3DVXA

Crystal structure of reduced dsba3 from neisseria meningitidis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
191
structure length
191
Chain Sequence
GYALTEGEDYLVLDKPIPQEQSGKIEVLEFFGYFCVHCHHFDPLLLKLGKALPSDAYLRTEHVVWQPEMLGLARMAAAVNLSGLKYQANPAVFKAVYEQKIRLENRSVAGKWALSQKGFDGKKLMRAYDSPEAAAAALKMQKLTEQYRIDSTPTVIVGGKYRVIFNNGFDGGVHTIKELVAKVREERKRQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Biochemical and structural study of the homologues of the thiol-disulfide oxidoreductase DsbA in Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis mc58
molecule tags Oxidoreductase
total genus 55
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3dvxA00
3NOFA 2X8CA 1NSWA 1OC9A 4GSNA 3FR6A 1BX9A 5HR3A 1KNGA 5IO0A 5FWGA 2VL9A 3CXGA 1FOVA 1SL1B 3KP8A 1TXXA 3EWLA 1T7PB 1ML6A 3TOTA 1UA5A 2AV4A 3UAPA 4V2MA 3ZMKA 3SWLA 1UN2A 5ENUA 1T4YA 1OE7A 1GTBA 2BMXA 5F06A 1M9AA 3H93A 3D5JA 3VI5A 4NV5A 4O32A 1V98A 2DMMA 4KGIA 4KX4A 3MWHA 1WWJA 1TI3A 3ME8A 3LQ7A 4MK3A 1VF3A 2CZ2A 2ON7A 4RUVA 2XBQA 3EURA 3PINA 4K0NA 2VCTA 3DWVA 3VI7A 2MYGA 5F05A 1GSYA 5DALB 1GNEA 1QGVA 18GSA 1RK4A 5ELGA 1S3CA 1ZL9A 8GSSA 4G19A 3GKXA 2OE1A 2H6ZA 4BWQA 1QMVA 2I4AA 3GKKA 1EV4A 10GSA 3ZIJA 4ECJA 1GUMA 3D6IA 1PD21 2OE0A 4MH2A 2YWMA 1PMTA 3M0FA 1HD2A 2N5FA 3L9VA 3VWUA 2HRFA 5AIXA 5CP1A 1WMJA 5ECMB 5HFKA 2HI7A 3GKNA 1WIKA 4MABA 1Z9HA 4N11A 2DJKA 3TGZA 2HLSA 1V40A 4PUAA 4BVYA 14GSA 2PU9C 2TRCP 1MDJA 2VCQA 3KJYA 5A4UA 2TRXA 3F4TA 5KN0A 2IIYA 3D22A 1G7OA 4IW9A 2C3QA 2VM1A 4XHMA 3F6DA 3FHKA 1TKDB 1WOUA 3QR6A 2IFQA 3A2XA 1G6WA 2N5BA 3HY2A 5LD0A 2XBIA 2K8SA 3IXRA 4MJAA 2GS3A 1T00A 3MDKA 3FK8A 4DSQA 5A5KA 1Z6NA 3GHAA 1M7TA 4DVCA 2WFCA 5EY6A 3LXTA 1FB0A 4ECCA 5CREA 5ECIB 4XTSA 1YF0A 1S3DA 4EC0A 1BQ7A 1TTZA 4GQFA 2BJXA 3HVXA 1O7UA 3ZRDA 2L5LA 4IP1A 1M2AA 4K6XA 2YWNA 5AGYA 1PA3A 1XWGA 1X9WB 2PN8A 1Q98A 4L5LA 5D96A 1S3AA 4ZBDA 2YJ7A 1DUGA 1V2AA 2WGRA 2H73A 4MCUA 1XWAA 3GX8A 3M8NA 2LJKA 2H0GA 22GSA 3VPQA 3EINA 4D73B 2H1DA 1PQNA 4WXTA 3NZNA 2O87A 1DE2A 2GVPA 3MAKA 2NDOA 2HXKA 3H79A 2MMAA 17GSA 4F0BA 3BBYA 4IN0A 2LQQA 2K6VA 3HZ8A 5DCHA 1A8YA 4ZB9A 2R6KA 2A2SA 4MJCA 1ZCPA 4HJ2A 5HR1A 1U87A 5HQPA 1M2BA 3QMXA 1ERWA 4EO3A 2GT5A 3G9BA 1V58A 1F2EA 2FGXA 1X5EA 3P7XA 3ED3A 4AGSA 2YCDA 2REMA 4D73A 2RIIA 1B9XC 2L57A 1HQOA 2DMLA 3ZYWA 20GSA 3Q19A 3QCPA 5CYYA 1QK8A 3E0UA 2A4VA 1MTCA 4OCEA 1MEKA 2FLSA 1GL8A 5A4VA 4WBJA 3GX0A 3K8NA 1GSSA 4PQ1A 4NAXA 1F37A 5D8IA 1O8XA 3RBTA 2IMIA 4KA0A 4TKYA 2H72A 1GUHA 1XW9A 2MBTA 5G1KA 1JZWA 5IOWA 3IPZA 4CDOA 4ULXA 4PX1A 5ECLB 3QFBC 3TCOA 4XS4B 1H75A 3FY7A 3GURA 4EVMA 4KDXA 1SL0B 3I6AA 1CQGA 2FCHA 3RHBA 4WR4A 4AJ7A 2RLIA 4KSOA 5DQYA 3Q6OA 4DEJA 5GAND 4BA7A 4LLRA 3APQA 1AW9A 1E2YA 2H1BA 3QD9A 4MH3A 1EWXA 5G2ZA 5B8AA 1ERVA 4QQ7A 4FYCA 4YH2A 3UBLA 3EC3A 4X43A 3GH6A 5JCGA 3GL3A 4MF6A 3W6GA 5J9CA 5J3RA 2YJHA 4JRRA 2YV9A 1JLVA 4IBPA 3IAM2 3UJ1A 1FW1A 3LORA 5ABRA 5E4WA 3TOUA 4F2IA 2C3TA 1EEMA 2H30A 3DIEA 4HU9A 2HSYA 1YEXA 2VLUA 5LNKe 3UMAA 4K7OA 4X1UA 1ZOFA 3IHQA 1JZOA 1J08A 2LRNA 3A3TA 3F4SA 4PNFA 1TU7A 3TKRA 5CRDA 1O81A 1H4OA 2FUG2 1GSEA 5G1LA 1X9MB 3M9JA 1WP0A 1NM3A 1DSBA 1NHOA 1PL1A 2LNSA 4OFTA 4OFMA 3UVHA 1AQVA 3EMXA 4F0CA 4IGJA 2CVDA 4V2NA 3UBKA 2AUVA 5B8BA 1PSQA 2GT6A 3HCZA 1EOHA 2H0HA 5IOXA 2NTOA 1O85A 4OWYA 1XVWA 2B1KA 4TXVA 4ZL8A 1ERUA 3GL5A 3HA9A 2VD1A 3LEFA 5G5FA 1K0NA 2V2GA 4EUYA 1JHBA 3DMLA 4MMMA 2H76A 4WF5A 2H71A 1XOAA 4ZIJA 4DSRA 3LYPA 3L4NA 1XZOA 1JLWA 2V32A 2MMNA 5JWOB 3HJOA 1TJDA 2M72A 4TW5A 3MNGA 1LU4A 2BTOT 1TRUA 3LG6A 1I9DA 1UC7A 3GSTA 2EC4A 5DBQA 4ECIA 3GIXA 3CBUA 3ERFA 1R5AA 4LA1A 4L5OA 1XOBA 2WZ9A 1R26A 3GYKA 3I9V2 4RI6A 5EL8A 2XPDA 4I2UA 3ERWA 1N2AA 5GSSA 1KEBA 2OBIA 2ON5A 1SKWB 3HVSA 2GQKA 1SYXA 3QDNA 4GLTA 2GLRA 1EZKA 2LEGA 2RM5A 1YZXA 3TKSE 2H0IA 1JFUA 2B1LA 1GSQA 3G7YA 4TOPA 3PGTA 4EE0A 3UIWA 1YF1A 3GV1A 2KUCA 2VOCA 3S9FA 3RPNA 5ECQB 1F9MA 2KP1A 3OR5A 4MPFA 3O3TA 3DRNA 2OKAA 2FD3A 5CRHA 1ZZYA 2VCWA 5ELAA 1G0TA 2HFDA 4TR1B 1E6BA 2AAWA 4RI7A 4N10A 1K0CA 3DKSA 3D0ZA 3KH9A 4HQSA 3IRAA 2J23A 1TK8B 1G7EA 2LV3A 2L6CA 5G30A 1OKDA 3GH9A 3ISOA 4XS1A 1TDIA 1GNWA 4MPGA 4LMWA 2HZFA 2RUFA 1PX6A 4POLA 4I6XA 3TDGA 5D93A 3IR4A 3UARA 2GSQA 3E3EA 2FA8A 1OE8A 4Z7XA 2DLXA 5J41A 3QAWA 13GSA 4TN8A 16GSA 2CVKA 1FB6A 2QC7A 2PVQA 2RM6A 4JZQA 4KW6A 1KTEA 4TR3A 4OFNA 1WPIA 2PUKC 5CNWA 3LWAA 1SD9A 4V2LA 2JADA 1W89A 2GZZA 2LKUA 4ISDA 1SYRA 2VCZA 5B7CA 4O7HA 3LSZA 1SK1A 4MJBA 2PWJA 5ECHB 1SJZA 2F51A 4WEYA 3FKFA 6GSYA 3ERGA 3TJBA 2KOKA 5DALA 3WGEA 4CW9A 5H5RA 5L71A 2OA7A 4K8MA 2LTKA 1XW6A 1GLQA 2FWFA 2V1MA 3H8QA 4K7NA 2MBSA 4ZILA 1ZMAA 4Q5NA 1A24A 1NHYA 1GTUA 4MDCA 5ECRB 3BCIA 5JCUA 1XFLA 3KGKA 3J7Yb 1FAAA 4IVFA 5E59A 5IIZA 3APSA 4KUNA 4KCEA 3L9SA 4PGTA 3GKMA 2DBCA 4IHUA 2B5YA 4ML1A 1XBSA 2L5OA 3C7MA 1SJ6A 5DQSA 1USBA 2I3YA 5F8BA 5D9TA 2VL2A 3V1WA 4L0WA 4KAEA 2WULA 1FHEA 4I8BA 1A8LA 1PKZA 4K2DA 1HNCA 4MP4A 4L0UA 2P31A 2IPAA 5D9VA 5ECOB 3VWXA 4ZL9A 2O8VB 4IQ1A 4IKHA 2PVOC 2WS2A 3WD6A 1SU9A 1K0DA 5INYA 4GSSA 2V6KA 4N0VA 5JWQB 2G0FA 2I9HA 2OBKA 6GSVA 1URMA 2B7KA 1AUCA 1ZYQB 2A2RA 2VLTA 19GSA 4PQHA 4EDZA 4IJIA 2YZUA 3ZLPA 4NHWA 3UOMA 1K3LA 1B4PA 5IQYA 1K0MA 4J56E 1ST9A 2YV7A 1JZRA 2L4QA 2NVLA 1AQXA 2E2GA 1YJ6A 4KCAA 5IMAA 1BAYA 2J9HA 1ILOA 3ZFLA 3EMPA 4Q5QA 5IM9A 4BWSA 1OKTA 4ID0A 2EIOA 1GH2A 5ECSA 2C0FA 3G7JA 1ACVA 2WB9A 2B7JA 5IPGA 1X5CA 3N5OA 3TJKA 3VURA 2LQOA 3KIJA 1SENA 4NXIA 4GXZA 3H4KA 2KHPA 2VM2A 2H01A 4HJMA 1EP8A 1PN9A 1TP9A 1ON4A 2ZUPA 2O89A 5CRWA 3FZAA 3FZ9A 5KN2A 1HNAA 2C80A 2JSYA 3L9UA 2B5EA 1F6MC 2E7PA 4WF4A 2HSHA 5JCWA 1X0RA 3W8SA 2CX3A 1BG5A 1ZYEA 2M46A 4P3YB 1QUWA 4FH8A 3QAVA 1U88A 2VO4A 2XC2A 4AJ6A 2DSAA 1M99A 3I43A 2VL2C 5DJMA 5EVOA 3US3A 1YDKA 3ZIVA 2R3XA 4TXOB 3VPTA 1ZGNA 3ZREA 2L59A 4ILFA 5ECPB 3SBCA 3BCKA 2YOIA 3TJJA 5LCZA 3UVTA 4F82A 4K0GA 4PNGA 5HFGA 3TRXA 2LSTA 2YANA 3FR9A 4XIHA 3P90A 5D9XA 3F3RA 4NWYA 1Z5YE 2WDUA 2FWGA 2DJ3A 1TRSA 1QQ2A 2YWIA 3UEMA 3GFKA 5GSTA 4XS4A 1N8JA 1LJRA 3CTFA 3O6TA 1HYUA 4TXOA 4ZB8A 4POBA 4MF5A 1AQWA 1K3OA 1J9BA 1MD4A 5COHA 2LRTA 3CMIA 1XXUA 2FNOA 3GA4A 1YQ1A 3EU4A 1XIYA 1F3AA 1XCCA 4JR6A 2NPBA 4KSMA 2YP6A 4H86A 2VUPA 4TR0A 5F0GA 3F0IA 2MMZA 3D21A 3ZZXA 2L4CA 1R4WA 3BJ5A 2KP2A 2VD0A 3CRUA 1EGOA 1O73A 1T3BA 3RPPA 2YZHA 2H74A 4JEDA 4X0XA 5DCGA 1X5DA 4ZBBA 1SD8A 4FO5A 4Q5FA 3FZ5A 4QL9A 5DJLA 4DSSB 2P5RA 3G7IA 4NPBA 3IAS2 5GAPD 2GDRA 5D9WA 4PXOA 3ZITA 3DXBA 1K3YA 4V1Ag 3P8WA 3WGXA 2FA4A 5IMCA 2C1YA 4XS6A 3HKRA 1Y6EA 3A5WA 2FWHA 5J4UA 1WRYA 2D2ZA 4O92A 5AN1A 4ECBA 4XRDA 1A2MA 3VFIA 3M3MA 4DSSA 3TJGA 1V57A 4NHZA 3KP9A 1UVZA 1GSUA 2F9SA 2H19A 1MDIA 1TK5B 2JZTA 4I97A 2VIMA 3HZ4A 5FT3A 3LGCA 3KCMA 4FIWA 5H5QA 3F3QA 4QL7A 3D4TA 1GP1A 4IQAA 1A2LA 4GWRA 1O8WA 4EL1A 5CRGA 3A2WA 3CSIA 1PRXA 3GUSA 1RW1A 3C8EA 4JU5A 3TUEA 4G2EA 1B8XA 3EYTA 1K0AA 1TK0B 2R37A 4HZ2A 4YAVA 4YQVA 2OACA 1FVJA 2XHFA 5A4WA 2FY6A 1OC9B 3HYPA 3KXOA 2KLXA 3Q18A 3AY8A 5FHIA 3TB2A 1GTIA 1XWCA 1XW5A 1TRVA 3C73A 3DD3A 3F4RA 4N0ZA 4I2TA 3RHCA 2C0GA 4HEA2 4EF0A 4WETA 2ZNMA 3I69A 2H66A 2DIYA 3IV4A 2K9FA 3L78A 2WRTA 2RUEA 3VLNA 3QFAC 2CVBA 3F8UA 4BPYA 3LJRA 4MF7A 3M1GA 2H70A 2JACA 2PERA 3TRQA 2O85A 3LXZA 2IWTA 1OAZA 4MA9A 2VLVA 3J7Yk 3KM6A 3P2AA 3VK9A 1GTAA 3KZQA 3F6FA 3DGQA 4IELA 4TR1A 4K1FA 3WGDA 2LS5A 3HJMA 3GTUB 1M9BA 3IDVA 2WCIA 3FYGA 2ES7A 2GQLA 3WT2A 1B4QA 2JL4A 1SKRB 2C4JA 3BOAA 4HZ4A 1Z6MA 4J2FA 2DJ2A 3APOA 5IMFA 2CAQA 1PKWA 2MMOA 3PH9A 3EE2A 3Q74A 4YQMA 2IMDA 3TJFA 2DJ0A 2O7KA 6GSTA 1VF4A 1U3AA 2XPEA 1YY7A 3IA1A 1GUKA 4KDUA 4G9HA 1Q4JA 3GTUA 3IE3A 2WJUA 3U6VA 3ME7A 2V6OA 2F8AA 3W8JA 2X8HA 1HNBA 4IP6A 1A23A 3IK9A 4OO4A 3ZTLA 2M80A 2VCXA 1AAZA 2FHEA 4ZBAA 2CQ9A 5EPFA 5CAXA 3BD2A 1TI1A 6GSXA 1WE0A 3DVXA 2AB6A 2IFQB 4TRXA 4HOJA 4POMA 2GQMA 2B3SA 1B48A 1KBNA 3QOUA 5IMVA 2JZSA 1VGLA 5ID2B 4MJEA 1THOA 2I1UA 5IPHA 1SK2A 5DAKB 1J0FA 2EIRA 3ZMLA 4GQCA 1EGRA 1YKCA 2B5XA 4CHSA 2DJJA 1DBYA 3TKSA 2YWOA 2H1AA 3HDCA 2L6DA 4PURA 4JE1A 2LUSA 3IBHA 3VWWA 1XVQA 2Z9SA 1B9YC 3GNJA 2GSTA 1QFNA 3RDWA 2LNTA 4POKA 6GSWA 4PUFC 3C1SA 5ID2A 1GLPA 3ZVJD 3FEUA 4O5RA 4HS1A 2R2JA 2CV4A 5DAKA 4XRAA 2N5AA 2OE3A 2IMKA 4WKWA 5HFIA 3L0HA 1TRWA 3IC4A 2HT9A 2P0GA 3N9JA 5IMZA 5IMDA 3HVVA 3JCML 3QAGA 1OC8A 1U3IA 3QPMA 4FYUA 4EKZA 2LRCA 1RQMA 1XPVA 1R5PA 2PMTA 1VRSD 2AJQB 5ECKB 3KMNA 1IYIA 1A0FA 3WYWA 1F3BA 3KMOA 2CZ3A 4OO5A 3D4MA 4YAPA 3U5RE 5DDLA 2LJRA 3HXSA 4HDEA 4EXJA 3HJPA 3CRTA 2F3MA 4RQRA 1O6JA 3KD0A 5KEJA 4V1Ap 1QXHA 4ZL7A 2LJAA 3GRXA 4TR4A 2VAFA 4ML6A 2R5GA 2I81A 2QSIA 4LMVA 2E0QA 2GGTA 2VL3A 3GN3A 2IJYA 4E8HA 4ACSA 2R4VA 3WT1A 2GSRA 2IL3A 4XCSA 3DYRA 1EP7A 4MLYA 2MZCA 2YN1A 4OMVA 5F07A 3R2QA 2AYTA 1K0OA 3PR8A 1FVKA 1EV9A 1AC1A 2H8LA 5G31A 4J57E 3KEBA 5D73A 5H5SA 3FZ4A 4KE3A 2K18A 2CX4A 5J9BA 5JWRB 4GF0A 3TKSC 3TKQA 4IS0A 2C3NA 7GSSA 4MZBA 2GZYA 4BL7A 2B6MA 1EOGA 4JR4A 2QGVA 2QKEA 2P5QA 2OADA 3CSHA 4GSTA 4HI7A 3O76A 1M0UA 1TW9A 1W4VA 5AIVA 2GZPA 4E8EA 1CQHA 3EU3A 2EIQA 2C0DA 3C71A 3C1RA 1OC3A 3KH7A 2HE3A 1WJKA 4BVXA 4N30A 1NW2A 1SKSB 1C72A 5GZZB 4TVEA 3LYKA 1DE1A 2VCVA 1VF1A 1U6TA 2H75A 2PPTA 2TIRA 2IN3A 1T4ZA 11GSA 1FO5A 1I5GA 1YEPA 2DC5A 1T8EB 2YPMA 5AISA 5B6MA 2ALBA 12GSA 5CO3A 3FRCA 3DVWA 4JBBA 4LL4B 4NMUA 2C8UA 2X99A 9GSSA 2DIZA 1V9WA 2DJ1A 4L8EA 1ABAA 2JSZA 2CA8A 5J5NA 1Y25A 2G2QA 2HZEB 2NBSA 3MSZA 1PGTA 4ZB6A 4FYBA 2HYXA 5C00A 4I5QA 6GSUA 1SK0A 1K0BA 1MDKA 1M2DA 1T1VA 2HRNA 1G6YA 4LL1B 1BEDA 2GTUA 4K9ZA 1Z3EA 4KDYA 2GSSA 3F9UA 5HR2A 4KH7A 1A0RP 2E2MA 3NIVA 2YNXA 2AHEA 3M9KA 5C04A 1XWKA 4YQUA 1THXA 2OJLA 4KNDA 1YKAA 3GMFA 4F03A 4G10A 4OCFA 5G5EA 4GTUA 2HZEA 1JZDA 4RQXA 3FR3A 5DVBA 1XWBA 1AXDA 1GWCA 3GSSA 2JZRA 3LFLA 4PQIA 6GSSA 4K7IA 2ZCTA 2K8VA 2H1GA 5B6NA 3EVIA 4HQZA 1GSFA 1R7HA 2H6XA 3CSJA 1Z7PA 1SJIA 2FWEA 3TKPA 3A2VA 1TU8A 4AJ8A 1FG4A 5ECNB 1BYEA 4WR5A 2F8FA 3FW2A 4OD7A 3ZFBA 3ZL5A 3DEXA 1IYHA 1VF2A 2HNLA 1OVNA 1A2JA 2CAIA 2CT6A 1SL2B 3E9JB 2C0EA 3IOSA 3RAZA 1TOFA 4WBRD 3IK7A 4ZXGA 2H6YA 4F9ZA 4MZWA 3F63A 3HD5A 1Z7RA 4GRFA 1OYJA 1AIUA 1PL2A 1X9SB 3KTLA 5KN3A 1MD3A 4NV2A 3HHVA 3CTGA 2JU5A 1GULA 2IMEA 4GCIA 3TRPA 2IMFA 4HUAA 3CYNA 4EDYA 5IO2A 1EEJA 3H1NA 2V41A 4AF2A 2X64A 4Q5RA 1BJXA 1GSDA 5HR0A 5KN1A 3KTBA 3UL3A 1GRXA 1PX7A 2X8GA 4HU7A 3VWVA 3ZVJA 2PGTA 1LBKA 4KB3A 1ERTA 4IJ3A 2PBJA 4MZCA
chains in the Genus database with same CATH superfamily
3NOFA 2X8CA 1NSWA 1OC9A 4GSNA 3FR6A 4G0LA 1BX9A 5HR3A 2A2PA 1KNGA 5IO0A 5FWGA 2VL9A 3CXGA 1FOVA 1SL1B 3KP8A 1TXXA 3EWLA 1T7PB 1ML6A 3TOTA 1UA5A 2AV4A 3UAPA 4V2MA 3ZMKA 3SWLA 1UN2A 5ENUA 1T4YA 1OE7A 1GTBA 2BMXA 5F06A 1M9AA 3H93A 3D5JA 3VI5A 4NV5A 4O32A 1V98A 2DMMA 4KGIA 4KX4A 3MWHA 1WWJA 1TI3A 3ME8A 3LQ7A 4MK3A 1VF3A 2CZ2A 2ON7A 4RUVA 2XBQA 3EURA 3PINA 4K0NA 2VCTA 3DWVA 3VI7A 2MYGA 5F05A 1GSYA 5DALB 1GNEA 1QGVA 18GSA 4BVYB 5BMUA 1RK4A 5ELGA 1S3CA 1ZL9A 8GSSA 4G19A 3GKXA 2OE1A 2H6ZA 4BWQA 1QMVA 2I4AA 3GKKA 4MNNA 1EV4A 3MIXA 10GSA 3ZIJA 4ECJA 1GUMA 3D6IA 1PD21 2OE0A 4MH2A 2YWMA 1PMTA 3M0FA 1HD2A 4YKGA 2N5FA 3L9VA 3VWUA 2HRFA 5AIXA 5CP1A 1WMJA 5ECMB 5HFKA 2HI7A 3GKNA 1WIKA 4MABA 1Z9HA 4N11A 2DJKA 3TGZA 2HLSA 1V40A 4PUAA 4BVYA 14GSA 2PU9C 2TRCP 1MDJA 2VCQA 3KJYA 5A4UA 2TRXA 3F4TA 5KN0A 2IIYA 3D22A 1G7OA 4IW9A 2C3QA 2VM1A 4XHMA 3F6DA 1PN0A 3FHKA 1TKDB 1WOUA 3QR6A 2IFQA 3A2XA 1G6WA 2N5BA 3HY2A 5LD0A 2XBIA 2K8SA 3IXRA 4MJAA 2GS3A 1T00A 3MDKA 3FK8A 4DSQA 5A5KA 1Z6NA 3GHAA 1M7TA 4DVCA 2WFCA 5EY6A 3LXTA 1FB0A 4ECCA 5CREA 5ECIB 4XTSA 1YF0A 1S3DA 4EC0A 1BQ7A 1TTZA 4GQFA 2BJXA 3HVXA 1O7UA 3ZRDA 2L5LA 4IP1A 1M2AA 4K6XA 2YWNA 5AGYA 1PA3A 1XWGA 1X9WB 2PN8A 1Q98A 4L5LA 5D96A 1S3AA 4G0IA 4ZBDA 2YJ7A 1DUGA 1V2AA 2WGRA 2H73A 4MCUA 1XWAA 3GX8A 3M8NA 2LJKA 2H0GA 22GSA 3VPQA 4USSA 3EINA 4D73B 2H1DA 1PQNA 4WXTA 3NZNA 2O87A 1DE2A 2GVPA 3MAKA 2NDOA 2HXKA 3H79A 2MMAA 17GSA 4F0BA 3BBYA 4IN0A 2LQQA 2K6VA 3HZ8A 5DCHA 1A8YA 4ZB9A 2R6KA 2A2SA 4MJCA 1ZCPA 4HJ2A 5HR1A 1U87A 5HQPA 1M2BA 3QMXA 1ERWA 4CY8A 4EO3A 2GT5A 3G9BA 1V58A 1F2EA 2FGXA 1X5EA 3P7XA 3ED3A 4AGSA 2YCDA 2REMA 4D73A 2RIIA 1B9XC 2L57A 1HQOA 2DMLA 3ZYWA 20GSA 3Q19A 3QCPA 5CYYA 1QK8A 3E0UA 2A4VA 1MTCA 4OCEA 1MEKA 2FLSA 1GL8A 5A4VA 4WBJA 3GX0A 3K8NA 1GSSA 4PQ1A 4NAXA 1F37A 5D8IA 1O8XA 3RBTA 2IMIA 4KA0A 4TKYA 2H72A 1GUHA 1XW9A 2MBTA 5G1KA 1JZWA 5IOWA 3IPZA 4CDOA 4ULXA 4PX1A 5ECLB 3QFBC 3TCOA 4XS4B 1H75A 3FY7A 3GURA 4EVMA 4KDXA 1SL0B 3I6AA 1CQGA 2FCHA 3RHBA 4WR4A 4AJ7A 2RLIA 4KSOA 5DQYA 3Q6OA 4DEJA 5GAND 4BA7A 4LLRA 1PFOA 3APQA 1AW9A 1E2YA 2H1BA 3QD9A 4MH3A 1EWXA 5KOWA 5G2ZA 5B8AA 1ERVA 4QQ7A 4FYCA 4YH2A 3UBLA 3EC3A 4X43A 3GH6A 5JCGA 3GL3A 4MF6A 3W6GA 5J9CA 5J3RA 2YJHA 4JRRA 2YV9A 1JLVA 4IBPA 3IAM2 3UJ1A 1FW1A 3LORA 5ABRA 5E4WA 3TOUA 4F2IA 2C3TA 1EEMA 2H30A 3DIEA 4HU9A 2HSYA 1XG8A 1YEXA 2VLUA 5LNKe 3UMAA 4K7OA 4Z2UA 4X1UA 3IHGA 1ZOFA 3IHQA 1JZOA 1J08A 2LRNA 3A3TA 3F4SA 4PNFA 1TU7A 3TKRA 5CRDA 1O81A 1H4OA 2FUG2 1GSEA 5G1LA 1X9MB 3M9JA 1WP0A 1NM3A 1DSBA 1NHOA 1PL1A 2LNSA 4OFTA 4OFMA 3UVHA 1AQVA 3EMXA 4F0CA 4IGJA 2CVDA 4V2NA 3UBKA 2AUVA 5B8BA 1PSQA 2GT6A 3HCZA 1EOHA 2H0HA 5IOXA 2NTOA 1O85A 4OWYA 1XVWA 2B1KA 4TXVA 4ZL8A 1ERUA 3GL5A 3HA9A 2VD1A 3LEFA 5G5FA 1K0NA 2V2GA 4EUYA 1JHBA 3DMLA 4MMMA 2H76A 4WF5A 2H71A 1XOAA 4ZIJA 4DSRA 3LYPA 3L4NA 1XZOA 2DKIA 1JLWA 2V32A 2MMNA 5JWOB 3HJOA 1TJDA 2M72A 4TW5A 3MNGA 1LU4A 2BTOT 1TRUA 3LG6A 1I9DA 1UC7A 3GSTA 2EC4A 5DBQA 4ECIA 3GIXA 3CBUA 3ERFA 1R5AA 4LA1A 4L5OA 1XOBA 2WZ9A 1M3JA 1R26A 3GYKA 3I9V2 4RI6A 5EL8A 2XPDA 4I2UA 3ERWA 1N2AA 5GSSA 1KEBA 2OBIA 2ON5A 1SKWB 3HVSA 2GQKA 1SYXA 3QDNA 4GLTA 2GLRA 4Z2RA 1EZKA 2LEGA 2RM5A 1YZXA 3TKSE 2H0IA 1JFUA 2B1LA 1GSQA 3G7YA 4TOPA 3PGTA 4EE0A 3UIWA 1YF1A 3GV1A 2KUCA 2VOCA 3S9FA 3RPNA 5ECQB 1F9MA 2KP1A 3OR5A 4MPFA 3O3TA 3DRNA 2OKAA 2FD3A 5CRHA 1ZZYA 2VCWA 5ELAA 1G0TA 2HFDA 4TR1B 1E6BA 2AAWA 4RI7A 4N10A 1K0CA 3DKSA 3D0ZA 3KH9A 4HQSA 3IRAA 2J23A 3HVNA 1TK8B 1G7EA 2LV3A 2L6CA 5G30A 1OKDA 3GH9A 3ISOA 4XS1A 2QA2A 1TDIA 1GNWA 4MPGA 4LMWA 2HZFA 2RUFA 1PX6A 4POLA 4I6XA 3TDGA 5D93A 3IR4A 3UARA 3FMWA 2GSQA 3E3EA 2FA8A 1OE8A 4Z7XA 2DLXA 5J41A 3QAWA 13GSA 4TN8A 16GSA 2CVKA 1FB6A 2QC7A 2PVQA 2RM6A 4JZQA 4KW6A 1KTEA 2A4HA 4TR3A 4OFNA 1WPIA 2PUKC 5CNWA 3LWAA 1SD9A 4V2LA 2JADA 1W89A 2GZZA 2LKUA 4ISDA 1SYRA 2VCZA 5B7CA 4O7HA 3LW9A 3LSZA 1SK1A 4MJBA 2PWJA 5ECHB 1SJZA 2F51A 4WEYA 3FKFA 6GSYA 3ERGA 3TJBA 2KOKA 5DALA 3WGEA 4CW9A 5H5RA 5L71A 2OA7A 4K8MA 2LTKA 1XW6A 1GLQA 2FWFA 2V1MA 3H8QA 4K7NA 2MBSA 4ZILA 1ZMAA 4Q5NA 1A24A 1NHYA 2HRAA 1GTUA 4MDCA 5ECRB 3BCIA 5JCUA 1XFLA 3KGKA 3J7Yb 1FAAA 4IVFA 5E59A 5IIZA 3APSA 4YKFA 4EIPA 4KUNA 4KCEA 2X49A 3L9SA 4PGTA 3GKMA 2DBCA 4IHUA 2B5YA 4K5RA 4ML1A 1XBSA 2L5OA 3C7MA 1SJ6A 5DQSA 1USBA 2I3YA 5F8BA 5D9TA 2VL2A 3V1WA 4L0WA 4KAEA 2WULA 1FHEA 4I8BA 1A8LA 1PKZA 4K2DA 1HNCA 4MP4A 4ICYA 4L0UA 2P31A 2IPAA 5D9VA 5ECOB 3VWXA 4ZL9A 2O8VB 4IQ1A 4IKHA 2PVOC 2WS2A 3WD6A 1SU9A 1K0DA 5INYA 4GSSA 2V6KA 4N0VA 5JWQB 2G0FA 1ZYPA 2I9HA 2OBKA 6GSVA 1URMA 2B7KA 1AUCA 2DKHA 1ZYQB 2A2RA 2VLTA 19GSA 4PQHA 4EDZA 4IJIA 2YZUA 3ZLPA 4NHWA 3UOMA 1K3LA 1B4PA 5IQYA 1K0MA 4J56E 1ST9A 2YV7A 1JZRA 2L4QA 2NVLA 1AQXA 2E2GA 1M3IA 1YJ6A 4KCAA 5IMAA 1BAYA 2J9HA 1ILOA 3ZFLA 3EMPA 2UZ8A 4Q5QA 5IM9A 4BWSA 1OKTA 4ID0A 2EIOA 1GH2A 5ECSA 2C0FA 3G7JA 1ACVA 2WB9A 2B7JA 5IPGA 1X5CA 3N5OA 3TJKA 3VURA 2LQOA 3KIJA 1SENA 4NXIA 4GXZA 3H4KA 2KHPA 2VM2A 2H01A 4HJMA 1EP8A 1PN9A 1TP9A 1ON4A 2ZUPA 2O89A 5CRWA 3FZAA 3FZ9A 5KN2A 1HNAA 2C80A 2JSYA 3L9UA 2B5EA 1F6MC 2E7PA 4WF4A 2HSHA 5JCWA 1X0RA 2R0GA 3W8SA 2CX3A 1BG5A 1ZYEA 2M46A 4P3YB 1QUWA 4FH8A 3QAVA 1U88A 2VO4A 2XC2A 4AJ6A 2DSAA 1M99A 3I43A 2VL2C 5DJMA 5EVOA 3US3A 1YDKA 3ZIVA 2R3XA 4TXOB 3VPTA 1ZGNA 3ZREA 2L59A 4ILFA 5ECPB 3SBCA 3BCKA 2YOIA 3TJJA 5LCZA 3UVTA 4F82A 4K0GA 4PNGA 5HFGA 3TRXA 2LSTA 2YANA 3FR9A 4XIHA 3P90A 5D9XA 3F3RA 4NWYA 1Z5YE 2WDUA 2FWGA 2DJ3A 1TRSA 1QQ2A 2YWIA 3UEMA 3GFKA 5GSTA 4XS4A 1N8JA 1LJRA 3CTFA 3O6TA 1HYUA 4TXOA 4ZB8A 4POBA 4MF5A 1AQWA 1K3OA 1J9BA 1MD4A 5COHA 2LRTA 3CMIA 1XXUA 2FNOA 3GA4A 1YQ1A 3EU4A 1XIYA 1F3AA 1XCCA 4JR6A 2NPBA 4KSMA 2HRKA 2YP6A 4H86A 2VUPA 4TR0A 5F0GA 3F0IA 2MMZA 3D21A 3ZZXA 2L4CA 1R4WA 3BJ5A 2KP2A 2VD0A 3CRUA 1EGOA 1O73A 1T3BA 3RPPA 2YZHA 2H74A 4JEDA 4X0XA 5DCGA 1X5DA 4ZBBA 1SD8A 4FO5A 4Q5FA 3FZ5A 4QL9A 5DJLA 4DSSB 2P5RA 3G7IA 4NPBA 3IAS2 5GAPD 2GDRA 5D9WA 4PXOA 3ZITA 3DXBA 1K3YA 4V1Ag 3P8WA 3WGXA 2FA4A 5IMCA 2C1YA 4XS6A 3HKRA 1Y6EA 3A5WA 2FWHA 5J4UA 3A5IA 1WRYA 2D2ZA 4O92A 5AN1A 4ECBA 4XRDA 1A2MA 3VFIA 3M3MA 4DSSA 3TJGA 1V57A 4NHZA 3KP9A 1UVZA 1GSUA 2F9SA 2H19A 1MDIA 1TK5B 2JZTA 4I97A 2VIMA 3HZ4A 5FT3A 3LGCA 3KCMA 4FIWA 5H5QA 3F3QA 4QL7A 3D4TA 1GP1A 4IQAA 1A2LA 4GWRA 1O8WA 4EL1A 5CRGA 3A2WA 3CSIA 1PRXA 3GUSA 1RW1A 3C8EA 4JU5A 3TUEA 4G2EA 1B8XA 2HSMA 3EYTA 1K0AA 1TK0B 2R37A 4HZ2A 4YAVA 4YQVA 2OACA 3IC8A 4HSCX 1FVJA 4Z2TA 2XHFA 5A4WA 2FY6A 1OC9B 3HYPA 3KXOA 2KLXA 3Q18A 3AY8A 5FHIA 3TB2A 1GTIA 1XWCA 1XW5A 1TRVA 3C73A 3DD3A 3F4RA 4FQUA 4N0ZA 4I2TA 3RHCA 2C0GA 4HEA2 4EF0A 4WETA 4K2XA 2ZNMA 3I69A 2H66A 2DIYA 2QA1A 3IV4A 2K9FA 3L78A 2WRTA 2RUEA 3VLNA 3QFAC 2CVBA 3F8UA 4BPYA 3LJRA 4MF7A 3M1GA 2H70A 2JACA 2PERA 3TRQA 2O85A 3LXZA 2IWTA 1OAZA 3R3EA 4MA9A 2VLVA 3J7Yk 3KM6A 3P2AA 3VK9A 1GTAA 3KZQA 3F6FA 3DGQA 4IELA 4TR1A 4K1FA 3WGDA 2LS5A 3HJMA 3GTUB 1M9BA 3IDVA 2WCIA 3FYGA 2ES7A 2GQLA 3WT2A 1B4QA 2JL4A 1SKRB 2C4JA 3BOAA 4HZ4A 1Z6MA 4J2FA 2DJ2A 3APOA 5IMFA 2CAQA 1PKWA 2MMOA 3PH9A 3EE2A 3Q74A 4YQMA 2IMDA 3TJFA 2DJ0A 2O7KA 6GSTA 1VF4A 1U3AA 2XPEA 1YY7A 3IA1A 1GUKA 4KDUA 4G9HA 1Q4JA 3GTUA 4PTSA 3IE3A 2WJUA 3U6VA 3ME7A 2V6OA 2F8AA 3W8JA 2X8HA 1HNBA 4IP6A 1A23A 3IK9A 4OO4A 3ZTLA 2M80A 2VCXA 1AAZA 2FHEA 4ZBAA 2CQ9A 5EPFA 5CAXA 3BD2A 1TI1A 6GSXA 1WE0A 3DVXA 2AB6A 2IFQB 4TRXA 4HOJA 4POMA 2GQMA 2B3SA 1B48A 1KBNA 3QOUA 5IMVA 2JZSA 1VGLA 5ID2B 4MJEA 1THOA 2I1UA 5IPHA 1SK2A 5DAKB 1J0FA 2EIRA 3ZMLA 4GQCA 1EGRA 1YKCA 1FOHA 2B5XA 4CHSA 2DJJA 1DBYA 3TKSA 4K5SA 2YWOA 2H1AA 3HDCA 2L6DA 4PURA 4JE1A 2LUSA 3IBHA 3VWWA 1XVQA 2Z9SA 1B9YC 3GNJA 2GSTA 1QFNA 3RDWA 2LNTA 4POKA 6GSWA 4PUFC 3C1SA 5ID2A 1GLPA 3ZVJD 3FEUA 4O5RA 3MYDA 3CQFA 4HS1A 4BIKA 2R2JA 4O5UA 2CV4A 5DAKA 4XRAA 2N5AA 2OE3A 2IMKA 4WKWA 5HFIA 3L0HA 1TRWA 3IC4A 2HT9A 2P0GA 3N9JA 5IMZA 5IMDA 3HVVA 3JCML 3QAGA 1OC8A 1U3IA 3QPMA 4FYUA 2R0CA 4EKZA 2LRCA 1RQMA 1XPVA 1R5PA 2PMTA 1VRSD 2AJQB 4X4JA 5ECKB 3KMNA 3PPUA 1IYIA 1A0FA 3WYWA 1F3BA 3KMOA 2CZ3A 4OO5A 3D4MA 4YAPA 3U5RE 5DDLA 2LJRA 3HXSA 4HDEA 4EXJA 3HJPA 3CRTA 2F3MA 4RQRA 1O6JA 3KD0A 5KEJA 4V1Ap 1QXHA 4ZL7A 2LJAA 3GRXA 4TR4A 2VAFA 4ML6A 2R5GA 2I81A 2QSIA 4LMVA 2E0QA 2GGTA 2VL3A 3GN3A 2IJYA 4E8HA 4ACSA 2R4VA 3WT1A 2GSRA 4BL7B 2IL3A 4XCSA 3DYRA 1EP7A 4MLYA 2MZCA 5BRTA 2YN1A 4OMVA 5F07A 3R2QA 2AYTA 1K0OA 3PR8A 1FVKA 1EV9A 1AC1A 2H8LA 5G31A 4CY6A 4J57E 3KEBA 5D73A 5H5SA 3FZ4A 4KE3A 2K18A 2CX4A 5J9BA 4BVXB 5JWRB 4GF0A 3TKSC 3TKQA 4IS0A 2C3NA 7GSSA 4MZBA 2GZYA 4BL7A 2B6MA 1EOGA 4JR4A 2QGVA 2QKEA 2P5QA 2OADA 3CSHA 4GSTA 4HI7A 3O76A 1M0UA 1TW9A 1W4VA 5AIVA 2GZPA 4E8EA 1CQHA 3EU3A 2EIQA 2C0DA 3C71A 3C1RA 1OC3A 3KH7A 2HE3A 4KF9A 1WJKA 4BVXA 4N30A 1NW2A 1SKSB 1C72A 1ZYNA 5GZZB 4TVEA 3LYKA 1DE1A 2VCVA 1VF1A 1U6TA 2H75A 2PPTA 2TIRA 2IN3A 1T4ZA 11GSA 1FO5A 1I5GA 1YEPA 2DC5A 1T8EB 2YPMA 5AISA 5B6MA 2ALBA 12GSA 5CO3A 3FRCA 3DVWA 4JBBA 4LL4B 4NMUA 2C8UA 2X99A 9GSSA 2DIZA 1V9WA 2DJ1A 4L8EA 1ABAA 2JSZA 2CA8A 5J5NA 1Y25A 2G2QA 2HZEB 2NBSA 3MSZA 1PGTA 4ZB6A 4FYBA 2HYXA 5C00A 4I5QA 6GSUA 1SK0A 1K0BA 1MDKA 1M2DA 2R0PA 1T1VA 2HRNA 1G6YA 4LL1B 1BEDA 2GTUA 4K9ZA 1Z3EA 4KDYA 2GSSA 3F9UA 5HR2A 4KH7A 1A0RP 2E2MA 3NIVA 2YNXA 2AHEA 3M9KA 5C04A 1XWKA 4YQUA 1THXA 2OJLA 4KNDA 1YKAA 3GMFA 4F03A 4G10A 4OCFA 5G5EA 4GTUA 2HZEA 1JZDA 4RQXA 3FR3A 5DVBA 1XWBA 1AXDA 1GWCA 3GSSA 2JZRA 3LFLA 3EPTA 4PQIA 6GSSA 4K7IA 2ZCTA 2K8VA 2H1GA 5B6NA 3EVIA 4HQZA 1GSFA 1R7HA 2H6XA 3CSJA 1Z7PA 1SJIA 2FWEA 3TKPA 3A2VA 1TU8A 4AJ8A 1FG4A 5ECNB 5KOXA 1BYEA 4WR5A 2F8FA 3FW2A 4OD7A 3ZFBA 4A5PA 3ZL5A 4O5QA 3DEXA 1IYHA 1VF2A 2HNLA 1OVNA 1A2JA 2CAIA 2CT6A 1SL2B 3E9JB 2C0EA 4G0KA 3IOSA 3RAZA 1TOFA 4WBRD 3IK7A 2X4AA 4ZXGA 2H6YA 4F9ZA 4MZWA 3F63A 3HD5A 1Z7RA 4GRFA 1OYJA 1AIUA 1PL2A 1X9SB 3KTLA 5KN3A 1MD3A 4NV2A 3HHVA 3CTGA 2JU5A 1GULA 2IMEA 4GCIA 3TRPA 2IMFA 4HUAA 3CYNA 4EDYA 5IO2A 1S3RA 1EEJA 3H1NA 2V41A 4AF2A 2X64A 4Q5RA 1BJXA 1GSDA 5HR0A 5KN1A 3KTBA 3UL3A 1GRXA 1PX7A 2X8GA 4HU7A 3VWVA 3ZVJA 2PGTA 1LBKA 4KB3A 1ERTA 4IJ3A 2PBJA 4MZCA 4EIQA
chains in the Genus database with same CATH topology
3NOFA 2X8CA 1NSWA 1OC9A 4GSNA 3FR6A 4G0LA 1BX9A 5HR3A 2A2PA 1KNGA 5IO0A 5FWGA 2VL9A 3CXGA 1FOVA 1SL1B 3KP8A 1TXXA 3EWLA 1T7PB 1ML6A 3TOTA 1UA5A 2AV4A 3UAPA 4V2MA 3ZMKA 3SWLA 1UN2A 5ENUA 1T4YA 1OE7A 1GTBA 2BMXA 5F06A 1M9AA 3H93A 3D5JA 3VI5A 4NV5A 4O32A 1V98A 2DMMA 4KGIA 4KX4A 3MWHA 1WWJA 1TI3A 3ME8A 3LQ7A 4MK3A 1VF3A 2CZ2A 2ON7A 4RUVA 2XBQA 3EURA 3PINA 4K0NA 2VCTA 3DWVA 3VI7A 2MYGA 5F05A 1GSYA 5DALB 1GNEA 1QGVA 18GSA 4BVYB 5BMUA 1RK4A 5ELGA 1S3CA 1ZL9A 8GSSA 4G19A 3GKXA 2OE1A 2H6ZA 4BWQA 1QMVA 2I4AA 3GKKA 4MNNA 1EV4A 3MIXA 10GSA 3ZIJA 4ECJA 1GUMA 3D6IA 1PD21 2OE0A 4MH2A 2YWMA 1PMTA 3M0FA 1HD2A 4YKGA 2N5FA 3L9VA 3VWUA 2HRFA 5AIXA 5CP1A 1WMJA 5ECMB 5HFKA 2HI7A 3GKNA 1WIKA 4MABA 1Z9HA 4N11A 2DJKA 3TGZA 2HLSA 1V40A 4PUAA 4BVYA 14GSA 2PU9C 2TRCP 1MDJA 2VCQA 3KJYA 5A4UA 2TRXA 3F4TA 5KN0A 2IIYA 3D22A 1G7OA 4IW9A 2C3QA 2VM1A 4XHMA 3F6DA 1PN0A 3FHKA 1TKDB 1WOUA 3QR6A 2IFQA 3A2XA 1G6WA 2N5BA 3HY2A 5LD0A 2XBIA 2K8SA 3IXRA 4MJAA 2GS3A 1T00A 3MDKA 3FK8A 4DSQA 5A5KA 1Z6NA 3GHAA 1M7TA 4DVCA 2WFCA 5EY6A 3LXTA 1FB0A 4ECCA 5CREA 5ECIB 4XTSA 1YF0A 1S3DA 4EC0A 1BQ7A 1TTZA 4GQFA 2BJXA 3HVXA 1O7UA 3ZRDA 2L5LA 4IP1A 1M2AA 4K6XA 2YWNA 5AGYA 1PA3A 1XWGA 1X9WB 2PN8A 1Q98A 4L5LA 5D96A 1S3AA 4G0IA 4ZBDA 2YJ7A 1DUGA 1V2AA 2WGRA 2H73A 4MCUA 1XWAA 3GX8A 3M8NA 2LJKA 2H0GA 22GSA 3VPQA 4USSA 3EINA 4D73B 2H1DA 1PQNA 4WXTA 3NZNA 2O87A 1DE2A 2GVPA 3MAKA 2NDOA 2HXKA 3H79A 2MMAA 17GSA 4F0BA 3BBYA 4IN0A 2LQQA 2K6VA 3HZ8A 5DCHA 1A8YA 4ZB9A 2R6KA 2A2SA 4MJCA 1ZCPA 4HJ2A 5HR1A 1U87A 5HQPA 1M2BA 3QMXA 1ERWA 4CY8A 4EO3A 2GT5A 3G9BA 1V58A 1F2EA 2FGXA 1X5EA 3P7XA 3ED3A 4AGSA 2YCDA 2REMA 4D73A 2RIIA 1B9XC 2L57A 1HQOA 2DMLA 3ZYWA 20GSA 3Q19A 3QCPA 5CYYA 1QK8A 3E0UA 2A4VA 1MTCA 4OCEA 1MEKA 2FLSA 1GL8A 5A4VA 4WBJA 3GX0A 3K8NA 1GSSA 4PQ1A 4NAXA 1F37A 5D8IA 1O8XA 3RBTA 2IMIA 4KA0A 4TKYA 2H72A 1GUHA 1XW9A 2MBTA 5G1KA 1JZWA 5IOWA 3IPZA 4CDOA 4ULXA 4PX1A 5ECLB 3QFBC 3TCOA 4XS4B 1H75A 3FY7A 3GURA 4EVMA 4KDXA 1SL0B 3I6AA 1CQGA 2FCHA 3RHBA 4WR4A 4AJ7A 2RLIA 4KSOA 5DQYA 3Q6OA 4DEJA 5GAND 4BA7A 4LLRA 3APQA 1AW9A 1E2YA 2H1BA 3QD9A 4MH3A 1EWXA 5KOWA 5G2ZA 5B8AA 1ERVA 4QQ7A 4FYCA 4YH2A 3UBLA 3EC3A 4X43A 3GH6A 5JCGA 3GL3A 4MF6A 3W6GA 5J9CA 5J3RA 2YJHA 4JRRA 2YV9A 1JLVA 4IBPA 3IAM2 3UJ1A 1FW1A 3LORA 5ABRA 5E4WA 3TOUA 4F2IA 2C3TA 1EEMA 2H30A 3DIEA 4HU9A 2HSYA 1YEXA 2VLUA 5LNKe 3UMAA 4K7OA 4Z2UA 4X1UA 3IHGA 1ZOFA 3IHQA 1JZOA 1J08A 2LRNA 3A3TA 3F4SA 4PNFA 1TU7A 3TKRA 5CRDA 1O81A 1H4OA 2FUG2 1GSEA 5G1LA 1X9MB 3M9JA 1WP0A 1NM3A 1DSBA 1NHOA 1PL1A 2LNSA 4OFTA 4OFMA 3UVHA 1AQVA 3EMXA 4F0CA 4IGJA 2CVDA 4V2NA 3UBKA 2AUVA 5B8BA 1PSQA 2GT6A 3HCZA 1EOHA 2H0HA 5IOXA 2NTOA 1O85A 4OWYA 1XVWA 2B1KA 4TXVA 4ZL8A 1ERUA 3GL5A 3HA9A 2VD1A 3LEFA 5G5FA 1K0NA 2V2GA 4EUYA 1JHBA 3DMLA 4MMMA 2H76A 4WF5A 2H71A 1XOAA 4ZIJA 4DSRA 3LYPA 3L4NA 1XZOA 2DKIA 1JLWA 2V32A 2MMNA 5JWOB 3HJOA 1TJDA 2M72A 4TW5A 3MNGA 1LU4A 2BTOT 1TRUA 3LG6A 1I9DA 1UC7A 3GSTA 2EC4A 5DBQA 4ECIA 3GIXA 3CBUA 3ERFA 1R5AA 4LA1A 4L5OA 1XOBA 2WZ9A 1R26A 3GYKA 3I9V2 4RI6A 5EL8A 2XPDA 4I2UA 3ERWA 1N2AA 5GSSA 1KEBA 2OBIA 2ON5A 1SKWB 3HVSA 2GQKA 1SYXA 3QDNA 4GLTA 2GLRA 4Z2RA 1EZKA 2LEGA 2RM5A 1YZXA 3TKSE 2H0IA 1JFUA 2B1LA 1GSQA 3G7YA 4TOPA 3PGTA 4EE0A 3UIWA 1YF1A 3GV1A 2KUCA 2VOCA 3S9FA 3RPNA 5ECQB 1F9MA 2KP1A 3OR5A 4MPFA 3O3TA 3DRNA 2OKAA 2FD3A 5CRHA 1ZZYA 2VCWA 5ELAA 1G0TA 2HFDA 4TR1B 1E6BA 2AAWA 4RI7A 4N10A 1K0CA 3DKSA 3D0ZA 3KH9A 4HQSA 3IRAA 2J23A 1TK8B 1G7EA 2LV3A 2L6CA 5G30A 1OKDA 3GH9A 3ISOA 4XS1A 2QA2A 1TDIA 1GNWA 4MPGA 4LMWA 2HZFA 2RUFA 1PX6A 4POLA 4I6XA 3TDGA 5D93A 3IR4A 3UARA 3FMWA 2GSQA 3E3EA 2FA8A 1OE8A 4Z7XA 2DLXA 5J41A 3QAWA 13GSA 4TN8A 16GSA 2CVKA 1FB6A 2QC7A 2PVQA 2RM6A 4JZQA 4KW6A 1KTEA 2A4HA 4TR3A 4OFNA 1WPIA 2PUKC 5CNWA 3LWAA 1SD9A 4V2LA 2JADA 1W89A 2GZZA 2LKUA 4ISDA 1SYRA 2VCZA 5B7CA 4O7HA 3LW9A 3LSZA 1SK1A 4MJBA 2PWJA 5ECHB 1SJZA 2F51A 4WEYA 3FKFA 6GSYA 3ERGA 3TJBA 2KOKA 5DALA 3WGEA 4CW9A 5H5RA 5L71A 2OA7A 4K8MA 2LTKA 1XW6A 1GLQA 2FWFA 2V1MA 3H8QA 4K7NA 2MBSA 4ZILA 1ZMAA 4Q5NA 1A24A 1NHYA 2HRAA 1GTUA 4MDCA 5ECRB 3BCIA 5JCUA 1XFLA 3KGKA 3J7Yb 1FAAA 4IVFA 5E59A 5IIZA 3APSA 4YKFA 4EIPA 4KUNA 4KCEA 2X49A 3L9SA 4PGTA 3GKMA 2DBCA 4IHUA 2B5YA 4K5RA 4ML1A 1XBSA 2L5OA 3C7MA 1SJ6A 5DQSA 1USBA 2I3YA 5F8BA 5D9TA 2VL2A 3V1WA 4L0WA 4KAEA 2WULA 1FHEA 4I8BA 1A8LA 1PKZA 4K2DA 1HNCA 4MP4A 4ICYA 4L0UA 2P31A 2IPAA 5D9VA 5ECOB 3VWXA 4ZL9A 2O8VB 4IQ1A 4IKHA 2PVOC 2WS2A 3WD6A 1SU9A 1K0DA 5INYA 4GSSA 2V6KA 4N0VA 5JWQB 2G0FA 1ZYPA 2I9HA 2OBKA 6GSVA 1URMA 2B7KA 1AUCA 2DKHA 1ZYQB 2A2RA 2VLTA 19GSA 4PQHA 4EDZA 4IJIA 2YZUA 3ZLPA 4NHWA 3UOMA 1K3LA 1B4PA 5IQYA 1K0MA 4J56E 1ST9A 2YV7A 1JZRA 2L4QA 2NVLA 1AQXA 2E2GA 1YJ6A 4KCAA 5IMAA 1BAYA 2J9HA 1ILOA 3ZFLA 3EMPA 2UZ8A 4Q5QA 5IM9A 4BWSA 1OKTA 4ID0A 2EIOA 1GH2A 5ECSA 2C0FA 3G7JA 1ACVA 2WB9A 2B7JA 5IPGA 1X5CA 3N5OA 3TJKA 3VURA 2LQOA 3KIJA 1SENA 4NXIA 4GXZA 3H4KA 2KHPA 2VM2A 2H01A 4HJMA 1EP8A 1PN9A 1TP9A 1ON4A 2ZUPA 2O89A 5CRWA 3FZAA 3FZ9A 5KN2A 1HNAA 2C80A 2JSYA 3L9UA 2B5EA 1F6MC 2E7PA 4WF4A 2HSHA 5JCWA 1X0RA 2R0GA 3W8SA 2CX3A 1BG5A 1ZYEA 2M46A 4P3YB 1QUWA 4FH8A 3QAVA 1U88A 2VO4A 2XC2A 4AJ6A 2DSAA 1M99A 3I43A 2VL2C 5DJMA 5EVOA 3US3A 1YDKA 3ZIVA 2R3XA 4TXOB 3VPTA 1ZGNA 3ZREA 2L59A 4ILFA 5ECPB 3SBCA 3BCKA 2YOIA 3TJJA 5LCZA 3UVTA 4F82A 4K0GA 4PNGA 5HFGA 3TRXA 2LSTA 2YANA 3FR9A 4XIHA 3P90A 5D9XA 3F3RA 4NWYA 1Z5YE 2WDUA 2FWGA 2DJ3A 1TRSA 1QQ2A 2YWIA 3UEMA 3GFKA 5GSTA 4XS4A 1N8JA 1LJRA 3CTFA 3O6TA 1HYUA 4TXOA 4ZB8A 4POBA 4MF5A 1AQWA 1K3OA 1J9BA 1MD4A 5COHA 2LRTA 3CMIA 1XXUA 2FNOA 3GA4A 1YQ1A 3EU4A 1XIYA 1F3AA 1XCCA 4JR6A 2NPBA 4KSMA 2HRKA 2YP6A 4H86A 2VUPA 4TR0A 5F0GA 3F0IA 2MMZA 3D21A 3ZZXA 2L4CA 1R4WA 3BJ5A 2KP2A 2VD0A 3CRUA 1EGOA 1O73A 1T3BA 3RPPA 2YZHA 2H74A 4JEDA 4X0XA 5DCGA 1X5DA 4ZBBA 1SD8A 4FO5A 4Q5FA 3FZ5A 4QL9A 5DJLA 4DSSB 2P5RA 3G7IA 4NPBA 3IAS2 5GAPD 2GDRA 5D9WA 4PXOA 3ZITA 3DXBA 1K3YA 4V1Ag 3P8WA 3WGXA 2FA4A 5IMCA 2C1YA 4XS6A 3HKRA 1Y6EA 3A5WA 2FWHA 5J4UA 3A5IA 1WRYA 2D2ZA 4O92A 5AN1A 4ECBA 4XRDA 1A2MA 3VFIA 3M3MA 4DSSA 3TJGA 1V57A 4NHZA 3KP9A 1UVZA 1GSUA 2F9SA 2H19A 1MDIA 1TK5B 2JZTA 4I97A 2VIMA 3HZ4A 5FT3A 3LGCA 3KCMA 4FIWA 5H5QA 3F3QA 4QL7A 3D4TA 1GP1A 4IQAA 1A2LA 4GWRA 1O8WA 4EL1A 5CRGA 3A2WA 3CSIA 1PRXA 3GUSA 1RW1A 3C8EA 4JU5A 3TUEA 4G2EA 1B8XA 2HSMA 3EYTA 1K0AA 1TK0B 2R37A 4HZ2A 4YAVA 4YQVA 2OACA 3IC8A 1FVJA 4Z2TA 2XHFA 5A4WA 2FY6A 1OC9B 3HYPA 3KXOA 2KLXA 3Q18A 3AY8A 5FHIA 3TB2A 1GTIA 1XWCA 1XW5A 1TRVA 3C73A 3DD3A 3F4RA 4FQUA 4N0ZA 4I2TA 3RHCA 2C0GA 4HEA2 4EF0A 4WETA 4K2XA 2ZNMA 3I69A 2H66A 2DIYA 2QA1A 3IV4A 2K9FA 3L78A 2WRTA 2RUEA 3VLNA 3QFAC 2CVBA 3F8UA 4BPYA 3LJRA 4MF7A 3M1GA 2H70A 2JACA 2PERA 3TRQA 2O85A 3LXZA 2IWTA 1OAZA 3R3EA 4MA9A 2VLVA 3J7Yk 3KM6A 3P2AA 3VK9A 1GTAA 3KZQA 3F6FA 3DGQA 4IELA 4TR1A 4K1FA 3WGDA 2LS5A 3HJMA 3GTUB 1M9BA 3IDVA 2WCIA 3FYGA 2ES7A 2GQLA 3WT2A 1B4QA 2JL4A 1SKRB 2C4JA 3BOAA 4HZ4A 1Z6MA 4J2FA 2DJ2A 3APOA 5IMFA 2CAQA 1PKWA 2MMOA 3PH9A 3EE2A 3Q74A 4YQMA 2IMDA 3TJFA 2DJ0A 2O7KA 6GSTA 1VF4A 1U3AA 2XPEA 1YY7A 3IA1A 1GUKA 4KDUA 4G9HA 1Q4JA 3GTUA 4PTSA 3IE3A 2WJUA 3U6VA 3ME7A 2V6OA 2F8AA 3W8JA 2X8HA 1HNBA 4IP6A 1A23A 3IK9A 4OO4A 3ZTLA 2M80A 2VCXA 1AAZA 2FHEA 4ZBAA 2CQ9A 5EPFA 5CAXA 3BD2A 1TI1A 6GSXA 1WE0A 3DVXA 2AB6A 2IFQB 4TRXA 4HOJA 4POMA 2GQMA 2B3SA 1B48A 1KBNA 3QOUA 5IMVA 2JZSA 1VGLA 5ID2B 4MJEA 1THOA 2I1UA 5IPHA 1SK2A 5DAKB 1J0FA 2EIRA 3ZMLA 4GQCA 1EGRA 1YKCA 1FOHA 2B5XA 4CHSA 2DJJA 1DBYA 3TKSA 4K5SA 2YWOA 2H1AA 3HDCA 2L6DA 4PURA 4JE1A 2LUSA 3IBHA 3VWWA 1XVQA 2Z9SA 1B9YC 3GNJA 2GSTA 1QFNA 3RDWA 2LNTA 4POKA 6GSWA 4PUFC 3C1SA 5ID2A 1GLPA 3ZVJD 3FEUA 4O5RA 3MYDA 4HS1A 2R2JA 4O5UA 2CV4A 5DAKA 4XRAA 2N5AA 2OE3A 2IMKA 4WKWA 5HFIA 3L0HA 1TRWA 3IC4A 2HT9A 2P0GA 3N9JA 5IMZA 5IMDA 3HVVA 3JCML 3QAGA 1OC8A 1U3IA 3QPMA 4FYUA 2R0CA 4EKZA 2LRCA 1RQMA 1XPVA 1R5PA 2PMTA 1VRSD 2AJQB 4X4JA 5ECKB 3KMNA 3PPUA 1IYIA 1A0FA 3WYWA 1F3BA 3KMOA 2CZ3A 4OO5A 3D4MA 4YAPA 3U5RE 5DDLA 2LJRA 3HXSA 4HDEA 4EXJA 3HJPA 3CRTA 2F3MA 4RQRA 1O6JA 3KD0A 5KEJA 4V1Ap 1QXHA 4ZL7A 2LJAA 3GRXA 4TR4A 2VAFA 4ML6A 2R5GA 2I81A 2QSIA 4LMVA 2E0QA 2GGTA 2VL3A 3GN3A 2IJYA 4E8HA 4ACSA 2R4VA 3WT1A 2GSRA 4BL7B 2IL3A 4XCSA 3DYRA 1EP7A 4MLYA 2MZCA 5BRTA 2YN1A 4OMVA 5F07A 3R2QA 2AYTA 1K0OA 3PR8A 1FVKA 1EV9A 1AC1A 2H8LA 5G31A 4CY6A 4J57E 3KEBA 5D73A 5H5SA 3FZ4A 4KE3A 2K18A 2CX4A 5J9BA 4BVXB 5JWRB 4GF0A 3TKSC 3TKQA 4IS0A 2C3NA 7GSSA 4MZBA 2GZYA 4BL7A 2B6MA 1EOGA 4JR4A 2QGVA 2QKEA 2P5QA 2OADA 3CSHA 4GSTA 4HI7A 3O76A 1M0UA 1TW9A 1W4VA 5AIVA 2GZPA 4E8EA 1CQHA 3EU3A 2EIQA 2C0DA 3C71A 3C1RA 1OC3A 3KH7A 2HE3A 4KF9A 1WJKA 4BVXA 4N30A 1NW2A 1SKSB 1C72A 1ZYNA 5GZZB 4TVEA 3LYKA 1DE1A 2VCVA 1VF1A 1U6TA 2H75A 2PPTA 2TIRA 2IN3A 1T4ZA 11GSA 1FO5A 1I5GA 1YEPA 2DC5A 1T8EB 2YPMA 5AISA 5B6MA 2ALBA 12GSA 5CO3A 3FRCA 3DVWA 4JBBA 4LL4B 4NMUA 2C8UA 2X99A 9GSSA 2DIZA 1V9WA 2DJ1A 4L8EA 1ABAA 2JSZA 2CA8A 5J5NA 1Y25A 2G2QA 2HZEB 2NBSA 3MSZA 1PGTA 4ZB6A 4FYBA 2HYXA 5C00A 4I5QA 6GSUA 1SK0A 1K0BA 1MDKA 1M2DA 2R0PA 1T1VA 2HRNA 1G6YA 4LL1B 1BEDA 2GTUA 4K9ZA 1Z3EA 4KDYA 2GSSA 3F9UA 5HR2A 4KH7A 1A0RP 2E2MA 3NIVA 2YNXA 2AHEA 3M9KA 5C04A 1XWKA 4YQUA 1THXA 2OJLA 4KNDA 1YKAA 3GMFA 4F03A 4G10A 4OCFA 5G5EA 4GTUA 2HZEA 1JZDA 4RQXA 3FR3A 5DVBA 1XWBA 1AXDA 1GWCA 3GSSA 2JZRA 3LFLA 3EPTA 4PQIA 6GSSA 4K7IA 2ZCTA 2K8VA 2H1GA 5B6NA 3EVIA 4HQZA 1GSFA 1R7HA 2H6XA 3CSJA 1Z7PA 1SJIA 2FWEA 3TKPA 3A2VA 1TU8A 4AJ8A 1FG4A 5ECNB 5KOXA 1BYEA 4WR5A 2F8FA 3FW2A 4OD7A 3ZFBA 4A5PA 3ZL5A 4O5QA 3DEXA 1IYHA 1VF2A 2HNLA 1OVNA 1A2JA 2CAIA 2CT6A 1SL2B 3E9JB 2C0EA 4G0KA 3IOSA 3RAZA 1TOFA 4WBRD 3IK7A 2X4AA 4ZXGA 2H6YA 4F9ZA 4MZWA 3F63A 3HD5A 1Z7RA 4GRFA 1OYJA 1AIUA 1PL2A 1X9SB 3KTLA 5KN3A 1MD3A 4NV2A 3HHVA 3CTGA 2JU5A 1GULA 2IMEA 4GCIA 3TRPA 2IMFA 4HUAA 3CYNA 4EDYA 5IO2A 1EEJA 3H1NA 2V41A 4AF2A 2X64A 4Q5RA 1BJXA 1GSDA 5HR0A 5KN1A 3KTBA 3UL3A 1GRXA 1PX7A 2X8GA 4HU7A 3VWVA 3ZVJA 2PGTA 1LBKA 4KB3A 1ERTA 4IJ3A 2PBJA 4MZCA 4EIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOF A;  2X8C A;  1NSW A;  1OC9 A;  4GSN A;  3FR6 A;  1BX9 A;  5HR3 A;  1KNG A;  5IO0 A;  5FWG A;  2VL9 A;  3CXG A;  1FOV A;  1SL1 B;  3KP8 A;  1TXX A;  3EWL A;  1T7P B;  1ML6 A;  3TOT A;  1UA5 A;  2AV4 A;  3UAP A;  4V2M A;  3ZMK A;  3SWL A;  1UN2 A;  5ENU A;  1T4Y A;  1OE7 A;  1GTB A;  2BMX A;  5F06 A;  1M9A A;  3H93 A;  3D5J A;  3VI5 A;  4NV5 A;  4O32 A;  1V98 A;  2DMM A;  4KGI A;  4KX4 A;  3MWH A;  1WWJ A;  1TI3 A;  3ME8 A;  3LQ7 A;  4MK3 A;  1VF3 A;  2CZ2 A;  2ON7 A;  4RUV A;  2XBQ A;  3EUR A;  3PIN A;  4K0N A;  2VCT A;  3DWV A;  3VI7 A;  2MYG A;  5F05 A;  1GSY A;  5DAL B;  1GNE A;  1QGV A;  18GS A;  1RK4 A;  5ELG A;  1S3C A;  1ZL9 A;  8GSS A;  4G19 A;  3GKX A;  2OE1 A;  2H6Z A;  4BWQ A;  1QMV A;  2I4A A;  3GKK A;  1EV4 A;  10GS A;  3ZIJ A;  4ECJ A;  1GUM A;  3D6I A;  1PD2 1;  2OE0 A;  4MH2 A;  2YWM A;  1PMT A;  3M0F A;  1HD2 A;  2N5F A;  3L9V A;  3VWU A;  2HRF A;  5AIX A;  5CP1 A;  1WMJ A;  5ECM B;  5HFK A;  2HI7 A;  3GKN A;  1WIK A;  4MAB A;  1Z9H A;  4N11 A;  2DJK A;  3TGZ A;  2HLS A;  1V40 A;  4PUA A;  4BVY A;  14GS A;  2PU9 C;  2TRC P;  1MDJ A;  2VCQ A;  3KJY A;  5A4U A;  2TRX A;  3F4T A;  5KN0 A;  2IIY A;  3D22 A;  1G7O A;  4IW9 A;  2C3Q A;  2VM1 A;  4XHM A;  3F6D A;  3FHK A;  1TKD B;  1WOU A;  3QR6 A;  2IFQ A;  3A2X A;  1G6W A;  2N5B A;  3HY2 A;  5LD0 A;  2XBI A;  2K8S A;  3IXR A;  4MJA A;  2GS3 A;  1T00 A;  3MDK A;  3FK8 A;  4DSQ A;  5A5K A;  1Z6N A;  3GHA A;  1M7T A;  4DVC A;  2WFC A;  5EY6 A;  3LXT A;  1FB0 A;  4ECC A;  5CRE A;  5ECI B;  4XTS A;  1YF0 A;  1S3D A;  4EC0 A;  1BQ7 A;  1TTZ A;  4GQF A;  2BJX A;  3HVX A;  1O7U A;  3ZRD A;  2L5L A;  4IP1 A;  1M2A A;  4K6X A;  2YWN A;  5AGY A;  1PA3 A;  1XWG A;  1X9W B;  2PN8 A;  1Q98 A;  4L5L A;  5D96 A;  1S3A A;  4ZBD A;  2YJ7 A;  1DUG A;  1V2A A;  2WGR A;  2H73 A;  4MCU A;  1XWA A;  3GX8 A;  3M8N A;  2LJK A;  2H0G A;  22GS A;  3VPQ A;  3EIN A;  4D73 B;  2H1D A;  1PQN A;  4WXT A;  3NZN A;  2O87 A;  1DE2 A;  2GVP A;  3MAK A;  2NDO A;  2HXK A;  3H79 A;  2MMA A;  17GS A;  4F0B A;  3BBY A;  4IN0 A;  2LQQ A;  2K6V A;  3HZ8 A;  5DCH A;  1A8Y A;  4ZB9 A;  2R6K A;  2A2S A;  4MJC A;  1ZCP A;  4HJ2 A;  5HR1 A;  1U87 A;  5HQP A;  1M2B A;  3QMX A;  1ERW A;  4EO3 A;  2GT5 A;  3G9B A;  1V58 A;  1F2E A;  2FGX A;  1X5E A;  3P7X A;  3ED3 A;  4AGS A;  2YCD A;  2REM A;  4D73 A;  2RII A;  1B9X C;  2L57 A;  1HQO A;  2DML A;  3ZYW A;  20GS A;  3Q19 A;  3QCP A;  5CYY A;  1QK8 A;  3E0U A;  2A4V A;  1MTC A;  4OCE A;  1MEK A;  2FLS A;  1GL8 A;  5A4V A;  4WBJ A;  3GX0 A;  3K8N A;  1GSS A;  4PQ1 A;  4NAX A;  1F37 A;  5D8I A;  1O8X A;  3RBT A;  2IMI A;  4KA0 A;  4TKY A;  2H72 A;  1GUH A;  1XW9 A;  2MBT A;  5G1K A;  1JZW A;  5IOW A;  3IPZ A;  4CDO A;  4ULX A;  4PX1 A;  5ECL B;  3QFB C;  3TCO A;  4XS4 B;  1H75 A;  3FY7 A;  3GUR A;  4EVM A;  4KDX A;  1SL0 B;  3I6A A;  1CQG A;  2FCH A;  3RHB A;  4WR4 A;  4AJ7 A;  2RLI A;  4KSO A;  5DQY A;  3Q6O A;  4DEJ A;  5GAN D;  4BA7 A;  4LLR A;  3APQ A;  1AW9 A;  1E2Y A;  2H1B A;  3QD9 A;  4MH3 A;  1EWX A;  5G2Z A;  5B8A A;  1ERV A;  4QQ7 A;  4FYC A;  4YH2 A;  3UBL A;  3EC3 A;  4X43 A;  3GH6 A;  5JCG A;  3GL3 A;  4MF6 A;  3W6G A;  5J9C A;  5J3R A;  2YJH A;  4JRR A;  2YV9 A;  1JLV A;  4IBP A;  3IAM 2;  3UJ1 A;  1FW1 A;  3LOR A;  5ABR A;  5E4W A;  3TOU A;  4F2I A;  2C3T A;  1EEM A;  2H30 A;  3DIE A;  4HU9 A;  2HSY A;  1YEX A;  2VLU A;  5LNK e;  3UMA A;  4K7O A;  4X1U A;  1ZOF A;  3IHQ A;  1JZO A;  1J08 A;  2LRN A;  3A3T A;  3F4S A;  4PNF A;  1TU7 A;  3TKR A;  5CRD A;  1O81 A;  1H4O A;  2FUG 2;  1GSE A;  5G1L A;  1X9M B;  3M9J A;  1WP0 A;  1NM3 A;  1DSB A;  1NHO A;  1PL1 A;  2LNS A;  4OFT A;  4OFM A;  3UVH A;  1AQV A;  3EMX A;  4F0C A;  4IGJ A;  2CVD A;  4V2N A;  3UBK A;  2AUV A;  5B8B A;  1PSQ A;  2GT6 A;  3HCZ A;  1EOH A;  2H0H A;  5IOX A;  2NTO A;  1O85 A;  4OWY A;  1XVW A;  2B1K A;  4TXV A;  4ZL8 A;  1ERU A;  3GL5 A;  3HA9 A;  2VD1 A;  3LEF A;  5G5F A;  1K0N A;  2V2G A;  4EUY A;  1JHB A;  3DML A;  4MMM A;  2H76 A;  4WF5 A;  2H71 A;  1XOA A;  4ZIJ A;  4DSR A;  3LYP A;  3L4N A;  1XZO A;  1JLW A;  2V32 A;  2MMN A;  5JWO B;  3HJO A;  1TJD A;  2M72 A;  4TW5 A;  3MNG A;  1LU4 A;  2BTO T;  1TRU A;  3LG6 A;  1I9D A;  1UC7 A;  3GST A;  2EC4 A;  5DBQ A;  4ECI A;  3GIX A;  3CBU A;  3ERF A;  1R5A A;  4LA1 A;  4L5O A;  1XOB A;  2WZ9 A;  1R26 A;  3GYK A;  3I9V 2;  4RI6 A;  5EL8 A;  2XPD A;  4I2U A;  3ERW A;  1N2A A;  5GSS A;  1KEB A;  2OBI A;  2ON5 A;  1SKW B;  3HVS A;  2GQK A;  1SYX A;  3QDN A;  4GLT A;  2GLR A;  1EZK A;  2LEG A;  2RM5 A;  1YZX A;  3TKS E;  2H0I A;  1JFU A;  2B1L A;  1GSQ A;  3G7Y A;  4TOP A;  3PGT A;  4EE0 A;  3UIW A;  1YF1 A;  3GV1 A;  2KUC A;  2VOC A;  3S9F A;  3RPN A;  5ECQ B;  1F9M A;  2KP1 A;  3OR5 A;  4MPF A;  3O3T A;  3DRN A;  2OKA A;  2FD3 A;  5CRH A;  1ZZY A;  2VCW A;  5ELA A;  1G0T A;  2HFD A;  4TR1 B;  1E6B A;  2AAW A;  4RI7 A;  4N10 A;  1K0C A;  3DKS A;  3D0Z A;  3KH9 A;  4HQS A;  3IRA A;  2J23 A;  1TK8 B;  1G7E A;  2LV3 A;  2L6C A;  5G30 A;  1OKD A;  3GH9 A;  3ISO A;  4XS1 A;  1TDI A;  1GNW A;  4MPG A;  4LMW A;  2HZF A;  2RUF A;  1PX6 A;  4POL A;  4I6X A;  3TDG A;  5D93 A;  3IR4 A;  3UAR A;  2GSQ A;  3E3E A;  2FA8 A;  1OE8 A;  4Z7X A;  2DLX A;  5J41 A;  3QAW A;  13GS A;  4TN8 A;  16GS A;  2CVK A;  1FB6 A;  2QC7 A;  2PVQ A;  2RM6 A;  4JZQ A;  4KW6 A;  1KTE A;  4TR3 A;  4OFN A;  1WPI A;  2PUK C;  5CNW A;  3LWA A;  1SD9 A;  4V2L A;  2JAD A;  1W89 A;  2GZZ A;  2LKU A;  4ISD A;  1SYR A;  2VCZ A;  5B7C A;  4O7H A;  3LSZ A;  1SK1 A;  4MJB A;  2PWJ A;  5ECH B;  1SJZ A;  2F51 A;  4WEY A;  3FKF A;  6GSY A;  3ERG A;  3TJB A;  2KOK A;  5DAL A;  3WGE A;  4CW9 A;  5H5R A;  5L71 A;  2OA7 A;  4K8M A;  2LTK A;  1XW6 A;  1GLQ A;  2FWF A;  2V1M A;  3H8Q A;  4K7N A;  2MBS A;  4ZIL A;  1ZMA A;  4Q5N A;  1A24 A;  1NHY A;  1GTU A;  4MDC A;  5ECR B;  3BCI A;  5JCU A;  1XFL A;  3KGK A;  3J7Y b;  1FAA A;  4IVF A;  5E59 A;  5IIZ A;  3APS A;  4KUN A;  4KCE A;  3L9S A;  4PGT A;  3GKM A;  2DBC A;  4IHU A;  2B5Y A;  4ML1 A;  1XBS A;  2L5O A;  3C7M A;  1SJ6 A;  5DQS A;  1USB A;  2I3Y A;  5F8B A;  5D9T A;  2VL2 A;  3V1W A;  4L0W A;  4KAE A;  2WUL A;  1FHE A;  4I8B A;  1A8L A;  1PKZ A;  4K2D A;  1HNC A;  4MP4 A;  4L0U A;  2P31 A;  2IPA A;  5D9V A;  5ECO B;  3VWX A;  4ZL9 A;  2O8V B;  4IQ1 A;  4IKH A;  2PVO C;  2WS2 A;  3WD6 A;  1SU9 A;  1K0D A;  5INY A;  4GSS A;  2V6K A;  4N0V A;  5JWQ B;  2G0F A;  2I9H A;  2OBK A;  6GSV A;  1URM A;  2B7K A;  1AUC A;  1ZYQ B;  2A2R A;  2VLT A;  19GS A;  4PQH A;  4EDZ A;  4IJI A;  2YZU A;  3ZLP A;  4NHW A;  3UOM A;  1K3L A;  1B4P A;  5IQY A;  1K0M A;  4J56 E;  1ST9 A;  2YV7 A;  1JZR A;  2L4Q A;  2NVL A;  1AQX A;  2E2G A;  1YJ6 A;  4KCA A;  5IMA A;  1BAY A;  2J9H A;  1ILO A;  3ZFL A;  3EMP A;  4Q5Q A;  5IM9 A;  4BWS A;  1OKT A;  4ID0 A;  2EIO A;  1GH2 A;  5ECS A;  2C0F A;  3G7J A;  1ACV A;  2WB9 A;  2B7J A;  5IPG A;  1X5C A;  3N5O A;  3TJK A;  3VUR A;  2LQO A;  3KIJ A;  1SEN A;  4NXI A;  4GXZ A;  3H4K A;  2KHP A;  2VM2 A;  2H01 A;  4HJM A;  1EP8 A;  1PN9 A;  1TP9 A;  1ON4 A;  2ZUP A;  2O89 A;  5CRW A;  3FZA A;  3FZ9 A;  5KN2 A;  1HNA A;  2C80 A;  2JSY A;  3L9U A;  2B5E A;  1F6M C;  2E7P A;  4WF4 A;  2HSH A;  5JCW A;  1X0R A;  3W8S A;  2CX3 A;  1BG5 A;  1ZYE A;  2M46 A;  4P3Y B;  1QUW A;  4FH8 A;  3QAV A;  1U88 A;  2VO4 A;  2XC2 A;  4AJ6 A;  2DSA A;  1M99 A;  3I43 A;  2VL2 C;  5DJM A;  5EVO A;  3US3 A;  1YDK A;  3ZIV A;  2R3X A;  4TXO B;  3VPT A;  1ZGN A;  3ZRE A;  2L59 A;  4ILF A;  5ECP B;  3SBC A;  3BCK A;  2YOI A;  3TJJ A;  5LCZ A;  3UVT A;  4F82 A;  4K0G A;  4PNG A;  5HFG A;  3TRX A;  2LST A;  2YAN A;  3FR9 A;  4XIH A;  3P90 A;  5D9X A;  3F3R A;  4NWY A;  1Z5Y E;  2WDU A;  2FWG A;  2DJ3 A;  1TRS A;  1QQ2 A;  2YWI A;  3UEM A;  3GFK A;  5GST A;  4XS4 A;  1N8J A;  1LJR A;  3CTF A;  3O6T A;  1HYU A;  4TXO A;  4ZB8 A;  4POB A;  4MF5 A;  1AQW A;  1K3O A;  1J9B A;  1MD4 A;  5COH A;  2LRT A;  3CMI A;  1XXU A;  2FNO A;  3GA4 A;  1YQ1 A;  3EU4 A;  1XIY A;  1F3A A;  1XCC A;  4JR6 A;  2NPB A;  4KSM A;  2YP6 A;  4H86 A;  2VUP A;  4TR0 A;  5F0G A;  3F0I A;  2MMZ A;  3D21 A;  3ZZX A;  2L4C A;  1R4W A;  3BJ5 A;  2KP2 A;  2VD0 A;  3CRU A;  1EGO A;  1O73 A;  1T3B A;  3RPP A;  2YZH A;  2H74 A;  4JED A;  4X0X A;  5DCG A;  1X5D A;  4ZBB A;  1SD8 A;  4FO5 A;  4Q5F A;  3FZ5 A;  4QL9 A;  5DJL A;  4DSS B;  2P5R A;  3G7I A;  4NPB A;  3IAS 2;  5GAP D;  2GDR A;  5D9W A;  4PXO A;  3ZIT A;  3DXB A;  1K3Y A;  4V1A g;  3P8W A;  3WGX A;  2FA4 A;  5IMC A;  2C1Y A;  4XS6 A;  3HKR A;  1Y6E A;  3A5W A;  2FWH A;  5J4U A;  1WRY A;  2D2Z A;  4O92 A;  5AN1 A;  4ECB A;  4XRD A;  1A2M A;  3VFI A;  3M3M A;  4DSS A;  3TJG A;  1V57 A;  4NHZ A;  3KP9 A;  1UVZ A;  1GSU A;  2F9S A;  2H19 A;  1MDI A;  1TK5 B;  2JZT A;  4I97 A;  2VIM A;  3HZ4 A;  5FT3 A;  3LGC A;  3KCM A;  4FIW A;  5H5Q A;  3F3Q A;  4QL7 A;  3D4T A;  1GP1 A;  4IQA A;  1A2L A;  4GWR A;  1O8W A;  4EL1 A;  5CRG A;  3A2W A;  3CSI A;  1PRX A;  3GUS A;  1RW1 A;  3C8E A;  4JU5 A;  3TUE A;  4G2E A;  1B8X A;  3EYT A;  1K0A A;  1TK0 B;  2R37 A;  4HZ2 A;  4YAV A;  4YQV A;  2OAC A;  1FVJ A;  2XHF A;  5A4W A;  2FY6 A;  1OC9 B;  3HYP A;  3KXO A;  2KLX A;  3Q18 A;  3AY8 A;  5FHI A;  3TB2 A;  1GTI A;  1XWC A;  1XW5 A;  1TRV A;  3C73 A;  3DD3 A;  3F4R A;  4N0Z A;  4I2T A;  3RHC A;  2C0G A;  4HEA 2;  4EF0 A;  4WET A;  2ZNM A;  3I69 A;  2H66 A;  2DIY A;  3IV4 A;  2K9F A;  3L78 A;  2WRT A;  2RUE A;  3VLN A;  3QFA C;  2CVB A;  3F8U A;  4BPY A;  3LJR A;  4MF7 A;  3M1G A;  2H70 A;  2JAC A;  2PER A;  3TRQ A;  2O85 A;  3LXZ A;  2IWT A;  1OAZ A;  4MA9 A;  2VLV A;  3J7Y k;  3KM6 A;  3P2A A;  3VK9 A;  1GTA A;  3KZQ A;  3F6F A;  3DGQ A;  4IEL A;  4TR1 A;  4K1F A;  3WGD A;  2LS5 A;  3HJM A;  3GTU B;  1M9B A;  3IDV A;  2WCI A;  3FYG A;  2ES7 A;  2GQL A;  3WT2 A;  1B4Q A;  2JL4 A;  1SKR B;  2C4J A;  3BOA A;  4HZ4 A;  1Z6M A;  4J2F A;  2DJ2 A;  3APO A;  5IMF A;  2CAQ A;  1PKW A;  2MMO A;  3PH9 A;  3EE2 A;  3Q74 A;  4YQM A;  2IMD A;  3TJF A;  2DJ0 A;  2O7K A;  6GST A;  1VF4 A;  1U3A A;  2XPE A;  1YY7 A;  3IA1 A;  1GUK A;  4KDU A;  4G9H A;  1Q4J A;  3GTU A;  3IE3 A;  2WJU A;  3U6V A;  3ME7 A;  2V6O A;  2F8A A;  3W8J A;  2X8H A;  1HNB A;  4IP6 A;  1A23 A;  3IK9 A;  4OO4 A;  3ZTL A;  2M80 A;  2VCX A;  1AAZ A;  2FHE A;  4ZBA A;  2CQ9 A;  5EPF A;  5CAX A;  3BD2 A;  1TI1 A;  6GSX A;  1WE0 A;  3DVX A;  2AB6 A;  2IFQ B;  4TRX A;  4HOJ A;  4POM A;  2GQM A;  2B3S A;  1B48 A;  1KBN A;  3QOU A;  5IMV A;  2JZS A;  1VGL A;  5ID2 B;  4MJE A;  1THO A;  2I1U A;  5IPH A;  1SK2 A;  5DAK B;  1J0F A;  2EIR A;  3ZML A;  4GQC A;  1EGR A;  1YKC A;  2B5X A;  4CHS A;  2DJJ A;  1DBY A;  3TKS A;  2YWO A;  2H1A A;  3HDC A;  2L6D A;  4PUR A;  4JE1 A;  2LUS A;  3IBH A;  3VWW A;  1XVQ A;  2Z9S A;  1B9Y C;  3GNJ A;  2GST A;  1QFN A;  3RDW A;  2LNT A;  4POK A;  6GSW A;  4PUF C;  3C1S A;  5ID2 A;  1GLP A;  3ZVJ D;  3FEU A;  4O5R A;  4HS1 A;  2R2J A;  2CV4 A;  5DAK A;  4XRA A;  2N5A A;  2OE3 A;  2IMK A;  4WKW A;  5HFI A;  3L0H A;  1TRW A;  3IC4 A;  2HT9 A;  2P0G A;  3N9J A;  5IMZ A;  5IMD A;  3HVV A;  3JCM L;  3QAG A;  1OC8 A;  1U3I A;  3QPM A;  4FYU A;  4EKZ A;  2LRC A;  1RQM A;  1XPV A;  1R5P A;  2PMT A;  1VRS D;  2AJQ B;  5ECK B;  3KMN A;  1IYI A;  1A0F A;  3WYW A;  1F3B A;  3KMO A;  2CZ3 A;  4OO5 A;  3D4M A;  4YAP A;  3U5R E;  5DDL A;  2LJR A;  3HXS A;  4HDE A;  4EXJ A;  3HJP A;  3CRT A;  2F3M A;  4RQR A;  1O6J A;  3KD0 A;  5KEJ A;  4V1A p;  1QXH A;  4ZL7 A;  2LJA A;  3GRX A;  4TR4 A;  2VAF A;  4ML6 A;  2R5G A;  2I81 A;  2QSI A;  4LMV A;  2E0Q A;  2GGT A;  2VL3 A;  3GN3 A;  2IJY A;  4E8H A;  4ACS A;  2R4V A;  3WT1 A;  2GSR A;  2IL3 A;  4XCS A;  3DYR A;  1EP7 A;  4MLY A;  2MZC A;  2YN1 A;  4OMV A;  5F07 A;  3R2Q A;  2AYT A;  1K0O A;  3PR8 A;  1FVK A;  1EV9 A;  1AC1 A;  2H8L A;  5G31 A;  4J57 E;  3KEB A;  5D73 A;  5H5S A;  3FZ4 A;  4KE3 A;  2K18 A;  2CX4 A;  5J9B A;  5JWR B;  4GF0 A;  3TKS C;  3TKQ A;  4IS0 A;  2C3N A;  7GSS A;  4MZB A;  2GZY A;  4BL7 A;  2B6M A;  1EOG A;  4JR4 A;  2QGV A;  2QKE A;  2P5Q A;  2OAD A;  3CSH A;  4GST A;  4HI7 A;  3O76 A;  1M0U A;  1TW9 A;  1W4V A;  5AIV A;  2GZP A;  4E8E A;  1CQH A;  3EU3 A;  2EIQ A;  2C0D A;  3C71 A;  3C1R A;  1OC3 A;  3KH7 A;  2HE3 A;  1WJK A;  4BVX A;  4N30 A;  1NW2 A;  1SKS B;  1C72 A;  5GZZ B;  4TVE A;  3LYK A;  1DE1 A;  2VCV A;  1VF1 A;  1U6T A;  2H75 A;  2PPT A;  2TIR A;  2IN3 A;  1T4Z A;  11GS A;  1FO5 A;  1I5G A;  1YEP A;  2DC5 A;  1T8E B;  2YPM A;  5AIS A;  5B6M A;  2ALB A;  12GS A;  5CO3 A;  3FRC A;  3DVW A;  4JBB A;  4LL4 B;  4NMU A;  2C8U A;  2X99 A;  9GSS A;  2DIZ A;  1V9W A;  2DJ1 A;  4L8E A;  1ABA A;  2JSZ A;  2CA8 A;  5J5N A;  1Y25 A;  2G2Q A;  2HZE B;  2NBS A;  3MSZ A;  1PGT A;  4ZB6 A;  4FYB A;  2HYX A;  5C00 A;  4I5Q A;  6GSU A;  1SK0 A;  1K0B A;  1MDK A;  1M2D A;  1T1V A;  2HRN A;  1G6Y A;  4LL1 B;  1BED A;  2GTU A;  4K9Z A;  1Z3E A;  4KDY A;  2GSS A;  3F9U A;  5HR2 A;  4KH7 A;  1A0R P;  2E2M A;  3NIV A;  2YNX A;  2AHE A;  3M9K A;  5C04 A;  1XWK A;  4YQU A;  1THX A;  2OJL A;  4KND A;  1YKA A;  3GMF A;  4F03 A;  4G10 A;  4OCF A;  5G5E A;  4GTU A;  2HZE A;  1JZD A;  4RQX A;  3FR3 A;  5DVB A;  1XWB A;  1AXD A;  1GWC A;  3GSS A;  2JZR A;  3LFL A;  4PQI A;  6GSS A;  4K7I A;  2ZCT A;  2K8V A;  2H1G A;  5B6N A;  3EVI A;  4HQZ A;  1GSF A;  1R7H A;  2H6X A;  3CSJ A;  1Z7P A;  1SJI A;  2FWE A;  3TKP A;  3A2V A;  1TU8 A;  4AJ8 A;  1FG4 A;  5ECN B;  1BYE A;  4WR5 A;  2F8F A;  3FW2 A;  4OD7 A;  3ZFB A;  3ZL5 A;  3DEX A;  1IYH A;  1VF2 A;  2HNL A;  1OVN A;  1A2J A;  2CAI A;  2CT6 A;  1SL2 B;  3E9J B;  2C0E A;  3IOS A;  3RAZ A;  1TOF A;  4WBR D;  3IK7 A;  4ZXG A;  2H6Y A;  4F9Z A;  4MZW A;  3F63 A;  3HD5 A;  1Z7R A;  4GRF A;  1OYJ A;  1AIU A;  1PL2 A;  1X9S B;  3KTL A;  5KN3 A;  1MD3 A;  4NV2 A;  3HHV A;  3CTG A;  2JU5 A;  1GUL A;  2IME A;  4GCI A;  3TRP A;  2IMF A;  4HUA A;  3CYN A;  4EDY A;  5IO2 A;  1EEJ A;  3H1N A;  2V41 A;  4AF2 A;  2X64 A;  4Q5R A;  1BJX A;  1GSD A;  5HR0 A;  5KN1 A;  3KTB A;  3UL3 A;  1GRX A;  1PX7 A;  2X8G A;  4HU7 A;  3VWV A;  3ZVJ A;  2PGT A;  1LBK A;  4KB3 A;  1ERT A;  4IJ3 A;  2PBJ A;  4MZC A; 
#chains in the Genus database with same CATH topology
 3NOF A;  2X8C A;  1NSW A;  1OC9 A;  4GSN A;  3FR6 A;  4G0L A;  1BX9 A;  5HR3 A;  2A2P A;  1KNG A;  5IO0 A;  5FWG A;  2VL9 A;  3CXG A;  1FOV A;  1SL1 B;  3KP8 A;  1TXX A;  3EWL A;  1T7P B;  1ML6 A;  3TOT A;  1UA5 A;  2AV4 A;  3UAP A;  4V2M A;  3ZMK A;  3SWL A;  1UN2 A;  5ENU A;  1T4Y A;  1OE7 A;  1GTB A;  2BMX A;  5F06 A;  1M9A A;  3H93 A;  3D5J A;  3VI5 A;  4NV5 A;  4O32 A;  1V98 A;  2DMM A;  4KGI A;  4KX4 A;  3MWH A;  1WWJ A;  1TI3 A;  3ME8 A;  3LQ7 A;  4MK3 A;  1VF3 A;  2CZ2 A;  2ON7 A;  4RUV A;  2XBQ A;  3EUR A;  3PIN A;  4K0N A;  2VCT A;  3DWV A;  3VI7 A;  2MYG A;  5F05 A;  1GSY A;  5DAL B;  1GNE A;  1QGV A;  18GS A;  4BVY B;  5BMU A;  1RK4 A;  5ELG A;  1S3C A;  1ZL9 A;  8GSS A;  4G19 A;  3GKX A;  2OE1 A;  2H6Z A;  4BWQ A;  1QMV A;  2I4A A;  3GKK A;  4MNN A;  1EV4 A;  3MIX A;  10GS A;  3ZIJ A;  4ECJ A;  1GUM A;  3D6I A;  1PD2 1;  2OE0 A;  4MH2 A;  2YWM A;  1PMT A;  3M0F A;  1HD2 A;  4YKG A;  2N5F A;  3L9V A;  3VWU A;  2HRF A;  5AIX A;  5CP1 A;  1WMJ A;  5ECM B;  5HFK A;  2HI7 A;  3GKN A;  1WIK A;  4MAB A;  1Z9H A;  4N11 A;  2DJK A;  3TGZ A;  2HLS A;  1V40 A;  4PUA A;  4BVY A;  14GS A;  2PU9 C;  2TRC P;  1MDJ A;  2VCQ A;  3KJY A;  5A4U A;  2TRX A;  3F4T A;  5KN0 A;  2IIY A;  3D22 A;  1G7O A;  4IW9 A;  2C3Q A;  2VM1 A;  4XHM A;  3F6D A;  1PN0 A;  3FHK A;  1TKD B;  1WOU A;  3QR6 A;  2IFQ A;  3A2X A;  1G6W A;  2N5B A;  3HY2 A;  5LD0 A;  2XBI A;  2K8S A;  3IXR A;  4MJA A;  2GS3 A;  1T00 A;  3MDK A;  3FK8 A;  4DSQ A;  5A5K A;  1Z6N A;  3GHA A;  1M7T A;  4DVC A;  2WFC A;  5EY6 A;  3LXT A;  1FB0 A;  4ECC A;  5CRE A;  5ECI B;  4XTS A;  1YF0 A;  1S3D A;  4EC0 A;  1BQ7 A;  1TTZ A;  4GQF A;  2BJX A;  3HVX A;  1O7U A;  3ZRD A;  2L5L A;  4IP1 A;  1M2A A;  4K6X A;  2YWN A;  5AGY A;  1PA3 A;  1XWG A;  1X9W B;  2PN8 A;  1Q98 A;  4L5L A;  5D96 A;  1S3A A;  4G0I A;  4ZBD A;  2YJ7 A;  1DUG A;  1V2A A;  2WGR A;  2H73 A;  4MCU A;  1XWA A;  3GX8 A;  3M8N A;  2LJK A;  2H0G A;  22GS A;  3VPQ A;  4USS A;  3EIN A;  4D73 B;  2H1D A;  1PQN A;  4WXT A;  3NZN A;  2O87 A;  1DE2 A;  2GVP A;  3MAK A;  2NDO A;  2HXK A;  3H79 A;  2MMA A;  17GS A;  4F0B A;  3BBY A;  4IN0 A;  2LQQ A;  2K6V A;  3HZ8 A;  5DCH A;  1A8Y A;  4ZB9 A;  2R6K A;  2A2S A;  4MJC A;  1ZCP A;  4HJ2 A;  5HR1 A;  1U87 A;  5HQP A;  1M2B A;  3QMX A;  1ERW A;  4CY8 A;  4EO3 A;  2GT5 A;  3G9B A;  1V58 A;  1F2E A;  2FGX A;  1X5E A;  3P7X A;  3ED3 A;  4AGS A;  2YCD A;  2REM A;  4D73 A;  2RII A;  1B9X C;  2L57 A;  1HQO A;  2DML A;  3ZYW A;  20GS A;  3Q19 A;  3QCP A;  5CYY A;  1QK8 A;  3E0U A;  2A4V A;  1MTC A;  4OCE A;  1MEK A;  2FLS A;  1GL8 A;  5A4V A;  4WBJ A;  3GX0 A;  3K8N A;  1GSS A;  4PQ1 A;  4NAX A;  1F37 A;  5D8I A;  1O8X A;  3RBT A;  2IMI A;  4KA0 A;  4TKY A;  2H72 A;  1GUH A;  1XW9 A;  2MBT A;  5G1K A;  1JZW A;  5IOW A;  3IPZ A;  4CDO A;  4ULX A;  4PX1 A;  5ECL B;  3QFB C;  3TCO A;  4XS4 B;  1H75 A;  3FY7 A;  3GUR A;  4EVM A;  4KDX A;  1SL0 B;  3I6A A;  1CQG A;  2FCH A;  3RHB A;  4WR4 A;  4AJ7 A;  2RLI A;  4KSO A;  5DQY A;  3Q6O A;  4DEJ A;  5GAN D;  4BA7 A;  4LLR A;  1PFO A;  3APQ A;  1AW9 A;  1E2Y A;  2H1B A;  3QD9 A;  4MH3 A;  1EWX A;  5KOW A;  5G2Z A;  5B8A A;  1ERV A;  4QQ7 A;  4FYC A;  4YH2 A;  3UBL A;  3EC3 A;  4X43 A;  3GH6 A;  5JCG A;  3GL3 A;  4MF6 A;  3W6G A;  5J9C A;  5J3R A;  2YJH A;  4JRR A;  2YV9 A;  1JLV A;  4IBP A;  3IAM 2;  3UJ1 A;  1FW1 A;  3LOR A;  5ABR A;  5E4W A;  3TOU A;  4F2I A;  2C3T A;  1EEM A;  2H30 A;  3DIE A;  4HU9 A;  2HSY A;  1XG8 A;  1YEX A;  2VLU A;  5LNK e;  3UMA A;  4K7O A;  4Z2U A;  4X1U A;  3IHG A;  1ZOF A;  3IHQ A;  1JZO A;  1J08 A;  2LRN A;  3A3T A;  3F4S A;  4PNF A;  1TU7 A;  3TKR A;  5CRD A;  1O81 A;  1H4O A;  2FUG 2;  1GSE A;  5G1L A;  1X9M B;  3M9J A;  1WP0 A;  1NM3 A;  1DSB A;  1NHO A;  1PL1 A;  2LNS A;  4OFT A;  4OFM A;  3UVH A;  1AQV A;  3EMX A;  4F0C A;  4IGJ A;  2CVD A;  4V2N A;  3UBK A;  2AUV A;  5B8B A;  1PSQ A;  2GT6 A;  3HCZ A;  1EOH A;  2H0H A;  5IOX A;  2NTO A;  1O85 A;  4OWY A;  1XVW A;  2B1K A;  4TXV A;  4ZL8 A;  1ERU A;  3GL5 A;  3HA9 A;  2VD1 A;  3LEF A;  5G5F A;  1K0N A;  2V2G A;  4EUY A;  1JHB A;  3DML A;  4MMM A;  2H76 A;  4WF5 A;  2H71 A;  1XOA A;  4ZIJ A;  4DSR A;  3LYP A;  3L4N A;  1XZO A;  2DKI A;  1JLW A;  2V32 A;  2MMN A;  5JWO B;  3HJO A;  1TJD A;  2M72 A;  4TW5 A;  3MNG A;  1LU4 A;  2BTO T;  1TRU A;  3LG6 A;  1I9D A;  1UC7 A;  3GST A;  2EC4 A;  5DBQ A;  4ECI A;  3GIX A;  3CBU A;  3ERF A;  1R5A A;  4LA1 A;  4L5O A;  1XOB A;  2WZ9 A;  1M3J A;  1R26 A;  3GYK A;  3I9V 2;  4RI6 A;  5EL8 A;  2XPD A;  4I2U A;  3ERW A;  1N2A A;  5GSS A;  1KEB A;  2OBI A;  2ON5 A;  1SKW B;  3HVS A;  2GQK A;  1SYX A;  3QDN A;  4GLT A;  2GLR A;  4Z2R A;  1EZK A;  2LEG A;  2RM5 A;  1YZX A;  3TKS E;  2H0I A;  1JFU A;  2B1L A;  1GSQ A;  3G7Y A;  4TOP A;  3PGT A;  4EE0 A;  3UIW A;  1YF1 A;  3GV1 A;  2KUC A;  2VOC A;  3S9F A;  3RPN A;  5ECQ B;  1F9M A;  2KP1 A;  3OR5 A;  4MPF A;  3O3T A;  3DRN A;  2OKA A;  2FD3 A;  5CRH A;  1ZZY A;  2VCW A;  5ELA A;  1G0T A;  2HFD A;  4TR1 B;  1E6B A;  2AAW A;  4RI7 A;  4N10 A;  1K0C A;  3DKS A;  3D0Z A;  3KH9 A;  4HQS A;  3IRA A;  2J23 A;  3HVN A;  1TK8 B;  1G7E A;  2LV3 A;  2L6C A;  5G30 A;  1OKD A;  3GH9 A;  3ISO A;  4XS1 A;  2QA2 A;  1TDI A;  1GNW A;  4MPG A;  4LMW A;  2HZF A;  2RUF A;  1PX6 A;  4POL A;  4I6X A;  3TDG A;  5D93 A;  3IR4 A;  3UAR A;  3FMW A;  2GSQ A;  3E3E A;  2FA8 A;  1OE8 A;  4Z7X A;  2DLX A;  5J41 A;  3QAW A;  13GS A;  4TN8 A;  16GS A;  2CVK A;  1FB6 A;  2QC7 A;  2PVQ A;  2RM6 A;  4JZQ A;  4KW6 A;  1KTE A;  2A4H A;  4TR3 A;  4OFN A;  1WPI A;  2PUK C;  5CNW A;  3LWA A;  1SD9 A;  4V2L A;  2JAD A;  1W89 A;  2GZZ A;  2LKU A;  4ISD A;  1SYR A;  2VCZ A;  5B7C A;  4O7H A;  3LW9 A;  3LSZ A;  1SK1 A;  4MJB A;  2PWJ A;  5ECH B;  1SJZ A;  2F51 A;  4WEY A;  3FKF A;  6GSY A;  3ERG A;  3TJB A;  2KOK A;  5DAL A;  3WGE A;  4CW9 A;  5H5R A;  5L71 A;  2OA7 A;  4K8M A;  2LTK A;  1XW6 A;  1GLQ A;  2FWF A;  2V1M A;  3H8Q A;  4K7N A;  2MBS A;  4ZIL A;  1ZMA A;  4Q5N A;  1A24 A;  1NHY A;  2HRA A;  1GTU A;  4MDC A;  5ECR B;  3BCI A;  5JCU A;  1XFL A;  3KGK A;  3J7Y b;  1FAA A;  4IVF A;  5E59 A;  5IIZ A;  3APS A;  4YKF A;  4EIP A;  4KUN A;  4KCE A;  2X49 A;  3L9S A;  4PGT A;  3GKM A;  2DBC A;  4IHU A;  2B5Y A;  4K5R A;  4ML1 A;  1XBS A;  2L5O A;  3C7M A;  1SJ6 A;  5DQS A;  1USB A;  2I3Y A;  5F8B A;  5D9T A;  2VL2 A;  3V1W A;  4L0W A;  4KAE A;  2WUL A;  1FHE A;  4I8B A;  1A8L A;  1PKZ A;  4K2D A;  1HNC A;  4MP4 A;  4ICY A;  4L0U A;  2P31 A;  2IPA A;  5D9V A;  5ECO B;  3VWX A;  4ZL9 A;  2O8V B;  4IQ1 A;  4IKH A;  2PVO C;  2WS2 A;  3WD6 A;  1SU9 A;  1K0D A;  5INY A;  4GSS A;  2V6K A;  4N0V A;  5JWQ B;  2G0F A;  1ZYP A;  2I9H A;  2OBK A;  6GSV A;  1URM A;  2B7K A;  1AUC A;  2DKH A;  1ZYQ B;  2A2R A;  2VLT A;  19GS A;  4PQH A;  4EDZ A;  4IJI A;  2YZU A;  3ZLP A;  4NHW A;  3UOM A;  1K3L A;  1B4P A;  5IQY A;  1K0M A;  4J56 E;  1ST9 A;  2YV7 A;  1JZR A;  2L4Q A;  2NVL A;  1AQX A;  2E2G A;  1M3I A;  1YJ6 A;  4KCA A;  5IMA A;  1BAY A;  2J9H A;  1ILO A;  3ZFL A;  3EMP A;  2UZ8 A;  4Q5Q A;  5IM9 A;  4BWS A;  1OKT A;  4ID0 A;  2EIO A;  1GH2 A;  5ECS A;  2C0F A;  3G7J A;  1ACV A;  2WB9 A;  2B7J A;  5IPG A;  1X5C A;  3N5O A;  3TJK A;  3VUR A;  2LQO A;  3KIJ A;  1SEN A;  4NXI A;  4GXZ A;  3H4K A;  2KHP A;  2VM2 A;  2H01 A;  4HJM A;  1EP8 A;  1PN9 A;  1TP9 A;  1ON4 A;  2ZUP A;  2O89 A;  5CRW A;  3FZA A;  3FZ9 A;  5KN2 A;  1HNA A;  2C80 A;  2JSY A;  3L9U A;  2B5E A;  1F6M C;  2E7P A;  4WF4 A;  2HSH A;  5JCW A;  1X0R A;  2R0G A;  3W8S A;  2CX3 A;  1BG5 A;  1ZYE A;  2M46 A;  4P3Y B;  1QUW A;  4FH8 A;  3QAV A;  1U88 A;  2VO4 A;  2XC2 A;  4AJ6 A;  2DSA A;  1M99 A;  3I43 A;  2VL2 C;  5DJM A;  5EVO A;  3US3 A;  1YDK A;  3ZIV A;  2R3X A;  4TXO B;  3VPT A;  1ZGN A;  3ZRE A;  2L59 A;  4ILF A;  5ECP B;  3SBC A;  3BCK A;  2YOI A;  3TJJ A;  5LCZ A;  3UVT A;  4F82 A;  4K0G A;  4PNG A;  5HFG A;  3TRX A;  2LST A;  2YAN A;  3FR9 A;  4XIH A;  3P90 A;  5D9X A;  3F3R A;  4NWY A;  1Z5Y E;  2WDU A;  2FWG A;  2DJ3 A;  1TRS A;  1QQ2 A;  2YWI A;  3UEM A;  3GFK A;  5GST A;  4XS4 A;  1N8J A;  1LJR A;  3CTF A;  3O6T A;  1HYU A;  4TXO A;  4ZB8 A;  4POB A;  4MF5 A;  1AQW A;  1K3O A;  1J9B A;  1MD4 A;  5COH A;  2LRT A;  3CMI A;  1XXU A;  2FNO A;  3GA4 A;  1YQ1 A;  3EU4 A;  1XIY A;  1F3A A;  1XCC A;  4JR6 A;  2NPB A;  4KSM A;  2HRK A;  2YP6 A;  4H86 A;  2VUP A;  4TR0 A;  5F0G A;  3F0I A;  2MMZ A;  3D21 A;  3ZZX A;  2L4C A;  1R4W A;  3BJ5 A;  2KP2 A;  2VD0 A;  3CRU A;  1EGO A;  1O73 A;  1T3B A;  3RPP A;  2YZH A;  2H74 A;  4JED A;  4X0X A;  5DCG A;  1X5D A;  4ZBB A;  1SD8 A;  4FO5 A;  4Q5F A;  3FZ5 A;  4QL9 A;  5DJL A;  4DSS B;  2P5R A;  3G7I A;  4NPB A;  3IAS 2;  5GAP D;  2GDR A;  5D9W A;  4PXO A;  3ZIT A;  3DXB A;  1K3Y A;  4V1A g;  3P8W A;  3WGX A;  2FA4 A;  5IMC A;  2C1Y A;  4XS6 A;  3HKR A;  1Y6E A;  3A5W A;  2FWH A;  5J4U A;  3A5I A;  1WRY A;  2D2Z A;  4O92 A;  5AN1 A;  4ECB A;  4XRD A;  1A2M A;  3VFI A;  3M3M A;  4DSS A;  3TJG A;  1V57 A;  4NHZ A;  3KP9 A;  1UVZ A;  1GSU A;  2F9S A;  2H19 A;  1MDI A;  1TK5 B;  2JZT A;  4I97 A;  2VIM A;  3HZ4 A;  5FT3 A;  3LGC A;  3KCM A;  4FIW A;  5H5Q A;  3F3Q A;  4QL7 A;  3D4T A;  1GP1 A;  4IQA A;  1A2L A;  4GWR A;  1O8W A;  4EL1 A;  5CRG A;  3A2W A;  3CSI A;  1PRX A;  3GUS A;  1RW1 A;  3C8E A;  4JU5 A;  3TUE A;  4G2E A;  1B8X A;  2HSM A;  3EYT A;  1K0A A;  1TK0 B;  2R37 A;  4HZ2 A;  4YAV A;  4YQV A;  2OAC A;  3IC8 A;  4HSC X;  1FVJ A;  4Z2T A;  2XHF A;  5A4W A;  2FY6 A;  1OC9 B;  3HYP A;  3KXO A;  2KLX A;  3Q18 A;  3AY8 A;  5FHI A;  3TB2 A;  1GTI A;  1XWC A;  1XW5 A;  1TRV A;  3C73 A;  3DD3 A;  3F4R A;  4FQU A;  4N0Z A;  4I2T A;  3RHC A;  2C0G A;  4HEA 2;  4EF0 A;  4WET A;  4K2X A;  2ZNM A;  3I69 A;  2H66 A;  2DIY A;  2QA1 A;  3IV4 A;  2K9F A;  3L78 A;  2WRT A;  2RUE A;  3VLN A;  3QFA C;  2CVB A;  3F8U A;  4BPY A;  3LJR A;  4MF7 A;  3M1G A;  2H70 A;  2JAC A;  2PER A;  3TRQ A;  2O85 A;  3LXZ A;  2IWT A;  1OAZ A;  3R3E A;  4MA9 A;  2VLV A;  3J7Y k;  3KM6 A;  3P2A A;  3VK9 A;  1GTA A;  3KZQ A;  3F6F A;  3DGQ A;  4IEL A;  4TR1 A;  4K1F A;  3WGD A;  2LS5 A;  3HJM A;  3GTU B;  1M9B A;  3IDV A;  2WCI A;  3FYG A;  2ES7 A;  2GQL A;  3WT2 A;  1B4Q A;  2JL4 A;  1SKR B;  2C4J A;  3BOA A;  4HZ4 A;  1Z6M A;  4J2F A;  2DJ2 A;  3APO A;  5IMF A;  2CAQ A;  1PKW A;  2MMO A;  3PH9 A;  3EE2 A;  3Q74 A;  4YQM A;  2IMD A;  3TJF A;  2DJ0 A;  2O7K A;  6GST A;  1VF4 A;  1U3A A;  2XPE A;  1YY7 A;  3IA1 A;  1GUK A;  4KDU A;  4G9H A;  1Q4J A;  3GTU A;  4PTS A;  3IE3 A;  2WJU A;  3U6V A;  3ME7 A;  2V6O A;  2F8A A;  3W8J A;  2X8H A;  1HNB A;  4IP6 A;  1A23 A;  3IK9 A;  4OO4 A;  3ZTL A;  2M80 A;  2VCX A;  1AAZ A;  2FHE A;  4ZBA A;  2CQ9 A;  5EPF A;  5CAX A;  3BD2 A;  1TI1 A;  6GSX A;  1WE0 A;  3DVX A;  2AB6 A;  2IFQ B;  4TRX A;  4HOJ A;  4POM A;  2GQM A;  2B3S A;  1B48 A;  1KBN A;  3QOU A;  5IMV A;  2JZS A;  1VGL A;  5ID2 B;  4MJE A;  1THO A;  2I1U A;  5IPH A;  1SK2 A;  5DAK B;  1J0F A;  2EIR A;  3ZML A;  4GQC A;  1EGR A;  1YKC A;  1FOH A;  2B5X A;  4CHS A;  2DJJ A;  1DBY A;  3TKS A;  4K5S A;  2YWO A;  2H1A A;  3HDC A;  2L6D A;  4PUR A;  4JE1 A;  2LUS A;  3IBH A;  3VWW A;  1XVQ A;  2Z9S A;  1B9Y C;  3GNJ A;  2GST A;  1QFN A;  3RDW A;  2LNT A;  4POK A;  6GSW A;  4PUF C;  3C1S A;  5ID2 A;  1GLP A;  3ZVJ D;  3FEU A;  4O5R A;  3MYD A;  3CQF A;  4HS1 A;  4BIK A;  2R2J A;  4O5U A;  2CV4 A;  5DAK A;  4XRA A;  2N5A A;  2OE3 A;  2IMK A;  4WKW A;  5HFI A;  3L0H A;  1TRW A;  3IC4 A;  2HT9 A;  2P0G A;  3N9J A;  5IMZ A;  5IMD A;  3HVV A;  3JCM L;  3QAG A;  1OC8 A;  1U3I A;  3QPM A;  4FYU A;  2R0C A;  4EKZ A;  2LRC A;  1RQM A;  1XPV A;  1R5P A;  2PMT A;  1VRS D;  2AJQ B;  4X4J A;  5ECK B;  3KMN A;  3PPU A;  1IYI A;  1A0F A;  3WYW A;  1F3B A;  3KMO A;  2CZ3 A;  4OO5 A;  3D4M A;  4YAP A;  3U5R E;  5DDL A;  2LJR A;  3HXS A;  4HDE A;  4EXJ A;  3HJP A;  3CRT A;  2F3M A;  4RQR A;  1O6J A;  3KD0 A;  5KEJ A;  4V1A p;  1QXH A;  4ZL7 A;  2LJA A;  3GRX A;  4TR4 A;  2VAF A;  4ML6 A;  2R5G A;  2I81 A;  2QSI A;  4LMV A;  2E0Q A;  2GGT A;  2VL3 A;  3GN3 A;  2IJY A;  4E8H A;  4ACS A;  2R4V A;  3WT1 A;  2GSR A;  4BL7 B;  2IL3 A;  4XCS A;  3DYR A;  1EP7 A;  4MLY A;  2MZC A;  5BRT A;  2YN1 A;  4OMV A;  5F07 A;  3R2Q A;  2AYT A;  1K0O A;  3PR8 A;  1FVK A;  1EV9 A;  1AC1 A;  2H8L A;  5G31 A;  4CY6 A;  4J57 E;  3KEB A;  5D73 A;  5H5S A;  3FZ4 A;  4KE3 A;  2K18 A;  2CX4 A;  5J9B A;  4BVX B;  5JWR B;  4GF0 A;  3TKS C;  3TKQ A;  4IS0 A;  2C3N A;  7GSS A;  4MZB A;  2GZY A;  4BL7 A;  2B6M A;  1EOG A;  4JR4 A;  2QGV A;  2QKE A;  2P5Q A;  2OAD A;  3CSH A;  4GST A;  4HI7 A;  3O76 A;  1M0U A;  1TW9 A;  1W4V A;  5AIV A;  2GZP A;  4E8E A;  1CQH A;  3EU3 A;  2EIQ A;  2C0D A;  3C71 A;  3C1R A;  1OC3 A;  3KH7 A;  2HE3 A;  4KF9 A;  1WJK A;  4BVX A;  4N30 A;  1NW2 A;  1SKS B;  1C72 A;  1ZYN A;  5GZZ B;  4TVE A;  3LYK A;  1DE1 A;  2VCV A;  1VF1 A;  1U6T A;  2H75 A;  2PPT A;  2TIR A;  2IN3 A;  1T4Z A;  11GS A;  1FO5 A;  1I5G A;  1YEP A;  2DC5 A;  1T8E B;  2YPM A;  5AIS A;  5B6M A;  2ALB A;  12GS A;  5CO3 A;  3FRC A;  3DVW A;  4JBB A;  4LL4 B;  4NMU A;  2C8U A;  2X99 A;  9GSS A;  2DIZ A;  1V9W A;  2DJ1 A;  4L8E A;  1ABA A;  2JSZ A;  2CA8 A;  5J5N A;  1Y25 A;  2G2Q A;  2HZE B;  2NBS A;  3MSZ A;  1PGT A;  4ZB6 A;  4FYB A;  2HYX A;  5C00 A;  4I5Q A;  6GSU A;  1SK0 A;  1K0B A;  1MDK A;  1M2D A;  2R0P A;  1T1V A;  2HRN A;  1G6Y A;  4LL1 B;  1BED A;  2GTU A;  4K9Z A;  1Z3E A;  4KDY A;  2GSS A;  3F9U A;  5HR2 A;  4KH7 A;  1A0R P;  2E2M A;  3NIV A;  2YNX A;  2AHE A;  3M9K A;  5C04 A;  1XWK A;  4YQU A;  1THX A;  2OJL A;  4KND A;  1YKA A;  3GMF A;  4F03 A;  4G10 A;  4OCF A;  5G5E A;  4GTU A;  2HZE A;  1JZD A;  4RQX A;  3FR3 A;  5DVB A;  1XWB A;  1AXD A;  1GWC A;  3GSS A;  2JZR A;  3LFL A;  3EPT A;  4PQI A;  6GSS A;  4K7I A;  2ZCT A;  2K8V A;  2H1G A;  5B6N A;  3EVI A;  4HQZ A;  1GSF A;  1R7H A;  2H6X A;  3CSJ A;  1Z7P A;  1SJI A;  2FWE A;  3TKP A;  3A2V A;  1TU8 A;  4AJ8 A;  1FG4 A;  5ECN B;  5KOX A;  1BYE A;  4WR5 A;  2F8F A;  3FW2 A;  4OD7 A;  3ZFB A;  4A5P A;  3ZL5 A;  4O5Q A;  3DEX A;  1IYH A;  1VF2 A;  2HNL A;  1OVN A;  1A2J A;  2CAI A;  2CT6 A;  1SL2 B;  3E9J B;  2C0E A;  4G0K A;  3IOS A;  3RAZ A;  1TOF A;  4WBR D;  3IK7 A;  2X4A A;  4ZXG A;  2H6Y A;  4F9Z A;  4MZW A;  3F63 A;  3HD5 A;  1Z7R A;  4GRF A;  1OYJ A;  1AIU A;  1PL2 A;  1X9S B;  3KTL A;  5KN3 A;  1MD3 A;  4NV2 A;  3HHV A;  3CTG A;  2JU5 A;  1GUL A;  2IME A;  4GCI A;  3TRP A;  2IMF A;  4HUA A;  3CYN A;  4EDY A;  5IO2 A;  1S3R A;  1EEJ A;  3H1N A;  2V41 A;  4AF2 A;  2X64 A;  4Q5R A;  1BJX A;  1GSD A;  5HR0 A;  5KN1 A;  3KTB A;  3UL3 A;  1GRX A;  1PX7 A;  2X8G A;  4HU7 A;  3VWV A;  3ZVJ A;  2PGT A;  1LBK A;  4KB3 A;  1ERT A;  4IJ3 A;  2PBJ A;  4MZC A;  4EIQ A; 
#chains in the Genus database with same CATH homology
 3NOF A;  2X8C A;  1NSW A;  1OC9 A;  4GSN A;  3FR6 A;  4G0L A;  1BX9 A;  5HR3 A;  2A2P A;  1KNG A;  5IO0 A;  5FWG A;  2VL9 A;  3CXG A;  1FOV A;  1SL1 B;  3KP8 A;  1TXX A;  3EWL A;  1T7P B;  1ML6 A;  3TOT A;  1UA5 A;  2AV4 A;  3UAP A;  4V2M A;  3ZMK A;  3SWL A;  1UN2 A;  5ENU A;  1T4Y A;  1OE7 A;  1GTB A;  2BMX A;  5F06 A;  1M9A A;  3H93 A;  3D5J A;  3VI5 A;  4NV5 A;  4O32 A;  1V98 A;  2DMM A;  4KGI A;  4KX4 A;  3MWH A;  1WWJ A;  1TI3 A;  3ME8 A;  3LQ7 A;  4MK3 A;  1VF3 A;  2CZ2 A;  2ON7 A;  4RUV A;  2XBQ A;  3EUR A;  3PIN A;  4K0N A;  2VCT A;  3DWV A;  3VI7 A;  2MYG A;  5F05 A;  1GSY A;  5DAL B;  1GNE A;  1QGV A;  18GS A;  4BVY B;  5BMU A;  1RK4 A;  5ELG A;  1S3C A;  1ZL9 A;  8GSS A;  4G19 A;  3GKX A;  2OE1 A;  2H6Z A;  4BWQ A;  1QMV A;  2I4A A;  3GKK A;  4MNN A;  1EV4 A;  3MIX A;  10GS A;  3ZIJ A;  4ECJ A;  1GUM A;  3D6I A;  1PD2 1;  2OE0 A;  4MH2 A;  2YWM A;  1PMT A;  3M0F A;  1HD2 A;  4YKG A;  2N5F A;  3L9V A;  3VWU A;  2HRF A;  5AIX A;  5CP1 A;  1WMJ A;  5ECM B;  5HFK A;  2HI7 A;  3GKN A;  1WIK A;  4MAB A;  1Z9H A;  4N11 A;  2DJK A;  3TGZ A;  2HLS A;  1V40 A;  4PUA A;  4BVY A;  14GS A;  2PU9 C;  2TRC P;  1MDJ A;  2VCQ A;  3KJY A;  5A4U A;  2TRX A;  3F4T A;  5KN0 A;  2IIY A;  3D22 A;  1G7O A;  4IW9 A;  2C3Q A;  2VM1 A;  4XHM A;  3F6D A;  1PN0 A;  3FHK A;  1TKD B;  1WOU A;  3QR6 A;  2IFQ A;  3A2X A;  1G6W A;  2N5B A;  3HY2 A;  5LD0 A;  2XBI A;  2K8S A;  3IXR A;  4MJA A;  2GS3 A;  1T00 A;  3MDK A;  3FK8 A;  4DSQ A;  5A5K A;  1Z6N A;  3GHA A;  1M7T A;  4DVC A;  2WFC A;  5EY6 A;  3LXT A;  1FB0 A;  4ECC A;  5CRE A;  5ECI B;  4XTS A;  1YF0 A;  1S3D A;  4EC0 A;  1BQ7 A;  1TTZ A;  4GQF A;  2BJX A;  3HVX A;  1O7U A;  3ZRD A;  2L5L A;  4IP1 A;  1M2A A;  4K6X A;  2YWN A;  5AGY A;  1PA3 A;  1XWG A;  1X9W B;  2PN8 A;  1Q98 A;  4L5L A;  5D96 A;  1S3A A;  4G0I A;  4ZBD A;  2YJ7 A;  1DUG A;  1V2A A;  2WGR A;  2H73 A;  4MCU A;  1XWA A;  3GX8 A;  3M8N A;  2LJK A;  2H0G A;  22GS A;  3VPQ A;  4USS A;  3EIN A;  4D73 B;  2H1D A;  1PQN A;  4WXT A;  3NZN A;  2O87 A;  1DE2 A;  2GVP A;  3MAK A;  2NDO A;  2HXK A;  3H79 A;  2MMA A;  17GS A;  4F0B A;  3BBY A;  4IN0 A;  2LQQ A;  2K6V A;  3HZ8 A;  5DCH A;  1A8Y A;  4ZB9 A;  2R6K A;  2A2S A;  4MJC A;  1ZCP A;  4HJ2 A;  5HR1 A;  1U87 A;  5HQP A;  1M2B A;  3QMX A;  1ERW A;  4CY8 A;  4EO3 A;  2GT5 A;  3G9B A;  1V58 A;  1F2E A;  2FGX A;  1X5E A;  3P7X A;  3ED3 A;  4AGS A;  2YCD A;  2REM A;  4D73 A;  2RII A;  1B9X C;  2L57 A;  1HQO A;  2DML A;  3ZYW A;  20GS A;  3Q19 A;  3QCP A;  5CYY A;  1QK8 A;  3E0U A;  2A4V A;  1MTC A;  4OCE A;  1MEK A;  2FLS A;  1GL8 A;  5A4V A;  4WBJ A;  3GX0 A;  3K8N A;  1GSS A;  4PQ1 A;  4NAX A;  1F37 A;  5D8I A;  1O8X A;  3RBT A;  2IMI A;  4KA0 A;  4TKY A;  2H72 A;  1GUH A;  1XW9 A;  2MBT A;  5G1K A;  1JZW A;  5IOW A;  3IPZ A;  4CDO A;  4ULX A;  4PX1 A;  5ECL B;  3QFB C;  3TCO A;  4XS4 B;  1H75 A;  3FY7 A;  3GUR A;  4EVM A;  4KDX A;  1SL0 B;  3I6A A;  1CQG A;  2FCH A;  3RHB A;  4WR4 A;  4AJ7 A;  2RLI A;  4KSO A;  5DQY A;  3Q6O A;  4DEJ A;  5GAN D;  4BA7 A;  4LLR A;  3APQ A;  1AW9 A;  1E2Y A;  2H1B A;  3QD9 A;  4MH3 A;  1EWX A;  5KOW A;  5G2Z A;  5B8A A;  1ERV A;  4QQ7 A;  4FYC A;  4YH2 A;  3UBL A;  3EC3 A;  4X43 A;  3GH6 A;  5JCG A;  3GL3 A;  4MF6 A;  3W6G A;  5J9C A;  5J3R A;  2YJH A;  4JRR A;  2YV9 A;  1JLV A;  4IBP A;  3IAM 2;  3UJ1 A;  1FW1 A;  3LOR A;  5ABR A;  5E4W A;  3TOU A;  4F2I A;  2C3T A;  1EEM A;  2H30 A;  3DIE A;  4HU9 A;  2HSY A;  1YEX A;  2VLU A;  5LNK e;  3UMA A;  4K7O A;  4Z2U A;  4X1U A;  3IHG A;  1ZOF A;  3IHQ A;  1JZO A;  1J08 A;  2LRN A;  3A3T A;  3F4S A;  4PNF A;  1TU7 A;  3TKR A;  5CRD A;  1O81 A;  1H4O A;  2FUG 2;  1GSE A;  5G1L A;  1X9M B;  3M9J A;  1WP0 A;  1NM3 A;  1DSB A;  1NHO A;  1PL1 A;  2LNS A;  4OFT A;  4OFM A;  3UVH A;  1AQV A;  3EMX A;  4F0C A;  4IGJ A;  2CVD A;  4V2N A;  3UBK A;  2AUV A;  5B8B A;  1PSQ A;  2GT6 A;  3HCZ A;  1EOH A;  2H0H A;  5IOX A;  2NTO A;  1O85 A;  4OWY A;  1XVW A;  2B1K A;  4TXV A;  4ZL8 A;  1ERU A;  3GL5 A;  3HA9 A;  2VD1 A;  3LEF A;  5G5F A;  1K0N A;  2V2G A;  4EUY A;  1JHB A;  3DML A;  4MMM A;  2H76 A;  4WF5 A;  2H71 A;  1XOA A;  4ZIJ A;  4DSR A;  3LYP A;  3L4N A;  1XZO A;  2DKI A;  1JLW A;  2V32 A;  2MMN A;  5JWO B;  3HJO A;  1TJD A;  2M72 A;  4TW5 A;  3MNG A;  1LU4 A;  2BTO T;  1TRU A;  3LG6 A;  1I9D A;  1UC7 A;  3GST A;  2EC4 A;  5DBQ A;  4ECI A;  3GIX A;  3CBU A;  3ERF A;  1R5A A;  4LA1 A;  4L5O A;  1XOB A;  2WZ9 A;  1R26 A;  3GYK A;  3I9V 2;  4RI6 A;  5EL8 A;  2XPD A;  4I2U A;  3ERW A;  1N2A A;  5GSS A;  1KEB A;  2OBI A;  2ON5 A;  1SKW B;  3HVS A;  2GQK A;  1SYX A;  3QDN A;  4GLT A;  2GLR A;  4Z2R A;  1EZK A;  2LEG A;  2RM5 A;  1YZX A;  3TKS E;  2H0I A;  1JFU A;  2B1L A;  1GSQ A;  3G7Y A;  4TOP A;  3PGT A;  4EE0 A;  3UIW A;  1YF1 A;  3GV1 A;  2KUC A;  2VOC A;  3S9F A;  3RPN A;  5ECQ B;  1F9M A;  2KP1 A;  3OR5 A;  4MPF A;  3O3T A;  3DRN A;  2OKA A;  2FD3 A;  5CRH A;  1ZZY A;  2VCW A;  5ELA A;  1G0T A;  2HFD A;  4TR1 B;  1E6B A;  2AAW A;  4RI7 A;  4N10 A;  1K0C A;  3DKS A;  3D0Z A;  3KH9 A;  4HQS A;  3IRA A;  2J23 A;  1TK8 B;  1G7E A;  2LV3 A;  2L6C A;  5G30 A;  1OKD A;  3GH9 A;  3ISO A;  4XS1 A;  2QA2 A;  1TDI A;  1GNW A;  4MPG A;  4LMW A;  2HZF A;  2RUF A;  1PX6 A;  4POL A;  4I6X A;  3TDG A;  5D93 A;  3IR4 A;  3UAR A;  3FMW A;  2GSQ A;  3E3E A;  2FA8 A;  1OE8 A;  4Z7X A;  2DLX A;  5J41 A;  3QAW A;  13GS A;  4TN8 A;  16GS A;  2CVK A;  1FB6 A;  2QC7 A;  2PVQ A;  2RM6 A;  4JZQ A;  4KW6 A;  1KTE A;  2A4H A;  4TR3 A;  4OFN A;  1WPI A;  2PUK C;  5CNW A;  3LWA A;  1SD9 A;  4V2L A;  2JAD A;  1W89 A;  2GZZ A;  2LKU A;  4ISD A;  1SYR A;  2VCZ A;  5B7C A;  4O7H A;  3LW9 A;  3LSZ A;  1SK1 A;  4MJB A;  2PWJ A;  5ECH B;  1SJZ A;  2F51 A;  4WEY A;  3FKF A;  6GSY A;  3ERG A;  3TJB A;  2KOK A;  5DAL A;  3WGE A;  4CW9 A;  5H5R A;  5L71 A;  2OA7 A;  4K8M A;  2LTK A;  1XW6 A;  1GLQ A;  2FWF A;  2V1M A;  3H8Q A;  4K7N A;  2MBS A;  4ZIL A;  1ZMA A;  4Q5N A;  1A24 A;  1NHY A;  2HRA A;  1GTU A;  4MDC A;  5ECR B;  3BCI A;  5JCU A;  1XFL A;  3KGK A;  3J7Y b;  1FAA A;  4IVF A;  5E59 A;  5IIZ A;  3APS A;  4YKF A;  4EIP A;  4KUN A;  4KCE A;  2X49 A;  3L9S A;  4PGT A;  3GKM A;  2DBC A;  4IHU A;  2B5Y A;  4K5R A;  4ML1 A;  1XBS A;  2L5O A;  3C7M A;  1SJ6 A;  5DQS A;  1USB A;  2I3Y A;  5F8B A;  5D9T A;  2VL2 A;  3V1W A;  4L0W A;  4KAE A;  2WUL A;  1FHE A;  4I8B A;  1A8L A;  1PKZ A;  4K2D A;  1HNC A;  4MP4 A;  4ICY A;  4L0U A;  2P31 A;  2IPA A;  5D9V A;  5ECO B;  3VWX A;  4ZL9 A;  2O8V B;  4IQ1 A;  4IKH A;  2PVO C;  2WS2 A;  3WD6 A;  1SU9 A;  1K0D A;  5INY A;  4GSS A;  2V6K A;  4N0V A;  5JWQ B;  2G0F A;  1ZYP A;  2I9H A;  2OBK A;  6GSV A;  1URM A;  2B7K A;  1AUC A;  2DKH A;  1ZYQ B;  2A2R A;  2VLT A;  19GS A;  4PQH A;  4EDZ A;  4IJI A;  2YZU A;  3ZLP A;  4NHW A;  3UOM A;  1K3L A;  1B4P A;  5IQY A;  1K0M A;  4J56 E;  1ST9 A;  2YV7 A;  1JZR A;  2L4Q A;  2NVL A;  1AQX A;  2E2G A;  1YJ6 A;  4KCA A;  5IMA A;  1BAY A;  2J9H A;  1ILO A;  3ZFL A;  3EMP A;  2UZ8 A;  4Q5Q A;  5IM9 A;  4BWS A;  1OKT A;  4ID0 A;  2EIO A;  1GH2 A;  5ECS A;  2C0F A;  3G7J A;  1ACV A;  2WB9 A;  2B7J A;  5IPG A;  1X5C A;  3N5O A;  3TJK A;  3VUR A;  2LQO A;  3KIJ A;  1SEN A;  4NXI A;  4GXZ A;  3H4K A;  2KHP A;  2VM2 A;  2H01 A;  4HJM A;  1EP8 A;  1PN9 A;  1TP9 A;  1ON4 A;  2ZUP A;  2O89 A;  5CRW A;  3FZA A;  3FZ9 A;  5KN2 A;  1HNA A;  2C80 A;  2JSY A;  3L9U A;  2B5E A;  1F6M C;  2E7P A;  4WF4 A;  2HSH A;  5JCW A;  1X0R A;  2R0G A;  3W8S A;  2CX3 A;  1BG5 A;  1ZYE A;  2M46 A;  4P3Y B;  1QUW A;  4FH8 A;  3QAV A;  1U88 A;  2VO4 A;  2XC2 A;  4AJ6 A;  2DSA A;  1M99 A;  3I43 A;  2VL2 C;  5DJM A;  5EVO A;  3US3 A;  1YDK A;  3ZIV A;  2R3X A;  4TXO B;  3VPT A;  1ZGN A;  3ZRE A;  2L59 A;  4ILF A;  5ECP B;  3SBC A;  3BCK A;  2YOI A;  3TJJ A;  5LCZ A;  3UVT A;  4F82 A;  4K0G A;  4PNG A;  5HFG A;  3TRX A;  2LST A;  2YAN A;  3FR9 A;  4XIH A;  3P90 A;  5D9X A;  3F3R A;  4NWY A;  1Z5Y E;  2WDU A;  2FWG A;  2DJ3 A;  1TRS A;  1QQ2 A;  2YWI A;  3UEM A;  3GFK A;  5GST A;  4XS4 A;  1N8J A;  1LJR A;  3CTF A;  3O6T A;  1HYU A;  4TXO A;  4ZB8 A;  4POB A;  4MF5 A;  1AQW A;  1K3O A;  1J9B A;  1MD4 A;  5COH A;  2LRT A;  3CMI A;  1XXU A;  2FNO A;  3GA4 A;  1YQ1 A;  3EU4 A;  1XIY A;  1F3A A;  1XCC A;  4JR6 A;  2NPB A;  4KSM A;  2HRK A;  2YP6 A;  4H86 A;  2VUP A;  4TR0 A;  5F0G A;  3F0I A;  2MMZ A;  3D21 A;  3ZZX A;  2L4C A;  1R4W A;  3BJ5 A;  2KP2 A;  2VD0 A;  3CRU A;  1EGO A;  1O73 A;  1T3B A;  3RPP A;  2YZH A;  2H74 A;  4JED A;  4X0X A;  5DCG A;  1X5D A;  4ZBB A;  1SD8 A;  4FO5 A;  4Q5F A;  3FZ5 A;  4QL9 A;  5DJL A;  4DSS B;  2P5R A;  3G7I A;  4NPB A;  3IAS 2;  5GAP D;  2GDR A;  5D9W A;  4PXO A;  3ZIT A;  3DXB A;  1K3Y A;  4V1A g;  3P8W A;  3WGX A;  2FA4 A;  5IMC A;  2C1Y A;  4XS6 A;  3HKR A;  1Y6E A;  3A5W A;  2FWH A;  5J4U A;  3A5I A;  1WRY A;  2D2Z A;  4O92 A;  5AN1 A;  4ECB A;  4XRD A;  1A2M A;  3VFI A;  3M3M A;  4DSS A;  3TJG A;  1V57 A;  4NHZ A;  3KP9 A;  1UVZ A;  1GSU A;  2F9S A;  2H19 A;  1MDI A;  1TK5 B;  2JZT A;  4I97 A;  2VIM A;  3HZ4 A;  5FT3 A;  3LGC A;  3KCM A;  4FIW A;  5H5Q A;  3F3Q A;  4QL7 A;  3D4T A;  1GP1 A;  4IQA A;  1A2L A;  4GWR A;  1O8W A;  4EL1 A;  5CRG A;  3A2W A;  3CSI A;  1PRX A;  3GUS A;  1RW1 A;  3C8E A;  4JU5 A;  3TUE A;  4G2E A;  1B8X A;  2HSM A;  3EYT A;  1K0A A;  1TK0 B;  2R37 A;  4HZ2 A;  4YAV A;  4YQV A;  2OAC A;  3IC8 A;  1FVJ A;  4Z2T A;  2XHF A;  5A4W A;  2FY6 A;  1OC9 B;  3HYP A;  3KXO A;  2KLX A;  3Q18 A;  3AY8 A;  5FHI A;  3TB2 A;  1GTI A;  1XWC A;  1XW5 A;  1TRV A;  3C73 A;  3DD3 A;  3F4R A;  4FQU A;  4N0Z A;  4I2T A;  3RHC A;  2C0G A;  4HEA 2;  4EF0 A;  4WET A;  4K2X A;  2ZNM A;  3I69 A;  2H66 A;  2DIY A;  2QA1 A;  3IV4 A;  2K9F A;  3L78 A;  2WRT A;  2RUE A;  3VLN A;  3QFA C;  2CVB A;  3F8U A;  4BPY A;  3LJR A;  4MF7 A;  3M1G A;  2H70 A;  2JAC A;  2PER A;  3TRQ A;  2O85 A;  3LXZ A;  2IWT A;  1OAZ A;  3R3E A;  4MA9 A;  2VLV A;  3J7Y k;  3KM6 A;  3P2A A;  3VK9 A;  1GTA A;  3KZQ A;  3F6F A;  3DGQ A;  4IEL A;  4TR1 A;  4K1F A;  3WGD A;  2LS5 A;  3HJM A;  3GTU B;  1M9B A;  3IDV A;  2WCI A;  3FYG A;  2ES7 A;  2GQL A;  3WT2 A;  1B4Q A;  2JL4 A;  1SKR B;  2C4J A;  3BOA A;  4HZ4 A;  1Z6M A;  4J2F A;  2DJ2 A;  3APO A;  5IMF A;  2CAQ A;  1PKW A;  2MMO A;  3PH9 A;  3EE2 A;  3Q74 A;  4YQM A;  2IMD A;  3TJF A;  2DJ0 A;  2O7K A;  6GST A;  1VF4 A;  1U3A A;  2XPE A;  1YY7 A;  3IA1 A;  1GUK A;  4KDU A;  4G9H A;  1Q4J A;  3GTU A;  4PTS A;  3IE3 A;  2WJU A;  3U6V A;  3ME7 A;  2V6O A;  2F8A A;  3W8J A;  2X8H A;  1HNB A;  4IP6 A;  1A23 A;  3IK9 A;  4OO4 A;  3ZTL A;  2M80 A;  2VCX A;  1AAZ A;  2FHE A;  4ZBA A;  2CQ9 A;  5EPF A;  5CAX A;  3BD2 A;  1TI1 A;  6GSX A;  1WE0 A;  3DVX A;  2AB6 A;  2IFQ B;  4TRX A;  4HOJ A;  4POM A;  2GQM A;  2B3S A;  1B48 A;  1KBN A;  3QOU A;  5IMV A;  2JZS A;  1VGL A;  5ID2 B;  4MJE A;  1THO A;  2I1U A;  5IPH A;  1SK2 A;  5DAK B;  1J0F A;  2EIR A;  3ZML A;  4GQC A;  1EGR A;  1YKC A;  1FOH A;  2B5X A;  4CHS A;  2DJJ A;  1DBY A;  3TKS A;  4K5S A;  2YWO A;  2H1A A;  3HDC A;  2L6D A;  4PUR A;  4JE1 A;  2LUS A;  3IBH A;  3VWW A;  1XVQ A;  2Z9S A;  1B9Y C;  3GNJ A;  2GST A;  1QFN A;  3RDW A;  2LNT A;  4POK A;  6GSW A;  4PUF C;  3C1S A;  5ID2 A;  1GLP A;  3ZVJ D;  3FEU A;  4O5R A;  3MYD A;  4HS1 A;  2R2J A;  4O5U A;  2CV4 A;  5DAK A;  4XRA A;  2N5A A;  2OE3 A;  2IMK A;  4WKW A;  5HFI A;  3L0H A;  1TRW A;  3IC4 A;  2HT9 A;  2P0G A;  3N9J A;  5IMZ A;  5IMD A;  3HVV A;  3JCM L;  3QAG A;  1OC8 A;  1U3I A;  3QPM A;  4FYU A;  2R0C A;  4EKZ A;  2LRC A;  1RQM A;  1XPV A;  1R5P A;  2PMT A;  1VRS D;  2AJQ B;  4X4J A;  5ECK B;  3KMN A;  3PPU A;  1IYI A;  1A0F A;  3WYW A;  1F3B A;  3KMO A;  2CZ3 A;  4OO5 A;  3D4M A;  4YAP A;  3U5R E;  5DDL A;  2LJR A;  3HXS A;  4HDE A;  4EXJ A;  3HJP A;  3CRT A;  2F3M A;  4RQR A;  1O6J A;  3KD0 A;  5KEJ A;  4V1A p;  1QXH A;  4ZL7 A;  2LJA A;  3GRX A;  4TR4 A;  2VAF A;  4ML6 A;  2R5G A;  2I81 A;  2QSI A;  4LMV A;  2E0Q A;  2GGT A;  2VL3 A;  3GN3 A;  2IJY A;  4E8H A;  4ACS A;  2R4V A;  3WT1 A;  2GSR A;  4BL7 B;  2IL3 A;  4XCS A;  3DYR A;  1EP7 A;  4MLY A;  2MZC A;  5BRT A;  2YN1 A;  4OMV A;  5F07 A;  3R2Q A;  2AYT A;  1K0O A;  3PR8 A;  1FVK A;  1EV9 A;  1AC1 A;  2H8L A;  5G31 A;  4CY6 A;  4J57 E;  3KEB A;  5D73 A;  5H5S A;  3FZ4 A;  4KE3 A;  2K18 A;  2CX4 A;  5J9B A;  4BVX B;  5JWR B;  4GF0 A;  3TKS C;  3TKQ A;  4IS0 A;  2C3N A;  7GSS A;  4MZB A;  2GZY A;  4BL7 A;  2B6M A;  1EOG A;  4JR4 A;  2QGV A;  2QKE A;  2P5Q A;  2OAD A;  3CSH A;  4GST A;  4HI7 A;  3O76 A;  1M0U A;  1TW9 A;  1W4V A;  5AIV A;  2GZP A;  4E8E A;  1CQH A;  3EU3 A;  2EIQ A;  2C0D A;  3C71 A;  3C1R A;  1OC3 A;  3KH7 A;  2HE3 A;  4KF9 A;  1WJK A;  4BVX A;  4N30 A;  1NW2 A;  1SKS B;  1C72 A;  1ZYN A;  5GZZ B;  4TVE A;  3LYK A;  1DE1 A;  2VCV A;  1VF1 A;  1U6T A;  2H75 A;  2PPT A;  2TIR A;  2IN3 A;  1T4Z A;  11GS A;  1FO5 A;  1I5G A;  1YEP A;  2DC5 A;  1T8E B;  2YPM A;  5AIS A;  5B6M A;  2ALB A;  12GS A;  5CO3 A;  3FRC A;  3DVW A;  4JBB A;  4LL4 B;  4NMU A;  2C8U A;  2X99 A;  9GSS A;  2DIZ A;  1V9W A;  2DJ1 A;  4L8E A;  1ABA A;  2JSZ A;  2CA8 A;  5J5N A;  1Y25 A;  2G2Q A;  2HZE B;  2NBS A;  3MSZ A;  1PGT A;  4ZB6 A;  4FYB A;  2HYX A;  5C00 A;  4I5Q A;  6GSU A;  1SK0 A;  1K0B A;  1MDK A;  1M2D A;  2R0P A;  1T1V A;  2HRN A;  1G6Y A;  4LL1 B;  1BED A;  2GTU A;  4K9Z A;  1Z3E A;  4KDY A;  2GSS A;  3F9U A;  5HR2 A;  4KH7 A;  1A0R P;  2E2M A;  3NIV A;  2YNX A;  2AHE A;  3M9K A;  5C04 A;  1XWK A;  4YQU A;  1THX A;  2OJL A;  4KND A;  1YKA A;  3GMF A;  4F03 A;  4G10 A;  4OCF A;  5G5E A;  4GTU A;  2HZE A;  1JZD A;  4RQX A;  3FR3 A;  5DVB A;  1XWB A;  1AXD A;  1GWC A;  3GSS A;  2JZR A;  3LFL A;  3EPT A;  4PQI A;  6GSS A;  4K7I A;  2ZCT A;  2K8V A;  2H1G A;  5B6N A;  3EVI A;  4HQZ A;  1GSF A;  1R7H A;  2H6X A;  3CSJ A;  1Z7P A;  1SJI A;  2FWE A;  3TKP A;  3A2V A;  1TU8 A;  4AJ8 A;  1FG4 A;  5ECN B;  5KOX A;  1BYE A;  4WR5 A;  2F8F A;  3FW2 A;  4OD7 A;  3ZFB A;  4A5P A;  3ZL5 A;  4O5Q A;  3DEX A;  1IYH A;  1VF2 A;  2HNL A;  1OVN A;  1A2J A;  2CAI A;  2CT6 A;  1SL2 B;  3E9J B;  2C0E A;  4G0K A;  3IOS A;  3RAZ A;  1TOF A;  4WBR D;  3IK7 A;  2X4A A;  4ZXG A;  2H6Y A;  4F9Z A;  4MZW A;  3F63 A;  3HD5 A;  1Z7R A;  4GRF A;  1OYJ A;  1AIU A;  1PL2 A;  1X9S B;  3KTL A;  5KN3 A;  1MD3 A;  4NV2 A;  3HHV A;  3CTG A;  2JU5 A;  1GUL A;  2IME A;  4GCI A;  3TRP A;  2IMF A;  4HUA A;  3CYN A;  4EDY A;  5IO2 A;  1EEJ A;  3H1N A;  2V41 A;  4AF2 A;  2X64 A;  4Q5R A;  1BJX A;  1GSD A;  5HR0 A;  5KN1 A;  3KTB A;  3UL3 A;  1GRX A;  1PX7 A;  2X8G A;  4HU7 A;  3VWV A;  3ZVJ A;  2PGT A;  1LBK A;  4KB3 A;  1ERT A;  4IJ3 A;  2PBJ A;  4MZC A;  4EIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...