3DVXA

Crystal structure of reduced dsba3 from neisseria meningitidis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
191
structure length
191
Chain Sequence
GYALTEGEDYLVLDKPIPQEQSGKIEVLEFFGYFCVHCHHFDPLLLKLGKALPSDAYLRTEHVVWQPEMLGLARMAAAVNLSGLKYQANPAVFKAVYEQKIRLENRSVAGKWALSQKGFDGKKLMRAYDSPEAAAAALKMQKLTEQYRIDSTPTVIVGGKYRVIFNNGFDGGVHTIKELVAKVREERKRQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Biochemical and structural study of the homologues of the thiol-disulfide oxidoreductase DsbA in Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis mc58
total genus 55
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3dvxA00
1EWXA 5A4VA 2YOIA 1FB6A 3GH6A 3ERWA 3HCZA 2WJUA 1H75A 1TKDB 2H74A 1X5CA 4TXVA 2GGTA 2VLTA 2DJ0A 1XXUA 3KTLA 2TIRA 1FVJA 1GSFA 3FW2A 1U3AA 4XS4B 2LSTA 2YPMA 1X9WB 1V9WA 1XW9A 2V1MA 1X9SB 3ED3A 2YV7A 3TOTA 3ZVJA 2PPTA 3IA1A 3HD5A 2VL9A 4PX1A 4KNDA 1TRSA 2H70A 3FKFA 2B5YA 1B8XA 3IE3A 3KH7A 3ME7A 1BQ7A 1WE0A 2M72A 2VCWA 5F06A 2R3XA 2YV9A 4IJ3A 1GWCA 3UEMA 1A2MA 3CRUA 3GUSA 1G7OA 3F8UA 3PH9A 3QD9A 2E0QA 3FR6A 5G31A 1BAYA 4ZL7A 1KEBA 1NM3A 5HFIA 4ML1A 2EC4A 5DAKA 5D8IA 1K0BA 2I4AA 1TOFA 3DIEA 2OE0A 2I3YA 3PR8A 3TOUA 3F9UA 3ZMLA 2ON5A 4I8BA 4ILFA 3GKXA 4KGIA 3IBHA 4IGJA 3HXSA 2B5EA 2NVLA 4E8EA 2QKEA 3RBTA 2OE1A 3ISOA 4GSNA 4HEA2 2IJYA 3GTUB 5GAPD 2YP6A 4KDXA 8GSSA 1V58A 1YKAA 1EOHA 3KP8A 1GLQA 2H19A 3TKSA 5CNWA 4PURA 4EVMA 3RHBA 2LNTA 3D0ZA 4BVYA 4ZB9A 4OO4A 2V41A 4TXOB 4FYCA 1R4WA 4MJBA 5D96A 4YAPA 2VL3A 2NBSA 1GL8A 1DBYA 3QCPA 2L4CA 3VWWA 4O92A 4OO5A 4K0GA 4TR4A 3VWVA 1F6MC 3EURA 1ACVA 4LMVA 2YZUA 3ZIVA 5LD0A 3CTGA 1G6WA 3MAKA 1M0UA 3WYWA 1ERWA 1KNGA 1SENA 2L57A 1BYEA 2FY6A 1A0FA 3NOFA 5FHIA 1XW6A 1S3AA 4YAVA 5CP1A 2IWTA 3GTUA 1OC3A 3LJRA 4ZBAA 3VURA 5IMAA 1B48A 4NAXA 4QL7A 1WP0A 1M99A 4H86A 3HKRA 3ZVJD 4TXOA 3HDCA 3WT2A 2FA4A 2X8HA 4WF5A 3WGXA 3RHCA 3WD6A 3UIWA 3GKKA 2ZCTA 2MZCA 1GTBA 2B6MA 3PINA 2OKAA 1JLVA 2L5LA 10GSA 4G9HA 4FYUA 5AGYA 4OMVA 5HFKA 1Z9HA 2LUSA 2X99A 14GSA 1I5GA 3F63A 1K3YA 1MTCA 2B7KA 2VM1A 2GLRA 5GSTA 12GSA 1SJZA 3F6FA 4JBBA 5HFGA 4XHMA 1YEPA 1G6YA 4ULXA 1ZYEA 4XTSA 3GA4A 2PERA 1KTEA 3LQ7A 5DQYA 5D9VA 1EV4A 1OKDA 1XOAA 1T4ZA 1EEJA 3D5JA 2C0FA 3HVSA 3KCMA 2L5OA 2C0DA 3L9SA 2V2GA 5J9BA 2Z9SA 4N0VA 2VLVA 1R5AA 2N5BA 3MNGA 3LG6A 2GS3A 3IOSA 4FO5A 3LSZA 2EIOA 1X5EA 1O6JA 4WBJA 2DMMA 1AQWA 1O8XA 3V1WA 3TRQA 2FWEA 2DSAA 4KCEA 5D93A 2CAIA 3DYRA 1BG5A 3IHQA 2C3QA 2QGVA 2ZNMA 2L6DA 2LS5A 1YEXA 4IP1A 3MSZA 2PWJA 1WPIA 3Q74A 4MPGA 4PQIA 1SD9A 4N30A 3LEFA 1IYHA 2WZ9A 3E3EA 3QOUA 2MMNA 2VCZA 1WIKA 4EE0A 4WR4A 2H0GA 3M9JA 5J5NA 2EIQA 3A2WA 4BPYA 5HQPA 3ZYWA 4MJAA 2A2SA 2VM2A 3RDWA 1DUGA 3FZAA 3TKSC 19GSA 2RUFA 3P8WA 1JZRA 3L0HA 1VF4A 3BOAA 3HJPA 4IBPA 4DSQA 2CV4A 2LJAA 1JZWA 3DD3A 4AF2A 3TKPA 1MEKA 4HJ2A 3NZNA 5A4UA 1XWGA 2VO4A 4V1Ag 2B7JA 2FWHA 4KDUA 4RI7A 1F2EA 3IPZA 4POMA 3UJ1A 1VF1A 3D6IA 1JLWA 2OJLA 3ZREA 3RPPA 1GTIA 1TDIA 3GX0A 3CBUA 1LJRA 1ILOA 4N0ZA 3UOMA 1GULA 2OA7A 1UN2A 2IMDA 4L0UA 2JZTA 4OD7A 4LLRA 4RQRA 3L9UA 4YH2A 5ID2B 1PA3A 3RAZA 1ERTA 3KTBA 1TJDA 2PUKC 4OWYA 3G7YA 3VI7A 3FY7A 3C7MA 3KGKA 1FB0A 3DGQA 4HS1A 3A2XA 2I9HA 4FH8A 3ME8A 4KX4A 2C8UA 5A5KA 2X8GA 2TRCP 4ZB6A 2PMTA 5KN2A 3A3TA 4MF7A 1XFLA 2FWGA 1OC9B 1VGLA 1ZGNA 2N5FA 3TUEA 1GTUA 2VCTA 4NPBA 1MDJA 1J9BA 11GSA 2VCVA 1AIUA 5ECNB 3L9VA 2KP2A 4EUYA 3EMXA 4Q5RA 2C80A 3CSHA 2EIRA 7GSSA 3QFBC 1XIYA 1XVQA 3F4SA 3FZ9A 1R5PA 3LXZA 1QFNA 1TK8B 4HQSA 4AGSA 3TRXA 2PU9C 1LBKA 5J4UA 2JZSA 3PGTA 1Z6NA 1SL2B 5GZZB 1V2AA 4WBRD 5JWOB 1O85A 5HR2A 2MBSA 3F3RA 1TRUA 5DDLA 2XC2A 2C3TA 2NPBA 3RPNA 4Q5NA 2KOKA 2H6XA 1T4YA 1M2DA 4NMUA 2AB6A 4NV5A 1UA5A 3LYPA 3VK9A 4XS6A 4GQCA 2ZUPA 3IR4A 2WCIA 3W8JA 2FNOA 3UVTA 4MZWA 3IK9A 4POKA 4DSSA 1TW9A 5ECPB 4HJMA 3APSA 3HZ8A 3QR6A 2WULA 3VI5A 1TI3A 2H1AA 1PN9A 3EC3A 5IPGA 1OC9A 4O32A 4TKYA 4ACSA 3F4RA 3GRXA 3IK7A 1GSDA 2GQMA 5KN3A 3OR5A 2FCHA 1PSQA 4WETA 3KD0A 5JCUA 1FO5A 4TRXA 2GVPA 3TKQA 2VD1A 3QDNA 4DEJA 3GSSA 2C1YA 2CVDA 3G7IA 4QL9A 2FGXA 4V2NA 3IC4A 3IAS2 5JWRB 4HZ4A 4IKHA 5IMDA 3E0UA 1YF1A 20GSA 5DCHA 4L5LA 3C1SA 4MP4A 3O76A 1SU9A 3C73A 5DBQA 3TJGA 3FR9A 5DAKB 1K3LA 1THOA 2GSRA 4ZL8A 4QQ7A 5DQSA 3U6VA 3VPTA 3TJKA 4KSMA 2KLXA 3VPQA 2HYXA 4D73A 3VWUA 1Q98A 5HR1A 1SL1B 3FZ5A 5JCGA 2H01A 1O7UA 2HFDA 5DCGA 2DC5A 1V98A 4ECIA 4E8HA 4O5RA 1R7HA 2XBQA 1XWBA 2JSYA 4IJIA 2F3MA 4IELA 2H71A 3BBYA 3BD2A 4EL1A 5B8BA 2L6CA 3APQA 4EDZA 1S3CA 1B9YC 3ERGA 2LTKA 4Z7XA 4PUAA 3GV1A 1QMVA 4ZILA 2H76A 1YQ1A 4OFTA 1TTZA 2YZHA 2XBIA 3GIXA 6GSVA 4GF0A 1YY7A 3N5OA 1B4PA 1SYXA 2K18A 3AY8A 2F8FA 2LRNA 2WDUA 3KEBA 5ECKB 2K8SA 5B8AA 4ISDA 3DMLA 3W6GA 2LRCA 2NTOA 2H0IA 3G9BA 4XIHA 4J57E 4TN8A 1TU8A 3KH9A 2V6KA 4NWYA 4IVFA 1WJKA 2R4VA 1EGOA 4FYBA 5E59A 2R5GA 5ABRA 1F3BA 1PX6A 4MK3A 5ECMB 2YANA 1YKCA 4LL4B 2VUPA 3P2AA 5DJMA 5ECQB 3ZRDA 3TB2A 1QUWA 2GTUA 3TRPA 2AV4A 1EP7A 1S3DA 1XWCA 2BMXA 2RLIA 1SYRA 3Q6OA 4XCSA 2YWOA 4AJ7A 4O7HA 3GL3A 22GSA 5CREA 3TKSE 6GSWA 3QFAC 1SJIA 2DLXA 2FUG2 4POLA 5IOWA 2C4JA 1T7PB 2O85A 6GSSA 3CTFA 1EGRA 3CSIA 1G7EA 4HU9A 1QXHA 2JU5A 2H8LA 3H4KA 2BTOT 4TW5A 2CX4A 1X0RA 5IIZA 2IFQA 3IV4A 4AJ8A 4K1FA 3C8EA 4ML6A 2FA8A 4IQ1A 5AN1A 5J41A 4CHSA 2CX3A 2B1KA 2HNLA 3K8NA 5CRHA 1ABAA 3SBCA 4EO3A 1OAZA 2YJHA 5HR0A 1JZOA 1GNWA 2GSSA 1M2AA 5EL8A 1AUCA 5IM9A 4I5QA 5GSSA 4K2DA 4WKWA 4NHZA 1TU7A 2P5QA 4KA0A 1XW5A 3IAM2 1X9MB 2X64A 2AUVA 4L5OA 4WF4A 4KCAA 2IL3A 1SKRB 2B1LA 2CAQA 3HYPA 4K9ZA 1VF3A 3UL3A 1HNAA 2QC7A 1PGTA 2IMKA 2H6ZA 2CVKA 1Y6EA 5CRWA 1FAAA 2CVBA 1FW1A 2K9FA 4I6XA 3QAGA 2H73A 5AIVA 3L78A 1TRWA 1F3AA 5D9TA 3D22A 3US3A 1K0NA 1KBNA 1THXA 2LJKA 5KN0A 5F0GA 2VOCA 1MD3A 2LNSA 4F9ZA 1A8LA 1XPVA 1K3OA 1Z6MA 2XPEA 9GSSA 1XOBA 1VRSD 2MYGA 2G2QA 1ERUA 1LU4A 2IIYA 2XHFA 3HVXA 2RM5A 4GTUA 2ES7A 2OBIA 1Z5YE 4GRFA 1O81A 2CT6A 4MCUA 2HSYA 2V6OA 4JR6A 1SK2A 6GSUA 2R37A 2AHEA 4XRAA 2YCDA 5CRDA 3EWLA 1SKWB 3M8NA 3I43A 1WMJA 2DJ3A 4K7OA 3J7Yk 3TJBA 4PGTA 2H72A 2H1GA 3I6AA 2HT9A 5HR3A 5G1KA 4LL1B 3LGCA 1W4VA 3DVXA 3O6TA 2IMIA 1T3BA 4K6XA 3M0FA 3TCOA 4GSTA 2P5RA 2DIZA 4V1Ap 4ZIJA 17GSA 3ZL5A 3UAPA 2LEGA 3SWLA 5ECHB 6GSYA 2GDRA 4KE3A 1OC8A 2R6KA 2VD0A 1EZKA 2M46A 1XBSA 3QMXA 2KP1A 3GL5A 4DSSB 1TXXA 4XRDA 2LJRA 2RM6A 4EXJA 2HZEB 1H4OA 5ELGA 1NW2A 3CSJA 1BJXA 1B9XC 2XPDA 4POBA 2REMA 1URMA 3F6DA 3TDGA 1AQXA 1K0CA 2DJ2A 1ZZYA 4HOJA 3TKRA 5JCWA 4KUNA 2X8CA 2YNXA 3ZLPA 2H75A 2VCQA 5KN1A 3MDKA 1PD21 2H1BA 4KB3A 2YJ7A 3CYNA 4NXIA 5FWGA 4KW6A 6GSXA 4F82A 1TP9A 2FLSA 3A5WA 4I2TA 2LV3A 3HA9A 2P31A 3KZQA 2VIMA 2PVOC 2IN3A 1E6BA 1GSYA 5AISA 4I2UA 4D73B 1TK0B 1FHEA 1ZMAA 3UVHA 1PKWA 1ZL9A 1NHYA 3H8QA 2VCXA 5ECOB 4KAEA 4PUFC 2JADA 2HZEA 3L4NA 4I97A 2OACA 4ZB8A 1MD4A 2RIIA 3CRTA 4OCFA 2GZZA 2WS2A 3UBLA 4GSSA 5G5FA 3KM6A 1FOVA 1HNBA 1DE2A 3IXRA 5A4WA 1JFUA 4BWSA 4G19A 3EMPA 1PKZA 3TJFA 5E4WA 1JZDA 3UMAA 1PMTA 2DJJA 2FD3A 4ECCA 4MMMA 4IS0A 2J23A 1QGVA 3O3TA 1K0MA 5G30A 4F0BA 3GYKA 1HNCA 3HZ4A 5IMCA 1M9BA 2YWIA 2VL2C 1AQVA 2L4QA 1EEMA 3WGDA 1XZOA 1T8EB 4PNFA 5FT3A 4OCEA 1SK0A 4TR1A 5IOXA 3H79A 4IN0A 2C0EA 1X5DA 4BL7A 1MDKA 1GH2A 1UVZA 3DRNA 4ZXGA 2RUEA 4MLYA 2HLSA 2NDOA 4JEDA 3ZZXA 1T1VA 2AJQB 3GFKA 4Q5FA 1J08A 1GSSA 2IMFA 2CA8A 1C72A 4K7NA 4L0WA 5B6MA 4V2LA 5DJLA 2A2RA 2O7KA 3E9JB 3EYTA 1NHOA 3DKSA 4IW9A 4IP6A 3FZ4A 1TI1A 3H93A 3LYKA 4MZCA 2B3SA 5EY6A 4XS1A 5D9WA 2CZ2A 1OE8A 2H66A 4X0XA 2QSIA 3LORA 2OADA 2DBCA 1PQNA 3LWAA 1A24A 2YWMA 4K7IA 4GXZA 1GUMA 3TGZA 3GNJA 5IPHA 1IYIA 1ST9A 3WGEA 5COHA 4Q5QA 2FHEA 1U3IA 1EV9A 1M7TA 3G7JA 1GRXA 3FYGA 1V40A 1GSQA 3Q19A 1A23A 2JZRA 4ID0A 4ZBDA 4F2IA 2H0HA 5LNKe 1EOGA 1GTAA 5IO2A 3W8SA 1OKTA 1AC1A 1Q4JA 4GWRA 5F05A 2CQ9A 2F8AA 4XS4A 3P90A 1CQHA 3GMFA 3ZFLA 4GLTA 4IQAA 1A8YA 1ZCPA 4LA1A 2L59A 4ECBA 4HDEA 4EDYA 1FVKA 2GSQA 5KEJA 2IFQB 3F3QA 4DSRA 2C0GA 3HY2A 2P0GA 2GZPA 2HZFA 1RK4A 3ERFA 4RUVA 3VFIA 5H5QA 4GCIA 3IRAA 16GSA 4ECJA 1BX9A 2DIYA 3C1RA 2F9SA 2MMZA 3APOA 2V32A 5F8BA 4NV2A 1TRVA 4WR5A 1ML6A 4LMWA 4JR4A 3BJ5A 3CMIA 2HI7A 1PL2A 4X1UA 1GSUA 3M1GA 1N8JA 1PL1A 1SKSB 1F37A 1ERVA 2AAWA 4MJCA 2PN8A 3EVIA 3ZMKA 3DXBA 2N5AA 3P7XA 2MBTA 2ON7A 2E2GA 4K8MA 2B5XA 4TR3A 1ZOFA 2WB9A 3UARA 1OVNA 3EINA 5J3RA 3KXOA 1F9MA 4G2EA 4WXTA 5ECRB 3GN3A 1OYJA 2H30A 1G0TA 5LCZA 5DVBA 2DJKA 2H6YA 1AAZA 3ZFBA 2J9HA 1K0OA 2HE3A 3VLNA 4JRRA 1NSWA 2GQKA 3F0IA 1GNEA 5INYA 3ZTLA 1XCCA 1RW1A 3LFLA 3M3MA 4CW9A 5IMVA 5D73A 2PGTA 3MWHA 5CO3A 2HRFA 3U5RE 4JU5A 1CQGA 4X43A 4PQHA 4KSOA 1BEDA 2WRTA 2GT5A 4RI6A 3I69A 1TK5B 2VLUA 1SK1A 6GSTA 3J7Yb 2TRXA 1PRXA 2WFCA 3A2VA 1HD2A 3EE2A 3DVWA 3Q18A 3FK8A 5F07A 4CDOA 4PNGA 1R26A 1Z7RA 4HUAA 2I81A 5ENUA 5IMFA 4YQVA 2CZ3A 4HU7A 4MZBA 1Y25A 4ZBBA 1XVWA 2D2ZA 3FHKA 3FR3A 3EU4A 2LQOA 5IQYA 1A0RP 5IO0A 2GT6A 3GH9A 2OBKA 1T00A 1J0FA 1E2YA 1U88A 2I1UA 2HSHA 4MH3A 1SD8A 3ZITA 2KHPA 3KMNA 3KIJA 2F51A 3JCML 1YDKA 4EC0A 1USBA 1HQOA 4MDCA 1N2AA 4MA9A 2VL2A 3BCIA 1UC7A 4MH2A 5IMZA 4EF0A 1V57A 5C04A 2WGRA 2GSTA 3DEXA 1DSBA 1MDIA 2PVQA 2YN1A 1QQ2A 4YQUA 2OE3A 2R2JA 1QK8A 1W89A 1M2BA 3BCKA 4EKZA 5EVOA 5GAND 5H5RA 5AIXA 2H1DA 2GQLA 4N10A 4MABA 3VWXA 3D4TA 1WWJA 4V2MA 4BVXA 5ELAA 1A2LA 3D21A 4F0CA 1PX7A 1AXDA 3TJJA 3ZIJA 4MF5A 1EP8A 1AW9A 2IMEA 1RQMA 3WT1A 2PBJA 3DWVA 3H1NA 1ON4A 3NIVA 3GSTA 5L71A 2FWFA 3FEUA 4OFMA 1B4QA 5B6NA 4P3YB 4KDYA 5DALB 5EPFA 5JWQB 4HQZA 4PXOA 4BA7A 4MPFA 2DMLA 1YJ6A 3GURA 4WEYA 4AJ6A 2E2MA 3IDVA 1K0DA 1WOUA 2AYTA 3KMOA 2A4VA 4DVCA 4G10A 1HYUA 4JE1A 3QAVA 5H5SA 1M9AA 2ALBA 4TR0A 4GQFA 2HXKA 1SJ6A 1GUHA 4J2FA 2MMAA 3N9JA 1YF0A 2O89A 1YZXA 2YWNA 4PQ1A 4IHUA 3FRCA 2IPAA 4YQMA 1GLPA 1JHBA 5ECSA 3HJMA 4KH7A 1XWAA 4TVEA 2K6VA 5CYYA 1U6TA 1XWKA 2JACA 4MF6A 3GKNA 1Z3EA 5J9CA 1I9DA 2BJXA 1SL0B 4J56E 3KJYA 5CRGA 1O73A 2LQQA 5ECLB 3GKMA 2E7PA 1K0AA 4TOPA 4L8EA 4BWQA 4NHWA 3GHAA 4TR1B 1O8WA 4JZQA 5C00A 1VF2A 1Z7PA 5DALA 1A2JA 18GSA 5D9XA 3M9KA 3S9FA 4F03A 3HHVA 2G0FA 4FIWA 2M80A 5ID2A 2MMOA 3HVVA 2VAFA 3UBKA 3QAWA 3HJOA 1DE1A 3EU3A 1GUKA 5G1LA 2JSZA 5ECIB 2DJ1A 4K0NA 2KUCA 5CAXA 3LXTA 4RQXA 4HI7A 1GSEA 5G2ZA 3C71A 3KP9A 2K8VA 1WRYA 2JL4A 2LKUA 3R2QA 4OFNA 3GX8A 13GSA 2O87A 4MJEA 3QPMA 5G5EA 4HZ2A 3F4TA 3CXGA 1ZYQB 2GZYA 2HRNA 4N11A 2C3NA 1U87A 3I9V2 5B7CA 4ZL9A 1FG4A 1GP1A 2O8VB 1OE7A 3D4MA 2LRTA
chains in the Genus database with same CATH superfamily
1EWXA 4USSA 5A4VA 2YOIA 1FB6A 3GH6A 3ERWA 3HCZA 2WJUA 1H75A 1TKDB 2H74A 1X5CA 4TXVA 2GGTA 2VLTA 2DJ0A 1XXUA 3KTLA 4EIQA 2TIRA 1FVJA 1GSFA 4HSCX 3FW2A 1U3AA 4XS4B 2LSTA 2YPMA 1X9WB 1V9WA 1XW9A 2V1MA 1X9SB 3ED3A 2YV7A 3TOTA 3ZVJA 2PPTA 3IA1A 3HD5A 2VL9A 4PX1A 4KNDA 1TRSA 2H70A 3FKFA 2B5YA 1B8XA 3IE3A 3KH7A 3ME7A 1BQ7A 1WE0A 2M72A 2VCWA 5F06A 2R3XA 2YV9A 4IJ3A 1GWCA 3UEMA 1A2MA 3CRUA 3GUSA 1G7OA 3F8UA 3PH9A 3QD9A 2E0QA 3FR6A 5G31A 1BAYA 4ZL7A 1KEBA 1NM3A 5HFIA 4ML1A 2EC4A 5DAKA 5D8IA 1K0BA 2I4AA 1TOFA 3DIEA 2OE0A 2I3YA 3PR8A 3TOUA 3F9UA 3ZMLA 2ON5A 4I8BA 5KOWA 4ILFA 3GKXA 3LW9A 4KGIA 3IBHA 4IGJA 3HXSA 2B5EA 2NVLA 4E8EA 2QKEA 3RBTA 2OE1A 3ISOA 4GSNA 4HEA2 2IJYA 3GTUB 5GAPD 2YP6A 4KDXA 8GSSA 1V58A 1YKAA 1EOHA 3KP8A 1GLQA 2H19A 3TKSA 5CNWA 4PURA 4EVMA 3RHBA 2LNTA 1ZYPA 3D0ZA 4BVYA 4ZB9A 4OO4A 2V41A 4TXOB 4FYCA 1R4WA 4MJBA 5D96A 4YAPA 2VL3A 2A2PA 2NBSA 1GL8A 1DBYA 3QCPA 2L4CA 3VWWA 4O92A 4OO5A 4K0GA 4TR4A 3VWVA 1F6MC 3EURA 4G0KA 1ACVA 4LMVA 2YZUA 3ZIVA 5LD0A 3CTGA 1G6WA 3MAKA 4YKGA 1M0UA 3WYWA 1ERWA 1KNGA 1SENA 2L57A 1BYEA 2FY6A 1A0FA 3NOFA 5FHIA 1XW6A 1S3AA 4YAVA 5CP1A 2IWTA 3GTUA 1OC3A 3LJRA 4ZBAA 3VURA 5IMAA 1B48A 4NAXA 4QL7A 1WP0A 1M99A 4H86A 3HKRA 3ZVJD 4TXOA 3HDCA 3WT2A 2FA4A 2X8HA 4WF5A 3WGXA 3RHCA 3WD6A 3UIWA 3GKKA 3MYDA 2ZCTA 2MZCA 1GTBA 2B6MA 3PINA 2OKAA 1JLVA 2L5LA 10GSA 4G9HA 4FYUA 5AGYA 4OMVA 5HFKA 1Z9HA 2LUSA 2X99A 14GSA 1I5GA 3F63A 1K3YA 1MTCA 2B7KA 2VM1A 2GLRA 5GSTA 12GSA 1SJZA 3F6FA 4JBBA 5HFGA 4XHMA 1YEPA 1G6YA 4ULXA 1ZYEA 4XTSA 3GA4A 2PERA 1KTEA 3LQ7A 5DQYA 5D9VA 1EV4A 1OKDA 1XOAA 1T4ZA 1EEJA 3D5JA 2C0FA 3HVSA 3KCMA 2L5OA 2C0DA 3L9SA 2V2GA 5J9BA 2Z9SA 4N0VA 2VLVA 1R5AA 2N5BA 3MNGA 3LG6A 2GS3A 3IOSA 4FO5A 3LSZA 2EIOA 1X5EA 1O6JA 4WBJA 2DMMA 1AQWA 1O8XA 3V1WA 3TRQA 2FWEA 2DSAA 4KCEA 5D93A 4BVXB 2CAIA 3DYRA 1BG5A 3IHQA 2C3QA 2QGVA 2ZNMA 2L6DA 2LS5A 1YEXA 4IP1A 3MSZA 2PWJA 1WPIA 3Q74A 4MPGA 4PQIA 1SD9A 2HSMA 4N30A 3LEFA 1IYHA 2WZ9A 2X49A 3E3EA 3QOUA 2MMNA 2VCZA 1WIKA 4EE0A 4WR4A 2H0GA 3M9JA 5J5NA 2EIQA 3A2WA 4BPYA 5HQPA 3ZYWA 4MJAA 2A2SA 2VM2A 3RDWA 1DUGA 3FZAA 3TKSC 19GSA 2RUFA 3P8WA 1JZRA 3L0HA 1VF4A 3BOAA 3HJPA 3HVNA 4IBPA 4DSQA 2CV4A 2LJAA 1JZWA 3DD3A 4AF2A 3TKPA 1MEKA 4HJ2A 3NZNA 5A4UA 1XWGA 2VO4A 4V1Ag 2B7JA 2FWHA 4KDUA 4RI7A 1F2EA 3IPZA 4POMA 3UJ1A 1VF1A 3D6IA 1JLWA 2OJLA 3ZREA 3IC8A 3RPPA 1GTIA 1TDIA 3GX0A 3CBUA 1LJRA 1ILOA 4N0ZA 3UOMA 1GULA 2OA7A 1UN2A 2IMDA 4L0UA 2JZTA 4OD7A 4LLRA 4RQRA 3L9UA 4YH2A 5ID2B 1PA3A 3RAZA 1ERTA 3KTBA 1TJDA 2PUKC 4OWYA 3G7YA 3VI7A 3FY7A 3C7MA 3KGKA 1FB0A 3DGQA 4HS1A 3A2XA 2I9HA 4FH8A 3ME8A 4KX4A 2C8UA 5A5KA 2X8GA 2TRCP 4ZB6A 2PMTA 5KN2A 3A3TA 4MF7A 1XFLA 2FWGA 1OC9B 1VGLA 1ZGNA 2N5FA 3TUEA 1GTUA 2VCTA 4NPBA 1MDJA 1J9BA 11GSA 2VCVA 1AIUA 5ECNB 3L9VA 2KP2A 4EUYA 3EMXA 4Q5RA 2C80A 3CSHA 2EIRA 7GSSA 3QFBC 1XIYA 1XVQA 3F4SA 3FZ9A 1R5PA 3LXZA 2QA2A 1QFNA 1TK8B 4HQSA 4AGSA 3TRXA 2PU9C 1LBKA 5J4UA 2JZSA 3PGTA 4KF9A 1Z6NA 1SL2B 5GZZB 1V2AA 1XG8A 4K5RA 5BRTA 4WBRD 5JWOB 1O85A 5HR2A 2MBSA 3F3RA 1TRUA 5DDLA 2XC2A 2C3TA 2NPBA 3RPNA 4Q5NA 2KOKA 2H6XA 1T4YA 1M2DA 4NMUA 2AB6A 4NV5A 1UA5A 3LYPA 3VK9A 4XS6A 4GQCA 2ZUPA 3IR4A 2WCIA 3W8JA 2FNOA 3UVTA 4MZWA 3IK9A 4POKA 4DSSA 1TW9A 5ECPB 4HJMA 3APSA 3HZ8A 3QR6A 2WULA 3VI5A 1TI3A 2H1AA 1PN9A 3EC3A 5IPGA 1OC9A 4O32A 4TKYA 4ACSA 3F4RA 3GRXA 3IK7A 1GSDA 2GQMA 5KN3A 3OR5A 2FCHA 1PSQA 4WETA 3KD0A 5JCUA 1FO5A 4TRXA 2GVPA 3TKQA 2VD1A 3QDNA 4DEJA 3GSSA 2C1YA 2CVDA 3G7IA 4QL9A 2FGXA 4V2NA 3IC4A 3IAS2 4X4JA 5JWRB 4HZ4A 2HRKA 4IKHA 5IMDA 3E0UA 1YF1A 20GSA 5DCHA 4L5LA 3C1SA 4MP4A 3O76A 1SU9A 3C73A 5DBQA 3TJGA 3FR9A 5DAKB 5BMUA 1K3LA 1THOA 2GSRA 4ZL8A 4QQ7A 5DQSA 3U6VA 3VPTA 3TJKA 4KSMA 2KLXA 3VPQA 2HYXA 4D73A 3VWUA 1Q98A 5HR1A 1SL1B 3FZ5A 5JCGA 2H01A 1O7UA 2HFDA 5DCGA 2DC5A 1V98A 4ECIA 4E8HA 4O5RA 1R7HA 2XBQA 1XWBA 2JSYA 4IJIA 2F3MA 4BVYB 4IELA 2H71A 3BBYA 3BD2A 4EL1A 5B8BA 2L6CA 3APQA 4EDZA 1S3CA 1B9YC 3ERGA 2LTKA 4Z7XA 4PUAA 3GV1A 1QMVA 4ZILA 2H76A 1YQ1A 4OFTA 1TTZA 2YZHA 2XBIA 3GIXA 3FMWA 6GSVA 4GF0A 1YY7A 3N5OA 1B4PA 1SYXA 2K18A 3AY8A 2F8FA 2LRNA 2WDUA 3KEBA 5ECKB 2K8SA 5B8AA 4ISDA 3DMLA 3W6GA 2LRCA 2NTOA 2H0IA 3G9BA 4XIHA 4J57E 4TN8A 4MNNA 1TU8A 3KH9A 2V6KA 4NWYA 4IVFA 4G0IA 1WJKA 2R4VA 4A5PA 4BIKA 1EGOA 4FYBA 5E59A 2R5GA 5ABRA 1F3BA 1PX6A 4MK3A 5ECMB 2YANA 1YKCA 4LL4B 2VUPA 3P2AA 5DJMA 5ECQB 2R0GA 3ZRDA 3TB2A 1QUWA 2GTUA 3TRPA 2AV4A 1EP7A 1S3DA 1XWCA 2BMXA 2RLIA 1SYRA 3Q6OA 4XCSA 2YWOA 4AJ7A 4O7HA 3GL3A 22GSA 5CREA 3TKSE 6GSWA 3QFAC 1FOHA 1SJIA 2DLXA 2FUG2 4POLA 5IOWA 2C4JA 1T7PB 2O85A 6GSSA 3CTFA 1EGRA 3CSIA 1G7EA 4HU9A 3IHGA 1QXHA 2JU5A 2H8LA 3H4KA 2BTOT 4TW5A 2CX4A 1X0RA 5IIZA 2IFQA 3IV4A 4AJ8A 4K1FA 3C8EA 4ML6A 2FA8A 4IQ1A 5AN1A 5J41A 4CHSA 2CX3A 2B1KA 2HNLA 3K8NA 5CRHA 1ABAA 3SBCA 4EO3A 1OAZA 2YJHA 5HR0A 1JZOA 1GNWA 2GSSA 1M2AA 5EL8A 1AUCA 5IM9A 4I5QA 5GSSA 4K2DA 4WKWA 4NHZA 2HRAA 1TU7A 2P5QA 4KA0A 4G0LA 1XW5A 3IAM2 1X9MB 2X64A 2AUVA 4L5OA 4WF4A 4KCAA 2IL3A 1SKRB 2B1LA 2CAQA 3HYPA 4K9ZA 1VF3A 3UL3A 1HNAA 2QC7A 1PGTA 2IMKA 2H6ZA 2CVKA 3CQFA 1Y6EA 5CRWA 1FAAA 2CVBA 1FW1A 2K9FA 4I6XA 3QAGA 2H73A 5AIVA 3L78A 1TRWA 1F3AA 5D9TA 3D22A 3US3A 1K0NA 1KBNA 1THXA 2LJKA 5KN0A 5F0GA 2VOCA 1MD3A 2LNSA 4F9ZA 3MIXA 1A8LA 1XPVA 1K3OA 1Z6MA 2XPEA 9GSSA 1XOBA 1VRSD 2MYGA 2G2QA 1ERUA 1LU4A 1PFOA 2IIYA 2XHFA 3HVXA 2RM5A 4GTUA 2ES7A 2OBIA 1Z5YE 4GRFA 1O81A 2CT6A 4MCUA 2HSYA 2V6OA 4JR6A 1SK2A 6GSUA 2R37A 2AHEA 4XRAA 2YCDA 5CRDA 3EWLA 1SKWB 3M8NA 3I43A 1WMJA 2DJ3A 4K7OA 3J7Yk 5KOXA 3TJBA 4PGTA 2H72A 2H1GA 3I6AA 2HT9A 5HR3A 5G1KA 4LL1B 3LGCA 1W4VA 3DVXA 3O6TA 2IMIA 1T3BA 4K6XA 3M0FA 3TCOA 4GSTA 2P5RA 2DIZA 4V1Ap 4ZIJA 17GSA 3ZL5A 3UAPA 2LEGA 3SWLA 5ECHB 6GSYA 2GDRA 4KE3A 1OC8A 2R6KA 2VD0A 1EZKA 2M46A 1XBSA 3QMXA 2KP1A 3GL5A 4DSSB 1TXXA 4XRDA 2LJRA 2RM6A 4EXJA 2HZEB 1H4OA 5ELGA 1NW2A 3CSJA 1BJXA 1B9XC 2XPDA 4POBA 2REMA 1URMA 3F6DA 3TDGA 1AQXA 1K0CA 2DJ2A 1ZZYA 4HOJA 3TKRA 5JCWA 4KUNA 2X8CA 2YNXA 3ZLPA 2H75A 2VCQA 5KN1A 3MDKA 1PD21 2H1BA 4KB3A 2YJ7A 3CYNA 4NXIA 5FWGA 4KW6A 6GSXA 4F82A 1TP9A 2FLSA 3A5WA 4I2TA 2LV3A 3PPUA 3HA9A 2P31A 3KZQA 2VIMA 2PVOC 2X4AA 2IN3A 1E6BA 1GSYA 5AISA 4I2UA 4D73B 1TK0B 4BL7B 1FHEA 1ZMAA 2QA1A 3UVHA 1PKWA 1ZL9A 1NHYA 3H8QA 2VCXA 5ECOB 4KAEA 4PUFC 2JADA 2HZEA 3L4NA 4I97A 2OACA 4ZB8A 1MD4A 2RIIA 3CRTA 4OCFA 2GZZA 2WS2A 3UBLA 4GSSA 4PTSA 5G5FA 3KM6A 1FOVA 1HNBA 4ICYA 2UZ8A 1DE2A 3IXRA 5A4WA 1JFUA 2R0CA 4BWSA 4G19A 3EMPA 1PKZA 3TJFA 5E4WA 1JZDA 3UMAA 1PMTA 2DJJA 2FD3A 4ECCA 4MMMA 4IS0A 2J23A 1QGVA 3O3TA 1K0MA 5G30A 4F0BA 3GYKA 3R3EA 1HNCA 3HZ4A 5IMCA 1M9BA 2YWIA 2VL2C 1AQVA 2L4QA 1EEMA 3WGDA 4CY6A 1XZOA 1T8EB 1S3RA 4PNFA 5FT3A 4OCEA 1SK0A 4TR1A 5IOXA 3H79A 4IN0A 2C0EA 1X5DA 4BL7A 1MDKA 1GH2A 1UVZA 3DRNA 4ZXGA 2RUEA 4MLYA 2HLSA 2NDOA 4JEDA 3ZZXA 1T1VA 2AJQB 3GFKA 4Q5FA 1J08A 1GSSA 2IMFA 2CA8A 1C72A 4K7NA 4L0WA 5B6MA 4V2LA 5DJLA 2A2RA 2O7KA 3E9JB 3EYTA 1NHOA 3DKSA 4IW9A 4IP6A 3FZ4A 1TI1A 3H93A 3LYKA 4MZCA 2B3SA 5EY6A 4XS1A 5D9WA 2CZ2A 4CY8A 1OE8A 1ZYNA 2H66A 4X0XA 2QSIA 3LORA 2OADA 2DBCA 1PQNA 3LWAA 1A24A 2YWMA 4K7IA 4GXZA 1GUMA 3TGZA 3GNJA 5IPHA 1IYIA 1ST9A 3WGEA 5COHA 4Q5QA 2FHEA 1U3IA 1EV9A 1M7TA 3G7JA 1GRXA 3FYGA 1V40A 1GSQA 3Q19A 1A23A 2JZRA 4ID0A 4ZBDA 4F2IA 2H0HA 5LNKe 1EOGA 1GTAA 5IO2A 3W8SA 1OKTA 1AC1A 1Q4JA 4GWRA 5F05A 2CQ9A 2F8AA 4XS4A 3P90A 1CQHA 3GMFA 3ZFLA 4GLTA 4IQAA 1A8YA 1ZCPA 4LA1A 2L59A 4ECBA 4HDEA 4EDYA 1FVKA 2GSQA 5KEJA 2IFQB 3F3QA 4DSRA 2C0GA 3HY2A 2P0GA 2GZPA 2HZFA 1RK4A 3ERFA 4RUVA 3VFIA 5H5QA 4GCIA 3IRAA 16GSA 4ECJA 1BX9A 2DIYA 3C1RA 2F9SA 2MMZA 3APOA 2V32A 5F8BA 3A5IA 4NV2A 1TRVA 4WR5A 1ML6A 4LMWA 4JR4A 3BJ5A 3CMIA 2HI7A 1PL2A 4X1UA 1GSUA 3M1GA 1N8JA 1PL1A 1SKSB 1F37A 1ERVA 2AAWA 4MJCA 2PN8A 3EVIA 3ZMKA 3DXBA 2N5AA 3P7XA 3EPTA 2MBTA 2ON7A 2E2GA 4K8MA 2A4HA 2B5XA 4TR3A 1ZOFA 2WB9A 3UARA 1OVNA 3EINA 5J3RA 3KXOA 1F9MA 4G2EA 4WXTA 5ECRB 3GN3A 1OYJA 2H30A 1G0TA 5LCZA 5DVBA 2DJKA 4Z2RA 2H6YA 1AAZA 3ZFBA 2J9HA 1K0OA 2HE3A 3VLNA 1PN0A 4JRRA 1NSWA 2GQKA 3F0IA 1GNEA 5INYA 3ZTLA 1XCCA 1RW1A 3LFLA 3M3MA 4CW9A 5IMVA 5D73A 2PGTA 3MWHA 5CO3A 2HRFA 3U5RE 4JU5A 1CQGA 4X43A 4PQHA 4KSOA 1BEDA 2WRTA 2GT5A 4RI6A 3I69A 1TK5B 2VLUA 1SK1A 6GSTA 3J7Yb 2TRXA 1PRXA 2WFCA 3A2VA 1HD2A 1M3JA 3EE2A 3DVWA 3Q18A 3FK8A 5F07A 4CDOA 4PNGA 1R26A 1Z7RA 4HUAA 2I81A 5ENUA 5IMFA 4YQVA 2CZ3A 4HU7A 4MZBA 1Y25A 4ZBBA 1XVWA 2D2ZA 3FHKA 3FR3A 3EU4A 2LQOA 5IQYA 1A0RP 5IO0A 2GT6A 3GH9A 2OBKA 1T00A 1J0FA 1E2YA 4O5QA 1U88A 2I1UA 2HSHA 4MH3A 1SD8A 3ZITA 2KHPA 3KMNA 3KIJA 2F51A 4Z2UA 3JCML 1YDKA 4EC0A 1USBA 1HQOA 4MDCA 1N2AA 4MA9A 2VL2A 3BCIA 1UC7A 4MH2A 5IMZA 4EF0A 1V57A 5C04A 2WGRA 2GSTA 3DEXA 1DSBA 4K5SA 4K2XA 1MDIA 2PVQA 2YN1A 1QQ2A 4YQUA 2OE3A 2R2JA 1QK8A 1W89A 4Z2TA 1M2BA 3BCKA 4EKZA 4FQUA 5EVOA 5GAND 5H5RA 5AIXA 2H1DA 2GQLA 4N10A 4MABA 3VWXA 3D4TA 1WWJA 4V2MA 4BVXA 5ELAA 1A2LA 3D21A 4F0CA 1PX7A 1AXDA 3TJJA 3ZIJA 4MF5A 1EP8A 1AW9A 2IMEA 2R0PA 1RQMA 3WT1A 2PBJA 3DWVA 3H1NA 1ON4A 3NIVA 3GSTA 5L71A 2FWFA 3FEUA 4OFMA 1B4QA 5B6NA 4P3YB 4KDYA 5DALB 5EPFA 5JWQB 4HQZA 4PXOA 4BA7A 4MPFA 2DMLA 1YJ6A 3GURA 4O5UA 4WEYA 4AJ6A 2E2MA 3IDVA 1K0DA 1WOUA 2AYTA 3KMOA 2A4VA 4DVCA 4G10A 1HYUA 4JE1A 3QAVA 5H5SA 1M9AA 2ALBA 4TR0A 4GQFA 2HXKA 1SJ6A 1GUHA 4J2FA 2MMAA 3N9JA 1YF0A 2O89A 1YZXA 2YWNA 4PQ1A 4IHUA 3FRCA 2IPAA 4YQMA 1GLPA 1JHBA 5ECSA 3HJMA 4KH7A 1XWAA 4TVEA 2K6VA 5CYYA 1U6TA 1XWKA 2JACA 4MF6A 3GKNA 1Z3EA 5J9CA 1I9DA 2BJXA 1SL0B 2DKIA 4J56E 3KJYA 5CRGA 1O73A 2LQQA 5ECLB 3GKMA 2E7PA 1K0AA 4TOPA 4L8EA 4BWQA 4NHWA 3GHAA 4TR1B 1O8WA 4JZQA 5C00A 1VF2A 1Z7PA 5DALA 1A2JA 18GSA 5D9XA 3M9KA 3S9FA 4F03A 3HHVA 2G0FA 4FIWA 2M80A 1M3IA 4YKFA 5ID2A 2MMOA 3HVVA 2VAFA 3UBKA 3QAWA 3HJOA 4EIPA 1DE1A 3EU3A 1GUKA 5G1LA 2JSZA 5ECIB 2DJ1A 4K0NA 2KUCA 5CAXA 3LXTA 4RQXA 4HI7A 1GSEA 5G2ZA 3C71A 3KP9A 2K8VA 1WRYA 2JL4A 2LKUA 3R2QA 4OFNA 3GX8A 13GSA 2O87A 4MJEA 3QPMA 5G5EA 4HZ2A 3F4TA 3CXGA 2DKHA 1ZYQB 2GZYA 2HRNA 4N11A 2C3NA 1U87A 3I9V2 5B7CA 4ZL9A 1FG4A 1GP1A 2O8VB 1OE7A 3D4MA 2LRTA
chains in the Genus database with same CATH topology
1EWXA 4USSA 5A4VA 2YOIA 1FB6A 3GH6A 3ERWA 3HCZA 2WJUA 1H75A 1TKDB 2H74A 1X5CA 4TXVA 2GGTA 2VLTA 2DJ0A 1XXUA 3KTLA 4EIQA 2TIRA 1FVJA 1GSFA 3FW2A 1U3AA 4XS4B 2LSTA 2YPMA 1X9WB 1V9WA 1XW9A 2V1MA 1X9SB 3ED3A 2YV7A 3TOTA 3ZVJA 2PPTA 3IA1A 3HD5A 2VL9A 4PX1A 4KNDA 1TRSA 2H70A 3FKFA 2B5YA 1B8XA 3IE3A 3KH7A 3ME7A 1BQ7A 1WE0A 2M72A 2VCWA 5F06A 2R3XA 2YV9A 4IJ3A 1GWCA 3UEMA 1A2MA 3CRUA 3GUSA 1G7OA 3F8UA 3PH9A 3QD9A 2E0QA 3FR6A 5G31A 1BAYA 4ZL7A 1KEBA 1NM3A 5HFIA 4ML1A 2EC4A 5DAKA 5D8IA 1K0BA 2I4AA 1TOFA 3DIEA 2OE0A 2I3YA 3PR8A 3TOUA 3F9UA 3ZMLA 2ON5A 4I8BA 5KOWA 4ILFA 3GKXA 3LW9A 4KGIA 3IBHA 4IGJA 3HXSA 2B5EA 2NVLA 4E8EA 2QKEA 3RBTA 2OE1A 3ISOA 4GSNA 4HEA2 2IJYA 3GTUB 5GAPD 2YP6A 4KDXA 8GSSA 1V58A 1YKAA 1EOHA 3KP8A 1GLQA 2H19A 3TKSA 5CNWA 4PURA 4EVMA 3RHBA 2LNTA 1ZYPA 3D0ZA 4BVYA 4ZB9A 4OO4A 2V41A 4TXOB 4FYCA 1R4WA 4MJBA 5D96A 4YAPA 2VL3A 2A2PA 2NBSA 1GL8A 1DBYA 3QCPA 2L4CA 3VWWA 4O92A 4OO5A 4K0GA 4TR4A 3VWVA 1F6MC 3EURA 4G0KA 1ACVA 4LMVA 2YZUA 3ZIVA 5LD0A 3CTGA 1G6WA 3MAKA 4YKGA 1M0UA 3WYWA 1ERWA 1KNGA 1SENA 2L57A 1BYEA 2FY6A 1A0FA 3NOFA 5FHIA 1XW6A 1S3AA 4YAVA 5CP1A 2IWTA 3GTUA 1OC3A 3LJRA 4ZBAA 3VURA 5IMAA 1B48A 4NAXA 4QL7A 1WP0A 1M99A 4H86A 3HKRA 3ZVJD 4TXOA 3HDCA 3WT2A 2FA4A 2X8HA 4WF5A 3WGXA 3RHCA 3WD6A 3UIWA 3GKKA 3MYDA 2ZCTA 2MZCA 1GTBA 2B6MA 3PINA 2OKAA 1JLVA 2L5LA 10GSA 4G9HA 4FYUA 5AGYA 4OMVA 5HFKA 1Z9HA 2LUSA 2X99A 14GSA 1I5GA 3F63A 1K3YA 1MTCA 2B7KA 2VM1A 2GLRA 5GSTA 12GSA 1SJZA 3F6FA 4JBBA 5HFGA 4XHMA 1YEPA 1G6YA 4ULXA 1ZYEA 4XTSA 3GA4A 2PERA 1KTEA 3LQ7A 5DQYA 5D9VA 1EV4A 1OKDA 1XOAA 1T4ZA 1EEJA 3D5JA 2C0FA 3HVSA 3KCMA 2L5OA 2C0DA 3L9SA 2V2GA 5J9BA 2Z9SA 4N0VA 2VLVA 1R5AA 2N5BA 3MNGA 3LG6A 2GS3A 3IOSA 4FO5A 3LSZA 2EIOA 1X5EA 1O6JA 4WBJA 2DMMA 1AQWA 1O8XA 3V1WA 3TRQA 2FWEA 2DSAA 4KCEA 5D93A 4BVXB 2CAIA 3DYRA 1BG5A 3IHQA 2C3QA 2QGVA 2ZNMA 2L6DA 2LS5A 1YEXA 4IP1A 3MSZA 2PWJA 1WPIA 3Q74A 4MPGA 4PQIA 1SD9A 2HSMA 4N30A 3LEFA 1IYHA 2WZ9A 2X49A 3E3EA 3QOUA 2MMNA 2VCZA 1WIKA 4EE0A 4WR4A 2H0GA 3M9JA 5J5NA 2EIQA 3A2WA 4BPYA 5HQPA 3ZYWA 4MJAA 2A2SA 2VM2A 3RDWA 1DUGA 3FZAA 3TKSC 19GSA 2RUFA 3P8WA 1JZRA 3L0HA 1VF4A 3BOAA 3HJPA 4IBPA 4DSQA 2CV4A 2LJAA 1JZWA 3DD3A 4AF2A 3TKPA 1MEKA 4HJ2A 3NZNA 5A4UA 1XWGA 2VO4A 4V1Ag 2B7JA 2FWHA 4KDUA 4RI7A 1F2EA 3IPZA 4POMA 3UJ1A 1VF1A 3D6IA 1JLWA 2OJLA 3ZREA 3IC8A 3RPPA 1GTIA 1TDIA 3GX0A 3CBUA 1LJRA 1ILOA 4N0ZA 3UOMA 1GULA 2OA7A 1UN2A 2IMDA 4L0UA 2JZTA 4OD7A 4LLRA 4RQRA 3L9UA 4YH2A 5ID2B 1PA3A 3RAZA 1ERTA 3KTBA 1TJDA 2PUKC 4OWYA 3G7YA 3VI7A 3FY7A 3C7MA 3KGKA 1FB0A 3DGQA 4HS1A 3A2XA 2I9HA 4FH8A 3ME8A 4KX4A 2C8UA 5A5KA 2X8GA 2TRCP 4ZB6A 2PMTA 5KN2A 3A3TA 4MF7A 1XFLA 2FWGA 1OC9B 1VGLA 1ZGNA 2N5FA 3TUEA 1GTUA 2VCTA 4NPBA 1MDJA 1J9BA 11GSA 2VCVA 1AIUA 5ECNB 3L9VA 2KP2A 4EUYA 3EMXA 4Q5RA 2C80A 3CSHA 2EIRA 7GSSA 3QFBC 1XIYA 1XVQA 3F4SA 3FZ9A 1R5PA 3LXZA 2QA2A 1QFNA 1TK8B 4HQSA 4AGSA 3TRXA 2PU9C 1LBKA 5J4UA 2JZSA 3PGTA 4KF9A 1Z6NA 1SL2B 5GZZB 1V2AA 4K5RA 5BRTA 4WBRD 5JWOB 1O85A 5HR2A 2MBSA 3F3RA 1TRUA 5DDLA 2XC2A 2C3TA 2NPBA 3RPNA 4Q5NA 2KOKA 2H6XA 1T4YA 1M2DA 4NMUA 2AB6A 4NV5A 1UA5A 3LYPA 3VK9A 4XS6A 4GQCA 2ZUPA 3IR4A 2WCIA 3W8JA 2FNOA 3UVTA 4MZWA 3IK9A 4POKA 4DSSA 1TW9A 5ECPB 4HJMA 3APSA 3HZ8A 3QR6A 2WULA 3VI5A 1TI3A 2H1AA 1PN9A 3EC3A 5IPGA 1OC9A 4O32A 4TKYA 4ACSA 3F4RA 3GRXA 3IK7A 1GSDA 2GQMA 5KN3A 3OR5A 2FCHA 1PSQA 4WETA 3KD0A 5JCUA 1FO5A 4TRXA 2GVPA 3TKQA 2VD1A 3QDNA 4DEJA 3GSSA 2C1YA 2CVDA 3G7IA 4QL9A 2FGXA 4V2NA 3IC4A 3IAS2 4X4JA 5JWRB 4HZ4A 2HRKA 4IKHA 5IMDA 3E0UA 1YF1A 20GSA 5DCHA 4L5LA 3C1SA 4MP4A 3O76A 1SU9A 3C73A 5DBQA 3TJGA 3FR9A 5DAKB 5BMUA 1K3LA 1THOA 2GSRA 4ZL8A 4QQ7A 5DQSA 3U6VA 3VPTA 3TJKA 4KSMA 2KLXA 3VPQA 2HYXA 4D73A 3VWUA 1Q98A 5HR1A 1SL1B 3FZ5A 5JCGA 2H01A 1O7UA 2HFDA 5DCGA 2DC5A 1V98A 4ECIA 4E8HA 4O5RA 1R7HA 2XBQA 1XWBA 2JSYA 4IJIA 2F3MA 4BVYB 4IELA 2H71A 3BBYA 3BD2A 4EL1A 5B8BA 2L6CA 3APQA 4EDZA 1S3CA 1B9YC 3ERGA 2LTKA 4Z7XA 4PUAA 3GV1A 1QMVA 4ZILA 2H76A 1YQ1A 4OFTA 1TTZA 2YZHA 2XBIA 3GIXA 3FMWA 6GSVA 4GF0A 1YY7A 3N5OA 1B4PA 1SYXA 2K18A 3AY8A 2F8FA 2LRNA 2WDUA 3KEBA 5ECKB 2K8SA 5B8AA 4ISDA 3DMLA 3W6GA 2LRCA 2NTOA 2H0IA 3G9BA 4XIHA 4J57E 4TN8A 4MNNA 1TU8A 3KH9A 2V6KA 4NWYA 4IVFA 4G0IA 1WJKA 2R4VA 4A5PA 1EGOA 4FYBA 5E59A 2R5GA 5ABRA 1F3BA 1PX6A 4MK3A 5ECMB 2YANA 1YKCA 4LL4B 2VUPA 3P2AA 5DJMA 5ECQB 2R0GA 3ZRDA 3TB2A 1QUWA 2GTUA 3TRPA 2AV4A 1EP7A 1S3DA 1XWCA 2BMXA 2RLIA 1SYRA 3Q6OA 4XCSA 2YWOA 4AJ7A 4O7HA 3GL3A 22GSA 5CREA 3TKSE 6GSWA 3QFAC 1FOHA 1SJIA 2DLXA 2FUG2 4POLA 5IOWA 2C4JA 1T7PB 2O85A 6GSSA 3CTFA 1EGRA 3CSIA 1G7EA 4HU9A 3IHGA 1QXHA 2JU5A 2H8LA 3H4KA 2BTOT 4TW5A 2CX4A 1X0RA 5IIZA 2IFQA 3IV4A 4AJ8A 4K1FA 3C8EA 4ML6A 2FA8A 4IQ1A 5AN1A 5J41A 4CHSA 2CX3A 2B1KA 2HNLA 3K8NA 5CRHA 1ABAA 3SBCA 4EO3A 1OAZA 2YJHA 5HR0A 1JZOA 1GNWA 2GSSA 1M2AA 5EL8A 1AUCA 5IM9A 4I5QA 5GSSA 4K2DA 4WKWA 4NHZA 2HRAA 1TU7A 2P5QA 4KA0A 4G0LA 1XW5A 3IAM2 1X9MB 2X64A 2AUVA 4L5OA 4WF4A 4KCAA 2IL3A 1SKRB 2B1LA 2CAQA 3HYPA 4K9ZA 1VF3A 3UL3A 1HNAA 2QC7A 1PGTA 2IMKA 2H6ZA 2CVKA 1Y6EA 5CRWA 1FAAA 2CVBA 1FW1A 2K9FA 4I6XA 3QAGA 2H73A 5AIVA 3L78A 1TRWA 1F3AA 5D9TA 3D22A 3US3A 1K0NA 1KBNA 1THXA 2LJKA 5KN0A 5F0GA 2VOCA 1MD3A 2LNSA 4F9ZA 3MIXA 1A8LA 1XPVA 1K3OA 1Z6MA 2XPEA 9GSSA 1XOBA 1VRSD 2MYGA 2G2QA 1ERUA 1LU4A 2IIYA 2XHFA 3HVXA 2RM5A 4GTUA 2ES7A 2OBIA 1Z5YE 4GRFA 1O81A 2CT6A 4MCUA 2HSYA 2V6OA 4JR6A 1SK2A 6GSUA 2R37A 2AHEA 4XRAA 2YCDA 5CRDA 3EWLA 1SKWB 3M8NA 3I43A 1WMJA 2DJ3A 4K7OA 3J7Yk 5KOXA 3TJBA 4PGTA 2H72A 2H1GA 3I6AA 2HT9A 5HR3A 5G1KA 4LL1B 3LGCA 1W4VA 3DVXA 3O6TA 2IMIA 1T3BA 4K6XA 3M0FA 3TCOA 4GSTA 2P5RA 2DIZA 4V1Ap 4ZIJA 17GSA 3ZL5A 3UAPA 2LEGA 3SWLA 5ECHB 6GSYA 2GDRA 4KE3A 1OC8A 2R6KA 2VD0A 1EZKA 2M46A 1XBSA 3QMXA 2KP1A 3GL5A 4DSSB 1TXXA 4XRDA 2LJRA 2RM6A 4EXJA 2HZEB 1H4OA 5ELGA 1NW2A 3CSJA 1BJXA 1B9XC 2XPDA 4POBA 2REMA 1URMA 3F6DA 3TDGA 1AQXA 1K0CA 2DJ2A 1ZZYA 4HOJA 3TKRA 5JCWA 4KUNA 2X8CA 2YNXA 3ZLPA 2H75A 2VCQA 5KN1A 3MDKA 1PD21 2H1BA 4KB3A 2YJ7A 3CYNA 4NXIA 5FWGA 4KW6A 6GSXA 4F82A 1TP9A 2FLSA 3A5WA 4I2TA 2LV3A 3PPUA 3HA9A 2P31A 3KZQA 2VIMA 2PVOC 2X4AA 2IN3A 1E6BA 1GSYA 5AISA 4I2UA 4D73B 1TK0B 4BL7B 1FHEA 1ZMAA 2QA1A 3UVHA 1PKWA 1ZL9A 1NHYA 3H8QA 2VCXA 5ECOB 4KAEA 4PUFC 2JADA 2HZEA 3L4NA 4I97A 2OACA 4ZB8A 1MD4A 2RIIA 3CRTA 4OCFA 2GZZA 2WS2A 3UBLA 4GSSA 4PTSA 5G5FA 3KM6A 1FOVA 1HNBA 4ICYA 2UZ8A 1DE2A 3IXRA 5A4WA 1JFUA 2R0CA 4BWSA 4G19A 3EMPA 1PKZA 3TJFA 5E4WA 1JZDA 3UMAA 1PMTA 2DJJA 2FD3A 4ECCA 4MMMA 4IS0A 2J23A 1QGVA 3O3TA 1K0MA 5G30A 4F0BA 3GYKA 3R3EA 1HNCA 3HZ4A 5IMCA 1M9BA 2YWIA 2VL2C 1AQVA 2L4QA 1EEMA 3WGDA 4CY6A 1XZOA 1T8EB 4PNFA 5FT3A 4OCEA 1SK0A 4TR1A 5IOXA 3H79A 4IN0A 2C0EA 1X5DA 4BL7A 1MDKA 1GH2A 1UVZA 3DRNA 4ZXGA 2RUEA 4MLYA 2HLSA 2NDOA 4JEDA 3ZZXA 1T1VA 2AJQB 3GFKA 4Q5FA 1J08A 1GSSA 2IMFA 2CA8A 1C72A 4K7NA 4L0WA 5B6MA 4V2LA 5DJLA 2A2RA 2O7KA 3E9JB 3EYTA 1NHOA 3DKSA 4IW9A 4IP6A 3FZ4A 1TI1A 3H93A 3LYKA 4MZCA 2B3SA 5EY6A 4XS1A 5D9WA 2CZ2A 4CY8A 1OE8A 1ZYNA 2H66A 4X0XA 2QSIA 3LORA 2OADA 2DBCA 1PQNA 3LWAA 1A24A 2YWMA 4K7IA 4GXZA 1GUMA 3TGZA 3GNJA 5IPHA 1IYIA 1ST9A 3WGEA 5COHA 4Q5QA 2FHEA 1U3IA 1EV9A 1M7TA 3G7JA 1GRXA 3FYGA 1V40A 1GSQA 3Q19A 1A23A 2JZRA 4ID0A 4ZBDA 4F2IA 2H0HA 5LNKe 1EOGA 1GTAA 5IO2A 3W8SA 1OKTA 1AC1A 1Q4JA 4GWRA 5F05A 2CQ9A 2F8AA 4XS4A 3P90A 1CQHA 3GMFA 3ZFLA 4GLTA 4IQAA 1A8YA 1ZCPA 4LA1A 2L59A 4ECBA 4HDEA 4EDYA 1FVKA 2GSQA 5KEJA 2IFQB 3F3QA 4DSRA 2C0GA 3HY2A 2P0GA 2GZPA 2HZFA 1RK4A 3ERFA 4RUVA 3VFIA 5H5QA 4GCIA 3IRAA 16GSA 4ECJA 1BX9A 2DIYA 3C1RA 2F9SA 2MMZA 3APOA 2V32A 5F8BA 3A5IA 4NV2A 1TRVA 4WR5A 1ML6A 4LMWA 4JR4A 3BJ5A 3CMIA 2HI7A 1PL2A 4X1UA 1GSUA 3M1GA 1N8JA 1PL1A 1SKSB 1F37A 1ERVA 2AAWA 4MJCA 2PN8A 3EVIA 3ZMKA 3DXBA 2N5AA 3P7XA 3EPTA 2MBTA 2ON7A 2E2GA 4K8MA 2A4HA 2B5XA 4TR3A 1ZOFA 2WB9A 3UARA 1OVNA 3EINA 5J3RA 3KXOA 1F9MA 4G2EA 4WXTA 5ECRB 3GN3A 1OYJA 2H30A 1G0TA 5LCZA 5DVBA 2DJKA 4Z2RA 2H6YA 1AAZA 3ZFBA 2J9HA 1K0OA 2HE3A 3VLNA 1PN0A 4JRRA 1NSWA 2GQKA 3F0IA 1GNEA 5INYA 3ZTLA 1XCCA 1RW1A 3LFLA 3M3MA 4CW9A 5IMVA 5D73A 2PGTA 3MWHA 5CO3A 2HRFA 3U5RE 4JU5A 1CQGA 4X43A 4PQHA 4KSOA 1BEDA 2WRTA 2GT5A 4RI6A 3I69A 1TK5B 2VLUA 1SK1A 6GSTA 3J7Yb 2TRXA 1PRXA 2WFCA 3A2VA 1HD2A 3EE2A 3DVWA 3Q18A 3FK8A 5F07A 4CDOA 4PNGA 1R26A 1Z7RA 4HUAA 2I81A 5ENUA 5IMFA 4YQVA 2CZ3A 4HU7A 4MZBA 1Y25A 4ZBBA 1XVWA 2D2ZA 3FHKA 3FR3A 3EU4A 2LQOA 5IQYA 1A0RP 5IO0A 2GT6A 3GH9A 2OBKA 1T00A 1J0FA 1E2YA 4O5QA 1U88A 2I1UA 2HSHA 4MH3A 1SD8A 3ZITA 2KHPA 3KMNA 3KIJA 2F51A 4Z2UA 3JCML 1YDKA 4EC0A 1USBA 1HQOA 4MDCA 1N2AA 4MA9A 2VL2A 3BCIA 1UC7A 4MH2A 5IMZA 4EF0A 1V57A 5C04A 2WGRA 2GSTA 3DEXA 1DSBA 4K5SA 4K2XA 1MDIA 2PVQA 2YN1A 1QQ2A 4YQUA 2OE3A 2R2JA 1QK8A 1W89A 4Z2TA 1M2BA 3BCKA 4EKZA 4FQUA 5EVOA 5GAND 5H5RA 5AIXA 2H1DA 2GQLA 4N10A 4MABA 3VWXA 3D4TA 1WWJA 4V2MA 4BVXA 5ELAA 1A2LA 3D21A 4F0CA 1PX7A 1AXDA 3TJJA 3ZIJA 4MF5A 1EP8A 1AW9A 2IMEA 2R0PA 1RQMA 3WT1A 2PBJA 3DWVA 3H1NA 1ON4A 3NIVA 3GSTA 5L71A 2FWFA 3FEUA 4OFMA 1B4QA 5B6NA 4P3YB 4KDYA 5DALB 5EPFA 5JWQB 4HQZA 4PXOA 4BA7A 4MPFA 2DMLA 1YJ6A 3GURA 4O5UA 4WEYA 4AJ6A 2E2MA 3IDVA 1K0DA 1WOUA 2AYTA 3KMOA 2A4VA 4DVCA 4G10A 1HYUA 4JE1A 3QAVA 5H5SA 1M9AA 2ALBA 4TR0A 4GQFA 2HXKA 1SJ6A 1GUHA 4J2FA 2MMAA 3N9JA 1YF0A 2O89A 1YZXA 2YWNA 4PQ1A 4IHUA 3FRCA 2IPAA 4YQMA 1GLPA 1JHBA 5ECSA 3HJMA 4KH7A 1XWAA 4TVEA 2K6VA 5CYYA 1U6TA 1XWKA 2JACA 4MF6A 3GKNA 1Z3EA 5J9CA 1I9DA 2BJXA 1SL0B 2DKIA 4J56E 3KJYA 5CRGA 1O73A 2LQQA 5ECLB 3GKMA 2E7PA 1K0AA 4TOPA 4L8EA 4BWQA 4NHWA 3GHAA 4TR1B 1O8WA 4JZQA 5C00A 1VF2A 1Z7PA 5DALA 1A2JA 18GSA 5D9XA 3M9KA 3S9FA 4F03A 3HHVA 2G0FA 4FIWA 2M80A 4YKFA 5ID2A 2MMOA 3HVVA 2VAFA 3UBKA 3QAWA 3HJOA 4EIPA 1DE1A 3EU3A 1GUKA 5G1LA 2JSZA 5ECIB 2DJ1A 4K0NA 2KUCA 5CAXA 3LXTA 4RQXA 4HI7A 1GSEA 5G2ZA 3C71A 3KP9A 2K8VA 1WRYA 2JL4A 2LKUA 3R2QA 4OFNA 3GX8A 13GSA 2O87A 4MJEA 3QPMA 5G5EA 4HZ2A 3F4TA 3CXGA 2DKHA 1ZYQB 2GZYA 2HRNA 4N11A 2C3NA 1U87A 3I9V2 5B7CA 4ZL9A 1FG4A 1GP1A 2O8VB 1OE7A 3D4MA 2LRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EWX A;  5A4V A;  2YOI A;  1FB6 A;  3GH6 A;  3ERW A;  3HCZ A;  2WJU A;  1H75 A;  1TKD B;  2H74 A;  1X5C A;  4TXV A;  2GGT A;  2VLT A;  2DJ0 A;  1XXU A;  3KTL A;  2TIR A;  1FVJ A;  1GSF A;  3FW2 A;  1U3A A;  4XS4 B;  2LST A;  2YPM A;  1X9W B;  1V9W A;  1XW9 A;  2V1M A;  1X9S B;  3ED3 A;  2YV7 A;  3TOT A;  3ZVJ A;  2PPT A;  3IA1 A;  3HD5 A;  2VL9 A;  4PX1 A;  4KND A;  1TRS A;  2H70 A;  3FKF A;  2B5Y A;  1B8X A;  3IE3 A;  3KH7 A;  3ME7 A;  1BQ7 A;  1WE0 A;  2M72 A;  2VCW A;  5F06 A;  2R3X A;  2YV9 A;  4IJ3 A;  1GWC A;  3UEM A;  1A2M A;  3CRU A;  3GUS A;  1G7O A;  3F8U A;  3PH9 A;  3QD9 A;  2E0Q A;  3FR6 A;  5G31 A;  1BAY A;  4ZL7 A;  1KEB A;  1NM3 A;  5HFI A;  4ML1 A;  2EC4 A;  5DAK A;  5D8I A;  1K0B A;  2I4A A;  1TOF A;  3DIE A;  2OE0 A;  2I3Y A;  3PR8 A;  3TOU A;  3F9U A;  3ZML A;  2ON5 A;  4I8B A;  4ILF A;  3GKX A;  4KGI A;  3IBH A;  4IGJ A;  3HXS A;  2B5E A;  2NVL A;  4E8E A;  2QKE A;  3RBT A;  2OE1 A;  3ISO A;  4GSN A;  4HEA 2;  2IJY A;  3GTU B;  5GAP D;  2YP6 A;  4KDX A;  8GSS A;  1V58 A;  1YKA A;  1EOH A;  3KP8 A;  1GLQ A;  2H19 A;  3TKS A;  5CNW A;  4PUR A;  4EVM A;  3RHB A;  2LNT A;  3D0Z A;  4BVY A;  4ZB9 A;  4OO4 A;  2V41 A;  4TXO B;  4FYC A;  1R4W A;  4MJB A;  5D96 A;  4YAP A;  2VL3 A;  2NBS A;  1GL8 A;  1DBY A;  3QCP A;  2L4C A;  3VWW A;  4O92 A;  4OO5 A;  4K0G A;  4TR4 A;  3VWV A;  1F6M C;  3EUR A;  1ACV A;  4LMV A;  2YZU A;  3ZIV A;  5LD0 A;  3CTG A;  1G6W A;  3MAK A;  1M0U A;  3WYW A;  1ERW A;  1KNG A;  1SEN A;  2L57 A;  1BYE A;  2FY6 A;  1A0F A;  3NOF A;  5FHI A;  1XW6 A;  1S3A A;  4YAV A;  5CP1 A;  2IWT A;  3GTU A;  1OC3 A;  3LJR A;  4ZBA A;  3VUR A;  5IMA A;  1B48 A;  4NAX A;  4QL7 A;  1WP0 A;  1M99 A;  4H86 A;  3HKR A;  3ZVJ D;  4TXO A;  3HDC A;  3WT2 A;  2FA4 A;  2X8H A;  4WF5 A;  3WGX A;  3RHC A;  3WD6 A;  3UIW A;  3GKK A;  2ZCT A;  2MZC A;  1GTB A;  2B6M A;  3PIN A;  2OKA A;  1JLV A;  2L5L A;  10GS A;  4G9H A;  4FYU A;  5AGY A;  4OMV A;  5HFK A;  1Z9H A;  2LUS A;  2X99 A;  14GS A;  1I5G A;  3F63 A;  1K3Y A;  1MTC A;  2B7K A;  2VM1 A;  2GLR A;  5GST A;  12GS A;  1SJZ A;  3F6F A;  4JBB A;  5HFG A;  4XHM A;  1YEP A;  1G6Y A;  4ULX A;  1ZYE A;  4XTS A;  3GA4 A;  2PER A;  1KTE A;  3LQ7 A;  5DQY A;  5D9V A;  1EV4 A;  1OKD A;  1XOA A;  1T4Z A;  1EEJ A;  3D5J A;  2C0F A;  3HVS A;  3KCM A;  2L5O A;  2C0D A;  3L9S A;  2V2G A;  5J9B A;  2Z9S A;  4N0V A;  2VLV A;  1R5A A;  2N5B A;  3MNG A;  3LG6 A;  2GS3 A;  3IOS A;  4FO5 A;  3LSZ A;  2EIO A;  1X5E A;  1O6J A;  4WBJ A;  2DMM A;  1AQW A;  1O8X A;  3V1W A;  3TRQ A;  2FWE A;  2DSA A;  4KCE A;  5D93 A;  2CAI A;  3DYR A;  1BG5 A;  3IHQ A;  2C3Q A;  2QGV A;  2ZNM A;  2L6D A;  2LS5 A;  1YEX A;  4IP1 A;  3MSZ A;  2PWJ A;  1WPI A;  3Q74 A;  4MPG A;  4PQI A;  1SD9 A;  4N30 A;  3LEF A;  1IYH A;  2WZ9 A;  3E3E A;  3QOU A;  2MMN A;  2VCZ A;  1WIK A;  4EE0 A;  4WR4 A;  2H0G A;  3M9J A;  5J5N A;  2EIQ A;  3A2W A;  4BPY A;  5HQP A;  3ZYW A;  4MJA A;  2A2S A;  2VM2 A;  3RDW A;  1DUG A;  3FZA A;  3TKS C;  19GS A;  2RUF A;  3P8W A;  1JZR A;  3L0H A;  1VF4 A;  3BOA A;  3HJP A;  4IBP A;  4DSQ A;  2CV4 A;  2LJA A;  1JZW A;  3DD3 A;  4AF2 A;  3TKP A;  1MEK A;  4HJ2 A;  3NZN A;  5A4U A;  1XWG A;  2VO4 A;  4V1A g;  2B7J A;  2FWH A;  4KDU A;  4RI7 A;  1F2E A;  3IPZ A;  4POM A;  3UJ1 A;  1VF1 A;  3D6I A;  1JLW A;  2OJL A;  3ZRE A;  3RPP A;  1GTI A;  1TDI A;  3GX0 A;  3CBU A;  1LJR A;  1ILO A;  4N0Z A;  3UOM A;  1GUL A;  2OA7 A;  1UN2 A;  2IMD A;  4L0U A;  2JZT A;  4OD7 A;  4LLR A;  4RQR A;  3L9U A;  4YH2 A;  5ID2 B;  1PA3 A;  3RAZ A;  1ERT A;  3KTB A;  1TJD A;  2PUK C;  4OWY A;  3G7Y A;  3VI7 A;  3FY7 A;  3C7M A;  3KGK A;  1FB0 A;  3DGQ A;  4HS1 A;  3A2X A;  2I9H A;  4FH8 A;  3ME8 A;  4KX4 A;  2C8U A;  5A5K A;  2X8G A;  2TRC P;  4ZB6 A;  2PMT A;  5KN2 A;  3A3T A;  4MF7 A;  1XFL A;  2FWG A;  1OC9 B;  1VGL A;  1ZGN A;  2N5F A;  3TUE A;  1GTU A;  2VCT A;  4NPB A;  1MDJ A;  1J9B A;  11GS A;  2VCV A;  1AIU A;  5ECN B;  3L9V A;  2KP2 A;  4EUY A;  3EMX A;  4Q5R A;  2C80 A;  3CSH A;  2EIR A;  7GSS A;  3QFB C;  1XIY A;  1XVQ A;  3F4S A;  3FZ9 A;  1R5P A;  3LXZ A;  1QFN A;  1TK8 B;  4HQS A;  4AGS A;  3TRX A;  2PU9 C;  1LBK A;  5J4U A;  2JZS A;  3PGT A;  1Z6N A;  1SL2 B;  5GZZ B;  1V2A A;  4WBR D;  5JWO B;  1O85 A;  5HR2 A;  2MBS A;  3F3R A;  1TRU A;  5DDL A;  2XC2 A;  2C3T A;  2NPB A;  3RPN A;  4Q5N A;  2KOK A;  2H6X A;  1T4Y A;  1M2D A;  4NMU A;  2AB6 A;  4NV5 A;  1UA5 A;  3LYP A;  3VK9 A;  4XS6 A;  4GQC A;  2ZUP A;  3IR4 A;  2WCI A;  3W8J A;  2FNO A;  3UVT A;  4MZW A;  3IK9 A;  4POK A;  4DSS A;  1TW9 A;  5ECP B;  4HJM A;  3APS A;  3HZ8 A;  3QR6 A;  2WUL A;  3VI5 A;  1TI3 A;  2H1A A;  1PN9 A;  3EC3 A;  5IPG A;  1OC9 A;  4O32 A;  4TKY A;  4ACS A;  3F4R A;  3GRX A;  3IK7 A;  1GSD A;  2GQM A;  5KN3 A;  3OR5 A;  2FCH A;  1PSQ A;  4WET A;  3KD0 A;  5JCU A;  1FO5 A;  4TRX A;  2GVP A;  3TKQ A;  2VD1 A;  3QDN A;  4DEJ A;  3GSS A;  2C1Y A;  2CVD A;  3G7I A;  4QL9 A;  2FGX A;  4V2N A;  3IC4 A;  3IAS 2;  5JWR B;  4HZ4 A;  4IKH A;  5IMD A;  3E0U A;  1YF1 A;  20GS A;  5DCH A;  4L5L A;  3C1S A;  4MP4 A;  3O76 A;  1SU9 A;  3C73 A;  5DBQ A;  3TJG A;  3FR9 A;  5DAK B;  1K3L A;  1THO A;  2GSR A;  4ZL8 A;  4QQ7 A;  5DQS A;  3U6V A;  3VPT A;  3TJK A;  4KSM A;  2KLX A;  3VPQ A;  2HYX A;  4D73 A;  3VWU A;  1Q98 A;  5HR1 A;  1SL1 B;  3FZ5 A;  5JCG A;  2H01 A;  1O7U A;  2HFD A;  5DCG A;  2DC5 A;  1V98 A;  4ECI A;  4E8H A;  4O5R A;  1R7H A;  2XBQ A;  1XWB A;  2JSY A;  4IJI A;  2F3M A;  4IEL A;  2H71 A;  3BBY A;  3BD2 A;  4EL1 A;  5B8B A;  2L6C A;  3APQ A;  4EDZ A;  1S3C A;  1B9Y C;  3ERG A;  2LTK A;  4Z7X A;  4PUA A;  3GV1 A;  1QMV A;  4ZIL A;  2H76 A;  1YQ1 A;  4OFT A;  1TTZ A;  2YZH A;  2XBI A;  3GIX A;  6GSV A;  4GF0 A;  1YY7 A;  3N5O A;  1B4P A;  1SYX A;  2K18 A;  3AY8 A;  2F8F A;  2LRN A;  2WDU A;  3KEB A;  5ECK B;  2K8S A;  5B8A A;  4ISD A;  3DML A;  3W6G A;  2LRC A;  2NTO A;  2H0I A;  3G9B A;  4XIH A;  4J57 E;  4TN8 A;  1TU8 A;  3KH9 A;  2V6K A;  4NWY A;  4IVF A;  1WJK A;  2R4V A;  1EGO A;  4FYB A;  5E59 A;  2R5G A;  5ABR A;  1F3B A;  1PX6 A;  4MK3 A;  5ECM B;  2YAN A;  1YKC A;  4LL4 B;  2VUP A;  3P2A A;  5DJM A;  5ECQ B;  3ZRD A;  3TB2 A;  1QUW A;  2GTU A;  3TRP A;  2AV4 A;  1EP7 A;  1S3D A;  1XWC A;  2BMX A;  2RLI A;  1SYR A;  3Q6O A;  4XCS A;  2YWO A;  4AJ7 A;  4O7H A;  3GL3 A;  22GS A;  5CRE A;  3TKS E;  6GSW A;  3QFA C;  1SJI A;  2DLX A;  2FUG 2;  4POL A;  5IOW A;  2C4J A;  1T7P B;  2O85 A;  6GSS A;  3CTF A;  1EGR A;  3CSI A;  1G7E A;  4HU9 A;  1QXH A;  2JU5 A;  2H8L A;  3H4K A;  2BTO T;  4TW5 A;  2CX4 A;  1X0R A;  5IIZ A;  2IFQ A;  3IV4 A;  4AJ8 A;  4K1F A;  3C8E A;  4ML6 A;  2FA8 A;  4IQ1 A;  5AN1 A;  5J41 A;  4CHS A;  2CX3 A;  2B1K A;  2HNL A;  3K8N A;  5CRH A;  1ABA A;  3SBC A;  4EO3 A;  1OAZ A;  2YJH A;  5HR0 A;  1JZO A;  1GNW A;  2GSS A;  1M2A A;  5EL8 A;  1AUC A;  5IM9 A;  4I5Q A;  5GSS A;  4K2D A;  4WKW A;  4NHZ A;  1TU7 A;  2P5Q A;  4KA0 A;  1XW5 A;  3IAM 2;  1X9M B;  2X64 A;  2AUV A;  4L5O A;  4WF4 A;  4KCA A;  2IL3 A;  1SKR B;  2B1L A;  2CAQ A;  3HYP A;  4K9Z A;  1VF3 A;  3UL3 A;  1HNA A;  2QC7 A;  1PGT A;  2IMK A;  2H6Z A;  2CVK A;  1Y6E A;  5CRW A;  1FAA A;  2CVB A;  1FW1 A;  2K9F A;  4I6X A;  3QAG A;  2H73 A;  5AIV A;  3L78 A;  1TRW A;  1F3A A;  5D9T A;  3D22 A;  3US3 A;  1K0N A;  1KBN A;  1THX A;  2LJK A;  5KN0 A;  5F0G A;  2VOC A;  1MD3 A;  2LNS A;  4F9Z A;  1A8L A;  1XPV A;  1K3O A;  1Z6M A;  2XPE A;  9GSS A;  1XOB A;  1VRS D;  2MYG A;  2G2Q A;  1ERU A;  1LU4 A;  2IIY A;  2XHF A;  3HVX A;  2RM5 A;  4GTU A;  2ES7 A;  2OBI A;  1Z5Y E;  4GRF A;  1O81 A;  2CT6 A;  4MCU A;  2HSY A;  2V6O A;  4JR6 A;  1SK2 A;  6GSU A;  2R37 A;  2AHE A;  4XRA A;  2YCD A;  5CRD A;  3EWL A;  1SKW B;  3M8N A;  3I43 A;  1WMJ A;  2DJ3 A;  4K7O A;  3J7Y k;  3TJB A;  4PGT A;  2H72 A;  2H1G A;  3I6A A;  2HT9 A;  5HR3 A;  5G1K A;  4LL1 B;  3LGC A;  1W4V A;  3DVX A;  3O6T A;  2IMI A;  1T3B A;  4K6X A;  3M0F A;  3TCO A;  4GST A;  2P5R A;  2DIZ A;  4V1A p;  4ZIJ A;  17GS A;  3ZL5 A;  3UAP A;  2LEG A;  3SWL A;  5ECH B;  6GSY A;  2GDR A;  4KE3 A;  1OC8 A;  2R6K A;  2VD0 A;  1EZK A;  2M46 A;  1XBS A;  3QMX A;  2KP1 A;  3GL5 A;  4DSS B;  1TXX A;  4XRD A;  2LJR A;  2RM6 A;  4EXJ A;  2HZE B;  1H4O A;  5ELG A;  1NW2 A;  3CSJ A;  1BJX A;  1B9X C;  2XPD A;  4POB A;  2REM A;  1URM A;  3F6D A;  3TDG A;  1AQX A;  1K0C A;  2DJ2 A;  1ZZY A;  4HOJ A;  3TKR A;  5JCW A;  4KUN A;  2X8C A;  2YNX A;  3ZLP A;  2H75 A;  2VCQ A;  5KN1 A;  3MDK A;  1PD2 1;  2H1B A;  4KB3 A;  2YJ7 A;  3CYN A;  4NXI A;  5FWG A;  4KW6 A;  6GSX A;  4F82 A;  1TP9 A;  2FLS A;  3A5W A;  4I2T A;  2LV3 A;  3HA9 A;  2P31 A;  3KZQ A;  2VIM A;  2PVO C;  2IN3 A;  1E6B A;  1GSY A;  5AIS A;  4I2U A;  4D73 B;  1TK0 B;  1FHE A;  1ZMA A;  3UVH A;  1PKW A;  1ZL9 A;  1NHY A;  3H8Q A;  2VCX A;  5ECO B;  4KAE A;  4PUF C;  2JAD A;  2HZE A;  3L4N A;  4I97 A;  2OAC A;  4ZB8 A;  1MD4 A;  2RII A;  3CRT A;  4OCF A;  2GZZ A;  2WS2 A;  3UBL A;  4GSS A;  5G5F A;  3KM6 A;  1FOV A;  1HNB A;  1DE2 A;  3IXR A;  5A4W A;  1JFU A;  4BWS A;  4G19 A;  3EMP A;  1PKZ A;  3TJF A;  5E4W A;  1JZD A;  3UMA A;  1PMT A;  2DJJ A;  2FD3 A;  4ECC A;  4MMM A;  4IS0 A;  2J23 A;  1QGV A;  3O3T A;  1K0M A;  5G30 A;  4F0B A;  3GYK A;  1HNC A;  3HZ4 A;  5IMC A;  1M9B A;  2YWI A;  2VL2 C;  1AQV A;  2L4Q A;  1EEM A;  3WGD A;  1XZO A;  1T8E B;  4PNF A;  5FT3 A;  4OCE A;  1SK0 A;  4TR1 A;  5IOX A;  3H79 A;  4IN0 A;  2C0E A;  1X5D A;  4BL7 A;  1MDK A;  1GH2 A;  1UVZ A;  3DRN A;  4ZXG A;  2RUE A;  4MLY A;  2HLS A;  2NDO A;  4JED A;  3ZZX A;  1T1V A;  2AJQ B;  3GFK A;  4Q5F A;  1J08 A;  1GSS A;  2IMF A;  2CA8 A;  1C72 A;  4K7N A;  4L0W A;  5B6M A;  4V2L A;  5DJL A;  2A2R A;  2O7K A;  3E9J B;  3EYT A;  1NHO A;  3DKS A;  4IW9 A;  4IP6 A;  3FZ4 A;  1TI1 A;  3H93 A;  3LYK A;  4MZC A;  2B3S A;  5EY6 A;  4XS1 A;  5D9W A;  2CZ2 A;  1OE8 A;  2H66 A;  4X0X A;  2QSI A;  3LOR A;  2OAD A;  2DBC A;  1PQN A;  3LWA A;  1A24 A;  2YWM A;  4K7I A;  4GXZ A;  1GUM A;  3TGZ A;  3GNJ A;  5IPH A;  1IYI A;  1ST9 A;  3WGE A;  5COH A;  4Q5Q A;  2FHE A;  1U3I A;  1EV9 A;  1M7T A;  3G7J A;  1GRX A;  3FYG A;  1V40 A;  1GSQ A;  3Q19 A;  1A23 A;  2JZR A;  4ID0 A;  4ZBD A;  4F2I A;  2H0H A;  5LNK e;  1EOG A;  1GTA A;  5IO2 A;  3W8S A;  1OKT A;  1AC1 A;  1Q4J A;  4GWR A;  5F05 A;  2CQ9 A;  2F8A A;  4XS4 A;  3P90 A;  1CQH A;  3GMF A;  3ZFL A;  4GLT A;  4IQA A;  1A8Y A;  1ZCP A;  4LA1 A;  2L59 A;  4ECB A;  4HDE A;  4EDY A;  1FVK A;  2GSQ A;  5KEJ A;  2IFQ B;  3F3Q A;  4DSR A;  2C0G A;  3HY2 A;  2P0G A;  2GZP A;  2HZF A;  1RK4 A;  3ERF A;  4RUV A;  3VFI A;  5H5Q A;  4GCI A;  3IRA A;  16GS A;  4ECJ A;  1BX9 A;  2DIY A;  3C1R A;  2F9S A;  2MMZ A;  3APO A;  2V32 A;  5F8B A;  4NV2 A;  1TRV A;  4WR5 A;  1ML6 A;  4LMW A;  4JR4 A;  3BJ5 A;  3CMI A;  2HI7 A;  1PL2 A;  4X1U A;  1GSU A;  3M1G A;  1N8J A;  1PL1 A;  1SKS B;  1F37 A;  1ERV A;  2AAW A;  4MJC A;  2PN8 A;  3EVI A;  3ZMK A;  3DXB A;  2N5A A;  3P7X A;  2MBT A;  2ON7 A;  2E2G A;  4K8M A;  2B5X A;  4TR3 A;  1ZOF A;  2WB9 A;  3UAR A;  1OVN A;  3EIN A;  5J3R A;  3KXO A;  1F9M A;  4G2E A;  4WXT A;  5ECR B;  3GN3 A;  1OYJ A;  2H30 A;  1G0T A;  5LCZ A;  5DVB A;  2DJK A;  2H6Y A;  1AAZ A;  3ZFB A;  2J9H A;  1K0O A;  2HE3 A;  3VLN A;  4JRR A;  1NSW A;  2GQK A;  3F0I A;  1GNE A;  5INY A;  3ZTL A;  1XCC A;  1RW1 A;  3LFL A;  3M3M A;  4CW9 A;  5IMV A;  5D73 A;  2PGT A;  3MWH A;  5CO3 A;  2HRF A;  3U5R E;  4JU5 A;  1CQG A;  4X43 A;  4PQH A;  4KSO A;  1BED A;  2WRT A;  2GT5 A;  4RI6 A;  3I69 A;  1TK5 B;  2VLU A;  1SK1 A;  6GST A;  3J7Y b;  2TRX A;  1PRX A;  2WFC A;  3A2V A;  1HD2 A;  3EE2 A;  3DVW A;  3Q18 A;  3FK8 A;  5F07 A;  4CDO A;  4PNG A;  1R26 A;  1Z7R A;  4HUA A;  2I81 A;  5ENU A;  5IMF A;  4YQV A;  2CZ3 A;  4HU7 A;  4MZB A;  1Y25 A;  4ZBB A;  1XVW A;  2D2Z A;  3FHK A;  3FR3 A;  3EU4 A;  2LQO A;  5IQY A;  1A0R P;  5IO0 A;  2GT6 A;  3GH9 A;  2OBK A;  1T00 A;  1J0F A;  1E2Y A;  1U88 A;  2I1U A;  2HSH A;  4MH3 A;  1SD8 A;  3ZIT A;  2KHP A;  3KMN A;  3KIJ A;  2F51 A;  3JCM L;  1YDK A;  4EC0 A;  1USB A;  1HQO A;  4MDC A;  1N2A A;  4MA9 A;  2VL2 A;  3BCI A;  1UC7 A;  4MH2 A;  5IMZ A;  4EF0 A;  1V57 A;  5C04 A;  2WGR A;  2GST A;  3DEX A;  1DSB A;  1MDI A;  2PVQ A;  2YN1 A;  1QQ2 A;  4YQU A;  2OE3 A;  2R2J A;  1QK8 A;  1W89 A;  1M2B A;  3BCK A;  4EKZ A;  5EVO A;  5GAN D;  5H5R A;  5AIX A;  2H1D A;  2GQL A;  4N10 A;  4MAB A;  3VWX A;  3D4T A;  1WWJ A;  4V2M A;  4BVX A;  5ELA A;  1A2L A;  3D21 A;  4F0C A;  1PX7 A;  1AXD A;  3TJJ A;  3ZIJ A;  4MF5 A;  1EP8 A;  1AW9 A;  2IME A;  1RQM A;  3WT1 A;  2PBJ A;  3DWV A;  3H1N A;  1ON4 A;  3NIV A;  3GST A;  5L71 A;  2FWF A;  3FEU A;  4OFM A;  1B4Q A;  5B6N A;  4P3Y B;  4KDY A;  5DAL B;  5EPF A;  5JWQ B;  4HQZ A;  4PXO A;  4BA7 A;  4MPF A;  2DML A;  1YJ6 A;  3GUR A;  4WEY A;  4AJ6 A;  2E2M A;  3IDV A;  1K0D A;  1WOU A;  2AYT A;  3KMO A;  2A4V A;  4DVC A;  4G10 A;  1HYU A;  4JE1 A;  3QAV A;  5H5S A;  1M9A A;  2ALB A;  4TR0 A;  4GQF A;  2HXK A;  1SJ6 A;  1GUH A;  4J2F A;  2MMA A;  3N9J A;  1YF0 A;  2O89 A;  1YZX A;  2YWN A;  4PQ1 A;  4IHU A;  3FRC A;  2IPA A;  4YQM A;  1GLP A;  1JHB A;  5ECS A;  3HJM A;  4KH7 A;  1XWA A;  4TVE A;  2K6V A;  5CYY A;  1U6T A;  1XWK A;  2JAC A;  4MF6 A;  3GKN A;  1Z3E A;  5J9C A;  1I9D A;  2BJX A;  1SL0 B;  4J56 E;  3KJY A;  5CRG A;  1O73 A;  2LQQ A;  5ECL B;  3GKM A;  2E7P A;  1K0A A;  4TOP A;  4L8E A;  4BWQ A;  4NHW A;  3GHA A;  4TR1 B;  1O8W A;  4JZQ A;  5C00 A;  1VF2 A;  1Z7P A;  5DAL A;  1A2J A;  18GS A;  5D9X A;  3M9K A;  3S9F A;  4F03 A;  3HHV A;  2G0F A;  4FIW A;  2M80 A;  5ID2 A;  2MMO A;  3HVV A;  2VAF A;  3UBK A;  3QAW A;  3HJO A;  1DE1 A;  3EU3 A;  1GUK A;  5G1L A;  2JSZ A;  5ECI B;  2DJ1 A;  4K0N A;  2KUC A;  5CAX A;  3LXT A;  4RQX A;  4HI7 A;  1GSE A;  5G2Z A;  3C71 A;  3KP9 A;  2K8V A;  1WRY A;  2JL4 A;  2LKU A;  3R2Q A;  4OFN A;  3GX8 A;  13GS A;  2O87 A;  4MJE A;  3QPM A;  5G5E A;  4HZ2 A;  3F4T A;  3CXG A;  1ZYQ B;  2GZY A;  2HRN A;  4N11 A;  2C3N A;  1U87 A;  3I9V 2;  5B7C A;  4ZL9 A;  1FG4 A;  1GP1 A;  2O8V B;  1OE7 A;  3D4M A;  2LRT A; 
#chains in the Genus database with same CATH topology
 1EWX A;  4USS A;  5A4V A;  2YOI A;  1FB6 A;  3GH6 A;  3ERW A;  3HCZ A;  2WJU A;  1H75 A;  1TKD B;  2H74 A;  1X5C A;  4TXV A;  2GGT A;  2VLT A;  2DJ0 A;  1XXU A;  3KTL A;  4EIQ A;  2TIR A;  1FVJ A;  1GSF A;  4HSC X;  3FW2 A;  1U3A A;  4XS4 B;  2LST A;  2YPM A;  1X9W B;  1V9W A;  1XW9 A;  2V1M A;  1X9S B;  3ED3 A;  2YV7 A;  3TOT A;  3ZVJ A;  2PPT A;  3IA1 A;  3HD5 A;  2VL9 A;  4PX1 A;  4KND A;  1TRS A;  2H70 A;  3FKF A;  2B5Y A;  1B8X A;  3IE3 A;  3KH7 A;  3ME7 A;  1BQ7 A;  1WE0 A;  2M72 A;  2VCW A;  5F06 A;  2R3X A;  2YV9 A;  4IJ3 A;  1GWC A;  3UEM A;  1A2M A;  3CRU A;  3GUS A;  1G7O A;  3F8U A;  3PH9 A;  3QD9 A;  2E0Q A;  3FR6 A;  5G31 A;  1BAY A;  4ZL7 A;  1KEB A;  1NM3 A;  5HFI A;  4ML1 A;  2EC4 A;  5DAK A;  5D8I A;  1K0B A;  2I4A A;  1TOF A;  3DIE A;  2OE0 A;  2I3Y A;  3PR8 A;  3TOU A;  3F9U A;  3ZML A;  2ON5 A;  4I8B A;  5KOW A;  4ILF A;  3GKX A;  3LW9 A;  4KGI A;  3IBH A;  4IGJ A;  3HXS A;  2B5E A;  2NVL A;  4E8E A;  2QKE A;  3RBT A;  2OE1 A;  3ISO A;  4GSN A;  4HEA 2;  2IJY A;  3GTU B;  5GAP D;  2YP6 A;  4KDX A;  8GSS A;  1V58 A;  1YKA A;  1EOH A;  3KP8 A;  1GLQ A;  2H19 A;  3TKS A;  5CNW A;  4PUR A;  4EVM A;  3RHB A;  2LNT A;  1ZYP A;  3D0Z A;  4BVY A;  4ZB9 A;  4OO4 A;  2V41 A;  4TXO B;  4FYC A;  1R4W A;  4MJB A;  5D96 A;  4YAP A;  2VL3 A;  2A2P A;  2NBS A;  1GL8 A;  1DBY A;  3QCP A;  2L4C A;  3VWW A;  4O92 A;  4OO5 A;  4K0G A;  4TR4 A;  3VWV A;  1F6M C;  3EUR A;  4G0K A;  1ACV A;  4LMV A;  2YZU A;  3ZIV A;  5LD0 A;  3CTG A;  1G6W A;  3MAK A;  4YKG A;  1M0U A;  3WYW A;  1ERW A;  1KNG A;  1SEN A;  2L57 A;  1BYE A;  2FY6 A;  1A0F A;  3NOF A;  5FHI A;  1XW6 A;  1S3A A;  4YAV A;  5CP1 A;  2IWT A;  3GTU A;  1OC3 A;  3LJR A;  4ZBA A;  3VUR A;  5IMA A;  1B48 A;  4NAX A;  4QL7 A;  1WP0 A;  1M99 A;  4H86 A;  3HKR A;  3ZVJ D;  4TXO A;  3HDC A;  3WT2 A;  2FA4 A;  2X8H A;  4WF5 A;  3WGX A;  3RHC A;  3WD6 A;  3UIW A;  3GKK A;  3MYD A;  2ZCT A;  2MZC A;  1GTB A;  2B6M A;  3PIN A;  2OKA A;  1JLV A;  2L5L A;  10GS A;  4G9H A;  4FYU A;  5AGY A;  4OMV A;  5HFK A;  1Z9H A;  2LUS A;  2X99 A;  14GS A;  1I5G A;  3F63 A;  1K3Y A;  1MTC A;  2B7K A;  2VM1 A;  2GLR A;  5GST A;  12GS A;  1SJZ A;  3F6F A;  4JBB A;  5HFG A;  4XHM A;  1YEP A;  1G6Y A;  4ULX A;  1ZYE A;  4XTS A;  3GA4 A;  2PER A;  1KTE A;  3LQ7 A;  5DQY A;  5D9V A;  1EV4 A;  1OKD A;  1XOA A;  1T4Z A;  1EEJ A;  3D5J A;  2C0F A;  3HVS A;  3KCM A;  2L5O A;  2C0D A;  3L9S A;  2V2G A;  5J9B A;  2Z9S A;  4N0V A;  2VLV A;  1R5A A;  2N5B A;  3MNG A;  3LG6 A;  2GS3 A;  3IOS A;  4FO5 A;  3LSZ A;  2EIO A;  1X5E A;  1O6J A;  4WBJ A;  2DMM A;  1AQW A;  1O8X A;  3V1W A;  3TRQ A;  2FWE A;  2DSA A;  4KCE A;  5D93 A;  4BVX B;  2CAI A;  3DYR A;  1BG5 A;  3IHQ A;  2C3Q A;  2QGV A;  2ZNM A;  2L6D A;  2LS5 A;  1YEX A;  4IP1 A;  3MSZ A;  2PWJ A;  1WPI A;  3Q74 A;  4MPG A;  4PQI A;  1SD9 A;  2HSM A;  4N30 A;  3LEF A;  1IYH A;  2WZ9 A;  2X49 A;  3E3E A;  3QOU A;  2MMN A;  2VCZ A;  1WIK A;  4EE0 A;  4WR4 A;  2H0G A;  3M9J A;  5J5N A;  2EIQ A;  3A2W A;  4BPY A;  5HQP A;  3ZYW A;  4MJA A;  2A2S A;  2VM2 A;  3RDW A;  1DUG A;  3FZA A;  3TKS C;  19GS A;  2RUF A;  3P8W A;  1JZR A;  3L0H A;  1VF4 A;  3BOA A;  3HJP A;  3HVN A;  4IBP A;  4DSQ A;  2CV4 A;  2LJA A;  1JZW A;  3DD3 A;  4AF2 A;  3TKP A;  1MEK A;  4HJ2 A;  3NZN A;  5A4U A;  1XWG A;  2VO4 A;  4V1A g;  2B7J A;  2FWH A;  4KDU A;  4RI7 A;  1F2E A;  3IPZ A;  4POM A;  3UJ1 A;  1VF1 A;  3D6I A;  1JLW A;  2OJL A;  3ZRE A;  3IC8 A;  3RPP A;  1GTI A;  1TDI A;  3GX0 A;  3CBU A;  1LJR A;  1ILO A;  4N0Z A;  3UOM A;  1GUL A;  2OA7 A;  1UN2 A;  2IMD A;  4L0U A;  2JZT A;  4OD7 A;  4LLR A;  4RQR A;  3L9U A;  4YH2 A;  5ID2 B;  1PA3 A;  3RAZ A;  1ERT A;  3KTB A;  1TJD A;  2PUK C;  4OWY A;  3G7Y A;  3VI7 A;  3FY7 A;  3C7M A;  3KGK A;  1FB0 A;  3DGQ A;  4HS1 A;  3A2X A;  2I9H A;  4FH8 A;  3ME8 A;  4KX4 A;  2C8U A;  5A5K A;  2X8G A;  2TRC P;  4ZB6 A;  2PMT A;  5KN2 A;  3A3T A;  4MF7 A;  1XFL A;  2FWG A;  1OC9 B;  1VGL A;  1ZGN A;  2N5F A;  3TUE A;  1GTU A;  2VCT A;  4NPB A;  1MDJ A;  1J9B A;  11GS A;  2VCV A;  1AIU A;  5ECN B;  3L9V A;  2KP2 A;  4EUY A;  3EMX A;  4Q5R A;  2C80 A;  3CSH A;  2EIR A;  7GSS A;  3QFB C;  1XIY A;  1XVQ A;  3F4S A;  3FZ9 A;  1R5P A;  3LXZ A;  2QA2 A;  1QFN A;  1TK8 B;  4HQS A;  4AGS A;  3TRX A;  2PU9 C;  1LBK A;  5J4U A;  2JZS A;  3PGT A;  4KF9 A;  1Z6N A;  1SL2 B;  5GZZ B;  1V2A A;  1XG8 A;  4K5R A;  5BRT A;  4WBR D;  5JWO B;  1O85 A;  5HR2 A;  2MBS A;  3F3R A;  1TRU A;  5DDL A;  2XC2 A;  2C3T A;  2NPB A;  3RPN A;  4Q5N A;  2KOK A;  2H6X A;  1T4Y A;  1M2D A;  4NMU A;  2AB6 A;  4NV5 A;  1UA5 A;  3LYP A;  3VK9 A;  4XS6 A;  4GQC A;  2ZUP A;  3IR4 A;  2WCI A;  3W8J A;  2FNO A;  3UVT A;  4MZW A;  3IK9 A;  4POK A;  4DSS A;  1TW9 A;  5ECP B;  4HJM A;  3APS A;  3HZ8 A;  3QR6 A;  2WUL A;  3VI5 A;  1TI3 A;  2H1A A;  1PN9 A;  3EC3 A;  5IPG A;  1OC9 A;  4O32 A;  4TKY A;  4ACS A;  3F4R A;  3GRX A;  3IK7 A;  1GSD A;  2GQM A;  5KN3 A;  3OR5 A;  2FCH A;  1PSQ A;  4WET A;  3KD0 A;  5JCU A;  1FO5 A;  4TRX A;  2GVP A;  3TKQ A;  2VD1 A;  3QDN A;  4DEJ A;  3GSS A;  2C1Y A;  2CVD A;  3G7I A;  4QL9 A;  2FGX A;  4V2N A;  3IC4 A;  3IAS 2;  4X4J A;  5JWR B;  4HZ4 A;  2HRK A;  4IKH A;  5IMD A;  3E0U A;  1YF1 A;  20GS A;  5DCH A;  4L5L A;  3C1S A;  4MP4 A;  3O76 A;  1SU9 A;  3C73 A;  5DBQ A;  3TJG A;  3FR9 A;  5DAK B;  5BMU A;  1K3L A;  1THO A;  2GSR A;  4ZL8 A;  4QQ7 A;  5DQS A;  3U6V A;  3VPT A;  3TJK A;  4KSM A;  2KLX A;  3VPQ A;  2HYX A;  4D73 A;  3VWU A;  1Q98 A;  5HR1 A;  1SL1 B;  3FZ5 A;  5JCG A;  2H01 A;  1O7U A;  2HFD A;  5DCG A;  2DC5 A;  1V98 A;  4ECI A;  4E8H A;  4O5R A;  1R7H A;  2XBQ A;  1XWB A;  2JSY A;  4IJI A;  2F3M A;  4BVY B;  4IEL A;  2H71 A;  3BBY A;  3BD2 A;  4EL1 A;  5B8B A;  2L6C A;  3APQ A;  4EDZ A;  1S3C A;  1B9Y C;  3ERG A;  2LTK A;  4Z7X A;  4PUA A;  3GV1 A;  1QMV A;  4ZIL A;  2H76 A;  1YQ1 A;  4OFT A;  1TTZ A;  2YZH A;  2XBI A;  3GIX A;  3FMW A;  6GSV A;  4GF0 A;  1YY7 A;  3N5O A;  1B4P A;  1SYX A;  2K18 A;  3AY8 A;  2F8F A;  2LRN A;  2WDU A;  3KEB A;  5ECK B;  2K8S A;  5B8A A;  4ISD A;  3DML A;  3W6G A;  2LRC A;  2NTO A;  2H0I A;  3G9B A;  4XIH A;  4J57 E;  4TN8 A;  4MNN A;  1TU8 A;  3KH9 A;  2V6K A;  4NWY A;  4IVF A;  4G0I A;  1WJK A;  2R4V A;  4A5P A;  4BIK A;  1EGO A;  4FYB A;  5E59 A;  2R5G A;  5ABR A;  1F3B A;  1PX6 A;  4MK3 A;  5ECM B;  2YAN A;  1YKC A;  4LL4 B;  2VUP A;  3P2A A;  5DJM A;  5ECQ B;  2R0G A;  3ZRD A;  3TB2 A;  1QUW A;  2GTU A;  3TRP A;  2AV4 A;  1EP7 A;  1S3D A;  1XWC A;  2BMX A;  2RLI A;  1SYR A;  3Q6O A;  4XCS A;  2YWO A;  4AJ7 A;  4O7H A;  3GL3 A;  22GS A;  5CRE A;  3TKS E;  6GSW A;  3QFA C;  1FOH A;  1SJI A;  2DLX A;  2FUG 2;  4POL A;  5IOW A;  2C4J A;  1T7P B;  2O85 A;  6GSS A;  3CTF A;  1EGR A;  3CSI A;  1G7E A;  4HU9 A;  3IHG A;  1QXH A;  2JU5 A;  2H8L A;  3H4K A;  2BTO T;  4TW5 A;  2CX4 A;  1X0R A;  5IIZ A;  2IFQ A;  3IV4 A;  4AJ8 A;  4K1F A;  3C8E A;  4ML6 A;  2FA8 A;  4IQ1 A;  5AN1 A;  5J41 A;  4CHS A;  2CX3 A;  2B1K A;  2HNL A;  3K8N A;  5CRH A;  1ABA A;  3SBC A;  4EO3 A;  1OAZ A;  2YJH A;  5HR0 A;  1JZO A;  1GNW A;  2GSS A;  1M2A A;  5EL8 A;  1AUC A;  5IM9 A;  4I5Q A;  5GSS A;  4K2D A;  4WKW A;  4NHZ A;  2HRA A;  1TU7 A;  2P5Q A;  4KA0 A;  4G0L A;  1XW5 A;  3IAM 2;  1X9M B;  2X64 A;  2AUV A;  4L5O A;  4WF4 A;  4KCA A;  2IL3 A;  1SKR B;  2B1L A;  2CAQ A;  3HYP A;  4K9Z A;  1VF3 A;  3UL3 A;  1HNA A;  2QC7 A;  1PGT A;  2IMK A;  2H6Z A;  2CVK A;  3CQF A;  1Y6E A;  5CRW A;  1FAA A;  2CVB A;  1FW1 A;  2K9F A;  4I6X A;  3QAG A;  2H73 A;  5AIV A;  3L78 A;  1TRW A;  1F3A A;  5D9T A;  3D22 A;  3US3 A;  1K0N A;  1KBN A;  1THX A;  2LJK A;  5KN0 A;  5F0G A;  2VOC A;  1MD3 A;  2LNS A;  4F9Z A;  3MIX A;  1A8L A;  1XPV A;  1K3O A;  1Z6M A;  2XPE A;  9GSS A;  1XOB A;  1VRS D;  2MYG A;  2G2Q A;  1ERU A;  1LU4 A;  1PFO A;  2IIY A;  2XHF A;  3HVX A;  2RM5 A;  4GTU A;  2ES7 A;  2OBI A;  1Z5Y E;  4GRF A;  1O81 A;  2CT6 A;  4MCU A;  2HSY A;  2V6O A;  4JR6 A;  1SK2 A;  6GSU A;  2R37 A;  2AHE A;  4XRA A;  2YCD A;  5CRD A;  3EWL A;  1SKW B;  3M8N A;  3I43 A;  1WMJ A;  2DJ3 A;  4K7O A;  3J7Y k;  5KOX A;  3TJB A;  4PGT A;  2H72 A;  2H1G A;  3I6A A;  2HT9 A;  5HR3 A;  5G1K A;  4LL1 B;  3LGC A;  1W4V A;  3DVX A;  3O6T A;  2IMI A;  1T3B A;  4K6X A;  3M0F A;  3TCO A;  4GST A;  2P5R A;  2DIZ A;  4V1A p;  4ZIJ A;  17GS A;  3ZL5 A;  3UAP A;  2LEG A;  3SWL A;  5ECH B;  6GSY A;  2GDR A;  4KE3 A;  1OC8 A;  2R6K A;  2VD0 A;  1EZK A;  2M46 A;  1XBS A;  3QMX A;  2KP1 A;  3GL5 A;  4DSS B;  1TXX A;  4XRD A;  2LJR A;  2RM6 A;  4EXJ A;  2HZE B;  1H4O A;  5ELG A;  1NW2 A;  3CSJ A;  1BJX A;  1B9X C;  2XPD A;  4POB A;  2REM A;  1URM A;  3F6D A;  3TDG A;  1AQX A;  1K0C A;  2DJ2 A;  1ZZY A;  4HOJ A;  3TKR A;  5JCW A;  4KUN A;  2X8C A;  2YNX A;  3ZLP A;  2H75 A;  2VCQ A;  5KN1 A;  3MDK A;  1PD2 1;  2H1B A;  4KB3 A;  2YJ7 A;  3CYN A;  4NXI A;  5FWG A;  4KW6 A;  6GSX A;  4F82 A;  1TP9 A;  2FLS A;  3A5W A;  4I2T A;  2LV3 A;  3PPU A;  3HA9 A;  2P31 A;  3KZQ A;  2VIM A;  2PVO C;  2X4A A;  2IN3 A;  1E6B A;  1GSY A;  5AIS A;  4I2U A;  4D73 B;  1TK0 B;  4BL7 B;  1FHE A;  1ZMA A;  2QA1 A;  3UVH A;  1PKW A;  1ZL9 A;  1NHY A;  3H8Q A;  2VCX A;  5ECO B;  4KAE A;  4PUF C;  2JAD A;  2HZE A;  3L4N A;  4I97 A;  2OAC A;  4ZB8 A;  1MD4 A;  2RII A;  3CRT A;  4OCF A;  2GZZ A;  2WS2 A;  3UBL A;  4GSS A;  4PTS A;  5G5F A;  3KM6 A;  1FOV A;  1HNB A;  4ICY A;  2UZ8 A;  1DE2 A;  3IXR A;  5A4W A;  1JFU A;  2R0C A;  4BWS A;  4G19 A;  3EMP A;  1PKZ A;  3TJF A;  5E4W A;  1JZD A;  3UMA A;  1PMT A;  2DJJ A;  2FD3 A;  4ECC A;  4MMM A;  4IS0 A;  2J23 A;  1QGV A;  3O3T A;  1K0M A;  5G30 A;  4F0B A;  3GYK A;  3R3E A;  1HNC A;  3HZ4 A;  5IMC A;  1M9B A;  2YWI A;  2VL2 C;  1AQV A;  2L4Q A;  1EEM A;  3WGD A;  4CY6 A;  1XZO A;  1T8E B;  1S3R A;  4PNF A;  5FT3 A;  4OCE A;  1SK0 A;  4TR1 A;  5IOX A;  3H79 A;  4IN0 A;  2C0E A;  1X5D A;  4BL7 A;  1MDK A;  1GH2 A;  1UVZ A;  3DRN A;  4ZXG A;  2RUE A;  4MLY A;  2HLS A;  2NDO A;  4JED A;  3ZZX A;  1T1V A;  2AJQ B;  3GFK A;  4Q5F A;  1J08 A;  1GSS A;  2IMF A;  2CA8 A;  1C72 A;  4K7N A;  4L0W A;  5B6M A;  4V2L A;  5DJL A;  2A2R A;  2O7K A;  3E9J B;  3EYT A;  1NHO A;  3DKS A;  4IW9 A;  4IP6 A;  3FZ4 A;  1TI1 A;  3H93 A;  3LYK A;  4MZC A;  2B3S A;  5EY6 A;  4XS1 A;  5D9W A;  2CZ2 A;  4CY8 A;  1OE8 A;  1ZYN A;  2H66 A;  4X0X A;  2QSI A;  3LOR A;  2OAD A;  2DBC A;  1PQN A;  3LWA A;  1A24 A;  2YWM A;  4K7I A;  4GXZ A;  1GUM A;  3TGZ A;  3GNJ A;  5IPH A;  1IYI A;  1ST9 A;  3WGE A;  5COH A;  4Q5Q A;  2FHE A;  1U3I A;  1EV9 A;  1M7T A;  3G7J A;  1GRX A;  3FYG A;  1V40 A;  1GSQ A;  3Q19 A;  1A23 A;  2JZR A;  4ID0 A;  4ZBD A;  4F2I A;  2H0H A;  5LNK e;  1EOG A;  1GTA A;  5IO2 A;  3W8S A;  1OKT A;  1AC1 A;  1Q4J A;  4GWR A;  5F05 A;  2CQ9 A;  2F8A A;  4XS4 A;  3P90 A;  1CQH A;  3GMF A;  3ZFL A;  4GLT A;  4IQA A;  1A8Y A;  1ZCP A;  4LA1 A;  2L59 A;  4ECB A;  4HDE A;  4EDY A;  1FVK A;  2GSQ A;  5KEJ A;  2IFQ B;  3F3Q A;  4DSR A;  2C0G A;  3HY2 A;  2P0G A;  2GZP A;  2HZF A;  1RK4 A;  3ERF A;  4RUV A;  3VFI A;  5H5Q A;  4GCI A;  3IRA A;  16GS A;  4ECJ A;  1BX9 A;  2DIY A;  3C1R A;  2F9S A;  2MMZ A;  3APO A;  2V32 A;  5F8B A;  3A5I A;  4NV2 A;  1TRV A;  4WR5 A;  1ML6 A;  4LMW A;  4JR4 A;  3BJ5 A;  3CMI A;  2HI7 A;  1PL2 A;  4X1U A;  1GSU A;  3M1G A;  1N8J A;  1PL1 A;  1SKS B;  1F37 A;  1ERV A;  2AAW A;  4MJC A;  2PN8 A;  3EVI A;  3ZMK A;  3DXB A;  2N5A A;  3P7X A;  3EPT A;  2MBT A;  2ON7 A;  2E2G A;  4K8M A;  2A4H A;  2B5X A;  4TR3 A;  1ZOF A;  2WB9 A;  3UAR A;  1OVN A;  3EIN A;  5J3R A;  3KXO A;  1F9M A;  4G2E A;  4WXT A;  5ECR B;  3GN3 A;  1OYJ A;  2H30 A;  1G0T A;  5LCZ A;  5DVB A;  2DJK A;  4Z2R A;  2H6Y A;  1AAZ A;  3ZFB A;  2J9H A;  1K0O A;  2HE3 A;  3VLN A;  1PN0 A;  4JRR A;  1NSW A;  2GQK A;  3F0I A;  1GNE A;  5INY A;  3ZTL A;  1XCC A;  1RW1 A;  3LFL A;  3M3M A;  4CW9 A;  5IMV A;  5D73 A;  2PGT A;  3MWH A;  5CO3 A;  2HRF A;  3U5R E;  4JU5 A;  1CQG A;  4X43 A;  4PQH A;  4KSO A;  1BED A;  2WRT A;  2GT5 A;  4RI6 A;  3I69 A;  1TK5 B;  2VLU A;  1SK1 A;  6GST A;  3J7Y b;  2TRX A;  1PRX A;  2WFC A;  3A2V A;  1HD2 A;  1M3J A;  3EE2 A;  3DVW A;  3Q18 A;  3FK8 A;  5F07 A;  4CDO A;  4PNG A;  1R26 A;  1Z7R A;  4HUA A;  2I81 A;  5ENU A;  5IMF A;  4YQV A;  2CZ3 A;  4HU7 A;  4MZB A;  1Y25 A;  4ZBB A;  1XVW A;  2D2Z A;  3FHK A;  3FR3 A;  3EU4 A;  2LQO A;  5IQY A;  1A0R P;  5IO0 A;  2GT6 A;  3GH9 A;  2OBK A;  1T00 A;  1J0F A;  1E2Y A;  4O5Q A;  1U88 A;  2I1U A;  2HSH A;  4MH3 A;  1SD8 A;  3ZIT A;  2KHP A;  3KMN A;  3KIJ A;  2F51 A;  4Z2U A;  3JCM L;  1YDK A;  4EC0 A;  1USB A;  1HQO A;  4MDC A;  1N2A A;  4MA9 A;  2VL2 A;  3BCI A;  1UC7 A;  4MH2 A;  5IMZ A;  4EF0 A;  1V57 A;  5C04 A;  2WGR A;  2GST A;  3DEX A;  1DSB A;  4K5S A;  4K2X A;  1MDI A;  2PVQ A;  2YN1 A;  1QQ2 A;  4YQU A;  2OE3 A;  2R2J A;  1QK8 A;  1W89 A;  4Z2T A;  1M2B A;  3BCK A;  4EKZ A;  4FQU A;  5EVO A;  5GAN D;  5H5R A;  5AIX A;  2H1D A;  2GQL A;  4N10 A;  4MAB A;  3VWX A;  3D4T A;  1WWJ A;  4V2M A;  4BVX A;  5ELA A;  1A2L A;  3D21 A;  4F0C A;  1PX7 A;  1AXD A;  3TJJ A;  3ZIJ A;  4MF5 A;  1EP8 A;  1AW9 A;  2IME A;  2R0P A;  1RQM A;  3WT1 A;  2PBJ A;  3DWV A;  3H1N A;  1ON4 A;  3NIV A;  3GST A;  5L71 A;  2FWF A;  3FEU A;  4OFM A;  1B4Q A;  5B6N A;  4P3Y B;  4KDY A;  5DAL B;  5EPF A;  5JWQ B;  4HQZ A;  4PXO A;  4BA7 A;  4MPF A;  2DML A;  1YJ6 A;  3GUR A;  4O5U A;  4WEY A;  4AJ6 A;  2E2M A;  3IDV A;  1K0D A;  1WOU A;  2AYT A;  3KMO A;  2A4V A;  4DVC A;  4G10 A;  1HYU A;  4JE1 A;  3QAV A;  5H5S A;  1M9A A;  2ALB A;  4TR0 A;  4GQF A;  2HXK A;  1SJ6 A;  1GUH A;  4J2F A;  2MMA A;  3N9J A;  1YF0 A;  2O89 A;  1YZX A;  2YWN A;  4PQ1 A;  4IHU A;  3FRC A;  2IPA A;  4YQM A;  1GLP A;  1JHB A;  5ECS A;  3HJM A;  4KH7 A;  1XWA A;  4TVE A;  2K6V A;  5CYY A;  1U6T A;  1XWK A;  2JAC A;  4MF6 A;  3GKN A;  1Z3E A;  5J9C A;  1I9D A;  2BJX A;  1SL0 B;  2DKI A;  4J56 E;  3KJY A;  5CRG A;  1O73 A;  2LQQ A;  5ECL B;  3GKM A;  2E7P A;  1K0A A;  4TOP A;  4L8E A;  4BWQ A;  4NHW A;  3GHA A;  4TR1 B;  1O8W A;  4JZQ A;  5C00 A;  1VF2 A;  1Z7P A;  5DAL A;  1A2J A;  18GS A;  5D9X A;  3M9K A;  3S9F A;  4F03 A;  3HHV A;  2G0F A;  4FIW A;  2M80 A;  1M3I A;  4YKF A;  5ID2 A;  2MMO A;  3HVV A;  2VAF A;  3UBK A;  3QAW A;  3HJO A;  4EIP A;  1DE1 A;  3EU3 A;  1GUK A;  5G1L A;  2JSZ A;  5ECI B;  2DJ1 A;  4K0N A;  2KUC A;  5CAX A;  3LXT A;  4RQX A;  4HI7 A;  1GSE A;  5G2Z A;  3C71 A;  3KP9 A;  2K8V A;  1WRY A;  2JL4 A;  2LKU A;  3R2Q A;  4OFN A;  3GX8 A;  13GS A;  2O87 A;  4MJE A;  3QPM A;  5G5E A;  4HZ2 A;  3F4T A;  3CXG A;  2DKH A;  1ZYQ B;  2GZY A;  2HRN A;  4N11 A;  2C3N A;  1U87 A;  3I9V 2;  5B7C A;  4ZL9 A;  1FG4 A;  1GP1 A;  2O8V B;  1OE7 A;  3D4M A;  2LRT A; 
#chains in the Genus database with same CATH homology
 1EWX A;  4USS A;  5A4V A;  2YOI A;  1FB6 A;  3GH6 A;  3ERW A;  3HCZ A;  2WJU A;  1H75 A;  1TKD B;  2H74 A;  1X5C A;  4TXV A;  2GGT A;  2VLT A;  2DJ0 A;  1XXU A;  3KTL A;  4EIQ A;  2TIR A;  1FVJ A;  1GSF A;  3FW2 A;  1U3A A;  4XS4 B;  2LST A;  2YPM A;  1X9W B;  1V9W A;  1XW9 A;  2V1M A;  1X9S B;  3ED3 A;  2YV7 A;  3TOT A;  3ZVJ A;  2PPT A;  3IA1 A;  3HD5 A;  2VL9 A;  4PX1 A;  4KND A;  1TRS A;  2H70 A;  3FKF A;  2B5Y A;  1B8X A;  3IE3 A;  3KH7 A;  3ME7 A;  1BQ7 A;  1WE0 A;  2M72 A;  2VCW A;  5F06 A;  2R3X A;  2YV9 A;  4IJ3 A;  1GWC A;  3UEM A;  1A2M A;  3CRU A;  3GUS A;  1G7O A;  3F8U A;  3PH9 A;  3QD9 A;  2E0Q A;  3FR6 A;  5G31 A;  1BAY A;  4ZL7 A;  1KEB A;  1NM3 A;  5HFI A;  4ML1 A;  2EC4 A;  5DAK A;  5D8I A;  1K0B A;  2I4A A;  1TOF A;  3DIE A;  2OE0 A;  2I3Y A;  3PR8 A;  3TOU A;  3F9U A;  3ZML A;  2ON5 A;  4I8B A;  5KOW A;  4ILF A;  3GKX A;  3LW9 A;  4KGI A;  3IBH A;  4IGJ A;  3HXS A;  2B5E A;  2NVL A;  4E8E A;  2QKE A;  3RBT A;  2OE1 A;  3ISO A;  4GSN A;  4HEA 2;  2IJY A;  3GTU B;  5GAP D;  2YP6 A;  4KDX A;  8GSS A;  1V58 A;  1YKA A;  1EOH A;  3KP8 A;  1GLQ A;  2H19 A;  3TKS A;  5CNW A;  4PUR A;  4EVM A;  3RHB A;  2LNT A;  1ZYP A;  3D0Z A;  4BVY A;  4ZB9 A;  4OO4 A;  2V41 A;  4TXO B;  4FYC A;  1R4W A;  4MJB A;  5D96 A;  4YAP A;  2VL3 A;  2A2P A;  2NBS A;  1GL8 A;  1DBY A;  3QCP A;  2L4C A;  3VWW A;  4O92 A;  4OO5 A;  4K0G A;  4TR4 A;  3VWV A;  1F6M C;  3EUR A;  4G0K A;  1ACV A;  4LMV A;  2YZU A;  3ZIV A;  5LD0 A;  3CTG A;  1G6W A;  3MAK A;  4YKG A;  1M0U A;  3WYW A;  1ERW A;  1KNG A;  1SEN A;  2L57 A;  1BYE A;  2FY6 A;  1A0F A;  3NOF A;  5FHI A;  1XW6 A;  1S3A A;  4YAV A;  5CP1 A;  2IWT A;  3GTU A;  1OC3 A;  3LJR A;  4ZBA A;  3VUR A;  5IMA A;  1B48 A;  4NAX A;  4QL7 A;  1WP0 A;  1M99 A;  4H86 A;  3HKR A;  3ZVJ D;  4TXO A;  3HDC A;  3WT2 A;  2FA4 A;  2X8H A;  4WF5 A;  3WGX A;  3RHC A;  3WD6 A;  3UIW A;  3GKK A;  3MYD A;  2ZCT A;  2MZC A;  1GTB A;  2B6M A;  3PIN A;  2OKA A;  1JLV A;  2L5L A;  10GS A;  4G9H A;  4FYU A;  5AGY A;  4OMV A;  5HFK A;  1Z9H A;  2LUS A;  2X99 A;  14GS A;  1I5G A;  3F63 A;  1K3Y A;  1MTC A;  2B7K A;  2VM1 A;  2GLR A;  5GST A;  12GS A;  1SJZ A;  3F6F A;  4JBB A;  5HFG A;  4XHM A;  1YEP A;  1G6Y A;  4ULX A;  1ZYE A;  4XTS A;  3GA4 A;  2PER A;  1KTE A;  3LQ7 A;  5DQY A;  5D9V A;  1EV4 A;  1OKD A;  1XOA A;  1T4Z A;  1EEJ A;  3D5J A;  2C0F A;  3HVS A;  3KCM A;  2L5O A;  2C0D A;  3L9S A;  2V2G A;  5J9B A;  2Z9S A;  4N0V A;  2VLV A;  1R5A A;  2N5B A;  3MNG A;  3LG6 A;  2GS3 A;  3IOS A;  4FO5 A;  3LSZ A;  2EIO A;  1X5E A;  1O6J A;  4WBJ A;  2DMM A;  1AQW A;  1O8X A;  3V1W A;  3TRQ A;  2FWE A;  2DSA A;  4KCE A;  5D93 A;  4BVX B;  2CAI A;  3DYR A;  1BG5 A;  3IHQ A;  2C3Q A;  2QGV A;  2ZNM A;  2L6D A;  2LS5 A;  1YEX A;  4IP1 A;  3MSZ A;  2PWJ A;  1WPI A;  3Q74 A;  4MPG A;  4PQI A;  1SD9 A;  2HSM A;  4N30 A;  3LEF A;  1IYH A;  2WZ9 A;  2X49 A;  3E3E A;  3QOU A;  2MMN A;  2VCZ A;  1WIK A;  4EE0 A;  4WR4 A;  2H0G A;  3M9J A;  5J5N A;  2EIQ A;  3A2W A;  4BPY A;  5HQP A;  3ZYW A;  4MJA A;  2A2S A;  2VM2 A;  3RDW A;  1DUG A;  3FZA A;  3TKS C;  19GS A;  2RUF A;  3P8W A;  1JZR A;  3L0H A;  1VF4 A;  3BOA A;  3HJP A;  4IBP A;  4DSQ A;  2CV4 A;  2LJA A;  1JZW A;  3DD3 A;  4AF2 A;  3TKP A;  1MEK A;  4HJ2 A;  3NZN A;  5A4U A;  1XWG A;  2VO4 A;  4V1A g;  2B7J A;  2FWH A;  4KDU A;  4RI7 A;  1F2E A;  3IPZ A;  4POM A;  3UJ1 A;  1VF1 A;  3D6I A;  1JLW A;  2OJL A;  3ZRE A;  3IC8 A;  3RPP A;  1GTI A;  1TDI A;  3GX0 A;  3CBU A;  1LJR A;  1ILO A;  4N0Z A;  3UOM A;  1GUL A;  2OA7 A;  1UN2 A;  2IMD A;  4L0U A;  2JZT A;  4OD7 A;  4LLR A;  4RQR A;  3L9U A;  4YH2 A;  5ID2 B;  1PA3 A;  3RAZ A;  1ERT A;  3KTB A;  1TJD A;  2PUK C;  4OWY A;  3G7Y A;  3VI7 A;  3FY7 A;  3C7M A;  3KGK A;  1FB0 A;  3DGQ A;  4HS1 A;  3A2X A;  2I9H A;  4FH8 A;  3ME8 A;  4KX4 A;  2C8U A;  5A5K A;  2X8G A;  2TRC P;  4ZB6 A;  2PMT A;  5KN2 A;  3A3T A;  4MF7 A;  1XFL A;  2FWG A;  1OC9 B;  1VGL A;  1ZGN A;  2N5F A;  3TUE A;  1GTU A;  2VCT A;  4NPB A;  1MDJ A;  1J9B A;  11GS A;  2VCV A;  1AIU A;  5ECN B;  3L9V A;  2KP2 A;  4EUY A;  3EMX A;  4Q5R A;  2C80 A;  3CSH A;  2EIR A;  7GSS A;  3QFB C;  1XIY A;  1XVQ A;  3F4S A;  3FZ9 A;  1R5P A;  3LXZ A;  2QA2 A;  1QFN A;  1TK8 B;  4HQS A;  4AGS A;  3TRX A;  2PU9 C;  1LBK A;  5J4U A;  2JZS A;  3PGT A;  4KF9 A;  1Z6N A;  1SL2 B;  5GZZ B;  1V2A A;  4K5R A;  5BRT A;  4WBR D;  5JWO B;  1O85 A;  5HR2 A;  2MBS A;  3F3R A;  1TRU A;  5DDL A;  2XC2 A;  2C3T A;  2NPB A;  3RPN A;  4Q5N A;  2KOK A;  2H6X A;  1T4Y A;  1M2D A;  4NMU A;  2AB6 A;  4NV5 A;  1UA5 A;  3LYP A;  3VK9 A;  4XS6 A;  4GQC A;  2ZUP A;  3IR4 A;  2WCI A;  3W8J A;  2FNO A;  3UVT A;  4MZW A;  3IK9 A;  4POK A;  4DSS A;  1TW9 A;  5ECP B;  4HJM A;  3APS A;  3HZ8 A;  3QR6 A;  2WUL A;  3VI5 A;  1TI3 A;  2H1A A;  1PN9 A;  3EC3 A;  5IPG A;  1OC9 A;  4O32 A;  4TKY A;  4ACS A;  3F4R A;  3GRX A;  3IK7 A;  1GSD A;  2GQM A;  5KN3 A;  3OR5 A;  2FCH A;  1PSQ A;  4WET A;  3KD0 A;  5JCU A;  1FO5 A;  4TRX A;  2GVP A;  3TKQ A;  2VD1 A;  3QDN A;  4DEJ A;  3GSS A;  2C1Y A;  2CVD A;  3G7I A;  4QL9 A;  2FGX A;  4V2N A;  3IC4 A;  3IAS 2;  4X4J A;  5JWR B;  4HZ4 A;  2HRK A;  4IKH A;  5IMD A;  3E0U A;  1YF1 A;  20GS A;  5DCH A;  4L5L A;  3C1S A;  4MP4 A;  3O76 A;  1SU9 A;  3C73 A;  5DBQ A;  3TJG A;  3FR9 A;  5DAK B;  5BMU A;  1K3L A;  1THO A;  2GSR A;  4ZL8 A;  4QQ7 A;  5DQS A;  3U6V A;  3VPT A;  3TJK A;  4KSM A;  2KLX A;  3VPQ A;  2HYX A;  4D73 A;  3VWU A;  1Q98 A;  5HR1 A;  1SL1 B;  3FZ5 A;  5JCG A;  2H01 A;  1O7U A;  2HFD A;  5DCG A;  2DC5 A;  1V98 A;  4ECI A;  4E8H A;  4O5R A;  1R7H A;  2XBQ A;  1XWB A;  2JSY A;  4IJI A;  2F3M A;  4BVY B;  4IEL A;  2H71 A;  3BBY A;  3BD2 A;  4EL1 A;  5B8B A;  2L6C A;  3APQ A;  4EDZ A;  1S3C A;  1B9Y C;  3ERG A;  2LTK A;  4Z7X A;  4PUA A;  3GV1 A;  1QMV A;  4ZIL A;  2H76 A;  1YQ1 A;  4OFT A;  1TTZ A;  2YZH A;  2XBI A;  3GIX A;  3FMW A;  6GSV A;  4GF0 A;  1YY7 A;  3N5O A;  1B4P A;  1SYX A;  2K18 A;  3AY8 A;  2F8F A;  2LRN A;  2WDU A;  3KEB A;  5ECK B;  2K8S A;  5B8A A;  4ISD A;  3DML A;  3W6G A;  2LRC A;  2NTO A;  2H0I A;  3G9B A;  4XIH A;  4J57 E;  4TN8 A;  4MNN A;  1TU8 A;  3KH9 A;  2V6K A;  4NWY A;  4IVF A;  4G0I A;  1WJK A;  2R4V A;  4A5P A;  1EGO A;  4FYB A;  5E59 A;  2R5G A;  5ABR A;  1F3B A;  1PX6 A;  4MK3 A;  5ECM B;  2YAN A;  1YKC A;  4LL4 B;  2VUP A;  3P2A A;  5DJM A;  5ECQ B;  2R0G A;  3ZRD A;  3TB2 A;  1QUW A;  2GTU A;  3TRP A;  2AV4 A;  1EP7 A;  1S3D A;  1XWC A;  2BMX A;  2RLI A;  1SYR A;  3Q6O A;  4XCS A;  2YWO A;  4AJ7 A;  4O7H A;  3GL3 A;  22GS A;  5CRE A;  3TKS E;  6GSW A;  3QFA C;  1FOH A;  1SJI A;  2DLX A;  2FUG 2;  4POL A;  5IOW A;  2C4J A;  1T7P B;  2O85 A;  6GSS A;  3CTF A;  1EGR A;  3CSI A;  1G7E A;  4HU9 A;  3IHG A;  1QXH A;  2JU5 A;  2H8L A;  3H4K A;  2BTO T;  4TW5 A;  2CX4 A;  1X0R A;  5IIZ A;  2IFQ A;  3IV4 A;  4AJ8 A;  4K1F A;  3C8E A;  4ML6 A;  2FA8 A;  4IQ1 A;  5AN1 A;  5J41 A;  4CHS A;  2CX3 A;  2B1K A;  2HNL A;  3K8N A;  5CRH A;  1ABA A;  3SBC A;  4EO3 A;  1OAZ A;  2YJH A;  5HR0 A;  1JZO A;  1GNW A;  2GSS A;  1M2A A;  5EL8 A;  1AUC A;  5IM9 A;  4I5Q A;  5GSS A;  4K2D A;  4WKW A;  4NHZ A;  2HRA A;  1TU7 A;  2P5Q A;  4KA0 A;  4G0L A;  1XW5 A;  3IAM 2;  1X9M B;  2X64 A;  2AUV A;  4L5O A;  4WF4 A;  4KCA A;  2IL3 A;  1SKR B;  2B1L A;  2CAQ A;  3HYP A;  4K9Z A;  1VF3 A;  3UL3 A;  1HNA A;  2QC7 A;  1PGT A;  2IMK A;  2H6Z A;  2CVK A;  1Y6E A;  5CRW A;  1FAA A;  2CVB A;  1FW1 A;  2K9F A;  4I6X A;  3QAG A;  2H73 A;  5AIV A;  3L78 A;  1TRW A;  1F3A A;  5D9T A;  3D22 A;  3US3 A;  1K0N A;  1KBN A;  1THX A;  2LJK A;  5KN0 A;  5F0G A;  2VOC A;  1MD3 A;  2LNS A;  4F9Z A;  3MIX A;  1A8L A;  1XPV A;  1K3O A;  1Z6M A;  2XPE A;  9GSS A;  1XOB A;  1VRS D;  2MYG A;  2G2Q A;  1ERU A;  1LU4 A;  2IIY A;  2XHF A;  3HVX A;  2RM5 A;  4GTU A;  2ES7 A;  2OBI A;  1Z5Y E;  4GRF A;  1O81 A;  2CT6 A;  4MCU A;  2HSY A;  2V6O A;  4JR6 A;  1SK2 A;  6GSU A;  2R37 A;  2AHE A;  4XRA A;  2YCD A;  5CRD A;  3EWL A;  1SKW B;  3M8N A;  3I43 A;  1WMJ A;  2DJ3 A;  4K7O A;  3J7Y k;  5KOX A;  3TJB A;  4PGT A;  2H72 A;  2H1G A;  3I6A A;  2HT9 A;  5HR3 A;  5G1K A;  4LL1 B;  3LGC A;  1W4V A;  3DVX A;  3O6T A;  2IMI A;  1T3B A;  4K6X A;  3M0F A;  3TCO A;  4GST A;  2P5R A;  2DIZ A;  4V1A p;  4ZIJ A;  17GS A;  3ZL5 A;  3UAP A;  2LEG A;  3SWL A;  5ECH B;  6GSY A;  2GDR A;  4KE3 A;  1OC8 A;  2R6K A;  2VD0 A;  1EZK A;  2M46 A;  1XBS A;  3QMX A;  2KP1 A;  3GL5 A;  4DSS B;  1TXX A;  4XRD A;  2LJR A;  2RM6 A;  4EXJ A;  2HZE B;  1H4O A;  5ELG A;  1NW2 A;  3CSJ A;  1BJX A;  1B9X C;  2XPD A;  4POB A;  2REM A;  1URM A;  3F6D A;  3TDG A;  1AQX A;  1K0C A;  2DJ2 A;  1ZZY A;  4HOJ A;  3TKR A;  5JCW A;  4KUN A;  2X8C A;  2YNX A;  3ZLP A;  2H75 A;  2VCQ A;  5KN1 A;  3MDK A;  1PD2 1;  2H1B A;  4KB3 A;  2YJ7 A;  3CYN A;  4NXI A;  5FWG A;  4KW6 A;  6GSX A;  4F82 A;  1TP9 A;  2FLS A;  3A5W A;  4I2T A;  2LV3 A;  3PPU A;  3HA9 A;  2P31 A;  3KZQ A;  2VIM A;  2PVO C;  2X4A A;  2IN3 A;  1E6B A;  1GSY A;  5AIS A;  4I2U A;  4D73 B;  1TK0 B;  4BL7 B;  1FHE A;  1ZMA A;  2QA1 A;  3UVH A;  1PKW A;  1ZL9 A;  1NHY A;  3H8Q A;  2VCX A;  5ECO B;  4KAE A;  4PUF C;  2JAD A;  2HZE A;  3L4N A;  4I97 A;  2OAC A;  4ZB8 A;  1MD4 A;  2RII A;  3CRT A;  4OCF A;  2GZZ A;  2WS2 A;  3UBL A;  4GSS A;  4PTS A;  5G5F A;  3KM6 A;  1FOV A;  1HNB A;  4ICY A;  2UZ8 A;  1DE2 A;  3IXR A;  5A4W A;  1JFU A;  2R0C A;  4BWS A;  4G19 A;  3EMP A;  1PKZ A;  3TJF A;  5E4W A;  1JZD A;  3UMA A;  1PMT A;  2DJJ A;  2FD3 A;  4ECC A;  4MMM A;  4IS0 A;  2J23 A;  1QGV A;  3O3T A;  1K0M A;  5G30 A;  4F0B A;  3GYK A;  3R3E A;  1HNC A;  3HZ4 A;  5IMC A;  1M9B A;  2YWI A;  2VL2 C;  1AQV A;  2L4Q A;  1EEM A;  3WGD A;  4CY6 A;  1XZO A;  1T8E B;  4PNF A;  5FT3 A;  4OCE A;  1SK0 A;  4TR1 A;  5IOX A;  3H79 A;  4IN0 A;  2C0E A;  1X5D A;  4BL7 A;  1MDK A;  1GH2 A;  1UVZ A;  3DRN A;  4ZXG A;  2RUE A;  4MLY A;  2HLS A;  2NDO A;  4JED A;  3ZZX A;  1T1V A;  2AJQ B;  3GFK A;  4Q5F A;  1J08 A;  1GSS A;  2IMF A;  2CA8 A;  1C72 A;  4K7N A;  4L0W A;  5B6M A;  4V2L A;  5DJL A;  2A2R A;  2O7K A;  3E9J B;  3EYT A;  1NHO A;  3DKS A;  4IW9 A;  4IP6 A;  3FZ4 A;  1TI1 A;  3H93 A;  3LYK A;  4MZC A;  2B3S A;  5EY6 A;  4XS1 A;  5D9W A;  2CZ2 A;  4CY8 A;  1OE8 A;  1ZYN A;  2H66 A;  4X0X A;  2QSI A;  3LOR A;  2OAD A;  2DBC A;  1PQN A;  3LWA A;  1A24 A;  2YWM A;  4K7I A;  4GXZ A;  1GUM A;  3TGZ A;  3GNJ A;  5IPH A;  1IYI A;  1ST9 A;  3WGE A;  5COH A;  4Q5Q A;  2FHE A;  1U3I A;  1EV9 A;  1M7T A;  3G7J A;  1GRX A;  3FYG A;  1V40 A;  1GSQ A;  3Q19 A;  1A23 A;  2JZR A;  4ID0 A;  4ZBD A;  4F2I A;  2H0H A;  5LNK e;  1EOG A;  1GTA A;  5IO2 A;  3W8S A;  1OKT A;  1AC1 A;  1Q4J A;  4GWR A;  5F05 A;  2CQ9 A;  2F8A A;  4XS4 A;  3P90 A;  1CQH A;  3GMF A;  3ZFL A;  4GLT A;  4IQA A;  1A8Y A;  1ZCP A;  4LA1 A;  2L59 A;  4ECB A;  4HDE A;  4EDY A;  1FVK A;  2GSQ A;  5KEJ A;  2IFQ B;  3F3Q A;  4DSR A;  2C0G A;  3HY2 A;  2P0G A;  2GZP A;  2HZF A;  1RK4 A;  3ERF A;  4RUV A;  3VFI A;  5H5Q A;  4GCI A;  3IRA A;  16GS A;  4ECJ A;  1BX9 A;  2DIY A;  3C1R A;  2F9S A;  2MMZ A;  3APO A;  2V32 A;  5F8B A;  3A5I A;  4NV2 A;  1TRV A;  4WR5 A;  1ML6 A;  4LMW A;  4JR4 A;  3BJ5 A;  3CMI A;  2HI7 A;  1PL2 A;  4X1U A;  1GSU A;  3M1G A;  1N8J A;  1PL1 A;  1SKS B;  1F37 A;  1ERV A;  2AAW A;  4MJC A;  2PN8 A;  3EVI A;  3ZMK A;  3DXB A;  2N5A A;  3P7X A;  3EPT A;  2MBT A;  2ON7 A;  2E2G A;  4K8M A;  2A4H A;  2B5X A;  4TR3 A;  1ZOF A;  2WB9 A;  3UAR A;  1OVN A;  3EIN A;  5J3R A;  3KXO A;  1F9M A;  4G2E A;  4WXT A;  5ECR B;  3GN3 A;  1OYJ A;  2H30 A;  1G0T A;  5LCZ A;  5DVB A;  2DJK A;  4Z2R A;  2H6Y A;  1AAZ A;  3ZFB A;  2J9H A;  1K0O A;  2HE3 A;  3VLN A;  1PN0 A;  4JRR A;  1NSW A;  2GQK A;  3F0I A;  1GNE A;  5INY A;  3ZTL A;  1XCC A;  1RW1 A;  3LFL A;  3M3M A;  4CW9 A;  5IMV A;  5D73 A;  2PGT A;  3MWH A;  5CO3 A;  2HRF A;  3U5R E;  4JU5 A;  1CQG A;  4X43 A;  4PQH A;  4KSO A;  1BED A;  2WRT A;  2GT5 A;  4RI6 A;  3I69 A;  1TK5 B;  2VLU A;  1SK1 A;  6GST A;  3J7Y b;  2TRX A;  1PRX A;  2WFC A;  3A2V A;  1HD2 A;  3EE2 A;  3DVW A;  3Q18 A;  3FK8 A;  5F07 A;  4CDO A;  4PNG A;  1R26 A;  1Z7R A;  4HUA A;  2I81 A;  5ENU A;  5IMF A;  4YQV A;  2CZ3 A;  4HU7 A;  4MZB A;  1Y25 A;  4ZBB A;  1XVW A;  2D2Z A;  3FHK A;  3FR3 A;  3EU4 A;  2LQO A;  5IQY A;  1A0R P;  5IO0 A;  2GT6 A;  3GH9 A;  2OBK A;  1T00 A;  1J0F A;  1E2Y A;  4O5Q A;  1U88 A;  2I1U A;  2HSH A;  4MH3 A;  1SD8 A;  3ZIT A;  2KHP A;  3KMN A;  3KIJ A;  2F51 A;  4Z2U A;  3JCM L;  1YDK A;  4EC0 A;  1USB A;  1HQO A;  4MDC A;  1N2A A;  4MA9 A;  2VL2 A;  3BCI A;  1UC7 A;  4MH2 A;  5IMZ A;  4EF0 A;  1V57 A;  5C04 A;  2WGR A;  2GST A;  3DEX A;  1DSB A;  4K5S A;  4K2X A;  1MDI A;  2PVQ A;  2YN1 A;  1QQ2 A;  4YQU A;  2OE3 A;  2R2J A;  1QK8 A;  1W89 A;  4Z2T A;  1M2B A;  3BCK A;  4EKZ A;  4FQU A;  5EVO A;  5GAN D;  5H5R A;  5AIX A;  2H1D A;  2GQL A;  4N10 A;  4MAB A;  3VWX A;  3D4T A;  1WWJ A;  4V2M A;  4BVX A;  5ELA A;  1A2L A;  3D21 A;  4F0C A;  1PX7 A;  1AXD A;  3TJJ A;  3ZIJ A;  4MF5 A;  1EP8 A;  1AW9 A;  2IME A;  2R0P A;  1RQM A;  3WT1 A;  2PBJ A;  3DWV A;  3H1N A;  1ON4 A;  3NIV A;  3GST A;  5L71 A;  2FWF A;  3FEU A;  4OFM A;  1B4Q A;  5B6N A;  4P3Y B;  4KDY A;  5DAL B;  5EPF A;  5JWQ B;  4HQZ A;  4PXO A;  4BA7 A;  4MPF A;  2DML A;  1YJ6 A;  3GUR A;  4O5U A;  4WEY A;  4AJ6 A;  2E2M A;  3IDV A;  1K0D A;  1WOU A;  2AYT A;  3KMO A;  2A4V A;  4DVC A;  4G10 A;  1HYU A;  4JE1 A;  3QAV A;  5H5S A;  1M9A A;  2ALB A;  4TR0 A;  4GQF A;  2HXK A;  1SJ6 A;  1GUH A;  4J2F A;  2MMA A;  3N9J A;  1YF0 A;  2O89 A;  1YZX A;  2YWN A;  4PQ1 A;  4IHU A;  3FRC A;  2IPA A;  4YQM A;  1GLP A;  1JHB A;  5ECS A;  3HJM A;  4KH7 A;  1XWA A;  4TVE A;  2K6V A;  5CYY A;  1U6T A;  1XWK A;  2JAC A;  4MF6 A;  3GKN A;  1Z3E A;  5J9C A;  1I9D A;  2BJX A;  1SL0 B;  2DKI A;  4J56 E;  3KJY A;  5CRG A;  1O73 A;  2LQQ A;  5ECL B;  3GKM A;  2E7P A;  1K0A A;  4TOP A;  4L8E A;  4BWQ A;  4NHW A;  3GHA A;  4TR1 B;  1O8W A;  4JZQ A;  5C00 A;  1VF2 A;  1Z7P A;  5DAL A;  1A2J A;  18GS A;  5D9X A;  3M9K A;  3S9F A;  4F03 A;  3HHV A;  2G0F A;  4FIW A;  2M80 A;  4YKF A;  5ID2 A;  2MMO A;  3HVV A;  2VAF A;  3UBK A;  3QAW A;  3HJO A;  4EIP A;  1DE1 A;  3EU3 A;  1GUK A;  5G1L A;  2JSZ A;  5ECI B;  2DJ1 A;  4K0N A;  2KUC A;  5CAX A;  3LXT A;  4RQX A;  4HI7 A;  1GSE A;  5G2Z A;  3C71 A;  3KP9 A;  2K8V A;  1WRY A;  2JL4 A;  2LKU A;  3R2Q A;  4OFN A;  3GX8 A;  13GS A;  2O87 A;  4MJE A;  3QPM A;  5G5E A;  4HZ2 A;  3F4T A;  3CXG A;  2DKH A;  1ZYQ B;  2GZY A;  2HRN A;  4N11 A;  2C3N A;  1U87 A;  3I9V 2;  5B7C A;  4ZL9 A;  1FG4 A;  1GP1 A;  2O8V B;  1OE7 A;  3D4M A;  2LRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...