  3ZZX A;  1XVQ A;  1THX A;  4KDY A;  1XCC A;  3KD0 A;  5IIZ A;  3VUR A;  3F6D A;  5ECO B;  4KH7 A;  3D5J A;  4YKF A;  5KN2 A;  4ID0 A;  5C04 A;  1FVJ A;  1LU4 A;  2LJA A;  1TP9 A;  1WRY A;  1PSQ A;  4OFN A;  3BJ5 A;  2LQQ A;  1SD9 A;  3LFL A;  3TKS E;  2HRN A;  2OE0 A;  4H86 A;  1GSU A;  4OFM A;  2WUL A;  4PQ1 A;  1XW5 A;  2XBI A;  1PKZ A;  2IWT A;  4Z2R A;  4LMV A;  4EXJ A;  3FEU A;  1WP0 A;  4GSN A;  4G2E A;  4MZW A;  2GST A;  4AGS A;  1HQO A;  1BJX A;  4MF6 A;  1J08 A;  4QL7 A;  5KEJ A;  4F9Z A;  4V1A p;  2GZP A;  4YKG A;  2JL4 A;  1Q4J A;  5DBQ A;  2DIZ A;  3VPT A;  2DJ0 A;  3F9U A;  5IMC A;  2VCQ A;  4X0X A;  1OE8 A;  19GS A;  2C80 A;  4NAX A;  1TU8 A;  1S3D A;  2VD0 A;  2PBJ A;  3KH9 A;  2J23 A;  2LUS A;  2MZC A;  3LW9 A;  2WZ9 A;  1SJZ A;  3MAK A;  2QGV A;  2XHF A;  1SKW B;  2B1L A;  1TRV A;  5DAL B;  1XWA A;  3FR3 A;  3HZ4 A;  1ZZY A;  1I9D A;  4AJ7 A;  2LNS A;  4G0K A;  1XBS A;  4O7H A;  2LJR A;  1GSY A;  2B7K A;  3HJM A;  4CY8 A;  3TJF A;  3DML A;  2FWG A;  5CAX A;  2V1M A;  1F3B A;  3HDC A;  4MPF A;  3U6V A;  1ZL9 A;  2GT5 A;  12GS A;  2H19 A;  4FYB A;  4IS0 A;  1QFN A;  2HSH A;  5HFG A;  1RK4 A;  3KGK A;  4NXI A;  5ECL B;  1PKW A;  2CT6 A;  3D22 A;  1MD4 A;  3CTF A;  5IMZ A;  5B7C A;  5ECK B;  3ZVJ A;  3LSZ A;  3GKN A;  2DLX A;  4XRD A;  3M0F A;  3GX0 A;  1PL1 A;  3RPN A;  4HS1 A;  5D96 A;  1O73 A;  3KTB A;  5G31 A;  1F3A A;  2TRC P;  4I6X A;  5DJM A;  2L4C A;  1W4V A;  1EP7 A;  4DSQ A;  4NHW A;  2CA8 A;  1Z5Y E;  3CSH A;  3CYN A;  1MTC A;  2GDR A;  5FHI A;  4K7I A;  4TR3 A;  3IXR A;  1E2Y A;  1GUH A;  2O87 A;  1WIK A;  3TKS A;  2GLR A;  2NBS A;  3VI7 A;  17GS A;  3EVI A;  3M9J A;  1JFU A;  3PR8 A;  2GQL A;  2VCW A;  4BVX B;  1VF2 A;  3ERG A;  1K0B A;  4ZB6 A;  5DDL A;  3UAP A;  2L5L A;  1TXX A;  5IM9 A;  3UVH A;  1R5A A;  5J4U A;  4I97 A;  4O5U A;  4XIH A;  2IPA A;  3DXB A;  6GSX A;  2OE3 A;  2B3S A;  2VD1 A;  4OO5 A;  4FQU A;  1VF4 A;  4V2N A;  4D73 A;  1WWJ A;  3F3R A;  4GQC A;  3MYD A;  3WYW A;  2H30 A;  5BMU A;  3S9F A;  4O32 A;  3PPU A;  4RI7 A;  4MJB A;  3MNG A;  2QC7 A;  2H1D A;  1GNE A;  3NZN A;  2LRT A;  2GSQ A;  1TTZ A;  10GS A;  4KSO A;  2LEG A;  3ZRD A;  5GAN D;  4G19 A;  4FIW A;  3DGQ A;  2WFC A;  2DKH A;  2WJU A;  2J9H A;  3RHB A;  2JU5 A;  3GHA A;  3FHK A;  1OC8 A;  2M46 A;  4MA9 A;  1WJK A;  1KBN A;  3A5I A;  1Z7P A;  5JCW A;  2REM A;  4JRR A;  1XVW A;  3QOU A;  5F0G A;  1SYX A;  1ZOF A;  4RUV A;  5JWO B;  2JZS A;  5EVO A;  3SBC A;  2E7P A;  3UBK A;  3KH7 A;  3DWV A;  2DBC A;  3ZML A;  1A8Y A;  3ZYW A;  4NV5 A;  2AB6 A;  4E8H A;  4POK A;  3FKF A;  4HI7 A;  2V32 A;  5DCH A;  3ZVJ D;  1G6W A;  1HD2 A;  3IC4 A;  3EPT A;  4IP6 A;  3LGC A;  4HU9 A;  1BQ7 A;  5CRG A;  4JE1 A;  4CY6 A;  2QA2 A;  4KDX A;  4XRA A;  3RPP A;  2R0G A;  1YF0 A;  3DKS A;  4MZC A;  3GSS A;  1A0F A;  4RQR A;  2HZE B;  2X8G A;  2R4V A;  3P2A A;  4O5R A;  2HFD A;  5DCG A;  3EC3 A;  1NSW A;  2N5F A;  2YWN A;  4IN0 A;  2JSZ A;  3BD2 A;  1SJI A;  1MD3 A;  2DC5 A;  2GVP A;  4KW6 A;  4X43 A;  1O8W A;  2LKU A;  1EGO A;  4RI6 A;  3GH6 A;  5GST A;  3I43 A;  3VWV A;  3LYK A;  3HZ8 A;  3GN3 A;  1EV4 A;  2HLS A;  4MJA A;  1QGV A;  3GKX A;  1V40 A;  2I3Y A;  1B9X C;  5D93 A;  3ZIT A;  2LS5 A;  2AV4 A;  3ZIJ A;  11GS A;  3FW2 A;  4OD7 A;  1C72 A;  2PER A;  5AIV A;  1XZO A;  1XFL A;  5IMA A;  6GSW A;  3LG6 A;  5H5S A;  2VIM A;  4DSS A;  2X99 A;  3L0H A;  1SK0 A;  1TW9 A;  1XWB A;  2DMM A;  1K0N A;  2YCD A;  3EU4 A;  3HA9 A;  3ERF A;  1JZD A;  3D6I A;  1MDJ A;  4ICY A;  2BJX A;  4GQF A;  4F82 A;  2EIQ A;  2IN3 A;  4F0B A;  2MBT A;  1TOF A;  5E4W A;  5HR3 A;  2B1K A;  4NMU A;  2DIY A;  1TRU A;  1XW9 A;  3GA4 A;  2CZ3 A;  4HZ2 A;  2I81 A;  2LNT A;  2G0F A;  1YEP A;  4G10 A;  1GTB A;  3UVT A;  2HRK A;  4EDZ A;  5GAP D;  2FA8 A;  3AY8 A;  3ISO A;  1IYI A;  2YP6 A;  4ZL8 A;  5ID2 B;  2B7J A;  3O3T A;  4WR5 A;  2CQ9 A;  1GLP A;  2O8V B;  1X5D A;  4IW9 A;  1PRX A;  2N5A A;  3CSJ A;  3C71 A;  4HOJ A;  1YEX A;  2VLU A;  4TRX A;  1DE1 A;  4AJ8 A;  5HQP A;  1A24 A;  1AUC A;  5CRD A;  2CAI A;  2FWF A;  1ERT A;  2FWE A;  3WT1 A;  2VL2 C;  5DAK A;  2VL3 A;  5ECQ B;  5KOW A;  1VF1 A;  2IJY A;  4ISD A;  4JR6 A;  3D4M A;  4RQX A;  5DQY A;  4ZL9 A;  2EC4 A;  4PXO A;  3WD6 A;  1WMJ A;  3IHG A;  2F3M A;  2IL3 A;  4FH8 A;  2C3Q A;  1F6M C;  2VO4 A;  4K8M A;  3TRP A;  3F4T A;  4EC0 A;  1YQ1 A;  4KCE A;  4HDE A;  1B4Q A;  1UVZ A;  2AJQ B;  5B8B A;  4A5P A;  4ECB A;  4TW5 A;  2GT6 A;  1OVN A;  2RUF A;  3WGX A;  2OKA A;  3A2V A;  5IPG A;  2PVQ A;  3C8E A;  3IA1 A;  2E2M A;  1T7P B;  5ECI B;  2B5X A;  4NPB A;  4TR4 A;  3M9K A;  3APO A;  3UOM A;  2A2R A;  1NM3 A;  3DD3 A;  1V98 A;  1Z3E A;  5G5F A;  4EF0 A;  5IOW A;  2L5O A;  3K8N A;  3FK8 A;  1AIU A;  1AQV A;  3ZMK A;  2VUP A;  3F8U A;  4F03 A;  1HNC A;  4PNF A;  1NHO A;  2RM6 A;  3EE2 A;  2FLS A;  1K0A A;  2AAW A;  2E2G A;  2LJK A;  2GZY A;  14GS A;  1FO5 A;  1QQ2 A;  2H72 A;  1GH2 A;  1AAZ A;  3ZL5 A;  4TR1 B;  1A2L A;  2HNL A;  2N5B A;  1OC9 A;  2MMO A;  1DBY A;  1YZX A;  3L4N A;  4PQH A;  4ZIJ A;  5B8A A;  4FYC A;  1FOV A;  3JCM L;  4GSS A;  3VWU A;  4EO3 A;  5D9V A;  5ECH B;  3F0I A;  3UIW A;  1ST9 A;  1F37 A;  3MWH A;  5G2Z A;  5CRE A;  1OYJ A;  2FUG 2;  4POM A;  3TJJ A;  4EIP A;  4XS4 A;  9GSS A;  3C1R A;  1PX6 A;  2L59 A;  3VLN A;  3TJG A;  4WF4 A;  3QDN A;  3A2X A;  4KA0 A;  5F8B A;  1GUM A;  4GF0 A;  4BVY B;  2KP1 A;  3KMO A;  4KF9 A;  2WB9 A;  3G7Y A;  1KNG A;  2DSA A;  4ZB9 A;  4K1F A;  1YY7 A;  1SU9 A;  2PPT A;  4MH2 A;  5BRT A;  3R2Q A;  3VPQ A;  3TOT A;  1G7E A;  1OKT A;  4WBR D;  2E0Q A;  2YWM A;  3UBL A;  3FR6 A;  3LWA A;  2MBS A;  1ERV A;  1O85 A;  1SJ6 A;  2Z9S A;  4ML6 A;  1Y6E A;  2P5Q A;  1ON4 A;  1KEB A;  4KE3 A;  2HE3 A;  4JBB A;  1M9B A;  4MP4 A;  2F51 A;  2X49 A;  3CXG A;  3EYT A;  4FO5 A;  4YQV A;  1GUK A;  2H71 A;  1T4Z A;  1R5P A;  3C7M A;  3D21 A;  1PMT A;  4YH2 A;  1XWC A;  4IQ1 A;  4OMV A;  4PQI A;  2VLT A;  3TKR A;  2X8C A;  4J56 E;  1ACV A;  1HNA A;  1TKD B;  1EEM A;  3SWL A;  1FHE A;  5G5E A;  1JZR A;  4YAP A;  1ILO A;  3O6T A;  1S3C A;  2O7K A;  2YPM A;  3Q19 A;  4TXO A;  1WE0 A;  3ME8 A;  16GS A;  4BL7 A;  3G7I A;  2PMT A;  5D9X A;  4KX4 A;  3HKR A;  5LCZ A;  2OAC A;  5CYY A;  1X5E A;  3GST A;  4MZB A;  4X1U A;  4PUR A;  4HJM A;  2VM1 A;  4KND A;  3DEX A;  2V6O A;  3DVX A;  3ED3 A;  1LBK A;  2NTO A;  1FOH A;  4KCA A;  3VWW A;  2R2J A;  4MJE A;  4PX1 A;  1V2A A;  3M3M A;  3LQ7 A;  1V57 A;  4HJ2 A;  2ON5 A;  3GRX A;  1M7T A;  4XTS A;  4Q5R A;  6GSV A;  3C1S A;  5CP1 A;  4IP1 A;  3CRT A;  4P3Y B;  3P90 A;  5ECN B;  1EGR A;  4IHU A;  4OCE A;  1THO A;  4JR4 A;  1SL2 B;  4IVF A;  4DEJ A;  1T3B A;  1A0R P;  5ENU A;  4MDC A;  3TGZ A;  2B6M A;  1Y25 A;  3V1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...