4DSRA

Crystal structure of peroxiredoxin ahp1 from saccharomyces cerevisiae in reduced form
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
174
structure length
174
Chain Sequence
DLVNKKFPAGDYKFQYIAISQSDADSESCKMPQTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin type-2
publication title Structural Snapshots of Yeast Alkyl Hydroperoxide Reductase Ahp1 Peroxiredoxin Reveal a Novel Two-cysteine Mechanism of Electron Transfer to Eliminate Reactive Oxygen Species.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 51
structure length 174
sequence length 174
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4dsrA00
4EKZA 3UBKA 3KP8A 2LS5A 3KMNA 1YY7A 2H0GA 3IC4A 3TKPA 2P5QA 2AJQB 1SJIA 1VF3A 2X8CA 1Z5YE 3LG6A 4Q5QA 2MMZA 4CDOA 3IDVA 5IOWA 4OFTA 1PD21 2HRNA 2NTOA 2H01A 1O85A 5CO3A 1T8EB 19GSA 2FHEA 1E2YA 1KTEA 3GH6A 2RIIA 3CTGA 2YCDA 1EV4A 5IMVA 4KSMA 3QAGA 3H1NA 4HS1A 1KBNA 2IPAA 1V98A 4IS0A 4N10A 1GP1A 3DVWA 1WPIA 3M9KA 2OA7A 4IP1A 5IMAA 2LKUA 2VD1A 3BCKA 3PH9A 1ZZYA 2VAFA 4K0GA 1AQXA 3GSSA 5KN0A 3KH9A 4JE1A 4ML1A 5IMCA 1EEJA 2C0FA 5CRHA 2WJUA 1Y25A 1EP7A 1U88A 5HFKA 3IAS2 4DSSB 3ZIJA 1S3CA 2F9SA 1ERWA 2LUSA 1IYHA 3QOUA 2VL2C 3KTLA 2H74A 5AGYA 3I43A 4I6XA 4H86A 5GAND 5IPGA 5J3RA 4YQUA 2YJHA 1JZDA 4I2UA 5L71A 2REMA 4IN0A 1WJKA 4KDUA 3HJMA 1O81A 1AC1A 4K7NA 1LU4A 1R26A 3ERFA 3HCZA 1PL2A 1V9WA 2HSHA 2PMTA 3P90A 1BX9A 2FA4A 2PVQA 3WD6A 3ME8A 1M7TA 3FW2A 3C73A 5IM9A 4F9ZA 3ZREA 1CQGA 3L4NA 2I1UA 1QGVA 3M0FA 3L9SA 3D6IA 4KCEA 2RM5A 1RQMA 3TRQA 3CRTA 3VI5A 3TKSE 5A4UA 4TXOA 4XS6A 1ACVA 3IR4A 4JRRA 5CREA 2YJ7A 2O89A 3F4TA 3TB2A 1AIUA 2F3MA 2BMXA 2KP2A 1QFNA 2AUVA 4YQVA 4HI7A 1K0AA 2B5YA 3LSZA 1SL1B 3ZL5A 3OR5A 2I3YA 2MBSA 6GSUA 1I5GA 4TR1A 4TRXA 4POBA 2K6VA 1J08A 4GWRA 4BPYA 3LWAA 3QFBC 1K0CA 1FB6A 3FZ9A 3MSZA 2PN8A 1BG5A 5AN1A 2C3TA 2FWHA 3PR8A 2MMOA 3LQ7A 1THOA 1PSQA 2HFDA 3MNGA 3QAVA 5IIZA 2R5GA 4PNFA 4IHUA 3O3TA 2AHEA 2VL9A 3VWUA 2OACA 1KNGA 3ZIVA 1GWCA 2YZUA 3VWWA 2DJKA 4D73A 3IV4A 5ELAA 2V32A 1Q98A 4EF0A 1DUGA 1M99A 4ZB6A 4WBJA 2WRTA 4MZBA 2M72A 1AXDA 1PA3A 4KUNA 3TKRA 3SWLA 2IMFA 4PGTA 1GTAA 3VI7A 3KCMA 1JLVA 4RQXA 1GSUA 3TJBA 1SKSB 3LXTA 3DMLA 3JCML 3TRXA 4F0BA 4NWYA 3DXBA 2ON7A 4L5LA 3LYKA 4O5RA 1VGLA 4FYCA 1PKWA 3F3RA 4TR1B 2LEGA 1FW1A 1FG4A 3WYWA 1X5CA 4MCUA 5HR3A 4TVEA 4F0CA 4XHMA 3GURA 1YEXA 1AQWA 2HZEA 3HYPA 1T7PB 2VCWA 4YH2A 2RM6A 2EC4A 1O73A 3DIEA 3FY7A 1TI1A 4WEYA 1M9AA 5DJMA 4FYBA 4EDYA 4PUAA 4RI7A 4WR5A 1A8LA 1M2BA 3LGCA 4MPGA 4I8BA 1XWBA 2RUEA 2GLRA 1XZOA 2C3QA 5B7CA 5IO2A 2YNXA 4MF5A 5HQPA 2CAIA 2LNSA 5ECRB 3DRNA 2ON5A 1SL2B 4ZBBA 2GSQA 4ZL7A 4L0WA 2GVPA 1PL1A 4L5OA 2K8VA 2V1MA 2F51A 4IJ3A 4V2LA 2YWIA 4G9HA 1PN9A 5IQYA 2CT6A 2OE1A 3HZ4A 4QL9A 3DYRA 1TU8A 1YEPA 4Q5FA 1T1VA 3EU3A 3E3EA 1B9XC 3F4RA 4ECCA 2MMNA 2AYTA 3FRCA 2B5XA 4CW9A 2H6XA 2VM1A 1GTBA 4KCAA 4PQ1A 4QL7A 1NW2A 4ZL9A 4POKA 4LL4B 1SYRA 4AJ6A 3DD3A 5DQSA 1K0OA 1PRXA 3VPQA 3ZYWA 2QKEA 3FEUA 3PINA 2F8FA 1XFLA 2O87A 4POMA 3EWLA 3H4KA 5J5NA 5DAKA 6GSWA 4XCSA 2IWTA 3W6GA 5ENUA 5LD0A 2OKAA 3HJPA 2WGRA 3N9JA 3IRAA 4HEA2 1GNWA 2YZHA 3W8JA 2L6DA 1NHOA 18GSA 1QUWA 3HJOA 1OAZA 1J0FA 1XW5A 1FVJA 1ZMAA 5J9CA 2L59A 4KB3A 3IK9A 3ZVJD 4NAXA 1X0RA 1SD8A 4MF6A 2K18A 2H75A 1N8JA 4K2DA 2DMLA 3C1RA 4GSSA 1O7UA 2A2RA 2HRFA 4IGJA 4MABA 3LXZA 2OE3A 4KDYA 2LSTA 1K3LA 1GUKA 3BD2A 4OCEA 5C00A 1XWCA 1GTIA 4KH7A 1RW1A 1WRYA 3GTUA 3CRUA 5B8AA 1H75A 4WF4A 1TU7A 2FWFA 5ECSA 2FUG2 3TRPA 3CSHA 5IOXA 3GRXA 3Q6OA 1S3DA 1YDKA 2C8UA 1Q4JA 5EL8A 6GSXA 1GH2A 1W4VA 3ED3A 3PGTA 4EO3A 2FGXA 3TJFA 2EIQA 4KW6A 2JSYA 5ID2A 2IJYA 3NZNA 2L5OA 1G0TA 12GSA 5A4VA 3CTFA 4MDCA 3L9VA 1XOBA 3F63A 1K0BA 4ZB8A 2VCVA 2OADA 2ZNMA 2E2MA 1TOFA 1X9MB 2CAQA 4JEDA 1TJDA 3E0UA 1TK5B 4K1FA 5LNKe 2OBKA 4EXJA 1XPVA 1G7OA 2B1LA 2NDOA 4OFMA 4O7HA 5IMDA 3ZVJA 3UBLA 2E2GA 5GSSA 2H6ZA 4MPFA 2DJ2A 3TKSA 2TIRA 1XWGA 2B3SA 3IA1A 1ZOFA 1T3BA 2GTUA 5F07A 4NHZA 1MDJA 3CBUA 3TJGA 1FVKA 4N0ZA 2XC2A 1XBSA 1AUCA 1OC3A 3A2VA 1LBKA 1XXUA 2IMIA 2FCHA 1VF4A 2DJ1A 2H8LA 4TKYA 3QMXA 1M2DA 4KGIA 5FHIA 5INYA 2N5BA 3F6DA 5ID2B 3G7JA 1QMVA 2KP1A 3DGQA 3SBCA 3EC3A 4ID0A 2EIRA 4MLYA 3TCOA 4DVCA 1OVNA 1M0UA 3EINA 3ZLPA 4EUYA 1TXXA 1YF0A 4KE3A 2FLSA 14GSA 2LRNA 5A5KA 3FZ5A 4MZWA 3G7YA 3ZMKA 4V2MA 4HU7A 4EDZA 3GNJA 2PPTA 3GKXA 4MH2A 4TR4A 2AAWA 2G0FA 1MEKA 3RHCA 5A4WA 2KHPA 3L0HA 3GH9A 1XWKA 5G2ZA 4TOPA 1X9SB 3LEFA 4ZBDA 5AISA 4AJ7A 1YZXA 1GSFA 2H0IA 1XIYA 1PMTA 2HSYA 2PVOC 1PKZA 4P3YB 2B6MA 5IO0A 5J41A 2TRCP 1FOVA 4AF2A 4G10A 3BJ5A 5CAXA 1O6JA 1WMJA 3K8NA 1TW9A 3US3A 3BBYA 4MH3A 2IN3A 5DCGA 2IMKA 1SKRB 4ECJA 2KOKA 2BJXA 3CSJA 4KA0A 5IPHA 1T4ZA 1FO5A 2YWMA 1F9MA 1NHYA 3TKQA 2JZTA 5DJLA 2WFCA 1GL8A 1N2AA 1UN2A 1FHEA 5JCUA 1WOUA 3TOUA 2IFQA 4EVMA 1YKCA 1TRUA 3KP9A 4XRDA 2K8SA 2FNOA 4EL1A 3O76A 2BTOT 1OC9A 1OKTA 2H71A 4YQMA 4G2EA 1R7HA 2DIZA 4POLA 5C04A 3HXSA 1K0NA 2FY6A 2LV3A 1MDIA 2GZPA 3QPMA 4V1Ap 4PNGA 4HDEA 5DVBA 3ZTLA 2X64A 3VFIA 1U6TA 3A2XA 3BCIA 1W89A 1UVZA 2X8HA 5ECQB 4HQSA 1EV9A 5LCZA 3ME7A 2GGTA 4I97A 4MJCA 2H6YA 4OO5A 2I9HA 5G31A 3S9FA 4HOJA 5IMZA 3ZITA 2DMMA 1WP0A 1XCCA 2L5LA 5ECNB 3CYNA 3RDWA 1ERVA 2O7KA 4IP6A 4MP4A 5D93A 1B9YC 4ECBA 4PX1A 2IFQB 4K8MA 6GSYA 5G5EA 5IMFA 4F2IA 4WKWA 3J7Yk 3HD5A 1JFUA 2H1AA 3D4TA 1AQVA 1NM3A 3N5OA 3UAPA 2V6OA 1GUMA 4JR4A 3GHAA 2CZ2A 2VL2A 2YV7A 3I69A 1TDIA 4IBPA 4G19A 2HLSA 5JCGA 4ZB9A 4TXOB 2FWGA 1V58A 3KH7A 1ST9A 2H66A 2DLXA 2DBCA 4NHWA 5EVOA 3O6TA 1M2AA 2XBIA 2B7KA 4RUVA 1PX6A 1A2JA 1A2LA 2L4CA 2VLUA 4OO4A 3R2QA 5FT3A 4EE0A 2GSRA 2H1GA 1ERUA 5ECPB 1XVWA 4ZIJA 1HNCA 3GKKA 2LJKA 1X5DA 1GNEA 2VO4A 4HJMA 2ZUPA 4J2FA 2P5RA 2IIYA 2PGTA 5ECHB 1SK2A 2CV4A 5HR1A 3FZ4A 2VLTA 2GT6A 2VCTA 5KN1A 1WIKA 1XVQA 4FO5A 3M8NA 2CX4A 3CMIA 2NBSA 3GMFA 2H1DA 2D2ZA 3IAM2 4D73B 2V41A 2OJLA 1TKDB 3QAWA 3GV1A 4WR4A 1B4PA 1MD4A 5DQYA 3HY2A 2R2JA 1R5PA 1GSYA 4OWYA 4F82A 3GL3A 4JU5A 4BA7A 1AAZA 3A3TA 3DVXA 3EMXA 2XPDA 1Z7RA 2V6KA 1YKAA 3BOAA 4OFNA 5CP1A 2QGVA 3UEMA 5ECIB 2C0DA 2LJRA 1GSQA 2GQLA 4TW5A 2KLXA 3EVIA 1TTZA 1TRVA 5HFIA 2HYXA 1IYIA 1A2MA 3VWVA 3KIJA 3P7XA 3NOFA 2CVKA 2HZEB 2A2SA 4XS4A 3H79A 1ZYEA 5J9BA 1GRXA 5ECKB 2AB6A 1FAAA 2DJJA 4IQAA 4FIWA 3IOSA 3HA9A 3UOMA 2A4VA 2L4QA 2YN1A 1QXHA 4X1UA 1BYEA 5DALA 5JWQB 3HVXA 1M9BA 2VM2A 1SK0A 4MF7A 4MZCA 4MJBA 1JZWA 3ISOA 2FA8A 4ZILA 4LL1B 1HQOA 4MK3A 1WWJA 3D21A 1MD3A 1T00A 1Z6MA 1GSSA 9GSSA 4I5QA 20GSA 3APSA 1TK8B 4GSTA 22GSA 2G2QA 1SJ6A 2N5AA 3GA4A 5DBQA 6GSTA 1B4QA 3HDCA 2B5EA 1K3YA 2GS3A 2H30A 3GYKA 3FK8A 1SU9A 1WE0A 4Z7XA 5KEJA 4JBBA 5EPFA 1CQHA 1TK0B 5D9VA 2GDRA 3KTBA 2C3NA 1XW9A 1B48A 1R5AA 2JL4A 3P2AA 2RLIA 2WB9A 2QSIA 3QD9A 2IL3A 1VF2A 3P8WA 4HZ2A 2XPEA 4N11A 4YAPA 2X8GA 2GZZA 5B8BA 3F0IA 5CNWA 4HQZA 3GUSA 3FZAA 1HYUA 3UVTA 5GAPD 1GTUA 1H4OA 5G1KA 3GL5A 2CVBA 4NV5A 4L0UA 5DAKB 2ES7A 1MTCA 2HNLA 1JZOA 4BL7A 2VCZA 3TUEA 4PQHA 5H5RA 3KZQA 5H5QA 3HVSA 5FWGA 2JSZA 4YAVA 1GSDA 4RI6A 3RAZA 4DEJA 4OCFA 3FYGA 2HZFA 5CRGA 1GSEA 4NXIA 2E0QA 2R4VA 4TR3A 3ZZXA 1TRSA 1JZRA 2VOCA 5G5FA 1TI3A 1S3AA 3WT1A 1G6WA 4KAEA 10GSA 1DE1A 3IHQA 1DE2A 1KEBA 2CZ3A 2OBIA 17GSA 5G1LA 5E59A 1EGRA 4WBRD 3M1GA 4GCIA 3H8QA 1SJZA 4PQIA 4RQRA 1ZL9A 3A2WA 2YV9A 3IBHA 5E4WA 3WGEA 2H76A 2L57A 3VLNA 3GTUB 2WULA 1HNAA 1EGOA 3IXRA 2O8VB 4ILFA 2VIMA 2VLVA 1UA5A 2AV4A 5H5SA 4Q5NA 2GZYA 2PBJA 4GLTA 4GXZA 4DSSA 3MAKA 4ISDA 2HT9A 4MJEA 2I81A 4OMVA 4LMVA 4F03A 1YQ1A 3D22A 1B8XA 3HZ8A 3HVVA 1ERTA 3KM6A 1F37A 4IQ1A 2L6CA 2PWJA 3LORA 1F3AA 3MWHA 1MDKA 1O8WA 2PUKC 3UL3A 3EE2A 5HR2A 3GIXA 2YOIA 1O8XA 8GSSA 4DSQA 3KGKA 4PXOA 4GSNA 4KDXA 4ZL8A 3F6FA 4FH8A 5GSTA 1HNBA 3D0ZA 4WXTA 2CX3A 3GSTA 2V2GA 5ECLB 2B1KA 3M9JA 3GFKA 1Z3EA 4KNDA 1ILOA 2DC5A 1EEMA 2GQKA 4WF5A 2PU9C 2JZSA 13GSA 3TGZA 3FKFA 2QC7A 5F0GA 1SL0B 4XTSA 3DWVA 1K0DA 1URMA 2LQQA 2GT5A 3F8UA 7GSSA 4IKHA 3APOA 1F2EA 4HUAA 2PERA 4V2NA 5AIVA 3C7MA 3LJRA 1BEDA 3J7Yb 1I9DA 2F8AA 2HXKA 5JWOB 1VRSD 3NIVA 1PGTA 5B6MA 4TXVA 3AY8A 4K9ZA 2JADA 2C1YA 1G7EA 3IPZA 1QQ2A 4TN8A 5DCHA 4HZ4A 5ABRA 3UARA 5J4UA 11GSA 1EWXA 2FWEA 3HKRA 4I2TA 5AIXA 3UIWA 2O85A 3UMAA 2C0GA 2EIOA 2NPBA 2ZCTA 3QCPA 2H1BA 1PX7A 4ECIA 5KN2A 4Q5RA 4L8EA 5HFGA 2J9HA 4KX4A 2JU5A 4X0XA 1V2AA 3EYTA 4ZXGA 2WCIA 4ML6A 3VWXA 1DBYA 3U6VA 2FD3A 3U5RE 4FYUA 2LRCA 2Z9SA 3IE3A 1TRWA 5JCWA 1A24A 3ERWA 3C8EA 1F6MC 1OC9B 1A0RP 4O92A 5D9WA 4N0VA 4JR6A 1OKDA 2TRXA 3G9BA 3FR9A 4X43A 5ECOB 5HR0A 1BQ7A 3IK7A 4K7OA 1GUHA 5F8BA 3KJYA 4NV2A 2MMAA 1EOGA 4XIHA 1R4WA 5D9XA 3VURA 2C80A 3WGDA 3ERGA 4E8HA 4GTUA 4WETA 3DEXA 1OE7A 2MBTA 1RK4A 2MZCA 3GX8A 4ACSA 2VCXA 3KXOA 3L78A 3Q74A 2C4JA 2C0EA 4IW9A 3E9JB 1XOAA 3WGXA 3RPPA 3RHBA 4HJ2A 1K3OA 5ECMB 2VD0A 4AJ8A 1X5EA 2H19A 1SYXA 2LTKA 3KMOA 3EU4A 4BVYA 4K6XA 2WZ9A 3EURA 1K0MA 3KEBA 4TR0A 1ML6A 1EOHA 2YWOA 4ULXA 1SENA 1ZGNA 4IJIA 3VPTA 2LRTA 3L9UA 3C71A 1PQNA 2YANA 3I6AA 3QFAC 3CSIA 2VCQA 4PURA 5G30A 1OC8A 3F3QA 5D8IA 1LJRA 3KD0A 2WDUA 1XWAA 1V57A 2K9FA 3I9V2 2R3XA 3CXGA 2CVDA 1OE8A 3TJJA 1C72A 1A0FA 5D96A 2LNTA 3F4SA 1GLQA 2H73A 1A8YA 2ALBA 16GSA 2DIYA 3Q19A 2M46A 4LA1A 5B6NA 3D5JA 2VL3A 2VUPA 4OD7A 3QDNA 4CHSA 1UC7A 2YWNA 2MYGA 1EZKA 3GN3A 1GULA 4O32A 3HHVA 1F3BA 2GQMA 2NVLA 2JACA 2X99A 2XHFA 3GKNA 4NMUA 1SK1A 4N30A 2R37A 3TOTA 1X9WB 4BWSA 1JLWA 5EY6A 1THXA 2R6KA 1J9BA 3DKSA 3MDKA 2H0HA 5COHA 3ZMLA 5KN3A 1BAYA 3V1WA 1SD9A 2P0GA 3Q18A 3C1SA 5D9TA 1ABAA 5CYYA 1G6YA 4XRAA 4EC0A 1U3AA 3RPNA 2DJ3A 4BVXA 3VK9A 3F9UA 4IELA 6GSVA 2KUCA 3TKSC 3FHKA 3ZFLA 2OE0A 1GLPA 1U87A 2LQOA 3FR6A 1BJXA 2CQ9A 1U3IA 1JHBA 2DSAA 2M80A 3FR3A 4K7IA 1FB0A 4GRFA 3UVHA 3TJKA 3M3MA 2J23A 1EP8A 4HU9A 3A5WA 1USBA 2N5FA 5F06A 1Y6EA 1VF1A 2GSTA 2H72A 3H93A 5GZZB 4ZBAA 1QK8A 2XBQA 3W8SA 4E8EA 4LMWA 4XS4B 2CA8A 3G7IA 2GSSA 4GQCA 2H70A 4KSOA 1T4YA 5DDLA 2WS2A 4LLRA 3LFLA 3TDGA 1Z6NA 5DALB 4J56E 1ON4A 5ELGA 1YJ6A 2JZRA 4DSRA 2I4AA 4PUFC 4JZQA 4BWQA 2E7PA 2IMEA 4GF0A 2B7JA 4K0NA 2HE3A 4MMMA 5F05A 1ZCPA 1HD2A 1Z9HA 2HI7A 2YPMA 2RUFA 6GSSA 2P31A 3QR6A 3ZRDA 2IMDA 4V1Ag 3EMPA 4MJAA 4MA9A 2LJAA 4IVFA 1XW6A 1ZYQB 3ZFBA 1AW9A 1A23A 3RBTA 4AGSA 2YP6A 1DSBA 1TP9A 5CRDA 4XS1A 1OYJA 3APQA 3GKMA 3D4MA 5CRWA 1SKWB 3GX0A 1Z7PA 1NSWA 3LYPA 2DJ0A 4J57E 5D73A 1V40A 3WT2A 4QQ7A 4GQFA 5JWRB 4NPBA 3UJ1A 1E6BA 1YF1A
chains in the Genus database with same CATH superfamily
4EKZA 3UBKA 3KP8A 2LS5A 3KMNA 1YY7A 2H0GA 3IC4A 3TKPA 2P5QA 2AJQB 1SJIA 1VF3A 2X8CA 1Z5YE 3LG6A 4Q5QA 4BL7B 2MMZA 4CDOA 3IDVA 5IOWA 4OFTA 1PD21 2HRNA 2NTOA 2H01A 1O85A 5CO3A 1T8EB 19GSA 2FHEA 1E2YA 1FOHA 1KTEA 3GH6A 2RIIA 3CTGA 2YCDA 1EV4A 5IMVA 4KSMA 3QAGA 3H1NA 4HS1A 1KBNA 2IPAA 1V98A 4IS0A 4N10A 1GP1A 3DVWA 1WPIA 3M9KA 2OA7A 4IP1A 5IMAA 2LKUA 2VD1A 3BCKA 3PH9A 1ZZYA 2VAFA 4K0GA 1AQXA 3GSSA 5KN0A 3KH9A 4JE1A 4ML1A 5IMCA 1EEJA 2C0FA 5CRHA 2WJUA 1Y25A 1EP7A 1U88A 5HFKA 2HRAA 3IAS2 4DSSB 3ZIJA 1S3CA 2F9SA 1ERWA 2LUSA 1IYHA 3QOUA 2VL2C 3KTLA 2H74A 5AGYA 3I43A 4I6XA 4H86A 5GAND 5IPGA 5J3RA 4YQUA 4CY8A 2YJHA 1JZDA 4I2UA 5L71A 2REMA 4IN0A 1WJKA 4KDUA 3HJMA 1O81A 1AC1A 4K7NA 1LU4A 1R26A 3ERFA 3HCZA 1PL2A 1V9WA 2HSHA 2PMTA 3P90A 1BX9A 2FA4A 2PVQA 3WD6A 3ME8A 1M7TA 3FW2A 3C73A 5IM9A 4F9ZA 3ZREA 1CQGA 3L4NA 2I1UA 1QGVA 3M0FA 3L9SA 3D6IA 4KCEA 2RM5A 1RQMA 3TRQA 3CRTA 3VI5A 3TKSE 5A4UA 4TXOA 4XS6A 1ACVA 2UZ8A 3IR4A 4JRRA 5CREA 2YJ7A 2O89A 3F4TA 3TB2A 1AIUA 2F3MA 2BMXA 2KP2A 1QFNA 4G0LA 4ICYA 2AUVA 4YQVA 4HI7A 1K0AA 2B5YA 3LSZA 1SL1B 3ZL5A 3OR5A 2I3YA 2R0PA 2MBSA 6GSUA 1I5GA 4TR1A 4TRXA 4POBA 2K6VA 1J08A 4GWRA 4BPYA 3LWAA 3QFBC 1K0CA 1FB6A 3FZ9A 3MSZA 2PN8A 1BG5A 5AN1A 2C3TA 2FWHA 3PR8A 2MMOA 3LQ7A 1THOA 1PSQA 2HFDA 3MNGA 3QAVA 5IIZA 2R5GA 4PNFA 4IHUA 3O3TA 2AHEA 2VL9A 3VWUA 2OACA 1KNGA 3ZIVA 1GWCA 2YZUA 3VWWA 2DJKA 4D73A 3IV4A 5ELAA 2V32A 1Q98A 4EF0A 1DUGA 1M99A 4ZB6A 4WBJA 2WRTA 4MZBA 2M72A 1AXDA 1PA3A 4KUNA 3TKRA 3SWLA 2IMFA 4PGTA 1GTAA 3VI7A 3KCMA 1JLVA 4RQXA 1GSUA 3TJBA 1SKSB 3LXTA 3DMLA 3JCML 3TRXA 4F0BA 4NWYA 3DXBA 2ON7A 4L5LA 3LYKA 4O5RA 1VGLA 4FYCA 1PKWA 3F3RA 4TR1B 2LEGA 1FW1A 1FG4A 5BRTA 3WYWA 1X5CA 4MCUA 5HR3A 4TVEA 4F0CA 4XHMA 3GURA 4BIKA 1YEXA 1AQWA 2HZEA 3HYPA 1T7PB 2VCWA 4YH2A 2RM6A 2EC4A 1O73A 3DIEA 3FY7A 1TI1A 4WEYA 1M9AA 5DJMA 4FYBA 4EDYA 4PUAA 4RI7A 4WR5A 1A8LA 1M2BA 3LGCA 4MPGA 4I8BA 1XWBA 2RUEA 2GLRA 1XZOA 2C3QA 5B7CA 5IO2A 2YNXA 4MF5A 5HQPA 4KF9A 2CAIA 2LNSA 5ECRB 3DRNA 2ON5A 1SL2B 4ZBBA 2GSQA 4ZL7A 4L0WA 2GVPA 1PL1A 4L5OA 2K8VA 2V1MA 2F51A 4IJ3A 4V2LA 2YWIA 4G9HA 1PN9A 5IQYA 2CT6A 2OE1A 3HZ4A 4QL9A 3DYRA 1TU8A 5BMUA 1YEPA 4BVYB 4Q5FA 1T1VA 3EU3A 3E3EA 1B9XC 3F4RA 4ECCA 2MMNA 2AYTA 3FRCA 2X49A 2B5XA 4CW9A 2H6XA 4USSA 2VM1A 1GTBA 4KCAA 4PQ1A 4QL7A 1NW2A 4G0KA 4ZL9A 4POKA 4LL4B 1SYRA 4AJ6A 3DD3A 5DQSA 1K0OA 1PRXA 3VPQA 3ZYWA 2QKEA 3FEUA 3PINA 2F8FA 1XFLA 2O87A 4POMA 3EWLA 3H4KA 5J5NA 5DAKA 1ZYPA 6GSWA 4XCSA 2IWTA 3W6GA 5ENUA 5LD0A 2OKAA 3HJPA 2WGRA 3N9JA 3IRAA 4HEA2 1GNWA 2YZHA 3W8JA 2L6DA 4K5SA 4K2XA 1NHOA 18GSA 1QUWA 3HJOA 1OAZA 1J0FA 1XW5A 4FQUA 2A4HA 1FVJA 1ZMAA 5J9CA 2L59A 4KB3A 3IK9A 3ZVJD 4NAXA 1X0RA 1SD8A 4MF6A 2K18A 2H75A 1N8JA 4K2DA 2DMLA 3C1RA 4GSSA 1O7UA 2A2RA 2HRFA 4IGJA 4MABA 3LXZA 2OE3A 4KDYA 2LSTA 1K3LA 1GUKA 3BD2A 4OCEA 5C00A 1XWCA 1GTIA 4KH7A 1RW1A 1WRYA 3GTUA 3CRUA 5B8AA 1H75A 4WF4A 1TU7A 2FWFA 5ECSA 2FUG2 3TRPA 3CSHA 5IOXA 3GRXA 3Q6OA 1S3DA 1YDKA 2C8UA 1Q4JA 5EL8A 6GSXA 1GH2A 1W4VA 3ED3A 3PGTA 4EO3A 2FGXA 3TJFA 2EIQA 4KW6A 2JSYA 5ID2A 2IJYA 3NZNA 2L5OA 1G0TA 12GSA 5A4VA 3CTFA 4MDCA 3L9VA 1XOBA 3F63A 5KOWA 1K0BA 4ZB8A 2VCVA 2OADA 2ZNMA 2E2MA 1TOFA 1X9MB 2CAQA 4JEDA 1TJDA 3E0UA 1TK5B 4K1FA 5LNKe 2OBKA 4EXJA 1XPVA 1G7OA 2B1LA 2NDOA 4OFMA 4O7HA 5IMDA 3ZVJA 3UBLA 2E2GA 5GSSA 2H6ZA 4MPFA 2DJ2A 3TKSA 2TIRA 1XWGA 2B3SA 3IA1A 1ZOFA 1T3BA 2GTUA 5F07A 4NHZA 1MDJA 3CBUA 3TJGA 1FVKA 4N0ZA 2XC2A 1XBSA 1AUCA 1OC3A 3A2VA 1LBKA 1XXUA 2IMIA 2FCHA 1VF4A 2DJ1A 2H8LA 4TKYA 3QMXA 1M2DA 1PN0A 4KGIA 5FHIA 5INYA 2N5BA 3F6DA 5ID2B 3G7JA 1QMVA 2KP1A 3DGQA 3SBCA 3EC3A 4ID0A 2EIRA 4MLYA 3TCOA 4DVCA 1OVNA 1M0UA 3EINA 3ZLPA 4EUYA 1TXXA 1YF0A 4KE3A 2FLSA 14GSA 2LRNA 5A5KA 3FZ5A 4MZWA 3G7YA 3ZMKA 4V2MA 4HU7A 4EDZA 3GNJA 2PPTA 3GKXA 4MH2A 4TR4A 2AAWA 2G0FA 1MEKA 3RHCA 5A4WA 2KHPA 3L0HA 3GH9A 1XWKA 5G2ZA 4TOPA 1X9SB 3LEFA 4ZBDA 5AISA 4AJ7A 1YZXA 1GSFA 2H0IA 1XIYA 1PMTA 2HSYA 2PVOC 1PKZA 4P3YB 2B6MA 5IO0A 5J41A 2TRCP 1FOVA 4AF2A 4G10A 3BJ5A 5CAXA 1O6JA 1WMJA 3K8NA 1TW9A 3US3A 3BBYA 4MH3A 2IN3A 5DCGA 2IMKA 1SKRB 4ECJA 2KOKA 2BJXA 3CSJA 4KA0A 5IPHA 4MNNA 1T4ZA 1FO5A 2YWMA 1F9MA 1NHYA 3TKQA 2JZTA 5DJLA 2WFCA 1GL8A 1N2AA 1UN2A 1FHEA 5JCUA 1WOUA 3TOUA 2IFQA 4EVMA 1YKCA 1TRUA 3LW9A 3MIXA 3KP9A 4XRDA 2K8SA 2FNOA 4EL1A 3O76A 2BTOT 1OC9A 1OKTA 2H71A 4YQMA 4G2EA 1R7HA 2DIZA 4POLA 5C04A 3HXSA 1K0NA 2HSMA 2FY6A 2LV3A 3FMWA 4EIPA 1MDIA 3MYDA 2GZPA 3QPMA 4V1Ap 4PNGA 4HDEA 5DVBA 3ZTLA 2X64A 3VFIA 1U6TA 3A2XA 3BCIA 1W89A 1UVZA 2X8HA 5ECQB 4HQSA 1EV9A 5LCZA 3ME7A 2GGTA 4I97A 4MJCA 2H6YA 4OO5A 2I9HA 5G31A 3S9FA 4HOJA 5IMZA 3ZITA 2DMMA 1WP0A 1XCCA 2L5LA 5ECNB 3CYNA 3RDWA 1ERVA 2O7KA 4IP6A 4MP4A 5D93A 1B9YC 4ECBA 4PX1A 2IFQB 4K8MA 6GSYA 5G5EA 5IMFA 4F2IA 4WKWA 3J7Yk 3HD5A 1JFUA 2H1AA 3D4TA 1AQVA 1NM3A 3N5OA 3UAPA 2V6OA 1GUMA 4JR4A 3GHAA 2CZ2A 2X4AA 2VL2A 2YV7A 3I69A 1TDIA 4IBPA 4G19A 2HLSA 5JCGA 4ZB9A 4TXOB 2FWGA 1V58A 3KH7A 1ST9A 2H66A 2DLXA 2DBCA 4NHWA 5EVOA 3O6TA 1M2AA 2XBIA 2B7KA 4RUVA 1PX6A 1A2JA 1A2LA 2L4CA 2VLUA 4OO4A 3R2QA 5FT3A 4EE0A 2GSRA 2H1GA 1ERUA 5ECPB 1XVWA 4ZIJA 1HNCA 3GKKA 2LJKA 1X5DA 1GNEA 2VO4A 4HJMA 2ZUPA 4J2FA 2P5RA 2IIYA 2PGTA 5ECHB 1SK2A 2CV4A 5HR1A 3FZ4A 2VLTA 2GT6A 2VCTA 5KN1A 1WIKA 1XVQA 4FO5A 3M8NA 2CX4A 3CMIA 2NBSA 4Z2UA 3GMFA 2H1DA 1M3IA 2D2ZA 3IAM2 4D73B 2V41A 2OJLA 1TKDB 3QAWA 3GV1A 4WR4A 1B4PA 1MD4A 5DQYA 3HY2A 2R2JA 1R5PA 1GSYA 4OWYA 4F82A 3GL3A 4JU5A 4BA7A 1AAZA 3A3TA 3DVXA 3EMXA 2XPDA 1Z7RA 2V6KA 1YKAA 3BOAA 4OFNA 5CP1A 2QGVA 3UEMA 5ECIB 2C0DA 3HVNA 2LJRA 1GSQA 2GQLA 4TW5A 2KLXA 3EVIA 1TTZA 1TRVA 5HFIA 2HYXA 1IYIA 1A2MA 2R0GA 3VWVA 3KIJA 3P7XA 4O5UA 3NOFA 2CVKA 2HRKA 2HZEB 2A2SA 4XS4A 3H79A 1ZYEA 5J9BA 1GRXA 5ECKB 2AB6A 1FAAA 2DJJA 4IQAA 4FIWA 3IOSA 3HA9A 3UOMA 2A4VA 2L4QA 2YN1A 1QXHA 4X1UA 1BYEA 5DALA 5JWQB 3HVXA 1M9BA 2VM2A 1SK0A 4MF7A 4MZCA 4MJBA 1JZWA 3ISOA 2FA8A 4ZILA 4LL1B 1HQOA 4MK3A 1WWJA 3D21A 1MD3A 1T00A 1Z6MA 1GSSA 9GSSA 4I5QA 20GSA 3APSA 1TK8B 4EIQA 4PTSA 4GSTA 22GSA 2G2QA 1SJ6A 2N5AA 3GA4A 5DBQA 6GSTA 1B4QA 3HDCA 2B5EA 1K3YA 2GS3A 2H30A 3GYKA 3FK8A 1SU9A 1WE0A 4Z7XA 5KEJA 4JBBA 5EPFA 1CQHA 1TK0B 5D9VA 2GDRA 3KTBA 2C3NA 1XW9A 2A2PA 1B48A 1R5AA 2JL4A 3P2AA 2RLIA 2WB9A 2QSIA 3QD9A 2IL3A 1VF2A 3P8WA 4HZ2A 2XPEA 4N11A 4YAPA 2X8GA 2GZZA 5B8BA 3F0IA 5CNWA 4HQZA 3GUSA 3FZAA 1HYUA 3UVTA 5GAPD 1GTUA 1H4OA 5G1KA 3GL5A 2CVBA 4NV5A 4L0UA 5DAKB 2ES7A 1MTCA 4X4JA 2HNLA 1JZOA 4BL7A 2VCZA 3TUEA 4PQHA 5H5RA 3KZQA 5H5QA 3HVSA 5FWGA 2JSZA 4YAVA 1GSDA 4RI6A 3RAZA 4DEJA 4OCFA 3FYGA 2HZFA 5CRGA 1GSEA 4NXIA 2E0QA 2R4VA 4TR3A 3ZZXA 1TRSA 1JZRA 2VOCA 5G5FA 1TI3A 1S3AA 3WT1A 1G6WA 4KAEA 10GSA 1DE1A 3IHQA 1DE2A 1KEBA 2CZ3A 2OBIA 17GSA 5G1LA 5E59A 1EGRA 4WBRD 3M1GA 4GCIA 3H8QA 1SJZA 4PQIA 4RQRA 1ZL9A 3A2WA 2YV9A 3IBHA 5E4WA 3WGEA 2H76A 2L57A 3VLNA 3GTUB 2WULA 1HNAA 1EGOA 3IXRA 2O8VB 4ILFA 2VIMA 3R3EA 2VLVA 1UA5A 2AV4A 5H5SA 2QA2A 4Q5NA 2GZYA 2PBJA 4GLTA 4GXZA 4DSSA 3MAKA 4ISDA 2HT9A 4MJEA 1PFOA 2I81A 4OMVA 4LMVA 4F03A 1YQ1A 3D22A 1B8XA 3HZ8A 3HVVA 1ERTA 3KM6A 1F37A 4IQ1A 2L6CA 2PWJA 3LORA 1F3AA 3MWHA 1MDKA 4A5PA 1O8WA 2PUKC 3UL3A 1S3RA 3EE2A 5HR2A 3GIXA 2YOIA 1O8XA 8GSSA 4DSQA 3KGKA 4PXOA 4GSNA 4KDXA 4ZL8A 3F6FA 4FH8A 5GSTA 1HNBA 3D0ZA 4WXTA 2CX3A 3GSTA 2V2GA 5ECLB 2B1KA 3M9JA 3GFKA 1Z3EA 4KNDA 1ILOA 2DC5A 1EEMA 2GQKA 4WF5A 2PU9C 2JZSA 13GSA 3TGZA 3FKFA 2QC7A 5F0GA 2QA1A 1SL0B 4XTSA 3DWVA 1K0DA 1URMA 2LQQA 2GT5A 3F8UA 7GSSA 4IKHA 3APOA 1F2EA 4HUAA 2PERA 4V2NA 5AIVA 3C7MA 3LJRA 1BEDA 3J7Yb 1I9DA 2F8AA 2HXKA 5JWOB 1VRSD 3NIVA 1PGTA 5B6MA 4TXVA 3AY8A 4K9ZA 2JADA 2C1YA 1G7EA 3IPZA 1QQ2A 4TN8A 5DCHA 4HZ4A 5ABRA 3UARA 5J4UA 4Z2RA 3A5IA 11GSA 1EWXA 2FWEA 4G0IA 3HKRA 4I2TA 5AIXA 3UIWA 2O85A 3UMAA 2C0GA 2EIOA 2NPBA 2ZCTA 3QCPA 2H1BA 1PX7A 4ECIA 5KN2A 4Q5RA 4L8EA 5HFGA 2J9HA 4KX4A 2JU5A 4Z2TA 4X0XA 3IC8A 1V2AA 4K5RA 3EYTA 4ZXGA 1XG8A 2WCIA 4ML6A 3VWXA 1DBYA 3U6VA 3PPUA 2FD3A 3U5RE 4FYUA 2LRCA 2Z9SA 3IE3A 1TRWA 5JCWA 1A24A 3ERWA 3C8EA 1F6MC 1OC9B 1A0RP 4O92A 5D9WA 4N0VA 4JR6A 1OKDA 2TRXA 3G9BA 3FR9A 4X43A 5ECOB 5HR0A 1BQ7A 3IK7A 4K7OA 1GUHA 5F8BA 3KJYA 4NV2A 2MMAA 1EOGA 4XIHA 1R4WA 5D9XA 3VURA 4YKGA 2C80A 3WGDA 3ERGA 4E8HA 4GTUA 4WETA 3DEXA 1OE7A 2MBTA 1RK4A 2MZCA 3GX8A 4ACSA 2VCXA 3KXOA 3L78A 3Q74A 2C4JA 2C0EA 4IW9A 3E9JB 1XOAA 3WGXA 3RPPA 3RHBA 4HJ2A 1K3OA 5ECMB 2VD0A 4AJ8A 1X5EA 2H19A 1SYXA 2LTKA 3KMOA 3EU4A 4BVYA 4K6XA 2WZ9A 3EURA 1K0MA 3KEBA 4TR0A 1ML6A 1EOHA 2YWOA 4ULXA 1SENA 1ZGNA 4IJIA 3VPTA 2LRTA 3L9UA 3C71A 1PQNA 2YANA 3I6AA 3QFAC 3CSIA 2VCQA 4PURA 5G30A 1OC8A 3F3QA 5D8IA 1LJRA 3KD0A 2WDUA 1XWAA 1V57A 2K9FA 3I9V2 2R3XA 3CXGA 2CVDA 1OE8A 3TJJA 1C72A 1A0FA 5D96A 2LNTA 3F4SA 1GLQA 2H73A 1A8YA 2ALBA 16GSA 2DIYA 3Q19A 2M46A 4LA1A 5B6NA 3D5JA 2VL3A 2VUPA 4OD7A 3QDNA 4CHSA 1UC7A 2DKHA 2YWNA 2MYGA 1EZKA 3GN3A 4HSCX 1GULA 4O32A 3HHVA 4O5QA 1F3BA 2GQMA 2NVLA 2JACA 2X99A 2XHFA 3GKNA 4NMUA 1SK1A 4N30A 2R37A 3CQFA 3TOTA 1X9WB 4BWSA 1JLWA 5EY6A 3EPTA 1THXA 2R6KA 1J9BA 3DKSA 3MDKA 2H0HA 5COHA 3ZMLA 1M3JA 5KN3A 1BAYA 3V1WA 1SD9A 2P0GA 3Q18A 3C1SA 5D9TA 1ABAA 5CYYA 1G6YA 4XRAA 4EC0A 1U3AA 3RPNA 2DJ3A 4BVXA 3VK9A 3F9UA 4IELA 6GSVA 2KUCA 3TKSC 3FHKA 3ZFLA 2OE0A 3IHGA 1GLPA 1U87A 2LQOA 3FR6A 4YKFA 1BJXA 2CQ9A 1U3IA 1JHBA 2DSAA 2M80A 3FR3A 4K7IA 1FB0A 4GRFA 3UVHA 3TJKA 3M3MA 2J23A 1EP8A 4HU9A 3A5WA 1USBA 2DKIA 2N5FA 5F06A 1Y6EA 1VF1A 2GSTA 2H72A 3H93A 5GZZB 4ZBAA 1QK8A 2XBQA 3W8SA 4E8EA 4LMWA 4XS4B 2CA8A 3G7IA 2GSSA 4GQCA 2H70A 4KSOA 4CY6A 1T4YA 5DDLA 2WS2A 4LLRA 3LFLA 3TDGA 1Z6NA 5DALB 4J56E 1ON4A 5ELGA 1YJ6A 2JZRA 4DSRA 2I4AA 4PUFC 4JZQA 4BWQA 2E7PA 2R0CA 2IMEA 4GF0A 2B7JA 4K0NA 2HE3A 4BVXB 4MMMA 5F05A 1ZCPA 1HD2A 1Z9HA 2HI7A 2YPMA 1ZYNA 2RUFA 6GSSA 2P31A 3QR6A 3ZRDA 2IMDA 4V1Ag 3EMPA 4MJAA 4MA9A 2LJAA 4IVFA 5KOXA 1XW6A 1ZYQB 3ZFBA 1AW9A 1A23A 3RBTA 4AGSA 2YP6A 1DSBA 1TP9A 5CRDA 4XS1A 1OYJA 3APQA 3GKMA 3D4MA 5CRWA 1SKWB 3GX0A 1Z7PA 1NSWA 3LYPA 2DJ0A 4J57E 5D73A 1V40A 3WT2A 4QQ7A 4GQFA 5JWRB 4NPBA 3UJ1A 1E6BA 1YF1A
chains in the Genus database with same CATH topology
4EKZA 3UBKA 3KP8A 2LS5A 3KMNA 1YY7A 2H0GA 3IC4A 3TKPA 2P5QA 2AJQB 1SJIA 1VF3A 2X8CA 1Z5YE 3LG6A 4Q5QA 4BL7B 2MMZA 4CDOA 3IDVA 5IOWA 4OFTA 1PD21 2HRNA 2NTOA 2H01A 1O85A 5CO3A 1T8EB 19GSA 2FHEA 1E2YA 1FOHA 1KTEA 3GH6A 2RIIA 3CTGA 2YCDA 1EV4A 5IMVA 4KSMA 3QAGA 3H1NA 4HS1A 1KBNA 2IPAA 1V98A 4IS0A 4N10A 1GP1A 3DVWA 1WPIA 3M9KA 2OA7A 4IP1A 5IMAA 2LKUA 2VD1A 3BCKA 3PH9A 1ZZYA 2VAFA 4K0GA 1AQXA 3GSSA 5KN0A 3KH9A 4JE1A 4ML1A 5IMCA 1EEJA 2C0FA 5CRHA 2WJUA 1Y25A 1EP7A 1U88A 5HFKA 2HRAA 3IAS2 4DSSB 3ZIJA 1S3CA 2F9SA 1ERWA 2LUSA 1IYHA 3QOUA 2VL2C 3KTLA 2H74A 5AGYA 3I43A 4I6XA 4H86A 5GAND 5IPGA 5J3RA 4YQUA 4CY8A 2YJHA 1JZDA 4I2UA 5L71A 2REMA 4IN0A 1WJKA 4KDUA 3HJMA 1O81A 1AC1A 4K7NA 1LU4A 1R26A 3ERFA 3HCZA 1PL2A 1V9WA 2HSHA 2PMTA 3P90A 1BX9A 2FA4A 2PVQA 3WD6A 3ME8A 1M7TA 3FW2A 3C73A 5IM9A 4F9ZA 3ZREA 1CQGA 3L4NA 2I1UA 1QGVA 3M0FA 3L9SA 3D6IA 4KCEA 2RM5A 1RQMA 3TRQA 3CRTA 3VI5A 3TKSE 5A4UA 4TXOA 4XS6A 1ACVA 2UZ8A 3IR4A 4JRRA 5CREA 2YJ7A 2O89A 3F4TA 3TB2A 1AIUA 2F3MA 2BMXA 2KP2A 1QFNA 4G0LA 4ICYA 2AUVA 4YQVA 4HI7A 1K0AA 2B5YA 3LSZA 1SL1B 3ZL5A 3OR5A 2I3YA 2R0PA 2MBSA 6GSUA 1I5GA 4TR1A 4TRXA 4POBA 2K6VA 1J08A 4GWRA 4BPYA 3LWAA 3QFBC 1K0CA 1FB6A 3FZ9A 3MSZA 2PN8A 1BG5A 5AN1A 2C3TA 2FWHA 3PR8A 2MMOA 3LQ7A 1THOA 1PSQA 2HFDA 3MNGA 3QAVA 5IIZA 2R5GA 4PNFA 4IHUA 3O3TA 2AHEA 2VL9A 3VWUA 2OACA 1KNGA 3ZIVA 1GWCA 2YZUA 3VWWA 2DJKA 4D73A 3IV4A 5ELAA 2V32A 1Q98A 4EF0A 1DUGA 1M99A 4ZB6A 4WBJA 2WRTA 4MZBA 2M72A 1AXDA 1PA3A 4KUNA 3TKRA 3SWLA 2IMFA 4PGTA 1GTAA 3VI7A 3KCMA 1JLVA 4RQXA 1GSUA 3TJBA 1SKSB 3LXTA 3DMLA 3JCML 3TRXA 4F0BA 4NWYA 3DXBA 2ON7A 4L5LA 3LYKA 4O5RA 1VGLA 4FYCA 1PKWA 3F3RA 4TR1B 2LEGA 1FW1A 1FG4A 5BRTA 3WYWA 1X5CA 4MCUA 5HR3A 4TVEA 4F0CA 4XHMA 3GURA 1YEXA 1AQWA 2HZEA 3HYPA 1T7PB 2VCWA 4YH2A 2RM6A 2EC4A 1O73A 3DIEA 3FY7A 1TI1A 4WEYA 1M9AA 5DJMA 4FYBA 4EDYA 4PUAA 4RI7A 4WR5A 1A8LA 1M2BA 3LGCA 4MPGA 4I8BA 1XWBA 2RUEA 2GLRA 1XZOA 2C3QA 5B7CA 5IO2A 2YNXA 4MF5A 5HQPA 4KF9A 2CAIA 2LNSA 5ECRB 3DRNA 2ON5A 1SL2B 4ZBBA 2GSQA 4ZL7A 4L0WA 2GVPA 1PL1A 4L5OA 2K8VA 2V1MA 2F51A 4IJ3A 4V2LA 2YWIA 4G9HA 1PN9A 5IQYA 2CT6A 2OE1A 3HZ4A 4QL9A 3DYRA 1TU8A 5BMUA 1YEPA 4BVYB 4Q5FA 1T1VA 3EU3A 3E3EA 1B9XC 3F4RA 4ECCA 2MMNA 2AYTA 3FRCA 2X49A 2B5XA 4CW9A 2H6XA 4USSA 2VM1A 1GTBA 4KCAA 4PQ1A 4QL7A 1NW2A 4G0KA 4ZL9A 4POKA 4LL4B 1SYRA 4AJ6A 3DD3A 5DQSA 1K0OA 1PRXA 3VPQA 3ZYWA 2QKEA 3FEUA 3PINA 2F8FA 1XFLA 2O87A 4POMA 3EWLA 3H4KA 5J5NA 5DAKA 1ZYPA 6GSWA 4XCSA 2IWTA 3W6GA 5ENUA 5LD0A 2OKAA 3HJPA 2WGRA 3N9JA 3IRAA 4HEA2 1GNWA 2YZHA 3W8JA 2L6DA 4K5SA 4K2XA 1NHOA 18GSA 1QUWA 3HJOA 1OAZA 1J0FA 1XW5A 4FQUA 2A4HA 1FVJA 1ZMAA 5J9CA 2L59A 4KB3A 3IK9A 3ZVJD 4NAXA 1X0RA 1SD8A 4MF6A 2K18A 2H75A 1N8JA 4K2DA 2DMLA 3C1RA 4GSSA 1O7UA 2A2RA 2HRFA 4IGJA 4MABA 3LXZA 2OE3A 4KDYA 2LSTA 1K3LA 1GUKA 3BD2A 4OCEA 5C00A 1XWCA 1GTIA 4KH7A 1RW1A 1WRYA 3GTUA 3CRUA 5B8AA 1H75A 4WF4A 1TU7A 2FWFA 5ECSA 2FUG2 3TRPA 3CSHA 5IOXA 3GRXA 3Q6OA 1S3DA 1YDKA 2C8UA 1Q4JA 5EL8A 6GSXA 1GH2A 1W4VA 3ED3A 3PGTA 4EO3A 2FGXA 3TJFA 2EIQA 4KW6A 2JSYA 5ID2A 2IJYA 3NZNA 2L5OA 1G0TA 12GSA 5A4VA 3CTFA 4MDCA 3L9VA 1XOBA 3F63A 5KOWA 1K0BA 4ZB8A 2VCVA 2OADA 2ZNMA 2E2MA 1TOFA 1X9MB 2CAQA 4JEDA 1TJDA 3E0UA 1TK5B 4K1FA 5LNKe 2OBKA 4EXJA 1XPVA 1G7OA 2B1LA 2NDOA 4OFMA 4O7HA 5IMDA 3ZVJA 3UBLA 2E2GA 5GSSA 2H6ZA 4MPFA 2DJ2A 3TKSA 2TIRA 1XWGA 2B3SA 3IA1A 1ZOFA 1T3BA 2GTUA 5F07A 4NHZA 1MDJA 3CBUA 3TJGA 1FVKA 4N0ZA 2XC2A 1XBSA 1AUCA 1OC3A 3A2VA 1LBKA 1XXUA 2IMIA 2FCHA 1VF4A 2DJ1A 2H8LA 4TKYA 3QMXA 1M2DA 1PN0A 4KGIA 5FHIA 5INYA 2N5BA 3F6DA 5ID2B 3G7JA 1QMVA 2KP1A 3DGQA 3SBCA 3EC3A 4ID0A 2EIRA 4MLYA 3TCOA 4DVCA 1OVNA 1M0UA 3EINA 3ZLPA 4EUYA 1TXXA 1YF0A 4KE3A 2FLSA 14GSA 2LRNA 5A5KA 3FZ5A 4MZWA 3G7YA 3ZMKA 4V2MA 4HU7A 4EDZA 3GNJA 2PPTA 3GKXA 4MH2A 4TR4A 2AAWA 2G0FA 1MEKA 3RHCA 5A4WA 2KHPA 3L0HA 3GH9A 1XWKA 5G2ZA 4TOPA 1X9SB 3LEFA 4ZBDA 5AISA 4AJ7A 1YZXA 1GSFA 2H0IA 1XIYA 1PMTA 2HSYA 2PVOC 1PKZA 4P3YB 2B6MA 5IO0A 5J41A 2TRCP 1FOVA 4AF2A 4G10A 3BJ5A 5CAXA 1O6JA 1WMJA 3K8NA 1TW9A 3US3A 3BBYA 4MH3A 2IN3A 5DCGA 2IMKA 1SKRB 4ECJA 2KOKA 2BJXA 3CSJA 4KA0A 5IPHA 4MNNA 1T4ZA 1FO5A 2YWMA 1F9MA 1NHYA 3TKQA 2JZTA 5DJLA 2WFCA 1GL8A 1N2AA 1UN2A 1FHEA 5JCUA 1WOUA 3TOUA 2IFQA 4EVMA 1YKCA 1TRUA 3LW9A 3MIXA 3KP9A 4XRDA 2K8SA 2FNOA 4EL1A 3O76A 2BTOT 1OC9A 1OKTA 2H71A 4YQMA 4G2EA 1R7HA 2DIZA 4POLA 5C04A 3HXSA 1K0NA 2HSMA 2FY6A 2LV3A 3FMWA 4EIPA 1MDIA 3MYDA 2GZPA 3QPMA 4V1Ap 4PNGA 4HDEA 5DVBA 3ZTLA 2X64A 3VFIA 1U6TA 3A2XA 3BCIA 1W89A 1UVZA 2X8HA 5ECQB 4HQSA 1EV9A 5LCZA 3ME7A 2GGTA 4I97A 4MJCA 2H6YA 4OO5A 2I9HA 5G31A 3S9FA 4HOJA 5IMZA 3ZITA 2DMMA 1WP0A 1XCCA 2L5LA 5ECNB 3CYNA 3RDWA 1ERVA 2O7KA 4IP6A 4MP4A 5D93A 1B9YC 4ECBA 4PX1A 2IFQB 4K8MA 6GSYA 5G5EA 5IMFA 4F2IA 4WKWA 3J7Yk 3HD5A 1JFUA 2H1AA 3D4TA 1AQVA 1NM3A 3N5OA 3UAPA 2V6OA 1GUMA 4JR4A 3GHAA 2CZ2A 2X4AA 2VL2A 2YV7A 3I69A 1TDIA 4IBPA 4G19A 2HLSA 5JCGA 4ZB9A 4TXOB 2FWGA 1V58A 3KH7A 1ST9A 2H66A 2DLXA 2DBCA 4NHWA 5EVOA 3O6TA 1M2AA 2XBIA 2B7KA 4RUVA 1PX6A 1A2JA 1A2LA 2L4CA 2VLUA 4OO4A 3R2QA 5FT3A 4EE0A 2GSRA 2H1GA 1ERUA 5ECPB 1XVWA 4ZIJA 1HNCA 3GKKA 2LJKA 1X5DA 1GNEA 2VO4A 4HJMA 2ZUPA 4J2FA 2P5RA 2IIYA 2PGTA 5ECHB 1SK2A 2CV4A 5HR1A 3FZ4A 2VLTA 2GT6A 2VCTA 5KN1A 1WIKA 1XVQA 4FO5A 3M8NA 2CX4A 3CMIA 2NBSA 4Z2UA 3GMFA 2H1DA 2D2ZA 3IAM2 4D73B 2V41A 2OJLA 1TKDB 3QAWA 3GV1A 4WR4A 1B4PA 1MD4A 5DQYA 3HY2A 2R2JA 1R5PA 1GSYA 4OWYA 4F82A 3GL3A 4JU5A 4BA7A 1AAZA 3A3TA 3DVXA 3EMXA 2XPDA 1Z7RA 2V6KA 1YKAA 3BOAA 4OFNA 5CP1A 2QGVA 3UEMA 5ECIB 2C0DA 2LJRA 1GSQA 2GQLA 4TW5A 2KLXA 3EVIA 1TTZA 1TRVA 5HFIA 2HYXA 1IYIA 1A2MA 2R0GA 3VWVA 3KIJA 3P7XA 4O5UA 3NOFA 2CVKA 2HRKA 2HZEB 2A2SA 4XS4A 3H79A 1ZYEA 5J9BA 1GRXA 5ECKB 2AB6A 1FAAA 2DJJA 4IQAA 4FIWA 3IOSA 3HA9A 3UOMA 2A4VA 2L4QA 2YN1A 1QXHA 4X1UA 1BYEA 5DALA 5JWQB 3HVXA 1M9BA 2VM2A 1SK0A 4MF7A 4MZCA 4MJBA 1JZWA 3ISOA 2FA8A 4ZILA 4LL1B 1HQOA 4MK3A 1WWJA 3D21A 1MD3A 1T00A 1Z6MA 1GSSA 9GSSA 4I5QA 20GSA 3APSA 1TK8B 4EIQA 4PTSA 4GSTA 22GSA 2G2QA 1SJ6A 2N5AA 3GA4A 5DBQA 6GSTA 1B4QA 3HDCA 2B5EA 1K3YA 2GS3A 2H30A 3GYKA 3FK8A 1SU9A 1WE0A 4Z7XA 5KEJA 4JBBA 5EPFA 1CQHA 1TK0B 5D9VA 2GDRA 3KTBA 2C3NA 1XW9A 2A2PA 1B48A 1R5AA 2JL4A 3P2AA 2RLIA 2WB9A 2QSIA 3QD9A 2IL3A 1VF2A 3P8WA 4HZ2A 2XPEA 4N11A 4YAPA 2X8GA 2GZZA 5B8BA 3F0IA 5CNWA 4HQZA 3GUSA 3FZAA 1HYUA 3UVTA 5GAPD 1GTUA 1H4OA 5G1KA 3GL5A 2CVBA 4NV5A 4L0UA 5DAKB 2ES7A 1MTCA 4X4JA 2HNLA 1JZOA 4BL7A 2VCZA 3TUEA 4PQHA 5H5RA 3KZQA 5H5QA 3HVSA 5FWGA 2JSZA 4YAVA 1GSDA 4RI6A 3RAZA 4DEJA 4OCFA 3FYGA 2HZFA 5CRGA 1GSEA 4NXIA 2E0QA 2R4VA 4TR3A 3ZZXA 1TRSA 1JZRA 2VOCA 5G5FA 1TI3A 1S3AA 3WT1A 1G6WA 4KAEA 10GSA 1DE1A 3IHQA 1DE2A 1KEBA 2CZ3A 2OBIA 17GSA 5G1LA 5E59A 1EGRA 4WBRD 3M1GA 4GCIA 3H8QA 1SJZA 4PQIA 4RQRA 1ZL9A 3A2WA 2YV9A 3IBHA 5E4WA 3WGEA 2H76A 2L57A 3VLNA 3GTUB 2WULA 1HNAA 1EGOA 3IXRA 2O8VB 4ILFA 2VIMA 3R3EA 2VLVA 1UA5A 2AV4A 5H5SA 2QA2A 4Q5NA 2GZYA 2PBJA 4GLTA 4GXZA 4DSSA 3MAKA 4ISDA 2HT9A 4MJEA 2I81A 4OMVA 4LMVA 4F03A 1YQ1A 3D22A 1B8XA 3HZ8A 3HVVA 1ERTA 3KM6A 1F37A 4IQ1A 2L6CA 2PWJA 3LORA 1F3AA 3MWHA 1MDKA 4A5PA 1O8WA 2PUKC 3UL3A 3EE2A 5HR2A 3GIXA 2YOIA 1O8XA 8GSSA 4DSQA 3KGKA 4PXOA 4GSNA 4KDXA 4ZL8A 3F6FA 4FH8A 5GSTA 1HNBA 3D0ZA 4WXTA 2CX3A 3GSTA 2V2GA 5ECLB 2B1KA 3M9JA 3GFKA 1Z3EA 4KNDA 1ILOA 2DC5A 1EEMA 2GQKA 4WF5A 2PU9C 2JZSA 13GSA 3TGZA 3FKFA 2QC7A 5F0GA 2QA1A 1SL0B 4XTSA 3DWVA 1K0DA 1URMA 2LQQA 2GT5A 3F8UA 7GSSA 4IKHA 3APOA 1F2EA 4HUAA 2PERA 4V2NA 5AIVA 3C7MA 3LJRA 1BEDA 3J7Yb 1I9DA 2F8AA 2HXKA 5JWOB 1VRSD 3NIVA 1PGTA 5B6MA 4TXVA 3AY8A 4K9ZA 2JADA 2C1YA 1G7EA 3IPZA 1QQ2A 4TN8A 5DCHA 4HZ4A 5ABRA 3UARA 5J4UA 4Z2RA 3A5IA 11GSA 1EWXA 2FWEA 4G0IA 3HKRA 4I2TA 5AIXA 3UIWA 2O85A 3UMAA 2C0GA 2EIOA 2NPBA 2ZCTA 3QCPA 2H1BA 1PX7A 4ECIA 5KN2A 4Q5RA 4L8EA 5HFGA 2J9HA 4KX4A 2JU5A 4Z2TA 4X0XA 3IC8A 1V2AA 4K5RA 3EYTA 4ZXGA 2WCIA 4ML6A 3VWXA 1DBYA 3U6VA 3PPUA 2FD3A 3U5RE 4FYUA 2LRCA 2Z9SA 3IE3A 1TRWA 5JCWA 1A24A 3ERWA 3C8EA 1F6MC 1OC9B 1A0RP 4O92A 5D9WA 4N0VA 4JR6A 1OKDA 2TRXA 3G9BA 3FR9A 4X43A 5ECOB 5HR0A 1BQ7A 3IK7A 4K7OA 1GUHA 5F8BA 3KJYA 4NV2A 2MMAA 1EOGA 4XIHA 1R4WA 5D9XA 3VURA 4YKGA 2C80A 3WGDA 3ERGA 4E8HA 4GTUA 4WETA 3DEXA 1OE7A 2MBTA 1RK4A 2MZCA 3GX8A 4ACSA 2VCXA 3KXOA 3L78A 3Q74A 2C4JA 2C0EA 4IW9A 3E9JB 1XOAA 3WGXA 3RPPA 3RHBA 4HJ2A 1K3OA 5ECMB 2VD0A 4AJ8A 1X5EA 2H19A 1SYXA 2LTKA 3KMOA 3EU4A 4BVYA 4K6XA 2WZ9A 3EURA 1K0MA 3KEBA 4TR0A 1ML6A 1EOHA 2YWOA 4ULXA 1SENA 1ZGNA 4IJIA 3VPTA 2LRTA 3L9UA 3C71A 1PQNA 2YANA 3I6AA 3QFAC 3CSIA 2VCQA 4PURA 5G30A 1OC8A 3F3QA 5D8IA 1LJRA 3KD0A 2WDUA 1XWAA 1V57A 2K9FA 3I9V2 2R3XA 3CXGA 2CVDA 1OE8A 3TJJA 1C72A 1A0FA 5D96A 2LNTA 3F4SA 1GLQA 2H73A 1A8YA 2ALBA 16GSA 2DIYA 3Q19A 2M46A 4LA1A 5B6NA 3D5JA 2VL3A 2VUPA 4OD7A 3QDNA 4CHSA 1UC7A 2DKHA 2YWNA 2MYGA 1EZKA 3GN3A 1GULA 4O32A 3HHVA 4O5QA 1F3BA 2GQMA 2NVLA 2JACA 2X99A 2XHFA 3GKNA 4NMUA 1SK1A 4N30A 2R37A 3TOTA 1X9WB 4BWSA 1JLWA 5EY6A 3EPTA 1THXA 2R6KA 1J9BA 3DKSA 3MDKA 2H0HA 5COHA 3ZMLA 5KN3A 1BAYA 3V1WA 1SD9A 2P0GA 3Q18A 3C1SA 5D9TA 1ABAA 5CYYA 1G6YA 4XRAA 4EC0A 1U3AA 3RPNA 2DJ3A 4BVXA 3VK9A 3F9UA 4IELA 6GSVA 2KUCA 3TKSC 3FHKA 3ZFLA 2OE0A 3IHGA 1GLPA 1U87A 2LQOA 3FR6A 4YKFA 1BJXA 2CQ9A 1U3IA 1JHBA 2DSAA 2M80A 3FR3A 4K7IA 1FB0A 4GRFA 3UVHA 3TJKA 3M3MA 2J23A 1EP8A 4HU9A 3A5WA 1USBA 2DKIA 2N5FA 5F06A 1Y6EA 1VF1A 2GSTA 2H72A 3H93A 5GZZB 4ZBAA 1QK8A 2XBQA 3W8SA 4E8EA 4LMWA 4XS4B 2CA8A 3G7IA 2GSSA 4GQCA 2H70A 4KSOA 4CY6A 1T4YA 5DDLA 2WS2A 4LLRA 3LFLA 3TDGA 1Z6NA 5DALB 4J56E 1ON4A 5ELGA 1YJ6A 2JZRA 4DSRA 2I4AA 4PUFC 4JZQA 4BWQA 2E7PA 2R0CA 2IMEA 4GF0A 2B7JA 4K0NA 2HE3A 4BVXB 4MMMA 5F05A 1ZCPA 1HD2A 1Z9HA 2HI7A 2YPMA 1ZYNA 2RUFA 6GSSA 2P31A 3QR6A 3ZRDA 2IMDA 4V1Ag 3EMPA 4MJAA 4MA9A 2LJAA 4IVFA 5KOXA 1XW6A 1ZYQB 3ZFBA 1AW9A 1A23A 3RBTA 4AGSA 2YP6A 1DSBA 1TP9A 5CRDA 4XS1A 1OYJA 3APQA 3GKMA 3D4MA 5CRWA 1SKWB 3GX0A 1Z7PA 1NSWA 3LYPA 2DJ0A 4J57E 5D73A 1V40A 3WT2A 4QQ7A 4GQFA 5JWRB 4NPBA 3UJ1A 1E6BA 1YF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EKZ A;  3UBK A;  3KP8 A;  2LS5 A;  3KMN A;  1YY7 A;  2H0G A;  3IC4 A;  3TKP A;  2P5Q A;  2AJQ B;  1SJI A;  1VF3 A;  2X8C A;  1Z5Y E;  3LG6 A;  4Q5Q A;  2MMZ A;  4CDO A;  3IDV A;  5IOW A;  4OFT A;  1PD2 1;  2HRN A;  2NTO A;  2H01 A;  1O85 A;  5CO3 A;  1T8E B;  19GS A;  2FHE A;  1E2Y A;  1KTE A;  3GH6 A;  2RII A;  3CTG A;  2YCD A;  1EV4 A;  5IMV A;  4KSM A;  3QAG A;  3H1N A;  4HS1 A;  1KBN A;  2IPA A;  1V98 A;  4IS0 A;  4N10 A;  1GP1 A;  3DVW A;  1WPI A;  3M9K A;  2OA7 A;  4IP1 A;  5IMA A;  2LKU A;  2VD1 A;  3BCK A;  3PH9 A;  1ZZY A;  2VAF A;  4K0G A;  1AQX A;  3GSS A;  5KN0 A;  3KH9 A;  4JE1 A;  4ML1 A;  5IMC A;  1EEJ A;  2C0F A;  5CRH A;  2WJU A;  1Y25 A;  1EP7 A;  1U88 A;  5HFK A;  3IAS 2;  4DSS B;  3ZIJ A;  1S3C A;  2F9S A;  1ERW A;  2LUS A;  1IYH A;  3QOU A;  2VL2 C;  3KTL A;  2H74 A;  5AGY A;  3I43 A;  4I6X A;  4H86 A;  5GAN D;  5IPG A;  5J3R A;  4YQU A;  2YJH A;  1JZD A;  4I2U A;  5L71 A;  2REM A;  4IN0 A;  1WJK A;  4KDU A;  3HJM A;  1O81 A;  1AC1 A;  4K7N A;  1LU4 A;  1R26 A;  3ERF A;  3HCZ A;  1PL2 A;  1V9W A;  2HSH A;  2PMT A;  3P90 A;  1BX9 A;  2FA4 A;  2PVQ A;  3WD6 A;  3ME8 A;  1M7T A;  3FW2 A;  3C73 A;  5IM9 A;  4F9Z A;  3ZRE A;  1CQG A;  3L4N A;  2I1U A;  1QGV A;  3M0F A;  3L9S A;  3D6I A;  4KCE A;  2RM5 A;  1RQM A;  3TRQ A;  3CRT A;  3VI5 A;  3TKS E;  5A4U A;  4TXO A;  4XS6 A;  1ACV A;  3IR4 A;  4JRR A;  5CRE A;  2YJ7 A;  2O89 A;  3F4T A;  3TB2 A;  1AIU A;  2F3M A;  2BMX A;  2KP2 A;  1QFN A;  2AUV A;  4YQV A;  4HI7 A;  1K0A A;  2B5Y A;  3LSZ A;  1SL1 B;  3ZL5 A;  3OR5 A;  2I3Y A;  2MBS A;  6GSU A;  1I5G A;  4TR1 A;  4TRX A;  4POB A;  2K6V A;  1J08 A;  4GWR A;  4BPY A;  3LWA A;  3QFB C;  1K0C A;  1FB6 A;  3FZ9 A;  3MSZ A;  2PN8 A;  1BG5 A;  5AN1 A;  2C3T A;  2FWH A;  3PR8 A;  2MMO A;  3LQ7 A;  1THO A;  1PSQ A;  2HFD A;  3MNG A;  3QAV A;  5IIZ A;  2R5G A;  4PNF A;  4IHU A;  3O3T A;  2AHE A;  2VL9 A;  3VWU A;  2OAC A;  1KNG A;  3ZIV A;  1GWC A;  2YZU A;  3VWW A;  2DJK A;  4D73 A;  3IV4 A;  5ELA A;  2V32 A;  1Q98 A;  4EF0 A;  1DUG A;  1M99 A;  4ZB6 A;  4WBJ A;  2WRT A;  4MZB A;  2M72 A;  1AXD A;  1PA3 A;  4KUN A;  3TKR A;  3SWL A;  2IMF A;  4PGT A;  1GTA A;  3VI7 A;  3KCM A;  1JLV A;  4RQX A;  1GSU A;  3TJB A;  1SKS B;  3LXT A;  3DML A;  3JCM L;  3TRX A;  4F0B A;  4NWY A;  3DXB A;  2ON7 A;  4L5L A;  3LYK A;  4O5R A;  1VGL A;  4FYC A;  1PKW A;  3F3R A;  4TR1 B;  2LEG A;  1FW1 A;  1FG4 A;  3WYW A;  1X5C A;  4MCU A;  5HR3 A;  4TVE A;  4F0C A;  4XHM A;  3GUR A;  1YEX A;  1AQW A;  2HZE A;  3HYP A;  1T7P B;  2VCW A;  4YH2 A;  2RM6 A;  2EC4 A;  1O73 A;  3DIE A;  3FY7 A;  1TI1 A;  4WEY A;  1M9A A;  5DJM A;  4FYB A;  4EDY A;  4PUA A;  4RI7 A;  4WR5 A;  1A8L A;  1M2B A;  3LGC A;  4MPG A;  4I8B A;  1XWB A;  2RUE A;  2GLR A;  1XZO A;  2C3Q A;  5B7C A;  5IO2 A;  2YNX A;  4MF5 A;  5HQP A;  2CAI A;  2LNS A;  5ECR B;  3DRN A;  2ON5 A;  1SL2 B;  4ZBB A;  2GSQ A;  4ZL7 A;  4L0W A;  2GVP A;  1PL1 A;  4L5O A;  2K8V A;  2V1M A;  2F51 A;  4IJ3 A;  4V2L A;  2YWI A;  4G9H A;  1PN9 A;  5IQY A;  2CT6 A;  2OE1 A;  3HZ4 A;  4QL9 A;  3DYR A;  1TU8 A;  1YEP A;  4Q5F A;  1T1V A;  3EU3 A;  3E3E A;  1B9X C;  3F4R A;  4ECC A;  2MMN A;  2AYT A;  3FRC A;  2B5X A;  4CW9 A;  2H6X A;  2VM1 A;  1GTB A;  4KCA A;  4PQ1 A;  4QL7 A;  1NW2 A;  4ZL9 A;  4POK A;  4LL4 B;  1SYR A;  4AJ6 A;  3DD3 A;  5DQS A;  1K0O A;  1PRX A;  3VPQ A;  3ZYW A;  2QKE A;  3FEU A;  3PIN A;  2F8F A;  1XFL A;  2O87 A;  4POM A;  3EWL A;  3H4K A;  5J5N A;  5DAK A;  6GSW A;  4XCS A;  2IWT A;  3W6G A;  5ENU A;  5LD0 A;  2OKA A;  3HJP A;  2WGR A;  3N9J A;  3IRA A;  4HEA 2;  1GNW A;  2YZH A;  3W8J A;  2L6D A;  1NHO A;  18GS A;  1QUW A;  3HJO A;  1OAZ A;  1J0F A;  1XW5 A;  1FVJ A;  1ZMA A;  5J9C A;  2L59 A;  4KB3 A;  3IK9 A;  3ZVJ D;  4NAX A;  1X0R A;  1SD8 A;  4MF6 A;  2K18 A;  2H75 A;  1N8J A;  4K2D A;  2DML A;  3C1R A;  4GSS A;  1O7U A;  2A2R A;  2HRF A;  4IGJ A;  4MAB A;  3LXZ A;  2OE3 A;  4KDY A;  2LST A;  1K3L A;  1GUK A;  3BD2 A;  4OCE A;  5C00 A;  1XWC A;  1GTI A;  4KH7 A;  1RW1 A;  1WRY A;  3GTU A;  3CRU A;  5B8A A;  1H75 A;  4WF4 A;  1TU7 A;  2FWF A;  5ECS A;  2FUG 2;  3TRP A;  3CSH A;  5IOX A;  3GRX A;  3Q6O A;  1S3D A;  1YDK A;  2C8U A;  1Q4J A;  5EL8 A;  6GSX A;  1GH2 A;  1W4V A;  3ED3 A;  3PGT A;  4EO3 A;  2FGX A;  3TJF A;  2EIQ A;  4KW6 A;  2JSY A;  5ID2 A;  2IJY A;  3NZN A;  2L5O A;  1G0T A;  12GS A;  5A4V A;  3CTF A;  4MDC A;  3L9V A;  1XOB A;  3F63 A;  1K0B A;  4ZB8 A;  2VCV A;  2OAD A;  2ZNM A;  2E2M A;  1TOF A;  1X9M B;  2CAQ A;  4JED A;  1TJD A;  3E0U A;  1TK5 B;  4K1F A;  5LNK e;  2OBK A;  4EXJ A;  1XPV A;  1G7O A;  2B1L A;  2NDO A;  4OFM A;  4O7H A;  5IMD A;  3ZVJ A;  3UBL A;  2E2G A;  5GSS A;  2H6Z A;  4MPF A;  2DJ2 A;  3TKS A;  2TIR A;  1XWG A;  2B3S A;  3IA1 A;  1ZOF A;  1T3B A;  2GTU A;  5F07 A;  4NHZ A;  1MDJ A;  3CBU A;  3TJG A;  1FVK A;  4N0Z A;  2XC2 A;  1XBS A;  1AUC A;  1OC3 A;  3A2V A;  1LBK A;  1XXU A;  2IMI A;  2FCH A;  1VF4 A;  2DJ1 A;  2H8L A;  4TKY A;  3QMX A;  1M2D A;  4KGI A;  5FHI A;  5INY A;  2N5B A;  3F6D A;  5ID2 B;  3G7J A;  1QMV A;  2KP1 A;  3DGQ A;  3SBC A;  3EC3 A;  4ID0 A;  2EIR A;  4MLY A;  3TCO A;  4DVC A;  1OVN A;  1M0U A;  3EIN A;  3ZLP A;  4EUY A;  1TXX A;  1YF0 A;  4KE3 A;  2FLS A;  14GS A;  2LRN A;  5A5K A;  3FZ5 A;  4MZW A;  3G7Y A;  3ZMK A;  4V2M A;  4HU7 A;  4EDZ A;  3GNJ A;  2PPT A;  3GKX A;  4MH2 A;  4TR4 A;  2AAW A;  2G0F A;  1MEK A;  3RHC A;  5A4W A;  2KHP A;  3L0H A;  3GH9 A;  1XWK A;  5G2Z A;  4TOP A;  1X9S B;  3LEF A;  4ZBD A;  5AIS A;  4AJ7 A;  1YZX A;  1GSF A;  2H0I A;  1XIY A;  1PMT A;  2HSY A;  2PVO C;  1PKZ A;  4P3Y B;  2B6M A;  5IO0 A;  5J41 A;  2TRC P;  1FOV A;  4AF2 A;  4G10 A;  3BJ5 A;  5CAX A;  1O6J A;  1WMJ A;  3K8N A;  1TW9 A;  3US3 A;  3BBY A;  4MH3 A;  2IN3 A;  5DCG A;  2IMK A;  1SKR B;  4ECJ A;  2KOK A;  2BJX A;  3CSJ A;  4KA0 A;  5IPH A;  1T4Z A;  1FO5 A;  2YWM A;  1F9M A;  1NHY A;  3TKQ A;  2JZT A;  5DJL A;  2WFC A;  1GL8 A;  1N2A A;  1UN2 A;  1FHE A;  5JCU A;  1WOU A;  3TOU A;  2IFQ A;  4EVM A;  1YKC A;  1TRU A;  3KP9 A;  4XRD A;  2K8S A;  2FNO A;  4EL1 A;  3O76 A;  2BTO T;  1OC9 A;  1OKT A;  2H71 A;  4YQM A;  4G2E A;  1R7H A;  2DIZ A;  4POL A;  5C04 A;  3HXS A;  1K0N A;  2FY6 A;  2LV3 A;  1MDI A;  2GZP A;  3QPM A;  4V1A p;  4PNG A;  4HDE A;  5DVB A;  3ZTL A;  2X64 A;  3VFI A;  1U6T A;  3A2X A;  3BCI A;  1W89 A;  1UVZ A;  2X8H A;  5ECQ B;  4HQS A;  1EV9 A;  5LCZ A;  3ME7 A;  2GGT A;  4I97 A;  4MJC A;  2H6Y A;  4OO5 A;  2I9H A;  5G31 A;  3S9F A;  4HOJ A;  5IMZ A;  3ZIT A;  2DMM A;  1WP0 A;  1XCC A;  2L5L A;  5ECN B;  3CYN A;  3RDW A;  1ERV A;  2O7K A;  4IP6 A;  4MP4 A;  5D93 A;  1B9Y C;  4ECB A;  4PX1 A;  2IFQ B;  4K8M A;  6GSY A;  5G5E A;  5IMF A;  4F2I A;  4WKW A;  3J7Y k;  3HD5 A;  1JFU A;  2H1A A;  3D4T A;  1AQV A;  1NM3 A;  3N5O A;  3UAP A;  2V6O A;  1GUM A;  4JR4 A;  3GHA A;  2CZ2 A;  2VL2 A;  2YV7 A;  3I69 A;  1TDI A;  4IBP A;  4G19 A;  2HLS A;  5JCG A;  4ZB9 A;  4TXO B;  2FWG A;  1V58 A;  3KH7 A;  1ST9 A;  2H66 A;  2DLX A;  2DBC A;  4NHW A;  5EVO A;  3O6T A;  1M2A A;  2XBI A;  2B7K A;  4RUV A;  1PX6 A;  1A2J A;  1A2L A;  2L4C A;  2VLU A;  4OO4 A;  3R2Q A;  5FT3 A;  4EE0 A;  2GSR A;  2H1G A;  1ERU A;  5ECP B;  1XVW A;  4ZIJ A;  1HNC A;  3GKK A;  2LJK A;  1X5D A;  1GNE A;  2VO4 A;  4HJM A;  2ZUP A;  4J2F A;  2P5R A;  2IIY A;  2PGT A;  5ECH B;  1SK2 A;  2CV4 A;  5HR1 A;  3FZ4 A;  2VLT A;  2GT6 A;  2VCT A;  5KN1 A;  1WIK A;  1XVQ A;  4FO5 A;  3M8N A;  2CX4 A;  3CMI A;  2NBS A;  3GMF A;  2H1D A;  2D2Z A;  3IAM 2;  4D73 B;  2V41 A;  2OJL A;  1TKD B;  3QAW A;  3GV1 A;  4WR4 A;  1B4P A;  1MD4 A;  5DQY A;  3HY2 A;  2R2J A;  1R5P A;  1GSY A;  4OWY A;  4F82 A;  3GL3 A;  4JU5 A;  4BA7 A;  1AAZ A;  3A3T A;  3DVX A;  3EMX A;  2XPD A;  1Z7R A;  2V6K A;  1YKA A;  3BOA A;  4OFN A;  5CP1 A;  2QGV A;  3UEM A;  5ECI B;  2C0D A;  2LJR A;  1GSQ A;  2GQL A;  4TW5 A;  2KLX A;  3EVI A;  1TTZ A;  1TRV A;  5HFI A;  2HYX A;  1IYI A;  1A2M A;  3VWV A;  3KIJ A;  3P7X A;  3NOF A;  2CVK A;  2HZE B;  2A2S A;  4XS4 A;  3H79 A;  1ZYE A;  5J9B A;  1GRX A;  5ECK B;  2AB6 A;  1FAA A;  2DJJ A;  4IQA A;  4FIW A;  3IOS A;  3HA9 A;  3UOM A;  2A4V A;  2L4Q A;  2YN1 A;  1QXH A;  4X1U A;  1BYE A;  5DAL A;  5JWQ B;  3HVX A;  1M9B A;  2VM2 A;  1SK0 A;  4MF7 A;  4MZC A;  4MJB A;  1JZW A;  3ISO A;  2FA8 A;  4ZIL A;  4LL1 B;  1HQO A;  4MK3 A;  1WWJ A;  3D21 A;  1MD3 A;  1T00 A;  1Z6M A;  1GSS A;  9GSS A;  4I5Q A;  20GS A;  3APS A;  1TK8 B;  4GST A;  22GS A;  2G2Q A;  1SJ6 A;  2N5A A;  3GA4 A;  5DBQ A;  6GST A;  1B4Q A;  3HDC A;  2B5E A;  1K3Y A;  2GS3 A;  2H30 A;  3GYK A;  3FK8 A;  1SU9 A;  1WE0 A;  4Z7X A;  5KEJ A;  4JBB A;  5EPF A;  1CQH A;  1TK0 B;  5D9V A;  2GDR A;  3KTB A;  2C3N A;  1XW9 A;  1B48 A;  1R5A A;  2JL4 A;  3P2A A;  2RLI A;  2WB9 A;  2QSI A;  3QD9 A;  2IL3 A;  1VF2 A;  3P8W A;  4HZ2 A;  2XPE A;  4N11 A;  4YAP A;  2X8G A;  2GZZ A;  5B8B A;  3F0I A;  5CNW A;  4HQZ A;  3GUS A;  3FZA A;  1HYU A;  3UVT A;  5GAP D;  1GTU A;  1H4O A;  5G1K A;  3GL5 A;  2CVB A;  4NV5 A;  4L0U A;  5DAK B;  2ES7 A;  1MTC A;  2HNL A;  1JZO A;  4BL7 A;  2VCZ A;  3TUE A;  4PQH A;  5H5R A;  3KZQ A;  5H5Q A;  3HVS A;  5FWG A;  2JSZ A;  4YAV A;  1GSD A;  4RI6 A;  3RAZ A;  4DEJ A;  4OCF A;  3FYG A;  2HZF A;  5CRG A;  1GSE A;  4NXI A;  2E0Q A;  2R4V A;  4TR3 A;  3ZZX A;  1TRS A;  1JZR A;  2VOC A;  5G5F A;  1TI3 A;  1S3A A;  3WT1 A;  1G6W A;  4KAE A;  10GS A;  1DE1 A;  3IHQ A;  1DE2 A;  1KEB A;  2CZ3 A;  2OBI A;  17GS A;  5G1L A;  5E59 A;  1EGR A;  4WBR D;  3M1G A;  4GCI A;  3H8Q A;  1SJZ A;  4PQI A;  4RQR A;  1ZL9 A;  3A2W A;  2YV9 A;  3IBH A;  5E4W A;  3WGE A;  2H76 A;  2L57 A;  3VLN A;  3GTU B;  2WUL A;  1HNA A;  1EGO A;  3IXR A;  2O8V B;  4ILF A;  2VIM A;  2VLV A;  1UA5 A;  2AV4 A;  5H5S A;  4Q5N A;  2GZY A;  2PBJ A;  4GLT A;  4GXZ A;  4DSS A;  3MAK A;  4ISD A;  2HT9 A;  4MJE A;  2I81 A;  4OMV A;  4LMV A;  4F03 A;  1YQ1 A;  3D22 A;  1B8X A;  3HZ8 A;  3HVV A;  1ERT A;  3KM6 A;  1F37 A;  4IQ1 A;  2L6C A;  2PWJ A;  3LOR A;  1F3A A;  3MWH A;  1MDK A;  1O8W A;  2PUK C;  3UL3 A;  3EE2 A;  5HR2 A;  3GIX A;  2YOI A;  1O8X A;  8GSS A;  4DSQ A;  3KGK A;  4PXO A;  4GSN A;  4KDX A;  4ZL8 A;  3F6F A;  4FH8 A;  5GST A;  1HNB A;  3D0Z A;  4WXT A;  2CX3 A;  3GST A;  2V2G A;  5ECL B;  2B1K A;  3M9J A;  3GFK A;  1Z3E A;  4KND A;  1ILO A;  2DC5 A;  1EEM A;  2GQK A;  4WF5 A;  2PU9 C;  2JZS A;  13GS A;  3TGZ A;  3FKF A;  2QC7 A;  5F0G A;  1SL0 B;  4XTS A;  3DWV A;  1K0D A;  1URM A;  2LQQ A;  2GT5 A;  3F8U A;  7GSS A;  4IKH A;  3APO A;  1F2E A;  4HUA A;  2PER A;  4V2N A;  5AIV A;  3C7M A;  3LJR A;  1BED A;  3J7Y b;  1I9D A;  2F8A A;  2HXK A;  5JWO B;  1VRS D;  3NIV A;  1PGT A;  5B6M A;  4TXV A;  3AY8 A;  4K9Z A;  2JAD A;  2C1Y A;  1G7E A;  3IPZ A;  1QQ2 A;  4TN8 A;  5DCH A;  4HZ4 A;  5ABR A;  3UAR A;  5J4U A;  11GS A;  1EWX A;  2FWE A;  3HKR A;  4I2T A;  5AIX A;  3UIW A;  2O85 A;  3UMA A;  2C0G A;  2EIO A;  2NPB A;  2ZCT A;  3QCP A;  2H1B A;  1PX7 A;  4ECI A;  5KN2 A;  4Q5R A;  4L8E A;  5HFG A;  2J9H A;  4KX4 A;  2JU5 A;  4X0X A;  1V2A A;  3EYT A;  4ZXG A;  2WCI A;  4ML6 A;  3VWX A;  1DBY A;  3U6V A;  2FD3 A;  3U5R E;  4FYU A;  2LRC A;  2Z9S A;  3IE3 A;  1TRW A;  5JCW A;  1A24 A;  3ERW A;  3C8E A;  1F6M C;  1OC9 B;  1A0R P;  4O92 A;  5D9W A;  4N0V A;  4JR6 A;  1OKD A;  2TRX A;  3G9B A;  3FR9 A;  4X43 A;  5ECO B;  5HR0 A;  1BQ7 A;  3IK7 A;  4K7O A;  1GUH A;  5F8B A;  3KJY A;  4NV2 A;  2MMA A;  1EOG A;  4XIH A;  1R4W A;  5D9X A;  3VUR A;  2C80 A;  3WGD A;  3ERG A;  4E8H A;  4GTU A;  4WET A;  3DEX A;  1OE7 A;  2MBT A;  1RK4 A;  2MZC A;  3GX8 A;  4ACS A;  2VCX A;  3KXO A;  3L78 A;  3Q74 A;  2C4J A;  2C0E A;  4IW9 A;  3E9J B;  1XOA A;  3WGX A;  3RPP A;  3RHB A;  4HJ2 A;  1K3O A;  5ECM B;  2VD0 A;  4AJ8 A;  1X5E A;  2H19 A;  1SYX A;  2LTK A;  3KMO A;  3EU4 A;  4BVY A;  4K6X A;  2WZ9 A;  3EUR A;  1K0M A;  3KEB A;  4TR0 A;  1ML6 A;  1EOH A;  2YWO A;  4ULX A;  1SEN A;  1ZGN A;  4IJI A;  3VPT A;  2LRT A;  3L9U A;  3C71 A;  1PQN A;  2YAN A;  3I6A A;  3QFA C;  3CSI A;  2VCQ A;  4PUR A;  5G30 A;  1OC8 A;  3F3Q A;  5D8I A;  1LJR A;  3KD0 A;  2WDU A;  1XWA A;  1V57 A;  2K9F A;  3I9V 2;  2R3X A;  3CXG A;  2CVD A;  1OE8 A;  3TJJ A;  1C72 A;  1A0F A;  5D96 A;  2LNT A;  3F4S A;  1GLQ A;  2H73 A;  1A8Y A;  2ALB A;  16GS A;  2DIY A;  3Q19 A;  2M46 A;  4LA1 A;  5B6N A;  3D5J A;  2VL3 A;  2VUP A;  4OD7 A;  3QDN A;  4CHS A;  1UC7 A;  2YWN A;  2MYG A;  1EZK A;  3GN3 A;  1GUL A;  4O32 A;  3HHV A;  1F3B A;  2GQM A;  2NVL A;  2JAC A;  2X99 A;  2XHF A;  3GKN A;  4NMU A;  1SK1 A;  4N30 A;  2R37 A;  3TOT A;  1X9W B;  4BWS A;  1JLW A;  5EY6 A;  1THX A;  2R6K A;  1J9B A;  3DKS A;  3MDK A;  2H0H A;  5COH A;  3ZML A;  5KN3 A;  1BAY A;  3V1W A;  1SD9 A;  2P0G A;  3Q18 A;  3C1S A;  5D9T A;  1ABA A;  5CYY A;  1G6Y A;  4XRA A;  4EC0 A;  1U3A A;  3RPN A;  2DJ3 A;  4BVX A;  3VK9 A;  3F9U A;  4IEL A;  6GSV A;  2KUC A;  3TKS C;  3FHK A;  3ZFL A;  2OE0 A;  1GLP A;  1U87 A;  2LQO A;  3FR6 A;  1BJX A;  2CQ9 A;  1U3I A;  1JHB A;  2DSA A;  2M80 A;  3FR3 A;  4K7I A;  1FB0 A;  4GRF A;  3UVH A;  3TJK A;  3M3M A;  2J23 A;  1EP8 A;  4HU9 A;  3A5W A;  1USB A;  2N5F A;  5F06 A;  1Y6E A;  1VF1 A;  2GST A;  2H72 A;  3H93 A;  5GZZ B;  4ZBA A;  1QK8 A;  2XBQ A;  3W8S A;  4E8E A;  4LMW A;  4XS4 B;  2CA8 A;  3G7I A;  2GSS A;  4GQC A;  2H70 A;  4KSO A;  1T4Y A;  5DDL A;  2WS2 A;  4LLR A;  3LFL A;  3TDG A;  1Z6N A;  5DAL B;  4J56 E;  1ON4 A;  5ELG A;  1YJ6 A;  2JZR A;  4DSR A;  2I4A A;  4PUF C;  4JZQ A;  4BWQ A;  2E7P A;  2IME A;  4GF0 A;  2B7J A;  4K0N A;  2HE3 A;  4MMM A;  5F05 A;  1ZCP A;  1HD2 A;  1Z9H A;  2HI7 A;  2YPM A;  2RUF A;  6GSS A;  2P31 A;  3QR6 A;  3ZRD A;  2IMD A;  4V1A g;  3EMP A;  4MJA A;  4MA9 A;  2LJA A;  4IVF A;  1XW6 A;  1ZYQ B;  3ZFB A;  1AW9 A;  1A23 A;  3RBT A;  4AGS A;  2YP6 A;  1DSB A;  1TP9 A;  5CRD A;  4XS1 A;  1OYJ A;  3APQ A;  3GKM A;  3D4M A;  5CRW A;  1SKW B;  3GX0 A;  1Z7P A;  1NSW A;  3LYP A;  2DJ0 A;  4J57 E;  5D73 A;  1V40 A;  3WT2 A;  4QQ7 A;  4GQF A;  5JWR B;  4NPB A;  3UJ1 A;  1E6B A;  1YF1 A; 
#chains in the Genus database with same CATH topology
 4EKZ A;  3UBK A;  3KP8 A;  2LS5 A;  3KMN A;  1YY7 A;  2H0G A;  3IC4 A;  3TKP A;  2P5Q A;  2AJQ B;  1SJI A;  1VF3 A;  2X8C A;  1Z5Y E;  3LG6 A;  4Q5Q A;  4BL7 B;  2MMZ A;  4CDO A;  3IDV A;  5IOW A;  4OFT A;  1PD2 1;  2HRN A;  2NTO A;  2H01 A;  1O85 A;  5CO3 A;  1T8E B;  19GS A;  2FHE A;  1E2Y A;  1FOH A;  1KTE A;  3GH6 A;  2RII A;  3CTG A;  2YCD A;  1EV4 A;  5IMV A;  4KSM A;  3QAG A;  3H1N A;  4HS1 A;  1KBN A;  2IPA A;  1V98 A;  4IS0 A;  4N10 A;  1GP1 A;  3DVW A;  1WPI A;  3M9K A;  2OA7 A;  4IP1 A;  5IMA A;  2LKU A;  2VD1 A;  3BCK A;  3PH9 A;  1ZZY A;  2VAF A;  4K0G A;  1AQX A;  3GSS A;  5KN0 A;  3KH9 A;  4JE1 A;  4ML1 A;  5IMC A;  1EEJ A;  2C0F A;  5CRH A;  2WJU A;  1Y25 A;  1EP7 A;  1U88 A;  5HFK A;  2HRA A;  3IAS 2;  4DSS B;  3ZIJ A;  1S3C A;  2F9S A;  1ERW A;  2LUS A;  1IYH A;  3QOU A;  2VL2 C;  3KTL A;  2H74 A;  5AGY A;  3I43 A;  4I6X A;  4H86 A;  5GAN D;  5IPG A;  5J3R A;  4YQU A;  4CY8 A;  2YJH A;  1JZD A;  4I2U A;  5L71 A;  2REM A;  4IN0 A;  1WJK A;  4KDU A;  3HJM A;  1O81 A;  1AC1 A;  4K7N A;  1LU4 A;  1R26 A;  3ERF A;  3HCZ A;  1PL2 A;  1V9W A;  2HSH A;  2PMT A;  3P90 A;  1BX9 A;  2FA4 A;  2PVQ A;  3WD6 A;  3ME8 A;  1M7T A;  3FW2 A;  3C73 A;  5IM9 A;  4F9Z A;  3ZRE A;  1CQG A;  3L4N A;  2I1U A;  1QGV A;  3M0F A;  3L9S A;  3D6I A;  4KCE A;  2RM5 A;  1RQM A;  3TRQ A;  3CRT A;  3VI5 A;  3TKS E;  5A4U A;  4TXO A;  4XS6 A;  1ACV A;  2UZ8 A;  3IR4 A;  4JRR A;  5CRE A;  2YJ7 A;  2O89 A;  3F4T A;  3TB2 A;  1AIU A;  2F3M A;  2BMX A;  2KP2 A;  1QFN A;  4G0L A;  4ICY A;  2AUV A;  4YQV A;  4HI7 A;  1K0A A;  2B5Y A;  3LSZ A;  1SL1 B;  3ZL5 A;  3OR5 A;  2I3Y A;  2R0P A;  2MBS A;  6GSU A;  1I5G A;  4TR1 A;  4TRX A;  4POB A;  2K6V A;  1J08 A;  4GWR A;  4BPY A;  3LWA A;  3QFB C;  1K0C A;  1FB6 A;  3FZ9 A;  3MSZ A;  2PN8 A;  1BG5 A;  5AN1 A;  2C3T A;  2FWH A;  3PR8 A;  2MMO A;  3LQ7 A;  1THO A;  1PSQ A;  2HFD A;  3MNG A;  3QAV A;  5IIZ A;  2R5G A;  4PNF A;  4IHU A;  3O3T A;  2AHE A;  2VL9 A;  3VWU A;  2OAC A;  1KNG A;  3ZIV A;  1GWC A;  2YZU A;  3VWW A;  2DJK A;  4D73 A;  3IV4 A;  5ELA A;  2V32 A;  1Q98 A;  4EF0 A;  1DUG A;  1M99 A;  4ZB6 A;  4WBJ A;  2WRT A;  4MZB A;  2M72 A;  1AXD A;  1PA3 A;  4KUN A;  3TKR A;  3SWL A;  2IMF A;  4PGT A;  1GTA A;  3VI7 A;  3KCM A;  1JLV A;  4RQX A;  1GSU A;  3TJB A;  1SKS B;  3LXT A;  3DML A;  3JCM L;  3TRX A;  4F0B A;  4NWY A;  3DXB A;  2ON7 A;  4L5L A;  3LYK A;  4O5R A;  1VGL A;  4FYC A;  1PKW A;  3F3R A;  4TR1 B;  2LEG A;  1FW1 A;  1FG4 A;  5BRT A;  3WYW A;  1X5C A;  4MCU A;  5HR3 A;  4TVE A;  4F0C A;  4XHM A;  3GUR A;  4BIK A;  1YEX A;  1AQW A;  2HZE A;  3HYP A;  1T7P B;  2VCW A;  4YH2 A;  2RM6 A;  2EC4 A;  1O73 A;  3DIE A;  3FY7 A;  1TI1 A;  4WEY A;  1M9A A;  5DJM A;  4FYB A;  4EDY A;  4PUA A;  4RI7 A;  4WR5 A;  1A8L A;  1M2B A;  3LGC A;  4MPG A;  4I8B A;  1XWB A;  2RUE A;  2GLR A;  1XZO A;  2C3Q A;  5B7C A;  5IO2 A;  2YNX A;  4MF5 A;  5HQP A;  4KF9 A;  2CAI A;  2LNS A;  5ECR B;  3DRN A;  2ON5 A;  1SL2 B;  4ZBB A;  2GSQ A;  4ZL7 A;  4L0W A;  2GVP A;  1PL1 A;  4L5O A;  2K8V A;  2V1M A;  2F51 A;  4IJ3 A;  4V2L A;  2YWI A;  4G9H A;  1PN9 A;  5IQY A;  2CT6 A;  2OE1 A;  3HZ4 A;  4QL9 A;  3DYR A;  1TU8 A;  5BMU A;  1YEP A;  4BVY B;  4Q5F A;  1T1V A;  3EU3 A;  3E3E A;  1B9X C;  3F4R A;  4ECC A;  2MMN A;  2AYT A;  3FRC A;  2X49 A;  2B5X A;  4CW9 A;  2H6X A;  4USS A;  2VM1 A;  1GTB A;  4KCA A;  4PQ1 A;  4QL7 A;  1NW2 A;  4G0K A;  4ZL9 A;  4POK A;  4LL4 B;  1SYR A;  4AJ6 A;  3DD3 A;  5DQS A;  1K0O A;  1PRX A;  3VPQ A;  3ZYW A;  2QKE A;  3FEU A;  3PIN A;  2F8F A;  1XFL A;  2O87 A;  4POM A;  3EWL A;  3H4K A;  5J5N A;  5DAK A;  1ZYP A;  6GSW A;  4XCS A;  2IWT A;  3W6G A;  5ENU A;  5LD0 A;  2OKA A;  3HJP A;  2WGR A;  3N9J A;  3IRA A;  4HEA 2;  1GNW A;  2YZH A;  3W8J A;  2L6D A;  4K5S A;  4K2X A;  1NHO A;  18GS A;  1QUW A;  3HJO A;  1OAZ A;  1J0F A;  1XW5 A;  4FQU A;  2A4H A;  1FVJ A;  1ZMA A;  5J9C A;  2L59 A;  4KB3 A;  3IK9 A;  3ZVJ D;  4NAX A;  1X0R A;  1SD8 A;  4MF6 A;  2K18 A;  2H75 A;  1N8J A;  4K2D A;  2DML A;  3C1R A;  4GSS A;  1O7U A;  2A2R A;  2HRF A;  4IGJ A;  4MAB A;  3LXZ A;  2OE3 A;  4KDY A;  2LST A;  1K3L A;  1GUK A;  3BD2 A;  4OCE A;  5C00 A;  1XWC A;  1GTI A;  4KH7 A;  1RW1 A;  1WRY A;  3GTU A;  3CRU A;  5B8A A;  1H75 A;  4WF4 A;  1TU7 A;  2FWF A;  5ECS A;  2FUG 2;  3TRP A;  3CSH A;  5IOX A;  3GRX A;  3Q6O A;  1S3D A;  1YDK A;  2C8U A;  1Q4J A;  5EL8 A;  6GSX A;  1GH2 A;  1W4V A;  3ED3 A;  3PGT A;  4EO3 A;  2FGX A;  3TJF A;  2EIQ A;  4KW6 A;  2JSY A;  5ID2 A;  2IJY A;  3NZN A;  2L5O A;  1G0T A;  12GS A;  5A4V A;  3CTF A;  4MDC A;  3L9V A;  1XOB A;  3F63 A;  5KOW A;  1K0B A;  4ZB8 A;  2VCV A;  2OAD A;  2ZNM A;  2E2M A;  1TOF A;  1X9M B;  2CAQ A;  4JED A;  1TJD A;  3E0U A;  1TK5 B;  4K1F A;  5LNK e;  2OBK A;  4EXJ A;  1XPV A;  1G7O A;  2B1L A;  2NDO A;  4OFM A;  4O7H A;  5IMD A;  3ZVJ A;  3UBL A;  2E2G A;  5GSS A;  2H6Z A;  4MPF A;  2DJ2 A;  3TKS A;  2TIR A;  1XWG A;  2B3S A;  3IA1 A;  1ZOF A;  1T3B A;  2GTU A;  5F07 A;  4NHZ A;  1MDJ A;  3CBU A;  3TJG A;  1FVK A;  4N0Z A;  2XC2 A;  1XBS A;  1AUC A;  1OC3 A;  3A2V A;  1LBK A;  1XXU A;  2IMI A;  2FCH A;  1VF4 A;  2DJ1 A;  2H8L A;  4TKY A;  3QMX A;  1M2D A;  1PN0 A;  4KGI A;  5FHI A;  5INY A;  2N5B A;  3F6D A;  5ID2 B;  3G7J A;  1QMV A;  2KP1 A;  3DGQ A;  3SBC A;  3EC3 A;  4ID0 A;  2EIR A;  4MLY A;  3TCO A;  4DVC A;  1OVN A;  1M0U A;  3EIN A;  3ZLP A;  4EUY A;  1TXX A;  1YF0 A;  4KE3 A;  2FLS A;  14GS A;  2LRN A;  5A5K A;  3FZ5 A;  4MZW A;  3G7Y A;  3ZMK A;  4V2M A;  4HU7 A;  4EDZ A;  3GNJ A;  2PPT A;  3GKX A;  4MH2 A;  4TR4 A;  2AAW A;  2G0F A;  1MEK A;  3RHC A;  5A4W A;  2KHP A;  3L0H A;  3GH9 A;  1XWK A;  5G2Z A;  4TOP A;  1X9S B;  3LEF A;  4ZBD A;  5AIS A;  4AJ7 A;  1YZX A;  1GSF A;  2H0I A;  1XIY A;  1PMT A;  2HSY A;  2PVO C;  1PKZ A;  4P3Y B;  2B6M A;  5IO0 A;  5J41 A;  2TRC P;  1FOV A;  4AF2 A;  4G10 A;  3BJ5 A;  5CAX A;  1O6J A;  1WMJ A;  3K8N A;  1TW9 A;  3US3 A;  3BBY A;  4MH3 A;  2IN3 A;  5DCG A;  2IMK A;  1SKR B;  4ECJ A;  2KOK A;  2BJX A;  3CSJ A;  4KA0 A;  5IPH A;  4MNN A;  1T4Z A;  1FO5 A;  2YWM A;  1F9M A;  1NHY A;  3TKQ A;  2JZT A;  5DJL A;  2WFC A;  1GL8 A;  1N2A A;  1UN2 A;  1FHE A;  5JCU A;  1WOU A;  3TOU A;  2IFQ A;  4EVM A;  1YKC A;  1TRU A;  3LW9 A;  3MIX A;  3KP9 A;  4XRD A;  2K8S A;  2FNO A;  4EL1 A;  3O76 A;  2BTO T;  1OC9 A;  1OKT A;  2H71 A;  4YQM A;  4G2E A;  1R7H A;  2DIZ A;  4POL A;  5C04 A;  3HXS A;  1K0N A;  2HSM A;  2FY6 A;  2LV3 A;  3FMW A;  4EIP A;  1MDI A;  3MYD A;  2GZP A;  3QPM A;  4V1A p;  4PNG A;  4HDE A;  5DVB A;  3ZTL A;  2X64 A;  3VFI A;  1U6T A;  3A2X A;  3BCI A;  1W89 A;  1UVZ A;  2X8H A;  5ECQ B;  4HQS A;  1EV9 A;  5LCZ A;  3ME7 A;  2GGT A;  4I97 A;  4MJC A;  2H6Y A;  4OO5 A;  2I9H A;  5G31 A;  3S9F A;  4HOJ A;  5IMZ A;  3ZIT A;  2DMM A;  1WP0 A;  1XCC A;  2L5L A;  5ECN B;  3CYN A;  3RDW A;  1ERV A;  2O7K A;  4IP6 A;  4MP4 A;  5D93 A;  1B9Y C;  4ECB A;  4PX1 A;  2IFQ B;  4K8M A;  6GSY A;  5G5E A;  5IMF A;  4F2I A;  4WKW A;  3J7Y k;  3HD5 A;  1JFU A;  2H1A A;  3D4T A;  1AQV A;  1NM3 A;  3N5O A;  3UAP A;  2V6O A;  1GUM A;  4JR4 A;  3GHA A;  2CZ2 A;  2X4A A;  2VL2 A;  2YV7 A;  3I69 A;  1TDI A;  4IBP A;  4G19 A;  2HLS A;  5JCG A;  4ZB9 A;  4TXO B;  2FWG A;  1V58 A;  3KH7 A;  1ST9 A;  2H66 A;  2DLX A;  2DBC A;  4NHW A;  5EVO A;  3O6T A;  1M2A A;  2XBI A;  2B7K A;  4RUV A;  1PX6 A;  1A2J A;  1A2L A;  2L4C A;  2VLU A;  4OO4 A;  3R2Q A;  5FT3 A;  4EE0 A;  2GSR A;  2H1G A;  1ERU A;  5ECP B;  1XVW A;  4ZIJ A;  1HNC A;  3GKK A;  2LJK A;  1X5D A;  1GNE A;  2VO4 A;  4HJM A;  2ZUP A;  4J2F A;  2P5R A;  2IIY A;  2PGT A;  5ECH B;  1SK2 A;  2CV4 A;  5HR1 A;  3FZ4 A;  2VLT A;  2GT6 A;  2VCT A;  5KN1 A;  1WIK A;  1XVQ A;  4FO5 A;  3M8N A;  2CX4 A;  3CMI A;  2NBS A;  4Z2U A;  3GMF A;  2H1D A;  1M3I A;  2D2Z A;  3IAM 2;  4D73 B;  2V41 A;  2OJL A;  1TKD B;  3QAW A;  3GV1 A;  4WR4 A;  1B4P A;  1MD4 A;  5DQY A;  3HY2 A;  2R2J A;  1R5P A;  1GSY A;  4OWY A;  4F82 A;  3GL3 A;  4JU5 A;  4BA7 A;  1AAZ A;  3A3T A;  3DVX A;  3EMX A;  2XPD A;  1Z7R A;  2V6K A;  1YKA A;  3BOA A;  4OFN A;  5CP1 A;  2QGV A;  3UEM A;  5ECI B;  2C0D A;  3HVN A;  2LJR A;  1GSQ A;  2GQL A;  4TW5 A;  2KLX A;  3EVI A;  1TTZ A;  1TRV A;  5HFI A;  2HYX A;  1IYI A;  1A2M A;  2R0G A;  3VWV A;  3KIJ A;  3P7X A;  4O5U A;  3NOF A;  2CVK A;  2HRK A;  2HZE B;  2A2S A;  4XS4 A;  3H79 A;  1ZYE A;  5J9B A;  1GRX A;  5ECK B;  2AB6 A;  1FAA A;  2DJJ A;  4IQA A;  4FIW A;  3IOS A;  3HA9 A;  3UOM A;  2A4V A;  2L4Q A;  2YN1 A;  1QXH A;  4X1U A;  1BYE A;  5DAL A;  5JWQ B;  3HVX A;  1M9B A;  2VM2 A;  1SK0 A;  4MF7 A;  4MZC A;  4MJB A;  1JZW A;  3ISO A;  2FA8 A;  4ZIL A;  4LL1 B;  1HQO A;  4MK3 A;  1WWJ A;  3D21 A;  1MD3 A;  1T00 A;  1Z6M A;  1GSS A;  9GSS A;  4I5Q A;  20GS A;  3APS A;  1TK8 B;  4EIQ A;  4PTS A;  4GST A;  22GS A;  2G2Q A;  1SJ6 A;  2N5A A;  3GA4 A;  5DBQ A;  6GST A;  1B4Q A;  3HDC A;  2B5E A;  1K3Y A;  2GS3 A;  2H30 A;  3GYK A;  3FK8 A;  1SU9 A;  1WE0 A;  4Z7X A;  5KEJ A;  4JBB A;  5EPF A;  1CQH A;  1TK0 B;  5D9V A;  2GDR A;  3KTB A;  2C3N A;  1XW9 A;  2A2P A;  1B48 A;  1R5A A;  2JL4 A;  3P2A A;  2RLI A;  2WB9 A;  2QSI A;  3QD9 A;  2IL3 A;  1VF2 A;  3P8W A;  4HZ2 A;  2XPE A;  4N11 A;  4YAP A;  2X8G A;  2GZZ A;  5B8B A;  3F0I A;  5CNW A;  4HQZ A;  3GUS A;  3FZA A;  1HYU A;  3UVT A;  5GAP D;  1GTU A;  1H4O A;  5G1K A;  3GL5 A;  2CVB A;  4NV5 A;  4L0U A;  5DAK B;  2ES7 A;  1MTC A;  4X4J A;  2HNL A;  1JZO A;  4BL7 A;  2VCZ A;  3TUE A;  4PQH A;  5H5R A;  3KZQ A;  5H5Q A;  3HVS A;  5FWG A;  2JSZ A;  4YAV A;  1GSD A;  4RI6 A;  3RAZ A;  4DEJ A;  4OCF A;  3FYG A;  2HZF A;  5CRG A;  1GSE A;  4NXI A;  2E0Q A;  2R4V A;  4TR3 A;  3ZZX A;  1TRS A;  1JZR A;  2VOC A;  5G5F A;  1TI3 A;  1S3A A;  3WT1 A;  1G6W A;  4KAE A;  10GS A;  1DE1 A;  3IHQ A;  1DE2 A;  1KEB A;  2CZ3 A;  2OBI A;  17GS A;  5G1L A;  5E59 A;  1EGR A;  4WBR D;  3M1G A;  4GCI A;  3H8Q A;  1SJZ A;  4PQI A;  4RQR A;  1ZL9 A;  3A2W A;  2YV9 A;  3IBH A;  5E4W A;  3WGE A;  2H76 A;  2L57 A;  3VLN A;  3GTU B;  2WUL A;  1HNA A;  1EGO A;  3IXR A;  2O8V B;  4ILF A;  2VIM A;  3R3E A;  2VLV A;  1UA5 A;  2AV4 A;  5H5S A;  2QA2 A;  4Q5N A;  2GZY A;  2PBJ A;  4GLT A;  4GXZ A;  4DSS A;  3MAK A;  4ISD A;  2HT9 A;  4MJE A;  1PFO A;  2I81 A;  4OMV A;  4LMV A;  4F03 A;  1YQ1 A;  3D22 A;  1B8X A;  3HZ8 A;  3HVV A;  1ERT A;  3KM6 A;  1F37 A;  4IQ1 A;  2L6C A;  2PWJ A;  3LOR A;  1F3A A;  3MWH A;  1MDK A;  4A5P A;  1O8W A;  2PUK C;  3UL3 A;  1S3R A;  3EE2 A;  5HR2 A;  3GIX A;  2YOI A;  1O8X A;  8GSS A;  4DSQ A;  3KGK A;  4PXO A;  4GSN A;  4KDX A;  4ZL8 A;  3F6F A;  4FH8 A;  5GST A;  1HNB A;  3D0Z A;  4WXT A;  2CX3 A;  3GST A;  2V2G A;  5ECL B;  2B1K A;  3M9J A;  3GFK A;  1Z3E A;  4KND A;  1ILO A;  2DC5 A;  1EEM A;  2GQK A;  4WF5 A;  2PU9 C;  2JZS A;  13GS A;  3TGZ A;  3FKF A;  2QC7 A;  5F0G A;  2QA1 A;  1SL0 B;  4XTS A;  3DWV A;  1K0D A;  1URM A;  2LQQ A;  2GT5 A;  3F8U A;  7GSS A;  4IKH A;  3APO A;  1F2E A;  4HUA A;  2PER A;  4V2N A;  5AIV A;  3C7M A;  3LJR A;  1BED A;  3J7Y b;  1I9D A;  2F8A A;  2HXK A;  5JWO B;  1VRS D;  3NIV A;  1PGT A;  5B6M A;  4TXV A;  3AY8 A;  4K9Z A;  2JAD A;  2C1Y A;  1G7E A;  3IPZ A;  1QQ2 A;  4TN8 A;  5DCH A;  4HZ4 A;  5ABR A;  3UAR A;  5J4U A;  4Z2R A;  3A5I A;  11GS A;  1EWX A;  2FWE A;  4G0I A;  3HKR A;  4I2T A;  5AIX A;  3UIW A;  2O85 A;  3UMA A;  2C0G A;  2EIO A;  2NPB A;  2ZCT A;  3QCP A;  2H1B A;  1PX7 A;  4ECI A;  5KN2 A;  4Q5R A;  4L8E A;  5HFG A;  2J9H A;  4KX4 A;  2JU5 A;  4Z2T A;  4X0X A;  3IC8 A;  1V2A A;  4K5R A;  3EYT A;  4ZXG A;  1XG8 A;  2WCI A;  4ML6 A;  3VWX A;  1DBY A;  3U6V A;  3PPU A;  2FD3 A;  3U5R E;  4FYU A;  2LRC A;  2Z9S A;  3IE3 A;  1TRW A;  5JCW A;  1A24 A;  3ERW A;  3C8E A;  1F6M C;  1OC9 B;  1A0R P;  4O92 A;  5D9W A;  4N0V A;  4JR6 A;  1OKD A;  2TRX A;  3G9B A;  3FR9 A;  4X43 A;  5ECO B;  5HR0 A;  1BQ7 A;  3IK7 A;  4K7O A;  1GUH A;  5F8B A;  3KJY A;  4NV2 A;  2MMA A;  1EOG A;  4XIH A;  1R4W A;  5D9X A;  3VUR A;  4YKG A;  2C80 A;  3WGD A;  3ERG A;  4E8H A;  4GTU A;  4WET A;  3DEX A;  1OE7 A;  2MBT A;  1RK4 A;  2MZC A;  3GX8 A;  4ACS A;  2VCX A;  3KXO A;  3L78 A;  3Q74 A;  2C4J A;  2C0E A;  4IW9 A;  3E9J B;  1XOA A;  3WGX A;  3RPP A;  3RHB A;  4HJ2 A;  1K3O A;  5ECM B;  2VD0 A;  4AJ8 A;  1X5E A;  2H19 A;  1SYX A;  2LTK A;  3KMO A;  3EU4 A;  4BVY A;  4K6X A;  2WZ9 A;  3EUR A;  1K0M A;  3KEB A;  4TR0 A;  1ML6 A;  1EOH A;  2YWO A;  4ULX A;  1SEN A;  1ZGN A;  4IJI A;  3VPT A;  2LRT A;  3L9U A;  3C71 A;  1PQN A;  2YAN A;  3I6A A;  3QFA C;  3CSI A;  2VCQ A;  4PUR A;  5G30 A;  1OC8 A;  3F3Q A;  5D8I A;  1LJR A;  3KD0 A;  2WDU A;  1XWA A;  1V57 A;  2K9F A;  3I9V 2;  2R3X A;  3CXG A;  2CVD A;  1OE8 A;  3TJJ A;  1C72 A;  1A0F A;  5D96 A;  2LNT A;  3F4S A;  1GLQ A;  2H73 A;  1A8Y A;  2ALB A;  16GS A;  2DIY A;  3Q19 A;  2M46 A;  4LA1 A;  5B6N A;  3D5J A;  2VL3 A;  2VUP A;  4OD7 A;  3QDN A;  4CHS A;  1UC7 A;  2DKH A;  2YWN A;  2MYG A;  1EZK A;  3GN3 A;  4HSC X;  1GUL A;  4O32 A;  3HHV A;  4O5Q A;  1F3B A;  2GQM A;  2NVL A;  2JAC A;  2X99 A;  2XHF A;  3GKN A;  4NMU A;  1SK1 A;  4N30 A;  2R37 A;  3CQF A;  3TOT A;  1X9W B;  4BWS A;  1JLW A;  5EY6 A;  3EPT A;  1THX A;  2R6K A;  1J9B A;  3DKS A;  3MDK A;  2H0H A;  5COH A;  3ZML A;  1M3J A;  5KN3 A;  1BAY A;  3V1W A;  1SD9 A;  2P0G A;  3Q18 A;  3C1S A;  5D9T A;  1ABA A;  5CYY A;  1G6Y A;  4XRA A;  4EC0 A;  1U3A A;  3RPN A;  2DJ3 A;  4BVX A;  3VK9 A;  3F9U A;  4IEL A;  6GSV A;  2KUC A;  3TKS C;  3FHK A;  3ZFL A;  2OE0 A;  3IHG A;  1GLP A;  1U87 A;  2LQO A;  3FR6 A;  4YKF A;  1BJX A;  2CQ9 A;  1U3I A;  1JHB A;  2DSA A;  2M80 A;  3FR3 A;  4K7I A;  1FB0 A;  4GRF A;  3UVH A;  3TJK A;  3M3M A;  2J23 A;  1EP8 A;  4HU9 A;  3A5W A;  1USB A;  2DKI A;  2N5F A;  5F06 A;  1Y6E A;  1VF1 A;  2GST A;  2H72 A;  3H93 A;  5GZZ B;  4ZBA A;  1QK8 A;  2XBQ A;  3W8S A;  4E8E A;  4LMW A;  4XS4 B;  2CA8 A;  3G7I A;  2GSS A;  4GQC A;  2H70 A;  4KSO A;  4CY6 A;  1T4Y A;  5DDL A;  2WS2 A;  4LLR A;  3LFL A;  3TDG A;  1Z6N A;  5DAL B;  4J56 E;  1ON4 A;  5ELG A;  1YJ6 A;  2JZR A;  4DSR A;  2I4A A;  4PUF C;  4JZQ A;  4BWQ A;  2E7P A;  2R0C A;  2IME A;  4GF0 A;  2B7J A;  4K0N A;  2HE3 A;  4BVX B;  4MMM A;  5F05 A;  1ZCP A;  1HD2 A;  1Z9H A;  2HI7 A;  2YPM A;  1ZYN A;  2RUF A;  6GSS A;  2P31 A;  3QR6 A;  3ZRD A;  2IMD A;  4V1A g;  3EMP A;  4MJA A;  4MA9 A;  2LJA A;  4IVF A;  5KOX A;  1XW6 A;  1ZYQ B;  3ZFB A;  1AW9 A;  1A23 A;  3RBT A;  4AGS A;  2YP6 A;  1DSB A;  1TP9 A;  5CRD A;  4XS1 A;  1OYJ A;  3APQ A;  3GKM A;  3D4M A;  5CRW A;  1SKW B;  3GX0 A;  1Z7P A;  1NSW A;  3LYP A;  2DJ0 A;  4J57 E;  5D73 A;  1V40 A;  3WT2 A;  4QQ7 A;  4GQF A;  5JWR B;  4NPB A;  3UJ1 A;  1E6B A;  1YF1 A; 
#chains in the Genus database with same CATH homology
 4EKZ A;  3UBK A;  3KP8 A;  2LS5 A;  3KMN A;  1YY7 A;  2H0G A;  3IC4 A;  3TKP A;  2P5Q A;  2AJQ B;  1SJI A;  1VF3 A;  2X8C A;  1Z5Y E;  3LG6 A;  4Q5Q A;  4BL7 B;  2MMZ A;  4CDO A;  3IDV A;  5IOW A;  4OFT A;  1PD2 1;  2HRN A;  2NTO A;  2H01 A;  1O85 A;  5CO3 A;  1T8E B;  19GS A;  2FHE A;  1E2Y A;  1FOH A;  1KTE A;  3GH6 A;  2RII A;  3CTG A;  2YCD A;  1EV4 A;  5IMV A;  4KSM A;  3QAG A;  3H1N A;  4HS1 A;  1KBN A;  2IPA A;  1V98 A;  4IS0 A;  4N10 A;  1GP1 A;  3DVW A;  1WPI A;  3M9K A;  2OA7 A;  4IP1 A;  5IMA A;  2LKU A;  2VD1 A;  3BCK A;  3PH9 A;  1ZZY A;  2VAF A;  4K0G A;  1AQX A;  3GSS A;  5KN0 A;  3KH9 A;  4JE1 A;  4ML1 A;  5IMC A;  1EEJ A;  2C0F A;  5CRH A;  2WJU A;  1Y25 A;  1EP7 A;  1U88 A;  5HFK A;  2HRA A;  3IAS 2;  4DSS B;  3ZIJ A;  1S3C A;  2F9S A;  1ERW A;  2LUS A;  1IYH A;  3QOU A;  2VL2 C;  3KTL A;  2H74 A;  5AGY A;  3I43 A;  4I6X A;  4H86 A;  5GAN D;  5IPG A;  5J3R A;  4YQU A;  4CY8 A;  2YJH A;  1JZD A;  4I2U A;  5L71 A;  2REM A;  4IN0 A;  1WJK A;  4KDU A;  3HJM A;  1O81 A;  1AC1 A;  4K7N A;  1LU4 A;  1R26 A;  3ERF A;  3HCZ A;  1PL2 A;  1V9W A;  2HSH A;  2PMT A;  3P90 A;  1BX9 A;  2FA4 A;  2PVQ A;  3WD6 A;  3ME8 A;  1M7T A;  3FW2 A;  3C73 A;  5IM9 A;  4F9Z A;  3ZRE A;  1CQG A;  3L4N A;  2I1U A;  1QGV A;  3M0F A;  3L9S A;  3D6I A;  4KCE A;  2RM5 A;  1RQM A;  3TRQ A;  3CRT A;  3VI5 A;  3TKS E;  5A4U A;  4TXO A;  4XS6 A;  1ACV A;  2UZ8 A;  3IR4 A;  4JRR A;  5CRE A;  2YJ7 A;  2O89 A;  3F4T A;  3TB2 A;  1AIU A;  2F3M A;  2BMX A;  2KP2 A;  1QFN A;  4G0L A;  4ICY A;  2AUV A;  4YQV A;  4HI7 A;  1K0A A;  2B5Y A;  3LSZ A;  1SL1 B;  3ZL5 A;  3OR5 A;  2I3Y A;  2R0P A;  2MBS A;  6GSU A;  1I5G A;  4TR1 A;  4TRX A;  4POB A;  2K6V A;  1J08 A;  4GWR A;  4BPY A;  3LWA A;  3QFB C;  1K0C A;  1FB6 A;  3FZ9 A;  3MSZ A;  2PN8 A;  1BG5 A;  5AN1 A;  2C3T A;  2FWH A;  3PR8 A;  2MMO A;  3LQ7 A;  1THO A;  1PSQ A;  2HFD A;  3MNG A;  3QAV A;  5IIZ A;  2R5G A;  4PNF A;  4IHU A;  3O3T A;  2AHE A;  2VL9 A;  3VWU A;  2OAC A;  1KNG A;  3ZIV A;  1GWC A;  2YZU A;  3VWW A;  2DJK A;  4D73 A;  3IV4 A;  5ELA A;  2V32 A;  1Q98 A;  4EF0 A;  1DUG A;  1M99 A;  4ZB6 A;  4WBJ A;  2WRT A;  4MZB A;  2M72 A;  1AXD A;  1PA3 A;  4KUN A;  3TKR A;  3SWL A;  2IMF A;  4PGT A;  1GTA A;  3VI7 A;  3KCM A;  1JLV A;  4RQX A;  1GSU A;  3TJB A;  1SKS B;  3LXT A;  3DML A;  3JCM L;  3TRX A;  4F0B A;  4NWY A;  3DXB A;  2ON7 A;  4L5L A;  3LYK A;  4O5R A;  1VGL A;  4FYC A;  1PKW A;  3F3R A;  4TR1 B;  2LEG A;  1FW1 A;  1FG4 A;  5BRT A;  3WYW A;  1X5C A;  4MCU A;  5HR3 A;  4TVE A;  4F0C A;  4XHM A;  3GUR A;  1YEX A;  1AQW A;  2HZE A;  3HYP A;  1T7P B;  2VCW A;  4YH2 A;  2RM6 A;  2EC4 A;  1O73 A;  3DIE A;  3FY7 A;  1TI1 A;  4WEY A;  1M9A A;  5DJM A;  4FYB A;  4EDY A;  4PUA A;  4RI7 A;  4WR5 A;  1A8L A;  1M2B A;  3LGC A;  4MPG A;  4I8B A;  1XWB A;  2RUE A;  2GLR A;  1XZO A;  2C3Q A;  5B7C A;  5IO2 A;  2YNX A;  4MF5 A;  5HQP A;  4KF9 A;  2CAI A;  2LNS A;  5ECR B;  3DRN A;  2ON5 A;  1SL2 B;  4ZBB A;  2GSQ A;  4ZL7 A;  4L0W A;  2GVP A;  1PL1 A;  4L5O A;  2K8V A;  2V1M A;  2F51 A;  4IJ3 A;  4V2L A;  2YWI A;  4G9H A;  1PN9 A;  5IQY A;  2CT6 A;  2OE1 A;  3HZ4 A;  4QL9 A;  3DYR A;  1TU8 A;  5BMU A;  1YEP A;  4BVY B;  4Q5F A;  1T1V A;  3EU3 A;  3E3E A;  1B9X C;  3F4R A;  4ECC A;  2MMN A;  2AYT A;  3FRC A;  2X49 A;  2B5X A;  4CW9 A;  2H6X A;  4USS A;  2VM1 A;  1GTB A;  4KCA A;  4PQ1 A;  4QL7 A;  1NW2 A;  4G0K A;  4ZL9 A;  4POK A;  4LL4 B;  1SYR A;  4AJ6 A;  3DD3 A;  5DQS A;  1K0O A;  1PRX A;  3VPQ A;  3ZYW A;  2QKE A;  3FEU A;  3PIN A;  2F8F A;  1XFL A;  2O87 A;  4POM A;  3EWL A;  3H4K A;  5J5N A;  5DAK A;  1ZYP A;  6GSW A;  4XCS A;  2IWT A;  3W6G A;  5ENU A;  5LD0 A;  2OKA A;  3HJP A;  2WGR A;  3N9J A;  3IRA A;  4HEA 2;  1GNW A;  2YZH A;  3W8J A;  2L6D A;  4K5S A;  4K2X A;  1NHO A;  18GS A;  1QUW A;  3HJO A;  1OAZ A;  1J0F A;  1XW5 A;  4FQU A;  2A4H A;  1FVJ A;  1ZMA A;  5J9C A;  2L59 A;  4KB3 A;  3IK9 A;  3ZVJ D;  4NAX A;  1X0R A;  1SD8 A;  4MF6 A;  2K18 A;  2H75 A;  1N8J A;  4K2D A;  2DML A;  3C1R A;  4GSS A;  1O7U A;  2A2R A;  2HRF A;  4IGJ A;  4MAB A;  3LXZ A;  2OE3 A;  4KDY A;  2LST A;  1K3L A;  1GUK A;  3BD2 A;  4OCE A;  5C00 A;  1XWC A;  1GTI A;  4KH7 A;  1RW1 A;  1WRY A;  3GTU A;  3CRU A;  5B8A A;  1H75 A;  4WF4 A;  1TU7 A;  2FWF A;  5ECS A;  2FUG 2;  3TRP A;  3CSH A;  5IOX A;  3GRX A;  3Q6O A;  1S3D A;  1YDK A;  2C8U A;  1Q4J A;  5EL8 A;  6GSX A;  1GH2 A;  1W4V A;  3ED3 A;  3PGT A;  4EO3 A;  2FGX A;  3TJF A;  2EIQ A;  4KW6 A;  2JSY A;  5ID2 A;  2IJY A;  3NZN A;  2L5O A;  1G0T A;  12GS A;  5A4V A;  3CTF A;  4MDC A;  3L9V A;  1XOB A;  3F63 A;  5KOW A;  1K0B A;  4ZB8 A;  2VCV A;  2OAD A;  2ZNM A;  2E2M A;  1TOF A;  1X9M B;  2CAQ A;  4JED A;  1TJD A;  3E0U A;  1TK5 B;  4K1F A;  5LNK e;  2OBK A;  4EXJ A;  1XPV A;  1G7O A;  2B1L A;  2NDO A;  4OFM A;  4O7H A;  5IMD A;  3ZVJ A;  3UBL A;  2E2G A;  5GSS A;  2H6Z A;  4MPF A;  2DJ2 A;  3TKS A;  2TIR A;  1XWG A;  2B3S A;  3IA1 A;  1ZOF A;  1T3B A;  2GTU A;  5F07 A;  4NHZ A;  1MDJ A;  3CBU A;  3TJG A;  1FVK A;  4N0Z A;  2XC2 A;  1XBS A;  1AUC A;  1OC3 A;  3A2V A;  1LBK A;  1XXU A;  2IMI A;  2FCH A;  1VF4 A;  2DJ1 A;  2H8L A;  4TKY A;  3QMX A;  1M2D A;  1PN0 A;  4KGI A;  5FHI A;  5INY A;  2N5B A;  3F6D A;  5ID2 B;  3G7J A;  1QMV A;  2KP1 A;  3DGQ A;  3SBC A;  3EC3 A;  4ID0 A;  2EIR A;  4MLY A;  3TCO A;  4DVC A;  1OVN A;  1M0U A;  3EIN A;  3ZLP A;  4EUY A;  1TXX A;  1YF0 A;  4KE3 A;  2FLS A;  14GS A;  2LRN A;  5A5K A;  3FZ5 A;  4MZW A;  3G7Y A;  3ZMK A;  4V2M A;  4HU7 A;  4EDZ A;  3GNJ A;  2PPT A;  3GKX A;  4MH2 A;  4TR4 A;  2AAW A;  2G0F A;  1MEK A;  3RHC A;  5A4W A;  2KHP A;  3L0H A;  3GH9 A;  1XWK A;  5G2Z A;  4TOP A;  1X9S B;  3LEF A;  4ZBD A;  5AIS A;  4AJ7 A;  1YZX A;  1GSF A;  2H0I A;  1XIY A;  1PMT A;  2HSY A;  2PVO C;  1PKZ A;  4P3Y B;  2B6M A;  5IO0 A;  5J41 A;  2TRC P;  1FOV A;  4AF2 A;  4G10 A;  3BJ5 A;  5CAX A;  1O6J A;  1WMJ A;  3K8N A;  1TW9 A;  3US3 A;  3BBY A;  4MH3 A;  2IN3 A;  5DCG A;  2IMK A;  1SKR B;  4ECJ A;  2KOK A;  2BJX A;  3CSJ A;  4KA0 A;  5IPH A;  4MNN A;  1T4Z A;  1FO5 A;  2YWM A;  1F9M A;  1NHY A;  3TKQ A;  2JZT A;  5DJL A;  2WFC A;  1GL8 A;  1N2A A;  1UN2 A;  1FHE A;  5JCU A;  1WOU A;  3TOU A;  2IFQ A;  4EVM A;  1YKC A;  1TRU A;  3LW9 A;  3MIX A;  3KP9 A;  4XRD A;  2K8S A;  2FNO A;  4EL1 A;  3O76 A;  2BTO T;  1OC9 A;  1OKT A;  2H71 A;  4YQM A;  4G2E A;  1R7H A;  2DIZ A;  4POL A;  5C04 A;  3HXS A;  1K0N A;  2HSM A;  2FY6 A;  2LV3 A;  3FMW A;  4EIP A;  1MDI A;  3MYD A;  2GZP A;  3QPM A;  4V1A p;  4PNG A;  4HDE A;  5DVB A;  3ZTL A;  2X64 A;  3VFI A;  1U6T A;  3A2X A;  3BCI A;  1W89 A;  1UVZ A;  2X8H A;  5ECQ B;  4HQS A;  1EV9 A;  5LCZ A;  3ME7 A;  2GGT A;  4I97 A;  4MJC A;  2H6Y A;  4OO5 A;  2I9H A;  5G31 A;  3S9F A;  4HOJ A;  5IMZ A;  3ZIT A;  2DMM A;  1WP0 A;  1XCC A;  2L5L A;  5ECN B;  3CYN A;  3RDW A;  1ERV A;  2O7K A;  4IP6 A;  4MP4 A;  5D93 A;  1B9Y C;  4ECB A;  4PX1 A;  2IFQ B;  4K8M A;  6GSY A;  5G5E A;  5IMF A;  4F2I A;  4WKW A;  3J7Y k;  3HD5 A;  1JFU A;  2H1A A;  3D4T A;  1AQV A;  1NM3 A;  3N5O A;  3UAP A;  2V6O A;  1GUM A;  4JR4 A;  3GHA A;  2CZ2 A;  2X4A A;  2VL2 A;  2YV7 A;  3I69 A;  1TDI A;  4IBP A;  4G19 A;  2HLS A;  5JCG A;  4ZB9 A;  4TXO B;  2FWG A;  1V58 A;  3KH7 A;  1ST9 A;  2H66 A;  2DLX A;  2DBC A;  4NHW A;  5EVO A;  3O6T A;  1M2A A;  2XBI A;  2B7K A;  4RUV A;  1PX6 A;  1A2J A;  1A2L A;  2L4C A;  2VLU A;  4OO4 A;  3R2Q A;  5FT3 A;  4EE0 A;  2GSR A;  2H1G A;  1ERU A;  5ECP B;  1XVW A;  4ZIJ A;  1HNC A;  3GKK A;  2LJK A;  1X5D A;  1GNE A;  2VO4 A;  4HJM A;  2ZUP A;  4J2F A;  2P5R A;  2IIY A;  2PGT A;  5ECH B;  1SK2 A;  2CV4 A;  5HR1 A;  3FZ4 A;  2VLT A;  2GT6 A;  2VCT A;  5KN1 A;  1WIK A;  1XVQ A;  4FO5 A;  3M8N A;  2CX4 A;  3CMI A;  2NBS A;  4Z2U A;  3GMF A;  2H1D A;  2D2Z A;  3IAM 2;  4D73 B;  2V41 A;  2OJL A;  1TKD B;  3QAW A;  3GV1 A;  4WR4 A;  1B4P A;  1MD4 A;  5DQY A;  3HY2 A;  2R2J A;  1R5P A;  1GSY A;  4OWY A;  4F82 A;  3GL3 A;  4JU5 A;  4BA7 A;  1AAZ A;  3A3T A;  3DVX A;  3EMX A;  2XPD A;  1Z7R A;  2V6K A;  1YKA A;  3BOA A;  4OFN A;  5CP1 A;  2QGV A;  3UEM A;  5ECI B;  2C0D A;  2LJR A;  1GSQ A;  2GQL A;  4TW5 A;  2KLX A;  3EVI A;  1TTZ A;  1TRV A;  5HFI A;  2HYX A;  1IYI A;  1A2M A;  2R0G A;  3VWV A;  3KIJ A;  3P7X A;  4O5U A;  3NOF A;  2CVK A;  2HRK A;  2HZE B;  2A2S A;  4XS4 A;  3H79 A;  1ZYE A;  5J9B A;  1GRX A;  5ECK B;  2AB6 A;  1FAA A;  2DJJ A;  4IQA A;  4FIW A;  3IOS A;  3HA9 A;  3UOM A;  2A4V A;  2L4Q A;  2YN1 A;  1QXH A;  4X1U A;  1BYE A;  5DAL A;  5JWQ B;  3HVX A;  1M9B A;  2VM2 A;  1SK0 A;  4MF7 A;  4MZC A;  4MJB A;  1JZW A;  3ISO A;  2FA8 A;  4ZIL A;  4LL1 B;  1HQO A;  4MK3 A;  1WWJ A;  3D21 A;  1MD3 A;  1T00 A;  1Z6M A;  1GSS A;  9GSS A;  4I5Q A;  20GS A;  3APS A;  1TK8 B;  4EIQ A;  4PTS A;  4GST A;  22GS A;  2G2Q A;  1SJ6 A;  2N5A A;  3GA4 A;  5DBQ A;  6GST A;  1B4Q A;  3HDC A;  2B5E A;  1K3Y A;  2GS3 A;  2H30 A;  3GYK A;  3FK8 A;  1SU9 A;  1WE0 A;  4Z7X A;  5KEJ A;  4JBB A;  5EPF A;  1CQH A;  1TK0 B;  5D9V A;  2GDR A;  3KTB A;  2C3N A;  1XW9 A;  2A2P A;  1B48 A;  1R5A A;  2JL4 A;  3P2A A;  2RLI A;  2WB9 A;  2QSI A;  3QD9 A;  2IL3 A;  1VF2 A;  3P8W A;  4HZ2 A;  2XPE A;  4N11 A;  4YAP A;  2X8G A;  2GZZ A;  5B8B A;  3F0I A;  5CNW A;  4HQZ A;  3GUS A;  3FZA A;  1HYU A;  3UVT A;  5GAP D;  1GTU A;  1H4O A;  5G1K A;  3GL5 A;  2CVB A;  4NV5 A;  4L0U A;  5DAK B;  2ES7 A;  1MTC A;  4X4J A;  2HNL A;  1JZO A;  4BL7 A;  2VCZ A;  3TUE A;  4PQH A;  5H5R A;  3KZQ A;  5H5Q A;  3HVS A;  5FWG A;  2JSZ A;  4YAV A;  1GSD A;  4RI6 A;  3RAZ A;  4DEJ A;  4OCF A;  3FYG A;  2HZF A;  5CRG A;  1GSE A;  4NXI A;  2E0Q A;  2R4V A;  4TR3 A;  3ZZX A;  1TRS A;  1JZR A;  2VOC A;  5G5F A;  1TI3 A;  1S3A A;  3WT1 A;  1G6W A;  4KAE A;  10GS A;  1DE1 A;  3IHQ A;  1DE2 A;  1KEB A;  2CZ3 A;  2OBI A;  17GS A;  5G1L A;  5E59 A;  1EGR A;  4WBR D;  3M1G A;  4GCI A;  3H8Q A;  1SJZ A;  4PQI A;  4RQR A;  1ZL9 A;  3A2W A;  2YV9 A;  3IBH A;  5E4W A;  3WGE A;  2H76 A;  2L57 A;  3VLN A;  3GTU B;  2WUL A;  1HNA A;  1EGO A;  3IXR A;  2O8V B;  4ILF A;  2VIM A;  3R3E A;  2VLV A;  1UA5 A;  2AV4 A;  5H5S A;  2QA2 A;  4Q5N A;  2GZY A;  2PBJ A;  4GLT A;  4GXZ A;  4DSS A;  3MAK A;  4ISD A;  2HT9 A;  4MJE A;  2I81 A;  4OMV A;  4LMV A;  4F03 A;  1YQ1 A;  3D22 A;  1B8X A;  3HZ8 A;  3HVV A;  1ERT A;  3KM6 A;  1F37 A;  4IQ1 A;  2L6C A;  2PWJ A;  3LOR A;  1F3A A;  3MWH A;  1MDK A;  4A5P A;  1O8W A;  2PUK C;  3UL3 A;  3EE2 A;  5HR2 A;  3GIX A;  2YOI A;  1O8X A;  8GSS A;  4DSQ A;  3KGK A;  4PXO A;  4GSN A;  4KDX A;  4ZL8 A;  3F6F A;  4FH8 A;  5GST A;  1HNB A;  3D0Z A;  4WXT A;  2CX3 A;  3GST A;  2V2G A;  5ECL B;  2B1K A;  3M9J A;  3GFK A;  1Z3E A;  4KND A;  1ILO A;  2DC5 A;  1EEM A;  2GQK A;  4WF5 A;  2PU9 C;  2JZS A;  13GS A;  3TGZ A;  3FKF A;  2QC7 A;  5F0G A;  2QA1 A;  1SL0 B;  4XTS A;  3DWV A;  1K0D A;  1URM A;  2LQQ A;  2GT5 A;  3F8U A;  7GSS A;  4IKH A;  3APO A;  1F2E A;  4HUA A;  2PER A;  4V2N A;  5AIV A;  3C7M A;  3LJR A;  1BED A;  3J7Y b;  1I9D A;  2F8A A;  2HXK A;  5JWO B;  1VRS D;  3NIV A;  1PGT A;  5B6M A;  4TXV A;  3AY8 A;  4K9Z A;  2JAD A;  2C1Y A;  1G7E A;  3IPZ A;  1QQ2 A;  4TN8 A;  5DCH A;  4HZ4 A;  5ABR A;  3UAR A;  5J4U A;  4Z2R A;  3A5I A;  11GS A;  1EWX A;  2FWE A;  4G0I A;  3HKR A;  4I2T A;  5AIX A;  3UIW A;  2O85 A;  3UMA A;  2C0G A;  2EIO A;  2NPB A;  2ZCT A;  3QCP A;  2H1B A;  1PX7 A;  4ECI A;  5KN2 A;  4Q5R A;  4L8E A;  5HFG A;  2J9H A;  4KX4 A;  2JU5 A;  4Z2T A;  4X0X A;  3IC8 A;  1V2A A;  4K5R A;  3EYT A;  4ZXG A;  2WCI A;  4ML6 A;  3VWX A;  1DBY A;  3U6V A;  3PPU A;  2FD3 A;  3U5R E;  4FYU A;  2LRC A;  2Z9S A;  3IE3 A;  1TRW A;  5JCW A;  1A24 A;  3ERW A;  3C8E A;  1F6M C;  1OC9 B;  1A0R P;  4O92 A;  5D9W A;  4N0V A;  4JR6 A;  1OKD A;  2TRX A;  3G9B A;  3FR9 A;  4X43 A;  5ECO B;  5HR0 A;  1BQ7 A;  3IK7 A;  4K7O A;  1GUH A;  5F8B A;  3KJY A;  4NV2 A;  2MMA A;  1EOG A;  4XIH A;  1R4W A;  5D9X A;  3VUR A;  4YKG A;  2C80 A;  3WGD A;  3ERG A;  4E8H A;  4GTU A;  4WET A;  3DEX A;  1OE7 A;  2MBT A;  1RK4 A;  2MZC A;  3GX8 A;  4ACS A;  2VCX A;  3KXO A;  3L78 A;  3Q74 A;  2C4J A;  2C0E A;  4IW9 A;  3E9J B;  1XOA A;  3WGX A;  3RPP A;  3RHB A;  4HJ2 A;  1K3O A;  5ECM B;  2VD0 A;  4AJ8 A;  1X5E A;  2H19 A;  1SYX A;  2LTK A;  3KMO A;  3EU4 A;  4BVY A;  4K6X A;  2WZ9 A;  3EUR A;  1K0M A;  3KEB A;  4TR0 A;  1ML6 A;  1EOH A;  2YWO A;  4ULX A;  1SEN A;  1ZGN A;  4IJI A;  3VPT A;  2LRT A;  3L9U A;  3C71 A;  1PQN A;  2YAN A;  3I6A A;  3QFA C;  3CSI A;  2VCQ A;  4PUR A;  5G30 A;  1OC8 A;  3F3Q A;  5D8I A;  1LJR A;  3KD0 A;  2WDU A;  1XWA A;  1V57 A;  2K9F A;  3I9V 2;  2R3X A;  3CXG A;  2CVD A;  1OE8 A;  3TJJ A;  1C72 A;  1A0F A;  5D96 A;  2LNT A;  3F4S A;  1GLQ A;  2H73 A;  1A8Y A;  2ALB A;  16GS A;  2DIY A;  3Q19 A;  2M46 A;  4LA1 A;  5B6N A;  3D5J A;  2VL3 A;  2VUP A;  4OD7 A;  3QDN A;  4CHS A;  1UC7 A;  2DKH A;  2YWN A;  2MYG A;  1EZK A;  3GN3 A;  1GUL A;  4O32 A;  3HHV A;  4O5Q A;  1F3B A;  2GQM A;  2NVL A;  2JAC A;  2X99 A;  2XHF A;  3GKN A;  4NMU A;  1SK1 A;  4N30 A;  2R37 A;  3TOT A;  1X9W B;  4BWS A;  1JLW A;  5EY6 A;  3EPT A;  1THX A;  2R6K A;  1J9B A;  3DKS A;  3MDK A;  2H0H A;  5COH A;  3ZML A;  5KN3 A;  1BAY A;  3V1W A;  1SD9 A;  2P0G A;  3Q18 A;  3C1S A;  5D9T A;  1ABA A;  5CYY A;  1G6Y A;  4XRA A;  4EC0 A;  1U3A A;  3RPN A;  2DJ3 A;  4BVX A;  3VK9 A;  3F9U A;  4IEL A;  6GSV A;  2KUC A;  3TKS C;  3FHK A;  3ZFL A;  2OE0 A;  3IHG A;  1GLP A;  1U87 A;  2LQO A;  3FR6 A;  4YKF A;  1BJX A;  2CQ9 A;  1U3I A;  1JHB A;  2DSA A;  2M80 A;  3FR3 A;  4K7I A;  1FB0 A;  4GRF A;  3UVH A;  3TJK A;  3M3M A;  2J23 A;  1EP8 A;  4HU9 A;  3A5W A;  1USB A;  2DKI A;  2N5F A;  5F06 A;  1Y6E A;  1VF1 A;  2GST A;  2H72 A;  3H93 A;  5GZZ B;  4ZBA A;  1QK8 A;  2XBQ A;  3W8S A;  4E8E A;  4LMW A;  4XS4 B;  2CA8 A;  3G7I A;  2GSS A;  4GQC A;  2H70 A;  4KSO A;  4CY6 A;  1T4Y A;  5DDL A;  2WS2 A;  4LLR A;  3LFL A;  3TDG A;  1Z6N A;  5DAL B;  4J56 E;  1ON4 A;  5ELG A;  1YJ6 A;  2JZR A;  4DSR A;  2I4A A;  4PUF C;  4JZQ A;  4BWQ A;  2E7P A;  2R0C A;  2IME A;  4GF0 A;  2B7J A;  4K0N A;  2HE3 A;  4BVX B;  4MMM A;  5F05 A;  1ZCP A;  1HD2 A;  1Z9H A;  2HI7 A;  2YPM A;  1ZYN A;  2RUF A;  6GSS A;  2P31 A;  3QR6 A;  3ZRD A;  2IMD A;  4V1A g;  3EMP A;  4MJA A;  4MA9 A;  2LJA A;  4IVF A;  5KOX A;  1XW6 A;  1ZYQ B;  3ZFB A;  1AW9 A;  1A23 A;  3RBT A;  4AGS A;  2YP6 A;  1DSB A;  1TP9 A;  5CRD A;  4XS1 A;  1OYJ A;  3APQ A;  3GKM A;  3D4M A;  5CRW A;  1SKW B;  3GX0 A;  1Z7P A;  1NSW A;  3LYP A;  2DJ0 A;  4J57 E;  5D73 A;  1V40 A;  3WT2 A;  4QQ7 A;  4GQF A;  5JWR B;  4NPB A;  3UJ1 A;  1E6B A;  1YF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...