5HFIA

Cytosolic disulfide reductase dsbm from pseudomonas aeruginosa with gsh
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
210
structure length
202
Chain Sequence
LTLHYLYDPLCGWCYGASPLLAAACEVTGLDVRLHGGGMMTQPVGAGLRHMPHDLRIAQLTGQPFGKDYFDGLLRDTSAVFDSAPPTAAVLAAEALDGLGAAMLARIQRAHYVEGRRIAERPVLLELGAELGLGEGFAEAFDACSGEPLRAHFADSRRLMNRLGAAGFPTFALERRLQVLDTGRYLGQPDDWRAFLETQLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Uncharacterized protein, cytosolic disulfide reductase DsbM
publication title Crystal structures of the disulfide reductase DsbM from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
total genus 69
structure length 202
sequence length 210
ec nomenclature
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5hfiA00
3EC3A 3H93A 4TR0A 2EIOA 4EDZA 3KJYA 1Z9HA 2R2JA 3IDVA 5JCWA 2IFQB 1TJDA 4MCUA 2AYTA 2C0EA 5FT3A 4OO5A 1A0RP 1QK8A 4GTUA 1ZCPA 3FZAA 4GSNA 5F05A 1QUWA 2LNSA 2M80A 5AIVA 1YY7A 3SBCA 1MTCA 2F3MA 2OBIA 1PKZA 1PKWA 2H30A 1MD3A 3IXRA 2K8VA 3D21A 3DXBA 10GSA 1K0CA 4WBJA 3Q74A 3EINA 3TB2A 2AV4A 3FW2A 4FO5A 1M2DA 2K6VA 3GA4A 4ZIJA 2JADA 3KP9A 2P5RA 4XS6A 2C0DA 1GUHA 1WRYA 2GSQA 3C1SA 4LMVA 2HZFA 2LJKA 4V1Ap 5ECQB 1WMJA 2OBKA 1KNGA 3VFIA 4O5RA 4JR4A 2WULA 3TOUA 2L59A 3ZYWA 1UVZA 1PRXA 1XPVA 4POBA 3CXGA 5CRGA 2PWJA 4KDYA 5CAXA 5G30A 1ACVA 1CQGA 3ZREA 4MJEA 2MMOA 1YEPA 3F3QA 2OKAA 3UL3A 2IMKA 1BEDA 3F4TA 4HZ4A 2FGXA 5F06A 3M1GA 3C1RA 4XS1A 1M9BA 1X5DA 2L5LA 4HDEA 4IN0A 1SKWB 2C0FA 5IM9A 3ERFA 2N5AA 2IWTA 4WETA 4ID0A 1FVKA 4ZBBA 4FH8A 1THXA 1SENA 3GKNA 4GRFA 4MF5A 1TDIA 4G2EA 2DMLA 1A23A 2MMNA 4IP6A 3H1NA 2A4VA 2GVPA 1W89A 4QQ7A 2H0IA 3TJBA 2X8GA 1G6YA 3TKQA 1VRSD 2GQMA 2HRFA 5D9TA 2I9HA 2C3QA 3GN3A 2YZUA 1HYUA 4I8BA 1X5EA 5DJMA 3HDCA 3LXZA 4E8HA 2VL3A 2EIQA 4IP1A 1NW2A 3G9BA 4DSSA 3DWVA 3S9FA 3LEFA 1BJXA 1AW9A 4TKYA 4EVMA 1V98A 2LEGA 2O8VB 4RQXA 4MJCA 2FA4A 5DJLA 5JCUA 3A2WA 4PNGA 5AN1A 3ZIVA 1ERWA 2JZSA 4EKZA 1ABAA 3N9JA 3RHBA 4EUYA 4PXOA 3TKSA 1F9MA 2RM6A 1BYEA 4F2IA 4L8EA 2QC7A 3HJPA 1VF4A 2LUSA 1O85A 1OKTA 3LWAA 3IPZA 2CX3A 1X9MB 4TR1B 4IJIA 1OE7A 5IMCA 1N8JA 1GNEA 1JZRA 4XHMA 3IA1A 2C4JA 3EYTA 2QKEA 5GAND 6GSWA 3HD5A 1TTZA 3H4KA 3ZMKA 2FLSA 2H0HA 2H66A 3KEBA 4POMA 3UJ1A 2LRTA 18GSA 3FK8A 2L6CA 4ZB9A 4CW9A 3FHKA 3VWWA 3ME7A 2YOIA 2C80A 2VM2A 3OR5A 3IC4A 1XVQA 3MSZA 2EIRA 2V41A 4QL7A 3I9V2 3RDWA 3F4RA 2VO4A 4OFTA 2E2GA 5G5FA 20GSA 1PN9A 2ZUPA 3LQ7A 4EO3A 3GMFA 2E7PA 1H4OA 5F07A 2IIYA 3GUSA 5G31A 4K2DA 3IRAA 4MP4A 2H73A 1UA5A 2H72A 5J4UA 2H1BA 3UVTA 3BCKA 2KLXA 3VURA 4IVFA 2KP2A 4X1UA 5CP1A 4IBPA 1ON4A 2O89A 4K8MA 1K0OA 2YWIA 1Z5YE 4YQUA 3PINA 4AF2A 2DJ3A 2TRCP 1X5CA 3D4MA 3WT2A 1SU9A 5EY6A 2PPTA 1ZL9A 4PUAA 5ECIB 3CMIA 1T8EB 3TCOA 2VCTA 2REMA 4F0CA 2MBTA 3DGQA 5ID2B 17GSA 3CYNA 1IYIA 3C8EA 4JBBA 5GAPD 4ISDA 3HCZA 3BD2A 1TK8B 1AQWA 4OMVA 4I97A 3GHAA 3TKSC 3RBTA 3BOAA 2PBJA 1FVJA 1SD8A 4EDYA 5CNWA 3H79A 4JEDA 4F03A 3L9UA 3QPMA 1O7UA 1GP1A 4ML1A 1O8XA 3MAKA 2CV4A 3APOA 1F37A 4HU9A 2YCDA 2V1MA 5H5SA 2XPDA 1A0FA 5JWRB 4XTSA 3F9UA 3GSSA 4BVYA 1XWBA 3H8QA 3ERGA 1S3AA 4WBRD 1B8XA 4FYCA 1VGLA 2XBIA 3M9KA 4PQHA 5ELGA 1EGRA 2DJ1A 5EPFA 3P8WA 4L5OA 3F8UA 2CVBA 5INYA 4N0VA 4V2NA 3HZ8A 1GTUA 2H8LA 3Q6OA 4LL4B 4OO4A 3VK9A 3IAS2 3PH9A 1Z7RA 1M99A 2FHEA 4MH3A 1V40A 2YV9A 4NPBA 3GL3A 1GTIA 1I9DA 1K0DA 3I6AA 2KP1A 3KMNA 4I6XA 3GX0A 1GSQA 4NV2A 3KH9A 3QMXA 4TR4A 1YEXA 1TK0B 3CRTA 3ZFLA 5D9WA 2YJ7A 2WJUA 1R5PA 1RQMA 4KX4A 2IMDA 3GKMA 1AQXA 5A4WA 6GSXA 2H1GA 1YJ6A 4OCFA 4NHZA 1YF0A 3KCMA 2NPBA 3F4SA 4PQIA 2E0QA 4KB3A 2GSTA 1DSBA 1QQ2A 1U88A 2B1KA 5IO0A 4J56E 1CQHA 5A5KA 5E59A 2GT5A 2VCVA 3WYWA 3GX8A 2HI7A 4NAXA 1GSYA 2F8FA 4YQMA 1DBYA 1WIKA 3QFBC 2HNLA 2VUPA 4EXJA 4G10A 4BL7A 2HT9A 4V2MA 4ZILA 2HZEA 3EMXA 5ECPB 4BVXA 4PURA 3VLNA 3D4TA 2WRTA 5B6MA 4ZB6A 5DQSA 5HQPA 1SL0B 6GSYA 4AGSA 3TRXA 1DE2A 2I1UA 5JWQB 1JZOA 2I81A 4MH2A 3VWVA 2MZCA 1LJRA 4WR5A 1OAZA 1JLVA 2GS3A 2HRNA 4NMUA 1N2AA 2WDUA 1K0AA 3A2XA 1V9WA 1OE8A 2Z9SA 3I43A 1WP0A 1TXXA 2P5QA 4Q5RA 5IMDA 3AY8A 3TKPA 1B4PA 1U6TA 4AJ6A 4NXIA 2ON5A 1WOUA 4WR4A 3HY2A 3KTBA 1PD21 4IHUA 2DBCA 2O7KA 2V6KA 4WF5A 2N5FA 3ZRDA 2F51A 1F2EA 1TRVA 1RK4A 3MDKA 4KAEA 22GSA 1URMA 3GSTA 4NV5A 1OC9B 3LFLA 3IK7A 3CRUA 4G9HA 2WB9A 2QGVA 3LXTA 5DAKA 3TUEA 5IPGA 1ZZYA 1BQ7A 2F9SA 3O6TA 2X8HA 4PX1A 3FZ5A 1SJ6A 1J0FA 1TRSA 1I5GA 6GSSA 1E6BA 1O73A 3GV1A 4GSTA 1TKDB 3M3MA 2YNXA 1VF3A 4ZL9A 2K18A 3M0FA 2DIZA 1FG4A 8GSSA 5FHIA 5HFIA 4TXOB 5H5QA 1SKRB 3BJ5A 4HI7A 3F63A 11GSA 4BA7A 2DJ0A 2FWHA 2JZRA 1TW9A 2LV3A 2MMAA 4F82A 5IO2A 1G7EA 5IIZA 2OACA 5HR2A 4XS4B 4OWYA 5J41A 4MF7A 4HQSA 1G6WA 3UOMA 1SYXA 3QOUA 2OE1A 1JZDA 4OFMA 3LYKA 1XIYA 1GTAA 2NTOA 1GSDA 5AIXA 1O81A 3WT1A 3HVSA 2HFDA 4JU5A 4JZQA 3APQA 2H6ZA 3GTUB 3L78A 3ME8A 2DJKA 2RIIA 2L4CA 3WGXA 3HVVA 5H5RA 5COHA 4ULXA 2B5EA 6GSUA 1XOAA 2FY6A 4L0UA 4MZCA 1FAAA 5C04A 1TRUA 1JLWA 1AXDA 1LU4A 3O3TA 1SK1A 1V58A 5ECMB 5LD0A 1GH2A 1U3AA 2VCWA 1AC1A 3KH7A 1EOHA 5EL8A 3HYPA 4K0NA 4LLRA 1YKCA 2DSAA 3FR3A 4GQCA 4IKHA 5D9VA 4EF0A 2PU9C 3TJFA 1GULA 4POLA 2P31A 2EC4A 2IFQA 2H1AA 2VL2A 5DVBA 1QGVA 5ECLB 1WE0A 4V2LA 1VF1A 3A5WA 3GNJA 5FWGA 3VWUA 5ELAA 4K7OA 2JSYA 3GH6A 1ERVA 4HUAA 1XWAA 1FOVA 2ZNMA 4YQVA 4O7HA 3CBUA 3C73A 3A2VA 1C72A 3L0HA 3VPQA 1A2MA 3DVXA 1XWCA 1FO5A 2PGTA 1SYRA 2XC2A 3HJOA 1T1VA 2I3YA 1HNBA 1WWJA 5KN0A 1EOGA 1OVNA 3K8NA 12GSA 1EEMA 1XWGA 4PGTA 4P3YB 5IMFA 2LTKA 4MLYA 2L6DA 1F6MC 2RLIA 2A2RA 5IQYA 1TI3A 1EV4A 1XW6A 1XZOA 4GCIA 1NHOA 1SL2B 5ABRA 1QXHA 1O8WA 4TVEA 3TGZA 3ZFBA 5DCGA 3W8JA 1SL1B 2L57A 3UAPA 4MDCA 1TP9A 1ZYEA 3A3TA 1TU8A 4RQRA 1HNCA 3CTGA 2MMZA 1F3AA 3HHVA 4MPFA 3KTLA 6GSTA 1KTEA 3FZ4A 1V57A 3G7YA 1XVWA 4HZ2A 2CVDA 2B7KA 3FYGA 5GZZB 3QD9A 4MA9A 3IAM2 2GSSA 3FEUA 5DALB 4ECIA 3GKXA 1T4YA 3ZITA 4ZL7A 3P90A 4ZL8A 4Q5NA 4D73B 2R3XA 1B4QA 3HKRA 1EP7A 4IJ3A 1WJKA 5D73A 4N10A 1PL2A 3LYPA 4IS0A 4TW5A 1AIUA 1SK0A 5ECNB 4Z7XA 1GSSA 4BPYA 3L4NA 1JFUA 2H19A 3FRCA 1Z7PA 4OFNA 1YKAA 3UEMA 3ZZXA 3W6GA 2DC5A 4N0ZA 3QCPA 2M46A 14GSA 5B6NA 3KIJA 2VL2C 5JCGA 5KN1A 3GRXA 4EE0A 2B5YA 1HNAA 1XBSA 5ENUA 5HFKA 3TRQA 1G0TA 3Q19A 3D22A 4ZBDA 3ERWA 1GNWA 1GL8A 1MDIA 1J08A 2CA8A 3US3A 5ECSA 2LQQA 3RAZA 2O87A 3FKFA 1Q98A 4KA0A 3UBLA 3Q18A 1X0RA 4HQZA 2IJYA 2FWGA 4K1FA 3F6DA 5KEJA 4XRAA 2X99A 4ZXGA 3EWLA 3BBYA 3CTFA 4KSOA 3L9VA 1RW1A 2TRXA 4KNDA 2AUVA 1MDJA 5CRWA 1R4WA 1FW1A 5IMVA 2AHEA 3FZ9A 1U3IA 1XW5A 4TR1A 3JCML 1FB0A 3KGKA 2K8SA 3VWXA 2GSRA 5CREA 2G2QA 3EU4A 5G1KA 4KCAA 1EGOA 2CT6A 2PERA 3CSIA 1BG5A 3DEXA 3QR6A 1TK5B 2MBSA 4HEA2 1F3BA 4GQFA 3LJRA 1LBKA 1X9SB 1XOBA 1PGTA 3DYRA 1M0UA 3EURA 1X9WB 3LORA 2JL4A 1GSEA 9GSSA 4NHWA 1O6JA 3M8NA 5HFGA 2VOCA 2O85A 3RPNA 3L9SA 1MDKA 3UARA 4J57E 1Z3EA 5ECRB 1PA3A 1SD9A 1TRWA 5D93A 3TDGA 3G7JA 3TJKA 2NBSA 1NHYA 4X43A 1M2AA 3IV4A 5G5EA 3IE3A 3KZQA 3KD0A 3WGDA 5C00A 1AAZA 5B8AA 1GWCA 2L4QA 4L0WA 2DMMA 5CRDA 1Y6EA 2VIMA 3E0UA 3IK9A 1BAYA 1XXUA 5G1LA 2B6MA 2YWMA 2LRNA 5D9XA 2C0GA 5B8BA 4TXVA 5B7CA 1T7PB 1JHBA 4DSSB 2X8CA 1TI1A 3IBHA 4MK3A 2WS2A 2GDRA 2FCHA 1OYJA 3TOTA 5ECOB 5DQYA 2VCZA 1VF2A 3HXSA 4CHSA 1W4VA 1SJIA 3CSJA 4JR6A 1B9XC 1EWXA 2YN1A 1PMTA 1MD4A 2D2ZA 1B9YC 5J5NA 2FA8A 3ZL5A 1XCCA 2KOKA 2H1DA 2VLTA 3ED3A 2J9HA 5ID2A 2VLVA 3P7XA 2F8AA 5DCHA 1ZGNA 3GL5A 4OCEA 2LJAA 4DEJA 2GTUA 4KSMA 2IMEA 2PN8A 4H86A 2ES7A 4BWQA 4QL9A 3KMOA 2GZPA 2N5BA 1YDKA 1GSFA 2RM5A 4O92A 4OD7A 3DRNA 1S3CA 2DJJA 4I2TA 4Q5FA 5HR1A 3E9JB 2B7JA 2YPMA 5IOWA 1AQVA 2HXKA 3UBKA 2CAIA 2H0GA 5JWOB 5AGYA 2DLXA 1THOA 4BWSA 5IOXA 4AJ8A 2C1YA 2JU5A 3VI5A 4L5LA 2I4AA 4ECBA 3MWHA 2GGTA 3VI7A 3IHQA 4MABA 4RUVA 3C71A 4DSRA 2HYXA 2PVQA 4IQAA 2PMTA 3EE2A 1PL1A 1OC8A 2IL3A 1GUKA 3U6VA 1HQOA 5AISA 2JZTA 4ECJA 2V6OA 2HLSA 3PGTA 4LMWA 1XWKA 1K0BA 4MJAA 2MYGA 2HE3A 2IPAA 4KE3A 2J23A 2B5XA 2FNOA 5G2ZA 2YANA 4RI6A 1EEJA 2BJXA 2NDOA 2YWNA 1R26A 1K0NA 2XHFA 4MJBA 5LNKe 2CAQA 1T4ZA 2K9FA 4JRRA 4ML6A 2BTOT 6GSVA 4KCEA 5DBQA 5EVOA 1SKSB 4ZB8A 4K9ZA 1E2YA 3IR4A 2H01A 2X64A 2CVKA 3C7MA 3QAWA 4CDOA 4FYUA 1B48A 5ECKB 5F0GA 3LGCA 2RUFA 2GT6A 1PX7A 2R6KA 4HJ2A 2V2GA 4TN8A 2H75A 4HOJA 3KXOA 4MPGA 2VM1A 1PX6A 4LL1B 4DVCA 3PR8A 4HJMA 1UN2A 2FWEA 2QSIA 4FYBA 2GQLA 4NWYA 1M9AA 2BMXA 3RPPA 2TIRA 2OE3A 2H70A 4KH7A 1A2LA 4WKWA 1PSQA 3CSHA 4N30A 2V32A 4TR3A 4PQ1A 2PUKC 4MF6A 2OJLA 1ZYQB 1GLQA 1ERUA 2YP6A 4I5QA 2M72A 3GURA 4F0BA 4J2FA 2VLUA 3D5JA 13GSA 1GUMA 2YJHA 1QMVA 2R5GA 2OE0A 1K0MA 5CYYA 2A2SA 2B3SA 4GLTA 2VAFA 3NIVA 4XIHA 3E3EA 4WEYA 1KEBA 1V2AA 3J7Yb 1FB6A 1OKDA 5HR3A 2YWOA 2DIYA 1J9BA 4FIWA 3APSA 1R5AA 3HZ4A 5D96A 5E4WA 5IMZA 2LJRA 1A24A 4WXTA 2H76A 5KN2A 3WD6A 4EL1A 2IN3A 7GSSA 2LQOA 2JSZA 1OC9A 1YZXA 2XPEA 1NSWA 1T00A 4AJ7A 2AAWA 2VCXA 3ZIJA 1TOFA 5D8IA 4KGIA 3F0IA 2L5OA 3GKKA 1ILOA 5F8BA 4O32A 5GSSA 3GIXA 1FHEA 1XFLA 4DSQA 3NZNA 2AB6A 2GZYA 2PVOC 2FD3A 3TJJA 4ECCA 1R7HA 5A4VA 1M2BA 3TJGA 5J9BA 4I2UA 4TXOA 5HR0A 3QFAC 1KBNA 1A2JA 1NM3A 1GLPA 3R2QA 1PQNA 3FR6A 3KM6A 4GXZA 4TOPA 4HU7A 3GFKA 4Q5QA 2LKUA 4K7IA 1TU7A 3DVWA 1EZKA 3FY7A 2C8UA 4XS4A 2HZEB 3I69A 2G0FA 4KW6A 2GQKA 2YZHA 2WFCA 4MZWA 3RHCA 3J7Yk 1IYHA 3ISOA 5LCZA 3V1WA 4GWRA 4POKA 2HSYA 2OA7A 4GSSA 3KP8A 4IGJA 3QAGA 2XBQA 2R4VA 3MNGA 2LS5A 2LNTA 3GYKA 3GTUA 3TKSE 2CX4A 3HA9A 3M9JA 5J9CA 3UIWA 2P0GA 3D0ZA 4F9ZA 3U5RE 3EMPA 5IPHA 4RI7A 3F3RA 4HS1A 3D6IA 1ML6A 4JE1A 2E2MA 2YV7A 3VPTA 2LSTA 3QDNA 2LRCA 19GSA 1Y25A 1DE1A 3GH9A 2IMIA 1SK2A 5J3RA 5GSTA 3FR9A 3P2AA 4PUFC 5CO3A 16GSA 1ZMAA 2RUEA 4K0GA 1S3DA 1Z6MA 4GF0A 4ACSA 1Q4JA 3ZLPA 2C3NA 5A4UA 2WGRA 2R37A 3W8SA 3TRPA 4K7NA 3O76A 4WF4A 1GTBA 5DAKB 2ALBA 4ILFA 3G7IA 4EC0A 4G19A 3LSZA 2B1LA 4YAPA 2WZ9A 4N11A 4E8EA 3NOFA 4IQ1A 4MMMA 3UVHA 3EVIA 3UMAA 3ZMLA 2H74A 4KUNA 1ERTA 1DUGA 3F6FA 2ZCTA 1T3BA 3ZTLA 5IMAA 1GSUA 4KDUA 3SWLA 3N5OA 1AUCA 2NVLA 5KN3A 5ECHB 2C3TA 3QAVA 4TRXA 2DJ2A 1EV9A 4K6XA 3ZVJA 1K3LA 1A8LA 1K3YA 1JZWA 2KUCA 4X0XA 2FUG2 4IELA 1HD2A 3HVXA 2IMFA 4MZBA 4V1Ag 4KDXA 1EP8A 3BCIA 3DD3A 4PNFA 3HJMA 4IW9A 2VD0A 2CZ3A 1OC3A 1SJZA 1BX9A 1MEKA 2GLRA 4XRDA 2VL9A 3DKSA 2H71A 3DIEA 3WGEA 2CZ2A 5DALA 3IOSA 4YAVA 2KHPA 2WCIA 1YQ1A 4XCSA 1H75A 3ZVJD 1UC7A 2H6YA 4LA1A 2GZZA 1A8YA 1QFNA 2FWFA 3EU3A 4YH2A 5L71A 4D73A 1M7TA 1ZOFA 2AJQB 1YF1A 1G7OA 2VD1A 2OADA 4ZBAA 2CQ9A 1K3OA 3LG6A 2H6XA 2HSHA 1WPIA 5CRHA 2VCQA 1Z6NA 1GRXA 1U87A 5DDLA 3DMLA 1USBA 2JACA 1XW9A 2ON7A 3TKRA 1ST9A
chains in the Genus database with same CATH superfamily
3EC3A 3H93A 4TR0A 2EIOA 4EDZA 3KJYA 1Z9HA 2R2JA 3IDVA 5JCWA 2IFQB 1TJDA 4MCUA 2AYTA 2C0EA 5FT3A 4OO5A 2HRKA 1A0RP 1QK8A 4GTUA 1ZCPA 3FZAA 4GSNA 5F05A 1QUWA 2LNSA 2M80A 5AIVA 1YY7A 3SBCA 1MTCA 2F3MA 2OBIA 1PKZA 1PKWA 2H30A 1MD3A 3IXRA 2K8VA 3D21A 3DXBA 10GSA 1K0CA 4WBJA 3Q74A 3EINA 3TB2A 2AV4A 3FW2A 4YKGA 4FO5A 1M2DA 4CY6A 2K6VA 3GA4A 4ZIJA 2JADA 3KP9A 2P5RA 4XS6A 2C0DA 1GUHA 1WRYA 2GSQA 3C1SA 4LMVA 2HZFA 2LJKA 4V1Ap 5ECQB 1WMJA 2OBKA 1KNGA 3VFIA 4O5RA 4JR4A 2WULA 3TOUA 2L59A 3ZYWA 1UVZA 1PRXA 1XPVA 4POBA 3CXGA 5CRGA 2PWJA 4KDYA 5CAXA 5G30A 1ACVA 1CQGA 3ZREA 4MJEA 2MMOA 1FOHA 1YEPA 3IHGA 3F3QA 2OKAA 3UL3A 2IMKA 4G0LA 1BEDA 3F4TA 4HZ4A 2FGXA 5F06A 3M1GA 3C1RA 4XS1A 1M9BA 1X5DA 2L5LA 4HDEA 4IN0A 1SKWB 2C0FA 5IM9A 3ERFA 2N5AA 2IWTA 4WETA 4ID0A 1FVKA 4ZBBA 4FH8A 1THXA 1SENA 3GKNA 4GRFA 4MF5A 1TDIA 4G2EA 2DMLA 1A23A 2MMNA 4IP6A 3H1NA 2A4VA 2GVPA 1W89A 4QQ7A 2H0IA 3TJBA 2X8GA 1G6YA 3TKQA 1VRSD 2GQMA 2HRFA 5D9TA 3EPTA 2I9HA 4FQUA 2C3QA 3GN3A 2YZUA 1HYUA 4A5PA 4I8BA 1X5EA 5DJMA 3HDCA 3LXZA 4E8HA 2VL3A 2EIQA 4IP1A 1NW2A 3G9BA 4DSSA 3DWVA 3S9FA 3LEFA 1BJXA 1AW9A 3CQFA 4TKYA 4EVMA 2R0CA 1V98A 2LEGA 4K5RA 2O8VB 4RQXA 4MJCA 2FA4A 5DJLA 5JCUA 3A2WA 4PNGA 5AN1A 3ZIVA 1ERWA 2JZSA 4EKZA 1ABAA 3N9JA 3RHBA 4EUYA 4PXOA 3TKSA 1F9MA 2RM6A 1BYEA 4F2IA 4L8EA 2QC7A 3HJPA 1VF4A 2LUSA 1O85A 1OKTA 3LWAA 3IPZA 2CX3A 1X9MB 4TR1B 2X4AA 4IJIA 1OE7A 5IMCA 1N8JA 1GNEA 1JZRA 4XHMA 3IA1A 2C4JA 3EYTA 2QKEA 5GAND 6GSWA 3HD5A 1TTZA 3H4KA 3ZMKA 2FLSA 2H0HA 2H66A 3KEBA 4POMA 3UJ1A 2LRTA 18GSA 3FK8A 2L6CA 4ZB9A 4CW9A 3FHKA 3VWWA 3ME7A 2YOIA 2C80A 2VM2A 3OR5A 3IC4A 1XVQA 3MSZA 2EIRA 2V41A 4QL7A 3I9V2 3RDWA 3F4RA 2VO4A 4OFTA 2E2GA 5G5FA 20GSA 1PN9A 2ZUPA 3LQ7A 4EO3A 3GMFA 2E7PA 1H4OA 5F07A 2IIYA 3GUSA 5G31A 1S3RA 3FMWA 4K2DA 3IRAA 4MP4A 2H73A 1UA5A 2H72A 5J4UA 2H1BA 3UVTA 2DKHA 3BCKA 2KLXA 3HVNA 3VURA 4IVFA 2KP2A 4X1UA 5CP1A 4IBPA 1ON4A 2O89A 4K8MA 1K0OA 2YWIA 1Z5YE 4YQUA 3PINA 4AF2A 2DJ3A 2TRCP 1X5CA 3D4MA 3WT2A 1SU9A 2PPTA 5EY6A 1ZL9A 4PUAA 5ECIB 3CMIA 1T8EB 3TCOA 2VCTA 2REMA 4F0CA 2MBTA 3DGQA 5ID2B 17GSA 3CYNA 1IYIA 3C8EA 4JBBA 5GAPD 4ISDA 2QA1A 3HCZA 3BD2A 1TK8B 1AQWA 4OMVA 4I97A 3GHAA 3TKSC 3RBTA 3BOAA 2PBJA 1FVJA 1SD8A 4EDYA 5CNWA 3H79A 4JEDA 2HRAA 4F03A 3L9UA 3QPMA 1O7UA 4CY8A 1GP1A 4ML1A 1O8XA 3MAKA 2CV4A 3APOA 1F37A 4HU9A 2YCDA 2V1MA 5H5SA 2XPDA 1A0FA 5JWRB 2A4HA 4XTSA 3F9UA 3GSSA 4BVYA 1XWBA 3H8QA 3ERGA 1S3AA 4WBRD 1B8XA 4FYCA 1VGLA 2XBIA 3M9KA 4PQHA 5ELGA 1EGRA 2DJ1A 5EPFA 3P8WA 4L5OA 3F8UA 2CVBA 5INYA 4N0VA 4V2NA 3HZ8A 1GTUA 2R0GA 2H8LA 3Q6OA 4LL4B 4OO4A 3VK9A 3IAS2 3MIXA 3PH9A 1Z7RA 1M99A 2FHEA 4MH3A 1V40A 2YV9A 4NPBA 3GL3A 1GTIA 1I9DA 1K0DA 3I6AA 2KP1A 3KMNA 4I6XA 3GX0A 1GSQA 4NV2A 3KH9A 3QMXA 4TR4A 1YEXA 1TK0B 3CRTA 3ZFLA 5D9WA 2YJ7A 2WJUA 1PFOA 2QA2A 1R5PA 1RQMA 4KX4A 2IMDA 3GKMA 1AQXA 5A4WA 6GSXA 2H1GA 1YJ6A 4OCFA 4NHZA 1YF0A 3KCMA 2NPBA 3F4SA 4PQIA 2E0QA 4KB3A 2GSTA 1DSBA 1QQ2A 1U88A 2B1KA 5IO0A 4J56E 1CQHA 5A5KA 5E59A 2GT5A 2R0PA 2VCVA 3WYWA 3GX8A 2HI7A 4NAXA 1GSYA 2F8FA 4YQMA 1DBYA 1WIKA 3QFBC 2HNLA 2VUPA 4EXJA 4G10A 4BL7A 2HT9A 4V2MA 5BMUA 4ZILA 2HZEA 3EMXA 5ECPB 4BVXA 4PURA 3VLNA 3D4TA 2WRTA 5B6MA 4ZB6A 5DQSA 5HQPA 1SL0B 6GSYA 4AGSA 3TRXA 1DE2A 2I1UA 5JWQB 4Z2RA 1JZOA 2I81A 4MH2A 3VWVA 2MZCA 1LJRA 4WR5A 1OAZA 1JLVA 2GS3A 2HRNA 4NMUA 1N2AA 2WDUA 1K0AA 3A2XA 1V9WA 1OE8A 2Z9SA 3I43A 1WP0A 1TXXA 2P5QA 4Q5RA 5IMDA 3AY8A 3TKPA 1B4PA 1U6TA 4AJ6A 4NXIA 2ON5A 1WOUA 4WR4A 3HY2A 3KTBA 1PD21 4IHUA 4KF9A 2DBCA 2O7KA 2V6KA 4WF5A 2N5FA 3ZRDA 4Z2TA 2F51A 1F2EA 4X4JA 1TRVA 1RK4A 3R3EA 3MDKA 4KAEA 22GSA 1URMA 3GSTA 4NV5A 1OC9B 3LFLA 3IK7A 3CRUA 4G9HA 2WB9A 2QGVA 3LXTA 5DAKA 3TUEA 5IPGA 1ZZYA 1BQ7A 2F9SA 3O6TA 2X8HA 4PX1A 3FZ5A 1SJ6A 1J0FA 1TRSA 1I5GA 6GSSA 1E6BA 1O73A 3GV1A 4GSTA 1TKDB 3M3MA 2YNXA 1VF3A 4ZL9A 2K18A 3M0FA 2DIZA 1FG4A 8GSSA 5FHIA 5HFIA 4TXOB 5H5QA 1SKRB 3BJ5A 4HI7A 3F63A 11GSA 4BA7A 2DJ0A 2FWHA 2JZRA 1TW9A 2LV3A 2MMAA 4F82A 5IO2A 1G7EA 5IIZA 2OACA 5HR2A 4XS4B 4OWYA 5J41A 4MF7A 4HQSA 1G6WA 3UOMA 1M3IA 1SYXA 3QOUA 2OE1A 1JZDA 4OFMA 3LYKA 1XIYA 1GTAA 2NTOA 1GSDA 5AIXA 1O81A 3WT1A 3HVSA 2HFDA 4JU5A 4JZQA 3APQA 2H6ZA 3GTUB 3L78A 3ME8A 2DJKA 2RIIA 2L4CA 3WGXA 3HVVA 5H5RA 5COHA 4ULXA 2B5EA 6GSUA 1XOAA 2FY6A 4L0UA 4MZCA 1FAAA 5C04A 1TRUA 1JLWA 1XG8A 1AXDA 1LU4A 3O3TA 1SK1A 1V58A 5ECMB 5LD0A 1GH2A 1U3AA 2VCWA 1AC1A 3KH7A 1EOHA 5EL8A 3HYPA 4K0NA 4LLRA 1YKCA 2DSAA 3FR3A 4GQCA 4IKHA 5D9VA 4EF0A 2PU9C 3TJFA 1GULA 4POLA 2P31A 3LW9A 4BVYB 2EC4A 2IFQA 2H1AA 2VL2A 5DVBA 1QGVA 5ECLB 1WE0A 4V2LA 1VF1A 3A5WA 3GNJA 5FWGA 3VWUA 5ELAA 4K7OA 2JSYA 3GH6A 1ERVA 4HUAA 1XWAA 1FOVA 2ZNMA 4YQVA 4O7HA 3CBUA 3C73A 3A2VA 1C72A 3L0HA 3VPQA 1A2MA 3DVXA 4HSCX 1XWCA 1FO5A 2PGTA 1SYRA 2XC2A 3HJOA 1T1VA 2I3YA 1HNBA 1WWJA 5KN0A 1EOGA 1OVNA 3K8NA 12GSA 1EEMA 1XWGA 4PGTA 4P3YB 5IMFA 1M3JA 2LTKA 4MLYA 2L6DA 1F6MC 2RLIA 2A2RA 5IQYA 1TI3A 1EV4A 1XW6A 1XZOA 1PN0A 4GCIA 1NHOA 1SL2B 5ABRA 1QXHA 1O8WA 4TVEA 3TGZA 3ZFBA 5DCGA 3W8JA 3A5IA 1SL1B 2L57A 3UAPA 4MDCA 1TP9A 1ZYEA 3A3TA 1TU8A 4RQRA 1HNCA 3CTGA 2MMZA 1F3AA 3HHVA 4MPFA 3KTLA 6GSTA 1KTEA 3FZ4A 1V57A 3G7YA 1XVWA 4HZ2A 2A2PA 2B7KA 2CVDA 3FYGA 5GZZB 3QD9A 4MA9A 3IAM2 2GSSA 4O5QA 3FEUA 5DALB 4ECIA 3GKXA 1T4YA 3ZITA 4ZL7A 3P90A 4ZL8A 4Q5NA 4D73B 2R3XA 1B4QA 3HKRA 1EP7A 4IJ3A 1WJKA 5D73A 4N10A 1PL2A 3LYPA 4IS0A 4TW5A 1AIUA 1SK0A 5ECNB 4Z7XA 1GSSA 4BPYA 3L4NA 1JFUA 2H19A 3FRCA 1Z7PA 4OFNA 1YKAA 3UEMA 3ZZXA 3W6GA 2DC5A 4N0ZA 3QCPA 2M46A 14GSA 5B6NA 3KIJA 2VL2C 5JCGA 5KN1A 3GRXA 4MNNA 4EE0A 2B5YA 1HNAA 1XBSA 5ENUA 5HFKA 3TRQA 1G0TA 3Q19A 3D22A 4ZBDA 3ERWA 1GNWA 1GL8A 1MDIA 1J08A 2CA8A 3US3A 5ECSA 2LQQA 3RAZA 2O87A 3FKFA 1Q98A 4KA0A 3UBLA 3Q18A 1X0RA 4HQZA 2IJYA 2FWGA 4K1FA 3F6DA 5KEJA 4XRAA 2X99A 4ZXGA 3EWLA 4YKFA 3BBYA 3CTFA 4PTSA 4KSOA 3L9VA 1RW1A 2TRXA 4KNDA 2AUVA 1MDJA 4G0KA 5CRWA 1R4WA 1FW1A 5IMVA 2AHEA 3FZ9A 1U3IA 2X49A 2UZ8A 1XW5A 4TR1A 3JCML 1FB0A 3KGKA 2K8SA 3VWXA 2GSRA 5CREA 2G2QA 3EU4A 5G1KA 4KCAA 1EGOA 2CT6A 2PERA 3CSIA 1BG5A 3DEXA 3QR6A 1TK5B 2MBSA 4HEA2 1F3BA 4GQFA 3LJRA 1LBKA 1X9SB 1XOBA 1PGTA 3DYRA 1M0UA 3EURA 1X9WB 3LORA 2JL4A 1GSEA 9GSSA 4NHWA 1O6JA 3M8NA 5HFGA 2VOCA 2O85A 3RPNA 3L9SA 1MDKA 3UARA 4J57E 1Z3EA 5ECRB 1PA3A 1SD9A 1TRWA 5D93A 3TDGA 3G7JA 3TJKA 2NBSA 1NHYA 4X43A 1M2AA 3IV4A 5G5EA 3IE3A 3KZQA 3KD0A 3WGDA 5C00A 1AAZA 5B8AA 1GWCA 2L4QA 4L0WA 2DMMA 5CRDA 1Y6EA 2VIMA 3E0UA 3IK9A 1BAYA 1XXUA 5G1LA 2B6MA 2YWMA 2LRNA 5D9XA 2C0GA 5B8BA 4TXVA 5B7CA 1T7PB 1JHBA 4DSSB 2X8CA 1TI1A 4USSA 3IBHA 4MK3A 2WS2A 2GDRA 2FCHA 1OYJA 3TOTA 5ECOB 5DQYA 2VCZA 1VF2A 3HXSA 4CHSA 1W4VA 1SJIA 3CSJA 4JR6A 1B9XC 1EWXA 2YN1A 1PMTA 1MD4A 2D2ZA 1B9YC 5J5NA 2FA8A 3ZL5A 1XCCA 2KOKA 2H1DA 2VLTA 3ED3A 2J9HA 5BRTA 5ID2A 2VLVA 3P7XA 2F8AA 5DCHA 1ZGNA 3IC8A 3GL5A 4OCEA 2LJAA 1ZYPA 4DEJA 2GTUA 4KSMA 2IMEA 2PN8A 4H86A 2ES7A 4BWQA 4EIQA 4QL9A 3KMOA 2GZPA 2N5BA 1YDKA 1GSFA 2RM5A 4O92A 4OD7A 3DRNA 1S3CA 2DJJA 4I2TA 4Q5FA 5HR1A 3E9JB 2B7JA 2YPMA 5IOWA 1AQVA 2HXKA 3UBKA 1ZYNA 2CAIA 2H0GA 5JWOB 5AGYA 2DLXA 1THOA 4BWSA 5IOXA 4AJ8A 2C1YA 2JU5A 3VI5A 4L5LA 2I4AA 4ECBA 3MWHA 2GGTA 3VI7A 3IHQA 4MABA 4RUVA 3C71A 4DSRA 2HYXA 2PVQA 4IQAA 2PMTA 3EE2A 1PL1A 1OC8A 2IL3A 1GUKA 3U6VA 1HQOA 5AISA 2JZTA 4ECJA 2V6OA 2HLSA 3PGTA 4LMWA 1XWKA 1K0BA 4MJAA 2MYGA 2HE3A 2IPAA 4KE3A 2J23A 2B5XA 2FNOA 5G2ZA 2YANA 4RI6A 1EEJA 2BJXA 2NDOA 2YWNA 1R26A 1K0NA 2XHFA 4MJBA 5LNKe 2CAQA 1T4ZA 2K9FA 4JRRA 4ML6A 2BTOT 6GSVA 4KCEA 5DBQA 5EVOA 1SKSB 4ZB8A 4K9ZA 1E2YA 3IR4A 2H01A 2X64A 2CVKA 3C7MA 3QAWA 4CDOA 4FYUA 1B48A 5ECKB 5F0GA 3LGCA 2RUFA 2GT6A 1PX7A 2R6KA 4HJ2A 2V2GA 4TN8A 2H75A 4HOJA 3KXOA 4MPGA 4EIPA 2VM1A 1PX6A 4LL1B 4DVCA 3PR8A 4HJMA 4ICYA 4O5UA 1UN2A 2FWEA 2QSIA 4FYBA 2GQLA 4NWYA 1M9AA 2BMXA 3RPPA 4BIKA 2TIRA 2OE3A 2H70A 4KH7A 2HSMA 1A2LA 4WKWA 1PSQA 3CSHA 4N30A 2V32A 4TR3A 4PQ1A 2PUKC 4MF6A 2OJLA 1ZYQB 1GLQA 1ERUA 2YP6A 4I5QA 2M72A 3GURA 4F0BA 4J2FA 2VLUA 3D5JA 13GSA 1GUMA 2YJHA 1QMVA 2R5GA 2OE0A 1K0MA 5CYYA 2A2SA 4Z2UA 2B3SA 5KOXA 4GLTA 2VAFA 3NIVA 4XIHA 3E3EA 4WEYA 1KEBA 1V2AA 3J7Yb 1FB6A 1OKDA 5HR3A 2YWOA 2DIYA 1J9BA 4FIWA 3APSA 1R5AA 3HZ4A 5D96A 5E4WA 5IMZA 2LJRA 1A24A 4WXTA 2H76A 5KN2A 3WD6A 4EL1A 2IN3A 7GSSA 2LQOA 2JSZA 5KOWA 1OC9A 1YZXA 2XPEA 1NSWA 1T00A 4K2XA 4AJ7A 2AAWA 3PPUA 2VCXA 3ZIJA 1TOFA 5D8IA 4KGIA 3F0IA 2L5OA 3GKKA 1ILOA 5F8BA 4O32A 5GSSA 3GIXA 1FHEA 1XFLA 4DSQA 3NZNA 2AB6A 2GZYA 2PVOC 2FD3A 3TJJA 4ECCA 1R7HA 5A4VA 1M2BA 3TJGA 5J9BA 4I2UA 4TXOA 5HR0A 3QFAC 1KBNA 1A2JA 1NM3A 1GLPA 3R2QA 1PQNA 3FR6A 3KM6A 4GXZA 4TOPA 4HU7A 3GFKA 4Q5QA 2LKUA 4K7IA 1TU7A 3DVWA 1EZKA 4K5SA 4BL7B 3FY7A 2C8UA 4XS4A 2HZEB 3I69A 2G0FA 4KW6A 2GQKA 4BVXB 2YZHA 2WFCA 4MZWA 3RHCA 3J7Yk 1IYHA 3ISOA 5LCZA 3V1WA 4GWRA 4POKA 2HSYA 2OA7A 4GSSA 3KP8A 4IGJA 3QAGA 2XBQA 2R4VA 4G0IA 3MNGA 2LS5A 2LNTA 3GYKA 3GTUA 3TKSE 2CX4A 3HA9A 3M9JA 5J9CA 3UIWA 2P0GA 3D0ZA 4F9ZA 3U5RE 3EMPA 5IPHA 4RI7A 3F3RA 4HS1A 3D6IA 1ML6A 4JE1A 2E2MA 2YV7A 3VPTA 2LSTA 3QDNA 2LRCA 19GSA 1Y25A 1DE1A 3GH9A 2IMIA 1SK2A 5J3RA 5GSTA 3FR9A 3P2AA 4PUFC 5CO3A 16GSA 1ZMAA 2RUEA 4K0GA 1S3DA 1Z6MA 4GF0A 4ACSA 1Q4JA 3ZLPA 2C3NA 5A4UA 2WGRA 2R37A 3W8SA 3TRPA 4K7NA 3O76A 4WF4A 1GTBA 5DAKB 2ALBA 4ILFA 3G7IA 4EC0A 4G19A 3LSZA 2B1LA 4YAPA 2WZ9A 4N11A 4E8EA 3NOFA 4IQ1A 4MMMA 3UVHA 3MYDA 3EVIA 3UMAA 3ZMLA 2H74A 4KUNA 1ERTA 1DUGA 3F6FA 2ZCTA 1T3BA 3ZTLA 5IMAA 1GSUA 4KDUA 3SWLA 3N5OA 1AUCA 2NVLA 5KN3A 5ECHB 2C3TA 3QAVA 4TRXA 2DJ2A 1EV9A 4K6XA 3ZVJA 1K3LA 1A8LA 1K3YA 1JZWA 2KUCA 4X0XA 2FUG2 4IELA 1HD2A 3HVXA 2IMFA 4MZBA 4V1Ag 4KDXA 1EP8A 3BCIA 3DD3A 4PNFA 3HJMA 4IW9A 2VD0A 2CZ3A 1OC3A 2DKIA 1SJZA 1BX9A 1MEKA 2GLRA 4XRDA 2VL9A 3DKSA 2H71A 3DIEA 3WGEA 2CZ2A 5DALA 3IOSA 4YAVA 2KHPA 2WCIA 1YQ1A 4XCSA 1H75A 3ZVJD 1UC7A 2H6YA 4LA1A 2GZZA 1A8YA 1QFNA 2FWFA 3EU3A 4YH2A 5L71A 4D73A 1M7TA 1ZOFA 2AJQB 1YF1A 1G7OA 2VD1A 2OADA 4ZBAA 2CQ9A 1K3OA 3LG6A 2H6XA 2HSHA 1WPIA 5CRHA 2VCQA 1Z6NA 1GRXA 1U87A 5DDLA 3DMLA 1USBA 2JACA 1XW9A 2ON7A 3TKRA 1ST9A
chains in the Genus database with same CATH topology
3EC3A 3H93A 4TR0A 2EIOA 4EDZA 3KJYA 1Z9HA 2R2JA 3IDVA 5JCWA 2IFQB 1TJDA 4MCUA 2AYTA 2C0EA 5FT3A 4OO5A 2HRKA 1A0RP 1QK8A 4GTUA 1ZCPA 3FZAA 4GSNA 5F05A 1QUWA 2LNSA 2M80A 5AIVA 1YY7A 3SBCA 1MTCA 2F3MA 2OBIA 1PKZA 1PKWA 2H30A 1MD3A 3IXRA 2K8VA 3D21A 3DXBA 10GSA 1K0CA 4WBJA 3Q74A 3EINA 3TB2A 2AV4A 3FW2A 4YKGA 4FO5A 1M2DA 4CY6A 2K6VA 3GA4A 4ZIJA 2JADA 3KP9A 2P5RA 4XS6A 2C0DA 1GUHA 1WRYA 2GSQA 3C1SA 4LMVA 2HZFA 2LJKA 4V1Ap 5ECQB 1WMJA 2OBKA 1KNGA 3VFIA 4O5RA 4JR4A 2WULA 3TOUA 2L59A 3ZYWA 1UVZA 1PRXA 1XPVA 4POBA 3CXGA 5CRGA 2PWJA 4KDYA 5CAXA 5G30A 1ACVA 1CQGA 3ZREA 4MJEA 2MMOA 1FOHA 1YEPA 3IHGA 3F3QA 2OKAA 3UL3A 2IMKA 4G0LA 1BEDA 3F4TA 4HZ4A 2FGXA 5F06A 3M1GA 3C1RA 4XS1A 1M9BA 1X5DA 2L5LA 4HDEA 4IN0A 1SKWB 2C0FA 5IM9A 3ERFA 2N5AA 2IWTA 4WETA 4ID0A 1FVKA 4ZBBA 4FH8A 1THXA 1SENA 3GKNA 4GRFA 4MF5A 1TDIA 4G2EA 2DMLA 1A23A 2MMNA 4IP6A 3H1NA 2A4VA 2GVPA 1W89A 4QQ7A 2H0IA 3TJBA 2X8GA 1G6YA 3TKQA 1VRSD 2GQMA 2HRFA 5D9TA 3EPTA 2I9HA 4FQUA 2C3QA 3GN3A 2YZUA 1HYUA 4A5PA 4I8BA 1X5EA 5DJMA 3HDCA 3LXZA 4E8HA 2VL3A 2EIQA 4IP1A 1NW2A 3G9BA 4DSSA 3DWVA 3S9FA 3LEFA 1BJXA 1AW9A 4TKYA 4EVMA 2R0CA 1V98A 2LEGA 4K5RA 2O8VB 4RQXA 4MJCA 2FA4A 5DJLA 5JCUA 3A2WA 4PNGA 5AN1A 3ZIVA 1ERWA 2JZSA 4EKZA 1ABAA 3N9JA 3RHBA 4EUYA 4PXOA 3TKSA 1F9MA 2RM6A 1BYEA 4F2IA 4L8EA 2QC7A 3HJPA 1VF4A 2LUSA 1O85A 1OKTA 3LWAA 3IPZA 2CX3A 1X9MB 4TR1B 2X4AA 4IJIA 1OE7A 5IMCA 1N8JA 1GNEA 1JZRA 4XHMA 3IA1A 2C4JA 3EYTA 2QKEA 5GAND 6GSWA 3HD5A 1TTZA 3H4KA 3ZMKA 2FLSA 2H0HA 2H66A 3KEBA 4POMA 3UJ1A 2LRTA 18GSA 3FK8A 2L6CA 4ZB9A 4CW9A 3FHKA 3VWWA 3ME7A 2YOIA 2C80A 2VM2A 3OR5A 3IC4A 1XVQA 3MSZA 2EIRA 2V41A 4QL7A 3I9V2 3RDWA 3F4RA 2VO4A 4OFTA 2E2GA 5G5FA 20GSA 1PN9A 2ZUPA 3LQ7A 4EO3A 3GMFA 2E7PA 1H4OA 5F07A 2IIYA 3GUSA 5G31A 3FMWA 4K2DA 3IRAA 4MP4A 2H73A 1UA5A 2H72A 5J4UA 2H1BA 3UVTA 2DKHA 3BCKA 2KLXA 3VURA 4IVFA 2KP2A 4X1UA 5CP1A 4IBPA 1ON4A 2O89A 4K8MA 1K0OA 2YWIA 1Z5YE 4YQUA 3PINA 4AF2A 2DJ3A 2TRCP 1X5CA 3D4MA 3WT2A 1SU9A 2PPTA 5EY6A 1ZL9A 4PUAA 5ECIB 3CMIA 1T8EB 3TCOA 2VCTA 2REMA 4F0CA 2MBTA 3DGQA 5ID2B 17GSA 3CYNA 1IYIA 3C8EA 4JBBA 5GAPD 4ISDA 2QA1A 3HCZA 3BD2A 1TK8B 1AQWA 4OMVA 4I97A 3GHAA 3TKSC 3RBTA 3BOAA 2PBJA 1FVJA 1SD8A 4EDYA 5CNWA 3H79A 4JEDA 2HRAA 4F03A 3L9UA 3QPMA 1O7UA 4CY8A 1GP1A 4ML1A 1O8XA 3MAKA 2CV4A 3APOA 1F37A 4HU9A 2YCDA 2V1MA 5H5SA 2XPDA 1A0FA 5JWRB 2A4HA 4XTSA 3F9UA 3GSSA 4BVYA 1XWBA 3H8QA 3ERGA 1S3AA 4WBRD 1B8XA 4FYCA 1VGLA 2XBIA 3M9KA 4PQHA 5ELGA 1EGRA 2DJ1A 5EPFA 3P8WA 4L5OA 3F8UA 2CVBA 5INYA 4N0VA 4V2NA 3HZ8A 1GTUA 2R0GA 2H8LA 3Q6OA 4LL4B 4OO4A 3VK9A 3IAS2 3MIXA 3PH9A 1Z7RA 1M99A 2FHEA 4MH3A 1V40A 2YV9A 4NPBA 3GL3A 1GTIA 1I9DA 1K0DA 3I6AA 2KP1A 3KMNA 4I6XA 3GX0A 1GSQA 4NV2A 3KH9A 3QMXA 4TR4A 1YEXA 1TK0B 3CRTA 3ZFLA 5D9WA 2YJ7A 2WJUA 2QA2A 1R5PA 1RQMA 4KX4A 2IMDA 3GKMA 1AQXA 5A4WA 6GSXA 2H1GA 1YJ6A 4OCFA 4NHZA 1YF0A 3KCMA 2NPBA 3F4SA 4PQIA 2E0QA 4KB3A 2GSTA 1DSBA 1QQ2A 1U88A 2B1KA 5IO0A 4J56E 1CQHA 5A5KA 5E59A 2GT5A 2R0PA 2VCVA 3WYWA 3GX8A 2HI7A 4NAXA 1GSYA 2F8FA 4YQMA 1DBYA 1WIKA 3QFBC 2HNLA 2VUPA 4EXJA 4G10A 4BL7A 2HT9A 4V2MA 5BMUA 4ZILA 2HZEA 3EMXA 5ECPB 4BVXA 4PURA 3VLNA 3D4TA 2WRTA 5B6MA 4ZB6A 5DQSA 5HQPA 1SL0B 6GSYA 4AGSA 3TRXA 1DE2A 2I1UA 5JWQB 4Z2RA 1JZOA 2I81A 4MH2A 3VWVA 2MZCA 1LJRA 4WR5A 1OAZA 1JLVA 2GS3A 2HRNA 4NMUA 1N2AA 2WDUA 1K0AA 3A2XA 1V9WA 1OE8A 2Z9SA 3I43A 1WP0A 1TXXA 2P5QA 4Q5RA 5IMDA 3AY8A 3TKPA 1B4PA 1U6TA 4AJ6A 4NXIA 2ON5A 1WOUA 4WR4A 3HY2A 3KTBA 1PD21 4IHUA 4KF9A 2DBCA 2O7KA 2V6KA 4WF5A 2N5FA 3ZRDA 4Z2TA 2F51A 1F2EA 4X4JA 1TRVA 1RK4A 3R3EA 3MDKA 4KAEA 22GSA 1URMA 3GSTA 4NV5A 1OC9B 3LFLA 3IK7A 3CRUA 4G9HA 2WB9A 2QGVA 3LXTA 5DAKA 3TUEA 5IPGA 1ZZYA 1BQ7A 2F9SA 3O6TA 2X8HA 4PX1A 3FZ5A 1SJ6A 1J0FA 1TRSA 1I5GA 6GSSA 1E6BA 1O73A 3GV1A 4GSTA 1TKDB 3M3MA 2YNXA 1VF3A 4ZL9A 2K18A 3M0FA 2DIZA 1FG4A 8GSSA 5FHIA 5HFIA 4TXOB 5H5QA 1SKRB 3BJ5A 4HI7A 3F63A 11GSA 4BA7A 2DJ0A 2FWHA 2JZRA 1TW9A 2LV3A 2MMAA 4F82A 5IO2A 1G7EA 5IIZA 2OACA 5HR2A 4XS4B 4OWYA 5J41A 4MF7A 4HQSA 1G6WA 3UOMA 1SYXA 3QOUA 2OE1A 1JZDA 4OFMA 3LYKA 1XIYA 1GTAA 2NTOA 1GSDA 5AIXA 1O81A 3WT1A 3HVSA 2HFDA 4JU5A 4JZQA 3APQA 2H6ZA 3GTUB 3L78A 3ME8A 2DJKA 2RIIA 2L4CA 3WGXA 3HVVA 5H5RA 5COHA 4ULXA 2B5EA 6GSUA 1XOAA 2FY6A 4L0UA 4MZCA 1FAAA 5C04A 1TRUA 1JLWA 1AXDA 1LU4A 3O3TA 1SK1A 1V58A 5ECMB 5LD0A 1GH2A 1U3AA 2VCWA 1AC1A 3KH7A 1EOHA 5EL8A 3HYPA 4K0NA 4LLRA 1YKCA 2DSAA 3FR3A 4GQCA 4IKHA 5D9VA 4EF0A 2PU9C 3TJFA 1GULA 4POLA 2P31A 3LW9A 4BVYB 2EC4A 2IFQA 2H1AA 2VL2A 5DVBA 1QGVA 5ECLB 1WE0A 4V2LA 1VF1A 3A5WA 3GNJA 5FWGA 3VWUA 5ELAA 4K7OA 2JSYA 3GH6A 1ERVA 4HUAA 1XWAA 1FOVA 2ZNMA 4YQVA 4O7HA 3CBUA 3C73A 3A2VA 1C72A 3L0HA 3VPQA 1A2MA 3DVXA 1XWCA 1FO5A 2PGTA 1SYRA 2XC2A 3HJOA 1T1VA 2I3YA 1HNBA 1WWJA 5KN0A 1EOGA 1OVNA 3K8NA 12GSA 1EEMA 1XWGA 4PGTA 4P3YB 5IMFA 2LTKA 4MLYA 2L6DA 1F6MC 2RLIA 2A2RA 5IQYA 1TI3A 1EV4A 1XW6A 1XZOA 1PN0A 4GCIA 1NHOA 1SL2B 5ABRA 1QXHA 1O8WA 4TVEA 3TGZA 3ZFBA 5DCGA 3W8JA 3A5IA 1SL1B 2L57A 3UAPA 4MDCA 1TP9A 1ZYEA 3A3TA 1TU8A 4RQRA 1HNCA 3CTGA 2MMZA 1F3AA 3HHVA 4MPFA 3KTLA 6GSTA 1KTEA 3FZ4A 1V57A 3G7YA 1XVWA 4HZ2A 2A2PA 2B7KA 2CVDA 3FYGA 5GZZB 3QD9A 4MA9A 3IAM2 2GSSA 4O5QA 3FEUA 5DALB 4ECIA 3GKXA 1T4YA 3ZITA 4ZL7A 3P90A 4ZL8A 4Q5NA 4D73B 2R3XA 1B4QA 3HKRA 1EP7A 4IJ3A 1WJKA 5D73A 4N10A 1PL2A 3LYPA 4IS0A 4TW5A 1AIUA 1SK0A 5ECNB 4Z7XA 1GSSA 4BPYA 3L4NA 1JFUA 2H19A 3FRCA 1Z7PA 4OFNA 1YKAA 3UEMA 3ZZXA 3W6GA 2DC5A 4N0ZA 3QCPA 2M46A 14GSA 5B6NA 3KIJA 2VL2C 5JCGA 5KN1A 3GRXA 4MNNA 4EE0A 2B5YA 1HNAA 1XBSA 5ENUA 5HFKA 3TRQA 1G0TA 3Q19A 3D22A 4ZBDA 3ERWA 1GNWA 1GL8A 1MDIA 1J08A 2CA8A 3US3A 5ECSA 2LQQA 3RAZA 2O87A 3FKFA 1Q98A 4KA0A 3UBLA 3Q18A 1X0RA 4HQZA 2IJYA 2FWGA 4K1FA 3F6DA 5KEJA 4XRAA 2X99A 4ZXGA 3EWLA 4YKFA 3BBYA 3CTFA 4PTSA 4KSOA 3L9VA 1RW1A 2TRXA 4KNDA 2AUVA 1MDJA 4G0KA 5CRWA 1R4WA 1FW1A 5IMVA 2AHEA 3FZ9A 1U3IA 2X49A 2UZ8A 1XW5A 4TR1A 3JCML 1FB0A 3KGKA 2K8SA 3VWXA 2GSRA 5CREA 2G2QA 3EU4A 5G1KA 4KCAA 1EGOA 2CT6A 2PERA 3CSIA 1BG5A 3DEXA 3QR6A 1TK5B 2MBSA 4HEA2 1F3BA 4GQFA 3LJRA 1LBKA 1X9SB 1XOBA 1PGTA 3DYRA 1M0UA 3EURA 1X9WB 3LORA 2JL4A 1GSEA 9GSSA 4NHWA 1O6JA 3M8NA 5HFGA 2VOCA 2O85A 3RPNA 3L9SA 1MDKA 3UARA 4J57E 1Z3EA 5ECRB 1PA3A 1SD9A 1TRWA 5D93A 3TDGA 3G7JA 3TJKA 2NBSA 1NHYA 4X43A 1M2AA 3IV4A 5G5EA 3IE3A 3KZQA 3KD0A 3WGDA 5C00A 1AAZA 5B8AA 1GWCA 2L4QA 4L0WA 2DMMA 5CRDA 1Y6EA 2VIMA 3E0UA 3IK9A 1BAYA 1XXUA 5G1LA 2B6MA 2YWMA 2LRNA 5D9XA 2C0GA 5B8BA 4TXVA 5B7CA 1T7PB 1JHBA 4DSSB 2X8CA 1TI1A 4USSA 3IBHA 4MK3A 2WS2A 2GDRA 2FCHA 1OYJA 3TOTA 5ECOB 5DQYA 2VCZA 1VF2A 3HXSA 4CHSA 1W4VA 1SJIA 3CSJA 4JR6A 1B9XC 1EWXA 2YN1A 1PMTA 1MD4A 2D2ZA 1B9YC 5J5NA 2FA8A 3ZL5A 1XCCA 2KOKA 2H1DA 2VLTA 3ED3A 2J9HA 5BRTA 5ID2A 2VLVA 3P7XA 2F8AA 5DCHA 1ZGNA 3IC8A 3GL5A 4OCEA 2LJAA 1ZYPA 4DEJA 2GTUA 4KSMA 2IMEA 2PN8A 4H86A 2ES7A 4BWQA 4EIQA 4QL9A 3KMOA 2GZPA 2N5BA 1YDKA 1GSFA 2RM5A 4O92A 4OD7A 3DRNA 1S3CA 2DJJA 4I2TA 4Q5FA 5HR1A 3E9JB 2B7JA 2YPMA 5IOWA 1AQVA 2HXKA 3UBKA 1ZYNA 2CAIA 2H0GA 5JWOB 5AGYA 2DLXA 1THOA 4BWSA 5IOXA 4AJ8A 2C1YA 2JU5A 3VI5A 4L5LA 2I4AA 4ECBA 3MWHA 2GGTA 3VI7A 3IHQA 4MABA 4RUVA 3C71A 4DSRA 2HYXA 2PVQA 4IQAA 2PMTA 3EE2A 1PL1A 1OC8A 2IL3A 1GUKA 3U6VA 1HQOA 5AISA 2JZTA 4ECJA 2V6OA 2HLSA 3PGTA 4LMWA 1XWKA 1K0BA 4MJAA 2MYGA 2HE3A 2IPAA 4KE3A 2J23A 2B5XA 2FNOA 5G2ZA 2YANA 4RI6A 1EEJA 2BJXA 2NDOA 2YWNA 1R26A 1K0NA 2XHFA 4MJBA 5LNKe 2CAQA 1T4ZA 2K9FA 4JRRA 4ML6A 2BTOT 6GSVA 4KCEA 5DBQA 5EVOA 1SKSB 4ZB8A 4K9ZA 1E2YA 3IR4A 2H01A 2X64A 2CVKA 3C7MA 3QAWA 4CDOA 4FYUA 1B48A 5ECKB 5F0GA 3LGCA 2RUFA 2GT6A 1PX7A 2R6KA 4HJ2A 2V2GA 4TN8A 2H75A 4HOJA 3KXOA 4MPGA 4EIPA 2VM1A 1PX6A 4LL1B 4DVCA 3PR8A 4HJMA 4ICYA 4O5UA 1UN2A 2FWEA 2QSIA 4FYBA 2GQLA 4NWYA 1M9AA 2BMXA 3RPPA 2TIRA 2OE3A 2H70A 4KH7A 2HSMA 1A2LA 4WKWA 1PSQA 3CSHA 4N30A 2V32A 4TR3A 4PQ1A 2PUKC 4MF6A 2OJLA 1ZYQB 1GLQA 1ERUA 2YP6A 4I5QA 2M72A 3GURA 4F0BA 4J2FA 2VLUA 3D5JA 13GSA 1GUMA 2YJHA 1QMVA 2R5GA 2OE0A 1K0MA 5CYYA 2A2SA 4Z2UA 2B3SA 5KOXA 4GLTA 2VAFA 3NIVA 4XIHA 3E3EA 4WEYA 1KEBA 1V2AA 3J7Yb 1FB6A 1OKDA 5HR3A 2YWOA 2DIYA 1J9BA 4FIWA 3APSA 1R5AA 3HZ4A 5D96A 5E4WA 5IMZA 2LJRA 1A24A 4WXTA 2H76A 5KN2A 3WD6A 4EL1A 2IN3A 7GSSA 2LQOA 2JSZA 5KOWA 1OC9A 1YZXA 2XPEA 1NSWA 1T00A 4K2XA 4AJ7A 2AAWA 3PPUA 2VCXA 3ZIJA 1TOFA 5D8IA 4KGIA 3F0IA 2L5OA 3GKKA 1ILOA 5F8BA 4O32A 5GSSA 3GIXA 1FHEA 1XFLA 4DSQA 3NZNA 2AB6A 2GZYA 2PVOC 2FD3A 3TJJA 4ECCA 1R7HA 5A4VA 1M2BA 3TJGA 5J9BA 4I2UA 4TXOA 5HR0A 3QFAC 1KBNA 1A2JA 1NM3A 1GLPA 3R2QA 1PQNA 3FR6A 3KM6A 4GXZA 4TOPA 4HU7A 3GFKA 4Q5QA 2LKUA 4K7IA 1TU7A 3DVWA 1EZKA 4K5SA 4BL7B 3FY7A 2C8UA 4XS4A 2HZEB 3I69A 2G0FA 4KW6A 2GQKA 4BVXB 2YZHA 2WFCA 4MZWA 3RHCA 3J7Yk 1IYHA 3ISOA 5LCZA 3V1WA 4GWRA 4POKA 2HSYA 2OA7A 4GSSA 3KP8A 4IGJA 3QAGA 2XBQA 2R4VA 4G0IA 3MNGA 2LS5A 2LNTA 3GYKA 3GTUA 3TKSE 2CX4A 3HA9A 3M9JA 5J9CA 3UIWA 2P0GA 3D0ZA 4F9ZA 3U5RE 3EMPA 5IPHA 4RI7A 3F3RA 4HS1A 3D6IA 1ML6A 4JE1A 2E2MA 2YV7A 3VPTA 2LSTA 3QDNA 2LRCA 19GSA 1Y25A 1DE1A 3GH9A 2IMIA 1SK2A 5J3RA 5GSTA 3FR9A 3P2AA 4PUFC 5CO3A 16GSA 1ZMAA 2RUEA 4K0GA 1S3DA 1Z6MA 4GF0A 4ACSA 1Q4JA 3ZLPA 2C3NA 5A4UA 2WGRA 2R37A 3W8SA 3TRPA 4K7NA 3O76A 4WF4A 1GTBA 5DAKB 2ALBA 4ILFA 3G7IA 4EC0A 4G19A 3LSZA 2B1LA 4YAPA 2WZ9A 4N11A 4E8EA 3NOFA 4IQ1A 4MMMA 3UVHA 3MYDA 3EVIA 3UMAA 3ZMLA 2H74A 4KUNA 1ERTA 1DUGA 3F6FA 2ZCTA 1T3BA 3ZTLA 5IMAA 1GSUA 4KDUA 3SWLA 3N5OA 1AUCA 2NVLA 5KN3A 5ECHB 2C3TA 3QAVA 4TRXA 2DJ2A 1EV9A 4K6XA 3ZVJA 1K3LA 1A8LA 1K3YA 1JZWA 2KUCA 4X0XA 2FUG2 4IELA 1HD2A 3HVXA 2IMFA 4MZBA 4V1Ag 4KDXA 1EP8A 3BCIA 3DD3A 4PNFA 3HJMA 4IW9A 2VD0A 2CZ3A 1OC3A 2DKIA 1SJZA 1BX9A 1MEKA 2GLRA 4XRDA 2VL9A 3DKSA 2H71A 3DIEA 3WGEA 2CZ2A 5DALA 3IOSA 4YAVA 2KHPA 2WCIA 1YQ1A 4XCSA 1H75A 3ZVJD 1UC7A 2H6YA 4LA1A 2GZZA 1A8YA 1QFNA 2FWFA 3EU3A 4YH2A 5L71A 4D73A 1M7TA 1ZOFA 2AJQB 1YF1A 1G7OA 2VD1A 2OADA 4ZBAA 2CQ9A 1K3OA 3LG6A 2H6XA 2HSHA 1WPIA 5CRHA 2VCQA 1Z6NA 1GRXA 1U87A 5DDLA 3DMLA 1USBA 2JACA 1XW9A 2ON7A 3TKRA 1ST9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EC3 A;  3H93 A;  4TR0 A;  2EIO A;  4EDZ A;  3KJY A;  1Z9H A;  2R2J A;  3IDV A;  5JCW A;  2IFQ B;  1TJD A;  4MCU A;  2AYT A;  2C0E A;  5FT3 A;  4OO5 A;  1A0R P;  1QK8 A;  4GTU A;  1ZCP A;  3FZA A;  4GSN A;  5F05 A;  1QUW A;  2LNS A;  2M80 A;  5AIV A;  1YY7 A;  3SBC A;  1MTC A;  2F3M A;  2OBI A;  1PKZ A;  1PKW A;  2H30 A;  1MD3 A;  3IXR A;  2K8V A;  3D21 A;  3DXB A;  10GS A;  1K0C A;  4WBJ A;  3Q74 A;  3EIN A;  3TB2 A;  2AV4 A;  3FW2 A;  4FO5 A;  1M2D A;  2K6V A;  3GA4 A;  4ZIJ A;  2JAD A;  3KP9 A;  2P5R A;  4XS6 A;  2C0D A;  1GUH A;  1WRY A;  2GSQ A;  3C1S A;  4LMV A;  2HZF A;  2LJK A;  4V1A p;  5ECQ B;  1WMJ A;  2OBK A;  1KNG A;  3VFI A;  4O5R A;  4JR4 A;  2WUL A;  3TOU A;  2L59 A;  3ZYW A;  1UVZ A;  1PRX A;  1XPV A;  4POB A;  3CXG A;  5CRG A;  2PWJ A;  4KDY A;  5CAX A;  5G30 A;  1ACV A;  1CQG A;  3ZRE A;  4MJE A;  2MMO A;  1YEP A;  3F3Q A;  2OKA A;  3UL3 A;  2IMK A;  1BED A;  3F4T A;  4HZ4 A;  2FGX A;  5F06 A;  3M1G A;  3C1R A;  4XS1 A;  1M9B A;  1X5D A;  2L5L A;  4HDE A;  4IN0 A;  1SKW B;  2C0F A;  5IM9 A;  3ERF A;  2N5A A;  2IWT A;  4WET A;  4ID0 A;  1FVK A;  4ZBB A;  4FH8 A;  1THX A;  1SEN A;  3GKN A;  4GRF A;  4MF5 A;  1TDI A;  4G2E A;  2DML A;  1A23 A;  2MMN A;  4IP6 A;  3H1N A;  2A4V A;  2GVP A;  1W89 A;  4QQ7 A;  2H0I A;  3TJB A;  2X8G A;  1G6Y A;  3TKQ A;  1VRS D;  2GQM A;  2HRF A;  5D9T A;  2I9H A;  2C3Q A;  3GN3 A;  2YZU A;  1HYU A;  4I8B A;  1X5E A;  5DJM A;  3HDC A;  3LXZ A;  4E8H A;  2VL3 A;  2EIQ A;  4IP1 A;  1NW2 A;  3G9B A;  4DSS A;  3DWV A;  3S9F A;  3LEF A;  1BJX A;  1AW9 A;  4TKY A;  4EVM A;  1V98 A;  2LEG A;  2O8V B;  4RQX A;  4MJC A;  2FA4 A;  5DJL A;  5JCU A;  3A2W A;  4PNG A;  5AN1 A;  3ZIV A;  1ERW A;  2JZS A;  4EKZ A;  1ABA A;  3N9J A;  3RHB A;  4EUY A;  4PXO A;  3TKS A;  1F9M A;  2RM6 A;  1BYE A;  4F2I A;  4L8E A;  2QC7 A;  3HJP A;  1VF4 A;  2LUS A;  1O85 A;  1OKT A;  3LWA A;  3IPZ A;  2CX3 A;  1X9M B;  4TR1 B;  4IJI A;  1OE7 A;  5IMC A;  1N8J A;  1GNE A;  1JZR A;  4XHM A;  3IA1 A;  2C4J A;  3EYT A;  2QKE A;  5GAN D;  6GSW A;  3HD5 A;  1TTZ A;  3H4K A;  3ZMK A;  2FLS A;  2H0H A;  2H66 A;  3KEB A;  4POM A;  3UJ1 A;  2LRT A;  18GS A;  3FK8 A;  2L6C A;  4ZB9 A;  4CW9 A;  3FHK A;  3VWW A;  3ME7 A;  2YOI A;  2C80 A;  2VM2 A;  3OR5 A;  3IC4 A;  1XVQ A;  3MSZ A;  2EIR A;  2V41 A;  4QL7 A;  3I9V 2;  3RDW A;  3F4R A;  2VO4 A;  4OFT A;  2E2G A;  5G5F A;  20GS A;  1PN9 A;  2ZUP A;  3LQ7 A;  4EO3 A;  3GMF A;  2E7P A;  1H4O A;  5F07 A;  2IIY A;  3GUS A;  5G31 A;  4K2D A;  3IRA A;  4MP4 A;  2H73 A;  1UA5 A;  2H72 A;  5J4U A;  2H1B A;  3UVT A;  3BCK A;  2KLX A;  3VUR A;  4IVF A;  2KP2 A;  4X1U A;  5CP1 A;  4IBP A;  1ON4 A;  2O89 A;  4K8M A;  1K0O A;  2YWI A;  1Z5Y E;  4YQU A;  3PIN A;  4AF2 A;  2DJ3 A;  2TRC P;  1X5C A;  3D4M A;  3WT2 A;  1SU9 A;  5EY6 A;  2PPT A;  1ZL9 A;  4PUA A;  5ECI B;  3CMI A;  1T8E B;  3TCO A;  2VCT A;  2REM A;  4F0C A;  2MBT A;  3DGQ A;  5ID2 B;  17GS A;  3CYN A;  1IYI A;  3C8E A;  4JBB A;  5GAP D;  4ISD A;  3HCZ A;  3BD2 A;  1TK8 B;  1AQW A;  4OMV A;  4I97 A;  3GHA A;  3TKS C;  3RBT A;  3BOA A;  2PBJ A;  1FVJ A;  1SD8 A;  4EDY A;  5CNW A;  3H79 A;  4JED A;  4F03 A;  3L9U A;  3QPM A;  1O7U A;  1GP1 A;  4ML1 A;  1O8X A;  3MAK A;  2CV4 A;  3APO A;  1F37 A;  4HU9 A;  2YCD A;  2V1M A;  5H5S A;  2XPD A;  1A0F A;  5JWR B;  4XTS A;  3F9U A;  3GSS A;  4BVY A;  1XWB A;  3H8Q A;  3ERG A;  1S3A A;  4WBR D;  1B8X A;  4FYC A;  1VGL A;  2XBI A;  3M9K A;  4PQH A;  5ELG A;  1EGR A;  2DJ1 A;  5EPF A;  3P8W A;  4L5O A;  3F8U A;  2CVB A;  5INY A;  4N0V A;  4V2N A;  3HZ8 A;  1GTU A;  2H8L A;  3Q6O A;  4LL4 B;  4OO4 A;  3VK9 A;  3IAS 2;  3PH9 A;  1Z7R A;  1M99 A;  2FHE A;  4MH3 A;  1V40 A;  2YV9 A;  4NPB A;  3GL3 A;  1GTI A;  1I9D A;  1K0D A;  3I6A A;  2KP1 A;  3KMN A;  4I6X A;  3GX0 A;  1GSQ A;  4NV2 A;  3KH9 A;  3QMX A;  4TR4 A;  1YEX A;  1TK0 B;  3CRT A;  3ZFL A;  5D9W A;  2YJ7 A;  2WJU A;  1R5P A;  1RQM A;  4KX4 A;  2IMD A;  3GKM A;  1AQX A;  5A4W A;  6GSX A;  2H1G A;  1YJ6 A;  4OCF A;  4NHZ A;  1YF0 A;  3KCM A;  2NPB A;  3F4S A;  4PQI A;  2E0Q A;  4KB3 A;  2GST A;  1DSB A;  1QQ2 A;  1U88 A;  2B1K A;  5IO0 A;  4J56 E;  1CQH A;  5A5K A;  5E59 A;  2GT5 A;  2VCV A;  3WYW A;  3GX8 A;  2HI7 A;  4NAX A;  1GSY A;  2F8F A;  4YQM A;  1DBY A;  1WIK A;  3QFB C;  2HNL A;  2VUP A;  4EXJ A;  4G10 A;  4BL7 A;  2HT9 A;  4V2M A;  4ZIL A;  2HZE A;  3EMX A;  5ECP B;  4BVX A;  4PUR A;  3VLN A;  3D4T A;  2WRT A;  5B6M A;  4ZB6 A;  5DQS A;  5HQP A;  1SL0 B;  6GSY A;  4AGS A;  3TRX A;  1DE2 A;  2I1U A;  5JWQ B;  1JZO A;  2I81 A;  4MH2 A;  3VWV A;  2MZC A;  1LJR A;  4WR5 A;  1OAZ A;  1JLV A;  2GS3 A;  2HRN A;  4NMU A;  1N2A A;  2WDU A;  1K0A A;  3A2X A;  1V9W A;  1OE8 A;  2Z9S A;  3I43 A;  1WP0 A;  1TXX A;  2P5Q A;  4Q5R A;  5IMD A;  3AY8 A;  3TKP A;  1B4P A;  1U6T A;  4AJ6 A;  4NXI A;  2ON5 A;  1WOU A;  4WR4 A;  3HY2 A;  3KTB A;  1PD2 1;  4IHU A;  2DBC A;  2O7K A;  2V6K A;  4WF5 A;  2N5F A;  3ZRD A;  2F51 A;  1F2E A;  1TRV A;  1RK4 A;  3MDK A;  4KAE A;  22GS A;  1URM A;  3GST A;  4NV5 A;  1OC9 B;  3LFL A;  3IK7 A;  3CRU A;  4G9H A;  2WB9 A;  2QGV A;  3LXT A;  5DAK A;  3TUE A;  5IPG A;  1ZZY A;  1BQ7 A;  2F9S A;  3O6T A;  2X8H A;  4PX1 A;  3FZ5 A;  1SJ6 A;  1J0F A;  1TRS A;  1I5G A;  6GSS A;  1E6B A;  1O73 A;  3GV1 A;  4GST A;  1TKD B;  3M3M A;  2YNX A;  1VF3 A;  4ZL9 A;  2K18 A;  3M0F A;  2DIZ A;  1FG4 A;  8GSS A;  5FHI A;  5HFI A;  4TXO B;  5H5Q A;  1SKR B;  3BJ5 A;  4HI7 A;  3F63 A;  11GS A;  4BA7 A;  2DJ0 A;  2FWH A;  2JZR A;  1TW9 A;  2LV3 A;  2MMA A;  4F82 A;  5IO2 A;  1G7E A;  5IIZ A;  2OAC A;  5HR2 A;  4XS4 B;  4OWY A;  5J41 A;  4MF7 A;  4HQS A;  1G6W A;  3UOM A;  1SYX A;  3QOU A;  2OE1 A;  1JZD A;  4OFM A;  3LYK A;  1XIY A;  1GTA A;  2NTO A;  1GSD A;  5AIX A;  1O81 A;  3WT1 A;  3HVS A;  2HFD A;  4JU5 A;  4JZQ A;  3APQ A;  2H6Z A;  3GTU B;  3L78 A;  3ME8 A;  2DJK A;  2RII A;  2L4C A;  3WGX A;  3HVV A;  5H5R A;  5COH A;  4ULX A;  2B5E A;  6GSU A;  1XOA A;  2FY6 A;  4L0U A;  4MZC A;  1FAA A;  5C04 A;  1TRU A;  1JLW A;  1AXD A;  1LU4 A;  3O3T A;  1SK1 A;  1V58 A;  5ECM B;  5LD0 A;  1GH2 A;  1U3A A;  2VCW A;  1AC1 A;  3KH7 A;  1EOH A;  5EL8 A;  3HYP A;  4K0N A;  4LLR A;  1YKC A;  2DSA A;  3FR3 A;  4GQC A;  4IKH A;  5D9V A;  4EF0 A;  2PU9 C;  3TJF A;  1GUL A;  4POL A;  2P31 A;  2EC4 A;  2IFQ A;  2H1A A;  2VL2 A;  5DVB A;  1QGV A;  5ECL B;  1WE0 A;  4V2L A;  1VF1 A;  3A5W A;  3GNJ A;  5FWG A;  3VWU A;  5ELA A;  4K7O A;  2JSY A;  3GH6 A;  1ERV A;  4HUA A;  1XWA A;  1FOV A;  2ZNM A;  4YQV A;  4O7H A;  3CBU A;  3C73 A;  3A2V A;  1C72 A;  3L0H A;  3VPQ A;  1A2M A;  3DVX A;  1XWC A;  1FO5 A;  2PGT A;  1SYR A;  2XC2 A;  3HJO A;  1T1V A;  2I3Y A;  1HNB A;  1WWJ A;  5KN0 A;  1EOG A;  1OVN A;  3K8N A;  12GS A;  1EEM A;  1XWG A;  4PGT A;  4P3Y B;  5IMF A;  2LTK A;  4MLY A;  2L6D A;  1F6M C;  2RLI A;  2A2R A;  5IQY A;  1TI3 A;  1EV4 A;  1XW6 A;  1XZO A;  4GCI A;  1NHO A;  1SL2 B;  5ABR A;  1QXH A;  1O8W A;  4TVE A;  3TGZ A;  3ZFB A;  5DCG A;  3W8J A;  1SL1 B;  2L57 A;  3UAP A;  4MDC A;  1TP9 A;  1ZYE A;  3A3T A;  1TU8 A;  4RQR A;  1HNC A;  3CTG A;  2MMZ A;  1F3A A;  3HHV A;  4MPF A;  3KTL A;  6GST A;  1KTE A;  3FZ4 A;  1V57 A;  3G7Y A;  1XVW A;  4HZ2 A;  2CVD A;  2B7K A;  3FYG A;  5GZZ B;  3QD9 A;  4MA9 A;  3IAM 2;  2GSS A;  3FEU A;  5DAL B;  4ECI A;  3GKX A;  1T4Y A;  3ZIT A;  4ZL7 A;  3P90 A;  4ZL8 A;  4Q5N A;  4D73 B;  2R3X A;  1B4Q A;  3HKR A;  1EP7 A;  4IJ3 A;  1WJK A;  5D73 A;  4N10 A;  1PL2 A;  3LYP A;  4IS0 A;  4TW5 A;  1AIU A;  1SK0 A;  5ECN B;  4Z7X A;  1GSS A;  4BPY A;  3L4N A;  1JFU A;  2H19 A;  3FRC A;  1Z7P A;  4OFN A;  1YKA A;  3UEM A;  3ZZX A;  3W6G A;  2DC5 A;  4N0Z A;  3QCP A;  2M46 A;  14GS A;  5B6N A;  3KIJ A;  2VL2 C;  5JCG A;  5KN1 A;  3GRX A;  4EE0 A;  2B5Y A;  1HNA A;  1XBS A;  5ENU A;  5HFK A;  3TRQ A;  1G0T A;  3Q19 A;  3D22 A;  4ZBD A;  3ERW A;  1GNW A;  1GL8 A;  1MDI A;  1J08 A;  2CA8 A;  3US3 A;  5ECS A;  2LQQ A;  3RAZ A;  2O87 A;  3FKF A;  1Q98 A;  4KA0 A;  3UBL A;  3Q18 A;  1X0R A;  4HQZ A;  2IJY A;  2FWG A;  4K1F A;  3F6D A;  5KEJ A;  4XRA A;  2X99 A;  4ZXG A;  3EWL A;  3BBY A;  3CTF A;  4KSO A;  3L9V A;  1RW1 A;  2TRX A;  4KND A;  2AUV A;  1MDJ A;  5CRW A;  1R4W A;  1FW1 A;  5IMV A;  2AHE A;  3FZ9 A;  1U3I A;  1XW5 A;  4TR1 A;  3JCM L;  1FB0 A;  3KGK A;  2K8S A;  3VWX A;  2GSR A;  5CRE A;  2G2Q A;  3EU4 A;  5G1K A;  4KCA A;  1EGO A;  2CT6 A;  2PER A;  3CSI A;  1BG5 A;  3DEX A;  3QR6 A;  1TK5 B;  2MBS A;  4HEA 2;  1F3B A;  4GQF A;  3LJR A;  1LBK A;  1X9S B;  1XOB A;  1PGT A;  3DYR A;  1M0U A;  3EUR A;  1X9W B;  3LOR A;  2JL4 A;  1GSE A;  9GSS A;  4NHW A;  1O6J A;  3M8N A;  5HFG A;  2VOC A;  2O85 A;  3RPN A;  3L9S A;  1MDK A;  3UAR A;  4J57 E;  1Z3E A;  5ECR B;  1PA3 A;  1SD9 A;  1TRW A;  5D93 A;  3TDG A;  3G7J A;  3TJK A;  2NBS A;  1NHY A;  4X43 A;  1M2A A;  3IV4 A;  5G5E A;  3IE3 A;  3KZQ A;  3KD0 A;  3WGD A;  5C00 A;  1AAZ A;  5B8A A;  1GWC A;  2L4Q A;  4L0W A;  2DMM A;  5CRD A;  1Y6E A;  2VIM A;  3E0U A;  3IK9 A;  1BAY A;  1XXU A;  5G1L A;  2B6M A;  2YWM A;  2LRN A;  5D9X A;  2C0G A;  5B8B A;  4TXV A;  5B7C A;  1T7P B;  1JHB A;  4DSS B;  2X8C A;  1TI1 A;  3IBH A;  4MK3 A;  2WS2 A;  2GDR A;  2FCH A;  1OYJ A;  3TOT A;  5ECO B;  5DQY A;  2VCZ A;  1VF2 A;  3HXS A;  4CHS A;  1W4V A;  1SJI A;  3CSJ A;  4JR6 A;  1B9X C;  1EWX A;  2YN1 A;  1PMT A;  1MD4 A;  2D2Z A;  1B9Y C;  5J5N A;  2FA8 A;  3ZL5 A;  1XCC A;  2KOK A;  2H1D A;  2VLT A;  3ED3 A;  2J9H A;  5ID2 A;  2VLV A;  3P7X A;  2F8A A;  5DCH A;  1ZGN A;  3GL5 A;  4OCE A;  2LJA A;  4DEJ A;  2GTU A;  4KSM A;  2IME A;  2PN8 A;  4H86 A;  2ES7 A;  4BWQ A;  4QL9 A;  3KMO A;  2GZP A;  2N5B A;  1YDK A;  1GSF A;  2RM5 A;  4O92 A;  4OD7 A;  3DRN A;  1S3C A;  2DJJ A;  4I2T A;  4Q5F A;  5HR1 A;  3E9J B;  2B7J A;  2YPM A;  5IOW A;  1AQV A;  2HXK A;  3UBK A;  2CAI A;  2H0G A;  5JWO B;  5AGY A;  2DLX A;  1THO A;  4BWS A;  5IOX A;  4AJ8 A;  2C1Y A;  2JU5 A;  3VI5 A;  4L5L A;  2I4A A;  4ECB A;  3MWH A;  2GGT A;  3VI7 A;  3IHQ A;  4MAB A;  4RUV A;  3C71 A;  4DSR A;  2HYX A;  2PVQ A;  4IQA A;  2PMT A;  3EE2 A;  1PL1 A;  1OC8 A;  2IL3 A;  1GUK A;  3U6V A;  1HQO A;  5AIS A;  2JZT A;  4ECJ A;  2V6O A;  2HLS A;  3PGT A;  4LMW A;  1XWK A;  1K0B A;  4MJA A;  2MYG A;  2HE3 A;  2IPA A;  4KE3 A;  2J23 A;  2B5X A;  2FNO A;  5G2Z A;  2YAN A;  4RI6 A;  1EEJ A;  2BJX A;  2NDO A;  2YWN A;  1R26 A;  1K0N A;  2XHF A;  4MJB A;  5LNK e;  2CAQ A;  1T4Z A;  2K9F A;  4JRR A;  4ML6 A;  2BTO T;  6GSV A;  4KCE A;  5DBQ A;  5EVO A;  1SKS B;  4ZB8 A;  4K9Z A;  1E2Y A;  3IR4 A;  2H01 A;  2X64 A;  2CVK A;  3C7M A;  3QAW A;  4CDO A;  4FYU A;  1B48 A;  5ECK B;  5F0G A;  3LGC A;  2RUF A;  2GT6 A;  1PX7 A;  2R6K A;  4HJ2 A;  2V2G A;  4TN8 A;  2H75 A;  4HOJ A;  3KXO A;  4MPG A;  2VM1 A;  1PX6 A;  4LL1 B;  4DVC A;  3PR8 A;  4HJM A;  1UN2 A;  2FWE A;  2QSI A;  4FYB A;  2GQL A;  4NWY A;  1M9A A;  2BMX A;  3RPP A;  2TIR A;  2OE3 A;  2H70 A;  4KH7 A;  1A2L A;  4WKW A;  1PSQ A;  3CSH A;  4N30 A;  2V32 A;  4TR3 A;  4PQ1 A;  2PUK C;  4MF6 A;  2OJL A;  1ZYQ B;  1GLQ A;  1ERU A;  2YP6 A;  4I5Q A;  2M72 A;  3GUR A;  4F0B A;  4J2F A;  2VLU A;  3D5J A;  13GS A;  1GUM A;  2YJH A;  1QMV A;  2R5G A;  2OE0 A;  1K0M A;  5CYY A;  2A2S A;  2B3S A;  4GLT A;  2VAF A;  3NIV A;  4XIH A;  3E3E A;  4WEY A;  1KEB A;  1V2A A;  3J7Y b;  1FB6 A;  1OKD A;  5HR3 A;  2YWO A;  2DIY A;  1J9B A;  4FIW A;  3APS A;  1R5A A;  3HZ4 A;  5D96 A;  5E4W A;  5IMZ A;  2LJR A;  1A24 A;  4WXT A;  2H76 A;  5KN2 A;  3WD6 A;  4EL1 A;  2IN3 A;  7GSS A;  2LQO A;  2JSZ A;  1OC9 A;  1YZX A;  2XPE A;  1NSW A;  1T00 A;  4AJ7 A;  2AAW A;  2VCX A;  3ZIJ A;  1TOF A;  5D8I A;  4KGI A;  3F0I A;  2L5O A;  3GKK A;  1ILO A;  5F8B A;  4O32 A;  5GSS A;  3GIX A;  1FHE A;  1XFL A;  4DSQ A;  3NZN A;  2AB6 A;  2GZY A;  2PVO C;  2FD3 A;  3TJJ A;  4ECC A;  1R7H A;  5A4V A;  1M2B A;  3TJG A;  5J9B A;  4I2U A;  4TXO A;  5HR0 A;  3QFA C;  1KBN A;  1A2J A;  1NM3 A;  1GLP A;  3R2Q A;  1PQN A;  3FR6 A;  3KM6 A;  4GXZ A;  4TOP A;  4HU7 A;  3GFK A;  4Q5Q A;  2LKU A;  4K7I A;  1TU7 A;  3DVW A;  1EZK A;  3FY7 A;  2C8U A;  4XS4 A;  2HZE B;  3I69 A;  2G0F A;  4KW6 A;  2GQK A;  2YZH A;  2WFC A;  4MZW A;  3RHC A;  3J7Y k;  1IYH A;  3ISO A;  5LCZ A;  3V1W A;  4GWR A;  4POK A;  2HSY A;  2OA7 A;  4GSS A;  3KP8 A;  4IGJ A;  3QAG A;  2XBQ A;  2R4V A;  3MNG A;  2LS5 A;  2LNT A;  3GYK A;  3GTU A;  3TKS E;  2CX4 A;  3HA9 A;  3M9J A;  5J9C A;  3UIW A;  2P0G A;  3D0Z A;  4F9Z A;  3U5R E;  3EMP A;  5IPH A;  4RI7 A;  3F3R A;  4HS1 A;  3D6I A;  1ML6 A;  4JE1 A;  2E2M A;  2YV7 A;  3VPT A;  2LST A;  3QDN A;  2LRC A;  19GS A;  1Y25 A;  1DE1 A;  3GH9 A;  2IMI A;  1SK2 A;  5J3R A;  5GST A;  3FR9 A;  3P2A A;  4PUF C;  5CO3 A;  16GS A;  1ZMA A;  2RUE A;  4K0G A;  1S3D A;  1Z6M A;  4GF0 A;  4ACS A;  1Q4J A;  3ZLP A;  2C3N A;  5A4U A;  2WGR A;  2R37 A;  3W8S A;  3TRP A;  4K7N A;  3O76 A;  4WF4 A;  1GTB A;  5DAK B;  2ALB A;  4ILF A;  3G7I A;  4EC0 A;  4G19 A;  3LSZ A;  2B1L A;  4YAP A;  2WZ9 A;  4N11 A;  4E8E A;  3NOF A;  4IQ1 A;  4MMM A;  3UVH A;  3EVI A;  3UMA A;  3ZML A;  2H74 A;  4KUN A;  1ERT A;  1DUG A;  3F6F A;  2ZCT A;  1T3B A;  3ZTL A;  5IMA A;  1GSU A;  4KDU A;  3SWL A;  3N5O A;  1AUC A;  2NVL A;  5KN3 A;  5ECH B;  2C3T A;  3QAV A;  4TRX A;  2DJ2 A;  1EV9 A;  4K6X A;  3ZVJ A;  1K3L A;  1A8L A;  1K3Y A;  1JZW A;  2KUC A;  4X0X A;  2FUG 2;  4IEL A;  1HD2 A;  3HVX A;  2IMF A;  4MZB A;  4V1A g;  4KDX A;  1EP8 A;  3BCI A;  3DD3 A;  4PNF A;  3HJM A;  4IW9 A;  2VD0 A;  2CZ3 A;  1OC3 A;  1SJZ A;  1BX9 A;  1MEK A;  2GLR A;  4XRD A;  2VL9 A;  3DKS A;  2H71 A;  3DIE A;  3WGE A;  2CZ2 A;  5DAL A;  3IOS A;  4YAV A;  2KHP A;  2WCI A;  1YQ1 A;  4XCS A;  1H75 A;  3ZVJ D;  1UC7 A;  2H6Y A;  4LA1 A;  2GZZ A;  1A8Y A;  1QFN A;  2FWF A;  3EU3 A;  4YH2 A;  5L71 A;  4D73 A;  1M7T A;  1ZOF A;  2AJQ B;  1YF1 A;  1G7O A;  2VD1 A;  2OAD A;  4ZBA A;  2CQ9 A;  1K3O A;  3LG6 A;  2H6X A;  2HSH A;  1WPI A;  5CRH A;  2VCQ A;  1Z6N A;  1GRX A;  1U87 A;  5DDL A;  3DML A;  1USB A;  2JAC A;  1XW9 A;  2ON7 A;  3TKR A;  1ST9 A; 
#chains in the Genus database with same CATH topology
 3EC3 A;  3H93 A;  4TR0 A;  2EIO A;  4EDZ A;  3KJY A;  1Z9H A;  2R2J A;  3IDV A;  5JCW A;  2IFQ B;  1TJD A;  4MCU A;  2AYT A;  2C0E A;  5FT3 A;  4OO5 A;  2HRK A;  1A0R P;  1QK8 A;  4GTU A;  1ZCP A;  3FZA A;  4GSN A;  5F05 A;  1QUW A;  2LNS A;  2M80 A;  5AIV A;  1YY7 A;  3SBC A;  1MTC A;  2F3M A;  2OBI A;  1PKZ A;  1PKW A;  2H30 A;  1MD3 A;  3IXR A;  2K8V A;  3D21 A;  3DXB A;  10GS A;  1K0C A;  4WBJ A;  3Q74 A;  3EIN A;  3TB2 A;  2AV4 A;  3FW2 A;  4YKG A;  4FO5 A;  1M2D A;  4CY6 A;  2K6V A;  3GA4 A;  4ZIJ A;  2JAD A;  3KP9 A;  2P5R A;  4XS6 A;  2C0D A;  1GUH A;  1WRY A;  2GSQ A;  3C1S A;  4LMV A;  2HZF A;  2LJK A;  4V1A p;  5ECQ B;  1WMJ A;  2OBK A;  1KNG A;  3VFI A;  4O5R A;  4JR4 A;  2WUL A;  3TOU A;  2L59 A;  3ZYW A;  1UVZ A;  1PRX A;  1XPV A;  4POB A;  3CXG A;  5CRG A;  2PWJ A;  4KDY A;  5CAX A;  5G30 A;  1ACV A;  1CQG A;  3ZRE A;  4MJE A;  2MMO A;  1FOH A;  1YEP A;  3IHG A;  3F3Q A;  2OKA A;  3UL3 A;  2IMK A;  4G0L A;  1BED A;  3F4T A;  4HZ4 A;  2FGX A;  5F06 A;  3M1G A;  3C1R A;  4XS1 A;  1M9B A;  1X5D A;  2L5L A;  4HDE A;  4IN0 A;  1SKW B;  2C0F A;  5IM9 A;  3ERF A;  2N5A A;  2IWT A;  4WET A;  4ID0 A;  1FVK A;  4ZBB A;  4FH8 A;  1THX A;  1SEN A;  3GKN A;  4GRF A;  4MF5 A;  1TDI A;  4G2E A;  2DML A;  1A23 A;  2MMN A;  4IP6 A;  3H1N A;  2A4V A;  2GVP A;  1W89 A;  4QQ7 A;  2H0I A;  3TJB A;  2X8G A;  1G6Y A;  3TKQ A;  1VRS D;  2GQM A;  2HRF A;  5D9T A;  3EPT A;  2I9H A;  4FQU A;  2C3Q A;  3GN3 A;  2YZU A;  1HYU A;  4A5P A;  4I8B A;  1X5E A;  5DJM A;  3HDC A;  3LXZ A;  4E8H A;  2VL3 A;  2EIQ A;  4IP1 A;  1NW2 A;  3G9B A;  4DSS A;  3DWV A;  3S9F A;  3LEF A;  1BJX A;  1AW9 A;  3CQF A;  4TKY A;  4EVM A;  2R0C A;  1V98 A;  2LEG A;  4K5R A;  2O8V B;  4RQX A;  4MJC A;  2FA4 A;  5DJL A;  5JCU A;  3A2W A;  4PNG A;  5AN1 A;  3ZIV A;  1ERW A;  2JZS A;  4EKZ A;  1ABA A;  3N9J A;  3RHB A;  4EUY A;  4PXO A;  3TKS A;  1F9M A;  2RM6 A;  1BYE A;  4F2I A;  4L8E A;  2QC7 A;  3HJP A;  1VF4 A;  2LUS A;  1O85 A;  1OKT A;  3LWA A;  3IPZ A;  2CX3 A;  1X9M B;  4TR1 B;  2X4A A;  4IJI A;  1OE7 A;  5IMC A;  1N8J A;  1GNE A;  1JZR A;  4XHM A;  3IA1 A;  2C4J A;  3EYT A;  2QKE A;  5GAN D;  6GSW A;  3HD5 A;  1TTZ A;  3H4K A;  3ZMK A;  2FLS A;  2H0H A;  2H66 A;  3KEB A;  4POM A;  3UJ1 A;  2LRT A;  18GS A;  3FK8 A;  2L6C A;  4ZB9 A;  4CW9 A;  3FHK A;  3VWW A;  3ME7 A;  2YOI A;  2C80 A;  2VM2 A;  3OR5 A;  3IC4 A;  1XVQ A;  3MSZ A;  2EIR A;  2V41 A;  4QL7 A;  3I9V 2;  3RDW A;  3F4R A;  2VO4 A;  4OFT A;  2E2G A;  5G5F A;  20GS A;  1PN9 A;  2ZUP A;  3LQ7 A;  4EO3 A;  3GMF A;  2E7P A;  1H4O A;  5F07 A;  2IIY A;  3GUS A;  5G31 A;  1S3R A;  3FMW A;  4K2D A;  3IRA A;  4MP4 A;  2H73 A;  1UA5 A;  2H72 A;  5J4U A;  2H1B A;  3UVT A;  2DKH A;  3BCK A;  2KLX A;  3HVN A;  3VUR A;  4IVF A;  2KP2 A;  4X1U A;  5CP1 A;  4IBP A;  1ON4 A;  2O89 A;  4K8M A;  1K0O A;  2YWI A;  1Z5Y E;  4YQU A;  3PIN A;  4AF2 A;  2DJ3 A;  2TRC P;  1X5C A;  3D4M A;  3WT2 A;  1SU9 A;  2PPT A;  5EY6 A;  1ZL9 A;  4PUA A;  5ECI B;  3CMI A;  1T8E B;  3TCO A;  2VCT A;  2REM A;  4F0C A;  2MBT A;  3DGQ A;  5ID2 B;  17GS A;  3CYN A;  1IYI A;  3C8E A;  4JBB A;  5GAP D;  4ISD A;  2QA1 A;  3HCZ A;  3BD2 A;  1TK8 B;  1AQW A;  4OMV A;  4I97 A;  3GHA A;  3TKS C;  3RBT A;  3BOA A;  2PBJ A;  1FVJ A;  1SD8 A;  4EDY A;  5CNW A;  3H79 A;  4JED A;  2HRA A;  4F03 A;  3L9U A;  3QPM A;  1O7U A;  4CY8 A;  1GP1 A;  4ML1 A;  1O8X A;  3MAK A;  2CV4 A;  3APO A;  1F37 A;  4HU9 A;  2YCD A;  2V1M A;  5H5S A;  2XPD A;  1A0F A;  5JWR B;  2A4H A;  4XTS A;  3F9U A;  3GSS A;  4BVY A;  1XWB A;  3H8Q A;  3ERG A;  1S3A A;  4WBR D;  1B8X A;  4FYC A;  1VGL A;  2XBI A;  3M9K A;  4PQH A;  5ELG A;  1EGR A;  2DJ1 A;  5EPF A;  3P8W A;  4L5O A;  3F8U A;  2CVB A;  5INY A;  4N0V A;  4V2N A;  3HZ8 A;  1GTU A;  2R0G A;  2H8L A;  3Q6O A;  4LL4 B;  4OO4 A;  3VK9 A;  3IAS 2;  3MIX A;  3PH9 A;  1Z7R A;  1M99 A;  2FHE A;  4MH3 A;  1V40 A;  2YV9 A;  4NPB A;  3GL3 A;  1GTI A;  1I9D A;  1K0D A;  3I6A A;  2KP1 A;  3KMN A;  4I6X A;  3GX0 A;  1GSQ A;  4NV2 A;  3KH9 A;  3QMX A;  4TR4 A;  1YEX A;  1TK0 B;  3CRT A;  3ZFL A;  5D9W A;  2YJ7 A;  2WJU A;  1PFO A;  2QA2 A;  1R5P A;  1RQM A;  4KX4 A;  2IMD A;  3GKM A;  1AQX A;  5A4W A;  6GSX A;  2H1G A;  1YJ6 A;  4OCF A;  4NHZ A;  1YF0 A;  3KCM A;  2NPB A;  3F4S A;  4PQI A;  2E0Q A;  4KB3 A;  2GST A;  1DSB A;  1QQ2 A;  1U88 A;  2B1K A;  5IO0 A;  4J56 E;  1CQH A;  5A5K A;  5E59 A;  2GT5 A;  2R0P A;  2VCV A;  3WYW A;  3GX8 A;  2HI7 A;  4NAX A;  1GSY A;  2F8F A;  4YQM A;  1DBY A;  1WIK A;  3QFB C;  2HNL A;  2VUP A;  4EXJ A;  4G10 A;  4BL7 A;  2HT9 A;  4V2M A;  5BMU A;  4ZIL A;  2HZE A;  3EMX A;  5ECP B;  4BVX A;  4PUR A;  3VLN A;  3D4T A;  2WRT A;  5B6M A;  4ZB6 A;  5DQS A;  5HQP A;  1SL0 B;  6GSY A;  4AGS A;  3TRX A;  1DE2 A;  2I1U A;  5JWQ B;  4Z2R A;  1JZO A;  2I81 A;  4MH2 A;  3VWV A;  2MZC A;  1LJR A;  4WR5 A;  1OAZ A;  1JLV A;  2GS3 A;  2HRN A;  4NMU A;  1N2A A;  2WDU A;  1K0A A;  3A2X A;  1V9W A;  1OE8 A;  2Z9S A;  3I43 A;  1WP0 A;  1TXX A;  2P5Q A;  4Q5R A;  5IMD A;  3AY8 A;  3TKP A;  1B4P A;  1U6T A;  4AJ6 A;  4NXI A;  2ON5 A;  1WOU A;  4WR4 A;  3HY2 A;  3KTB A;  1PD2 1;  4IHU A;  4KF9 A;  2DBC A;  2O7K A;  2V6K A;  4WF5 A;  2N5F A;  3ZRD A;  4Z2T A;  2F51 A;  1F2E A;  4X4J A;  1TRV A;  1RK4 A;  3R3E A;  3MDK A;  4KAE A;  22GS A;  1URM A;  3GST A;  4NV5 A;  1OC9 B;  3LFL A;  3IK7 A;  3CRU A;  4G9H A;  2WB9 A;  2QGV A;  3LXT A;  5DAK A;  3TUE A;  5IPG A;  1ZZY A;  1BQ7 A;  2F9S A;  3O6T A;  2X8H A;  4PX1 A;  3FZ5 A;  1SJ6 A;  1J0F A;  1TRS A;  1I5G A;  6GSS A;  1E6B A;  1O73 A;  3GV1 A;  4GST A;  1TKD B;  3M3M A;  2YNX A;  1VF3 A;  4ZL9 A;  2K18 A;  3M0F A;  2DIZ A;  1FG4 A;  8GSS A;  5FHI A;  5HFI A;  4TXO B;  5H5Q A;  1SKR B;  3BJ5 A;  4HI7 A;  3F63 A;  11GS A;  4BA7 A;  2DJ0 A;  2FWH A;  2JZR A;  1TW9 A;  2LV3 A;  2MMA A;  4F82 A;  5IO2 A;  1G7E A;  5IIZ A;  2OAC A;  5HR2 A;  4XS4 B;  4OWY A;  5J41 A;  4MF7 A;  4HQS A;  1G6W A;  3UOM A;  1M3I A;  1SYX A;  3QOU A;  2OE1 A;  1JZD A;  4OFM A;  3LYK A;  1XIY A;  1GTA A;  2NTO A;  1GSD A;  5AIX A;  1O81 A;  3WT1 A;  3HVS A;  2HFD A;  4JU5 A;  4JZQ A;  3APQ A;  2H6Z A;  3GTU B;  3L78 A;  3ME8 A;  2DJK A;  2RII A;  2L4C A;  3WGX A;  3HVV A;  5H5R A;  5COH A;  4ULX A;  2B5E A;  6GSU A;  1XOA A;  2FY6 A;  4L0U A;  4MZC A;  1FAA A;  5C04 A;  1TRU A;  1JLW A;  1XG8 A;  1AXD A;  1LU4 A;  3O3T A;  1SK1 A;  1V58 A;  5ECM B;  5LD0 A;  1GH2 A;  1U3A A;  2VCW A;  1AC1 A;  3KH7 A;  1EOH A;  5EL8 A;  3HYP A;  4K0N A;  4LLR A;  1YKC A;  2DSA A;  3FR3 A;  4GQC A;  4IKH A;  5D9V A;  4EF0 A;  2PU9 C;  3TJF A;  1GUL A;  4POL A;  2P31 A;  3LW9 A;  4BVY B;  2EC4 A;  2IFQ A;  2H1A A;  2VL2 A;  5DVB A;  1QGV A;  5ECL B;  1WE0 A;  4V2L A;  1VF1 A;  3A5W A;  3GNJ A;  5FWG A;  3VWU A;  5ELA A;  4K7O A;  2JSY A;  3GH6 A;  1ERV A;  4HUA A;  1XWA A;  1FOV A;  2ZNM A;  4YQV A;  4O7H A;  3CBU A;  3C73 A;  3A2V A;  1C72 A;  3L0H A;  3VPQ A;  1A2M A;  3DVX A;  4HSC X;  1XWC A;  1FO5 A;  2PGT A;  1SYR A;  2XC2 A;  3HJO A;  1T1V A;  2I3Y A;  1HNB A;  1WWJ A;  5KN0 A;  1EOG A;  1OVN A;  3K8N A;  12GS A;  1EEM A;  1XWG A;  4PGT A;  4P3Y B;  5IMF A;  1M3J A;  2LTK A;  4MLY A;  2L6D A;  1F6M C;  2RLI A;  2A2R A;  5IQY A;  1TI3 A;  1EV4 A;  1XW6 A;  1XZO A;  1PN0 A;  4GCI A;  1NHO A;  1SL2 B;  5ABR A;  1QXH A;  1O8W A;  4TVE A;  3TGZ A;  3ZFB A;  5DCG A;  3W8J A;  3A5I A;  1SL1 B;  2L57 A;  3UAP A;  4MDC A;  1TP9 A;  1ZYE A;  3A3T A;  1TU8 A;  4RQR A;  1HNC A;  3CTG A;  2MMZ A;  1F3A A;  3HHV A;  4MPF A;  3KTL A;  6GST A;  1KTE A;  3FZ4 A;  1V57 A;  3G7Y A;  1XVW A;  4HZ2 A;  2A2P A;  2B7K A;  2CVD A;  3FYG A;  5GZZ B;  3QD9 A;  4MA9 A;  3IAM 2;  2GSS A;  4O5Q A;  3FEU A;  5DAL B;  4ECI A;  3GKX A;  1T4Y A;  3ZIT A;  4ZL7 A;  3P90 A;  4ZL8 A;  4Q5N A;  4D73 B;  2R3X A;  1B4Q A;  3HKR A;  1EP7 A;  4IJ3 A;  1WJK A;  5D73 A;  4N10 A;  1PL2 A;  3LYP A;  4IS0 A;  4TW5 A;  1AIU A;  1SK0 A;  5ECN B;  4Z7X A;  1GSS A;  4BPY A;  3L4N A;  1JFU A;  2H19 A;  3FRC A;  1Z7P A;  4OFN A;  1YKA A;  3UEM A;  3ZZX A;  3W6G A;  2DC5 A;  4N0Z A;  3QCP A;  2M46 A;  14GS A;  5B6N A;  3KIJ A;  2VL2 C;  5JCG A;  5KN1 A;  3GRX A;  4MNN A;  4EE0 A;  2B5Y A;  1HNA A;  1XBS A;  5ENU A;  5HFK A;  3TRQ A;  1G0T A;  3Q19 A;  3D22 A;  4ZBD A;  3ERW A;  1GNW A;  1GL8 A;  1MDI A;  1J08 A;  2CA8 A;  3US3 A;  5ECS A;  2LQQ A;  3RAZ A;  2O87 A;  3FKF A;  1Q98 A;  4KA0 A;  3UBL A;  3Q18 A;  1X0R A;  4HQZ A;  2IJY A;  2FWG A;  4K1F A;  3F6D A;  5KEJ A;  4XRA A;  2X99 A;  4ZXG A;  3EWL A;  4YKF A;  3BBY A;  3CTF A;  4PTS A;  4KSO A;  3L9V A;  1RW1 A;  2TRX A;  4KND A;  2AUV A;  1MDJ A;  4G0K A;  5CRW A;  1R4W A;  1FW1 A;  5IMV A;  2AHE A;  3FZ9 A;  1U3I A;  2X49 A;  2UZ8 A;  1XW5 A;  4TR1 A;  3JCM L;  1FB0 A;  3KGK A;  2K8S A;  3VWX A;  2GSR A;  5CRE A;  2G2Q A;  3EU4 A;  5G1K A;  4KCA A;  1EGO A;  2CT6 A;  2PER A;  3CSI A;  1BG5 A;  3DEX A;  3QR6 A;  1TK5 B;  2MBS A;  4HEA 2;  1F3B A;  4GQF A;  3LJR A;  1LBK A;  1X9S B;  1XOB A;  1PGT A;  3DYR A;  1M0U A;  3EUR A;  1X9W B;  3LOR A;  2JL4 A;  1GSE A;  9GSS A;  4NHW A;  1O6J A;  3M8N A;  5HFG A;  2VOC A;  2O85 A;  3RPN A;  3L9S A;  1MDK A;  3UAR A;  4J57 E;  1Z3E A;  5ECR B;  1PA3 A;  1SD9 A;  1TRW A;  5D93 A;  3TDG A;  3G7J A;  3TJK A;  2NBS A;  1NHY A;  4X43 A;  1M2A A;  3IV4 A;  5G5E A;  3IE3 A;  3KZQ A;  3KD0 A;  3WGD A;  5C00 A;  1AAZ A;  5B8A A;  1GWC A;  2L4Q A;  4L0W A;  2DMM A;  5CRD A;  1Y6E A;  2VIM A;  3E0U A;  3IK9 A;  1BAY A;  1XXU A;  5G1L A;  2B6M A;  2YWM A;  2LRN A;  5D9X A;  2C0G A;  5B8B A;  4TXV A;  5B7C A;  1T7P B;  1JHB A;  4DSS B;  2X8C A;  1TI1 A;  4USS A;  3IBH A;  4MK3 A;  2WS2 A;  2GDR A;  2FCH A;  1OYJ A;  3TOT A;  5ECO B;  5DQY A;  2VCZ A;  1VF2 A;  3HXS A;  4CHS A;  1W4V A;  1SJI A;  3CSJ A;  4JR6 A;  1B9X C;  1EWX A;  2YN1 A;  1PMT A;  1MD4 A;  2D2Z A;  1B9Y C;  5J5N A;  2FA8 A;  3ZL5 A;  1XCC A;  2KOK A;  2H1D A;  2VLT A;  3ED3 A;  2J9H A;  5BRT A;  5ID2 A;  2VLV A;  3P7X A;  2F8A A;  5DCH A;  1ZGN A;  3IC8 A;  3GL5 A;  4OCE A;  2LJA A;  1ZYP A;  4DEJ A;  2GTU A;  4KSM A;  2IME A;  2PN8 A;  4H86 A;  2ES7 A;  4BWQ A;  4EIQ A;  4QL9 A;  3KMO A;  2GZP A;  2N5B A;  1YDK A;  1GSF A;  2RM5 A;  4O92 A;  4OD7 A;  3DRN A;  1S3C A;  2DJJ A;  4I2T A;  4Q5F A;  5HR1 A;  3E9J B;  2B7J A;  2YPM A;  5IOW A;  1AQV A;  2HXK A;  3UBK A;  1ZYN A;  2CAI A;  2H0G A;  5JWO B;  5AGY A;  2DLX A;  1THO A;  4BWS A;  5IOX A;  4AJ8 A;  2C1Y A;  2JU5 A;  3VI5 A;  4L5L A;  2I4A A;  4ECB A;  3MWH A;  2GGT A;  3VI7 A;  3IHQ A;  4MAB A;  4RUV A;  3C71 A;  4DSR A;  2HYX A;  2PVQ A;  4IQA A;  2PMT A;  3EE2 A;  1PL1 A;  1OC8 A;  2IL3 A;  1GUK A;  3U6V A;  1HQO A;  5AIS A;  2JZT A;  4ECJ A;  2V6O A;  2HLS A;  3PGT A;  4LMW A;  1XWK A;  1K0B A;  4MJA A;  2MYG A;  2HE3 A;  2IPA A;  4KE3 A;  2J23 A;  2B5X A;  2FNO A;  5G2Z A;  2YAN A;  4RI6 A;  1EEJ A;  2BJX A;  2NDO A;  2YWN A;  1R26 A;  1K0N A;  2XHF A;  4MJB A;  5LNK e;  2CAQ A;  1T4Z A;  2K9F A;  4JRR A;  4ML6 A;  2BTO T;  6GSV A;  4KCE A;  5DBQ A;  5EVO A;  1SKS B;  4ZB8 A;  4K9Z A;  1E2Y A;  3IR4 A;  2H01 A;  2X64 A;  2CVK A;  3C7M A;  3QAW A;  4CDO A;  4FYU A;  1B48 A;  5ECK B;  5F0G A;  3LGC A;  2RUF A;  2GT6 A;  1PX7 A;  2R6K A;  4HJ2 A;  2V2G A;  4TN8 A;  2H75 A;  4HOJ A;  3KXO A;  4MPG A;  4EIP A;  2VM1 A;  1PX6 A;  4LL1 B;  4DVC A;  3PR8 A;  4HJM A;  4ICY A;  4O5U A;  1UN2 A;  2FWE A;  2QSI A;  4FYB A;  2GQL A;  4NWY A;  1M9A A;  2BMX A;  3RPP A;  4BIK A;  2TIR A;  2OE3 A;  2H70 A;  4KH7 A;  2HSM A;  1A2L A;  4WKW A;  1PSQ A;  3CSH A;  4N30 A;  2V32 A;  4TR3 A;  4PQ1 A;  2PUK C;  4MF6 A;  2OJL A;  1ZYQ B;  1GLQ A;  1ERU A;  2YP6 A;  4I5Q A;  2M72 A;  3GUR A;  4F0B A;  4J2F A;  2VLU A;  3D5J A;  13GS A;  1GUM A;  2YJH A;  1QMV A;  2R5G A;  2OE0 A;  1K0M A;  5CYY A;  2A2S A;  4Z2U A;  2B3S A;  5KOX A;  4GLT A;  2VAF A;  3NIV A;  4XIH A;  3E3E A;  4WEY A;  1KEB A;  1V2A A;  3J7Y b;  1FB6 A;  1OKD A;  5HR3 A;  2YWO A;  2DIY A;  1J9B A;  4FIW A;  3APS A;  1R5A A;  3HZ4 A;  5D96 A;  5E4W A;  5IMZ A;  2LJR A;  1A24 A;  4WXT A;  2H76 A;  5KN2 A;  3WD6 A;  4EL1 A;  2IN3 A;  7GSS A;  2LQO A;  2JSZ A;  5KOW A;  1OC9 A;  1YZX A;  2XPE A;  1NSW A;  1T00 A;  4K2X A;  4AJ7 A;  2AAW A;  3PPU A;  2VCX A;  3ZIJ A;  1TOF A;  5D8I A;  4KGI A;  3F0I A;  2L5O A;  3GKK A;  1ILO A;  5F8B A;  4O32 A;  5GSS A;  3GIX A;  1FHE A;  1XFL A;  4DSQ A;  3NZN A;  2AB6 A;  2GZY A;  2PVO C;  2FD3 A;  3TJJ A;  4ECC A;  1R7H A;  5A4V A;  1M2B A;  3TJG A;  5J9B A;  4I2U A;  4TXO A;  5HR0 A;  3QFA C;  1KBN A;  1A2J A;  1NM3 A;  1GLP A;  3R2Q A;  1PQN A;  3FR6 A;  3KM6 A;  4GXZ A;  4TOP A;  4HU7 A;  3GFK A;  4Q5Q A;  2LKU A;  4K7I A;  1TU7 A;  3DVW A;  1EZK A;  4K5S A;  4BL7 B;  3FY7 A;  2C8U A;  4XS4 A;  2HZE B;  3I69 A;  2G0F A;  4KW6 A;  2GQK A;  4BVX B;  2YZH A;  2WFC A;  4MZW A;  3RHC A;  3J7Y k;  1IYH A;  3ISO A;  5LCZ A;  3V1W A;  4GWR A;  4POK A;  2HSY A;  2OA7 A;  4GSS A;  3KP8 A;  4IGJ A;  3QAG A;  2XBQ A;  2R4V A;  4G0I A;  3MNG A;  2LS5 A;  2LNT A;  3GYK A;  3GTU A;  3TKS E;  2CX4 A;  3HA9 A;  3M9J A;  5J9C A;  3UIW A;  2P0G A;  3D0Z A;  4F9Z A;  3U5R E;  3EMP A;  5IPH A;  4RI7 A;  3F3R A;  4HS1 A;  3D6I A;  1ML6 A;  4JE1 A;  2E2M A;  2YV7 A;  3VPT A;  2LST A;  3QDN A;  2LRC A;  19GS A;  1Y25 A;  1DE1 A;  3GH9 A;  2IMI A;  1SK2 A;  5J3R A;  5GST A;  3FR9 A;  3P2A A;  4PUF C;  5CO3 A;  16GS A;  1ZMA A;  2RUE A;  4K0G A;  1S3D A;  1Z6M A;  4GF0 A;  4ACS A;  1Q4J A;  3ZLP A;  2C3N A;  5A4U A;  2WGR A;  2R37 A;  3W8S A;  3TRP A;  4K7N A;  3O76 A;  4WF4 A;  1GTB A;  5DAK B;  2ALB A;  4ILF A;  3G7I A;  4EC0 A;  4G19 A;  3LSZ A;  2B1L A;  4YAP A;  2WZ9 A;  4N11 A;  4E8E A;  3NOF A;  4IQ1 A;  4MMM A;  3UVH A;  3MYD A;  3EVI A;  3UMA A;  3ZML A;  2H74 A;  4KUN A;  1ERT A;  1DUG A;  3F6F A;  2ZCT A;  1T3B A;  3ZTL A;  5IMA A;  1GSU A;  4KDU A;  3SWL A;  3N5O A;  1AUC A;  2NVL A;  5KN3 A;  5ECH B;  2C3T A;  3QAV A;  4TRX A;  2DJ2 A;  1EV9 A;  4K6X A;  3ZVJ A;  1K3L A;  1A8L A;  1K3Y A;  1JZW A;  2KUC A;  4X0X A;  2FUG 2;  4IEL A;  1HD2 A;  3HVX A;  2IMF A;  4MZB A;  4V1A g;  4KDX A;  1EP8 A;  3BCI A;  3DD3 A;  4PNF A;  3HJM A;  4IW9 A;  2VD0 A;  2CZ3 A;  1OC3 A;  2DKI A;  1SJZ A;  1BX9 A;  1MEK A;  2GLR A;  4XRD A;  2VL9 A;  3DKS A;  2H71 A;  3DIE A;  3WGE A;  2CZ2 A;  5DAL A;  3IOS A;  4YAV A;  2KHP A;  2WCI A;  1YQ1 A;  4XCS A;  1H75 A;  3ZVJ D;  1UC7 A;  2H6Y A;  4LA1 A;  2GZZ A;  1A8Y A;  1QFN A;  2FWF A;  3EU3 A;  4YH2 A;  5L71 A;  4D73 A;  1M7T A;  1ZOF A;  2AJQ B;  1YF1 A;  1G7O A;  2VD1 A;  2OAD A;  4ZBA A;  2CQ9 A;  1K3O A;  3LG6 A;  2H6X A;  2HSH A;  1WPI A;  5CRH A;  2VCQ A;  1Z6N A;  1GRX A;  1U87 A;  5DDL A;  3DML A;  1USB A;  2JAC A;  1XW9 A;  2ON7 A;  3TKR A;  1ST9 A; 
#chains in the Genus database with same CATH homology
 3EC3 A;  3H93 A;  4TR0 A;  2EIO A;  4EDZ A;  3KJY A;  1Z9H A;  2R2J A;  3IDV A;  5JCW A;  2IFQ B;  1TJD A;  4MCU A;  2AYT A;  2C0E A;  5FT3 A;  4OO5 A;  2HRK A;  1A0R P;  1QK8 A;  4GTU A;  1ZCP A;  3FZA A;  4GSN A;  5F05 A;  1QUW A;  2LNS A;  2M80 A;  5AIV A;  1YY7 A;  3SBC A;  1MTC A;  2F3M A;  2OBI A;  1PKZ A;  1PKW A;  2H30 A;  1MD3 A;  3IXR A;  2K8V A;  3D21 A;  3DXB A;  10GS A;  1K0C A;  4WBJ A;  3Q74 A;  3EIN A;  3TB2 A;  2AV4 A;  3FW2 A;  4YKG A;  4FO5 A;  1M2D A;  4CY6 A;  2K6V A;  3GA4 A;  4ZIJ A;  2JAD A;  3KP9 A;  2P5R A;  4XS6 A;  2C0D A;  1GUH A;  1WRY A;  2GSQ A;  3C1S A;  4LMV A;  2HZF A;  2LJK A;  4V1A p;  5ECQ B;  1WMJ A;  2OBK A;  1KNG A;  3VFI A;  4O5R A;  4JR4 A;  2WUL A;  3TOU A;  2L59 A;  3ZYW A;  1UVZ A;  1PRX A;  1XPV A;  4POB A;  3CXG A;  5CRG A;  2PWJ A;  4KDY A;  5CAX A;  5G30 A;  1ACV A;  1CQG A;  3ZRE A;  4MJE A;  2MMO A;  1FOH A;  1YEP A;  3IHG A;  3F3Q A;  2OKA A;  3UL3 A;  2IMK A;  4G0L A;  1BED A;  3F4T A;  4HZ4 A;  2FGX A;  5F06 A;  3M1G A;  3C1R A;  4XS1 A;  1M9B A;  1X5D A;  2L5L A;  4HDE A;  4IN0 A;  1SKW B;  2C0F A;  5IM9 A;  3ERF A;  2N5A A;  2IWT A;  4WET A;  4ID0 A;  1FVK A;  4ZBB A;  4FH8 A;  1THX A;  1SEN A;  3GKN A;  4GRF A;  4MF5 A;  1TDI A;  4G2E A;  2DML A;  1A23 A;  2MMN A;  4IP6 A;  3H1N A;  2A4V A;  2GVP A;  1W89 A;  4QQ7 A;  2H0I A;  3TJB A;  2X8G A;  1G6Y A;  3TKQ A;  1VRS D;  2GQM A;  2HRF A;  5D9T A;  3EPT A;  2I9H A;  4FQU A;  2C3Q A;  3GN3 A;  2YZU A;  1HYU A;  4A5P A;  4I8B A;  1X5E A;  5DJM A;  3HDC A;  3LXZ A;  4E8H A;  2VL3 A;  2EIQ A;  4IP1 A;  1NW2 A;  3G9B A;  4DSS A;  3DWV A;  3S9F A;  3LEF A;  1BJX A;  1AW9 A;  4TKY A;  4EVM A;  2R0C A;  1V98 A;  2LEG A;  4K5R A;  2O8V B;  4RQX A;  4MJC A;  2FA4 A;  5DJL A;  5JCU A;  3A2W A;  4PNG A;  5AN1 A;  3ZIV A;  1ERW A;  2JZS A;  4EKZ A;  1ABA A;  3N9J A;  3RHB A;  4EUY A;  4PXO A;  3TKS A;  1F9M A;  2RM6 A;  1BYE A;  4F2I A;  4L8E A;  2QC7 A;  3HJP A;  1VF4 A;  2LUS A;  1O85 A;  1OKT A;  3LWA A;  3IPZ A;  2CX3 A;  1X9M B;  4TR1 B;  2X4A A;  4IJI A;  1OE7 A;  5IMC A;  1N8J A;  1GNE A;  1JZR A;  4XHM A;  3IA1 A;  2C4J A;  3EYT A;  2QKE A;  5GAN D;  6GSW A;  3HD5 A;  1TTZ A;  3H4K A;  3ZMK A;  2FLS A;  2H0H A;  2H66 A;  3KEB A;  4POM A;  3UJ1 A;  2LRT A;  18GS A;  3FK8 A;  2L6C A;  4ZB9 A;  4CW9 A;  3FHK A;  3VWW A;  3ME7 A;  2YOI A;  2C80 A;  2VM2 A;  3OR5 A;  3IC4 A;  1XVQ A;  3MSZ A;  2EIR A;  2V41 A;  4QL7 A;  3I9V 2;  3RDW A;  3F4R A;  2VO4 A;  4OFT A;  2E2G A;  5G5F A;  20GS A;  1PN9 A;  2ZUP A;  3LQ7 A;  4EO3 A;  3GMF A;  2E7P A;  1H4O A;  5F07 A;  2IIY A;  3GUS A;  5G31 A;  3FMW A;  4K2D A;  3IRA A;  4MP4 A;  2H73 A;  1UA5 A;  2H72 A;  5J4U A;  2H1B A;  3UVT A;  2DKH A;  3BCK A;  2KLX A;  3VUR A;  4IVF A;  2KP2 A;  4X1U A;  5CP1 A;  4IBP A;  1ON4 A;  2O89 A;  4K8M A;  1K0O A;  2YWI A;  1Z5Y E;  4YQU A;  3PIN A;  4AF2 A;  2DJ3 A;  2TRC P;  1X5C A;  3D4M A;  3WT2 A;  1SU9 A;  2PPT A;  5EY6 A;  1ZL9 A;  4PUA A;  5ECI B;  3CMI A;  1T8E B;  3TCO A;  2VCT A;  2REM A;  4F0C A;  2MBT A;  3DGQ A;  5ID2 B;  17GS A;  3CYN A;  1IYI A;  3C8E A;  4JBB A;  5GAP D;  4ISD A;  2QA1 A;  3HCZ A;  3BD2 A;  1TK8 B;  1AQW A;  4OMV A;  4I97 A;  3GHA A;  3TKS C;  3RBT A;  3BOA A;  2PBJ A;  1FVJ A;  1SD8 A;  4EDY A;  5CNW A;  3H79 A;  4JED A;  2HRA A;  4F03 A;  3L9U A;  3QPM A;  1O7U A;  4CY8 A;  1GP1 A;  4ML1 A;  1O8X A;  3MAK A;  2CV4 A;  3APO A;  1F37 A;  4HU9 A;  2YCD A;  2V1M A;  5H5S A;  2XPD A;  1A0F A;  5JWR B;  2A4H A;  4XTS A;  3F9U A;  3GSS A;  4BVY A;  1XWB A;  3H8Q A;  3ERG A;  1S3A A;  4WBR D;  1B8X A;  4FYC A;  1VGL A;  2XBI A;  3M9K A;  4PQH A;  5ELG A;  1EGR A;  2DJ1 A;  5EPF A;  3P8W A;  4L5O A;  3F8U A;  2CVB A;  5INY A;  4N0V A;  4V2N A;  3HZ8 A;  1GTU A;  2R0G A;  2H8L A;  3Q6O A;  4LL4 B;  4OO4 A;  3VK9 A;  3IAS 2;  3MIX A;  3PH9 A;  1Z7R A;  1M99 A;  2FHE A;  4MH3 A;  1V40 A;  2YV9 A;  4NPB A;  3GL3 A;  1GTI A;  1I9D A;  1K0D A;  3I6A A;  2KP1 A;  3KMN A;  4I6X A;  3GX0 A;  1GSQ A;  4NV2 A;  3KH9 A;  3QMX A;  4TR4 A;  1YEX A;  1TK0 B;  3CRT A;  3ZFL A;  5D9W A;  2YJ7 A;  2WJU A;  2QA2 A;  1R5P A;  1RQM A;  4KX4 A;  2IMD A;  3GKM A;  1AQX A;  5A4W A;  6GSX A;  2H1G A;  1YJ6 A;  4OCF A;  4NHZ A;  1YF0 A;  3KCM A;  2NPB A;  3F4S A;  4PQI A;  2E0Q A;  4KB3 A;  2GST A;  1DSB A;  1QQ2 A;  1U88 A;  2B1K A;  5IO0 A;  4J56 E;  1CQH A;  5A5K A;  5E59 A;  2GT5 A;  2R0P A;  2VCV A;  3WYW A;  3GX8 A;  2HI7 A;  4NAX A;  1GSY A;  2F8F A;  4YQM A;  1DBY A;  1WIK A;  3QFB C;  2HNL A;  2VUP A;  4EXJ A;  4G10 A;  4BL7 A;  2HT9 A;  4V2M A;  5BMU A;  4ZIL A;  2HZE A;  3EMX A;  5ECP B;  4BVX A;  4PUR A;  3VLN A;  3D4T A;  2WRT A;  5B6M A;  4ZB6 A;  5DQS A;  5HQP A;  1SL0 B;  6GSY A;  4AGS A;  3TRX A;  1DE2 A;  2I1U A;  5JWQ B;  4Z2R A;  1JZO A;  2I81 A;  4MH2 A;  3VWV A;  2MZC A;  1LJR A;  4WR5 A;  1OAZ A;  1JLV A;  2GS3 A;  2HRN A;  4NMU A;  1N2A A;  2WDU A;  1K0A A;  3A2X A;  1V9W A;  1OE8 A;  2Z9S A;  3I43 A;  1WP0 A;  1TXX A;  2P5Q A;  4Q5R A;  5IMD A;  3AY8 A;  3TKP A;  1B4P A;  1U6T A;  4AJ6 A;  4NXI A;  2ON5 A;  1WOU A;  4WR4 A;  3HY2 A;  3KTB A;  1PD2 1;  4IHU A;  4KF9 A;  2DBC A;  2O7K A;  2V6K A;  4WF5 A;  2N5F A;  3ZRD A;  4Z2T A;  2F51 A;  1F2E A;  4X4J A;  1TRV A;  1RK4 A;  3R3E A;  3MDK A;  4KAE A;  22GS A;  1URM A;  3GST A;  4NV5 A;  1OC9 B;  3LFL A;  3IK7 A;  3CRU A;  4G9H A;  2WB9 A;  2QGV A;  3LXT A;  5DAK A;  3TUE A;  5IPG A;  1ZZY A;  1BQ7 A;  2F9S A;  3O6T A;  2X8H A;  4PX1 A;  3FZ5 A;  1SJ6 A;  1J0F A;  1TRS A;  1I5G A;  6GSS A;  1E6B A;  1O73 A;  3GV1 A;  4GST A;  1TKD B;  3M3M A;  2YNX A;  1VF3 A;  4ZL9 A;  2K18 A;  3M0F A;  2DIZ A;  1FG4 A;  8GSS A;  5FHI A;  5HFI A;  4TXO B;  5H5Q A;  1SKR B;  3BJ5 A;  4HI7 A;  3F63 A;  11GS A;  4BA7 A;  2DJ0 A;  2FWH A;  2JZR A;  1TW9 A;  2LV3 A;  2MMA A;  4F82 A;  5IO2 A;  1G7E A;  5IIZ A;  2OAC A;  5HR2 A;  4XS4 B;  4OWY A;  5J41 A;  4MF7 A;  4HQS A;  1G6W A;  3UOM A;  1SYX A;  3QOU A;  2OE1 A;  1JZD A;  4OFM A;  3LYK A;  1XIY A;  1GTA A;  2NTO A;  1GSD A;  5AIX A;  1O81 A;  3WT1 A;  3HVS A;  2HFD A;  4JU5 A;  4JZQ A;  3APQ A;  2H6Z A;  3GTU B;  3L78 A;  3ME8 A;  2DJK A;  2RII A;  2L4C A;  3WGX A;  3HVV A;  5H5R A;  5COH A;  4ULX A;  2B5E A;  6GSU A;  1XOA A;  2FY6 A;  4L0U A;  4MZC A;  1FAA A;  5C04 A;  1TRU A;  1JLW A;  1AXD A;  1LU4 A;  3O3T A;  1SK1 A;  1V58 A;  5ECM B;  5LD0 A;  1GH2 A;  1U3A A;  2VCW A;  1AC1 A;  3KH7 A;  1EOH A;  5EL8 A;  3HYP A;  4K0N A;  4LLR A;  1YKC A;  2DSA A;  3FR3 A;  4GQC A;  4IKH A;  5D9V A;  4EF0 A;  2PU9 C;  3TJF A;  1GUL A;  4POL A;  2P31 A;  3LW9 A;  4BVY B;  2EC4 A;  2IFQ A;  2H1A A;  2VL2 A;  5DVB A;  1QGV A;  5ECL B;  1WE0 A;  4V2L A;  1VF1 A;  3A5W A;  3GNJ A;  5FWG A;  3VWU A;  5ELA A;  4K7O A;  2JSY A;  3GH6 A;  1ERV A;  4HUA A;  1XWA A;  1FOV A;  2ZNM A;  4YQV A;  4O7H A;  3CBU A;  3C73 A;  3A2V A;  1C72 A;  3L0H A;  3VPQ A;  1A2M A;  3DVX A;  1XWC A;  1FO5 A;  2PGT A;  1SYR A;  2XC2 A;  3HJO A;  1T1V A;  2I3Y A;  1HNB A;  1WWJ A;  5KN0 A;  1EOG A;  1OVN A;  3K8N A;  12GS A;  1EEM A;  1XWG A;  4PGT A;  4P3Y B;  5IMF A;  2LTK A;  4MLY A;  2L6D A;  1F6M C;  2RLI A;  2A2R A;  5IQY A;  1TI3 A;  1EV4 A;  1XW6 A;  1XZO A;  1PN0 A;  4GCI A;  1NHO A;  1SL2 B;  5ABR A;  1QXH A;  1O8W A;  4TVE A;  3TGZ A;  3ZFB A;  5DCG A;  3W8J A;  3A5I A;  1SL1 B;  2L57 A;  3UAP A;  4MDC A;  1TP9 A;  1ZYE A;  3A3T A;  1TU8 A;  4RQR A;  1HNC A;  3CTG A;  2MMZ A;  1F3A A;  3HHV A;  4MPF A;  3KTL A;  6GST A;  1KTE A;  3FZ4 A;  1V57 A;  3G7Y A;  1XVW A;  4HZ2 A;  2A2P A;  2B7K A;  2CVD A;  3FYG A;  5GZZ B;  3QD9 A;  4MA9 A;  3IAM 2;  2GSS A;  4O5Q A;  3FEU A;  5DAL B;  4ECI A;  3GKX A;  1T4Y A;  3ZIT A;  4ZL7 A;  3P90 A;  4ZL8 A;  4Q5N A;  4D73 B;  2R3X A;  1B4Q A;  3HKR A;  1EP7 A;  4IJ3 A;  1WJK A;  5D73 A;  4N10 A;  1PL2 A;  3LYP A;  4IS0 A;  4TW5 A;  1AIU A;  1SK0 A;  5ECN B;  4Z7X A;  1GSS A;  4BPY A;  3L4N A;  1JFU A;  2H19 A;  3FRC A;  1Z7P A;  4OFN A;  1YKA A;  3UEM A;  3ZZX A;  3W6G A;  2DC5 A;  4N0Z A;  3QCP A;  2M46 A;  14GS A;  5B6N A;  3KIJ A;  2VL2 C;  5JCG A;  5KN1 A;  3GRX A;  4MNN A;  4EE0 A;  2B5Y A;  1HNA A;  1XBS A;  5ENU A;  5HFK A;  3TRQ A;  1G0T A;  3Q19 A;  3D22 A;  4ZBD A;  3ERW A;  1GNW A;  1GL8 A;  1MDI A;  1J08 A;  2CA8 A;  3US3 A;  5ECS A;  2LQQ A;  3RAZ A;  2O87 A;  3FKF A;  1Q98 A;  4KA0 A;  3UBL A;  3Q18 A;  1X0R A;  4HQZ A;  2IJY A;  2FWG A;  4K1F A;  3F6D A;  5KEJ A;  4XRA A;  2X99 A;  4ZXG A;  3EWL A;  4YKF A;  3BBY A;  3CTF A;  4PTS A;  4KSO A;  3L9V A;  1RW1 A;  2TRX A;  4KND A;  2AUV A;  1MDJ A;  4G0K A;  5CRW A;  1R4W A;  1FW1 A;  5IMV A;  2AHE A;  3FZ9 A;  1U3I A;  2X49 A;  2UZ8 A;  1XW5 A;  4TR1 A;  3JCM L;  1FB0 A;  3KGK A;  2K8S A;  3VWX A;  2GSR A;  5CRE A;  2G2Q A;  3EU4 A;  5G1K A;  4KCA A;  1EGO A;  2CT6 A;  2PER A;  3CSI A;  1BG5 A;  3DEX A;  3QR6 A;  1TK5 B;  2MBS A;  4HEA 2;  1F3B A;  4GQF A;  3LJR A;  1LBK A;  1X9S B;  1XOB A;  1PGT A;  3DYR A;  1M0U A;  3EUR A;  1X9W B;  3LOR A;  2JL4 A;  1GSE A;  9GSS A;  4NHW A;  1O6J A;  3M8N A;  5HFG A;  2VOC A;  2O85 A;  3RPN A;  3L9S A;  1MDK A;  3UAR A;  4J57 E;  1Z3E A;  5ECR B;  1PA3 A;  1SD9 A;  1TRW A;  5D93 A;  3TDG A;  3G7J A;  3TJK A;  2NBS A;  1NHY A;  4X43 A;  1M2A A;  3IV4 A;  5G5E A;  3IE3 A;  3KZQ A;  3KD0 A;  3WGD A;  5C00 A;  1AAZ A;  5B8A A;  1GWC A;  2L4Q A;  4L0W A;  2DMM A;  5CRD A;  1Y6E A;  2VIM A;  3E0U A;  3IK9 A;  1BAY A;  1XXU A;  5G1L A;  2B6M A;  2YWM A;  2LRN A;  5D9X A;  2C0G A;  5B8B A;  4TXV A;  5B7C A;  1T7P B;  1JHB A;  4DSS B;  2X8C A;  1TI1 A;  4USS A;  3IBH A;  4MK3 A;  2WS2 A;  2GDR A;  2FCH A;  1OYJ A;  3TOT A;  5ECO B;  5DQY A;  2VCZ A;  1VF2 A;  3HXS A;  4CHS A;  1W4V A;  1SJI A;  3CSJ A;  4JR6 A;  1B9X C;  1EWX A;  2YN1 A;  1PMT A;  1MD4 A;  2D2Z A;  1B9Y C;  5J5N A;  2FA8 A;  3ZL5 A;  1XCC A;  2KOK A;  2H1D A;  2VLT A;  3ED3 A;  2J9H A;  5BRT A;  5ID2 A;  2VLV A;  3P7X A;  2F8A A;  5DCH A;  1ZGN A;  3IC8 A;  3GL5 A;  4OCE A;  2LJA A;  1ZYP A;  4DEJ A;  2GTU A;  4KSM A;  2IME A;  2PN8 A;  4H86 A;  2ES7 A;  4BWQ A;  4EIQ A;  4QL9 A;  3KMO A;  2GZP A;  2N5B A;  1YDK A;  1GSF A;  2RM5 A;  4O92 A;  4OD7 A;  3DRN A;  1S3C A;  2DJJ A;  4I2T A;  4Q5F A;  5HR1 A;  3E9J B;  2B7J A;  2YPM A;  5IOW A;  1AQV A;  2HXK A;  3UBK A;  1ZYN A;  2CAI A;  2H0G A;  5JWO B;  5AGY A;  2DLX A;  1THO A;  4BWS A;  5IOX A;  4AJ8 A;  2C1Y A;  2JU5 A;  3VI5 A;  4L5L A;  2I4A A;  4ECB A;  3MWH A;  2GGT A;  3VI7 A;  3IHQ A;  4MAB A;  4RUV A;  3C71 A;  4DSR A;  2HYX A;  2PVQ A;  4IQA A;  2PMT A;  3EE2 A;  1PL1 A;  1OC8 A;  2IL3 A;  1GUK A;  3U6V A;  1HQO A;  5AIS A;  2JZT A;  4ECJ A;  2V6O A;  2HLS A;  3PGT A;  4LMW A;  1XWK A;  1K0B A;  4MJA A;  2MYG A;  2HE3 A;  2IPA A;  4KE3 A;  2J23 A;  2B5X A;  2FNO A;  5G2Z A;  2YAN A;  4RI6 A;  1EEJ A;  2BJX A;  2NDO A;  2YWN A;  1R26 A;  1K0N A;  2XHF A;  4MJB A;  5LNK e;  2CAQ A;  1T4Z A;  2K9F A;  4JRR A;  4ML6 A;  2BTO T;  6GSV A;  4KCE A;  5DBQ A;  5EVO A;  1SKS B;  4ZB8 A;  4K9Z A;  1E2Y A;  3IR4 A;  2H01 A;  2X64 A;  2CVK A;  3C7M A;  3QAW A;  4CDO A;  4FYU A;  1B48 A;  5ECK B;  5F0G A;  3LGC A;  2RUF A;  2GT6 A;  1PX7 A;  2R6K A;  4HJ2 A;  2V2G A;  4TN8 A;  2H75 A;  4HOJ A;  3KXO A;  4MPG A;  4EIP A;  2VM1 A;  1PX6 A;  4LL1 B;  4DVC A;  3PR8 A;  4HJM A;  4ICY A;  4O5U A;  1UN2 A;  2FWE A;  2QSI A;  4FYB A;  2GQL A;  4NWY A;  1M9A A;  2BMX A;  3RPP A;  2TIR A;  2OE3 A;  2H70 A;  4KH7 A;  2HSM A;  1A2L A;  4WKW A;  1PSQ A;  3CSH A;  4N30 A;  2V32 A;  4TR3 A;  4PQ1 A;  2PUK C;  4MF6 A;  2OJL A;  1ZYQ B;  1GLQ A;  1ERU A;  2YP6 A;  4I5Q A;  2M72 A;  3GUR A;  4F0B A;  4J2F A;  2VLU A;  3D5J A;  13GS A;  1GUM A;  2YJH A;  1QMV A;  2R5G A;  2OE0 A;  1K0M A;  5CYY A;  2A2S A;  4Z2U A;  2B3S A;  5KOX A;  4GLT A;  2VAF A;  3NIV A;  4XIH A;  3E3E A;  4WEY A;  1KEB A;  1V2A A;  3J7Y b;  1FB6 A;  1OKD A;  5HR3 A;  2YWO A;  2DIY A;  1J9B A;  4FIW A;  3APS A;  1R5A A;  3HZ4 A;  5D96 A;  5E4W A;  5IMZ A;  2LJR A;  1A24 A;  4WXT A;  2H76 A;  5KN2 A;  3WD6 A;  4EL1 A;  2IN3 A;  7GSS A;  2LQO A;  2JSZ A;  5KOW A;  1OC9 A;  1YZX A;  2XPE A;  1NSW A;  1T00 A;  4K2X A;  4AJ7 A;  2AAW A;  3PPU A;  2VCX A;  3ZIJ A;  1TOF A;  5D8I A;  4KGI A;  3F0I A;  2L5O A;  3GKK A;  1ILO A;  5F8B A;  4O32 A;  5GSS A;  3GIX A;  1FHE A;  1XFL A;  4DSQ A;  3NZN A;  2AB6 A;  2GZY A;  2PVO C;  2FD3 A;  3TJJ A;  4ECC A;  1R7H A;  5A4V A;  1M2B A;  3TJG A;  5J9B A;  4I2U A;  4TXO A;  5HR0 A;  3QFA C;  1KBN A;  1A2J A;  1NM3 A;  1GLP A;  3R2Q A;  1PQN A;  3FR6 A;  3KM6 A;  4GXZ A;  4TOP A;  4HU7 A;  3GFK A;  4Q5Q A;  2LKU A;  4K7I A;  1TU7 A;  3DVW A;  1EZK A;  4K5S A;  4BL7 B;  3FY7 A;  2C8U A;  4XS4 A;  2HZE B;  3I69 A;  2G0F A;  4KW6 A;  2GQK A;  4BVX B;  2YZH A;  2WFC A;  4MZW A;  3RHC A;  3J7Y k;  1IYH A;  3ISO A;  5LCZ A;  3V1W A;  4GWR A;  4POK A;  2HSY A;  2OA7 A;  4GSS A;  3KP8 A;  4IGJ A;  3QAG A;  2XBQ A;  2R4V A;  4G0I A;  3MNG A;  2LS5 A;  2LNT A;  3GYK A;  3GTU A;  3TKS E;  2CX4 A;  3HA9 A;  3M9J A;  5J9C A;  3UIW A;  2P0G A;  3D0Z A;  4F9Z A;  3U5R E;  3EMP A;  5IPH A;  4RI7 A;  3F3R A;  4HS1 A;  3D6I A;  1ML6 A;  4JE1 A;  2E2M A;  2YV7 A;  3VPT A;  2LST A;  3QDN A;  2LRC A;  19GS A;  1Y25 A;  1DE1 A;  3GH9 A;  2IMI A;  1SK2 A;  5J3R A;  5GST A;  3FR9 A;  3P2A A;  4PUF C;  5CO3 A;  16GS A;  1ZMA A;  2RUE A;  4K0G A;  1S3D A;  1Z6M A;  4GF0 A;  4ACS A;  1Q4J A;  3ZLP A;  2C3N A;  5A4U A;  2WGR A;  2R37 A;  3W8S A;  3TRP A;  4K7N A;  3O76 A;  4WF4 A;  1GTB A;  5DAK B;  2ALB A;  4ILF A;  3G7I A;  4EC0 A;  4G19 A;  3LSZ A;  2B1L A;  4YAP A;  2WZ9 A;  4N11 A;  4E8E A;  3NOF A;  4IQ1 A;  4MMM A;  3UVH A;  3MYD A;  3EVI A;  3UMA A;  3ZML A;  2H74 A;  4KUN A;  1ERT A;  1DUG A;  3F6F A;  2ZCT A;  1T3B A;  3ZTL A;  5IMA A;  1GSU A;  4KDU A;  3SWL A;  3N5O A;  1AUC A;  2NVL A;  5KN3 A;  5ECH B;  2C3T A;  3QAV A;  4TRX A;  2DJ2 A;  1EV9 A;  4K6X A;  3ZVJ A;  1K3L A;  1A8L A;  1K3Y A;  1JZW A;  2KUC A;  4X0X A;  2FUG 2;  4IEL A;  1HD2 A;  3HVX A;  2IMF A;  4MZB A;  4V1A g;  4KDX A;  1EP8 A;  3BCI A;  3DD3 A;  4PNF A;  3HJM A;  4IW9 A;  2VD0 A;  2CZ3 A;  1OC3 A;  2DKI A;  1SJZ A;  1BX9 A;  1MEK A;  2GLR A;  4XRD A;  2VL9 A;  3DKS A;  2H71 A;  3DIE A;  3WGE A;  2CZ2 A;  5DAL A;  3IOS A;  4YAV A;  2KHP A;  2WCI A;  1YQ1 A;  4XCS A;  1H75 A;  3ZVJ D;  1UC7 A;  2H6Y A;  4LA1 A;  2GZZ A;  1A8Y A;  1QFN A;  2FWF A;  3EU3 A;  4YH2 A;  5L71 A;  4D73 A;  1M7T A;  1ZOF A;  2AJQ B;  1YF1 A;  1G7O A;  2VD1 A;  2OAD A;  4ZBA A;  2CQ9 A;  1K3O A;  3LG6 A;  2H6X A;  2HSH A;  1WPI A;  5CRH A;  2VCQ A;  1Z6N A;  1GRX A;  1U87 A;  5DDL A;  3DML A;  1USB A;  2JAC A;  1XW9 A;  2ON7 A;  3TKR A;  1ST9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...