2ES7A

Crystal structure of q8zp25 from salmonella typhimurium lt2. nesg target str70
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
103
Chain Sequence
FSALWQRLLTRGWQPVEASVGDGVILLSSDPRRSDNPVMIAELLREFPQFDWQVAVADLEQSEAIGDRFNVRRFPATLVFTDGALSGIHPWAELLTLMRSIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords putative thiol-disulfide isomerase and thioredoxin
publication title Crystal structure of Q8ZP25 from Salmonella typhimurium LT2 NESG target STR70.
rcsb
source organism Salmonella typhimurium
total genus 20
structure length 103
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07449 HyaE Hydrogenase-1 expression protein HyaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2es7A00
3IK9A 5IMZA 2PMTA 3ISOA 4OO5A 4WR4A 4KCEA 3HVXA 4GCIA 3D21A 3WT2A 5JWRB 4OCEA 1SU9A 4NV5A 2H75A 4TRXA 1K0DA 4XS4B 3APOA 1TRSA 2L5LA 4DEJA 16GSA 4G9HA 1WE0A 3PR8A 4RQRA 2CA8A 3ERFA 2H6YA 3CTFA 3WGEA 2YZUA 3EVIA 5GSTA 1ON4A 1O8WA 5D93A 4MPGA 2D2ZA 1ERVA 1Q98A 4QL9A 1FVKA 4ML6A 3W6GA 4HZ4A 2H1BA 4IP1A 2C3QA 5FHIA 2HSHA 3G7IA 4ULXA 4HQSA 3VPTA 1WOUA 4J2FA 5ECRB 2IMIA 5ELGA 2AUVA 2OA7A 5ECOB 1AQXA 3HVVA 2LKUA 1I5GA 2VL2A 4BVYA 2AB6A 4FYCA 1TK0B 2HNLA 4L5OA 1QFNA 4TR4A 4GTUA 1UA5A 5B8BA 1RK4A 3HKRA 1WRYA 3QAWA 3GURA 3L0HA 1Z7PA 1T7PB 5DALB 4IW9A 3F4SA 5IPGA 3M3MA 4GF0A 4IJ3A 4MF5A 5KN3A 2XC2A 4LL1B 5DJLA 1XWGA 1X9SB 2YOIA 1BAYA 2I81A 1XW9A 3E9JB 4GQCA 1MTCA 2H1GA 1O81A 2P5RA 4Q5RA 4TW5A 5ID2A 5AIVA 1TU7A 3TJKA 4KX4A 1CQGA 3ZIJA 4P3YB 3P8WA 5A4WA 1BG5A 1MDKA 3TRQA 2CZ3A 5LNKe 5F0GA 1EEMA 4OMVA 3HXSA 2C1YA 5G5EA 1V98A 4TR1A 1ZCPA 1TDIA 4K8MA 5GSSA 1ZZYA 3GMFA 2LRTA 4K1FA 5C00A 4YAVA 4JR4A 4CHSA 5C04A 2CAQA 5JCWA 5GAPD 1AIUA 4GRFA 4HDEA 1DBYA 4K7NA 2YWMA 2WS2A 3GN3A 1O73A 4LL4B 1U87A 4MP4A 4ILFA 5B6MA 4E8EA 3FZ5A 1PKZA 5IMFA 1PN9A 5G1KA 2R4VA 3M8NA 3KMOA 4I2TA 2M72A 1ML6A 2VM1A 2HE3A 2CQ9A 5IQYA 6GSWA 2H8LA 1GSQA 5GZZB 3GL3A 3M9KA 3IDVA 5J9BA 1XWKA 2GQMA 1LU4A 3CYNA 3H93A 2PPTA 4PX1A 1WPIA 1DSBA 3IPZA 2WDUA 3TKPA 2YPMA 1MDJA 1A23A 4ZILA 5AISA 4N10A 3HCZA 3QD9A 3TKRA 1YEPA 5AIXA 1Q4JA 5D9TA 4MJCA 4HI7A 4TXOB 2LRCA 2PU9C 2WZ9A 1OC9A 3IRAA 4IELA 4NPBA 4MF7A 4MZWA 1OC3A 2FWHA 2BJXA 4F82A 1NM3A 2DIYA 2R2JA 1TP9A 2DJJA 4IBPA 4JZQA 2YP6A 1TW9A 2B1KA 2GSTA 1I9DA 4N0VA 1GLPA 4TOPA 1M0UA 2ZCTA 4E8HA 1PMTA 3O76A 4HZ2A 4OFNA 1PD21 4POKA 4K2DA 4IGJA 2JADA 1SL1B 1XVWA 2JZRA 4H86A 2PVOC 2P31A 4EF0A 4PURA 4Q5QA 3TOTA 2ALBA 3HHVA 3VWUA 3WD6A 3Q18A 3M1GA 2HI7A 4N11A 1GULA 1B8XA 1TRVA 2GVPA 2MBSA 1EEJA 1Z6NA 2NDOA 3M9JA 3CRUA 1WMJA 3GKKA 4OFTA 1NHYA 1OE8A 1SD9A 3V1WA 3BCKA 1S3DA 1YZXA 4V2MA 1G0TA 2K8SA 1G7OA 2VO4A 3CSJA 1T4YA 3GX8A 1FHEA 2H0IA 1F6MC 1PL2A 11GSA 2XBIA 1Y25A 2C0DA 3G7JA 5JWQB 5IO2A 3LJRA 2GDRA 1TJDA 3PH9A 1K0BA 1J08A 2DSAA 3HY2A 5IO0A 1W89A 2LNSA 3ZZXA 3TDGA 1NW2A 5ECNB 4XS1A 2YANA 4G2EA 4TR0A 3VI5A 4MZCA 6GSVA 3US3A 2EIOA 2LRNA 2YCDA 4EL1A 2YN1A 2NTOA 3U5RE 4ECJA 2C8UA 3CTGA 5ENUA 1JFUA 6GSXA 4QQ7A 3GH6A 3H79A 2HSYA 2K6VA 2QGVA 1R5AA 4KCAA 1V40A 3WYWA 1MD3A 1K0AA 3VI7A 4D73B 2YNXA 2X8HA 5A4UA 1R5PA 3IE3A 2VD0A 2YWIA 3FHKA 1F2EA 3L4NA 2B7JA 3P90A 3TKSC 3FY7A 3BCIA 3D4MA 2MMAA 4OFMA 3SBCA 3EMPA 1QXHA 3L9UA 4JBBA 1THXA 4JU5A 3TRPA 4ZXGA 1GTAA 3KH7A 4HEA2 1FOVA 3TJFA 4TR3A 3GNJA 2E2MA 3KIJA 4V1Ap 1SJ6A 2VIMA 1OYJA 5F06A 4GSNA 3O3TA 3RPPA 2P0GA 4ZBDA 5J41A 2OE0A 3R2QA 3KZQA 3UARA 3U6VA 1W4VA 5JWOB 3TJJA 4L0WA 3VPQA 3C1SA 3P2AA 1VF4A 1EP8A 4X43A 1ZYQB 3ZFLA 1G7EA 1RW1A 2IFQB 2LNTA 4O32A 4MF6A 1JLWA 3QCPA 2C0FA 2GS3A 1GNEA 3VFIA 3I9V2 2FLSA 1BQ7A 2VL9A 2GZPA 3GIXA 4MH2A 1GSDA 4IVFA 3EU4A 3LXTA 1XVQA 4Q5NA 3QOUA 4MJAA 4IQ1A 1A24A 1SYRA 2V41A 1F37A 2J23A 1AAZA 3DVWA 5INYA 1EGRA 4GSTA 3WT1A 1NSWA 2FD3A 3UAPA 3KEBA 4G19A 4AJ6A 3L9VA 4L0UA 2VLVA 1K3YA 3RAZA 2YV7A 2X99A 3RPNA 5H5SA 1H75A 3KP8A 4IJIA 1TI1A 3ED3A 2IMEA 3DMLA 3DKSA 1GTIA 4PQIA 2AAWA 2HZFA 1XZOA 4OD7A 3ZMKA 3LQ7A 2EC4A 4ECIA 3FR9A 2VCTA 3RHCA 5CAXA 1ABAA 1V57A 3A3TA 1EOHA 4XRDA 1F3BA 5E59A 2HZEB 3BOAA 4MJEA 1N8JA 5DCGA 4ZIJA 4TXVA 1M9BA 2H1AA 3KCMA 4POMA 3NIVA 3CRTA 4MPFA 5JCUA 2KUCA 2VCXA 3H4KA 2CV4A 1EP7A 4KNDA 2A4VA 2I4AA 1TOFA 2YJHA 1K3OA 4NWYA 5G5FA 4KE3A 5ECHB 4PQHA 4WKWA 2V6OA 2H6ZA 3DD3A 3E3EA 1M2AA 3QR6A 1GUHA 2H72A 2HFDA 2RIIA 19GSA 2GGTA 2JU5A 1KBNA 3F6DA 3UOMA 2FY6A 2AYTA 4EDYA 1M2DA 3LXZA 2VUPA 2KP2A 3HJPA 3IK7A 1YF1A 1YKAA 2DBCA 4WETA 4RUVA 1CQHA 5LD0A 2IWTA 3D5JA 4POBA 2HRFA 4KUNA 1XBSA 3NOFA 1TK8B 4KSMA 2H66A 4K6XA 1TRWA 2OE3A 4F9ZA 2DMLA 3CSIA 3WGXA 3TJGA 1XFLA 2VLTA 2FWEA 1GP1A 4I97A 3UBLA 1QUWA 2GQKA 2KOKA 5IMAA 2GLRA 3VLNA 3KMNA 3OR5A 2PWJA 1X9WB 1LJRA 3I69A 4I6XA 1EZKA 2VOCA 5LCZA 3FEUA 2EIRA 1B4PA 2JSZA 4MH3A 4POLA 3M0FA 5DCHA 1BX9A 4CDOA 3K8NA 3F6FA 1PGTA 3GSTA 4RQXA 5B6NA 1GSSA 3Q74A 2IPAA 2GSQA 4MJBA 1JZDA 1YJ6A 5IOXA 4ML1A 4LA1A 1A8YA 1H4OA 22GSA 5HR1A 2H0HA 4TXOA 3IHQA 2OADA 3EMXA 1FB6A 1BJXA 2JSYA 4MZBA 1Z3EA 5B7CA 1ILOA 1T8EB 4KW6A 2OE1A 5DAKA 4OO4A 1UN2A 5EL8A 1PRXA 3G7YA 5J5NA 3QAGA 2ZNMA 1X5CA 4TN8A 3Q19A 3EE2A 2R6KA 4NHZA 2FCHA 1E2YA 2PVQA 3BJ5A 4K0NA 2L59A 3GKXA 4N0ZA 5FWGA 2H73A 3Q6OA 1FO5A 1PL1A 2YWNA 3DGQA 4XIHA 5CRWA 3KM6A 2DMMA 3H1NA 1FW1A 4KDUA 1HNCA 3PINA 1SK1A 4JE1A 4XS6A 1N2AA 3UL3A 4YQVA 5ID2B 2X8CA 1IYHA 2PGTA 1T3BA 1MDIA 1OKDA 3FZ9A 1FAAA 1MD4A 4EC0A 2F8AA 4FYUA 1JHBA 1XIYA 1PQNA 4O92A 5F07A 2E0QA 2O89A 2IJYA 2XHFA 2GQLA 3GSSA 12GSA 3DYRA 3LORA 7GSSA 2F8FA 2H01A 3TCOA 2KP1A 4MCUA 4DVCA 2LTKA 1GTUA 1B48A 4FYBA 1YKCA 3FYGA 5G31A 2DC5A 3GTUB 2JZSA 2LS5A 1EV9A 3MAKA 5IMDA 4PNGA 5F8BA 4MDCA 2YV9A 1T00A 2L6DA 4MABA 1PX6A 4NHWA 3S9FA 3D22A 1GH2A 5ECKB 1GSUA 3CXGA 3IOSA 1X5EA 3TKSA 5IMVA 1THOA 3VK9A 2BMXA 1SKRB 5DQYA 1K0NA 1ZOFA 4XTSA 2L57A 4IQAA 3APSA 1V2AA 2RM5A 1TXXA 1U3IA 1ZL9A 3EINA 2G0FA 3UJ1A 3TGZA 3N5OA 4K7IA 3GA4A 2DLXA 3L78A 4F03A 2B7KA 2FWGA 3MNGA 2KHPA 5G1LA 2WGRA 1OKTA 5CO3A 2NBSA 4OCFA 3IV4A 2K18A 1S3CA 2CAIA 2GT6A 4YAPA 2LEGA 3FK8A 1F3AA 3FR6A 1VF1A 2CVDA 2FGXA 4J57E 5CYYA 4JRRA 5EY6A 4V2NA 4YQMA 4GQFA 2JL4A 1A0FA 4ZBAA 2LSTA 2MMNA 3F4RA 3KXOA 5COHA 5A4VA 2WFCA 2GZZA 1SL2B 4WEYA 4RI7A 4K0GA 4CW9A 2H0GA 1WIKA 5ELAA 2FA8A 1JLVA 3KTLA 4FO5A 1SK0A 4DSSB 2CVKA 3DVXA 4XCSA 5D9XA 2B3SA 2VCVA 3VWVA 3QAVA 4KSOA 3DEXA 3ZL5A 2LQQA 2LJKA 3D6IA 1G6YA 3TKQA 2VAFA 2OJLA 1XOAA 2P5QA 2C3NA 2XPDA 1TRUA 5D9VA 3LYPA 4HQZA 1TK5B 2CX3A 1M99A 1GTBA 4X1UA 1XW5A 4FH8A 2WCIA 4GXZA 2O7KA 1BEDA 5HFKA 3GRXA 3QFBC 3GHAA 3W8JA 1X9MB 2HZEA 3RHBA 4PUAA 1C72A 5F05A 4G10A 3F4TA 5H5RA 2VCQA 2V1MA 1UC7A 3NZNA 1XW6A 1U6TA 1S3AA 2B5XA 4XS4A 1B9YC 2DJ3A 4PGTA 1A2MA 1VRSD 1ZYEA 2LJAA 1M2BA 2DJ1A 1R26A 2ON5A 2NVLA 3A2XA 5B8AA 2OACA 3I6AA 1TI3A 2VL3A 4WF4A 5CP1A 2WJUA 2V6KA 4WXTA 3FZ4A 4HJ2A 4PUFC 3MWHA 2GSRA 5ECLB 3VWXA 4DSQA 1YY7A 3HJMA 5J4UA 1AW9A 3H8QA 4KB3A 2A2SA 2IL3A 2MYGA 3MSZA 5HFIA 2DJKA 2H74A 4AF2A 3N9JA 2L4QA 1QQ2A 2H1DA 1A0RP 2IMKA 5J3RA 3P7XA 1X5DA 1SKWB 5D96A 2YWOA 3F0IA 4WF5A 1R7HA 3KTBA 4OWYA 4EDZA 1K3LA 1OE7A 3EYTA 4EVMA 2IMFA 1PX7A 2VM2A 3EURA 4LLRA 3SWLA 1QGVA 3C71A 1JZWA 5DALA 1SJZA 20GSA 2B5YA 3LFLA 1KEBA 2PBJA 4IS0A 3W8SA 3LYKA 4EE0A 2F51A 1VF2A 4NMUA 1TU8A 4PNFA 4V1Ag 5IOWA 2C3TA 5KN0A 1AXDA 5H5QA 3TRXA 3ME8A 1HD2A 4TVEA 4BL7A 1GSFA 2A2RA 1GUKA 5IMCA 1AQVA 4MMMA 2H19A 1U88A 3MDKA 4GSSA 1IYIA 1OAZA 2RUFA 4JR6A 2HXKA 4GLTA 4PXOA 2F3MA 3BBYA 2K8VA 3ZTLA 1VF3A 5HR3A 2MMZA 1JZRA 3AY8A 3GYKA 3QDNA 4BPYA 14GSA 4F0BA 2AV4A 3TUEA 4BA7A 2G2QA 1GNWA 1GUMA 5J9CA 2L6CA 2QSIA 4PQ1A 2HRNA 4KA0A 4J56E 4Z7XA 5E4WA 2VLUA 4AGSA 4ZB8A 6GSYA 3GKMA 2B5EA 3VURA 1U3AA 3DWVA 1O8XA 3BD2A 2M46A 2YZHA 2O87A 5KN2A 3PGTA 2TRXA 3LEFA 3HD5A 1QMVA 6GSUA 4I8BA 4EXJA 3DIEA 2GTUA 1Z9HA 2FHEA 2CT6A 4ZB6A 4V2LA 1WJKA 2R37A 2WULA 2AJQB 3UVTA 18GSA 9GSSA 2H71A 2DJ0A 1SKSB 2RM6A 3ERGA 1K0CA 4XHMA 2IMDA 2GT5A 3J7Yb 5HR2A 1ZMAA 5ECQB 3GH9A 1SYXA 4KH7A 2DJ2A 1O6JA 5DBQA 3IXRA 3JCML 5ECPB 2QKEA 1BYEA 1YF0A 4BWQA 2PUKC 1XWBA 5L71A 4TKYA 6GSSA 3ZREA 5AGYA 2VL2C 2ZUPA 3ZRDA 2E2GA 2V2GA 4KDYA 3HA9A 3GTUA 2ON7A 4IN0A 2MZCA 2NPBA 5ECIB 3GX0A 1QK8A 1E6BA 3C73A 5IIZA 1PSQA 1DE2A 3F3QA 1GWCA 1G6WA 3UIWA 5CRDA 1OC8A 2XPEA 1ERUA 3C1RA 4ISDA 4ZL8A 4BWSA 1URMA 5CNWA 1SJIA 3HJOA 2PN8A 3F9UA 2R3XA 4Q5FA 3KD0A 2C0EA 4WBRD 1T1VA 5ABRA 5HFGA 1GL8A 1DE1A 1GSYA 3CBUA 1NHOA 1KNGA 3GL5A 1HQOA 2BTOT 4ZL7A 2CVBA 1HNAA 4L8EA 3HVSA 3HDCA 3ZFBA 1Y6EA 3UVHA 2XBQA 4TR1B 3WGDA 4K9ZA 4FIWA 3TB2A 3LWAA 1UVZA 5G30A 2X64A 1M9AA 5DJMA 1JZOA 1J0FA 1ACVA 3CMIA 3A2WA 1ZGNA 2M80A 1YEXA 5JCGA 4NXIA 3RDWA 3DRNA 3UMAA 2O85A 2I9HA 3QPMA 5DAKB 1A2JA 4K7OA 5ECMB 4RI6A 2K9FA 2J9HA 1GSEA 17GSA 2AHEA 1AQWA 4O5RA 2N5AA 1FG4A 10GSA 3KP9A 1EGOA 5ECSA 1XCCA 2KLXA 2OKAA 3GUSA 1V58A 4QL7A 1M7TA 3KJYA 4D73A 5DDLA 1HYUA 3HZ8A 1J9BA 3FW2A 1YQ1A 4DSSA 3ZLPA 2H70A 2B6MA 4IKHA 5HQPA 5EPFA 3KH9A 1SD8A 2RUEA 3L9SA 3IR4A 1X0RA 1XXUA 1O7UA 4KDXA 3IC4A 1AC1A 2LUSA 2MMOA 3FRCA 2CZ2A 4MA9A 3DXBA 1USBA 3HZ4A 1GLQA 2VD1A 2LQOA 5DVBA 3VWWA 1PKWA 3FZAA 5CREA 5D8IA 2L5OA 4F0CA 3D4TA 4EKZA 2F9SA 2IIYA 2JZTA 1OC9B 1WWJA 2FNOA 1SENA 3LG6A 4GWRA 2LV3A 4I5QA 4ACSA 4ECCA 3TKSE 3ZVJD 1V9WA 2CX4A 4MLYA 3IBHA 2IFQA 4F2IA 2VCZA 4WR5A 3F3RA 4N30A 3QFAC 5FT3A 1EWXA 3FKFA 3ZMLA 6GSTA 2FWFA 4ZB9A 2I1UA 1R4WA 3LGCA 1ERTA 4JEDA 2PERA 3EU3A 5A5KA 3ZYWA 2TRCP 5D9WA 1AUCA 1K0OA 5EVOA 1DUGA 5KEJA 2EIQA 1TKDB 3HYPA 2YJ7A 1TTZA 3G9BA 1LBKA 3GKNA 3I43A 4O7HA 2C80A 3UBKA 1XWAA 2C4JA 1B4QA 4ID0A 3F63A 5G2ZA 4KAEA 4HS1A 1A2LA 3ZIVA 4X0XA 3ZVJA 4MK3A 2H76A 1MEKA 4HU7A 5CRGA 2LJRA 5IPHA 3EC3A 2RLIA 4HU9A 1F9MA 1FVJA 3A2VA 4L5LA 2Z9SA 1VGLA 2V32A 1RQMA 2O8VB 3EWLA 3C7MA 3ZITA 3GV1A 2N5FA 1T4ZA 2L4CA 4HUAA 4EO3A 5DQSA 2WB9A 3UEMA 1SL0B 4WBJA 1FB0A 4LMWA 1XPVA 3J7Yk 3CSHA 2GZYA 2H30A 2B1LA 2MBTA 3RBTA 2WRTA 2REMA 4ECBA 2OBIA 3ERWA 1Z7RA 3IA1A 5KN1A 4EUYA 3E0UA 8GSSA 2VCWA 2QC7A 4YH2A 1WP0A 1EV4A 3O6TA 2HLSA 3QMXA 5GAND 5CRHA 4HJMA 13GSA 1GRXA 2H6XA 4IP6A 2I3YA 2TIRA 1Z6MA 3KGKA 4NV2A 1OVNA 2ES7A 2R5GA 4YQUA 4BVXA 1XOBA 4IHUA 2DIZA 3C8EA 4KGIA 2C0GA 1K0MA 5HR0A 1Z5YE 2FA4A 3TOUA 2GSSA 3A5WA 4HOJA 1HNBA 4DSRA 1EOGA 3GFKA 3IAS2 5D73A 4LMVA 5IM9A 3FR3A 2X8GA 2JACA 1ST9A 4ZBBA 1PA3A 2IN3A 3ME7A 1O85A 3IAM2 5AN1A 4AJ8A 2OBKA 4I2UA 1YDKA 1ERWA 1XWCA 4AJ7A 4ZL9A 1B9XC 2HT9A 3APQA 3LSZA 1KTEA 3F8UA 4XRAA 1A8LA 3D0ZA 4NAXA 2FUG2 2E7PA 3TJBA 2HYXA 1SK2A 2N5BA
chains in the Genus database with same CATH superfamily
3IK9A 5IMZA 2PMTA 3ISOA 4OO5A 4WR4A 4KCEA 3HVXA 4GCIA 3D21A 3WT2A 3MYDA 5JWRB 4OCEA 1SU9A 4NV5A 2H75A 3FMWA 4TRXA 1K0DA 2HRKA 4XS4B 3APOA 1TRSA 2L5LA 4DEJA 16GSA 4G9HA 1WE0A 3PR8A 4RQRA 2CA8A 3ERFA 2H6YA 3CTFA 3WGEA 2YZUA 3EVIA 4EIQA 5GSTA 1ON4A 1O8WA 5D93A 4MPGA 2D2ZA 1ERVA 1Q98A 4QL9A 1FVKA 4ML6A 3W6GA 4HZ4A 2H1BA 4IP1A 2C3QA 5FHIA 2HSHA 3G7IA 4ULXA 4HQSA 3VPTA 1WOUA 4J2FA 5ECRB 2IMIA 5ELGA 2AUVA 2OA7A 5ECOB 1AQXA 3HVVA 2LKUA 1I5GA 2VL2A 4BVYA 2AB6A 4FYCA 1TK0B 2HNLA 4L5OA 1QFNA 4TR4A 4GTUA 1UA5A 5B8BA 1RK4A 3HKRA 1WRYA 3QAWA 3GURA 4YKGA 3L0HA 1Z7PA 1T7PB 5DALB 4IW9A 3F4SA 5IPGA 3M3MA 4GF0A 4IJ3A 4MF5A 5KN3A 2XC2A 4LL1B 5DJLA 1XWGA 1X9SB 2YOIA 1BAYA 2I81A 1XW9A 3E9JB 4GQCA 1MTCA 2H1GA 1O81A 2P5RA 4Q5RA 4TW5A 5ID2A 5AIVA 1TU7A 4BL7B 5BMUA 3TJKA 4KX4A 1CQGA 3ZIJA 4P3YB 3P8WA 5A4WA 1BG5A 1MDKA 3TRQA 2CZ3A 5LNKe 5F0GA 1EEMA 4OMVA 3HXSA 2C1YA 5G5EA 1V98A 4TR1A 1ZCPA 1TDIA 4K8MA 5GSSA 1ZZYA 3GMFA 2LRTA 4K1FA 5C00A 4YAVA 4JR4A 4CHSA 5C04A 2CAQA 5JCWA 5GAPD 1AIUA 4GRFA 4HDEA 1DBYA 4K7NA 4MNNA 2YWMA 2WS2A 3GN3A 1O73A 4LL4B 1U87A 4MP4A 4ILFA 5B6MA 4E8EA 3FZ5A 1PKZA 5IMFA 1PN9A 2R0PA 5G1KA 2R4VA 3M8NA 1XG8A 3KMOA 4I2TA 2M72A 1ML6A 2VM1A 2HE3A 2CQ9A 5IQYA 6GSWA 2H8LA 1GSQA 5GZZB 3GL3A 3M9KA 3IDVA 5J9BA 1XWKA 2GQMA 1LU4A 3CYNA 4CY8A 3H93A 2PPTA 4PX1A 1WPIA 1DSBA 3IPZA 2WDUA 3TKPA 2YPMA 1MDJA 1A23A 4ZILA 5AISA 4N10A 3HCZA 3QD9A 3TKRA 1YEPA 5AIXA 1Q4JA 5D9TA 4MJCA 4HI7A 4TXOB 2LRCA 2PU9C 2WZ9A 1OC9A 3IRAA 4IELA 4NPBA 4MF7A 4MZWA 1OC3A 2FWHA 2BJXA 3HVNA 4F82A 1NM3A 4Z2RA 2DIYA 2R2JA 1TP9A 2DJJA 4IBPA 4JZQA 2YP6A 1TW9A 4BIKA 2B1KA 4X4JA 2GSTA 1I9DA 4N0VA 1GLPA 4TOPA 1M0UA 2ZCTA 4E8HA 1PMTA 3O76A 4HZ2A 4OFNA 1PD21 4POKA 4K2DA 4IGJA 2JADA 1SL1B 1XVWA 2JZRA 4H86A 2PVOC 2P31A 4EF0A 4PURA 4Q5QA 3TOTA 2ALBA 3HHVA 3VWUA 3WD6A 3Q18A 3M1GA 2HI7A 4N11A 1GULA 1B8XA 1TRVA 2GVPA 2MBSA 1EEJA 1Z6NA 2NDOA 3M9JA 3CRUA 1WMJA 3GKKA 4OFTA 1NHYA 1OE8A 1SD9A 3V1WA 3BCKA 1S3DA 1YZXA 4V2MA 1G0TA 2K8SA 1G7OA 2VO4A 3CSJA 1T4YA 3GX8A 1FHEA 2H0IA 1F6MC 1PL2A 11GSA 2XBIA 1Y25A 2C0DA 3G7JA 5JWQB 5IO2A 3LJRA 2GDRA 1TJDA 3PH9A 1K0BA 1J08A 2DSAA 3HY2A 5IO0A 1W89A 2LNSA 3ZZXA 3TDGA 1NW2A 5ECNB 4XS1A 2YANA 4G2EA 4TR0A 3VI5A 4MZCA 6GSVA 3US3A 2EIOA 2LRNA 2YCDA 4EL1A 2YN1A 2NTOA 3U5RE 4ECJA 2C8UA 3CTGA 5ENUA 1JFUA 2HSMA 6GSXA 4QQ7A 3GH6A 3H79A 2HSYA 2K6VA 2QGVA 1R5AA 4KCAA 1V40A 3WYWA 1MD3A 1K0AA 3VI7A 4D73B 2YNXA 2X8HA 5A4UA 1R5PA 3IE3A 2VD0A 2YWIA 3FHKA 1F2EA 3L4NA 2B7JA 3P90A 3TKSC 3FY7A 3BCIA 3D4MA 2MMAA 4OFMA 3SBCA 3EMPA 1QXHA 3L9UA 4JBBA 1THXA 4JU5A 3TRPA 4ZXGA 1GTAA 3KH7A 4HEA2 1FOVA 3TJFA 4TR3A 3GNJA 2E2MA 3KIJA 4V1Ap 1SJ6A 2VIMA 1OYJA 5F06A 4GSNA 3O3TA 3RPPA 2P0GA 4ZBDA 4K5SA 4K2XA 2OE0A 5J41A 3R2QA 3KZQA 3UARA 3U6VA 1W4VA 5JWOB 3TJJA 4L0WA 3VPQA 3C1SA 3P2AA 4G0IA 1VF4A 1EP8A 4X43A 1ZYQB 3ZFLA 1G7EA 1RW1A 2IFQB 1PN0A 2LNTA 4O32A 4MF6A 1JLWA 3QCPA 2C0FA 2GS3A 1GNEA 3VFIA 3I9V2 2FLSA 1BQ7A 2VL9A 2GZPA 3GIXA 4MH2A 1GSDA 4IVFA 3EU4A 3LXTA 1XVQA 4Q5NA 3QOUA 4MJAA 3EPTA 4IQ1A 1A24A 1SYRA 2V41A 1F37A 2J23A 1AAZA 3DVWA 5INYA 1EGRA 4GSTA 3WT1A 1NSWA 2FD3A 3UAPA 3KEBA 4G19A 4AJ6A 3L9VA 4L0UA 2VLVA 1K3YA 3RAZA 2YV7A 2X99A 3RPNA 5H5SA 1H75A 3KP8A 4IJIA 1TI1A 3ED3A 2IMEA 3DMLA 3DKSA 1GTIA 4PQIA 2AAWA 2HZFA 1XZOA 4OD7A 3ZMKA 3LQ7A 2EC4A 4ECIA 3FR9A 2VCTA 3RHCA 5CAXA 1ABAA 1V57A 3A3TA 1EOHA 4XRDA 1F3BA 5E59A 2HZEB 3BOAA 4MJEA 1N8JA 5DCGA 4ZIJA 4TXVA 1M9BA 2H1AA 3KCMA 4POMA 3NIVA 3CRTA 4MPFA 5JCUA 2HRAA 2KUCA 2VCXA 3H4KA 2CV4A 1EP7A 4KNDA 2A4VA 2I4AA 1TOFA 2YJHA 1K3OA 4NWYA 5G5FA 4KE3A 5ECHB 4PQHA 4WKWA 2V6OA 2H6ZA 3DD3A 2DKHA 3E3EA 1M2AA 3QR6A 1GUHA 2H72A 2HFDA 2RIIA 19GSA 2GGTA 2JU5A 1KBNA 3F6DA 3UOMA 2FY6A 2AYTA 4EDYA 1M2DA 3LXZA 2VUPA 2KP2A 3HJPA 3IK7A 1YF1A 1YKAA 2DBCA 4WETA 4HSCX 4RUVA 1CQHA 5LD0A 2IWTA 3D5JA 4POBA 2HRFA 4KUNA 1XBSA 3NOFA 1TK8B 4KSMA 2H66A 4K6XA 1TRWA 2OE3A 4F9ZA 2DMLA 3CSIA 3WGXA 3TJGA 1XFLA 2VLTA 2FWEA 1GP1A 4I97A 3UBLA 1QUWA 2GQKA 2KOKA 5IMAA 2GLRA 3VLNA 3KMNA 3OR5A 2PWJA 1X9WB 1LJRA 3I69A 4I6XA 1EZKA 2VOCA 5LCZA 3FEUA 2EIRA 1B4PA 2JSZA 4MH3A 4POLA 3M0FA 5DCHA 1BX9A 4CDOA 3K8NA 3F6FA 1PGTA 3GSTA 4RQXA 5B6NA 1GSSA 3Q74A 2IPAA 2GSQA 4MJBA 1JZDA 1YJ6A 5IOXA 4ML1A 4LA1A 1A8YA 1H4OA 22GSA 5HR1A 2H0HA 4TXOA 3IHQA 2OADA 3EMXA 1FB6A 1BJXA 4KF9A 2JSYA 4MZBA 1Z3EA 5B7CA 1ILOA 1T8EB 4KW6A 2OE1A 5DAKA 4OO4A 1UN2A 5EL8A 1PRXA 3G7YA 5J5NA 3QAGA 2ZNMA 1X5CA 4TN8A 3Q19A 3EE2A 2R6KA 4NHZA 2FCHA 1E2YA 2PVQA 3BJ5A 4K0NA 2L59A 3GKXA 4N0ZA 5FWGA 2H73A 3Q6OA 1FO5A 1PL1A 2YWNA 3DGQA 4XIHA 5CRWA 3KM6A 2DMMA 3H1NA 1FW1A 4KDUA 1HNCA 3PINA 1PFOA 1SK1A 4JE1A 4XS6A 1N2AA 3UL3A 4YQVA 5ID2B 3PPUA 2X8CA 1IYHA 2PGTA 1T3BA 1MDIA 1OKDA 1ZYNA 3FZ9A 1FAAA 1MD4A 4EC0A 2F8AA 4FYUA 1JHBA 1XIYA 1PQNA 4O92A 4O5UA 5F07A 2E0QA 2O89A 2IJYA 2XHFA 2GQLA 3GSSA 12GSA 3DYRA 3LORA 7GSSA 2F8FA 2H01A 3TCOA 2KP1A 4MCUA 4ICYA 4DVCA 2LTKA 1GTUA 1B48A 4FYBA 1YKCA 3FYGA 5G31A 2DC5A 3GTUB 2JZSA 2LS5A 1EV9A 4PTSA 3MAKA 5IMDA 4PNGA 5F8BA 4MDCA 2YV9A 3LW9A 1T00A 2L6DA 4MABA 1PX6A 4NHWA 3S9FA 3D22A 1GH2A 5ECKB 1GSUA 3CXGA 3IOSA 1X5EA 3TKSA 5IMVA 1THOA 3VK9A 2BMXA 2A2PA 1SKRB 5DQYA 1K0NA 1ZOFA 4XTSA 2L57A 4IQAA 3APSA 1V2AA 2RM5A 1TXXA 1U3IA 1ZL9A 3EINA 2G0FA 3UJ1A 3TGZA 3N5OA 4K7IA 3GA4A 2DLXA 3L78A 4F03A 2B7KA 2FWGA 3MNGA 2KHPA 2QA2A 5G1LA 2WGRA 1OKTA 5CO3A 2NBSA 4OCFA 3IV4A 2K18A 1S3CA 4CY6A 2CAIA 2GT6A 4YAPA 2LEGA 3FK8A 1F3AA 3FR6A 1VF1A 2CVDA 2FGXA 4J57E 5CYYA 4JRRA 5EY6A 4V2NA 4YQMA 4GQFA 2JL4A 1A0FA 4ZBAA 2LSTA 2MMNA 3F4RA 3KXOA 5COHA 5A4VA 2WFCA 2GZZA 1SL2B 4WEYA 4RI7A 4K0GA 4CW9A 2H0GA 1WIKA 5ELAA 2FA8A 1JLVA 3IC8A 3KTLA 4FO5A 1SK0A 4DSSB 2CVKA 3DVXA 4XCSA 5D9XA 2B3SA 2VCVA 3VWVA 3QAVA 4KSOA 3DEXA 3ZL5A 2LQQA 2LJKA 3D6IA 1G6YA 3TKQA 2VAFA 2OJLA 1XOAA 2P5QA 2C3NA 2XPDA 1TRUA 5D9VA 3LYPA 4HQZA 1TK5B 2CX3A 1M99A 1GTBA 4X1UA 1XW5A 4FH8A 2WCIA 4GXZA 2O7KA 1BEDA 5HFKA 3GRXA 3QFBC 3GHAA 3W8JA 1X9MB 2HZEA 3RHBA 4PUAA 1C72A 5F05A 4G10A 3F4TA 5H5RA 2VCQA 2V1MA 1UC7A 3NZNA 1XW6A 1U6TA 1S3AA 2B5XA 4XS4A 1B9YC 2DJ3A 4PGTA 1A2MA 1VRSD 1ZYEA 2LJAA 1M2BA 2DJ1A 1R26A 2ON5A 2NVLA 3A2XA 5B8AA 2OACA 3I6AA 1TI3A 2VL3A 2X4AA 4WF4A 5CP1A 2WJUA 2V6KA 4WXTA 3FZ4A 4HJ2A 4PUFC 3MWHA 2GSRA 5ECLB 3VWXA 4DSQA 1YY7A 3HJMA 3CQFA 5J4UA 1AW9A 3H8QA 4KB3A 2A2SA 2IL3A 2MYGA 3MSZA 5HFIA 2DJKA 2H74A 4AF2A 1M3JA 3N9JA 2L4QA 1QQ2A 2H1DA 1A0RP 2IMKA 5J3RA 3P7XA 1X5DA 1SKWB 5D96A 2YWOA 3F0IA 4WF5A 1R7HA 3KTBA 4OWYA 4EDZA 1K3LA 1OE7A 3EYTA 4EVMA 2IMFA 1PX7A 2VM2A 3EURA 4LLRA 3SWLA 1QGVA 3C71A 1JZWA 5DALA 1SJZA 20GSA 2B5YA 3LFLA 1KEBA 2PBJA 4IS0A 3W8SA 3LYKA 4EE0A 2F51A 1VF2A 4NMUA 1TU8A 4PNFA 4V1Ag 5IOWA 2C3TA 5KN0A 2X49A 1AXDA 4K5RA 5H5QA 3TRXA 3ME8A 1HD2A 4TVEA 4BL7A 1GSFA 2A2RA 1GUKA 5IMCA 1AQVA 4O5QA 4MMMA 2H19A 1U88A 3MDKA 4GSSA 1IYIA 1OAZA 2RUFA 4JR6A 4Z2UA 2HXKA 4BVXB 4GLTA 4PXOA 2F3MA 3BBYA 4EIPA 2K8VA 3ZTLA 1VF3A 5HR3A 2MMZA 1JZRA 3AY8A 3GYKA 3QDNA 4A5PA 4BPYA 14GSA 4F0BA 2AV4A 3TUEA 4BA7A 2G2QA 1GNWA 1GUMA 5J9CA 2L6CA 2QSIA 4PQ1A 2HRNA 4KA0A 4J56E 4Z7XA 5E4WA 2VLUA 4AGSA 4ZB8A 6GSYA 3GKMA 2B5EA 5KOWA 3VURA 1U3AA 3DWVA 1O8XA 3BD2A 2M46A 2YZHA 2O87A 5KN2A 3PGTA 2TRXA 3LEFA 3HD5A 1QMVA 3IHGA 6GSUA 4I8BA 4EXJA 3DIEA 2GTUA 1Z9HA 2FHEA 2CT6A 4ZB6A 4V2LA 1WJKA 2R37A 2WULA 2AJQB 3UVTA 18GSA 9GSSA 2H71A 2DJ0A 1SKSB 2RM6A 3ERGA 1K0CA 4XHMA 2IMDA 2GT5A 3J7Yb 5HR2A 1ZMAA 5ECQB 3GH9A 1SYXA 4KH7A 2DJ2A 1O6JA 5DBQA 3IXRA 3JCML 5ECPB 2QKEA 1BYEA 1YF0A 4BWQA 2PUKC 4BVYB 1XWBA 5L71A 4TKYA 6GSSA 3ZREA 5AGYA 2VL2C 2ZUPA 3ZRDA 2E2GA 2V2GA 4KDYA 1M3IA 3HA9A 3GTUA 2A4HA 2ON7A 4IN0A 2MZCA 2NPBA 5ECIB 3GX0A 1QK8A 1E6BA 3C73A 5IIZA 1PSQA 1DE2A 3F3QA 1GWCA 1G6WA 3UIWA 5CRDA 1OC8A 2XPEA 1ERUA 3C1RA 4ISDA 4ZL8A 4BWSA 4G0KA 1URMA 5CNWA 1SJIA 3HJOA 2PN8A 3F9UA 2R3XA 4Q5FA 3KD0A 3A5IA 2C0EA 4WBRD 1T1VA 5ABRA 5HFGA 1GL8A 1DE1A 1GSYA 3CBUA 1NHOA 1KNGA 3GL5A 2QA1A 1HQOA 2BTOT 4ZL7A 2CVBA 1HNAA 4L8EA 3HVSA 3HDCA 3ZFBA 1Y6EA 3UVHA 2XBQA 4TR1B 3WGDA 4K9ZA 4FIWA 3TB2A 3LWAA 1UVZA 5G30A 2X64A 1M9AA 5DJMA 1JZOA 4YKFA 1J0FA 1ACVA 3CMIA 3A2WA 1ZGNA 2M80A 1YEXA 5JCGA 1ZYPA 4NXIA 3RDWA 3DRNA 3UMAA 2O85A 2I9HA 3MIXA 3QPMA 5DAKB 1A2JA 4K7OA 5ECMB 4RI6A 2K9FA 2J9HA 1GSEA 17GSA 2AHEA 1AQWA 4O5RA 2N5AA 1FG4A 10GSA 3KP9A 1EGOA 5ECSA 1XCCA 2KLXA 2OKAA 3GUSA 1V58A 4QL7A 1M7TA 3KJYA 4D73A 1HYUA 3HZ8A 5DDLA 1J9BA 3FW2A 1YQ1A 4DSSA 3ZLPA 2H70A 2B6MA 4IKHA 5HQPA 5EPFA 3KH9A 1SD8A 2RUEA 3L9SA 3IR4A 1X0RA 1XXUA 1O7UA 4KDXA 3IC4A 1AC1A 2LUSA 2MMOA 3FRCA 2CZ2A 4MA9A 3DXBA 1USBA 3HZ4A 1GLQA 2VD1A 2LQOA 5DVBA 3VWWA 1PKWA 3FZAA 5CREA 5D8IA 2L5OA 4F0CA 3D4TA 4EKZA 2F9SA 2IIYA 2JZTA 1OC9B 1WWJA 2FNOA 1SENA 3LG6A 4GWRA 2LV3A 4I5QA 4ACSA 4ECCA 3TKSE 3ZVJD 2R0GA 1V9WA 2CX4A 4MLYA 3IBHA 2R0CA 2IFQA 4F2IA 2VCZA 4WR5A 3F3RA 4N30A 3QFAC 5FT3A 1EWXA 3FKFA 3ZMLA 6GSTA 2FWFA 4ZB9A 2DKIA 2I1UA 1R4WA 3LGCA 1ERTA 4JEDA 2PERA 3EU3A 5A5KA 3ZYWA 2TRCP 5D9WA 1AUCA 1K0OA 5EVOA 1DUGA 5KEJA 2EIQA 1TKDB 3HYPA 2YJ7A 1TTZA 3G9BA 1LBKA 3GKNA 3I43A 4O7HA 2C80A 5BRTA 1FOHA 3UBKA 1XWAA 2C4JA 1B4QA 4ID0A 3F63A 5G2ZA 4KAEA 4HS1A 1A2LA 3ZIVA 4X0XA 3ZVJA 2UZ8A 4MK3A 4G0LA 2H76A 1MEKA 4HU7A 5CRGA 2LJRA 5IPHA 3EC3A 2RLIA 4HU9A 1F9MA 1FVJA 3A2VA 4L5LA 2Z9SA 1VGLA 2V32A 1RQMA 2O8VB 3EWLA 3C7MA 3ZITA 3GV1A 2N5FA 1T4ZA 2L4CA 4HUAA 4EO3A 5DQSA 2WB9A 3UEMA 1SL0B 4WBJA 1FB0A 4LMWA 1XPVA 3J7Yk 3CSHA 2GZYA 2H30A 2B1LA 2MBTA 3RBTA 2WRTA 2REMA 4ECBA 2OBIA 3ERWA 1Z7RA 3IA1A 5KN1A 4EUYA 3E0UA 8GSSA 2VCWA 2QC7A 4YH2A 1WP0A 1EV4A 3O6TA 4USSA 2HLSA 3QMXA 5GAND 5CRHA 4HJMA 13GSA 1GRXA 2H6XA 4IP6A 2I3YA 2TIRA 1Z6MA 3KGKA 4NV2A 1OVNA 2ES7A 2R5GA 4YQUA 4BVXA 1XOBA 4IHUA 2DIZA 3C8EA 4KGIA 2C0GA 1K0MA 5KOXA 4Z2TA 5HR0A 1Z5YE 2FA4A 3TOUA 2GSSA 3A5WA 4HOJA 1HNBA 4DSRA 1EOGA 3GFKA 3IAS2 5D73A 1S3RA 4LMVA 5IM9A 3FR3A 2X8GA 2JACA 1ST9A 4ZBBA 1PA3A 2IN3A 3ME7A 3R3EA 1O85A 3IAM2 5AN1A 4AJ8A 2OBKA 4I2UA 1YDKA 1ERWA 1XWCA 4AJ7A 4ZL9A 1B9XC 2HT9A 3APQA 3LSZA 4FQUA 1KTEA 3F8UA 4XRAA 1A8LA 3D0ZA 4NAXA 2FUG2 2E7PA 3TJBA 2HYXA 1SK2A 2N5BA
chains in the Genus database with same CATH topology
3IK9A 5IMZA 2PMTA 3ISOA 4OO5A 4WR4A 4KCEA 3HVXA 4GCIA 3D21A 3WT2A 3MYDA 5JWRB 4OCEA 1SU9A 4NV5A 2H75A 3FMWA 4TRXA 1K0DA 2HRKA 4XS4B 3APOA 1TRSA 2L5LA 4DEJA 16GSA 4G9HA 1WE0A 3PR8A 4RQRA 2CA8A 3ERFA 2H6YA 3CTFA 3WGEA 2YZUA 3EVIA 4EIQA 5GSTA 1ON4A 1O8WA 5D93A 4MPGA 2D2ZA 1ERVA 1Q98A 4QL9A 1FVKA 4ML6A 3W6GA 4HZ4A 2H1BA 4IP1A 2C3QA 5FHIA 2HSHA 3G7IA 4ULXA 4HQSA 3VPTA 1WOUA 4J2FA 5ECRB 2IMIA 5ELGA 2AUVA 2OA7A 5ECOB 1AQXA 3HVVA 2LKUA 1I5GA 2VL2A 4BVYA 2AB6A 4FYCA 1TK0B 2HNLA 4L5OA 1QFNA 4TR4A 4GTUA 1UA5A 5B8BA 1RK4A 3HKRA 1WRYA 3QAWA 3GURA 4YKGA 3L0HA 1Z7PA 1T7PB 5DALB 4IW9A 3F4SA 5IPGA 3M3MA 4GF0A 4IJ3A 4MF5A 5KN3A 2XC2A 4LL1B 5DJLA 1XWGA 1X9SB 2YOIA 1BAYA 2I81A 1XW9A 3E9JB 4GQCA 1MTCA 2H1GA 1O81A 2P5RA 4Q5RA 4TW5A 5ID2A 5AIVA 1TU7A 4BL7B 5BMUA 3TJKA 4KX4A 1CQGA 3ZIJA 4P3YB 3P8WA 5A4WA 1BG5A 1MDKA 3TRQA 2CZ3A 5LNKe 5F0GA 1EEMA 4OMVA 3HXSA 2C1YA 5G5EA 1V98A 4TR1A 1ZCPA 1TDIA 4K8MA 5GSSA 1ZZYA 3GMFA 2LRTA 4K1FA 5C00A 4YAVA 4JR4A 4CHSA 5C04A 2CAQA 5JCWA 5GAPD 1AIUA 4GRFA 4HDEA 1DBYA 4K7NA 4MNNA 2YWMA 2WS2A 3GN3A 1O73A 4LL4B 1U87A 4MP4A 4ILFA 5B6MA 4E8EA 3FZ5A 1PKZA 5IMFA 1PN9A 2R0PA 5G1KA 2R4VA 3M8NA 3KMOA 4I2TA 2M72A 1ML6A 2VM1A 2HE3A 2CQ9A 5IQYA 6GSWA 2H8LA 1GSQA 5GZZB 3GL3A 3M9KA 3IDVA 5J9BA 1XWKA 2GQMA 1LU4A 3CYNA 4CY8A 3H93A 2PPTA 4PX1A 1WPIA 1DSBA 3IPZA 2WDUA 3TKPA 2YPMA 1MDJA 1A23A 4ZILA 5AISA 4N10A 3HCZA 3QD9A 3TKRA 1YEPA 5AIXA 1Q4JA 5D9TA 4MJCA 4HI7A 4TXOB 2LRCA 2PU9C 2WZ9A 1OC9A 3IRAA 4IELA 4NPBA 4MF7A 4MZWA 1OC3A 2FWHA 2BJXA 4F82A 1NM3A 4Z2RA 2DIYA 2R2JA 1TP9A 2DJJA 4IBPA 4JZQA 2YP6A 1TW9A 2B1KA 4X4JA 2GSTA 1I9DA 4N0VA 1GLPA 4TOPA 1M0UA 2ZCTA 4E8HA 1PMTA 3O76A 4HZ2A 4OFNA 1PD21 4POKA 4K2DA 4IGJA 2JADA 1SL1B 1XVWA 2JZRA 4H86A 2PVOC 2P31A 4EF0A 4PURA 4Q5QA 3TOTA 2ALBA 3HHVA 3VWUA 3WD6A 3Q18A 3M1GA 2HI7A 4N11A 1GULA 1B8XA 1TRVA 2GVPA 2MBSA 1EEJA 1Z6NA 2NDOA 3M9JA 3CRUA 1WMJA 3GKKA 4OFTA 1NHYA 1OE8A 1SD9A 3V1WA 3BCKA 1S3DA 1YZXA 4V2MA 1G0TA 2K8SA 1G7OA 2VO4A 3CSJA 1T4YA 3GX8A 1FHEA 2H0IA 1F6MC 1PL2A 11GSA 2XBIA 1Y25A 2C0DA 3G7JA 5JWQB 5IO2A 3LJRA 2GDRA 1TJDA 3PH9A 1K0BA 1J08A 2DSAA 3HY2A 5IO0A 1W89A 2LNSA 3ZZXA 3TDGA 1NW2A 5ECNB 4XS1A 2YANA 4G2EA 4TR0A 3VI5A 4MZCA 6GSVA 3US3A 2EIOA 2LRNA 2YCDA 4EL1A 2YN1A 2NTOA 3U5RE 4ECJA 2C8UA 3CTGA 5ENUA 1JFUA 2HSMA 6GSXA 4QQ7A 3GH6A 3H79A 2HSYA 2K6VA 2QGVA 1R5AA 4KCAA 1V40A 3WYWA 1MD3A 1K0AA 3VI7A 4D73B 2YNXA 2X8HA 5A4UA 1R5PA 3IE3A 2VD0A 2YWIA 3FHKA 1F2EA 3L4NA 2B7JA 3P90A 3TKSC 3FY7A 3BCIA 3D4MA 2MMAA 4OFMA 3SBCA 3EMPA 1QXHA 3L9UA 4JBBA 1THXA 4JU5A 3TRPA 4ZXGA 1GTAA 3KH7A 4HEA2 1FOVA 3TJFA 4TR3A 3GNJA 2E2MA 3KIJA 4V1Ap 1SJ6A 2VIMA 1OYJA 5F06A 4GSNA 3O3TA 3RPPA 2P0GA 4ZBDA 4K5SA 4K2XA 2OE0A 5J41A 3R2QA 3KZQA 3UARA 3U6VA 1W4VA 5JWOB 3TJJA 4L0WA 3VPQA 3C1SA 3P2AA 4G0IA 1VF4A 1EP8A 4X43A 1ZYQB 3ZFLA 1G7EA 1RW1A 2IFQB 1PN0A 2LNTA 4O32A 4MF6A 1JLWA 3QCPA 2C0FA 2GS3A 1GNEA 3VFIA 3I9V2 2FLSA 1BQ7A 2VL9A 2GZPA 3GIXA 4MH2A 1GSDA 4IVFA 3EU4A 3LXTA 1XVQA 4Q5NA 3QOUA 4MJAA 3EPTA 4IQ1A 1A24A 1SYRA 2V41A 1F37A 2J23A 1AAZA 3DVWA 5INYA 1EGRA 4GSTA 3WT1A 1NSWA 2FD3A 3UAPA 3KEBA 4G19A 4AJ6A 3L9VA 4L0UA 2VLVA 1K3YA 3RAZA 2YV7A 2X99A 3RPNA 5H5SA 1H75A 3KP8A 4IJIA 1TI1A 3ED3A 2IMEA 3DMLA 3DKSA 1GTIA 4PQIA 2AAWA 2HZFA 1XZOA 4OD7A 3ZMKA 3LQ7A 2EC4A 4ECIA 3FR9A 2VCTA 3RHCA 5CAXA 1ABAA 1V57A 3A3TA 1EOHA 4XRDA 1F3BA 5E59A 2HZEB 3BOAA 4MJEA 1N8JA 5DCGA 4ZIJA 4TXVA 1M9BA 2H1AA 3KCMA 4POMA 3NIVA 3CRTA 4MPFA 5JCUA 2HRAA 2KUCA 2VCXA 3H4KA 2CV4A 1EP7A 4KNDA 2A4VA 2I4AA 1TOFA 2YJHA 1K3OA 4NWYA 5G5FA 4KE3A 5ECHB 4PQHA 4WKWA 2V6OA 2H6ZA 3DD3A 2DKHA 3E3EA 1M2AA 3QR6A 1GUHA 2H72A 2HFDA 2RIIA 19GSA 2GGTA 2JU5A 1KBNA 3F6DA 3UOMA 2FY6A 2AYTA 4EDYA 1M2DA 3LXZA 2VUPA 2KP2A 3HJPA 3IK7A 1YF1A 1YKAA 2DBCA 4WETA 4RUVA 1CQHA 5LD0A 2IWTA 3D5JA 4POBA 2HRFA 4KUNA 1XBSA 3NOFA 1TK8B 4KSMA 2H66A 4K6XA 1TRWA 2OE3A 4F9ZA 2DMLA 3CSIA 3WGXA 3TJGA 1XFLA 2VLTA 2FWEA 1GP1A 4I97A 3UBLA 1QUWA 2GQKA 2KOKA 5IMAA 2GLRA 3VLNA 3KMNA 3OR5A 2PWJA 1X9WB 1LJRA 3I69A 4I6XA 1EZKA 2VOCA 5LCZA 3FEUA 2EIRA 1B4PA 2JSZA 4MH3A 4POLA 3M0FA 5DCHA 1BX9A 4CDOA 3K8NA 3F6FA 1PGTA 3GSTA 4RQXA 5B6NA 1GSSA 3Q74A 2IPAA 2GSQA 4MJBA 1JZDA 1YJ6A 5IOXA 4ML1A 4LA1A 1A8YA 1H4OA 22GSA 5HR1A 2H0HA 4TXOA 3IHQA 2OADA 3EMXA 1FB6A 1BJXA 4KF9A 2JSYA 4MZBA 1Z3EA 5B7CA 1ILOA 1T8EB 4KW6A 2OE1A 5DAKA 4OO4A 1UN2A 5EL8A 1PRXA 3G7YA 5J5NA 3QAGA 2ZNMA 1X5CA 4TN8A 3Q19A 3EE2A 2R6KA 4NHZA 2FCHA 1E2YA 2PVQA 3BJ5A 4K0NA 2L59A 3GKXA 4N0ZA 5FWGA 2H73A 3Q6OA 1FO5A 1PL1A 2YWNA 3DGQA 4XIHA 5CRWA 3KM6A 2DMMA 3H1NA 1FW1A 4KDUA 1HNCA 3PINA 1SK1A 4JE1A 4XS6A 1N2AA 3UL3A 4YQVA 5ID2B 3PPUA 2X8CA 1IYHA 2PGTA 1T3BA 1MDIA 1OKDA 1ZYNA 3FZ9A 1FAAA 1MD4A 4EC0A 2F8AA 4FYUA 1JHBA 1XIYA 1PQNA 4O92A 4O5UA 5F07A 2E0QA 2O89A 2IJYA 2XHFA 2GQLA 3GSSA 12GSA 3DYRA 3LORA 7GSSA 2F8FA 2H01A 3TCOA 2KP1A 4MCUA 4ICYA 4DVCA 2LTKA 1GTUA 1B48A 4FYBA 1YKCA 3FYGA 5G31A 2DC5A 3GTUB 2JZSA 2LS5A 1EV9A 4PTSA 3MAKA 5IMDA 4PNGA 5F8BA 4MDCA 2YV9A 3LW9A 1T00A 2L6DA 4MABA 1PX6A 4NHWA 3S9FA 3D22A 1GH2A 5ECKB 1GSUA 3CXGA 3IOSA 1X5EA 3TKSA 5IMVA 1THOA 3VK9A 2BMXA 2A2PA 1SKRB 5DQYA 1K0NA 1ZOFA 4XTSA 2L57A 4IQAA 3APSA 1V2AA 2RM5A 1TXXA 1U3IA 1ZL9A 3EINA 2G0FA 3UJ1A 3TGZA 3N5OA 4K7IA 3GA4A 2DLXA 3L78A 4F03A 2B7KA 2FWGA 3MNGA 2KHPA 2QA2A 5G1LA 2WGRA 1OKTA 5CO3A 2NBSA 4OCFA 3IV4A 2K18A 1S3CA 4CY6A 2CAIA 2GT6A 4YAPA 2LEGA 3FK8A 1F3AA 3FR6A 1VF1A 2CVDA 2FGXA 4J57E 5CYYA 4JRRA 5EY6A 4V2NA 4YQMA 4GQFA 2JL4A 1A0FA 4ZBAA 2LSTA 2MMNA 3F4RA 3KXOA 5COHA 5A4VA 2WFCA 2GZZA 1SL2B 4WEYA 4RI7A 4K0GA 4CW9A 2H0GA 1WIKA 5ELAA 2FA8A 1JLVA 3IC8A 3KTLA 4FO5A 1SK0A 4DSSB 2CVKA 3DVXA 4XCSA 5D9XA 2B3SA 2VCVA 3VWVA 3QAVA 4KSOA 3DEXA 3ZL5A 2LQQA 2LJKA 3D6IA 1G6YA 3TKQA 2VAFA 2OJLA 1XOAA 2P5QA 2C3NA 2XPDA 1TRUA 5D9VA 3LYPA 4HQZA 1TK5B 2CX3A 1M99A 1GTBA 4X1UA 1XW5A 4FH8A 2WCIA 4GXZA 2O7KA 1BEDA 5HFKA 3GRXA 3QFBC 3GHAA 3W8JA 1X9MB 2HZEA 3RHBA 4PUAA 1C72A 5F05A 4G10A 3F4TA 5H5RA 2VCQA 2V1MA 1UC7A 3NZNA 1XW6A 1U6TA 1S3AA 2B5XA 4XS4A 1B9YC 2DJ3A 4PGTA 1A2MA 1VRSD 1ZYEA 2LJAA 1M2BA 2DJ1A 1R26A 2ON5A 2NVLA 3A2XA 5B8AA 2OACA 3I6AA 1TI3A 2VL3A 2X4AA 4WF4A 5CP1A 2WJUA 2V6KA 4WXTA 3FZ4A 4HJ2A 4PUFC 3MWHA 2GSRA 5ECLB 3VWXA 4DSQA 1YY7A 3HJMA 5J4UA 1AW9A 3H8QA 4KB3A 2A2SA 2IL3A 2MYGA 3MSZA 5HFIA 2DJKA 2H74A 4AF2A 3N9JA 2L4QA 1QQ2A 2H1DA 1A0RP 2IMKA 5J3RA 3P7XA 1X5DA 1SKWB 5D96A 2YWOA 3F0IA 4WF5A 1R7HA 3KTBA 4OWYA 4EDZA 1K3LA 1OE7A 3EYTA 4EVMA 2IMFA 1PX7A 2VM2A 3EURA 4LLRA 3SWLA 1QGVA 3C71A 1JZWA 5DALA 1SJZA 20GSA 2B5YA 3LFLA 1KEBA 2PBJA 4IS0A 3W8SA 3LYKA 4EE0A 2F51A 1VF2A 4NMUA 1TU8A 4PNFA 4V1Ag 5IOWA 2C3TA 5KN0A 2X49A 1AXDA 4K5RA 5H5QA 3TRXA 3ME8A 1HD2A 4TVEA 4BL7A 1GSFA 2A2RA 1GUKA 5IMCA 1AQVA 4O5QA 4MMMA 2H19A 1U88A 3MDKA 4GSSA 1IYIA 1OAZA 2RUFA 4JR6A 4Z2UA 2HXKA 4BVXB 4GLTA 4PXOA 2F3MA 3BBYA 4EIPA 2K8VA 3ZTLA 1VF3A 5HR3A 2MMZA 1JZRA 3AY8A 3GYKA 3QDNA 4A5PA 4BPYA 14GSA 4F0BA 2AV4A 3TUEA 4BA7A 2G2QA 1GNWA 1GUMA 5J9CA 2L6CA 2QSIA 4PQ1A 2HRNA 4KA0A 4J56E 4Z7XA 5E4WA 2VLUA 4AGSA 4ZB8A 6GSYA 3GKMA 2B5EA 5KOWA 3VURA 1U3AA 3DWVA 1O8XA 3BD2A 2M46A 2YZHA 2O87A 5KN2A 3PGTA 2TRXA 3LEFA 3HD5A 1QMVA 3IHGA 6GSUA 4I8BA 4EXJA 3DIEA 2GTUA 1Z9HA 2FHEA 2CT6A 4ZB6A 4V2LA 1WJKA 2R37A 2WULA 2AJQB 3UVTA 18GSA 9GSSA 2H71A 2DJ0A 1SKSB 2RM6A 3ERGA 1K0CA 4XHMA 2IMDA 2GT5A 3J7Yb 5HR2A 1ZMAA 5ECQB 3GH9A 1SYXA 4KH7A 2DJ2A 1O6JA 5DBQA 3IXRA 3JCML 5ECPB 2QKEA 1BYEA 1YF0A 4BWQA 2PUKC 4BVYB 1XWBA 5L71A 4TKYA 6GSSA 3ZREA 5AGYA 2VL2C 2ZUPA 3ZRDA 2E2GA 2V2GA 4KDYA 3HA9A 3GTUA 2A4HA 2ON7A 4IN0A 2MZCA 2NPBA 5ECIB 3GX0A 1QK8A 1E6BA 3C73A 5IIZA 1PSQA 1DE2A 3F3QA 1GWCA 1G6WA 3UIWA 5CRDA 1OC8A 2XPEA 1ERUA 3C1RA 4ISDA 4ZL8A 4BWSA 4G0KA 1URMA 5CNWA 1SJIA 3HJOA 2PN8A 3F9UA 2R3XA 4Q5FA 3KD0A 3A5IA 2C0EA 4WBRD 1T1VA 5ABRA 5HFGA 1GL8A 1DE1A 1GSYA 3CBUA 1NHOA 1KNGA 3GL5A 2QA1A 1HQOA 2BTOT 4ZL7A 2CVBA 1HNAA 4L8EA 3HVSA 3HDCA 3ZFBA 1Y6EA 3UVHA 2XBQA 4TR1B 3WGDA 4K9ZA 4FIWA 3TB2A 3LWAA 1UVZA 5G30A 2X64A 1M9AA 5DJMA 1JZOA 4YKFA 1J0FA 1ACVA 3CMIA 3A2WA 1ZGNA 2M80A 1YEXA 5JCGA 1ZYPA 4NXIA 3RDWA 3DRNA 3UMAA 2O85A 2I9HA 3MIXA 3QPMA 5DAKB 1A2JA 4K7OA 5ECMB 4RI6A 2K9FA 2J9HA 1GSEA 17GSA 2AHEA 1AQWA 4O5RA 2N5AA 1FG4A 10GSA 3KP9A 1EGOA 5ECSA 1XCCA 2KLXA 2OKAA 3GUSA 1V58A 4QL7A 1M7TA 3KJYA 4D73A 1HYUA 3HZ8A 5DDLA 1J9BA 3FW2A 1YQ1A 4DSSA 3ZLPA 2H70A 2B6MA 4IKHA 5HQPA 5EPFA 3KH9A 1SD8A 2RUEA 3L9SA 3IR4A 1X0RA 1XXUA 1O7UA 4KDXA 3IC4A 1AC1A 2LUSA 2MMOA 3FRCA 2CZ2A 4MA9A 3DXBA 1USBA 3HZ4A 1GLQA 2VD1A 2LQOA 5DVBA 3VWWA 1PKWA 3FZAA 5CREA 5D8IA 2L5OA 4F0CA 3D4TA 4EKZA 2F9SA 2IIYA 2JZTA 1OC9B 1WWJA 2FNOA 1SENA 3LG6A 4GWRA 2LV3A 4I5QA 4ACSA 4ECCA 3TKSE 3ZVJD 2R0GA 1V9WA 2CX4A 4MLYA 3IBHA 2R0CA 2IFQA 4F2IA 2VCZA 4WR5A 3F3RA 4N30A 3QFAC 5FT3A 1EWXA 3FKFA 3ZMLA 6GSTA 2FWFA 4ZB9A 2DKIA 2I1UA 1R4WA 3LGCA 1ERTA 4JEDA 2PERA 3EU3A 5A5KA 3ZYWA 2TRCP 5D9WA 1AUCA 1K0OA 5EVOA 1DUGA 5KEJA 2EIQA 1TKDB 3HYPA 2YJ7A 1TTZA 3G9BA 1LBKA 3GKNA 3I43A 4O7HA 2C80A 5BRTA 1FOHA 3UBKA 1XWAA 2C4JA 1B4QA 4ID0A 3F63A 5G2ZA 4KAEA 4HS1A 1A2LA 3ZIVA 4X0XA 3ZVJA 2UZ8A 4MK3A 4G0LA 2H76A 1MEKA 4HU7A 5CRGA 2LJRA 5IPHA 3EC3A 2RLIA 4HU9A 1F9MA 1FVJA 3A2VA 4L5LA 2Z9SA 1VGLA 2V32A 1RQMA 2O8VB 3EWLA 3C7MA 3ZITA 3GV1A 2N5FA 1T4ZA 2L4CA 4HUAA 4EO3A 5DQSA 2WB9A 3UEMA 1SL0B 4WBJA 1FB0A 4LMWA 1XPVA 3J7Yk 3CSHA 2GZYA 2H30A 2B1LA 2MBTA 3RBTA 2WRTA 2REMA 4ECBA 2OBIA 3ERWA 1Z7RA 3IA1A 5KN1A 4EUYA 3E0UA 8GSSA 2VCWA 2QC7A 4YH2A 1WP0A 1EV4A 3O6TA 4USSA 2HLSA 3QMXA 5GAND 5CRHA 4HJMA 13GSA 1GRXA 2H6XA 4IP6A 2I3YA 2TIRA 1Z6MA 3KGKA 4NV2A 1OVNA 2ES7A 2R5GA 4YQUA 4BVXA 1XOBA 4IHUA 2DIZA 3C8EA 4KGIA 2C0GA 1K0MA 5KOXA 4Z2TA 5HR0A 1Z5YE 2FA4A 3TOUA 2GSSA 3A5WA 4HOJA 1HNBA 4DSRA 1EOGA 3GFKA 3IAS2 5D73A 4LMVA 5IM9A 3FR3A 2X8GA 2JACA 1ST9A 4ZBBA 1PA3A 2IN3A 3ME7A 3R3EA 1O85A 3IAM2 5AN1A 4AJ8A 2OBKA 4I2UA 1YDKA 1ERWA 1XWCA 4AJ7A 4ZL9A 1B9XC 2HT9A 3APQA 3LSZA 4FQUA 1KTEA 3F8UA 4XRAA 1A8LA 3D0ZA 4NAXA 2FUG2 2E7PA 3TJBA 2HYXA 1SK2A 2N5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IK9 A;  5IMZ A;  2PMT A;  3ISO A;  4OO5 A;  4WR4 A;  4KCE A;  3HVX A;  4GCI A;  3D21 A;  3WT2 A;  5JWR B;  4OCE A;  1SU9 A;  4NV5 A;  2H75 A;  4TRX A;  1K0D A;  4XS4 B;  3APO A;  1TRS A;  2L5L A;  4DEJ A;  16GS A;  4G9H A;  1WE0 A;  3PR8 A;  4RQR A;  2CA8 A;  3ERF A;  2H6Y A;  3CTF A;  3WGE A;  2YZU A;  3EVI A;  5GST A;  1ON4 A;  1O8W A;  5D93 A;  4MPG A;  2D2Z A;  1ERV A;  1Q98 A;  4QL9 A;  1FVK A;  4ML6 A;  3W6G A;  4HZ4 A;  2H1B A;  4IP1 A;  2C3Q A;  5FHI A;  2HSH A;  3G7I A;  4ULX A;  4HQS A;  3VPT A;  1WOU A;  4J2F A;  5ECR B;  2IMI A;  5ELG A;  2AUV A;  2OA7 A;  5ECO B;  1AQX A;  3HVV A;  2LKU A;  1I5G A;  2VL2 A;  4BVY A;  2AB6 A;  4FYC A;  1TK0 B;  2HNL A;  4L5O A;  1QFN A;  4TR4 A;  4GTU A;  1UA5 A;  5B8B A;  1RK4 A;  3HKR A;  1WRY A;  3QAW A;  3GUR A;  3L0H A;  1Z7P A;  1T7P B;  5DAL B;  4IW9 A;  3F4S A;  5IPG A;  3M3M A;  4GF0 A;  4IJ3 A;  4MF5 A;  5KN3 A;  2XC2 A;  4LL1 B;  5DJL A;  1XWG A;  1X9S B;  2YOI A;  1BAY A;  2I81 A;  1XW9 A;  3E9J B;  4GQC A;  1MTC A;  2H1G A;  1O81 A;  2P5R A;  4Q5R A;  4TW5 A;  5ID2 A;  5AIV A;  1TU7 A;  3TJK A;  4KX4 A;  1CQG A;  3ZIJ A;  4P3Y B;  3P8W A;  5A4W A;  1BG5 A;  1MDK A;  3TRQ A;  2CZ3 A;  5LNK e;  5F0G A;  1EEM A;  4OMV A;  3HXS A;  2C1Y A;  5G5E A;  1V98 A;  4TR1 A;  1ZCP A;  1TDI A;  4K8M A;  5GSS A;  1ZZY A;  3GMF A;  2LRT A;  4K1F A;  5C00 A;  4YAV A;  4JR4 A;  4CHS A;  5C04 A;  2CAQ A;  5JCW A;  5GAP D;  1AIU A;  4GRF A;  4HDE A;  1DBY A;  4K7N A;  2YWM A;  2WS2 A;  3GN3 A;  1O73 A;  4LL4 B;  1U87 A;  4MP4 A;  4ILF A;  5B6M A;  4E8E A;  3FZ5 A;  1PKZ A;  5IMF A;  1PN9 A;  5G1K A;  2R4V A;  3M8N A;  3KMO A;  4I2T A;  2M72 A;  1ML6 A;  2VM1 A;  2HE3 A;  2CQ9 A;  5IQY A;  6GSW A;  2H8L A;  1GSQ A;  5GZZ B;  3GL3 A;  3M9K A;  3IDV A;  5J9B A;  1XWK A;  2GQM A;  1LU4 A;  3CYN A;  3H93 A;  2PPT A;  4PX1 A;  1WPI A;  1DSB A;  3IPZ A;  2WDU A;  3TKP A;  2YPM A;  1MDJ A;  1A23 A;  4ZIL A;  5AIS A;  4N10 A;  3HCZ A;  3QD9 A;  3TKR A;  1YEP A;  5AIX A;  1Q4J A;  5D9T A;  4MJC A;  4HI7 A;  4TXO B;  2LRC A;  2PU9 C;  2WZ9 A;  1OC9 A;  3IRA A;  4IEL A;  4NPB A;  4MF7 A;  4MZW A;  1OC3 A;  2FWH A;  2BJX A;  4F82 A;  1NM3 A;  2DIY A;  2R2J A;  1TP9 A;  2DJJ A;  4IBP A;  4JZQ A;  2YP6 A;  1TW9 A;  2B1K A;  2GST A;  1I9D A;  4N0V A;  1GLP A;  4TOP A;  1M0U A;  2ZCT A;  4E8H A;  1PMT A;  3O76 A;  4HZ2 A;  4OFN A;  1PD2 1;  4POK A;  4K2D A;  4IGJ A;  2JAD A;  1SL1 B;  1XVW A;  2JZR A;  4H86 A;  2PVO C;  2P31 A;  4EF0 A;  4PUR A;  4Q5Q A;  3TOT A;  2ALB A;  3HHV A;  3VWU A;  3WD6 A;  3Q18 A;  3M1G A;  2HI7 A;  4N11 A;  1GUL A;  1B8X A;  1TRV A;  2GVP A;  2MBS A;  1EEJ A;  1Z6N A;  2NDO A;  3M9J A;  3CRU A;  1WMJ A;  3GKK A;  4OFT A;  1NHY A;  1OE8 A;  1SD9 A;  3V1W A;  3BCK A;  1S3D A;  1YZX A;  4V2M A;  1G0T A;  2K8S A;  1G7O A;  2VO4 A;  3CSJ A;  1T4Y A;  3GX8 A;  1FHE A;  2H0I A;  1F6M C;  1PL2 A;  11GS A;  2XBI A;  1Y25 A;  2C0D A;  3G7J A;  5JWQ B;  5IO2 A;  3LJR A;  2GDR A;  1TJD A;  3PH9 A;  1K0B A;  1J08 A;  2DSA A;  3HY2 A;  5IO0 A;  1W89 A;  2LNS A;  3ZZX A;  3TDG A;  1NW2 A;  5ECN B;  4XS1 A;  2YAN A;  4G2E A;  4TR0 A;  3VI5 A;  4MZC A;  6GSV A;  3US3 A;  2EIO A;  2LRN A;  2YCD A;  4EL1 A;  2YN1 A;  2NTO A;  3U5R E;  4ECJ A;  2C8U A;  3CTG A;  5ENU A;  1JFU A;  6GSX A;  4QQ7 A;  3GH6 A;  3H79 A;  2HSY A;  2K6V A;  2QGV A;  1R5A A;  4KCA A;  1V40 A;  3WYW A;  1MD3 A;  1K0A A;  3VI7 A;  4D73 B;  2YNX A;  2X8H A;  5A4U A;  1R5P A;  3IE3 A;  2VD0 A;  2YWI A;  3FHK A;  1F2E A;  3L4N A;  2B7J A;  3P90 A;  3TKS C;  3FY7 A;  3BCI A;  3D4M A;  2MMA A;  4OFM A;  3SBC A;  3EMP A;  1QXH A;  3L9U A;  4JBB A;  1THX A;  4JU5 A;  3TRP A;  4ZXG A;  1GTA A;  3KH7 A;  4HEA 2;  1FOV A;  3TJF A;  4TR3 A;  3GNJ A;  2E2M A;  3KIJ A;  4V1A p;  1SJ6 A;  2VIM A;  1OYJ A;  5F06 A;  4GSN A;  3O3T A;  3RPP A;  2P0G A;  4ZBD A;  5J41 A;  2OE0 A;  3R2Q A;  3KZQ A;  3UAR A;  3U6V A;  1W4V A;  5JWO B;  3TJJ A;  4L0W A;  3VPQ A;  3C1S A;  3P2A A;  1VF4 A;  1EP8 A;  4X43 A;  1ZYQ B;  3ZFL A;  1G7E A;  1RW1 A;  2IFQ B;  2LNT A;  4O32 A;  4MF6 A;  1JLW A;  3QCP A;  2C0F A;  2GS3 A;  1GNE A;  3VFI A;  3I9V 2;  2FLS A;  1BQ7 A;  2VL9 A;  2GZP A;  3GIX A;  4MH2 A;  1GSD A;  4IVF A;  3EU4 A;  3LXT A;  1XVQ A;  4Q5N A;  3QOU A;  4MJA A;  4IQ1 A;  1A24 A;  1SYR A;  2V41 A;  1F37 A;  2J23 A;  1AAZ A;  3DVW A;  5INY A;  1EGR A;  4GST A;  3WT1 A;  1NSW A;  2FD3 A;  3UAP A;  3KEB A;  4G19 A;  4AJ6 A;  3L9V A;  4L0U A;  2VLV A;  1K3Y A;  3RAZ A;  2YV7 A;  2X99 A;  3RPN A;  5H5S A;  1H75 A;  3KP8 A;  4IJI A;  1TI1 A;  3ED3 A;  2IME A;  3DML A;  3DKS A;  1GTI A;  4PQI A;  2AAW A;  2HZF A;  1XZO A;  4OD7 A;  3ZMK A;  3LQ7 A;  2EC4 A;  4ECI A;  3FR9 A;  2VCT A;  3RHC A;  5CAX A;  1ABA A;  1V57 A;  3A3T A;  1EOH A;  4XRD A;  1F3B A;  5E59 A;  2HZE B;  3BOA A;  4MJE A;  1N8J A;  5DCG A;  4ZIJ A;  4TXV A;  1M9B A;  2H1A A;  3KCM A;  4POM A;  3NIV A;  3CRT A;  4MPF A;  5JCU A;  2KUC A;  2VCX A;  3H4K A;  2CV4 A;  1EP7 A;  4KND A;  2A4V A;  2I4A A;  1TOF A;  2YJH A;  1K3O A;  4NWY A;  5G5F A;  4KE3 A;  5ECH B;  4PQH A;  4WKW A;  2V6O A;  2H6Z A;  3DD3 A;  3E3E A;  1M2A A;  3QR6 A;  1GUH A;  2H72 A;  2HFD A;  2RII A;  19GS A;  2GGT A;  2JU5 A;  1KBN A;  3F6D A;  3UOM A;  2FY6 A;  2AYT A;  4EDY A;  1M2D A;  3LXZ A;  2VUP A;  2KP2 A;  3HJP A;  3IK7 A;  1YF1 A;  1YKA A;  2DBC A;  4WET A;  4RUV A;  1CQH A;  5LD0 A;  2IWT A;  3D5J A;  4POB A;  2HRF A;  4KUN A;  1XBS A;  3NOF A;  1TK8 B;  4KSM A;  2H66 A;  4K6X A;  1TRW A;  2OE3 A;  4F9Z A;  2DML A;  3CSI A;  3WGX A;  3TJG A;  1XFL A;  2VLT A;  2FWE A;  1GP1 A;  4I97 A;  3UBL A;  1QUW A;  2GQK A;  2KOK A;  5IMA A;  2GLR A;  3VLN A;  3KMN A;  3OR5 A;  2PWJ A;  1X9W B;  1LJR A;  3I69 A;  4I6X A;  1EZK A;  2VOC A;  5LCZ A;  3FEU A;  2EIR A;  1B4P A;  2JSZ A;  4MH3 A;  4POL A;  3M0F A;  5DCH A;  1BX9 A;  4CDO A;  3K8N A;  3F6F A;  1PGT A;  3GST A;  4RQX A;  5B6N A;  1GSS A;  3Q74 A;  2IPA A;  2GSQ A;  4MJB A;  1JZD A;  1YJ6 A;  5IOX A;  4ML1 A;  4LA1 A;  1A8Y A;  1H4O A;  22GS A;  5HR1 A;  2H0H A;  4TXO A;  3IHQ A;  2OAD A;  3EMX A;  1FB6 A;  1BJX A;  2JSY A;  4MZB A;  1Z3E A;  5B7C A;  1ILO A;  1T8E B;  4KW6 A;  2OE1 A;  5DAK A;  4OO4 A;  1UN2 A;  5EL8 A;  1PRX A;  3G7Y A;  5J5N A;  3QAG A;  2ZNM A;  1X5C A;  4TN8 A;  3Q19 A;  3EE2 A;  2R6K A;  4NHZ A;  2FCH A;  1E2Y A;  2PVQ A;  3BJ5 A;  4K0N A;  2L59 A;  3GKX A;  4N0Z A;  5FWG A;  2H73 A;  3Q6O A;  1FO5 A;  1PL1 A;  2YWN A;  3DGQ A;  4XIH A;  5CRW A;  3KM6 A;  2DMM A;  3H1N A;  1FW1 A;  4KDU A;  1HNC A;  3PIN A;  1SK1 A;  4JE1 A;  4XS6 A;  1N2A A;  3UL3 A;  4YQV A;  5ID2 B;  2X8C A;  1IYH A;  2PGT A;  1T3B A;  1MDI A;  1OKD A;  3FZ9 A;  1FAA A;  1MD4 A;  4EC0 A;  2F8A A;  4FYU A;  1JHB A;  1XIY A;  1PQN A;  4O92 A;  5F07 A;  2E0Q A;  2O89 A;  2IJY A;  2XHF A;  2GQL A;  3GSS A;  12GS A;  3DYR A;  3LOR A;  7GSS A;  2F8F A;  2H01 A;  3TCO A;  2KP1 A;  4MCU A;  4DVC A;  2LTK A;  1GTU A;  1B48 A;  4FYB A;  1YKC A;  3FYG A;  5G31 A;  2DC5 A;  3GTU B;  2JZS A;  2LS5 A;  1EV9 A;  3MAK A;  5IMD A;  4PNG A;  5F8B A;  4MDC A;  2YV9 A;  1T00 A;  2L6D A;  4MAB A;  1PX6 A;  4NHW A;  3S9F A;  3D22 A;  1GH2 A;  5ECK B;  1GSU A;  3CXG A;  3IOS A;  1X5E A;  3TKS A;  5IMV A;  1THO A;  3VK9 A;  2BMX A;  1SKR B;  5DQY A;  1K0N A;  1ZOF A;  4XTS A;  2L57 A;  4IQA A;  3APS A;  1V2A A;  2RM5 A;  1TXX A;  1U3I A;  1ZL9 A;  3EIN A;  2G0F A;  3UJ1 A;  3TGZ A;  3N5O A;  4K7I A;  3GA4 A;  2DLX A;  3L78 A;  4F03 A;  2B7K A;  2FWG A;  3MNG A;  2KHP A;  5G1L A;  2WGR A;  1OKT A;  5CO3 A;  2NBS A;  4OCF A;  3IV4 A;  2K18 A;  1S3C A;  2CAI A;  2GT6 A;  4YAP A;  2LEG A;  3FK8 A;  1F3A A;  3FR6 A;  1VF1 A;  2CVD A;  2FGX A;  4J57 E;  5CYY A;  4JRR A;  5EY6 A;  4V2N A;  4YQM A;  4GQF A;  2JL4 A;  1A0F A;  4ZBA A;  2LST A;  2MMN A;  3F4R A;  3KXO A;  5COH A;  5A4V A;  2WFC A;  2GZZ A;  1SL2 B;  4WEY A;  4RI7 A;  4K0G A;  4CW9 A;  2H0G A;  1WIK A;  5ELA A;  2FA8 A;  1JLV A;  3KTL A;  4FO5 A;  1SK0 A;  4DSS B;  2CVK A;  3DVX A;  4XCS A;  5D9X A;  2B3S A;  2VCV A;  3VWV A;  3QAV A;  4KSO A;  3DEX A;  3ZL5 A;  2LQQ A;  2LJK A;  3D6I A;  1G6Y A;  3TKQ A;  2VAF A;  2OJL A;  1XOA A;  2P5Q A;  2C3N A;  2XPD A;  1TRU A;  5D9V A;  3LYP A;  4HQZ A;  1TK5 B;  2CX3 A;  1M99 A;  1GTB A;  4X1U A;  1XW5 A;  4FH8 A;  2WCI A;  4GXZ A;  2O7K A;  1BED A;  5HFK A;  3GRX A;  3QFB C;  3GHA A;  3W8J A;  1X9M B;  2HZE A;  3RHB A;  4PUA A;  1C72 A;  5F05 A;  4G10 A;  3F4T A;  5H5R A;  2VCQ A;  2V1M A;  1UC7 A;  3NZN A;  1XW6 A;  1U6T A;  1S3A A;  2B5X A;  4XS4 A;  1B9Y C;  2DJ3 A;  4PGT A;  1A2M A;  1VRS D;  1ZYE A;  2LJA A;  1M2B A;  2DJ1 A;  1R26 A;  2ON5 A;  2NVL A;  3A2X A;  5B8A A;  2OAC A;  3I6A A;  1TI3 A;  2VL3 A;  4WF4 A;  5CP1 A;  2WJU A;  2V6K A;  4WXT A;  3FZ4 A;  4HJ2 A;  4PUF C;  3MWH A;  2GSR A;  5ECL B;  3VWX A;  4DSQ A;  1YY7 A;  3HJM A;  5J4U A;  1AW9 A;  3H8Q A;  4KB3 A;  2A2S A;  2IL3 A;  2MYG A;  3MSZ A;  5HFI A;  2DJK A;  2H74 A;  4AF2 A;  3N9J A;  2L4Q A;  1QQ2 A;  2H1D A;  1A0R P;  2IMK A;  5J3R A;  3P7X A;  1X5D A;  1SKW B;  5D96 A;  2YWO A;  3F0I A;  4WF5 A;  1R7H A;  3KTB A;  4OWY A;  4EDZ A;  1K3L A;  1OE7 A;  3EYT A;  4EVM A;  2IMF A;  1PX7 A;  2VM2 A;  3EUR A;  4LLR A;  3SWL A;  1QGV A;  3C71 A;  1JZW A;  5DAL A;  1SJZ A;  20GS A;  2B5Y A;  3LFL A;  1KEB A;  2PBJ A;  4IS0 A;  3W8S A;  3LYK A;  4EE0 A;  2F51 A;  1VF2 A;  4NMU A;  1TU8 A;  4PNF A;  4V1A g;  5IOW A;  2C3T A;  5KN0 A;  1AXD A;  5H5Q A;  3TRX A;  3ME8 A;  1HD2 A;  4TVE A;  4BL7 A;  1GSF A;  2A2R A;  1GUK A;  5IMC A;  1AQV A;  4MMM A;  2H19 A;  1U88 A;  3MDK A;  4GSS A;  1IYI A;  1OAZ A;  2RUF A;  4JR6 A;  2HXK A;  4GLT A;  4PXO A;  2F3M A;  3BBY A;  2K8V A;  3ZTL A;  1VF3 A;  5HR3 A;  2MMZ A;  1JZR A;  3AY8 A;  3GYK A;  3QDN A;  4BPY A;  14GS A;  4F0B A;  2AV4 A;  3TUE A;  4BA7 A;  2G2Q A;  1GNW A;  1GUM A;  5J9C A;  2L6C A;  2QSI A;  4PQ1 A;  2HRN A;  4KA0 A;  4J56 E;  4Z7X A;  5E4W A;  2VLU A;  4AGS A;  4ZB8 A;  6GSY A;  3GKM A;  2B5E A;  3VUR A;  1U3A A;  3DWV A;  1O8X A;  3BD2 A;  2M46 A;  2YZH A;  2O87 A;  5KN2 A;  3PGT A;  2TRX A;  3LEF A;  3HD5 A;  1QMV A;  6GSU A;  4I8B A;  4EXJ A;  3DIE A;  2GTU A;  1Z9H A;  2FHE A;  2CT6 A;  4ZB6 A;  4V2L A;  1WJK A;  2R37 A;  2WUL A;  2AJQ B;  3UVT A;  18GS A;  9GSS A;  2H71 A;  2DJ0 A;  1SKS B;  2RM6 A;  3ERG A;  1K0C A;  4XHM A;  2IMD A;  2GT5 A;  3J7Y b;  5HR2 A;  1ZMA A;  5ECQ B;  3GH9 A;  1SYX A;  4KH7 A;  2DJ2 A;  1O6J A;  5DBQ A;  3IXR A;  3JCM L;  5ECP B;  2QKE A;  1BYE A;  1YF0 A;  4BWQ A;  2PUK C;  1XWB A;  5L71 A;  4TKY A;  6GSS A;  3ZRE A;  5AGY A;  2VL2 C;  2ZUP A;  3ZRD A;  2E2G A;  2V2G A;  4KDY A;  3HA9 A;  3GTU A;  2ON7 A;  4IN0 A;  2MZC A;  2NPB A;  5ECI B;  3GX0 A;  1QK8 A;  1E6B A;  3C73 A;  5IIZ A;  1PSQ A;  1DE2 A;  3F3Q A;  1GWC A;  1G6W A;  3UIW A;  5CRD A;  1OC8 A;  2XPE A;  1ERU A;  3C1R A;  4ISD A;  4ZL8 A;  4BWS A;  1URM A;  5CNW A;  1SJI A;  3HJO A;  2PN8 A;  3F9U A;  2R3X A;  4Q5F A;  3KD0 A;  2C0E A;  4WBR D;  1T1V A;  5ABR A;  5HFG A;  1GL8 A;  1DE1 A;  1GSY A;  3CBU A;  1NHO A;  1KNG A;  3GL5 A;  1HQO A;  2BTO T;  4ZL7 A;  2CVB A;  1HNA A;  4L8E A;  3HVS A;  3HDC A;  3ZFB A;  1Y6E A;  3UVH A;  2XBQ A;  4TR1 B;  3WGD A;  4K9Z A;  4FIW A;  3TB2 A;  3LWA A;  1UVZ A;  5G30 A;  2X64 A;  1M9A A;  5DJM A;  1JZO A;  1J0F A;  1ACV A;  3CMI A;  3A2W A;  1ZGN A;  2M80 A;  1YEX A;  5JCG A;  4NXI A;  3RDW A;  3DRN A;  3UMA A;  2O85 A;  2I9H A;  3QPM A;  5DAK B;  1A2J A;  4K7O A;  5ECM B;  4RI6 A;  2K9F A;  2J9H A;  1GSE A;  17GS A;  2AHE A;  1AQW A;  4O5R A;  2N5A A;  1FG4 A;  10GS A;  3KP9 A;  1EGO A;  5ECS A;  1XCC A;  2KLX A;  2OKA A;  3GUS A;  1V58 A;  4QL7 A;  1M7T A;  3KJY A;  4D73 A;  5DDL A;  1HYU A;  3HZ8 A;  1J9B A;  3FW2 A;  1YQ1 A;  4DSS A;  3ZLP A;  2H70 A;  2B6M A;  4IKH A;  5HQP A;  5EPF A;  3KH9 A;  1SD8 A;  2RUE A;  3L9S A;  3IR4 A;  1X0R A;  1XXU A;  1O7U A;  4KDX A;  3IC4 A;  1AC1 A;  2LUS A;  2MMO A;  3FRC A;  2CZ2 A;  4MA9 A;  3DXB A;  1USB A;  3HZ4 A;  1GLQ A;  2VD1 A;  2LQO A;  5DVB A;  3VWW A;  1PKW A;  3FZA A;  5CRE A;  5D8I A;  2L5O A;  4F0C A;  3D4T A;  4EKZ A;  2F9S A;  2IIY A;  2JZT A;  1OC9 B;  1WWJ A;  2FNO A;  1SEN A;  3LG6 A;  4GWR A;  2LV3 A;  4I5Q A;  4ACS A;  4ECC A;  3TKS E;  3ZVJ D;  1V9W A;  2CX4 A;  4MLY A;  3IBH A;  2IFQ A;  4F2I A;  2VCZ A;  4WR5 A;  3F3R A;  4N30 A;  3QFA C;  5FT3 A;  1EWX A;  3FKF A;  3ZML A;  6GST A;  2FWF A;  4ZB9 A;  2I1U A;  1R4W A;  3LGC A;  1ERT A;  4JED A;  2PER A;  3EU3 A;  5A5K A;  3ZYW A;  2TRC P;  5D9W A;  1AUC A;  1K0O A;  5EVO A;  1DUG A;  5KEJ A;  2EIQ A;  1TKD B;  3HYP A;  2YJ7 A;  1TTZ A;  3G9B A;  1LBK A;  3GKN A;  3I43 A;  4O7H A;  2C80 A;  3UBK A;  1XWA A;  2C4J A;  1B4Q A;  4ID0 A;  3F63 A;  5G2Z A;  4KAE A;  4HS1 A;  1A2L A;  3ZIV A;  4X0X A;  3ZVJ A;  4MK3 A;  2H76 A;  1MEK A;  4HU7 A;  5CRG A;  2LJR A;  5IPH A;  3EC3 A;  2RLI A;  4HU9 A;  1F9M A;  1FVJ A;  3A2V A;  4L5L A;  2Z9S A;  1VGL A;  2V32 A;  1RQM A;  2O8V B;  3EWL A;  3C7M A;  3ZIT A;  3GV1 A;  2N5F A;  1T4Z A;  2L4C A;  4HUA A;  4EO3 A;  5DQS A;  2WB9 A;  3UEM A;  1SL0 B;  4WBJ A;  1FB0 A;  4LMW A;  1XPV A;  3J7Y k;  3CSH A;  2GZY A;  2H30 A;  2B1L A;  2MBT A;  3RBT A;  2WRT A;  2REM A;  4ECB A;  2OBI A;  3ERW A;  1Z7R A;  3IA1 A;  5KN1 A;  4EUY A;  3E0U A;  8GSS A;  2VCW A;  2QC7 A;  4YH2 A;  1WP0 A;  1EV4 A;  3O6T A;  2HLS A;  3QMX A;  5GAN D;  5CRH A;  4HJM A;  13GS A;  1GRX A;  2H6X A;  4IP6 A;  2I3Y A;  2TIR A;  1Z6M A;  3KGK A;  4NV2 A;  1OVN A;  2ES7 A;  2R5G A;  4YQU A;  4BVX A;  1XOB A;  4IHU A;  2DIZ A;  3C8E A;  4KGI A;  2C0G A;  1K0M A;  5HR0 A;  1Z5Y E;  2FA4 A;  3TOU A;  2GSS A;  3A5W A;  4HOJ A;  1HNB A;  4DSR A;  1EOG A;  3GFK A;  3IAS 2;  5D73 A;  4LMV A;  5IM9 A;  3FR3 A;  2X8G A;  2JAC A;  1ST9 A;  4ZBB A;  1PA3 A;  2IN3 A;  3ME7 A;  1O85 A;  3IAM 2;  5AN1 A;  4AJ8 A;  2OBK A;  4I2U A;  1YDK A;  1ERW A;  1XWC A;  4AJ7 A;  4ZL9 A;  1B9X C;  2HT9 A;  3APQ A;  3LSZ A;  1KTE A;  3F8U A;  4XRA A;  1A8L A;  3D0Z A;  4NAX A;  2FUG 2;  2E7P A;  3TJB A;  2HYX A;  1SK2 A;  2N5B A; 
#chains in the Genus database with same CATH topology
 3IK9 A;  5IMZ A;  2PMT A;  3ISO A;  4OO5 A;  4WR4 A;  4KCE A;  3HVX A;  4GCI A;  3D21 A;  3WT2 A;  3MYD A;  5JWR B;  4OCE A;  1SU9 A;  4NV5 A;  2H75 A;  3FMW A;  4TRX A;  1K0D A;  2HRK A;  4XS4 B;  3APO A;  1TRS A;  2L5L A;  4DEJ A;  16GS A;  4G9H A;  1WE0 A;  3PR8 A;  4RQR A;  2CA8 A;  3ERF A;  2H6Y A;  3CTF A;  3WGE A;  2YZU A;  3EVI A;  4EIQ A;  5GST A;  1ON4 A;  1O8W A;  5D93 A;  4MPG A;  2D2Z A;  1ERV A;  1Q98 A;  4QL9 A;  1FVK A;  4ML6 A;  3W6G A;  4HZ4 A;  2H1B A;  4IP1 A;  2C3Q A;  5FHI A;  2HSH A;  3G7I A;  4ULX A;  4HQS A;  3VPT A;  1WOU A;  4J2F A;  5ECR B;  2IMI A;  5ELG A;  2AUV A;  2OA7 A;  5ECO B;  1AQX A;  3HVV A;  2LKU A;  1I5G A;  2VL2 A;  4BVY A;  2AB6 A;  4FYC A;  1TK0 B;  2HNL A;  4L5O A;  1QFN A;  4TR4 A;  4GTU A;  1UA5 A;  5B8B A;  1RK4 A;  3HKR A;  1WRY A;  3QAW A;  3GUR A;  4YKG A;  3L0H A;  1Z7P A;  1T7P B;  5DAL B;  4IW9 A;  3F4S A;  5IPG A;  3M3M A;  4GF0 A;  4IJ3 A;  4MF5 A;  5KN3 A;  2XC2 A;  4LL1 B;  5DJL A;  1XWG A;  1X9S B;  2YOI A;  1BAY A;  2I81 A;  1XW9 A;  3E9J B;  4GQC A;  1MTC A;  2H1G A;  1O81 A;  2P5R A;  4Q5R A;  4TW5 A;  5ID2 A;  5AIV A;  1TU7 A;  4BL7 B;  5BMU A;  3TJK A;  4KX4 A;  1CQG A;  3ZIJ A;  4P3Y B;  3P8W A;  5A4W A;  1BG5 A;  1MDK A;  3TRQ A;  2CZ3 A;  5LNK e;  5F0G A;  1EEM A;  4OMV A;  3HXS A;  2C1Y A;  5G5E A;  1V98 A;  4TR1 A;  1ZCP A;  1TDI A;  4K8M A;  5GSS A;  1ZZY A;  3GMF A;  2LRT A;  4K1F A;  5C00 A;  4YAV A;  4JR4 A;  4CHS A;  5C04 A;  2CAQ A;  5JCW A;  5GAP D;  1AIU A;  4GRF A;  4HDE A;  1DBY A;  4K7N A;  4MNN A;  2YWM A;  2WS2 A;  3GN3 A;  1O73 A;  4LL4 B;  1U87 A;  4MP4 A;  4ILF A;  5B6M A;  4E8E A;  3FZ5 A;  1PKZ A;  5IMF A;  1PN9 A;  2R0P A;  5G1K A;  2R4V A;  3M8N A;  1XG8 A;  3KMO A;  4I2T A;  2M72 A;  1ML6 A;  2VM1 A;  2HE3 A;  2CQ9 A;  5IQY A;  6GSW A;  2H8L A;  1GSQ A;  5GZZ B;  3GL3 A;  3M9K A;  3IDV A;  5J9B A;  1XWK A;  2GQM A;  1LU4 A;  3CYN A;  4CY8 A;  3H93 A;  2PPT A;  4PX1 A;  1WPI A;  1DSB A;  3IPZ A;  2WDU A;  3TKP A;  2YPM A;  1MDJ A;  1A23 A;  4ZIL A;  5AIS A;  4N10 A;  3HCZ A;  3QD9 A;  3TKR A;  1YEP A;  5AIX A;  1Q4J A;  5D9T A;  4MJC A;  4HI7 A;  4TXO B;  2LRC A;  2PU9 C;  2WZ9 A;  1OC9 A;  3IRA A;  4IEL A;  4NPB A;  4MF7 A;  4MZW A;  1OC3 A;  2FWH A;  2BJX A;  3HVN A;  4F82 A;  1NM3 A;  4Z2R A;  2DIY A;  2R2J A;  1TP9 A;  2DJJ A;  4IBP A;  4JZQ A;  2YP6 A;  1TW9 A;  4BIK A;  2B1K A;  4X4J A;  2GST A;  1I9D A;  4N0V A;  1GLP A;  4TOP A;  1M0U A;  2ZCT A;  4E8H A;  1PMT A;  3O76 A;  4HZ2 A;  4OFN A;  1PD2 1;  4POK A;  4K2D A;  4IGJ A;  2JAD A;  1SL1 B;  1XVW A;  2JZR A;  4H86 A;  2PVO C;  2P31 A;  4EF0 A;  4PUR A;  4Q5Q A;  3TOT A;  2ALB A;  3HHV A;  3VWU A;  3WD6 A;  3Q18 A;  3M1G A;  2HI7 A;  4N11 A;  1GUL A;  1B8X A;  1TRV A;  2GVP A;  2MBS A;  1EEJ A;  1Z6N A;  2NDO A;  3M9J A;  3CRU A;  1WMJ A;  3GKK A;  4OFT A;  1NHY A;  1OE8 A;  1SD9 A;  3V1W A;  3BCK A;  1S3D A;  1YZX A;  4V2M A;  1G0T A;  2K8S A;  1G7O A;  2VO4 A;  3CSJ A;  1T4Y A;  3GX8 A;  1FHE A;  2H0I A;  1F6M C;  1PL2 A;  11GS A;  2XBI A;  1Y25 A;  2C0D A;  3G7J A;  5JWQ B;  5IO2 A;  3LJR A;  2GDR A;  1TJD A;  3PH9 A;  1K0B A;  1J08 A;  2DSA A;  3HY2 A;  5IO0 A;  1W89 A;  2LNS A;  3ZZX A;  3TDG A;  1NW2 A;  5ECN B;  4XS1 A;  2YAN A;  4G2E A;  4TR0 A;  3VI5 A;  4MZC A;  6GSV A;  3US3 A;  2EIO A;  2LRN A;  2YCD A;  4EL1 A;  2YN1 A;  2NTO A;  3U5R E;  4ECJ A;  2C8U A;  3CTG A;  5ENU A;  1JFU A;  2HSM A;  6GSX A;  4QQ7 A;  3GH6 A;  3H79 A;  2HSY A;  2K6V A;  2QGV A;  1R5A A;  4KCA A;  1V40 A;  3WYW A;  1MD3 A;  1K0A A;  3VI7 A;  4D73 B;  2YNX A;  2X8H A;  5A4U A;  1R5P A;  3IE3 A;  2VD0 A;  2YWI A;  3FHK A;  1F2E A;  3L4N A;  2B7J A;  3P90 A;  3TKS C;  3FY7 A;  3BCI A;  3D4M A;  2MMA A;  4OFM A;  3SBC A;  3EMP A;  1QXH A;  3L9U A;  4JBB A;  1THX A;  4JU5 A;  3TRP A;  4ZXG A;  1GTA A;  3KH7 A;  4HEA 2;  1FOV A;  3TJF A;  4TR3 A;  3GNJ A;  2E2M A;  3KIJ A;  4V1A p;  1SJ6 A;  2VIM A;  1OYJ A;  5F06 A;  4GSN A;  3O3T A;  3RPP A;  2P0G A;  4ZBD A;  4K5S A;  4K2X A;  2OE0 A;  5J41 A;  3R2Q A;  3KZQ A;  3UAR A;  3U6V A;  1W4V A;  5JWO B;  3TJJ A;  4L0W A;  3VPQ A;  3C1S A;  3P2A A;  4G0I A;  1VF4 A;  1EP8 A;  4X43 A;  1ZYQ B;  3ZFL A;  1G7E A;  1RW1 A;  2IFQ B;  1PN0 A;  2LNT A;  4O32 A;  4MF6 A;  1JLW A;  3QCP A;  2C0F A;  2GS3 A;  1GNE A;  3VFI A;  3I9V 2;  2FLS A;  1BQ7 A;  2VL9 A;  2GZP A;  3GIX A;  4MH2 A;  1GSD A;  4IVF A;  3EU4 A;  3LXT A;  1XVQ A;  4Q5N A;  3QOU A;  4MJA A;  3EPT A;  4IQ1 A;  1A24 A;  1SYR A;  2V41 A;  1F37 A;  2J23 A;  1AAZ A;  3DVW A;  5INY A;  1EGR A;  4GST A;  3WT1 A;  1NSW A;  2FD3 A;  3UAP A;  3KEB A;  4G19 A;  4AJ6 A;  3L9V A;  4L0U A;  2VLV A;  1K3Y A;  3RAZ A;  2YV7 A;  2X99 A;  3RPN A;  5H5S A;  1H75 A;  3KP8 A;  4IJI A;  1TI1 A;  3ED3 A;  2IME A;  3DML A;  3DKS A;  1GTI A;  4PQI A;  2AAW A;  2HZF A;  1XZO A;  4OD7 A;  3ZMK A;  3LQ7 A;  2EC4 A;  4ECI A;  3FR9 A;  2VCT A;  3RHC A;  5CAX A;  1ABA A;  1V57 A;  3A3T A;  1EOH A;  4XRD A;  1F3B A;  5E59 A;  2HZE B;  3BOA A;  4MJE A;  1N8J A;  5DCG A;  4ZIJ A;  4TXV A;  1M9B A;  2H1A A;  3KCM A;  4POM A;  3NIV A;  3CRT A;  4MPF A;  5JCU A;  2HRA A;  2KUC A;  2VCX A;  3H4K A;  2CV4 A;  1EP7 A;  4KND A;  2A4V A;  2I4A A;  1TOF A;  2YJH A;  1K3O A;  4NWY A;  5G5F A;  4KE3 A;  5ECH B;  4PQH A;  4WKW A;  2V6O A;  2H6Z A;  3DD3 A;  2DKH A;  3E3E A;  1M2A A;  3QR6 A;  1GUH A;  2H72 A;  2HFD A;  2RII A;  19GS A;  2GGT A;  2JU5 A;  1KBN A;  3F6D A;  3UOM A;  2FY6 A;  2AYT A;  4EDY A;  1M2D A;  3LXZ A;  2VUP A;  2KP2 A;  3HJP A;  3IK7 A;  1YF1 A;  1YKA A;  2DBC A;  4WET A;  4HSC X;  4RUV A;  1CQH A;  5LD0 A;  2IWT A;  3D5J A;  4POB A;  2HRF A;  4KUN A;  1XBS A;  3NOF A;  1TK8 B;  4KSM A;  2H66 A;  4K6X A;  1TRW A;  2OE3 A;  4F9Z A;  2DML A;  3CSI A;  3WGX A;  3TJG A;  1XFL A;  2VLT A;  2FWE A;  1GP1 A;  4I97 A;  3UBL A;  1QUW A;  2GQK A;  2KOK A;  5IMA A;  2GLR A;  3VLN A;  3KMN A;  3OR5 A;  2PWJ A;  1X9W B;  1LJR A;  3I69 A;  4I6X A;  1EZK A;  2VOC A;  5LCZ A;  3FEU A;  2EIR A;  1B4P A;  2JSZ A;  4MH3 A;  4POL A;  3M0F A;  5DCH A;  1BX9 A;  4CDO A;  3K8N A;  3F6F A;  1PGT A;  3GST A;  4RQX A;  5B6N A;  1GSS A;  3Q74 A;  2IPA A;  2GSQ A;  4MJB A;  1JZD A;  1YJ6 A;  5IOX A;  4ML1 A;  4LA1 A;  1A8Y A;  1H4O A;  22GS A;  5HR1 A;  2H0H A;  4TXO A;  3IHQ A;  2OAD A;  3EMX A;  1FB6 A;  1BJX A;  4KF9 A;  2JSY A;  4MZB A;  1Z3E A;  5B7C A;  1ILO A;  1T8E B;  4KW6 A;  2OE1 A;  5DAK A;  4OO4 A;  1UN2 A;  5EL8 A;  1PRX A;  3G7Y A;  5J5N A;  3QAG A;  2ZNM A;  1X5C A;  4TN8 A;  3Q19 A;  3EE2 A;  2R6K A;  4NHZ A;  2FCH A;  1E2Y A;  2PVQ A;  3BJ5 A;  4K0N A;  2L59 A;  3GKX A;  4N0Z A;  5FWG A;  2H73 A;  3Q6O A;  1FO5 A;  1PL1 A;  2YWN A;  3DGQ A;  4XIH A;  5CRW A;  3KM6 A;  2DMM A;  3H1N A;  1FW1 A;  4KDU A;  1HNC A;  3PIN A;  1PFO A;  1SK1 A;  4JE1 A;  4XS6 A;  1N2A A;  3UL3 A;  4YQV A;  5ID2 B;  3PPU A;  2X8C A;  1IYH A;  2PGT A;  1T3B A;  1MDI A;  1OKD A;  1ZYN A;  3FZ9 A;  1FAA A;  1MD4 A;  4EC0 A;  2F8A A;  4FYU A;  1JHB A;  1XIY A;  1PQN A;  4O92 A;  4O5U A;  5F07 A;  2E0Q A;  2O89 A;  2IJY A;  2XHF A;  2GQL A;  3GSS A;  12GS A;  3DYR A;  3LOR A;  7GSS A;  2F8F A;  2H01 A;  3TCO A;  2KP1 A;  4MCU A;  4ICY A;  4DVC A;  2LTK A;  1GTU A;  1B48 A;  4FYB A;  1YKC A;  3FYG A;  5G31 A;  2DC5 A;  3GTU B;  2JZS A;  2LS5 A;  1EV9 A;  4PTS A;  3MAK A;  5IMD A;  4PNG A;  5F8B A;  4MDC A;  2YV9 A;  3LW9 A;  1T00 A;  2L6D A;  4MAB A;  1PX6 A;  4NHW A;  3S9F A;  3D22 A;  1GH2 A;  5ECK B;  1GSU A;  3CXG A;  3IOS A;  1X5E A;  3TKS A;  5IMV A;  1THO A;  3VK9 A;  2BMX A;  2A2P A;  1SKR B;  5DQY A;  1K0N A;  1ZOF A;  4XTS A;  2L57 A;  4IQA A;  3APS A;  1V2A A;  2RM5 A;  1TXX A;  1U3I A;  1ZL9 A;  3EIN A;  2G0F A;  3UJ1 A;  3TGZ A;  3N5O A;  4K7I A;  3GA4 A;  2DLX A;  3L78 A;  4F03 A;  2B7K A;  2FWG A;  3MNG A;  2KHP A;  2QA2 A;  5G1L A;  2WGR A;  1OKT A;  5CO3 A;  2NBS A;  4OCF A;  3IV4 A;  2K18 A;  1S3C A;  4CY6 A;  2CAI A;  2GT6 A;  4YAP A;  2LEG A;  3FK8 A;  1F3A A;  3FR6 A;  1VF1 A;  2CVD A;  2FGX A;  4J57 E;  5CYY A;  4JRR A;  5EY6 A;  4V2N A;  4YQM A;  4GQF A;  2JL4 A;  1A0F A;  4ZBA A;  2LST A;  2MMN A;  3F4R A;  3KXO A;  5COH A;  5A4V A;  2WFC A;  2GZZ A;  1SL2 B;  4WEY A;  4RI7 A;  4K0G A;  4CW9 A;  2H0G A;  1WIK A;  5ELA A;  2FA8 A;  1JLV A;  3IC8 A;  3KTL A;  4FO5 A;  1SK0 A;  4DSS B;  2CVK A;  3DVX A;  4XCS A;  5D9X A;  2B3S A;  2VCV A;  3VWV A;  3QAV A;  4KSO A;  3DEX A;  3ZL5 A;  2LQQ A;  2LJK A;  3D6I A;  1G6Y A;  3TKQ A;  2VAF A;  2OJL A;  1XOA A;  2P5Q A;  2C3N A;  2XPD A;  1TRU A;  5D9V A;  3LYP A;  4HQZ A;  1TK5 B;  2CX3 A;  1M99 A;  1GTB A;  4X1U A;  1XW5 A;  4FH8 A;  2WCI A;  4GXZ A;  2O7K A;  1BED A;  5HFK A;  3GRX A;  3QFB C;  3GHA A;  3W8J A;  1X9M B;  2HZE A;  3RHB A;  4PUA A;  1C72 A;  5F05 A;  4G10 A;  3F4T A;  5H5R A;  2VCQ A;  2V1M A;  1UC7 A;  3NZN A;  1XW6 A;  1U6T A;  1S3A A;  2B5X A;  4XS4 A;  1B9Y C;  2DJ3 A;  4PGT A;  1A2M A;  1VRS D;  1ZYE A;  2LJA A;  1M2B A;  2DJ1 A;  1R26 A;  2ON5 A;  2NVL A;  3A2X A;  5B8A A;  2OAC A;  3I6A A;  1TI3 A;  2VL3 A;  2X4A A;  4WF4 A;  5CP1 A;  2WJU A;  2V6K A;  4WXT A;  3FZ4 A;  4HJ2 A;  4PUF C;  3MWH A;  2GSR A;  5ECL B;  3VWX A;  4DSQ A;  1YY7 A;  3HJM A;  3CQF A;  5J4U A;  1AW9 A;  3H8Q A;  4KB3 A;  2A2S A;  2IL3 A;  2MYG A;  3MSZ A;  5HFI A;  2DJK A;  2H74 A;  4AF2 A;  1M3J A;  3N9J A;  2L4Q A;  1QQ2 A;  2H1D A;  1A0R P;  2IMK A;  5J3R A;  3P7X A;  1X5D A;  1SKW B;  5D96 A;  2YWO A;  3F0I A;  4WF5 A;  1R7H A;  3KTB A;  4OWY A;  4EDZ A;  1K3L A;  1OE7 A;  3EYT A;  4EVM A;  2IMF A;  1PX7 A;  2VM2 A;  3EUR A;  4LLR A;  3SWL A;  1QGV A;  3C71 A;  1JZW A;  5DAL A;  1SJZ A;  20GS A;  2B5Y A;  3LFL A;  1KEB A;  2PBJ A;  4IS0 A;  3W8S A;  3LYK A;  4EE0 A;  2F51 A;  1VF2 A;  4NMU A;  1TU8 A;  4PNF A;  4V1A g;  5IOW A;  2C3T A;  5KN0 A;  2X49 A;  1AXD A;  4K5R A;  5H5Q A;  3TRX A;  3ME8 A;  1HD2 A;  4TVE A;  4BL7 A;  1GSF A;  2A2R A;  1GUK A;  5IMC A;  1AQV A;  4O5Q A;  4MMM A;  2H19 A;  1U88 A;  3MDK A;  4GSS A;  1IYI A;  1OAZ A;  2RUF A;  4JR6 A;  4Z2U A;  2HXK A;  4BVX B;  4GLT A;  4PXO A;  2F3M A;  3BBY A;  4EIP A;  2K8V A;  3ZTL A;  1VF3 A;  5HR3 A;  2MMZ A;  1JZR A;  3AY8 A;  3GYK A;  3QDN A;  4A5P A;  4BPY A;  14GS A;  4F0B A;  2AV4 A;  3TUE A;  4BA7 A;  2G2Q A;  1GNW A;  1GUM A;  5J9C A;  2L6C A;  2QSI A;  4PQ1 A;  2HRN A;  4KA0 A;  4J56 E;  4Z7X A;  5E4W A;  2VLU A;  4AGS A;  4ZB8 A;  6GSY A;  3GKM A;  2B5E A;  5KOW A;  3VUR A;  1U3A A;  3DWV A;  1O8X A;  3BD2 A;  2M46 A;  2YZH A;  2O87 A;  5KN2 A;  3PGT A;  2TRX A;  3LEF A;  3HD5 A;  1QMV A;  3IHG A;  6GSU A;  4I8B A;  4EXJ A;  3DIE A;  2GTU A;  1Z9H A;  2FHE A;  2CT6 A;  4ZB6 A;  4V2L A;  1WJK A;  2R37 A;  2WUL A;  2AJQ B;  3UVT A;  18GS A;  9GSS A;  2H71 A;  2DJ0 A;  1SKS B;  2RM6 A;  3ERG A;  1K0C A;  4XHM A;  2IMD A;  2GT5 A;  3J7Y b;  5HR2 A;  1ZMA A;  5ECQ B;  3GH9 A;  1SYX A;  4KH7 A;  2DJ2 A;  1O6J A;  5DBQ A;  3IXR A;  3JCM L;  5ECP B;  2QKE A;  1BYE A;  1YF0 A;  4BWQ A;  2PUK C;  4BVY B;  1XWB A;  5L71 A;  4TKY A;  6GSS A;  3ZRE A;  5AGY A;  2VL2 C;  2ZUP A;  3ZRD A;  2E2G A;  2V2G A;  4KDY A;  1M3I A;  3HA9 A;  3GTU A;  2A4H A;  2ON7 A;  4IN0 A;  2MZC A;  2NPB A;  5ECI B;  3GX0 A;  1QK8 A;  1E6B A;  3C73 A;  5IIZ A;  1PSQ A;  1DE2 A;  3F3Q A;  1GWC A;  1G6W A;  3UIW A;  5CRD A;  1OC8 A;  2XPE A;  1ERU A;  3C1R A;  4ISD A;  4ZL8 A;  4BWS A;  4G0K A;  1URM A;  5CNW A;  1SJI A;  3HJO A;  2PN8 A;  3F9U A;  2R3X A;  4Q5F A;  3KD0 A;  3A5I A;  2C0E A;  4WBR D;  1T1V A;  5ABR A;  5HFG A;  1GL8 A;  1DE1 A;  1GSY A;  3CBU A;  1NHO A;  1KNG A;  3GL5 A;  2QA1 A;  1HQO A;  2BTO T;  4ZL7 A;  2CVB A;  1HNA A;  4L8E A;  3HVS A;  3HDC A;  3ZFB A;  1Y6E A;  3UVH A;  2XBQ A;  4TR1 B;  3WGD A;  4K9Z A;  4FIW A;  3TB2 A;  3LWA A;  1UVZ A;  5G30 A;  2X64 A;  1M9A A;  5DJM A;  1JZO A;  4YKF A;  1J0F A;  1ACV A;  3CMI A;  3A2W A;  1ZGN A;  2M80 A;  1YEX A;  5JCG A;  1ZYP A;  4NXI A;  3RDW A;  3DRN A;  3UMA A;  2O85 A;  2I9H A;  3MIX A;  3QPM A;  5DAK B;  1A2J A;  4K7O A;  5ECM B;  4RI6 A;  2K9F A;  2J9H A;  1GSE A;  17GS A;  2AHE A;  1AQW A;  4O5R A;  2N5A A;  1FG4 A;  10GS A;  3KP9 A;  1EGO A;  5ECS A;  1XCC A;  2KLX A;  2OKA A;  3GUS A;  1V58 A;  4QL7 A;  1M7T A;  3KJY A;  4D73 A;  1HYU A;  3HZ8 A;  5DDL A;  1J9B A;  3FW2 A;  1YQ1 A;  4DSS A;  3ZLP A;  2H70 A;  2B6M A;  4IKH A;  5HQP A;  5EPF A;  3KH9 A;  1SD8 A;  2RUE A;  3L9S A;  3IR4 A;  1X0R A;  1XXU A;  1O7U A;  4KDX A;  3IC4 A;  1AC1 A;  2LUS A;  2MMO A;  3FRC A;  2CZ2 A;  4MA9 A;  3DXB A;  1USB A;  3HZ4 A;  1GLQ A;  2VD1 A;  2LQO A;  5DVB A;  3VWW A;  1PKW A;  3FZA A;  5CRE A;  5D8I A;  2L5O A;  4F0C A;  3D4T A;  4EKZ A;  2F9S A;  2IIY A;  2JZT A;  1OC9 B;  1WWJ A;  2FNO A;  1SEN A;  3LG6 A;  4GWR A;  2LV3 A;  4I5Q A;  4ACS A;  4ECC A;  3TKS E;  3ZVJ D;  2R0G A;  1V9W A;  2CX4 A;  4MLY A;  3IBH A;  2R0C A;  2IFQ A;  4F2I A;  2VCZ A;  4WR5 A;  3F3R A;  4N30 A;  3QFA C;  5FT3 A;  1EWX A;  3FKF A;  3ZML A;  6GST A;  2FWF A;  4ZB9 A;  2DKI A;  2I1U A;  1R4W A;  3LGC A;  1ERT A;  4JED A;  2PER A;  3EU3 A;  5A5K A;  3ZYW A;  2TRC P;  5D9W A;  1AUC A;  1K0O A;  5EVO A;  1DUG A;  5KEJ A;  2EIQ A;  1TKD B;  3HYP A;  2YJ7 A;  1TTZ A;  3G9B A;  1LBK A;  3GKN A;  3I43 A;  4O7H A;  2C80 A;  5BRT A;  1FOH A;  3UBK A;  1XWA A;  2C4J A;  1B4Q A;  4ID0 A;  3F63 A;  5G2Z A;  4KAE A;  4HS1 A;  1A2L A;  3ZIV A;  4X0X A;  3ZVJ A;  2UZ8 A;  4MK3 A;  4G0L A;  2H76 A;  1MEK A;  4HU7 A;  5CRG A;  2LJR A;  5IPH A;  3EC3 A;  2RLI A;  4HU9 A;  1F9M A;  1FVJ A;  3A2V A;  4L5L A;  2Z9S A;  1VGL A;  2V32 A;  1RQM A;  2O8V B;  3EWL A;  3C7M A;  3ZIT A;  3GV1 A;  2N5F A;  1T4Z A;  2L4C A;  4HUA A;  4EO3 A;  5DQS A;  2WB9 A;  3UEM A;  1SL0 B;  4WBJ A;  1FB0 A;  4LMW A;  1XPV A;  3J7Y k;  3CSH A;  2GZY A;  2H30 A;  2B1L A;  2MBT A;  3RBT A;  2WRT A;  2REM A;  4ECB A;  2OBI A;  3ERW A;  1Z7R A;  3IA1 A;  5KN1 A;  4EUY A;  3E0U A;  8GSS A;  2VCW A;  2QC7 A;  4YH2 A;  1WP0 A;  1EV4 A;  3O6T A;  4USS A;  2HLS A;  3QMX A;  5GAN D;  5CRH A;  4HJM A;  13GS A;  1GRX A;  2H6X A;  4IP6 A;  2I3Y A;  2TIR A;  1Z6M A;  3KGK A;  4NV2 A;  1OVN A;  2ES7 A;  2R5G A;  4YQU A;  4BVX A;  1XOB A;  4IHU A;  2DIZ A;  3C8E A;  4KGI A;  2C0G A;  1K0M A;  5KOX A;  4Z2T A;  5HR0 A;  1Z5Y E;  2FA4 A;  3TOU A;  2GSS A;  3A5W A;  4HOJ A;  1HNB A;  4DSR A;  1EOG A;  3GFK A;  3IAS 2;  5D73 A;  1S3R A;  4LMV A;  5IM9 A;  3FR3 A;  2X8G A;  2JAC A;  1ST9 A;  4ZBB A;  1PA3 A;  2IN3 A;  3ME7 A;  3R3E A;  1O85 A;  3IAM 2;  5AN1 A;  4AJ8 A;  2OBK A;  4I2U A;  1YDK A;  1ERW A;  1XWC A;  4AJ7 A;  4ZL9 A;  1B9X C;  2HT9 A;  3APQ A;  3LSZ A;  4FQU A;  1KTE A;  3F8U A;  4XRA A;  1A8L A;  3D0Z A;  4NAX A;  2FUG 2;  2E7P A;  3TJB A;  2HYX A;  1SK2 A;  2N5B A; 
#chains in the Genus database with same CATH homology
 3IK9 A;  5IMZ A;  2PMT A;  3ISO A;  4OO5 A;  4WR4 A;  4KCE A;  3HVX A;  4GCI A;  3D21 A;  3WT2 A;  3MYD A;  5JWR B;  4OCE A;  1SU9 A;  4NV5 A;  2H75 A;  3FMW A;  4TRX A;  1K0D A;  2HRK A;  4XS4 B;  3APO A;  1TRS A;  2L5L A;  4DEJ A;  16GS A;  4G9H A;  1WE0 A;  3PR8 A;  4RQR A;  2CA8 A;  3ERF A;  2H6Y A;  3CTF A;  3WGE A;  2YZU A;  3EVI A;  4EIQ A;  5GST A;  1ON4 A;  1O8W A;  5D93 A;  4MPG A;  2D2Z A;  1ERV A;  1Q98 A;  4QL9 A;  1FVK A;  4ML6 A;  3W6G A;  4HZ4 A;  2H1B A;  4IP1 A;  2C3Q A;  5FHI A;  2HSH A;  3G7I A;  4ULX A;  4HQS A;  3VPT A;  1WOU A;  4J2F A;  5ECR B;  2IMI A;  5ELG A;  2AUV A;  2OA7 A;  5ECO B;  1AQX A;  3HVV A;  2LKU A;  1I5G A;  2VL2 A;  4BVY A;  2AB6 A;  4FYC A;  1TK0 B;  2HNL A;  4L5O A;  1QFN A;  4TR4 A;  4GTU A;  1UA5 A;  5B8B A;  1RK4 A;  3HKR A;  1WRY A;  3QAW A;  3GUR A;  4YKG A;  3L0H A;  1Z7P A;  1T7P B;  5DAL B;  4IW9 A;  3F4S A;  5IPG A;  3M3M A;  4GF0 A;  4IJ3 A;  4MF5 A;  5KN3 A;  2XC2 A;  4LL1 B;  5DJL A;  1XWG A;  1X9S B;  2YOI A;  1BAY A;  2I81 A;  1XW9 A;  3E9J B;  4GQC A;  1MTC A;  2H1G A;  1O81 A;  2P5R A;  4Q5R A;  4TW5 A;  5ID2 A;  5AIV A;  1TU7 A;  4BL7 B;  5BMU A;  3TJK A;  4KX4 A;  1CQG A;  3ZIJ A;  4P3Y B;  3P8W A;  5A4W A;  1BG5 A;  1MDK A;  3TRQ A;  2CZ3 A;  5LNK e;  5F0G A;  1EEM A;  4OMV A;  3HXS A;  2C1Y A;  5G5E A;  1V98 A;  4TR1 A;  1ZCP A;  1TDI A;  4K8M A;  5GSS A;  1ZZY A;  3GMF A;  2LRT A;  4K1F A;  5C00 A;  4YAV A;  4JR4 A;  4CHS A;  5C04 A;  2CAQ A;  5JCW A;  5GAP D;  1AIU A;  4GRF A;  4HDE A;  1DBY A;  4K7N A;  4MNN A;  2YWM A;  2WS2 A;  3GN3 A;  1O73 A;  4LL4 B;  1U87 A;  4MP4 A;  4ILF A;  5B6M A;  4E8E A;  3FZ5 A;  1PKZ A;  5IMF A;  1PN9 A;  2R0P A;  5G1K A;  2R4V A;  3M8N A;  3KMO A;  4I2T A;  2M72 A;  1ML6 A;  2VM1 A;  2HE3 A;  2CQ9 A;  5IQY A;  6GSW A;  2H8L A;  1GSQ A;  5GZZ B;  3GL3 A;  3M9K A;  3IDV A;  5J9B A;  1XWK A;  2GQM A;  1LU4 A;  3CYN A;  4CY8 A;  3H93 A;  2PPT A;  4PX1 A;  1WPI A;  1DSB A;  3IPZ A;  2WDU A;  3TKP A;  2YPM A;  1MDJ A;  1A23 A;  4ZIL A;  5AIS A;  4N10 A;  3HCZ A;  3QD9 A;  3TKR A;  1YEP A;  5AIX A;  1Q4J A;  5D9T A;  4MJC A;  4HI7 A;  4TXO B;  2LRC A;  2PU9 C;  2WZ9 A;  1OC9 A;  3IRA A;  4IEL A;  4NPB A;  4MF7 A;  4MZW A;  1OC3 A;  2FWH A;  2BJX A;  4F82 A;  1NM3 A;  4Z2R A;  2DIY A;  2R2J A;  1TP9 A;  2DJJ A;  4IBP A;  4JZQ A;  2YP6 A;  1TW9 A;  2B1K A;  4X4J A;  2GST A;  1I9D A;  4N0V A;  1GLP A;  4TOP A;  1M0U A;  2ZCT A;  4E8H A;  1PMT A;  3O76 A;  4HZ2 A;  4OFN A;  1PD2 1;  4POK A;  4K2D A;  4IGJ A;  2JAD A;  1SL1 B;  1XVW A;  2JZR A;  4H86 A;  2PVO C;  2P31 A;  4EF0 A;  4PUR A;  4Q5Q A;  3TOT A;  2ALB A;  3HHV A;  3VWU A;  3WD6 A;  3Q18 A;  3M1G A;  2HI7 A;  4N11 A;  1GUL A;  1B8X A;  1TRV A;  2GVP A;  2MBS A;  1EEJ A;  1Z6N A;  2NDO A;  3M9J A;  3CRU A;  1WMJ A;  3GKK A;  4OFT A;  1NHY A;  1OE8 A;  1SD9 A;  3V1W A;  3BCK A;  1S3D A;  1YZX A;  4V2M A;  1G0T A;  2K8S A;  1G7O A;  2VO4 A;  3CSJ A;  1T4Y A;  3GX8 A;  1FHE A;  2H0I A;  1F6M C;  1PL2 A;  11GS A;  2XBI A;  1Y25 A;  2C0D A;  3G7J A;  5JWQ B;  5IO2 A;  3LJR A;  2GDR A;  1TJD A;  3PH9 A;  1K0B A;  1J08 A;  2DSA A;  3HY2 A;  5IO0 A;  1W89 A;  2LNS A;  3ZZX A;  3TDG A;  1NW2 A;  5ECN B;  4XS1 A;  2YAN A;  4G2E A;  4TR0 A;  3VI5 A;  4MZC A;  6GSV A;  3US3 A;  2EIO A;  2LRN A;  2YCD A;  4EL1 A;  2YN1 A;  2NTO A;  3U5R E;  4ECJ A;  2C8U A;  3CTG A;  5ENU A;  1JFU A;  2HSM A;  6GSX A;  4QQ7 A;  3GH6 A;  3H79 A;  2HSY A;  2K6V A;  2QGV A;  1R5A A;  4KCA A;  1V40 A;  3WYW A;  1MD3 A;  1K0A A;  3VI7 A;  4D73 B;  2YNX A;  2X8H A;  5A4U A;  1R5P A;  3IE3 A;  2VD0 A;  2YWI A;  3FHK A;  1F2E A;  3L4N A;  2B7J A;  3P90 A;  3TKS C;  3FY7 A;  3BCI A;  3D4M A;  2MMA A;  4OFM A;  3SBC A;  3EMP A;  1QXH A;  3L9U A;  4JBB A;  1THX A;  4JU5 A;  3TRP A;  4ZXG A;  1GTA A;  3KH7 A;  4HEA 2;  1FOV A;  3TJF A;  4TR3 A;  3GNJ A;  2E2M A;  3KIJ A;  4V1A p;  1SJ6 A;  2VIM A;  1OYJ A;  5F06 A;  4GSN A;  3O3T A;  3RPP A;  2P0G A;  4ZBD A;  4K5S A;  4K2X A;  2OE0 A;  5J41 A;  3R2Q A;  3KZQ A;  3UAR A;  3U6V A;  1W4V A;  5JWO B;  3TJJ A;  4L0W A;  3VPQ A;  3C1S A;  3P2A A;  4G0I A;  1VF4 A;  1EP8 A;  4X43 A;  1ZYQ B;  3ZFL A;  1G7E A;  1RW1 A;  2IFQ B;  1PN0 A;  2LNT A;  4O32 A;  4MF6 A;  1JLW A;  3QCP A;  2C0F A;  2GS3 A;  1GNE A;  3VFI A;  3I9V 2;  2FLS A;  1BQ7 A;  2VL9 A;  2GZP A;  3GIX A;  4MH2 A;  1GSD A;  4IVF A;  3EU4 A;  3LXT A;  1XVQ A;  4Q5N A;  3QOU A;  4MJA A;  3EPT A;  4IQ1 A;  1A24 A;  1SYR A;  2V41 A;  1F37 A;  2J23 A;  1AAZ A;  3DVW A;  5INY A;  1EGR A;  4GST A;  3WT1 A;  1NSW A;  2FD3 A;  3UAP A;  3KEB A;  4G19 A;  4AJ6 A;  3L9V A;  4L0U A;  2VLV A;  1K3Y A;  3RAZ A;  2YV7 A;  2X99 A;  3RPN A;  5H5S A;  1H75 A;  3KP8 A;  4IJI A;  1TI1 A;  3ED3 A;  2IME A;  3DML A;  3DKS A;  1GTI A;  4PQI A;  2AAW A;  2HZF A;  1XZO A;  4OD7 A;  3ZMK A;  3LQ7 A;  2EC4 A;  4ECI A;  3FR9 A;  2VCT A;  3RHC A;  5CAX A;  1ABA A;  1V57 A;  3A3T A;  1EOH A;  4XRD A;  1F3B A;  5E59 A;  2HZE B;  3BOA A;  4MJE A;  1N8J A;  5DCG A;  4ZIJ A;  4TXV A;  1M9B A;  2H1A A;  3KCM A;  4POM A;  3NIV A;  3CRT A;  4MPF A;  5JCU A;  2HRA A;  2KUC A;  2VCX A;  3H4K A;  2CV4 A;  1EP7 A;  4KND A;  2A4V A;  2I4A A;  1TOF A;  2YJH A;  1K3O A;  4NWY A;  5G5F A;  4KE3 A;  5ECH B;  4PQH A;  4WKW A;  2V6O A;  2H6Z A;  3DD3 A;  2DKH A;  3E3E A;  1M2A A;  3QR6 A;  1GUH A;  2H72 A;  2HFD A;  2RII A;  19GS A;  2GGT A;  2JU5 A;  1KBN A;  3F6D A;  3UOM A;  2FY6 A;  2AYT A;  4EDY A;  1M2D A;  3LXZ A;  2VUP A;  2KP2 A;  3HJP A;  3IK7 A;  1YF1 A;  1YKA A;  2DBC A;  4WET A;  4RUV A;  1CQH A;  5LD0 A;  2IWT A;  3D5J A;  4POB A;  2HRF A;  4KUN A;  1XBS A;  3NOF A;  1TK8 B;  4KSM A;  2H66 A;  4K6X A;  1TRW A;  2OE3 A;  4F9Z A;  2DML A;  3CSI A;  3WGX A;  3TJG A;  1XFL A;  2VLT A;  2FWE A;  1GP1 A;  4I97 A;  3UBL A;  1QUW A;  2GQK A;  2KOK A;  5IMA A;  2GLR A;  3VLN A;  3KMN A;  3OR5 A;  2PWJ A;  1X9W B;  1LJR A;  3I69 A;  4I6X A;  1EZK A;  2VOC A;  5LCZ A;  3FEU A;  2EIR A;  1B4P A;  2JSZ A;  4MH3 A;  4POL A;  3M0F A;  5DCH A;  1BX9 A;  4CDO A;  3K8N A;  3F6F A;  1PGT A;  3GST A;  4RQX A;  5B6N A;  1GSS A;  3Q74 A;  2IPA A;  2GSQ A;  4MJB A;  1JZD A;  1YJ6 A;  5IOX A;  4ML1 A;  4LA1 A;  1A8Y A;  1H4O A;  22GS A;  5HR1 A;  2H0H A;  4TXO A;  3IHQ A;  2OAD A;  3EMX A;  1FB6 A;  1BJX A;  4KF9 A;  2JSY A;  4MZB A;  1Z3E A;  5B7C A;  1ILO A;  1T8E B;  4KW6 A;  2OE1 A;  5DAK A;  4OO4 A;  1UN2 A;  5EL8 A;  1PRX A;  3G7Y A;  5J5N A;  3QAG A;  2ZNM A;  1X5C A;  4TN8 A;  3Q19 A;  3EE2 A;  2R6K A;  4NHZ A;  2FCH A;  1E2Y A;  2PVQ A;  3BJ5 A;  4K0N A;  2L59 A;  3GKX A;  4N0Z A;  5FWG A;  2H73 A;  3Q6O A;  1FO5 A;  1PL1 A;  2YWN A;  3DGQ A;  4XIH A;  5CRW A;  3KM6 A;  2DMM A;  3H1N A;  1FW1 A;  4KDU A;  1HNC A;  3PIN A;  1SK1 A;  4JE1 A;  4XS6 A;  1N2A A;  3UL3 A;  4YQV A;  5ID2 B;  3PPU A;  2X8C A;  1IYH A;  2PGT A;  1T3B A;  1MDI A;  1OKD A;  1ZYN A;  3FZ9 A;  1FAA A;  1MD4 A;  4EC0 A;  2F8A A;  4FYU A;  1JHB A;  1XIY A;  1PQN A;  4O92 A;  4O5U A;  5F07 A;  2E0Q A;  2O89 A;  2IJY A;  2XHF A;  2GQL A;  3GSS A;  12GS A;  3DYR A;  3LOR A;  7GSS A;  2F8F A;  2H01 A;  3TCO A;  2KP1 A;  4MCU A;  4ICY A;  4DVC A;  2LTK A;  1GTU A;  1B48 A;  4FYB A;  1YKC A;  3FYG A;  5G31 A;  2DC5 A;  3GTU B;  2JZS A;  2LS5 A;  1EV9 A;  4PTS A;  3MAK A;  5IMD A;  4PNG A;  5F8B A;  4MDC A;  2YV9 A;  3LW9 A;  1T00 A;  2L6D A;  4MAB A;  1PX6 A;  4NHW A;  3S9F A;  3D22 A;  1GH2 A;  5ECK B;  1GSU A;  3CXG A;  3IOS A;  1X5E A;  3TKS A;  5IMV A;  1THO A;  3VK9 A;  2BMX A;  2A2P A;  1SKR B;  5DQY A;  1K0N A;  1ZOF A;  4XTS A;  2L57 A;  4IQA A;  3APS A;  1V2A A;  2RM5 A;  1TXX A;  1U3I A;  1ZL9 A;  3EIN A;  2G0F A;  3UJ1 A;  3TGZ A;  3N5O A;  4K7I A;  3GA4 A;  2DLX A;  3L78 A;  4F03 A;  2B7K A;  2FWG A;  3MNG A;  2KHP A;  2QA2 A;  5G1L A;  2WGR A;  1OKT A;  5CO3 A;  2NBS A;  4OCF A;  3IV4 A;  2K18 A;  1S3C A;  4CY6 A;  2CAI A;  2GT6 A;  4YAP A;  2LEG A;  3FK8 A;  1F3A A;  3FR6 A;  1VF1 A;  2CVD A;  2FGX A;  4J57 E;  5CYY A;  4JRR A;  5EY6 A;  4V2N A;  4YQM A;  4GQF A;  2JL4 A;  1A0F A;  4ZBA A;  2LST A;  2MMN A;  3F4R A;  3KXO A;  5COH A;  5A4V A;  2WFC A;  2GZZ A;  1SL2 B;  4WEY A;  4RI7 A;  4K0G A;  4CW9 A;  2H0G A;  1WIK A;  5ELA A;  2FA8 A;  1JLV A;  3IC8 A;  3KTL A;  4FO5 A;  1SK0 A;  4DSS B;  2CVK A;  3DVX A;  4XCS A;  5D9X A;  2B3S A;  2VCV A;  3VWV A;  3QAV A;  4KSO A;  3DEX A;  3ZL5 A;  2LQQ A;  2LJK A;  3D6I A;  1G6Y A;  3TKQ A;  2VAF A;  2OJL A;  1XOA A;  2P5Q A;  2C3N A;  2XPD A;  1TRU A;  5D9V A;  3LYP A;  4HQZ A;  1TK5 B;  2CX3 A;  1M99 A;  1GTB A;  4X1U A;  1XW5 A;  4FH8 A;  2WCI A;  4GXZ A;  2O7K A;  1BED A;  5HFK A;  3GRX A;  3QFB C;  3GHA A;  3W8J A;  1X9M B;  2HZE A;  3RHB A;  4PUA A;  1C72 A;  5F05 A;  4G10 A;  3F4T A;  5H5R A;  2VCQ A;  2V1M A;  1UC7 A;  3NZN A;  1XW6 A;  1U6T A;  1S3A A;  2B5X A;  4XS4 A;  1B9Y C;  2DJ3 A;  4PGT A;  1A2M A;  1VRS D;  1ZYE A;  2LJA A;  1M2B A;  2DJ1 A;  1R26 A;  2ON5 A;  2NVL A;  3A2X A;  5B8A A;  2OAC A;  3I6A A;  1TI3 A;  2VL3 A;  2X4A A;  4WF4 A;  5CP1 A;  2WJU A;  2V6K A;  4WXT A;  3FZ4 A;  4HJ2 A;  4PUF C;  3MWH A;  2GSR A;  5ECL B;  3VWX A;  4DSQ A;  1YY7 A;  3HJM A;  5J4U A;  1AW9 A;  3H8Q A;  4KB3 A;  2A2S A;  2IL3 A;  2MYG A;  3MSZ A;  5HFI A;  2DJK A;  2H74 A;  4AF2 A;  3N9J A;  2L4Q A;  1QQ2 A;  2H1D A;  1A0R P;  2IMK A;  5J3R A;  3P7X A;  1X5D A;  1SKW B;  5D96 A;  2YWO A;  3F0I A;  4WF5 A;  1R7H A;  3KTB A;  4OWY A;  4EDZ A;  1K3L A;  1OE7 A;  3EYT A;  4EVM A;  2IMF A;  1PX7 A;  2VM2 A;  3EUR A;  4LLR A;  3SWL A;  1QGV A;  3C71 A;  1JZW A;  5DAL A;  1SJZ A;  20GS A;  2B5Y A;  3LFL A;  1KEB A;  2PBJ A;  4IS0 A;  3W8S A;  3LYK A;  4EE0 A;  2F51 A;  1VF2 A;  4NMU A;  1TU8 A;  4PNF A;  4V1A g;  5IOW A;  2C3T A;  5KN0 A;  2X49 A;  1AXD A;  4K5R A;  5H5Q A;  3TRX A;  3ME8 A;  1HD2 A;  4TVE A;  4BL7 A;  1GSF A;  2A2R A;  1GUK A;  5IMC A;  1AQV A;  4O5Q A;  4MMM A;  2H19 A;  1U88 A;  3MDK A;  4GSS A;  1IYI A;  1OAZ A;  2RUF A;  4JR6 A;  4Z2U A;  2HXK A;  4BVX B;  4GLT A;  4PXO A;  2F3M A;  3BBY A;  4EIP A;  2K8V A;  3ZTL A;  1VF3 A;  5HR3 A;  2MMZ A;  1JZR A;  3AY8 A;  3GYK A;  3QDN A;  4A5P A;  4BPY A;  14GS A;  4F0B A;  2AV4 A;  3TUE A;  4BA7 A;  2G2Q A;  1GNW A;  1GUM A;  5J9C A;  2L6C A;  2QSI A;  4PQ1 A;  2HRN A;  4KA0 A;  4J56 E;  4Z7X A;  5E4W A;  2VLU A;  4AGS A;  4ZB8 A;  6GSY A;  3GKM A;  2B5E A;  5KOW A;  3VUR A;  1U3A A;  3DWV A;  1O8X A;  3BD2 A;  2M46 A;  2YZH A;  2O87 A;  5KN2 A;  3PGT A;  2TRX A;  3LEF A;  3HD5 A;  1QMV A;  3IHG A;  6GSU A;  4I8B A;  4EXJ A;  3DIE A;  2GTU A;  1Z9H A;  2FHE A;  2CT6 A;  4ZB6 A;  4V2L A;  1WJK A;  2R37 A;  2WUL A;  2AJQ B;  3UVT A;  18GS A;  9GSS A;  2H71 A;  2DJ0 A;  1SKS B;  2RM6 A;  3ERG A;  1K0C A;  4XHM A;  2IMD A;  2GT5 A;  3J7Y b;  5HR2 A;  1ZMA A;  5ECQ B;  3GH9 A;  1SYX A;  4KH7 A;  2DJ2 A;  1O6J A;  5DBQ A;  3IXR A;  3JCM L;  5ECP B;  2QKE A;  1BYE A;  1YF0 A;  4BWQ A;  2PUK C;  4BVY B;  1XWB A;  5L71 A;  4TKY A;  6GSS A;  3ZRE A;  5AGY A;  2VL2 C;  2ZUP A;  3ZRD A;  2E2G A;  2V2G A;  4KDY A;  3HA9 A;  3GTU A;  2A4H A;  2ON7 A;  4IN0 A;  2MZC A;  2NPB A;  5ECI B;  3GX0 A;  1QK8 A;  1E6B A;  3C73 A;  5IIZ A;  1PSQ A;  1DE2 A;  3F3Q A;  1GWC A;  1G6W A;  3UIW A;  5CRD A;  1OC8 A;  2XPE A;  1ERU A;  3C1R A;  4ISD A;  4ZL8 A;  4BWS A;  4G0K A;  1URM A;  5CNW A;  1SJI A;  3HJO A;  2PN8 A;  3F9U A;  2R3X A;  4Q5F A;  3KD0 A;  3A5I A;  2C0E A;  4WBR D;  1T1V A;  5ABR A;  5HFG A;  1GL8 A;  1DE1 A;  1GSY A;  3CBU A;  1NHO A;  1KNG A;  3GL5 A;  2QA1 A;  1HQO A;  2BTO T;  4ZL7 A;  2CVB A;  1HNA A;  4L8E A;  3HVS A;  3HDC A;  3ZFB A;  1Y6E A;  3UVH A;  2XBQ A;  4TR1 B;  3WGD A;  4K9Z A;  4FIW A;  3TB2 A;  3LWA A;  1UVZ A;  5G30 A;  2X64 A;  1M9A A;  5DJM A;  1JZO A;  4YKF A;  1J0F A;  1ACV A;  3CMI A;  3A2W A;  1ZGN A;  2M80 A;  1YEX A;  5JCG A;  1ZYP A;  4NXI A;  3RDW A;  3DRN A;  3UMA A;  2O85 A;  2I9H A;  3MIX A;  3QPM A;  5DAK B;  1A2J A;  4K7O A;  5ECM B;  4RI6 A;  2K9F A;  2J9H A;  1GSE A;  17GS A;  2AHE A;  1AQW A;  4O5R A;  2N5A A;  1FG4 A;  10GS A;  3KP9 A;  1EGO A;  5ECS A;  1XCC A;  2KLX A;  2OKA A;  3GUS A;  1V58 A;  4QL7 A;  1M7T A;  3KJY A;  4D73 A;  1HYU A;  3HZ8 A;  5DDL A;  1J9B A;  3FW2 A;  1YQ1 A;  4DSS A;  3ZLP A;  2H70 A;  2B6M A;  4IKH A;  5HQP A;  5EPF A;  3KH9 A;  1SD8 A;  2RUE A;  3L9S A;  3IR4 A;  1X0R A;  1XXU A;  1O7U A;  4KDX A;  3IC4 A;  1AC1 A;  2LUS A;  2MMO A;  3FRC A;  2CZ2 A;  4MA9 A;  3DXB A;  1USB A;  3HZ4 A;  1GLQ A;  2VD1 A;  2LQO A;  5DVB A;  3VWW A;  1PKW A;  3FZA A;  5CRE A;  5D8I A;  2L5O A;  4F0C A;  3D4T A;  4EKZ A;  2F9S A;  2IIY A;  2JZT A;  1OC9 B;  1WWJ A;  2FNO A;  1SEN A;  3LG6 A;  4GWR A;  2LV3 A;  4I5Q A;  4ACS A;  4ECC A;  3TKS E;  3ZVJ D;  2R0G A;  1V9W A;  2CX4 A;  4MLY A;  3IBH A;  2R0C A;  2IFQ A;  4F2I A;  2VCZ A;  4WR5 A;  3F3R A;  4N30 A;  3QFA C;  5FT3 A;  1EWX A;  3FKF A;  3ZML A;  6GST A;  2FWF A;  4ZB9 A;  2DKI A;  2I1U A;  1R4W A;  3LGC A;  1ERT A;  4JED A;  2PER A;  3EU3 A;  5A5K A;  3ZYW A;  2TRC P;  5D9W A;  1AUC A;  1K0O A;  5EVO A;  1DUG A;  5KEJ A;  2EIQ A;  1TKD B;  3HYP A;  2YJ7 A;  1TTZ A;  3G9B A;  1LBK A;  3GKN A;  3I43 A;  4O7H A;  2C80 A;  5BRT A;  1FOH A;  3UBK A;  1XWA A;  2C4J A;  1B4Q A;  4ID0 A;  3F63 A;  5G2Z A;  4KAE A;  4HS1 A;  1A2L A;  3ZIV A;  4X0X A;  3ZVJ A;  2UZ8 A;  4MK3 A;  4G0L A;  2H76 A;  1MEK A;  4HU7 A;  5CRG A;  2LJR A;  5IPH A;  3EC3 A;  2RLI A;  4HU9 A;  1F9M A;  1FVJ A;  3A2V A;  4L5L A;  2Z9S A;  1VGL A;  2V32 A;  1RQM A;  2O8V B;  3EWL A;  3C7M A;  3ZIT A;  3GV1 A;  2N5F A;  1T4Z A;  2L4C A;  4HUA A;  4EO3 A;  5DQS A;  2WB9 A;  3UEM A;  1SL0 B;  4WBJ A;  1FB0 A;  4LMW A;  1XPV A;  3J7Y k;  3CSH A;  2GZY A;  2H30 A;  2B1L A;  2MBT A;  3RBT A;  2WRT A;  2REM A;  4ECB A;  2OBI A;  3ERW A;  1Z7R A;  3IA1 A;  5KN1 A;  4EUY A;  3E0U A;  8GSS A;  2VCW A;  2QC7 A;  4YH2 A;  1WP0 A;  1EV4 A;  3O6T A;  4USS A;  2HLS A;  3QMX A;  5GAN D;  5CRH A;  4HJM A;  13GS A;  1GRX A;  2H6X A;  4IP6 A;  2I3Y A;  2TIR A;  1Z6M A;  3KGK A;  4NV2 A;  1OVN A;  2ES7 A;  2R5G A;  4YQU A;  4BVX A;  1XOB A;  4IHU A;  2DIZ A;  3C8E A;  4KGI A;  2C0G A;  1K0M A;  5KOX A;  4Z2T A;  5HR0 A;  1Z5Y E;  2FA4 A;  3TOU A;  2GSS A;  3A5W A;  4HOJ A;  1HNB A;  4DSR A;  1EOG A;  3GFK A;  3IAS 2;  5D73 A;  4LMV A;  5IM9 A;  3FR3 A;  2X8G A;  2JAC A;  1ST9 A;  4ZBB A;  1PA3 A;  2IN3 A;  3ME7 A;  3R3E A;  1O85 A;  3IAM 2;  5AN1 A;  4AJ8 A;  2OBK A;  4I2U A;  1YDK A;  1ERW A;  1XWC A;  4AJ7 A;  4ZL9 A;  1B9X C;  2HT9 A;  3APQ A;  3LSZ A;  4FQU A;  1KTE A;  3F8U A;  4XRA A;  1A8L A;  3D0Z A;  4NAX A;  2FUG 2;  2E7P A;  3TJB A;  2HYX A;  1SK2 A;  2N5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...