2ES7A

Crystal structure of q8zp25 from salmonella typhimurium lt2. nesg target str70
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
103
Chain Sequence
FSALWQRLLTRGWQPVEASVGDGVILLSSDPRRSDNPVMIAELLREFPQFDWQVAVADLEQSEAIGDRFNVRRFPATLVFTDGALSGIHPWAELLTLMRSIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative thiol-disulfide isomerase and thioredoxin
publication title Crystal structure of Q8ZP25 from Salmonella typhimurium LT2 NESG target STR70.
rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
total genus 20
structure length 103
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07449 HyaE Hydrogenase-1 expression protein HyaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2es7A00
3A3TA 3F6FA 1T7PB 4V2MA 3QDNA 3TOUA 4OO4A 3GH9A 2QC7A 4QL7A 3UVHA 4EF0A 3FYGA 2FWGA 5HFKA 5COHA 4OO5A 2LSTA 1O8XA 4TR1A 4RI6A 3LXZA 1K0NA 3TKQA 2MMZA 3ZRDA 4HQSA 4MJAA 1BJXA 1Y6EA 1AW9A 3IR4A 3PH9A 4FYUA 3A2XA 1Z9HA 3FZ5A 1AQVA 3HXSA 2O7KA 5F05A 2VLVA 2YJHA 3GMFA 2GGTA 4X0XA 4PQ1A 2EC4A 2E2GA 3D5JA 5D8IA 1F3AA 1O6JA 4NWYA 5J9CA 1QQ2A 4HJ2A 5ENUA 4IP6A 2GDRA 4Z7XA 3UEMA 2JZTA 3R2QA 3GKKA 2KP2A 5IQYA 3ISOA 2A4VA 2B3SA 3F9UA 1XWBA 4ILFA 2CAQA 3GFKA 1JZWA 2PWJA 2I4AA 1K0DA 2GQKA 2FWEA 2V1MA 1SENA 2H6XA 4ZBDA 2LUSA 1A0RP 4RQXA 3HHVA 2JSZA 2JZSA 1J9BA 2J9HA 2HZEB 1OC8A 1FG4A 3HCZA 1KBNA 1R7HA 2IFQB 2YNXA 3W8JA 1TU8A 2GZPA 3S9FA 1GNWA 1GTAA 2FUG2 1EP7A 3ZYWA 3GKXA 1V98A 3TJBA 2I81A 1B48A 4NV2A 2VM1A 2OACA 4MABA 3C1RA 3BCKA 4ZILA 3VFIA 2PU9C 4JRRA 4TR4A 3U5RE 4IP1A 2WFCA 3APOA 3P8WA 2AUVA 5H5QA 1O8WA 2IMFA 4PUAA 1MD3A 2L6CA 3PGTA 3RHCA 3H1NA 1KTEA 5F07A 4PUFC 3UL3A 5DALB 1H75A 2GZYA 2AB6A 4TRXA 1B4PA 4FO5A 3G7YA 3RPNA 2H30A 5IMZA 3LORA 2PVQA 2JL4A 1AAZA 1SU9A 3C73A 5DAKB 3C71A 1AQWA 5HQPA 4QL9A 4HQZA 1X5EA 2XHFA 3H79A 1A8YA 1F3BA 2R5GA 2YWOA 3HKRA 5IOWA 1YY7A 3FR9A 5KN2A 2H1GA 3TKSC 1K3OA 3GTUA 3G9BA 2E2MA 2R4VA 2MBTA 3ZITA 5B7CA 5IPGA 5B8AA 4K7OA 3ME8A 3GIXA 2K8VA 3ZIJA 1V2AA 5JWOB 2M72A 2E0QA 2H6YA 3DD3A 1S3DA 1PD21 3TJGA 3OR5A 1YQ1A 4YAVA 4XRDA 2O85A 4HUAA 3D21A 3HVXA 2XBIA 2DIYA 3EE2A 3C7MA 3HJMA 3CBUA 3VWVA 3N5OA 3F4TA 4MJBA 5DVBA 1PL1A 4WF5A 1WE0A 1PX7A 5HR2A 1QGVA 9GSSA 4F03A 3KMOA 1GULA 2FWHA 4POBA 2PBJA 5DQYA 2XC2A 2H6ZA 2LNSA 5CRGA 4XS1A 1G7EA 3KP8A 4POLA 3ZVJD 1THOA 3RDWA 1U3AA 3F3RA 3WYWA 5HFGA 1HQOA 1Z7RA 3Q6OA 1XVQA 3ZZXA 2LRNA 2GQLA 1GLQA 2KUCA 1R4WA 2YCDA 4PQIA 2YZHA 4Q5NA 1HD2A 4ZB8A 4OD7A 3TRXA 4NHZA 4PURA 3WT1A 5IMAA 4LLRA 2H66A 2XBQA 2H72A 2R2JA 4AGSA 2IFQA 3KXOA 1A8LA 2DJ1A 2OE0A 1JLWA 2JZRA 4BVYA 3QOUA 1ERTA 1SL0B 2H0HA 5IO2A 4ML1A 1TP9A 4DSRA 3N9JA 2YWIA 4NAXA 1MTCA 2H8LA 3HDCA 3ERFA 2I9HA 3FKFA 1AQXA 2HRNA 1PL2A 3LG6A 3IBHA 3BCIA 1T8EB 2JSYA 1M9BA 2CQ9A 4EKZA 1BEDA 1A2LA 2VD0A 2H74A 5ELGA 1QXHA 1UN2A 5D9XA 1VF1A 2F8FA 1NHOA 3CSJA 3KM6A 5DALA 5LD0A 3DKSA 3VI7A 3GSSA 4WR5A 5J5NA 2R37A 3UBLA 3EINA 4K0NA 3AY8A 3GKMA 4PX1A 1T00A 1BQ7A 1LU4A 4JBBA 4FH8A 2LTKA 3GL3A 4HOJA 2O87A 2HSYA 2LRCA 3V1WA 1JZDA 2LJRA 1WWJA 2H71A 5ECPB 4HZ4A 2GSSA 1F2EA 5KEJA 2I3YA 5GSSA 2ALBA 1GNEA 1A23A 1ACVA 4KB3A 3RAZA 5JCWA 3ED3A 2K8SA 1SL2B 4AJ8A 1USBA 3LSZA 4I5QA 1FB0A 1SK1A 4BWQA 5G5FA 2YPMA 2VCXA 4TOPA 4EE0A 4GF0A 4MH3A 2IMDA 3GNJA 5IO0A 3QCPA 6GSXA 3J7Yk 1M99A 3CMIA 5E59A 3GX0A 4IELA 1YEXA 1A0FA 3GH6A 1M9AA 1EOHA 1TRSA 5AIXA 3LJRA 5LNKe 4ZIJA 1ZL9A 1F9MA 4MF7A 3VK9A 3FR3A 2RIIA 4IJIA 4KAEA 1WPIA 4KCEA 2EIQA 1MDIA 4ZL9A 3DGQA 2IMEA 3LEFA 4IN0A 1A2MA 1YZXA 2XPEA 2BTOT 2H75A 1K3YA 4G10A 2H73A 5E4WA 5KN3A 5G2ZA 3IDVA 3TKSE 5ECKB 4FYBA 4WEYA 2O89A 4KSOA 6GSSA 3HD5A 4HDEA 1YF1A 4EC0A 4HI7A 1PMTA 2C1YA 5ABRA 1DUGA 1UVZA 2CA8A 3CXGA 10GSA 4KNDA 2ON7A 2GT5A 3CSIA 1M2BA 3JCML 4G2EA 1TRWA 2DC5A 5D9VA 4MH2A 4WETA 1GSSA 3D4MA 1X0RA 1Z6MA 2X64A 3FEUA 4YAPA 2VCZA 4ISDA 1TK5B 5H5SA 4G19A 3UMAA 3TGZA 3L9VA 1G6YA 3GTUB 5A4WA 5CO3A 2AHEA 1XWGA 17GSA 4NV5A 1I9DA 4PNGA 2B7JA 2PN8A 1K0OA 3L78A 1SYRA 2GSRA 3TOTA 2MMNA 2HYXA 3KCMA 4CDOA 1JZOA 1XBSA 1K0BA 3Q18A 1PQNA 3W6GA 2H1BA 1SJIA 1EV4A 2F3MA 1XCCA 1U3IA 2NVLA 4MPFA 2F51A 1O85A 3PR8A 3WGXA 5EY6A 2B1LA 4ZBBA 4IW9A 2VM2A 2V6OA 1EEJA 4N10A 1FHEA 4O92A 3QFAC 1PKWA 1URMA 2IIYA 3VURA 3TKPA 5EPFA 3EVIA 3BOAA 5C00A 1U87A 1ERUA 1BX9A 1OAZA 2HSHA 1K0MA 1X9SB 2C80A 3KEBA 2WB9A 2CAIA 4K2DA 3I6AA 5HR1A 1Y25A 4BA7A 2YJ7A 2A2RA 2V2GA 5CP1A 3EU4A 4MF5A 4HU9A 2H76A 3UAPA 1XOAA 4WR4A 1F6MC 4EDZA 3BJ5A 5ID2A 5ECRB 2IJYA 5H5RA 4KDYA 2F8AA 3HZ8A 2KOKA 4I2TA 4P3YB 5FWGA 3QMXA 1GP1A 3KH7A 2OADA 2EIRA 1GTUA 1Q4JA 1SKRB 3E9JB 4OFMA 3ME7A 4MZWA 1PKZA 4QQ7A 2P5QA 1SKWB 4TVEA 2IL3A 4YQVA 1ERWA 5L71A 1GSFA 4TXOB 1BG5A 1G0TA 2VL2C 2LKUA 2GVPA 4IS0A 3GA4A 2L5OA 4JR4A 1LJRA 4KDUA 5GSTA 3IV4A 2VL9A 5G5EA 4CW9A 4TXVA 3UOMA 4JE1A 2LQOA 1EOGA 3CRUA 3HY2A 1F37A 4D73A 5B6NA 4PQHA 2BMXA 1ON4A 1AXDA 3QAVA 1O73A 4BL7A 1IYIA 4LL1B 6GSYA 4WKWA 3FR6A 2L57A 1XPVA 3GSTA 3C1SA 3GV1A 1Z6NA 4PGTA 2QGVA 3G7IA 5D93A 4BWSA 1QMVA 4XHMA 3QAGA 4O32A 3UVTA 3IRAA 4BPYA 2GTUA 1KNGA 4ECCA 5B6MA 3F8UA 4KE3A 4IHUA 2G2QA 4DSQA 2GLRA 5AGYA 3DRNA 2TIRA 1OKDA 2ZCTA 3M0FA 4KSMA 4IQ1A 4LMWA 5G30A 3M3MA 1T3BA 4KDXA 1SL1B 3K8NA 1CQHA 5G1LA 4MF6A 4N0ZA 1XWKA 1PN9A 1ZMAA 1XW5A 3FZ4A 5CREA 4GSSA 3ZLPA 1J0FA 2HNLA 3PINA 2YN1A 3TRQA 2OE3A 3VI5A 1WIKA 3L4NA 4KCAA 3LFLA 3LGCA 4IJ3A 2XPDA 4L5OA 4L5LA 1MD4A 5GZZB 2DJJA 1S3CA 3HJOA 3E0UA 3FZ9A 6GSVA 1V40A 2DBCA 3EWLA 3ZMLA 5AN1A 1SD9A 4TR0A 4XTSA 4GTUA 14GSA 4N0VA 3IE3A 4I6XA 2M80A 3KGKA 4Q5FA 16GSA 1M2AA 3NZNA 3O6TA 5D9WA 5INYA 3HA9A 2E7PA 3M8NA 2HLSA 3IAS2 2C3QA 2PGTA 1JFUA 3ZREA 1B9XC 2OKAA 4ECJA 1XVWA 1GSDA 1EGOA 5DCGA 4GLTA 4K7NA 3P7XA 5LCZA 1MEKA 2KLXA 5AISA 5IIZA 4EDYA 5CRDA 5J3RA 2WCIA 4TKYA 1KEBA 2JU5A 2LRTA 5CYYA 1Z3EA 4TXOA 3ZMKA 2P31A 5D9TA 3RPPA 2R3XA 2ZUPA 1THXA 2PVOC 3D22A 4X1UA 5F0GA 4DEJA 3U6VA 3GN3A 4MK3A 3CRTA 3GKNA 1YKCA 2QKEA 5B8BA 7GSSA 4WBJA 1EZKA 20GSA 4DSSB 2C8UA 4FYCA 3MSZA 2I1UA 1BYEA 1Z5YE 4GQCA 3VWUA 1N8JA 2V41A 3UIWA 4K9ZA 1XWCA 1B8XA 2GSTA 1UC7A 1XXUA 4MZCA 5ELAA 3RHBA 1XW9A 4YH2A 2YWNA 3IAM2 5C04A 1VGLA 1AUCA 2L6DA 1SD8A 3QPMA 1N2AA 2C3TA 1GSQA 3DWVA 1A2JA 2NBSA 1GSUA 1M7TA 4N11A 2A2SA 1TRVA 4GRFA 4GSTA 4NMUA 5IM9A 4EO3A 2F9SA 1RK4A 3TJKA 3VWWA 2HI7A 5ID2B 3VPQA 1EP8A 3CTFA 1XW6A 1X5CA 2VLUA 2VCVA 5IMFA 2K18A 4RQRA 1GTBA 3SBCA 4K8MA 2GT6A 1B4QA 3GURA 1TXXA 1O81A 2HZFA 1WOUA 2VUPA 2WJUA 4F2IA 2FD3A 3ZFLA 2L4QA 2K6VA 2VIMA 1TK0B 3DYRA 3QAWA 4OCFA 2FHEA 2VO4A 5ECQB 2X8HA 5DJMA 2YZUA 1W89A 3QFBC 2R6KA 4LL4B 3TRPA 4J56E 1GTIA 1OC3A 3ZVJA 3NIVA 5EL8A 1MDJA 4WBRD 1GUMA 2HXKA 4BVXA 1GLPA 3UBKA 4ZL7A 1PX6A 4L0WA 1YKAA 3EURA 1VRSD 3LXTA 2FY6A 3IA1A 5G31A 4AF2A 1J08A 4D73B 1X5DA 1O7UA 4ZBAA 2X99A 3I9V2 2DMMA 1JLVA 1OYJA 3MNGA 3LYKA 2D2ZA 3IPZA 4MJEA 3APSA 3FK8A 4HEA2 5DJLA 4AJ6A 4KW6A 1SJ6A 3SWLA 1EV9A 1UA5A 1AIUA 3TJJA 1X9WB 4YQUA 22GSA 3TUEA 4MZBA 3ZFBA 2C4JA 2WGRA 4XIHA 5A5KA 4EVMA 3US3A 4ECIA 2MMAA 1V57A 2H19A 1ERVA 1ILOA 2ON5A 4V2NA 5HFIA 5ECOB 5IMVA 2VAFA 3WGEA 1ST9A 2G0FA 3C8EA 2PMTA 4F82A 2O8VB 5D73A 1TI3A 1XOBA 3F4RA 2CT6A 5ECLB 1SJZA 2GQMA 1HNCA 3VWXA 3DIEA 4POKA 5DDLA 4IVFA 3KH9A 4G9HA 2NPBA 1JHBA 2X8GA 3DVXA 1XZOA 4KH7A 3A2VA 3IK9A 4MCUA 2EIOA 3FY7A 4MPGA 4MLYA 4DSSA 1ABAA 4XS4B 4L0UA 1PA3A 1SKSB 1WJKA 3M1GA 2CVBA 2C0DA 5KN0A 3ERGA 3GUSA 1SK2A 1GSEA 2ZNMA 4GSNA 2C0GA 1DBYA 5JCUA 5D96A 2FLSA 2JADA 4RUVA 2OBKA 2IMKA 2V6KA 1TTZA 4TW5A 2DJ0A 1QFNA 5J9BA 4YQMA 1K0CA 2J23A 1IYHA 2HRFA 5KN1A 3GL5A 3W8SA 2TRXA 2L4CA 4I2UA 4IKHA 1TK8B 2B5EA 1OKTA 4NXIA 2P0GA 4KA0A 4EXJA 3O76A 3HJPA 1W4VA 4K7IA 3H93A 6GSUA 2N5AA 1JZRA 1H4OA 2RLIA 1TW9A 1RW1A 4Q5QA 1WP0A 2CZ2A 1FVKA 5HR3A 4N30A 1NW2A 4L8EA 3EMXA 4NPBA 2H0GA 3F0IA 4OFNA 4ZB9A 4DVCA 1PRXA 2C3NA 2OJLA 5DQSA 4O5RA 3L9UA 1V9WA 3DVWA 1ZYEA 1HYUA 2M46A 1OC9A 2REMA 2QSIA 2YANA 2H70A 2C0EA 4CHSA 2YP6A 1NSWA 3J7Yb 2AYTA 5J41A 2IPAA 5FT3A 3CTGA 2OBIA 4F0BA 3GHAA 3DEXA 2KHPA 4XCSA 8GSSA 2NDOA 4JZQA 4MDCA 3HVVA 1LBKA 4PXOA 3KP9A 1FW1A 3A2WA 5DCHA 5IPHA 3Q74A 4HJMA 1PGTA 3CSHA 2OE1A 1DSBA 4JEDA 4ML6A 2PPTA 3IXRA 1PSQA 1K3LA 1E6BA 2FGXA 3QR6A 13GSA 1Z7PA 5CNWA 4TN8A 1WRYA 2GZZA 3BD2A 2FCHA 3A5WA 4MMMA 2GS3A 4POMA 1CQGA 3D6IA 2FNOA 4IQAA 3G7JA 6GSWA 19GSA 2YWMA 3FHKA 4J57E 5ECNB 1TDIA 3E3EA 1TRUA 2PERA 3MWHA 1ML6A 3L9SA 3WGDA 3HVSA 4X43A 2KP1A 3WT2A 2DSAA 1GL8A 5F06A 5IOXA 1ZCPA 5FHIA 2CVDA 3D4TA 2VLTA 2LNTA 4V1Ap 1I5GA 2RM6A 3O3TA 3EU3A 1XFLA 3UJ1A 4LA1A 2LJAA 3TCOA 1GSYA 2B7KA 2JACA 3P90A 2BJXA 2CX3A 2LJKA 2L5LA 1FAAA 4V2LA 1GUKA 2VL3A 3IOSA 1YEPA 2HT9A 1NM3A 2IN3A 5JWRB 1GRXA 1SYXA 2IMIA 4XS4A 1EGRA 4ACSA 2YV9A 5ECSA 12GSA 4MA9A 1SK0A 3F6DA 4JR6A 5EVOA 4O7HA 3APQA 1VF4A 2DJKA 1ZYQB 4I8BA 1T1VA 3DXBA 3ZL5A 18GSA 1GWCA 4KUNA 3EYTA 3IHQA 2ES7A 3VPTA 2Z9SA 5DBQA 4K0GA 2LV3A 5ECIB 1S3AA 4OCEA 2CX4A 1VF3A 4J2FA 2NTOA 3M9JA 2MBSA 1MDKA 2GSQA 4PNFA 1U88A 2VCTA 1X9MB 1WMJA 1E2YA 2RUFA 2B1KA 4GQFA 5ECHB 2DJ2A 1HNAA 2B5YA 5J4UA 2WS2A 1FO5A 3FZAA 2P5RA 3H8QA 4KGIA 4ULXA 1GUHA 5IMCA 4LMVA 1ZGNA 3ZTLA 4OWYA 1XIYA 3IK7A 1HNBA 3EMPA 2PUKC 2MZCA 4H86A 2H0IA 2OA7A 5JWQB 2VOCA 1GH2A 2HE3A 1A24A 2WULA 2CV4A 3FRCA 5AIVA 2WDUA 2HZEA 2VD1A 3F63A 2AV4A 1R5PA 1YF0A 1TI1A 5ECMB 3F4SA 3QD9A 1FB6A 2IWTA 4ZXGA 5JCGA 2N5BA 2AJQB 4Q5RA 3KIJA 3LYPA 3D0ZA 4GXZA 2MMOA 3LWAA 1QUWA 2DIZA 5GAPD 4AJ7A 2DLXA 2YOIA 4WF4A 5A4UA 4TR1B 3KTLA 4EUYA 4RI7A 5IMDA 2FWFA 1OE7A 2CVKA 1ZZYA 2WZ9A 4HZ2A 3VLNA 5CAXA 1TJDA 3GRXA 1U6TA 1TOFA 2YV7A 4JU5A 4MP4A 4TR3A 5CRWA 1OVNA 2DMLA 2V32A 3I43A 4E8HA 5DAKA 2RM5A 2DJ3A 2VCQA 1FOVA 3ZIVA 3IC4A 4ZB6A 2H01A 3H4KA 2B6MA 2VCWA 4IGJA 2HFDA 5HR0A 1TKDB 4K6XA 2CZ3A 3L0HA 4GWRA 2MYGA 3KZQA 4ID0A 1XWAA 5G1KA 3DMLA 1M0UA 5F8BA 3HZ4A 1B9YC 4EL1A 1QK8A 3CYNA 3BBYA 3ERWA 3LQ7A 4OFTA 1OC9B 2X8CA 3Q19A 1T4ZA 2VL2A 3KD0A 3NOFA 3P2AA 2H1AA 2H1DA 2K9FA 2B5XA 1EWXA 3UARA 5A4VA 1NHYA 1YJ6A 4XS6A 5CRHA 2WRTA 1K0AA 1T4YA 2C0FA 6GSTA 3KMNA 3I69A 4E8EA 2FA8A 1EEMA 4OMVA 1C72A 2FA4A 4FIWA 2LS5A 2N5FA 3GYKA 1DE1A 1R5AA 2AAWA 3EC3A 4MJCA 3TKRA 2LQQA 4XRAA 1ZOFA 4IBPA 4NHWA 1VF2A 1TU7A 2L59A 1G6WA 3TJFA 11GSA 3KTBA 3TDGA 2TRCP 1M2DA 1BAYA 4HU7A 4F9ZA 3MAKA 4I97A 4ZL8A 1YDKA 1V58A 3MDKA 4KX4A 1OE8A 4K1FA 3TKSA 1G7OA 3FW2A 3RBTA 1R26A 5GAND 3TB2A 2RUEA 1Q98A 3M9KA 3KJYA 4V1Ag 4WXTA 4ECBA 1RQMA 1DE2A 3GX8A 4GCIA 3HYPA 2LEGA 3F3QA 3WD6A 1AC1A 4HS1A 1FVJA 4F0CA
chains in the Genus database with same CATH superfamily
3A3TA 3F6FA 1T7PB 4V2MA 3QDNA 3TOUA 4OO4A 3GH9A 2QC7A 4QL7A 3UVHA 4EF0A 3FYGA 2FWGA 5HFKA 5COHA 4OO5A 4Z2UA 2LSTA 1O8XA 4TR1A 4RI6A 3LXZA 1K0NA 3TKQA 2MMZA 3ZRDA 4HQSA 4MJAA 1BJXA 1Y6EA 1AW9A 3IR4A 3PH9A 4FYUA 4EIPA 3A2XA 1Z9HA 3FZ5A 1AQVA 3HXSA 2O7KA 5F05A 2VLVA 2YJHA 3GMFA 2GGTA 4X0XA 4PQ1A 2EC4A 2E2GA 3D5JA 5D8IA 1F3AA 1O6JA 4NWYA 5J9CA 1QQ2A 4HJ2A 5ENUA 4IP6A 2GDRA 4Z7XA 3UEMA 2JZTA 3R2QA 3GKKA 2KP2A 5IQYA 3ISOA 2A4VA 2B3SA 3F9UA 1XWBA 4ILFA 2CAQA 3GFKA 1JZWA 2PWJA 2I4AA 1K0DA 2GQKA 2FWEA 2V1MA 1SENA 2H6XA 4ZBDA 2LUSA 1A0RP 4RQXA 2DKIA 3HHVA 2JSZA 2JZSA 3IHGA 1J9BA 2J9HA 2HZEB 1OC8A 1FG4A 3HCZA 1KBNA 1R7HA 2IFQB 2YNXA 3W8JA 1TU8A 2GZPA 3S9FA 1GNWA 4O5QA 1GTAA 2FUG2 1EP7A 3ZYWA 3GKXA 1V98A 3TJBA 2I81A 1B48A 4NV2A 2VM1A 2OACA 4MABA 3C1RA 3BCKA 4ZILA 3VFIA 3EPTA 2PU9C 4JRRA 4TR4A 3U5RE 4IP1A 2WFCA 3APOA 3P8WA 2AUVA 5H5QA 1O8WA 2IMFA 4PUAA 1MD3A 2L6CA 3PGTA 3RHCA 3H1NA 1KTEA 5F07A 4PUFC 3UL3A 5DALB 1H75A 2GZYA 2AB6A 4TRXA 1B4PA 4FO5A 3G7YA 4ICYA 3RPNA 2H30A 5IMZA 3LORA 2PVQA 2JL4A 1AAZA 1SU9A 3C73A 5DAKB 3C71A 1AQWA 5HQPA 4QL9A 4HQZA 1X5EA 2XHFA 3H79A 1A8YA 1F3BA 2R5GA 2YWOA 2DKHA 3HKRA 5IOWA 1YY7A 3FR9A 5KN2A 2H1GA 3TKSC 1K3OA 3GTUA 3G9BA 2E2MA 2R4VA 2MBTA 3ZITA 5B7CA 5IPGA 5B8AA 4K7OA 3ME8A 3GIXA 2K8VA 3ZIJA 1V2AA 5JWOB 2M72A 4CY8A 2E0QA 2H6YA 3DD3A 1S3DA 1PD21 3TJGA 3OR5A 2R0PA 1YQ1A 4YAVA 4XRDA 2O85A 4HUAA 3D21A 3HVXA 2XBIA 4A5PA 2DIYA 3EE2A 3C7MA 3HJMA 3CBUA 3VWVA 3N5OA 3F4TA 4MJBA 5DVBA 1PL1A 4WF5A 1WE0A 1PX7A 5HR2A 4MNNA 1QGVA 9GSSA 4F03A 3KMOA 1GULA 2FWHA 4POBA 2PBJA 5DQYA 2XC2A 2H6ZA 2LNSA 5CRGA 4XS1A 1G7EA 3KP8A 4POLA 3ZVJD 4G0IA 1THOA 3RDWA 1U3AA 3F3RA 3WYWA 5HFGA 1HQOA 4Z2RA 1Z7RA 3Q6OA 1XVQA 3ZZXA 2LRNA 2GQLA 1GLQA 2KUCA 1R4WA 2YCDA 4PQIA 2YZHA 4Q5NA 1HD2A 4ZB8A 4OD7A 3TRXA 4NHZA 4PURA 3WT1A 5IMAA 4LLRA 2H66A 2XBQA 2H72A 2R2JA 4AGSA 2IFQA 3KXOA 3MIXA 1A8LA 2DJ1A 2OE0A 1JLWA 2JZRA 4BVYA 3QOUA 4G0KA 1ERTA 1SL0B 2H0HA 5IO2A 4ML1A 1TP9A 4DSRA 3N9JA 2A4HA 2YWIA 4NAXA 1MTCA 2H8LA 3HDCA 3ERFA 4KF9A 2I9HA 3FKFA 1AQXA 2HRNA 1PL2A 3LG6A 3IBHA 3BCIA 1T8EB 2JSYA 1M9BA 2CQ9A 4EKZA 1BEDA 1ZYPA 1A2LA 2VD0A 2H74A 5ELGA 1QXHA 1UN2A 5D9XA 1VF1A 2F8FA 1NHOA 3CSJA 3KM6A 5DALA 5LD0A 3DKSA 3VI7A 3GSSA 4WR5A 5J5NA 2R37A 3UBLA 3EINA 4K0NA 3AY8A 3GKMA 4PX1A 1T00A 1BQ7A 1LU4A 4JBBA 4FH8A 2LTKA 3GL3A 4HOJA 2O87A 2HSYA 2LRCA 3V1WA 1JZDA 4K2XA 2LJRA 1WWJA 2H71A 5ECPB 4HZ4A 2GSSA 1F2EA 5KEJA 2I3YA 5GSSA 2ALBA 1GNEA 1A23A 1ACVA 4KB3A 4G0LA 3RAZA 5JCWA 3ED3A 2K8SA 2UZ8A 1SL2B 5BRTA 4AJ8A 1USBA 3LSZA 4I5QA 1FB0A 1SK1A 4BWQA 5G5FA 2YPMA 2VCXA 4TOPA 4EE0A 4GF0A 4MH3A 2IMDA 3GNJA 5IO0A 3QCPA 6GSXA 3J7Yk 1M99A 3CMIA 5E59A 3GX0A 4IELA 1YEXA 1A0FA 3GH6A 1M9AA 1EOHA 1TRSA 5AIXA 3LJRA 5LNKe 4ZIJA 1ZL9A 1F9MA 4MF7A 3VK9A 3FR3A 2RIIA 4IJIA 4KAEA 1WPIA 4KCEA 2EIQA 1MDIA 4ZL9A 3DGQA 2IMEA 3LEFA 4IN0A 4Z2TA 1A2MA 1YZXA 2XPEA 2BTOT 2H75A 1K3YA 4G10A 2H73A 5E4WA 5KN3A 5G2ZA 3IDVA 3TKSE 5ECKB 4FYBA 4WEYA 2O89A 4KSOA 6GSSA 3HD5A 4HDEA 1YF1A 4EC0A 4HI7A 1PMTA 2C1YA 5ABRA 1DUGA 1UVZA 2CA8A 3CXGA 10GSA 4KNDA 2ON7A 1M3JA 2GT5A 3CSIA 1M2BA 3JCML 4G2EA 1TRWA 2DC5A 5D9VA 4MH2A 4WETA 1GSSA 3D4MA 1X0RA 1Z6MA 2X64A 3FEUA 4YAPA 2VCZA 4ISDA 1TK5B 5H5SA 4G19A 3UMAA 3TGZA 3L9VA 1G6YA 3GTUB 5A4WA 5CO3A 2AHEA 1XWGA 17GSA 4NV5A 1I9DA 4PNGA 2B7JA 2PN8A 1K0OA 3L78A 1SYRA 2GSRA 3TOTA 2MMNA 2HYXA 3KCMA 4CDOA 1JZOA 1XBSA 1K0BA 3Q18A 1PQNA 3W6GA 2H1BA 1SJIA 1EV4A 2F3MA 1XCCA 1U3IA 2NVLA 4MPFA 2F51A 1O85A 3PR8A 3WGXA 5EY6A 2B1LA 4ZBBA 4IW9A 2VM2A 2V6OA 1EEJA 4N10A 1FHEA 4O92A 3QFAC 1PKWA 1URMA 2IIYA 3VURA 3TKPA 5EPFA 4YKGA 3EVIA 3BOAA 5C00A 1U87A 1ERUA 1BX9A 1OAZA 2HSHA 1K0MA 1X9SB 3A5IA 2C80A 3KEBA 2WB9A 2CAIA 4K2DA 3I6AA 5HR1A 1Y25A 4BA7A 2YJ7A 2A2RA 2V2GA 5CP1A 3EU4A 4MF5A 4HU9A 2H76A 3UAPA 1XOAA 4WR4A 1F6MC 4EDZA 3BJ5A 5ID2A 5ECRB 2IJYA 5H5RA 4KDYA 2F8AA 3HZ8A 2KOKA 4I2TA 4P3YB 5FWGA 3QMXA 1GP1A 3KH7A 2OADA 2EIRA 1GTUA 1Q4JA 1SKRB 3E9JB 4OFMA 3ME7A 4MZWA 1PKZA 4QQ7A 2P5QA 1SKWB 4TVEA 2IL3A 4BVYB 4YQVA 1ERWA 5L71A 1GSFA 4TXOB 1BG5A 1G0TA 2VL2C 2LKUA 2GVPA 4IS0A 3GA4A 2L5OA 4JR4A 1LJRA 4KDUA 5GSTA 3IV4A 2VL9A 5G5EA 2HSMA 4CW9A 4TXVA 3UOMA 4JE1A 2LQOA 1EOGA 3CRUA 3HY2A 1F37A 4D73A 5B6NA 4PQHA 2BMXA 1ON4A 1AXDA 3QAVA 1O73A 4BL7A 1IYIA 4LL1B 6GSYA 4WKWA 3FR6A 4K5RA 2L57A 1XPVA 3GSTA 3C1SA 3GV1A 1Z6NA 4PGTA 2QGVA 3G7IA 5D93A 4BWSA 1QMVA 4XHMA 3QAGA 4O32A 3UVTA 3IRAA 4BPYA 2GTUA 1KNGA 4ECCA 5B6MA 3F8UA 4KE3A 4IHUA 2G2QA 4DSQA 2GLRA 5AGYA 3DRNA 2TIRA 1OKDA 2ZCTA 3M0FA 4KSMA 4IQ1A 4LMWA 1M3IA 5G30A 3M3MA 1T3BA 4KDXA 1SL1B 3K8NA 1CQHA 5G1LA 4MF6A 4N0ZA 1XWKA 1PN9A 1ZMAA 1XW5A 3FZ4A 5CREA 4GSSA 3ZLPA 1J0FA 2HNLA 3PINA 2YN1A 3TRQA 2OE3A 3VI5A 1WIKA 3L4NA 4KCAA 3LFLA 3LGCA 4IJ3A 2XPDA 4L5OA 4L5LA 1MD4A 5GZZB 2DJJA 1S3CA 3HJOA 3E0UA 3FZ9A 6GSVA 1V40A 2DBCA 4HSCX 3EWLA 3IC8A 3ZMLA 5AN1A 1SD9A 4TR0A 4XTSA 4GTUA 14GSA 4N0VA 3IE3A 4I6XA 2M80A 3KGKA 4Q5FA 16GSA 1M2AA 3NZNA 2X4AA 3O6TA 5D9WA 5INYA 3HA9A 2E7PA 3M8NA 2HLSA 3IAS2 2C3QA 2PGTA 1JFUA 3ZREA 1B9XC 2OKAA 4ECJA 1XVWA 1GSDA 2R0CA 1EGOA 5DCGA 4GLTA 4K7NA 3P7XA 5LCZA 1MEKA 2KLXA 5AISA 5IIZA 4EDYA 5CRDA 5J3RA 2WCIA 4TKYA 1KEBA 2JU5A 2LRTA 5CYYA 1Z3EA 4TXOA 3ZMKA 2P31A 5D9TA 3RPPA 2R3XA 2ZUPA 1THXA 2PVOC 3D22A 4X1UA 5F0GA 4DEJA 3U6VA 3GN3A 4MK3A 3CRTA 3GKNA 1YKCA 2QKEA 5B8BA 7GSSA 4WBJA 1EZKA 20GSA 4DSSB 2C8UA 4FYCA 3MSZA 2I1UA 1BYEA 1Z5YE 4GQCA 3VWUA 1N8JA 1FOHA 2V41A 3UIWA 4K9ZA 1XWCA 1B8XA 2GSTA 1UC7A 1XXUA 4MZCA 5ELAA 3RHBA 1XW9A 4YH2A 2YWNA 3IAM2 5C04A 1PFOA 1VGLA 1AUCA 2L6DA 1SD8A 3QPMA 1N2AA 2C3TA 1XG8A 1GSQA 3DWVA 1A2JA 2NBSA 1GSUA 1M7TA 4N11A 2A2SA 1TRVA 4GRFA 4GSTA 4NMUA 5IM9A 4EO3A 2F9SA 1RK4A 3PPUA 3TJKA 5KOXA 3VWWA 2HI7A 5ID2B 3VPQA 1EP8A 3CTFA 1XW6A 1X5CA 2VLUA 2VCVA 5IMFA 2K18A 4RQRA 1GTBA 4YKFA 3SBCA 4K8MA 2GT6A 1B4QA 3GURA 1PN0A 1TXXA 1O81A 2HZFA 1WOUA 2VUPA 2WJUA 4F2IA 2FD3A 3ZFLA 2L4QA 2K6VA 2VIMA 1TK0B 3DYRA 3QAWA 4OCFA 2FHEA 2VO4A 5ECQB 2X8HA 5DJMA 2YZUA 1W89A 3QFBC 2A2PA 2R6KA 4LL4B 3TRPA 4J56E 1GTIA 1OC3A 3ZVJA 3NIVA 3MYDA 3HVNA 5EL8A 1MDJA 4WBRD 1GUMA 2HXKA 4BVXA 1GLPA 3UBKA 4ZL7A 1PX6A 4L0WA 1YKAA 3EURA 1VRSD 3LXTA 2FY6A 3IA1A 5G31A 4AF2A 1J08A 4D73B 1X5DA 1O7UA 4ZBAA 2X99A 3I9V2 2DMMA 4BL7B 1JLVA 1OYJA 3MNGA 3LYKA 2D2ZA 3IPZA 4MJEA 3APSA 3FK8A 4HEA2 5DJLA 4AJ6A 4BIKA 4KW6A 1SJ6A 3SWLA 1EV9A 1UA5A 1AIUA 3TJJA 1X9WB 4YQUA 22GSA 3TUEA 4MZBA 3ZFBA 2C4JA 2WGRA 4XIHA 5A5KA 4EVMA 3US3A 4ECIA 2MMAA 1V57A 2H19A 1ERVA 1ILOA 2ON5A 4V2NA 5HFIA 5ECOB 5IMVA 2VAFA 3WGEA 1ST9A 2G0FA 3C8EA 2PMTA 4F82A 2O8VB 5D73A 1TI3A 1XOBA 3F4RA 2CT6A 5ECLB 1SJZA 2GQMA 1HNCA 3VWXA 3DIEA 4POKA 5DDLA 4IVFA 3KH9A 4G9HA 2NPBA 1JHBA 2X8GA 3DVXA 1XZOA 4KH7A 3A2VA 3IK9A 4MCUA 2EIOA 3FY7A 4MPGA 4MLYA 4DSSA 1ABAA 2QA2A 4XS4B 4L0UA 1PA3A 1SKSB 1WJKA 3M1GA 2CVBA 2C0DA 5KN0A 3ERGA 3GUSA 1SK2A 1GSEA 2ZNMA 4GSNA 2C0GA 1DBYA 5JCUA 5D96A 2FLSA 2JADA 4RUVA 2OBKA 2IMKA 2V6KA 1TTZA 4TW5A 2DJ0A 1QFNA 5J9BA 4YQMA 1K0CA 2J23A 1IYHA 2HRFA 5KN1A 3GL5A 3W8SA 2TRXA 2L4CA 4I2UA 4IKHA 1TK8B 2B5EA 1OKTA 4NXIA 2P0GA 2QA1A 4KA0A 4EXJA 3O76A 3HJPA 1W4VA 4K7IA 3H93A 6GSUA 2N5AA 1JZRA 1H4OA 2RLIA 1TW9A 1RW1A 4Q5QA 1WP0A 2CZ2A 1FVKA 5HR3A 4N30A 1NW2A 4L8EA 3EMXA 4NPBA 2H0GA 3F0IA 4OFNA 4ZB9A 2R0GA 4DVCA 1PRXA 2C3NA 2OJLA 5DQSA 4O5RA 3L9UA 1V9WA 3DVWA 1ZYEA 1HYUA 2M46A 1OC9A 2REMA 2QSIA 2YANA 2H70A 3R3EA 2C0EA 4CHSA 2YP6A 1NSWA 3J7Yb 2AYTA 4O5UA 5J41A 2IPAA 4USSA 5FT3A 3CTGA 2OBIA 4F0BA 3GHAA 4FQUA 3DEXA 2KHPA 4XCSA 8GSSA 2NDOA 4JZQA 4MDCA 3HVVA 1LBKA 4PXOA 3KP9A 1FW1A 3A2WA 5DCHA 5IPHA 3Q74A 4HJMA 1PGTA 3CSHA 2OE1A 1DSBA 4JEDA 4ML6A 2PPTA 3IXRA 1PSQA 1K3LA 1E6BA 2FGXA 3QR6A 13GSA 1Z7PA 5CNWA 4TN8A 1WRYA 2GZZA 3FMWA 3BD2A 2FCHA 3A5WA 4MMMA 2GS3A 4POMA 1CQGA 3D6IA 2FNOA 4IQAA 3G7JA 6GSWA 19GSA 2YWMA 3FHKA 4J57E 5ECNB 1TDIA 3E3EA 1TRUA 2PERA 3MWHA 1ML6A 3L9SA 3WGDA 3HVSA 4X43A 3LW9A 2KP1A 3WT2A 2DSAA 1GL8A 5F06A 5IOXA 1ZCPA 5FHIA 2CVDA 3D4TA 2VLTA 5KOWA 2LNTA 4V1Ap 1I5GA 2RM6A 3O3TA 3EU3A 1XFLA 3UJ1A 4LA1A 2LJAA 3TCOA 1GSYA 2B7KA 2JACA 3P90A 2BJXA 2CX3A 2LJKA 2L5LA 1FAAA 4V2LA 1GUKA 2VL3A 3IOSA 1YEPA 2HT9A 1NM3A 2IN3A 5JWRB 1GRXA 1SYXA 2IMIA 4XS4A 1EGRA 4ACSA 2YV9A 5ECSA 12GSA 4MA9A 1SK0A 3F6DA 4JR6A 5EVOA 4O7HA 3APQA 1VF4A 2DJKA 1ZYQB 4I8BA 1T1VA 3DXBA 3ZL5A 18GSA 1GWCA 4KUNA 3EYTA 4BVXB 2HRAA 3IHQA 2ES7A 3VPTA 2Z9SA 5DBQA 4K0GA 2LV3A 5ECIB 1S3AA 3CQFA 4OCEA 2CX4A 1VF3A 4J2FA 2NTOA 3M9JA 2MBSA 1MDKA 2GSQA 4PNFA 1S3RA 1U88A 4K5SA 2VCTA 1X9MB 1WMJA 1E2YA 2RUFA 2B1KA 4GQFA 5BMUA 5ECHB 2DJ2A 1HNAA 2B5YA 5J4UA 2WS2A 1FO5A 3FZAA 2P5RA 3H8QA 4KGIA 4ULXA 1GUHA 5IMCA 4LMVA 1ZGNA 3ZTLA 4OWYA 1XIYA 3IK7A 1HNBA 3EMPA 2PUKC 2MZCA 4H86A 2H0IA 2OA7A 5JWQB 2VOCA 1GH2A 2HE3A 1A24A 2WULA 2CV4A 3FRCA 4PTSA 5AIVA 2WDUA 2HZEA 2HRKA 2VD1A 3F63A 2AV4A 1R5PA 1YF0A 1TI1A 5ECMB 3F4SA 3QD9A 1FB6A 2IWTA 4ZXGA 5JCGA 2N5BA 2AJQB 4Q5RA 3KIJA 3LYPA 3D0ZA 4GXZA 2MMOA 3LWAA 1QUWA 2DIZA 5GAPD 4AJ7A 2DLXA 2YOIA 4WF4A 5A4UA 4TR1B 3KTLA 4EUYA 4RI7A 5IMDA 2FWFA 1OE7A 2CVKA 1ZZYA 2WZ9A 4HZ2A 3VLNA 5CAXA 1TJDA 3GRXA 1U6TA 1TOFA 2YV7A 4JU5A 4MP4A 4TR3A 5CRWA 1OVNA 2DMLA 2V32A 3I43A 4E8HA 5DAKA 2RM5A 2DJ3A 2VCQA 1FOVA 3ZIVA 3IC4A 4ZB6A 2H01A 3H4KA 2B6MA 2VCWA 4IGJA 2HFDA 5HR0A 1TKDB 4K6XA 2CZ3A 3L0HA 4GWRA 2MYGA 3KZQA 4ID0A 1XWAA 5G1KA 3DMLA 1M0UA 5F8BA 3HZ4A 1B9YC 4EL1A 1QK8A 3CYNA 3BBYA 3ERWA 3LQ7A 4OFTA 1OC9B 2X8CA 3Q19A 1T4ZA 2VL2A 3KD0A 3NOFA 3P2AA 2H1AA 2H1DA 2K9FA 2B5XA 1EWXA 3UARA 5A4VA 1NHYA 1YJ6A 4CY6A 4XS6A 5CRHA 2X49A 2WRTA 1K0AA 1T4YA 2C0FA 6GSTA 3KMNA 3I69A 1ZYNA 4E8EA 4EIQA 2FA8A 1EEMA 4OMVA 1C72A 2FA4A 4FIWA 2LS5A 2N5FA 3GYKA 1DE1A 1R5AA 2AAWA 3EC3A 4MJCA 3TKRA 2LQQA 4XRAA 1ZOFA 4IBPA 4NHWA 1VF2A 1TU7A 2L59A 1G6WA 3TJFA 11GSA 3KTBA 3TDGA 2TRCP 1M2DA 1BAYA 4HU7A 4F9ZA 3MAKA 4I97A 4ZL8A 1YDKA 1V58A 3MDKA 4KX4A 1OE8A 4K1FA 3TKSA 4X4JA 1G7OA 3FW2A 3RBTA 1R26A 5GAND 3TB2A 2RUEA 1Q98A 3M9KA 3KJYA 4V1Ag 4WXTA 4ECBA 1RQMA 1DE2A 3GX8A 4GCIA 3HYPA 2LEGA 3F3QA 3WD6A 1AC1A 4HS1A 1FVJA 4F0CA
chains in the Genus database with same CATH topology
3A3TA 3F6FA 1T7PB 4V2MA 3QDNA 3TOUA 4OO4A 3GH9A 2QC7A 4QL7A 3UVHA 4EF0A 3FYGA 2FWGA 5HFKA 5COHA 4OO5A 4Z2UA 2LSTA 1O8XA 4TR1A 4RI6A 3LXZA 1K0NA 3TKQA 2MMZA 3ZRDA 4HQSA 4MJAA 1BJXA 1Y6EA 1AW9A 3IR4A 3PH9A 4FYUA 4EIPA 3A2XA 1Z9HA 3FZ5A 1AQVA 3HXSA 2O7KA 5F05A 2VLVA 2YJHA 3GMFA 2GGTA 4X0XA 4PQ1A 2EC4A 2E2GA 3D5JA 5D8IA 1F3AA 1O6JA 4NWYA 5J9CA 1QQ2A 4HJ2A 5ENUA 4IP6A 2GDRA 4Z7XA 3UEMA 2JZTA 3R2QA 3GKKA 2KP2A 5IQYA 3ISOA 2A4VA 2B3SA 3F9UA 1XWBA 4ILFA 2CAQA 3GFKA 1JZWA 2PWJA 2I4AA 1K0DA 2GQKA 2FWEA 2V1MA 1SENA 2H6XA 4ZBDA 2LUSA 1A0RP 4RQXA 2DKIA 3HHVA 2JSZA 2JZSA 3IHGA 1J9BA 2J9HA 2HZEB 1OC8A 1FG4A 3HCZA 1KBNA 1R7HA 2IFQB 2YNXA 3W8JA 1TU8A 2GZPA 3S9FA 1GNWA 4O5QA 1GTAA 2FUG2 1EP7A 3ZYWA 3GKXA 1V98A 3TJBA 2I81A 1B48A 4NV2A 2VM1A 2OACA 4MABA 3C1RA 3BCKA 4ZILA 3VFIA 3EPTA 2PU9C 4JRRA 4TR4A 3U5RE 4IP1A 2WFCA 3APOA 3P8WA 2AUVA 5H5QA 1O8WA 2IMFA 4PUAA 1MD3A 2L6CA 3PGTA 3RHCA 3H1NA 1KTEA 5F07A 4PUFC 3UL3A 5DALB 1H75A 2GZYA 2AB6A 4TRXA 1B4PA 4FO5A 3G7YA 4ICYA 3RPNA 2H30A 5IMZA 3LORA 2PVQA 2JL4A 1AAZA 1SU9A 3C73A 5DAKB 3C71A 1AQWA 5HQPA 4QL9A 4HQZA 1X5EA 2XHFA 3H79A 1A8YA 1F3BA 2R5GA 2YWOA 2DKHA 3HKRA 5IOWA 1YY7A 3FR9A 5KN2A 2H1GA 3TKSC 1K3OA 3GTUA 3G9BA 2E2MA 2R4VA 2MBTA 3ZITA 5B7CA 5IPGA 5B8AA 4K7OA 3ME8A 3GIXA 2K8VA 3ZIJA 1V2AA 5JWOB 2M72A 4CY8A 2E0QA 2H6YA 3DD3A 1S3DA 1PD21 3TJGA 3OR5A 2R0PA 1YQ1A 4YAVA 4XRDA 2O85A 4HUAA 3D21A 3HVXA 2XBIA 4A5PA 2DIYA 3EE2A 3C7MA 3HJMA 3CBUA 3VWVA 3N5OA 3F4TA 4MJBA 5DVBA 1PL1A 4WF5A 1WE0A 1PX7A 5HR2A 4MNNA 1QGVA 9GSSA 4F03A 3KMOA 1GULA 2FWHA 4POBA 2PBJA 5DQYA 2XC2A 2H6ZA 2LNSA 5CRGA 4XS1A 1G7EA 3KP8A 4POLA 3ZVJD 4G0IA 1THOA 3RDWA 1U3AA 3F3RA 3WYWA 5HFGA 1HQOA 4Z2RA 1Z7RA 3Q6OA 1XVQA 3ZZXA 2LRNA 2GQLA 1GLQA 2KUCA 1R4WA 2YCDA 4PQIA 2YZHA 4Q5NA 1HD2A 4ZB8A 4OD7A 3TRXA 4NHZA 4PURA 3WT1A 5IMAA 4LLRA 2H66A 2XBQA 2H72A 2R2JA 4AGSA 2IFQA 3KXOA 3MIXA 1A8LA 2DJ1A 2OE0A 1JLWA 2JZRA 4BVYA 3QOUA 4G0KA 1ERTA 1SL0B 2H0HA 5IO2A 4ML1A 1TP9A 4DSRA 3N9JA 2A4HA 2YWIA 4NAXA 1MTCA 2H8LA 3HDCA 3ERFA 4KF9A 2I9HA 3FKFA 1AQXA 2HRNA 1PL2A 3LG6A 3IBHA 3BCIA 1T8EB 2JSYA 1M9BA 2CQ9A 4EKZA 1BEDA 1ZYPA 1A2LA 2VD0A 2H74A 5ELGA 1QXHA 1UN2A 5D9XA 1VF1A 2F8FA 1NHOA 3CSJA 3KM6A 5DALA 5LD0A 3DKSA 3VI7A 3GSSA 4WR5A 5J5NA 2R37A 3UBLA 3EINA 4K0NA 3AY8A 3GKMA 4PX1A 1T00A 1BQ7A 1LU4A 4JBBA 4FH8A 2LTKA 3GL3A 4HOJA 2O87A 2HSYA 2LRCA 3V1WA 1JZDA 4K2XA 2LJRA 1WWJA 2H71A 5ECPB 4HZ4A 2GSSA 1F2EA 5KEJA 2I3YA 5GSSA 2ALBA 1GNEA 1A23A 1ACVA 4KB3A 4G0LA 3RAZA 5JCWA 3ED3A 2K8SA 2UZ8A 1SL2B 5BRTA 4AJ8A 1USBA 3LSZA 4I5QA 1FB0A 1SK1A 4BWQA 5G5FA 2YPMA 2VCXA 4TOPA 4EE0A 4GF0A 4MH3A 2IMDA 3GNJA 5IO0A 3QCPA 6GSXA 3J7Yk 1M99A 3CMIA 5E59A 3GX0A 4IELA 1YEXA 1A0FA 3GH6A 1M9AA 1EOHA 1TRSA 5AIXA 3LJRA 5LNKe 4ZIJA 1ZL9A 1F9MA 4MF7A 3VK9A 3FR3A 2RIIA 4IJIA 4KAEA 1WPIA 4KCEA 2EIQA 1MDIA 4ZL9A 3DGQA 2IMEA 3LEFA 4IN0A 4Z2TA 1A2MA 1YZXA 2XPEA 2BTOT 2H75A 1K3YA 4G10A 2H73A 5E4WA 5KN3A 5G2ZA 3IDVA 3TKSE 5ECKB 4FYBA 4WEYA 2O89A 4KSOA 6GSSA 3HD5A 4HDEA 1YF1A 4EC0A 4HI7A 1PMTA 2C1YA 5ABRA 1DUGA 1UVZA 2CA8A 3CXGA 10GSA 4KNDA 2ON7A 2GT5A 3CSIA 1M2BA 3JCML 4G2EA 1TRWA 2DC5A 5D9VA 4MH2A 4WETA 1GSSA 3D4MA 1X0RA 1Z6MA 2X64A 3FEUA 4YAPA 2VCZA 4ISDA 1TK5B 5H5SA 4G19A 3UMAA 3TGZA 3L9VA 1G6YA 3GTUB 5A4WA 5CO3A 2AHEA 1XWGA 17GSA 4NV5A 1I9DA 4PNGA 2B7JA 2PN8A 1K0OA 3L78A 1SYRA 2GSRA 3TOTA 2MMNA 2HYXA 3KCMA 4CDOA 1JZOA 1XBSA 1K0BA 3Q18A 1PQNA 3W6GA 2H1BA 1SJIA 1EV4A 2F3MA 1XCCA 1U3IA 2NVLA 4MPFA 2F51A 1O85A 3PR8A 3WGXA 5EY6A 2B1LA 4ZBBA 4IW9A 2VM2A 2V6OA 1EEJA 4N10A 1FHEA 4O92A 3QFAC 1PKWA 1URMA 2IIYA 3VURA 3TKPA 5EPFA 4YKGA 3EVIA 3BOAA 5C00A 1U87A 1ERUA 1BX9A 1OAZA 2HSHA 1K0MA 1X9SB 3A5IA 2C80A 3KEBA 2WB9A 2CAIA 4K2DA 3I6AA 5HR1A 1Y25A 4BA7A 2YJ7A 2A2RA 2V2GA 5CP1A 3EU4A 4MF5A 4HU9A 2H76A 3UAPA 1XOAA 4WR4A 1F6MC 4EDZA 3BJ5A 5ID2A 5ECRB 2IJYA 5H5RA 4KDYA 2F8AA 3HZ8A 2KOKA 4I2TA 4P3YB 5FWGA 3QMXA 1GP1A 3KH7A 2OADA 2EIRA 1GTUA 1Q4JA 1SKRB 3E9JB 4OFMA 3ME7A 4MZWA 1PKZA 4QQ7A 2P5QA 1SKWB 4TVEA 2IL3A 4BVYB 4YQVA 1ERWA 5L71A 1GSFA 4TXOB 1BG5A 1G0TA 2VL2C 2LKUA 2GVPA 4IS0A 3GA4A 2L5OA 4JR4A 1LJRA 4KDUA 5GSTA 3IV4A 2VL9A 5G5EA 2HSMA 4CW9A 4TXVA 3UOMA 4JE1A 2LQOA 1EOGA 3CRUA 3HY2A 1F37A 4D73A 5B6NA 4PQHA 2BMXA 1ON4A 1AXDA 3QAVA 1O73A 4BL7A 1IYIA 4LL1B 6GSYA 4WKWA 3FR6A 4K5RA 2L57A 1XPVA 3GSTA 3C1SA 3GV1A 1Z6NA 4PGTA 2QGVA 3G7IA 5D93A 4BWSA 1QMVA 4XHMA 3QAGA 4O32A 3UVTA 3IRAA 4BPYA 2GTUA 1KNGA 4ECCA 5B6MA 3F8UA 4KE3A 4IHUA 2G2QA 4DSQA 2GLRA 5AGYA 3DRNA 2TIRA 1OKDA 2ZCTA 3M0FA 4KSMA 4IQ1A 4LMWA 5G30A 3M3MA 1T3BA 4KDXA 1SL1B 3K8NA 1CQHA 5G1LA 4MF6A 4N0ZA 1XWKA 1PN9A 1ZMAA 1XW5A 3FZ4A 5CREA 4GSSA 3ZLPA 1J0FA 2HNLA 3PINA 2YN1A 3TRQA 2OE3A 3VI5A 1WIKA 3L4NA 4KCAA 3LFLA 3LGCA 4IJ3A 2XPDA 4L5OA 4L5LA 1MD4A 5GZZB 2DJJA 1S3CA 3HJOA 3E0UA 3FZ9A 6GSVA 1V40A 2DBCA 3EWLA 3IC8A 3ZMLA 5AN1A 1SD9A 4TR0A 4XTSA 4GTUA 14GSA 4N0VA 3IE3A 4I6XA 2M80A 3KGKA 4Q5FA 16GSA 1M2AA 3NZNA 2X4AA 3O6TA 5D9WA 5INYA 3HA9A 2E7PA 3M8NA 2HLSA 3IAS2 2C3QA 2PGTA 1JFUA 3ZREA 1B9XC 2OKAA 4ECJA 1XVWA 1GSDA 2R0CA 1EGOA 5DCGA 4GLTA 4K7NA 3P7XA 5LCZA 1MEKA 2KLXA 5AISA 5IIZA 4EDYA 5CRDA 5J3RA 2WCIA 4TKYA 1KEBA 2JU5A 2LRTA 5CYYA 1Z3EA 4TXOA 3ZMKA 2P31A 5D9TA 3RPPA 2R3XA 2ZUPA 1THXA 2PVOC 3D22A 4X1UA 5F0GA 4DEJA 3U6VA 3GN3A 4MK3A 3CRTA 3GKNA 1YKCA 2QKEA 5B8BA 7GSSA 4WBJA 1EZKA 20GSA 4DSSB 2C8UA 4FYCA 3MSZA 2I1UA 1BYEA 1Z5YE 4GQCA 3VWUA 1N8JA 1FOHA 2V41A 3UIWA 4K9ZA 1XWCA 1B8XA 2GSTA 1UC7A 1XXUA 4MZCA 5ELAA 3RHBA 1XW9A 4YH2A 2YWNA 3IAM2 5C04A 1VGLA 1AUCA 2L6DA 1SD8A 3QPMA 1N2AA 2C3TA 1GSQA 3DWVA 1A2JA 2NBSA 1GSUA 1M7TA 4N11A 2A2SA 1TRVA 4GRFA 4GSTA 4NMUA 5IM9A 4EO3A 2F9SA 1RK4A 3PPUA 3TJKA 5KOXA 3VWWA 2HI7A 5ID2B 3VPQA 1EP8A 3CTFA 1XW6A 1X5CA 2VLUA 2VCVA 5IMFA 2K18A 4RQRA 1GTBA 4YKFA 3SBCA 4K8MA 2GT6A 1B4QA 3GURA 1PN0A 1TXXA 1O81A 2HZFA 1WOUA 2VUPA 2WJUA 4F2IA 2FD3A 3ZFLA 2L4QA 2K6VA 2VIMA 1TK0B 3DYRA 3QAWA 4OCFA 2FHEA 2VO4A 5ECQB 2X8HA 5DJMA 2YZUA 1W89A 3QFBC 2A2PA 2R6KA 4LL4B 3TRPA 4J56E 1GTIA 1OC3A 3ZVJA 3NIVA 3MYDA 5EL8A 1MDJA 4WBRD 1GUMA 2HXKA 4BVXA 1GLPA 3UBKA 4ZL7A 1PX6A 4L0WA 1YKAA 3EURA 1VRSD 3LXTA 2FY6A 3IA1A 5G31A 4AF2A 1J08A 4D73B 1X5DA 1O7UA 4ZBAA 2X99A 3I9V2 2DMMA 4BL7B 1JLVA 1OYJA 3MNGA 3LYKA 2D2ZA 3IPZA 4MJEA 3APSA 3FK8A 4HEA2 5DJLA 4AJ6A 4KW6A 1SJ6A 3SWLA 1EV9A 1UA5A 1AIUA 3TJJA 1X9WB 4YQUA 22GSA 3TUEA 4MZBA 3ZFBA 2C4JA 2WGRA 4XIHA 5A5KA 4EVMA 3US3A 4ECIA 2MMAA 1V57A 2H19A 1ERVA 1ILOA 2ON5A 4V2NA 5HFIA 5ECOB 5IMVA 2VAFA 3WGEA 1ST9A 2G0FA 3C8EA 2PMTA 4F82A 2O8VB 5D73A 1TI3A 1XOBA 3F4RA 2CT6A 5ECLB 1SJZA 2GQMA 1HNCA 3VWXA 3DIEA 4POKA 5DDLA 4IVFA 3KH9A 4G9HA 2NPBA 1JHBA 2X8GA 3DVXA 1XZOA 4KH7A 3A2VA 3IK9A 4MCUA 2EIOA 3FY7A 4MPGA 4MLYA 4DSSA 1ABAA 2QA2A 4XS4B 4L0UA 1PA3A 1SKSB 1WJKA 3M1GA 2CVBA 2C0DA 5KN0A 3ERGA 3GUSA 1SK2A 1GSEA 2ZNMA 4GSNA 2C0GA 1DBYA 5JCUA 5D96A 2FLSA 2JADA 4RUVA 2OBKA 2IMKA 2V6KA 1TTZA 4TW5A 2DJ0A 1QFNA 5J9BA 4YQMA 1K0CA 2J23A 1IYHA 2HRFA 5KN1A 3GL5A 3W8SA 2TRXA 2L4CA 4I2UA 4IKHA 1TK8B 2B5EA 1OKTA 4NXIA 2P0GA 2QA1A 4KA0A 4EXJA 3O76A 3HJPA 1W4VA 4K7IA 3H93A 6GSUA 2N5AA 1JZRA 1H4OA 2RLIA 1TW9A 1RW1A 4Q5QA 1WP0A 2CZ2A 1FVKA 5HR3A 4N30A 1NW2A 4L8EA 3EMXA 4NPBA 2H0GA 3F0IA 4OFNA 4ZB9A 2R0GA 4DVCA 1PRXA 2C3NA 2OJLA 5DQSA 4O5RA 3L9UA 1V9WA 3DVWA 1ZYEA 1HYUA 2M46A 1OC9A 2REMA 2QSIA 2YANA 2H70A 3R3EA 2C0EA 4CHSA 2YP6A 1NSWA 3J7Yb 2AYTA 4O5UA 5J41A 2IPAA 4USSA 5FT3A 3CTGA 2OBIA 4F0BA 3GHAA 4FQUA 3DEXA 2KHPA 4XCSA 8GSSA 2NDOA 4JZQA 4MDCA 3HVVA 1LBKA 4PXOA 3KP9A 1FW1A 3A2WA 5DCHA 5IPHA 3Q74A 4HJMA 1PGTA 3CSHA 2OE1A 1DSBA 4JEDA 4ML6A 2PPTA 3IXRA 1PSQA 1K3LA 1E6BA 2FGXA 3QR6A 13GSA 1Z7PA 5CNWA 4TN8A 1WRYA 2GZZA 3FMWA 3BD2A 2FCHA 3A5WA 4MMMA 2GS3A 4POMA 1CQGA 3D6IA 2FNOA 4IQAA 3G7JA 6GSWA 19GSA 2YWMA 3FHKA 4J57E 5ECNB 1TDIA 3E3EA 1TRUA 2PERA 3MWHA 1ML6A 3L9SA 3WGDA 3HVSA 4X43A 3LW9A 2KP1A 3WT2A 2DSAA 1GL8A 5F06A 5IOXA 1ZCPA 5FHIA 2CVDA 3D4TA 2VLTA 5KOWA 2LNTA 4V1Ap 1I5GA 2RM6A 3O3TA 3EU3A 1XFLA 3UJ1A 4LA1A 2LJAA 3TCOA 1GSYA 2B7KA 2JACA 3P90A 2BJXA 2CX3A 2LJKA 2L5LA 1FAAA 4V2LA 1GUKA 2VL3A 3IOSA 1YEPA 2HT9A 1NM3A 2IN3A 5JWRB 1GRXA 1SYXA 2IMIA 4XS4A 1EGRA 4ACSA 2YV9A 5ECSA 12GSA 4MA9A 1SK0A 3F6DA 4JR6A 5EVOA 4O7HA 3APQA 1VF4A 2DJKA 1ZYQB 4I8BA 1T1VA 3DXBA 3ZL5A 18GSA 1GWCA 4KUNA 3EYTA 4BVXB 2HRAA 3IHQA 2ES7A 3VPTA 2Z9SA 5DBQA 4K0GA 2LV3A 5ECIB 1S3AA 4OCEA 2CX4A 1VF3A 4J2FA 2NTOA 3M9JA 2MBSA 1MDKA 2GSQA 4PNFA 1U88A 4K5SA 2VCTA 1X9MB 1WMJA 1E2YA 2RUFA 2B1KA 4GQFA 5BMUA 5ECHB 2DJ2A 1HNAA 2B5YA 5J4UA 2WS2A 1FO5A 3FZAA 2P5RA 3H8QA 4KGIA 4ULXA 1GUHA 5IMCA 4LMVA 1ZGNA 3ZTLA 4OWYA 1XIYA 3IK7A 1HNBA 3EMPA 2PUKC 2MZCA 4H86A 2H0IA 2OA7A 5JWQB 2VOCA 1GH2A 2HE3A 1A24A 2WULA 2CV4A 3FRCA 4PTSA 5AIVA 2WDUA 2HZEA 2HRKA 2VD1A 3F63A 2AV4A 1R5PA 1YF0A 1TI1A 5ECMB 3F4SA 3QD9A 1FB6A 2IWTA 4ZXGA 5JCGA 2N5BA 2AJQB 4Q5RA 3KIJA 3LYPA 3D0ZA 4GXZA 2MMOA 3LWAA 1QUWA 2DIZA 5GAPD 4AJ7A 2DLXA 2YOIA 4WF4A 5A4UA 4TR1B 3KTLA 4EUYA 4RI7A 5IMDA 2FWFA 1OE7A 2CVKA 1ZZYA 2WZ9A 4HZ2A 3VLNA 5CAXA 1TJDA 3GRXA 1U6TA 1TOFA 2YV7A 4JU5A 4MP4A 4TR3A 5CRWA 1OVNA 2DMLA 2V32A 3I43A 4E8HA 5DAKA 2RM5A 2DJ3A 2VCQA 1FOVA 3ZIVA 3IC4A 4ZB6A 2H01A 3H4KA 2B6MA 2VCWA 4IGJA 2HFDA 5HR0A 1TKDB 4K6XA 2CZ3A 3L0HA 4GWRA 2MYGA 3KZQA 4ID0A 1XWAA 5G1KA 3DMLA 1M0UA 5F8BA 3HZ4A 1B9YC 4EL1A 1QK8A 3CYNA 3BBYA 3ERWA 3LQ7A 4OFTA 1OC9B 2X8CA 3Q19A 1T4ZA 2VL2A 3KD0A 3NOFA 3P2AA 2H1AA 2H1DA 2K9FA 2B5XA 1EWXA 3UARA 5A4VA 1NHYA 1YJ6A 4CY6A 4XS6A 5CRHA 2X49A 2WRTA 1K0AA 1T4YA 2C0FA 6GSTA 3KMNA 3I69A 1ZYNA 4E8EA 4EIQA 2FA8A 1EEMA 4OMVA 1C72A 2FA4A 4FIWA 2LS5A 2N5FA 3GYKA 1DE1A 1R5AA 2AAWA 3EC3A 4MJCA 3TKRA 2LQQA 4XRAA 1ZOFA 4IBPA 4NHWA 1VF2A 1TU7A 2L59A 1G6WA 3TJFA 11GSA 3KTBA 3TDGA 2TRCP 1M2DA 1BAYA 4HU7A 4F9ZA 3MAKA 4I97A 4ZL8A 1YDKA 1V58A 3MDKA 4KX4A 1OE8A 4K1FA 3TKSA 4X4JA 1G7OA 3FW2A 3RBTA 1R26A 5GAND 3TB2A 2RUEA 1Q98A 3M9KA 3KJYA 4V1Ag 4WXTA 4ECBA 1RQMA 1DE2A 3GX8A 4GCIA 3HYPA 2LEGA 3F3QA 3WD6A 1AC1A 4HS1A 1FVJA 4F0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A3T A;  3F6F A;  1T7P B;  4V2M A;  3QDN A;  3TOU A;  4OO4 A;  3GH9 A;  2QC7 A;  4QL7 A;  3UVH A;  4EF0 A;  3FYG A;  2FWG A;  5HFK A;  5COH A;  4OO5 A;  2LST A;  1O8X A;  4TR1 A;  4RI6 A;  3LXZ A;  1K0N A;  3TKQ A;  2MMZ A;  3ZRD A;  4HQS A;  4MJA A;  1BJX A;  1Y6E A;  1AW9 A;  3IR4 A;  3PH9 A;  4FYU A;  3A2X A;  1Z9H A;  3FZ5 A;  1AQV A;  3HXS A;  2O7K A;  5F05 A;  2VLV A;  2YJH A;  3GMF A;  2GGT A;  4X0X A;  4PQ1 A;  2EC4 A;  2E2G A;  3D5J A;  5D8I A;  1F3A A;  1O6J A;  4NWY A;  5J9C A;  1QQ2 A;  4HJ2 A;  5ENU A;  4IP6 A;  2GDR A;  4Z7X A;  3UEM A;  2JZT A;  3R2Q A;  3GKK A;  2KP2 A;  5IQY A;  3ISO A;  2A4V A;  2B3S A;  3F9U A;  1XWB A;  4ILF A;  2CAQ A;  3GFK A;  1JZW A;  2PWJ A;  2I4A A;  1K0D A;  2GQK A;  2FWE A;  2V1M A;  1SEN A;  2H6X A;  4ZBD A;  2LUS A;  1A0R P;  4RQX A;  3HHV A;  2JSZ A;  2JZS A;  1J9B A;  2J9H A;  2HZE B;  1OC8 A;  1FG4 A;  3HCZ A;  1KBN A;  1R7H A;  2IFQ B;  2YNX A;  3W8J A;  1TU8 A;  2GZP A;  3S9F A;  1GNW A;  1GTA A;  2FUG 2;  1EP7 A;  3ZYW A;  3GKX A;  1V98 A;  3TJB A;  2I81 A;  1B48 A;  4NV2 A;  2VM1 A;  2OAC A;  4MAB A;  3C1R A;  3BCK A;  4ZIL A;  3VFI A;  2PU9 C;  4JRR A;  4TR4 A;  3U5R E;  4IP1 A;  2WFC A;  3APO A;  3P8W A;  2AUV A;  5H5Q A;  1O8W A;  2IMF A;  4PUA A;  1MD3 A;  2L6C A;  3PGT A;  3RHC A;  3H1N A;  1KTE A;  5F07 A;  4PUF C;  3UL3 A;  5DAL B;  1H75 A;  2GZY A;  2AB6 A;  4TRX A;  1B4P A;  4FO5 A;  3G7Y A;  3RPN A;  2H30 A;  5IMZ A;  3LOR A;  2PVQ A;  2JL4 A;  1AAZ A;  1SU9 A;  3C73 A;  5DAK B;  3C71 A;  1AQW A;  5HQP A;  4QL9 A;  4HQZ A;  1X5E A;  2XHF A;  3H79 A;  1A8Y A;  1F3B A;  2R5G A;  2YWO A;  3HKR A;  5IOW A;  1YY7 A;  3FR9 A;  5KN2 A;  2H1G A;  3TKS C;  1K3O A;  3GTU A;  3G9B A;  2E2M A;  2R4V A;  2MBT A;  3ZIT A;  5B7C A;  5IPG A;  5B8A A;  4K7O A;  3ME8 A;  3GIX A;  2K8V A;  3ZIJ A;  1V2A A;  5JWO B;  2M72 A;  2E0Q A;  2H6Y A;  3DD3 A;  1S3D A;  1PD2 1;  3TJG A;  3OR5 A;  1YQ1 A;  4YAV A;  4XRD A;  2O85 A;  4HUA A;  3D21 A;  3HVX A;  2XBI A;  2DIY A;  3EE2 A;  3C7M A;  3HJM A;  3CBU A;  3VWV A;  3N5O A;  3F4T A;  4MJB A;  5DVB A;  1PL1 A;  4WF5 A;  1WE0 A;  1PX7 A;  5HR2 A;  1QGV A;  9GSS A;  4F03 A;  3KMO A;  1GUL A;  2FWH A;  4POB A;  2PBJ A;  5DQY A;  2XC2 A;  2H6Z A;  2LNS A;  5CRG A;  4XS1 A;  1G7E A;  3KP8 A;  4POL A;  3ZVJ D;  1THO A;  3RDW A;  1U3A A;  3F3R A;  3WYW A;  5HFG A;  1HQO A;  1Z7R A;  3Q6O A;  1XVQ A;  3ZZX A;  2LRN A;  2GQL A;  1GLQ A;  2KUC A;  1R4W A;  2YCD A;  4PQI A;  2YZH A;  4Q5N A;  1HD2 A;  4ZB8 A;  4OD7 A;  3TRX A;  4NHZ A;  4PUR A;  3WT1 A;  5IMA A;  4LLR A;  2H66 A;  2XBQ A;  2H72 A;  2R2J A;  4AGS A;  2IFQ A;  3KXO A;  1A8L A;  2DJ1 A;  2OE0 A;  1JLW A;  2JZR A;  4BVY A;  3QOU A;  1ERT A;  1SL0 B;  2H0H A;  5IO2 A;  4ML1 A;  1TP9 A;  4DSR A;  3N9J A;  2YWI A;  4NAX A;  1MTC A;  2H8L A;  3HDC A;  3ERF A;  2I9H A;  3FKF A;  1AQX A;  2HRN A;  1PL2 A;  3LG6 A;  3IBH A;  3BCI A;  1T8E B;  2JSY A;  1M9B A;  2CQ9 A;  4EKZ A;  1BED A;  1A2L A;  2VD0 A;  2H74 A;  5ELG A;  1QXH A;  1UN2 A;  5D9X A;  1VF1 A;  2F8F A;  1NHO A;  3CSJ A;  3KM6 A;  5DAL A;  5LD0 A;  3DKS A;  3VI7 A;  3GSS A;  4WR5 A;  5J5N A;  2R37 A;  3UBL A;  3EIN A;  4K0N A;  3AY8 A;  3GKM A;  4PX1 A;  1T00 A;  1BQ7 A;  1LU4 A;  4JBB A;  4FH8 A;  2LTK A;  3GL3 A;  4HOJ A;  2O87 A;  2HSY A;  2LRC A;  3V1W A;  1JZD A;  2LJR A;  1WWJ A;  2H71 A;  5ECP B;  4HZ4 A;  2GSS A;  1F2E A;  5KEJ A;  2I3Y A;  5GSS A;  2ALB A;  1GNE A;  1A23 A;  1ACV A;  4KB3 A;  3RAZ A;  5JCW A;  3ED3 A;  2K8S A;  1SL2 B;  4AJ8 A;  1USB A;  3LSZ A;  4I5Q A;  1FB0 A;  1SK1 A;  4BWQ A;  5G5F A;  2YPM A;  2VCX A;  4TOP A;  4EE0 A;  4GF0 A;  4MH3 A;  2IMD A;  3GNJ A;  5IO0 A;  3QCP A;  6GSX A;  3J7Y k;  1M99 A;  3CMI A;  5E59 A;  3GX0 A;  4IEL A;  1YEX A;  1A0F A;  3GH6 A;  1M9A A;  1EOH A;  1TRS A;  5AIX A;  3LJR A;  5LNK e;  4ZIJ A;  1ZL9 A;  1F9M A;  4MF7 A;  3VK9 A;  3FR3 A;  2RII A;  4IJI A;  4KAE A;  1WPI A;  4KCE A;  2EIQ A;  1MDI A;  4ZL9 A;  3DGQ A;  2IME A;  3LEF A;  4IN0 A;  1A2M A;  1YZX A;  2XPE A;  2BTO T;  2H75 A;  1K3Y A;  4G10 A;  2H73 A;  5E4W A;  5KN3 A;  5G2Z A;  3IDV A;  3TKS E;  5ECK B;  4FYB A;  4WEY A;  2O89 A;  4KSO A;  6GSS A;  3HD5 A;  4HDE A;  1YF1 A;  4EC0 A;  4HI7 A;  1PMT A;  2C1Y A;  5ABR A;  1DUG A;  1UVZ A;  2CA8 A;  3CXG A;  10GS A;  4KND A;  2ON7 A;  2GT5 A;  3CSI A;  1M2B A;  3JCM L;  4G2E A;  1TRW A;  2DC5 A;  5D9V A;  4MH2 A;  4WET A;  1GSS A;  3D4M A;  1X0R A;  1Z6M A;  2X64 A;  3FEU A;  4YAP A;  2VCZ A;  4ISD A;  1TK5 B;  5H5S A;  4G19 A;  3UMA A;  3TGZ A;  3L9V A;  1G6Y A;  3GTU B;  5A4W A;  5CO3 A;  2AHE A;  1XWG A;  17GS A;  4NV5 A;  1I9D A;  4PNG A;  2B7J A;  2PN8 A;  1K0O A;  3L78 A;  1SYR A;  2GSR A;  3TOT A;  2MMN A;  2HYX A;  3KCM A;  4CDO A;  1JZO A;  1XBS A;  1K0B A;  3Q18 A;  1PQN A;  3W6G A;  2H1B A;  1SJI A;  1EV4 A;  2F3M A;  1XCC A;  1U3I A;  2NVL A;  4MPF A;  2F51 A;  1O85 A;  3PR8 A;  3WGX A;  5EY6 A;  2B1L A;  4ZBB A;  4IW9 A;  2VM2 A;  2V6O A;  1EEJ A;  4N10 A;  1FHE A;  4O92 A;  3QFA C;  1PKW A;  1URM A;  2IIY A;  3VUR A;  3TKP A;  5EPF A;  3EVI A;  3BOA A;  5C00 A;  1U87 A;  1ERU A;  1BX9 A;  1OAZ A;  2HSH A;  1K0M A;  1X9S B;  2C80 A;  3KEB A;  2WB9 A;  2CAI A;  4K2D A;  3I6A A;  5HR1 A;  1Y25 A;  4BA7 A;  2YJ7 A;  2A2R A;  2V2G A;  5CP1 A;  3EU4 A;  4MF5 A;  4HU9 A;  2H76 A;  3UAP A;  1XOA A;  4WR4 A;  1F6M C;  4EDZ A;  3BJ5 A;  5ID2 A;  5ECR B;  2IJY A;  5H5R A;  4KDY A;  2F8A A;  3HZ8 A;  2KOK A;  4I2T A;  4P3Y B;  5FWG A;  3QMX A;  1GP1 A;  3KH7 A;  2OAD A;  2EIR A;  1GTU A;  1Q4J A;  1SKR B;  3E9J B;  4OFM A;  3ME7 A;  4MZW A;  1PKZ A;  4QQ7 A;  2P5Q A;  1SKW B;  4TVE A;  2IL3 A;  4YQV A;  1ERW A;  5L71 A;  1GSF A;  4TXO B;  1BG5 A;  1G0T A;  2VL2 C;  2LKU A;  2GVP A;  4IS0 A;  3GA4 A;  2L5O A;  4JR4 A;  1LJR A;  4KDU A;  5GST A;  3IV4 A;  2VL9 A;  5G5E A;  4CW9 A;  4TXV A;  3UOM A;  4JE1 A;  2LQO A;  1EOG A;  3CRU A;  3HY2 A;  1F37 A;  4D73 A;  5B6N A;  4PQH A;  2BMX A;  1ON4 A;  1AXD A;  3QAV A;  1O73 A;  4BL7 A;  1IYI A;  4LL1 B;  6GSY A;  4WKW A;  3FR6 A;  2L57 A;  1XPV A;  3GST A;  3C1S A;  3GV1 A;  1Z6N A;  4PGT A;  2QGV A;  3G7I A;  5D93 A;  4BWS A;  1QMV A;  4XHM A;  3QAG A;  4O32 A;  3UVT A;  3IRA A;  4BPY A;  2GTU A;  1KNG A;  4ECC A;  5B6M A;  3F8U A;  4KE3 A;  4IHU A;  2G2Q A;  4DSQ A;  2GLR A;  5AGY A;  3DRN A;  2TIR A;  1OKD A;  2ZCT A;  3M0F A;  4KSM A;  4IQ1 A;  4LMW A;  5G30 A;  3M3M A;  1T3B A;  4KDX A;  1SL1 B;  3K8N A;  1CQH A;  5G1L A;  4MF6 A;  4N0Z A;  1XWK A;  1PN9 A;  1ZMA A;  1XW5 A;  3FZ4 A;  5CRE A;  4GSS A;  3ZLP A;  1J0F A;  2HNL A;  3PIN A;  2YN1 A;  3TRQ A;  2OE3 A;  3VI5 A;  1WIK A;  3L4N A;  4KCA A;  3LFL A;  3LGC A;  4IJ3 A;  2XPD A;  4L5O A;  4L5L A;  1MD4 A;  5GZZ B;  2DJJ A;  1S3C A;  3HJO A;  3E0U A;  3FZ9 A;  6GSV A;  1V40 A;  2DBC A;  3EWL A;  3ZML A;  5AN1 A;  1SD9 A;  4TR0 A;  4XTS A;  4GTU A;  14GS A;  4N0V A;  3IE3 A;  4I6X A;  2M80 A;  3KGK A;  4Q5F A;  16GS A;  1M2A A;  3NZN A;  3O6T A;  5D9W A;  5INY A;  3HA9 A;  2E7P A;  3M8N A;  2HLS A;  3IAS 2;  2C3Q A;  2PGT A;  1JFU A;  3ZRE A;  1B9X C;  2OKA A;  4ECJ A;  1XVW A;  1GSD A;  1EGO A;  5DCG A;  4GLT A;  4K7N A;  3P7X A;  5LCZ A;  1MEK A;  2KLX A;  5AIS A;  5IIZ A;  4EDY A;  5CRD A;  5J3R A;  2WCI A;  4TKY A;  1KEB A;  2JU5 A;  2LRT A;  5CYY A;  1Z3E A;  4TXO A;  3ZMK A;  2P31 A;  5D9T A;  3RPP A;  2R3X A;  2ZUP A;  1THX A;  2PVO C;  3D22 A;  4X1U A;  5F0G A;  4DEJ A;  3U6V A;  3GN3 A;  4MK3 A;  3CRT A;  3GKN A;  1YKC A;  2QKE A;  5B8B A;  7GSS A;  4WBJ A;  1EZK A;  20GS A;  4DSS B;  2C8U A;  4FYC A;  3MSZ A;  2I1U A;  1BYE A;  1Z5Y E;  4GQC A;  3VWU A;  1N8J A;  2V41 A;  3UIW A;  4K9Z A;  1XWC A;  1B8X A;  2GST A;  1UC7 A;  1XXU A;  4MZC A;  5ELA A;  3RHB A;  1XW9 A;  4YH2 A;  2YWN A;  3IAM 2;  5C04 A;  1VGL A;  1AUC A;  2L6D A;  1SD8 A;  3QPM A;  1N2A A;  2C3T A;  1GSQ A;  3DWV A;  1A2J A;  2NBS A;  1GSU A;  1M7T A;  4N11 A;  2A2S A;  1TRV A;  4GRF A;  4GST A;  4NMU A;  5IM9 A;  4EO3 A;  2F9S A;  1RK4 A;  3TJK A;  3VWW A;  2HI7 A;  5ID2 B;  3VPQ A;  1EP8 A;  3CTF A;  1XW6 A;  1X5C A;  2VLU A;  2VCV A;  5IMF A;  2K18 A;  4RQR A;  1GTB A;  3SBC A;  4K8M A;  2GT6 A;  1B4Q A;  3GUR A;  1TXX A;  1O81 A;  2HZF A;  1WOU A;  2VUP A;  2WJU A;  4F2I A;  2FD3 A;  3ZFL A;  2L4Q A;  2K6V A;  2VIM A;  1TK0 B;  3DYR A;  3QAW A;  4OCF A;  2FHE A;  2VO4 A;  5ECQ B;  2X8H A;  5DJM A;  2YZU A;  1W89 A;  3QFB C;  2R6K A;  4LL4 B;  3TRP A;  4J56 E;  1GTI A;  1OC3 A;  3ZVJ A;  3NIV A;  5EL8 A;  1MDJ A;  4WBR D;  1GUM A;  2HXK A;  4BVX A;  1GLP A;  3UBK A;  4ZL7 A;  1PX6 A;  4L0W A;  1YKA A;  3EUR A;  1VRS D;  3LXT A;  2FY6 A;  3IA1 A;  5G31 A;  4AF2 A;  1J08 A;  4D73 B;  1X5D A;  1O7U A;  4ZBA A;  2X99 A;  3I9V 2;  2DMM A;  1JLV A;  1OYJ A;  3MNG A;  3LYK A;  2D2Z A;  3IPZ A;  4MJE A;  3APS A;  3FK8 A;  4HEA 2;  5DJL A;  4AJ6 A;  4KW6 A;  1SJ6 A;  3SWL A;  1EV9 A;  1UA5 A;  1AIU A;  3TJJ A;  1X9W B;  4YQU A;  22GS A;  3TUE A;  4MZB A;  3ZFB A;  2C4J A;  2WGR A;  4XIH A;  5A5K A;  4EVM A;  3US3 A;  4ECI A;  2MMA A;  1V57 A;  2H19 A;  1ERV A;  1ILO A;  2ON5 A;  4V2N A;  5HFI A;  5ECO B;  5IMV A;  2VAF A;  3WGE A;  1ST9 A;  2G0F A;  3C8E A;  2PMT A;  4F82 A;  2O8V B;  5D73 A;  1TI3 A;  1XOB A;  3F4R A;  2CT6 A;  5ECL B;  1SJZ A;  2GQM A;  1HNC A;  3VWX A;  3DIE A;  4POK A;  5DDL A;  4IVF A;  3KH9 A;  4G9H A;  2NPB A;  1JHB A;  2X8G A;  3DVX A;  1XZO A;  4KH7 A;  3A2V A;  3IK9 A;  4MCU A;  2EIO A;  3FY7 A;  4MPG A;  4MLY A;  4DSS A;  1ABA A;  4XS4 B;  4L0U A;  1PA3 A;  1SKS B;  1WJK A;  3M1G A;  2CVB A;  2C0D A;  5KN0 A;  3ERG A;  3GUS A;  1SK2 A;  1GSE A;  2ZNM A;  4GSN A;  2C0G A;  1DBY A;  5JCU A;  5D96 A;  2FLS A;  2JAD A;  4RUV A;  2OBK A;  2IMK A;  2V6K A;  1TTZ A;  4TW5 A;  2DJ0 A;  1QFN A;  5J9B A;  4YQM A;  1K0C A;  2J23 A;  1IYH A;  2HRF A;  5KN1 A;  3GL5 A;  3W8S A;  2TRX A;  2L4C A;  4I2U A;  4IKH A;  1TK8 B;  2B5E A;  1OKT A;  4NXI A;  2P0G A;  4KA0 A;  4EXJ A;  3O76 A;  3HJP A;  1W4V A;  4K7I A;  3H93 A;  6GSU A;  2N5A A;  1JZR A;  1H4O A;  2RLI A;  1TW9 A;  1RW1 A;  4Q5Q A;  1WP0 A;  2CZ2 A;  1FVK A;  5HR3 A;  4N30 A;  1NW2 A;  4L8E A;  3EMX A;  4NPB A;  2H0G A;  3F0I A;  4OFN A;  4ZB9 A;  4DVC A;  1PRX A;  2C3N A;  2OJL A;  5DQS A;  4O5R A;  3L9U A;  1V9W A;  3DVW A;  1ZYE A;  1HYU A;  2M46 A;  1OC9 A;  2REM A;  2QSI A;  2YAN A;  2H70 A;  2C0E A;  4CHS A;  2YP6 A;  1NSW A;  3J7Y b;  2AYT A;  5J41 A;  2IPA A;  5FT3 A;  3CTG A;  2OBI A;  4F0B A;  3GHA A;  3DEX A;  2KHP A;  4XCS A;  8GSS A;  2NDO A;  4JZQ A;  4MDC A;  3HVV A;  1LBK A;  4PXO A;  3KP9 A;  1FW1 A;  3A2W A;  5DCH A;  5IPH A;  3Q74 A;  4HJM A;  1PGT A;  3CSH A;  2OE1 A;  1DSB A;  4JED A;  4ML6 A;  2PPT A;  3IXR A;  1PSQ A;  1K3L A;  1E6B A;  2FGX A;  3QR6 A;  13GS A;  1Z7P A;  5CNW A;  4TN8 A;  1WRY A;  2GZZ A;  3BD2 A;  2FCH A;  3A5W A;  4MMM A;  2GS3 A;  4POM A;  1CQG A;  3D6I A;  2FNO A;  4IQA A;  3G7J A;  6GSW A;  19GS A;  2YWM A;  3FHK A;  4J57 E;  5ECN B;  1TDI A;  3E3E A;  1TRU A;  2PER A;  3MWH A;  1ML6 A;  3L9S A;  3WGD A;  3HVS A;  4X43 A;  2KP1 A;  3WT2 A;  2DSA A;  1GL8 A;  5F06 A;  5IOX A;  1ZCP A;  5FHI A;  2CVD A;  3D4T A;  2VLT A;  2LNT A;  4V1A p;  1I5G A;  2RM6 A;  3O3T A;  3EU3 A;  1XFL A;  3UJ1 A;  4LA1 A;  2LJA A;  3TCO A;  1GSY A;  2B7K A;  2JAC A;  3P90 A;  2BJX A;  2CX3 A;  2LJK A;  2L5L A;  1FAA A;  4V2L A;  1GUK A;  2VL3 A;  3IOS A;  1YEP A;  2HT9 A;  1NM3 A;  2IN3 A;  5JWR B;  1GRX A;  1SYX A;  2IMI A;  4XS4 A;  1EGR A;  4ACS A;  2YV9 A;  5ECS A;  12GS A;  4MA9 A;  1SK0 A;  3F6D A;  4JR6 A;  5EVO A;  4O7H A;  3APQ A;  1VF4 A;  2DJK A;  1ZYQ B;  4I8B A;  1T1V A;  3DXB A;  3ZL5 A;  18GS A;  1GWC A;  4KUN A;  3EYT A;  3IHQ A;  2ES7 A;  3VPT A;  2Z9S A;  5DBQ A;  4K0G A;  2LV3 A;  5ECI B;  1S3A A;  4OCE A;  2CX4 A;  1VF3 A;  4J2F A;  2NTO A;  3M9J A;  2MBS A;  1MDK A;  2GSQ A;  4PNF A;  1U88 A;  2VCT A;  1X9M B;  1WMJ A;  1E2Y A;  2RUF A;  2B1K A;  4GQF A;  5ECH B;  2DJ2 A;  1HNA A;  2B5Y A;  5J4U A;  2WS2 A;  1FO5 A;  3FZA A;  2P5R A;  3H8Q A;  4KGI A;  4ULX A;  1GUH A;  5IMC A;  4LMV A;  1ZGN A;  3ZTL A;  4OWY A;  1XIY A;  3IK7 A;  1HNB A;  3EMP A;  2PUK C;  2MZC A;  4H86 A;  2H0I A;  2OA7 A;  5JWQ B;  2VOC A;  1GH2 A;  2HE3 A;  1A24 A;  2WUL A;  2CV4 A;  3FRC A;  5AIV A;  2WDU A;  2HZE A;  2VD1 A;  3F63 A;  2AV4 A;  1R5P A;  1YF0 A;  1TI1 A;  5ECM B;  3F4S A;  3QD9 A;  1FB6 A;  2IWT A;  4ZXG A;  5JCG A;  2N5B A;  2AJQ B;  4Q5R A;  3KIJ A;  3LYP A;  3D0Z A;  4GXZ A;  2MMO A;  3LWA A;  1QUW A;  2DIZ A;  5GAP D;  4AJ7 A;  2DLX A;  2YOI A;  4WF4 A;  5A4U A;  4TR1 B;  3KTL A;  4EUY A;  4RI7 A;  5IMD A;  2FWF A;  1OE7 A;  2CVK A;  1ZZY A;  2WZ9 A;  4HZ2 A;  3VLN A;  5CAX A;  1TJD A;  3GRX A;  1U6T A;  1TOF A;  2YV7 A;  4JU5 A;  4MP4 A;  4TR3 A;  5CRW A;  1OVN A;  2DML A;  2V32 A;  3I43 A;  4E8H A;  5DAK A;  2RM5 A;  2DJ3 A;  2VCQ A;  1FOV A;  3ZIV A;  3IC4 A;  4ZB6 A;  2H01 A;  3H4K A;  2B6M A;  2VCW A;  4IGJ A;  2HFD A;  5HR0 A;  1TKD B;  4K6X A;  2CZ3 A;  3L0H A;  4GWR A;  2MYG A;  3KZQ A;  4ID0 A;  1XWA A;  5G1K A;  3DML A;  1M0U A;  5F8B A;  3HZ4 A;  1B9Y C;  4EL1 A;  1QK8 A;  3CYN A;  3BBY A;  3ERW A;  3LQ7 A;  4OFT A;  1OC9 B;  2X8C A;  3Q19 A;  1T4Z A;  2VL2 A;  3KD0 A;  3NOF A;  3P2A A;  2H1A A;  2H1D A;  2K9F A;  2B5X A;  1EWX A;  3UAR A;  5A4V A;  1NHY A;  1YJ6 A;  4XS6 A;  5CRH A;  2WRT A;  1K0A A;  1T4Y A;  2C0F A;  6GST A;  3KMN A;  3I69 A;  4E8E A;  2FA8 A;  1EEM A;  4OMV A;  1C72 A;  2FA4 A;  4FIW A;  2LS5 A;  2N5F A;  3GYK A;  1DE1 A;  1R5A A;  2AAW A;  3EC3 A;  4MJC A;  3TKR A;  2LQQ A;  4XRA A;  1ZOF A;  4IBP A;  4NHW A;  1VF2 A;  1TU7 A;  2L59 A;  1G6W A;  3TJF A;  11GS A;  3KTB A;  3TDG A;  2TRC P;  1M2D A;  1BAY A;  4HU7 A;  4F9Z A;  3MAK A;  4I97 A;  4ZL8 A;  1YDK A;  1V58 A;  3MDK A;  4KX4 A;  1OE8 A;  4K1F A;  3TKS A;  1G7O A;  3FW2 A;  3RBT A;  1R26 A;  5GAN D;  3TB2 A;  2RUE A;  1Q98 A;  3M9K A;  3KJY A;  4V1A g;  4WXT A;  4ECB A;  1RQM A;  1DE2 A;  3GX8 A;  4GCI A;  3HYP A;  2LEG A;  3F3Q A;  3WD6 A;  1AC1 A;  4HS1 A;  1FVJ A;  4F0C A; 
#chains in the Genus database with same CATH topology
 3A3T A;  3F6F A;  1T7P B;  4V2M A;  3QDN A;  3TOU A;  4OO4 A;  3GH9 A;  2QC7 A;  4QL7 A;  3UVH A;  4EF0 A;  3FYG A;  2FWG A;  5HFK A;  5COH A;  4OO5 A;  4Z2U A;  2LST A;  1O8X A;  4TR1 A;  4RI6 A;  3LXZ A;  1K0N A;  3TKQ A;  2MMZ A;  3ZRD A;  4HQS A;  4MJA A;  1BJX A;  1Y6E A;  1AW9 A;  3IR4 A;  3PH9 A;  4FYU A;  4EIP A;  3A2X A;  1Z9H A;  3FZ5 A;  1AQV A;  3HXS A;  2O7K A;  5F05 A;  2VLV A;  2YJH A;  3GMF A;  2GGT A;  4X0X A;  4PQ1 A;  2EC4 A;  2E2G A;  3D5J A;  5D8I A;  1F3A A;  1O6J A;  4NWY A;  5J9C A;  1QQ2 A;  4HJ2 A;  5ENU A;  4IP6 A;  2GDR A;  4Z7X A;  3UEM A;  2JZT A;  3R2Q A;  3GKK A;  2KP2 A;  5IQY A;  3ISO A;  2A4V A;  2B3S A;  3F9U A;  1XWB A;  4ILF A;  2CAQ A;  3GFK A;  1JZW A;  2PWJ A;  2I4A A;  1K0D A;  2GQK A;  2FWE A;  2V1M A;  1SEN A;  2H6X A;  4ZBD A;  2LUS A;  1A0R P;  4RQX A;  2DKI A;  3HHV A;  2JSZ A;  2JZS A;  3IHG A;  1J9B A;  2J9H A;  2HZE B;  1OC8 A;  1FG4 A;  3HCZ A;  1KBN A;  1R7H A;  2IFQ B;  2YNX A;  3W8J A;  1TU8 A;  2GZP A;  3S9F A;  1GNW A;  4O5Q A;  1GTA A;  2FUG 2;  1EP7 A;  3ZYW A;  3GKX A;  1V98 A;  3TJB A;  2I81 A;  1B48 A;  4NV2 A;  2VM1 A;  2OAC A;  4MAB A;  3C1R A;  3BCK A;  4ZIL A;  3VFI A;  3EPT A;  2PU9 C;  4JRR A;  4TR4 A;  3U5R E;  4IP1 A;  2WFC A;  3APO A;  3P8W A;  2AUV A;  5H5Q A;  1O8W A;  2IMF A;  4PUA A;  1MD3 A;  2L6C A;  3PGT A;  3RHC A;  3H1N A;  1KTE A;  5F07 A;  4PUF C;  3UL3 A;  5DAL B;  1H75 A;  2GZY A;  2AB6 A;  4TRX A;  1B4P A;  4FO5 A;  3G7Y A;  4ICY A;  3RPN A;  2H30 A;  5IMZ A;  3LOR A;  2PVQ A;  2JL4 A;  1AAZ A;  1SU9 A;  3C73 A;  5DAK B;  3C71 A;  1AQW A;  5HQP A;  4QL9 A;  4HQZ A;  1X5E A;  2XHF A;  3H79 A;  1A8Y A;  1F3B A;  2R5G A;  2YWO A;  2DKH A;  3HKR A;  5IOW A;  1YY7 A;  3FR9 A;  5KN2 A;  2H1G A;  3TKS C;  1K3O A;  3GTU A;  3G9B A;  2E2M A;  2R4V A;  2MBT A;  3ZIT A;  5B7C A;  5IPG A;  5B8A A;  4K7O A;  3ME8 A;  3GIX A;  2K8V A;  3ZIJ A;  1V2A A;  5JWO B;  2M72 A;  4CY8 A;  2E0Q A;  2H6Y A;  3DD3 A;  1S3D A;  1PD2 1;  3TJG A;  3OR5 A;  2R0P A;  1YQ1 A;  4YAV A;  4XRD A;  2O85 A;  4HUA A;  3D21 A;  3HVX A;  2XBI A;  4A5P A;  2DIY A;  3EE2 A;  3C7M A;  3HJM A;  3CBU A;  3VWV A;  3N5O A;  3F4T A;  4MJB A;  5DVB A;  1PL1 A;  4WF5 A;  1WE0 A;  1PX7 A;  5HR2 A;  4MNN A;  1QGV A;  9GSS A;  4F03 A;  3KMO A;  1GUL A;  2FWH A;  4POB A;  2PBJ A;  5DQY A;  2XC2 A;  2H6Z A;  2LNS A;  5CRG A;  4XS1 A;  1G7E A;  3KP8 A;  4POL A;  3ZVJ D;  4G0I A;  1THO A;  3RDW A;  1U3A A;  3F3R A;  3WYW A;  5HFG A;  1HQO A;  4Z2R A;  1Z7R A;  3Q6O A;  1XVQ A;  3ZZX A;  2LRN A;  2GQL A;  1GLQ A;  2KUC A;  1R4W A;  2YCD A;  4PQI A;  2YZH A;  4Q5N A;  1HD2 A;  4ZB8 A;  4OD7 A;  3TRX A;  4NHZ A;  4PUR A;  3WT1 A;  5IMA A;  4LLR A;  2H66 A;  2XBQ A;  2H72 A;  2R2J A;  4AGS A;  2IFQ A;  3KXO A;  3MIX A;  1A8L A;  2DJ1 A;  2OE0 A;  1JLW A;  2JZR A;  4BVY A;  3QOU A;  4G0K A;  1ERT A;  1SL0 B;  2H0H A;  5IO2 A;  4ML1 A;  1TP9 A;  4DSR A;  3N9J A;  2A4H A;  2YWI A;  4NAX A;  1MTC A;  2H8L A;  3HDC A;  3ERF A;  4KF9 A;  2I9H A;  3FKF A;  1AQX A;  2HRN A;  1PL2 A;  3LG6 A;  3IBH A;  3BCI A;  1T8E B;  2JSY A;  1M9B A;  2CQ9 A;  4EKZ A;  1BED A;  1ZYP A;  1A2L A;  2VD0 A;  2H74 A;  5ELG A;  1QXH A;  1UN2 A;  5D9X A;  1VF1 A;  2F8F A;  1NHO A;  3CSJ A;  3KM6 A;  5DAL A;  5LD0 A;  3DKS A;  3VI7 A;  3GSS A;  4WR5 A;  5J5N A;  2R37 A;  3UBL A;  3EIN A;  4K0N A;  3AY8 A;  3GKM A;  4PX1 A;  1T00 A;  1BQ7 A;  1LU4 A;  4JBB A;  4FH8 A;  2LTK A;  3GL3 A;  4HOJ A;  2O87 A;  2HSY A;  2LRC A;  3V1W A;  1JZD A;  4K2X A;  2LJR A;  1WWJ A;  2H71 A;  5ECP B;  4HZ4 A;  2GSS A;  1F2E A;  5KEJ A;  2I3Y A;  5GSS A;  2ALB A;  1GNE A;  1A23 A;  1ACV A;  4KB3 A;  4G0L A;  3RAZ A;  5JCW A;  3ED3 A;  2K8S A;  2UZ8 A;  1SL2 B;  5BRT A;  4AJ8 A;  1USB A;  3LSZ A;  4I5Q A;  1FB0 A;  1SK1 A;  4BWQ A;  5G5F A;  2YPM A;  2VCX A;  4TOP A;  4EE0 A;  4GF0 A;  4MH3 A;  2IMD A;  3GNJ A;  5IO0 A;  3QCP A;  6GSX A;  3J7Y k;  1M99 A;  3CMI A;  5E59 A;  3GX0 A;  4IEL A;  1YEX A;  1A0F A;  3GH6 A;  1M9A A;  1EOH A;  1TRS A;  5AIX A;  3LJR A;  5LNK e;  4ZIJ A;  1ZL9 A;  1F9M A;  4MF7 A;  3VK9 A;  3FR3 A;  2RII A;  4IJI A;  4KAE A;  1WPI A;  4KCE A;  2EIQ A;  1MDI A;  4ZL9 A;  3DGQ A;  2IME A;  3LEF A;  4IN0 A;  4Z2T A;  1A2M A;  1YZX A;  2XPE A;  2BTO T;  2H75 A;  1K3Y A;  4G10 A;  2H73 A;  5E4W A;  5KN3 A;  5G2Z A;  3IDV A;  3TKS E;  5ECK B;  4FYB A;  4WEY A;  2O89 A;  4KSO A;  6GSS A;  3HD5 A;  4HDE A;  1YF1 A;  4EC0 A;  4HI7 A;  1PMT A;  2C1Y A;  5ABR A;  1DUG A;  1UVZ A;  2CA8 A;  3CXG A;  10GS A;  4KND A;  2ON7 A;  1M3J A;  2GT5 A;  3CSI A;  1M2B A;  3JCM L;  4G2E A;  1TRW A;  2DC5 A;  5D9V A;  4MH2 A;  4WET A;  1GSS A;  3D4M A;  1X0R A;  1Z6M A;  2X64 A;  3FEU A;  4YAP A;  2VCZ A;  4ISD A;  1TK5 B;  5H5S A;  4G19 A;  3UMA A;  3TGZ A;  3L9V A;  1G6Y A;  3GTU B;  5A4W A;  5CO3 A;  2AHE A;  1XWG A;  17GS A;  4NV5 A;  1I9D A;  4PNG A;  2B7J A;  2PN8 A;  1K0O A;  3L78 A;  1SYR A;  2GSR A;  3TOT A;  2MMN A;  2HYX A;  3KCM A;  4CDO A;  1JZO A;  1XBS A;  1K0B A;  3Q18 A;  1PQN A;  3W6G A;  2H1B A;  1SJI A;  1EV4 A;  2F3M A;  1XCC A;  1U3I A;  2NVL A;  4MPF A;  2F51 A;  1O85 A;  3PR8 A;  3WGX A;  5EY6 A;  2B1L A;  4ZBB A;  4IW9 A;  2VM2 A;  2V6O A;  1EEJ A;  4N10 A;  1FHE A;  4O92 A;  3QFA C;  1PKW A;  1URM A;  2IIY A;  3VUR A;  3TKP A;  5EPF A;  4YKG A;  3EVI A;  3BOA A;  5C00 A;  1U87 A;  1ERU A;  1BX9 A;  1OAZ A;  2HSH A;  1K0M A;  1X9S B;  3A5I A;  2C80 A;  3KEB A;  2WB9 A;  2CAI A;  4K2D A;  3I6A A;  5HR1 A;  1Y25 A;  4BA7 A;  2YJ7 A;  2A2R A;  2V2G A;  5CP1 A;  3EU4 A;  4MF5 A;  4HU9 A;  2H76 A;  3UAP A;  1XOA A;  4WR4 A;  1F6M C;  4EDZ A;  3BJ5 A;  5ID2 A;  5ECR B;  2IJY A;  5H5R A;  4KDY A;  2F8A A;  3HZ8 A;  2KOK A;  4I2T A;  4P3Y B;  5FWG A;  3QMX A;  1GP1 A;  3KH7 A;  2OAD A;  2EIR A;  1GTU A;  1Q4J A;  1SKR B;  3E9J B;  4OFM A;  3ME7 A;  4MZW A;  1PKZ A;  4QQ7 A;  2P5Q A;  1SKW B;  4TVE A;  2IL3 A;  4BVY B;  4YQV A;  1ERW A;  5L71 A;  1GSF A;  4TXO B;  1BG5 A;  1G0T A;  2VL2 C;  2LKU A;  2GVP A;  4IS0 A;  3GA4 A;  2L5O A;  4JR4 A;  1LJR A;  4KDU A;  5GST A;  3IV4 A;  2VL9 A;  5G5E A;  2HSM A;  4CW9 A;  4TXV A;  3UOM A;  4JE1 A;  2LQO A;  1EOG A;  3CRU A;  3HY2 A;  1F37 A;  4D73 A;  5B6N A;  4PQH A;  2BMX A;  1ON4 A;  1AXD A;  3QAV A;  1O73 A;  4BL7 A;  1IYI A;  4LL1 B;  6GSY A;  4WKW A;  3FR6 A;  4K5R A;  2L57 A;  1XPV A;  3GST A;  3C1S A;  3GV1 A;  1Z6N A;  4PGT A;  2QGV A;  3G7I A;  5D93 A;  4BWS A;  1QMV A;  4XHM A;  3QAG A;  4O32 A;  3UVT A;  3IRA A;  4BPY A;  2GTU A;  1KNG A;  4ECC A;  5B6M A;  3F8U A;  4KE3 A;  4IHU A;  2G2Q A;  4DSQ A;  2GLR A;  5AGY A;  3DRN A;  2TIR A;  1OKD A;  2ZCT A;  3M0F A;  4KSM A;  4IQ1 A;  4LMW A;  1M3I A;  5G30 A;  3M3M A;  1T3B A;  4KDX A;  1SL1 B;  3K8N A;  1CQH A;  5G1L A;  4MF6 A;  4N0Z A;  1XWK A;  1PN9 A;  1ZMA A;  1XW5 A;  3FZ4 A;  5CRE A;  4GSS A;  3ZLP A;  1J0F A;  2HNL A;  3PIN A;  2YN1 A;  3TRQ A;  2OE3 A;  3VI5 A;  1WIK A;  3L4N A;  4KCA A;  3LFL A;  3LGC A;  4IJ3 A;  2XPD A;  4L5O A;  4L5L A;  1MD4 A;  5GZZ B;  2DJJ A;  1S3C A;  3HJO A;  3E0U A;  3FZ9 A;  6GSV A;  1V40 A;  2DBC A;  4HSC X;  3EWL A;  3IC8 A;  3ZML A;  5AN1 A;  1SD9 A;  4TR0 A;  4XTS A;  4GTU A;  14GS A;  4N0V A;  3IE3 A;  4I6X A;  2M80 A;  3KGK A;  4Q5F A;  16GS A;  1M2A A;  3NZN A;  2X4A A;  3O6T A;  5D9W A;  5INY A;  3HA9 A;  2E7P A;  3M8N A;  2HLS A;  3IAS 2;  2C3Q A;  2PGT A;  1JFU A;  3ZRE A;  1B9X C;  2OKA A;  4ECJ A;  1XVW A;  1GSD A;  2R0C A;  1EGO A;  5DCG A;  4GLT A;  4K7N A;  3P7X A;  5LCZ A;  1MEK A;  2KLX A;  5AIS A;  5IIZ A;  4EDY A;  5CRD A;  5J3R A;  2WCI A;  4TKY A;  1KEB A;  2JU5 A;  2LRT A;  5CYY A;  1Z3E A;  4TXO A;  3ZMK A;  2P31 A;  5D9T A;  3RPP A;  2R3X A;  2ZUP A;  1THX A;  2PVO C;  3D22 A;  4X1U A;  5F0G A;  4DEJ A;  3U6V A;  3GN3 A;  4MK3 A;  3CRT A;  3GKN A;  1YKC A;  2QKE A;  5B8B A;  7GSS A;  4WBJ A;  1EZK A;  20GS A;  4DSS B;  2C8U A;  4FYC A;  3MSZ A;  2I1U A;  1BYE A;  1Z5Y E;  4GQC A;  3VWU A;  1N8J A;  1FOH A;  2V41 A;  3UIW A;  4K9Z A;  1XWC A;  1B8X A;  2GST A;  1UC7 A;  1XXU A;  4MZC A;  5ELA A;  3RHB A;  1XW9 A;  4YH2 A;  2YWN A;  3IAM 2;  5C04 A;  1PFO A;  1VGL A;  1AUC A;  2L6D A;  1SD8 A;  3QPM A;  1N2A A;  2C3T A;  1XG8 A;  1GSQ A;  3DWV A;  1A2J A;  2NBS A;  1GSU A;  1M7T A;  4N11 A;  2A2S A;  1TRV A;  4GRF A;  4GST A;  4NMU A;  5IM9 A;  4EO3 A;  2F9S A;  1RK4 A;  3PPU A;  3TJK A;  5KOX A;  3VWW A;  2HI7 A;  5ID2 B;  3VPQ A;  1EP8 A;  3CTF A;  1XW6 A;  1X5C A;  2VLU A;  2VCV A;  5IMF A;  2K18 A;  4RQR A;  1GTB A;  4YKF A;  3SBC A;  4K8M A;  2GT6 A;  1B4Q A;  3GUR A;  1PN0 A;  1TXX A;  1O81 A;  2HZF A;  1WOU A;  2VUP A;  2WJU A;  4F2I A;  2FD3 A;  3ZFL A;  2L4Q A;  2K6V A;  2VIM A;  1TK0 B;  3DYR A;  3QAW A;  4OCF A;  2FHE A;  2VO4 A;  5ECQ B;  2X8H A;  5DJM A;  2YZU A;  1W89 A;  3QFB C;  2A2P A;  2R6K A;  4LL4 B;  3TRP A;  4J56 E;  1GTI A;  1OC3 A;  3ZVJ A;  3NIV A;  3MYD A;  3HVN A;  5EL8 A;  1MDJ A;  4WBR D;  1GUM A;  2HXK A;  4BVX A;  1GLP A;  3UBK A;  4ZL7 A;  1PX6 A;  4L0W A;  1YKA A;  3EUR A;  1VRS D;  3LXT A;  2FY6 A;  3IA1 A;  5G31 A;  4AF2 A;  1J08 A;  4D73 B;  1X5D A;  1O7U A;  4ZBA A;  2X99 A;  3I9V 2;  2DMM A;  4BL7 B;  1JLV A;  1OYJ A;  3MNG A;  3LYK A;  2D2Z A;  3IPZ A;  4MJE A;  3APS A;  3FK8 A;  4HEA 2;  5DJL A;  4AJ6 A;  4BIK A;  4KW6 A;  1SJ6 A;  3SWL A;  1EV9 A;  1UA5 A;  1AIU A;  3TJJ A;  1X9W B;  4YQU A;  22GS A;  3TUE A;  4MZB A;  3ZFB A;  2C4J A;  2WGR A;  4XIH A;  5A5K A;  4EVM A;  3US3 A;  4ECI A;  2MMA A;  1V57 A;  2H19 A;  1ERV A;  1ILO A;  2ON5 A;  4V2N A;  5HFI A;  5ECO B;  5IMV A;  2VAF A;  3WGE A;  1ST9 A;  2G0F A;  3C8E A;  2PMT A;  4F82 A;  2O8V B;  5D73 A;  1TI3 A;  1XOB A;  3F4R A;  2CT6 A;  5ECL B;  1SJZ A;  2GQM A;  1HNC A;  3VWX A;  3DIE A;  4POK A;  5DDL A;  4IVF A;  3KH9 A;  4G9H A;  2NPB A;  1JHB A;  2X8G A;  3DVX A;  1XZO A;  4KH7 A;  3A2V A;  3IK9 A;  4MCU A;  2EIO A;  3FY7 A;  4MPG A;  4MLY A;  4DSS A;  1ABA A;  2QA2 A;  4XS4 B;  4L0U A;  1PA3 A;  1SKS B;  1WJK A;  3M1G A;  2CVB A;  2C0D A;  5KN0 A;  3ERG A;  3GUS A;  1SK2 A;  1GSE A;  2ZNM A;  4GSN A;  2C0G A;  1DBY A;  5JCU A;  5D96 A;  2FLS A;  2JAD A;  4RUV A;  2OBK A;  2IMK A;  2V6K A;  1TTZ A;  4TW5 A;  2DJ0 A;  1QFN A;  5J9B A;  4YQM A;  1K0C A;  2J23 A;  1IYH A;  2HRF A;  5KN1 A;  3GL5 A;  3W8S A;  2TRX A;  2L4C A;  4I2U A;  4IKH A;  1TK8 B;  2B5E A;  1OKT A;  4NXI A;  2P0G A;  2QA1 A;  4KA0 A;  4EXJ A;  3O76 A;  3HJP A;  1W4V A;  4K7I A;  3H93 A;  6GSU A;  2N5A A;  1JZR A;  1H4O A;  2RLI A;  1TW9 A;  1RW1 A;  4Q5Q A;  1WP0 A;  2CZ2 A;  1FVK A;  5HR3 A;  4N30 A;  1NW2 A;  4L8E A;  3EMX A;  4NPB A;  2H0G A;  3F0I A;  4OFN A;  4ZB9 A;  2R0G A;  4DVC A;  1PRX A;  2C3N A;  2OJL A;  5DQS A;  4O5R A;  3L9U A;  1V9W A;  3DVW A;  1ZYE A;  1HYU A;  2M46 A;  1OC9 A;  2REM A;  2QSI A;  2YAN A;  2H70 A;  3R3E A;  2C0E A;  4CHS A;  2YP6 A;  1NSW A;  3J7Y b;  2AYT A;  4O5U A;  5J41 A;  2IPA A;  4USS A;  5FT3 A;  3CTG A;  2OBI A;  4F0B A;  3GHA A;  4FQU A;  3DEX A;  2KHP A;  4XCS A;  8GSS A;  2NDO A;  4JZQ A;  4MDC A;  3HVV A;  1LBK A;  4PXO A;  3KP9 A;  1FW1 A;  3A2W A;  5DCH A;  5IPH A;  3Q74 A;  4HJM A;  1PGT A;  3CSH A;  2OE1 A;  1DSB A;  4JED A;  4ML6 A;  2PPT A;  3IXR A;  1PSQ A;  1K3L A;  1E6B A;  2FGX A;  3QR6 A;  13GS A;  1Z7P A;  5CNW A;  4TN8 A;  1WRY A;  2GZZ A;  3FMW A;  3BD2 A;  2FCH A;  3A5W A;  4MMM A;  2GS3 A;  4POM A;  1CQG A;  3D6I A;  2FNO A;  4IQA A;  3G7J A;  6GSW A;  19GS A;  2YWM A;  3FHK A;  4J57 E;  5ECN B;  1TDI A;  3E3E A;  1TRU A;  2PER A;  3MWH A;  1ML6 A;  3L9S A;  3WGD A;  3HVS A;  4X43 A;  3LW9 A;  2KP1 A;  3WT2 A;  2DSA A;  1GL8 A;  5F06 A;  5IOX A;  1ZCP A;  5FHI A;  2CVD A;  3D4T A;  2VLT A;  5KOW A;  2LNT A;  4V1A p;  1I5G A;  2RM6 A;  3O3T A;  3EU3 A;  1XFL A;  3UJ1 A;  4LA1 A;  2LJA A;  3TCO A;  1GSY A;  2B7K A;  2JAC A;  3P90 A;  2BJX A;  2CX3 A;  2LJK A;  2L5L A;  1FAA A;  4V2L A;  1GUK A;  2VL3 A;  3IOS A;  1YEP A;  2HT9 A;  1NM3 A;  2IN3 A;  5JWR B;  1GRX A;  1SYX A;  2IMI A;  4XS4 A;  1EGR A;  4ACS A;  2YV9 A;  5ECS A;  12GS A;  4MA9 A;  1SK0 A;  3F6D A;  4JR6 A;  5EVO A;  4O7H A;  3APQ A;  1VF4 A;  2DJK A;  1ZYQ B;  4I8B A;  1T1V A;  3DXB A;  3ZL5 A;  18GS A;  1GWC A;  4KUN A;  3EYT A;  4BVX B;  2HRA A;  3IHQ A;  2ES7 A;  3VPT A;  2Z9S A;  5DBQ A;  4K0G A;  2LV3 A;  5ECI B;  1S3A A;  3CQF A;  4OCE A;  2CX4 A;  1VF3 A;  4J2F A;  2NTO A;  3M9J A;  2MBS A;  1MDK A;  2GSQ A;  4PNF A;  1S3R A;  1U88 A;  4K5S A;  2VCT A;  1X9M B;  1WMJ A;  1E2Y A;  2RUF A;  2B1K A;  4GQF A;  5BMU A;  5ECH B;  2DJ2 A;  1HNA A;  2B5Y A;  5J4U A;  2WS2 A;  1FO5 A;  3FZA A;  2P5R A;  3H8Q A;  4KGI A;  4ULX A;  1GUH A;  5IMC A;  4LMV A;  1ZGN A;  3ZTL A;  4OWY A;  1XIY A;  3IK7 A;  1HNB A;  3EMP A;  2PUK C;  2MZC A;  4H86 A;  2H0I A;  2OA7 A;  5JWQ B;  2VOC A;  1GH2 A;  2HE3 A;  1A24 A;  2WUL A;  2CV4 A;  3FRC A;  4PTS A;  5AIV A;  2WDU A;  2HZE A;  2HRK A;  2VD1 A;  3F63 A;  2AV4 A;  1R5P A;  1YF0 A;  1TI1 A;  5ECM B;  3F4S A;  3QD9 A;  1FB6 A;  2IWT A;  4ZXG A;  5JCG A;  2N5B A;  2AJQ B;  4Q5R A;  3KIJ A;  3LYP A;  3D0Z A;  4GXZ A;  2MMO A;  3LWA A;  1QUW A;  2DIZ A;  5GAP D;  4AJ7 A;  2DLX A;  2YOI A;  4WF4 A;  5A4U A;  4TR1 B;  3KTL A;  4EUY A;  4RI7 A;  5IMD A;  2FWF A;  1OE7 A;  2CVK A;  1ZZY A;  2WZ9 A;  4HZ2 A;  3VLN A;  5CAX A;  1TJD A;  3GRX A;  1U6T A;  1TOF A;  2YV7 A;  4JU5 A;  4MP4 A;  4TR3 A;  5CRW A;  1OVN A;  2DML A;  2V32 A;  3I43 A;  4E8H A;  5DAK A;  2RM5 A;  2DJ3 A;  2VCQ A;  1FOV A;  3ZIV A;  3IC4 A;  4ZB6 A;  2H01 A;  3H4K A;  2B6M A;  2VCW A;  4IGJ A;  2HFD A;  5HR0 A;  1TKD B;  4K6X A;  2CZ3 A;  3L0H A;  4GWR A;  2MYG A;  3KZQ A;  4ID0 A;  1XWA A;  5G1K A;  3DML A;  1M0U A;  5F8B A;  3HZ4 A;  1B9Y C;  4EL1 A;  1QK8 A;  3CYN A;  3BBY A;  3ERW A;  3LQ7 A;  4OFT A;  1OC9 B;  2X8C A;  3Q19 A;  1T4Z A;  2VL2 A;  3KD0 A;  3NOF A;  3P2A A;  2H1A A;  2H1D A;  2K9F A;  2B5X A;  1EWX A;  3UAR A;  5A4V A;  1NHY A;  1YJ6 A;  4CY6 A;  4XS6 A;  5CRH A;  2X49 A;  2WRT A;  1K0A A;  1T4Y A;  2C0F A;  6GST A;  3KMN A;  3I69 A;  1ZYN A;  4E8E A;  4EIQ A;  2FA8 A;  1EEM A;  4OMV A;  1C72 A;  2FA4 A;  4FIW A;  2LS5 A;  2N5F A;  3GYK A;  1DE1 A;  1R5A A;  2AAW A;  3EC3 A;  4MJC A;  3TKR A;  2LQQ A;  4XRA A;  1ZOF A;  4IBP A;  4NHW A;  1VF2 A;  1TU7 A;  2L59 A;  1G6W A;  3TJF A;  11GS A;  3KTB A;  3TDG A;  2TRC P;  1M2D A;  1BAY A;  4HU7 A;  4F9Z A;  3MAK A;  4I97 A;  4ZL8 A;  1YDK A;  1V58 A;  3MDK A;  4KX4 A;  1OE8 A;  4K1F A;  3TKS A;  4X4J A;  1G7O A;  3FW2 A;  3RBT A;  1R26 A;  5GAN D;  3TB2 A;  2RUE A;  1Q98 A;  3M9K A;  3KJY A;  4V1A g;  4WXT A;  4ECB A;  1RQM A;  1DE2 A;  3GX8 A;  4GCI A;  3HYP A;  2LEG A;  3F3Q A;  3WD6 A;  1AC1 A;  4HS1 A;  1FVJ A;  4F0C A; 
#chains in the Genus database with same CATH homology
 3A3T A;  3F6F A;  1T7P B;  4V2M A;  3QDN A;  3TOU A;  4OO4 A;  3GH9 A;  2QC7 A;  4QL7 A;  3UVH A;  4EF0 A;  3FYG A;  2FWG A;  5HFK A;  5COH A;  4OO5 A;  4Z2U A;  2LST A;  1O8X A;  4TR1 A;  4RI6 A;  3LXZ A;  1K0N A;  3TKQ A;  2MMZ A;  3ZRD A;  4HQS A;  4MJA A;  1BJX A;  1Y6E A;  1AW9 A;  3IR4 A;  3PH9 A;  4FYU A;  4EIP A;  3A2X A;  1Z9H A;  3FZ5 A;  1AQV A;  3HXS A;  2O7K A;  5F05 A;  2VLV A;  2YJH A;  3GMF A;  2GGT A;  4X0X A;  4PQ1 A;  2EC4 A;  2E2G A;  3D5J A;  5D8I A;  1F3A A;  1O6J A;  4NWY A;  5J9C A;  1QQ2 A;  4HJ2 A;  5ENU A;  4IP6 A;  2GDR A;  4Z7X A;  3UEM A;  2JZT A;  3R2Q A;  3GKK A;  2KP2 A;  5IQY A;  3ISO A;  2A4V A;  2B3S A;  3F9U A;  1XWB A;  4ILF A;  2CAQ A;  3GFK A;  1JZW A;  2PWJ A;  2I4A A;  1K0D A;  2GQK A;  2FWE A;  2V1M A;  1SEN A;  2H6X A;  4ZBD A;  2LUS A;  1A0R P;  4RQX A;  2DKI A;  3HHV A;  2JSZ A;  2JZS A;  3IHG A;  1J9B A;  2J9H A;  2HZE B;  1OC8 A;  1FG4 A;  3HCZ A;  1KBN A;  1R7H A;  2IFQ B;  2YNX A;  3W8J A;  1TU8 A;  2GZP A;  3S9F A;  1GNW A;  4O5Q A;  1GTA A;  2FUG 2;  1EP7 A;  3ZYW A;  3GKX A;  1V98 A;  3TJB A;  2I81 A;  1B48 A;  4NV2 A;  2VM1 A;  2OAC A;  4MAB A;  3C1R A;  3BCK A;  4ZIL A;  3VFI A;  3EPT A;  2PU9 C;  4JRR A;  4TR4 A;  3U5R E;  4IP1 A;  2WFC A;  3APO A;  3P8W A;  2AUV A;  5H5Q A;  1O8W A;  2IMF A;  4PUA A;  1MD3 A;  2L6C A;  3PGT A;  3RHC A;  3H1N A;  1KTE A;  5F07 A;  4PUF C;  3UL3 A;  5DAL B;  1H75 A;  2GZY A;  2AB6 A;  4TRX A;  1B4P A;  4FO5 A;  3G7Y A;  4ICY A;  3RPN A;  2H30 A;  5IMZ A;  3LOR A;  2PVQ A;  2JL4 A;  1AAZ A;  1SU9 A;  3C73 A;  5DAK B;  3C71 A;  1AQW A;  5HQP A;  4QL9 A;  4HQZ A;  1X5E A;  2XHF A;  3H79 A;  1A8Y A;  1F3B A;  2R5G A;  2YWO A;  2DKH A;  3HKR A;  5IOW A;  1YY7 A;  3FR9 A;  5KN2 A;  2H1G A;  3TKS C;  1K3O A;  3GTU A;  3G9B A;  2E2M A;  2R4V A;  2MBT A;  3ZIT A;  5B7C A;  5IPG A;  5B8A A;  4K7O A;  3ME8 A;  3GIX A;  2K8V A;  3ZIJ A;  1V2A A;  5JWO B;  2M72 A;  4CY8 A;  2E0Q A;  2H6Y A;  3DD3 A;  1S3D A;  1PD2 1;  3TJG A;  3OR5 A;  2R0P A;  1YQ1 A;  4YAV A;  4XRD A;  2O85 A;  4HUA A;  3D21 A;  3HVX A;  2XBI A;  4A5P A;  2DIY A;  3EE2 A;  3C7M A;  3HJM A;  3CBU A;  3VWV A;  3N5O A;  3F4T A;  4MJB A;  5DVB A;  1PL1 A;  4WF5 A;  1WE0 A;  1PX7 A;  5HR2 A;  4MNN A;  1QGV A;  9GSS A;  4F03 A;  3KMO A;  1GUL A;  2FWH A;  4POB A;  2PBJ A;  5DQY A;  2XC2 A;  2H6Z A;  2LNS A;  5CRG A;  4XS1 A;  1G7E A;  3KP8 A;  4POL A;  3ZVJ D;  4G0I A;  1THO A;  3RDW A;  1U3A A;  3F3R A;  3WYW A;  5HFG A;  1HQO A;  4Z2R A;  1Z7R A;  3Q6O A;  1XVQ A;  3ZZX A;  2LRN A;  2GQL A;  1GLQ A;  2KUC A;  1R4W A;  2YCD A;  4PQI A;  2YZH A;  4Q5N A;  1HD2 A;  4ZB8 A;  4OD7 A;  3TRX A;  4NHZ A;  4PUR A;  3WT1 A;  5IMA A;  4LLR A;  2H66 A;  2XBQ A;  2H72 A;  2R2J A;  4AGS A;  2IFQ A;  3KXO A;  3MIX A;  1A8L A;  2DJ1 A;  2OE0 A;  1JLW A;  2JZR A;  4BVY A;  3QOU A;  4G0K A;  1ERT A;  1SL0 B;  2H0H A;  5IO2 A;  4ML1 A;  1TP9 A;  4DSR A;  3N9J A;  2A4H A;  2YWI A;  4NAX A;  1MTC A;  2H8L A;  3HDC A;  3ERF A;  4KF9 A;  2I9H A;  3FKF A;  1AQX A;  2HRN A;  1PL2 A;  3LG6 A;  3IBH A;  3BCI A;  1T8E B;  2JSY A;  1M9B A;  2CQ9 A;  4EKZ A;  1BED A;  1ZYP A;  1A2L A;  2VD0 A;  2H74 A;  5ELG A;  1QXH A;  1UN2 A;  5D9X A;  1VF1 A;  2F8F A;  1NHO A;  3CSJ A;  3KM6 A;  5DAL A;  5LD0 A;  3DKS A;  3VI7 A;  3GSS A;  4WR5 A;  5J5N A;  2R37 A;  3UBL A;  3EIN A;  4K0N A;  3AY8 A;  3GKM A;  4PX1 A;  1T00 A;  1BQ7 A;  1LU4 A;  4JBB A;  4FH8 A;  2LTK A;  3GL3 A;  4HOJ A;  2O87 A;  2HSY A;  2LRC A;  3V1W A;  1JZD A;  4K2X A;  2LJR A;  1WWJ A;  2H71 A;  5ECP B;  4HZ4 A;  2GSS A;  1F2E A;  5KEJ A;  2I3Y A;  5GSS A;  2ALB A;  1GNE A;  1A23 A;  1ACV A;  4KB3 A;  4G0L A;  3RAZ A;  5JCW A;  3ED3 A;  2K8S A;  2UZ8 A;  1SL2 B;  5BRT A;  4AJ8 A;  1USB A;  3LSZ A;  4I5Q A;  1FB0 A;  1SK1 A;  4BWQ A;  5G5F A;  2YPM A;  2VCX A;  4TOP A;  4EE0 A;  4GF0 A;  4MH3 A;  2IMD A;  3GNJ A;  5IO0 A;  3QCP A;  6GSX A;  3J7Y k;  1M99 A;  3CMI A;  5E59 A;  3GX0 A;  4IEL A;  1YEX A;  1A0F A;  3GH6 A;  1M9A A;  1EOH A;  1TRS A;  5AIX A;  3LJR A;  5LNK e;  4ZIJ A;  1ZL9 A;  1F9M A;  4MF7 A;  3VK9 A;  3FR3 A;  2RII A;  4IJI A;  4KAE A;  1WPI A;  4KCE A;  2EIQ A;  1MDI A;  4ZL9 A;  3DGQ A;  2IME A;  3LEF A;  4IN0 A;  4Z2T A;  1A2M A;  1YZX A;  2XPE A;  2BTO T;  2H75 A;  1K3Y A;  4G10 A;  2H73 A;  5E4W A;  5KN3 A;  5G2Z A;  3IDV A;  3TKS E;  5ECK B;  4FYB A;  4WEY A;  2O89 A;  4KSO A;  6GSS A;  3HD5 A;  4HDE A;  1YF1 A;  4EC0 A;  4HI7 A;  1PMT A;  2C1Y A;  5ABR A;  1DUG A;  1UVZ A;  2CA8 A;  3CXG A;  10GS A;  4KND A;  2ON7 A;  2GT5 A;  3CSI A;  1M2B A;  3JCM L;  4G2E A;  1TRW A;  2DC5 A;  5D9V A;  4MH2 A;  4WET A;  1GSS A;  3D4M A;  1X0R A;  1Z6M A;  2X64 A;  3FEU A;  4YAP A;  2VCZ A;  4ISD A;  1TK5 B;  5H5S A;  4G19 A;  3UMA A;  3TGZ A;  3L9V A;  1G6Y A;  3GTU B;  5A4W A;  5CO3 A;  2AHE A;  1XWG A;  17GS A;  4NV5 A;  1I9D A;  4PNG A;  2B7J A;  2PN8 A;  1K0O A;  3L78 A;  1SYR A;  2GSR A;  3TOT A;  2MMN A;  2HYX A;  3KCM A;  4CDO A;  1JZO A;  1XBS A;  1K0B A;  3Q18 A;  1PQN A;  3W6G A;  2H1B A;  1SJI A;  1EV4 A;  2F3M A;  1XCC A;  1U3I A;  2NVL A;  4MPF A;  2F51 A;  1O85 A;  3PR8 A;  3WGX A;  5EY6 A;  2B1L A;  4ZBB A;  4IW9 A;  2VM2 A;  2V6O A;  1EEJ A;  4N10 A;  1FHE A;  4O92 A;  3QFA C;  1PKW A;  1URM A;  2IIY A;  3VUR A;  3TKP A;  5EPF A;  4YKG A;  3EVI A;  3BOA A;  5C00 A;  1U87 A;  1ERU A;  1BX9 A;  1OAZ A;  2HSH A;  1K0M A;  1X9S B;  3A5I A;  2C80 A;  3KEB A;  2WB9 A;  2CAI A;  4K2D A;  3I6A A;  5HR1 A;  1Y25 A;  4BA7 A;  2YJ7 A;  2A2R A;  2V2G A;  5CP1 A;  3EU4 A;  4MF5 A;  4HU9 A;  2H76 A;  3UAP A;  1XOA A;  4WR4 A;  1F6M C;  4EDZ A;  3BJ5 A;  5ID2 A;  5ECR B;  2IJY A;  5H5R A;  4KDY A;  2F8A A;  3HZ8 A;  2KOK A;  4I2T A;  4P3Y B;  5FWG A;  3QMX A;  1GP1 A;  3KH7 A;  2OAD A;  2EIR A;  1GTU A;  1Q4J A;  1SKR B;  3E9J B;  4OFM A;  3ME7 A;  4MZW A;  1PKZ A;  4QQ7 A;  2P5Q A;  1SKW B;  4TVE A;  2IL3 A;  4BVY B;  4YQV A;  1ERW A;  5L71 A;  1GSF A;  4TXO B;  1BG5 A;  1G0T A;  2VL2 C;  2LKU A;  2GVP A;  4IS0 A;  3GA4 A;  2L5O A;  4JR4 A;  1LJR A;  4KDU A;  5GST A;  3IV4 A;  2VL9 A;  5G5E A;  2HSM A;  4CW9 A;  4TXV A;  3UOM A;  4JE1 A;  2LQO A;  1EOG A;  3CRU A;  3HY2 A;  1F37 A;  4D73 A;  5B6N A;  4PQH A;  2BMX A;  1ON4 A;  1AXD A;  3QAV A;  1O73 A;  4BL7 A;  1IYI A;  4LL1 B;  6GSY A;  4WKW A;  3FR6 A;  4K5R A;  2L57 A;  1XPV A;  3GST A;  3C1S A;  3GV1 A;  1Z6N A;  4PGT A;  2QGV A;  3G7I A;  5D93 A;  4BWS A;  1QMV A;  4XHM A;  3QAG A;  4O32 A;  3UVT A;  3IRA A;  4BPY A;  2GTU A;  1KNG A;  4ECC A;  5B6M A;  3F8U A;  4KE3 A;  4IHU A;  2G2Q A;  4DSQ A;  2GLR A;  5AGY A;  3DRN A;  2TIR A;  1OKD A;  2ZCT A;  3M0F A;  4KSM A;  4IQ1 A;  4LMW A;  5G30 A;  3M3M A;  1T3B A;  4KDX A;  1SL1 B;  3K8N A;  1CQH A;  5G1L A;  4MF6 A;  4N0Z A;  1XWK A;  1PN9 A;  1ZMA A;  1XW5 A;  3FZ4 A;  5CRE A;  4GSS A;  3ZLP A;  1J0F A;  2HNL A;  3PIN A;  2YN1 A;  3TRQ A;  2OE3 A;  3VI5 A;  1WIK A;  3L4N A;  4KCA A;  3LFL A;  3LGC A;  4IJ3 A;  2XPD A;  4L5O A;  4L5L A;  1MD4 A;  5GZZ B;  2DJJ A;  1S3C A;  3HJO A;  3E0U A;  3FZ9 A;  6GSV A;  1V40 A;  2DBC A;  3EWL A;  3IC8 A;  3ZML A;  5AN1 A;  1SD9 A;  4TR0 A;  4XTS A;  4GTU A;  14GS A;  4N0V A;  3IE3 A;  4I6X A;  2M80 A;  3KGK A;  4Q5F A;  16GS A;  1M2A A;  3NZN A;  2X4A A;  3O6T A;  5D9W A;  5INY A;  3HA9 A;  2E7P A;  3M8N A;  2HLS A;  3IAS 2;  2C3Q A;  2PGT A;  1JFU A;  3ZRE A;  1B9X C;  2OKA A;  4ECJ A;  1XVW A;  1GSD A;  2R0C A;  1EGO A;  5DCG A;  4GLT A;  4K7N A;  3P7X A;  5LCZ A;  1MEK A;  2KLX A;  5AIS A;  5IIZ A;  4EDY A;  5CRD A;  5J3R A;  2WCI A;  4TKY A;  1KEB A;  2JU5 A;  2LRT A;  5CYY A;  1Z3E A;  4TXO A;  3ZMK A;  2P31 A;  5D9T A;  3RPP A;  2R3X A;  2ZUP A;  1THX A;  2PVO C;  3D22 A;  4X1U A;  5F0G A;  4DEJ A;  3U6V A;  3GN3 A;  4MK3 A;  3CRT A;  3GKN A;  1YKC A;  2QKE A;  5B8B A;  7GSS A;  4WBJ A;  1EZK A;  20GS A;  4DSS B;  2C8U A;  4FYC A;  3MSZ A;  2I1U A;  1BYE A;  1Z5Y E;  4GQC A;  3VWU A;  1N8J A;  1FOH A;  2V41 A;  3UIW A;  4K9Z A;  1XWC A;  1B8X A;  2GST A;  1UC7 A;  1XXU A;  4MZC A;  5ELA A;  3RHB A;  1XW9 A;  4YH2 A;  2YWN A;  3IAM 2;  5C04 A;  1VGL A;  1AUC A;  2L6D A;  1SD8 A;  3QPM A;  1N2A A;  2C3T A;  1GSQ A;  3DWV A;  1A2J A;  2NBS A;  1GSU A;  1M7T A;  4N11 A;  2A2S A;  1TRV A;  4GRF A;  4GST A;  4NMU A;  5IM9 A;  4EO3 A;  2F9S A;  1RK4 A;  3PPU A;  3TJK A;  5KOX A;  3VWW A;  2HI7 A;  5ID2 B;  3VPQ A;  1EP8 A;  3CTF A;  1XW6 A;  1X5C A;  2VLU A;  2VCV A;  5IMF A;  2K18 A;  4RQR A;  1GTB A;  4YKF A;  3SBC A;  4K8M A;  2GT6 A;  1B4Q A;  3GUR A;  1PN0 A;  1TXX A;  1O81 A;  2HZF A;  1WOU A;  2VUP A;  2WJU A;  4F2I A;  2FD3 A;  3ZFL A;  2L4Q A;  2K6V A;  2VIM A;  1TK0 B;  3DYR A;  3QAW A;  4OCF A;  2FHE A;  2VO4 A;  5ECQ B;  2X8H A;  5DJM A;  2YZU A;  1W89 A;  3QFB C;  2A2P A;  2R6K A;  4LL4 B;  3TRP A;  4J56 E;  1GTI A;  1OC3 A;  3ZVJ A;  3NIV A;  3MYD A;  5EL8 A;  1MDJ A;  4WBR D;  1GUM A;  2HXK A;  4BVX A;  1GLP A;  3UBK A;  4ZL7 A;  1PX6 A;  4L0W A;  1YKA A;  3EUR A;  1VRS D;  3LXT A;  2FY6 A;  3IA1 A;  5G31 A;  4AF2 A;  1J08 A;  4D73 B;  1X5D A;  1O7U A;  4ZBA A;  2X99 A;  3I9V 2;  2DMM A;  4BL7 B;  1JLV A;  1OYJ A;  3MNG A;  3LYK A;  2D2Z A;  3IPZ A;  4MJE A;  3APS A;  3FK8 A;  4HEA 2;  5DJL A;  4AJ6 A;  4KW6 A;  1SJ6 A;  3SWL A;  1EV9 A;  1UA5 A;  1AIU A;  3TJJ A;  1X9W B;  4YQU A;  22GS A;  3TUE A;  4MZB A;  3ZFB A;  2C4J A;  2WGR A;  4XIH A;  5A5K A;  4EVM A;  3US3 A;  4ECI A;  2MMA A;  1V57 A;  2H19 A;  1ERV A;  1ILO A;  2ON5 A;  4V2N A;  5HFI A;  5ECO B;  5IMV A;  2VAF A;  3WGE A;  1ST9 A;  2G0F A;  3C8E A;  2PMT A;  4F82 A;  2O8V B;  5D73 A;  1TI3 A;  1XOB A;  3F4R A;  2CT6 A;  5ECL B;  1SJZ A;  2GQM A;  1HNC A;  3VWX A;  3DIE A;  4POK A;  5DDL A;  4IVF A;  3KH9 A;  4G9H A;  2NPB A;  1JHB A;  2X8G A;  3DVX A;  1XZO A;  4KH7 A;  3A2V A;  3IK9 A;  4MCU A;  2EIO A;  3FY7 A;  4MPG A;  4MLY A;  4DSS A;  1ABA A;  2QA2 A;  4XS4 B;  4L0U A;  1PA3 A;  1SKS B;  1WJK A;  3M1G A;  2CVB A;  2C0D A;  5KN0 A;  3ERG A;  3GUS A;  1SK2 A;  1GSE A;  2ZNM A;  4GSN A;  2C0G A;  1DBY A;  5JCU A;  5D96 A;  2FLS A;  2JAD A;  4RUV A;  2OBK A;  2IMK A;  2V6K A;  1TTZ A;  4TW5 A;  2DJ0 A;  1QFN A;  5J9B A;  4YQM A;  1K0C A;  2J23 A;  1IYH A;  2HRF A;  5KN1 A;  3GL5 A;  3W8S A;  2TRX A;  2L4C A;  4I2U A;  4IKH A;  1TK8 B;  2B5E A;  1OKT A;  4NXI A;  2P0G A;  2QA1 A;  4KA0 A;  4EXJ A;  3O76 A;  3HJP A;  1W4V A;  4K7I A;  3H93 A;  6GSU A;  2N5A A;  1JZR A;  1H4O A;  2RLI A;  1TW9 A;  1RW1 A;  4Q5Q A;  1WP0 A;  2CZ2 A;  1FVK A;  5HR3 A;  4N30 A;  1NW2 A;  4L8E A;  3EMX A;  4NPB A;  2H0G A;  3F0I A;  4OFN A;  4ZB9 A;  2R0G A;  4DVC A;  1PRX A;  2C3N A;  2OJL A;  5DQS A;  4O5R A;  3L9U A;  1V9W A;  3DVW A;  1ZYE A;  1HYU A;  2M46 A;  1OC9 A;  2REM A;  2QSI A;  2YAN A;  2H70 A;  3R3E A;  2C0E A;  4CHS A;  2YP6 A;  1NSW A;  3J7Y b;  2AYT A;  4O5U A;  5J41 A;  2IPA A;  4USS A;  5FT3 A;  3CTG A;  2OBI A;  4F0B A;  3GHA A;  4FQU A;  3DEX A;  2KHP A;  4XCS A;  8GSS A;  2NDO A;  4JZQ A;  4MDC A;  3HVV A;  1LBK A;  4PXO A;  3KP9 A;  1FW1 A;  3A2W A;  5DCH A;  5IPH A;  3Q74 A;  4HJM A;  1PGT A;  3CSH A;  2OE1 A;  1DSB A;  4JED A;  4ML6 A;  2PPT A;  3IXR A;  1PSQ A;  1K3L A;  1E6B A;  2FGX A;  3QR6 A;  13GS A;  1Z7P A;  5CNW A;  4TN8 A;  1WRY A;  2GZZ A;  3FMW A;  3BD2 A;  2FCH A;  3A5W A;  4MMM A;  2GS3 A;  4POM A;  1CQG A;  3D6I A;  2FNO A;  4IQA A;  3G7J A;  6GSW A;  19GS A;  2YWM A;  3FHK A;  4J57 E;  5ECN B;  1TDI A;  3E3E A;  1TRU A;  2PER A;  3MWH A;  1ML6 A;  3L9S A;  3WGD A;  3HVS A;  4X43 A;  3LW9 A;  2KP1 A;  3WT2 A;  2DSA A;  1GL8 A;  5F06 A;  5IOX A;  1ZCP A;  5FHI A;  2CVD A;  3D4T A;  2VLT A;  5KOW A;  2LNT A;  4V1A p;  1I5G A;  2RM6 A;  3O3T A;  3EU3 A;  1XFL A;  3UJ1 A;  4LA1 A;  2LJA A;  3TCO A;  1GSY A;  2B7K A;  2JAC A;  3P90 A;  2BJX A;  2CX3 A;  2LJK A;  2L5L A;  1FAA A;  4V2L A;  1GUK A;  2VL3 A;  3IOS A;  1YEP A;  2HT9 A;  1NM3 A;  2IN3 A;  5JWR B;  1GRX A;  1SYX A;  2IMI A;  4XS4 A;  1EGR A;  4ACS A;  2YV9 A;  5ECS A;  12GS A;  4MA9 A;  1SK0 A;  3F6D A;  4JR6 A;  5EVO A;  4O7H A;  3APQ A;  1VF4 A;  2DJK A;  1ZYQ B;  4I8B A;  1T1V A;  3DXB A;  3ZL5 A;  18GS A;  1GWC A;  4KUN A;  3EYT A;  4BVX B;  2HRA A;  3IHQ A;  2ES7 A;  3VPT A;  2Z9S A;  5DBQ A;  4K0G A;  2LV3 A;  5ECI B;  1S3A A;  4OCE A;  2CX4 A;  1VF3 A;  4J2F A;  2NTO A;  3M9J A;  2MBS A;  1MDK A;  2GSQ A;  4PNF A;  1U88 A;  4K5S A;  2VCT A;  1X9M B;  1WMJ A;  1E2Y A;  2RUF A;  2B1K A;  4GQF A;  5BMU A;  5ECH B;  2DJ2 A;  1HNA A;  2B5Y A;  5J4U A;  2WS2 A;  1FO5 A;  3FZA A;  2P5R A;  3H8Q A;  4KGI A;  4ULX A;  1GUH A;  5IMC A;  4LMV A;  1ZGN A;  3ZTL A;  4OWY A;  1XIY A;  3IK7 A;  1HNB A;  3EMP A;  2PUK C;  2MZC A;  4H86 A;  2H0I A;  2OA7 A;  5JWQ B;  2VOC A;  1GH2 A;  2HE3 A;  1A24 A;  2WUL A;  2CV4 A;  3FRC A;  4PTS A;  5AIV A;  2WDU A;  2HZE A;  2HRK A;  2VD1 A;  3F63 A;  2AV4 A;  1R5P A;  1YF0 A;  1TI1 A;  5ECM B;  3F4S A;  3QD9 A;  1FB6 A;  2IWT A;  4ZXG A;  5JCG A;  2N5B A;  2AJQ B;  4Q5R A;  3KIJ A;  3LYP A;  3D0Z A;  4GXZ A;  2MMO A;  3LWA A;  1QUW A;  2DIZ A;  5GAP D;  4AJ7 A;  2DLX A;  2YOI A;  4WF4 A;  5A4U A;  4TR1 B;  3KTL A;  4EUY A;  4RI7 A;  5IMD A;  2FWF A;  1OE7 A;  2CVK A;  1ZZY A;  2WZ9 A;  4HZ2 A;  3VLN A;  5CAX A;  1TJD A;  3GRX A;  1U6T A;  1TOF A;  2YV7 A;  4JU5 A;  4MP4 A;  4TR3 A;  5CRW A;  1OVN A;  2DML A;  2V32 A;  3I43 A;  4E8H A;  5DAK A;  2RM5 A;  2DJ3 A;  2VCQ A;  1FOV A;  3ZIV A;  3IC4 A;  4ZB6 A;  2H01 A;  3H4K A;  2B6M A;  2VCW A;  4IGJ A;  2HFD A;  5HR0 A;  1TKD B;  4K6X A;  2CZ3 A;  3L0H A;  4GWR A;  2MYG A;  3KZQ A;  4ID0 A;  1XWA A;  5G1K A;  3DML A;  1M0U A;  5F8B A;  3HZ4 A;  1B9Y C;  4EL1 A;  1QK8 A;  3CYN A;  3BBY A;  3ERW A;  3LQ7 A;  4OFT A;  1OC9 B;  2X8C A;  3Q19 A;  1T4Z A;  2VL2 A;  3KD0 A;  3NOF A;  3P2A A;  2H1A A;  2H1D A;  2K9F A;  2B5X A;  1EWX A;  3UAR A;  5A4V A;  1NHY A;  1YJ6 A;  4CY6 A;  4XS6 A;  5CRH A;  2X49 A;  2WRT A;  1K0A A;  1T4Y A;  2C0F A;  6GST A;  3KMN A;  3I69 A;  1ZYN A;  4E8E A;  4EIQ A;  2FA8 A;  1EEM A;  4OMV A;  1C72 A;  2FA4 A;  4FIW A;  2LS5 A;  2N5F A;  3GYK A;  1DE1 A;  1R5A A;  2AAW A;  3EC3 A;  4MJC A;  3TKR A;  2LQQ A;  4XRA A;  1ZOF A;  4IBP A;  4NHW A;  1VF2 A;  1TU7 A;  2L59 A;  1G6W A;  3TJF A;  11GS A;  3KTB A;  3TDG A;  2TRC P;  1M2D A;  1BAY A;  4HU7 A;  4F9Z A;  3MAK A;  4I97 A;  4ZL8 A;  1YDK A;  1V58 A;  3MDK A;  4KX4 A;  1OE8 A;  4K1F A;  3TKS A;  4X4J A;  1G7O A;  3FW2 A;  3RBT A;  1R26 A;  5GAN D;  3TB2 A;  2RUE A;  1Q98 A;  3M9K A;  3KJY A;  4V1A g;  4WXT A;  4ECB A;  1RQM A;  1DE2 A;  3GX8 A;  4GCI A;  3HYP A;  2LEG A;  3F3Q A;  3WD6 A;  1AC1 A;  4HS1 A;  1FVJ A;  4F0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...