3F9UA

Crystal structure of c-terminal domain of putative exported cytochrome c biogenesis-related protein from bacteroides fragilis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
145
structure length
145
Chain Sequence
EVHAKFDDYDLGMEYARQHNKPVMLDFTGYGCVNCRKMELAVWTDPKVSSIINNDYVLITLYVDNKTPLTEPVKIMENGTERTLRTVGDKWSYLQRVKFGANAQPFYVLIDNEGNPLNKSYAYDEDISKYINFLQTGLENYRKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Putative exported cytochrome C biogenesis-related protein
publication title Crystal structure of C-terminal domain of putative exported cytochrome C biogenesis-related protein from Bacteroides fragilis
rcsb
source organism Bacteroides fragilis nctc 9343
total genus 46
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f9uA00
3ZIJA 5ABRA 4BVYA 3KD0A 4YQUA 1O7UA 2FNOA 2HZEA 1DE2A 1K0AA 1GLQA 3M8NA 4GSSA 1X5EA 3IPZA 4AF2A 2IIYA 5GAND 3LXTA 4BWSA 2EIRA 5ID2B 3A3TA 1TU7A 3F4TA 1G0TA 2C3NA 4POMA 3SWLA 11GSA 4JU5A 1VGLA 2C1YA 1AXDA 3CXGA 2L5OA 3TKSE 3WD6A 1F3AA 3A2XA 4TR0A 4NWYA 1GSYA 4KSMA 3GH6A 4V2LA 1TI1A 2H0IA 1OKTA 4IP1A 3W8JA 1SJ6A 3GSSA 3A2WA 4BA7A 3GKXA 2DJ1A 3FZ9A 1JHBA 5IM9A 4TVEA 1EP7A 1N2AA 4KA0A 3LGCA 1OC9A 2L57A 2J9HA 2DJJA 1X5DA 4ZBAA 2FLSA 4XS4B 2AYTA 4TR4A 2TRCP 3H79A 4DVCA 4MLYA 2I3YA 3W8SA 2B1KA 1K0DA 5CYYA 1MTCA 1A8LA 2DBCA 4J56E 1ZYQB 2VOCA 5DCGA 3L4NA 4MJEA 1JZOA 3UBLA 2HNLA 3TRXA 1F37A 1QMVA 5DQYA 4XRDA 1EV4A 5D96A 1RW1A 3H1NA 4MPGA 3I6AA 1TOFA 1FB6A 1FVKA 1Q4JA 1Z3EA 2VLVA 3D4TA 5CRGA 1IYHA 4ZL7A 5E59A 2ALBA 4X0XA 2F3MA 2LUSA 3KEBA 2HSYA 3CBUA 2VL2C 3LYPA 3S9FA 1JLVA 3UBKA 1ON4A 5IIZA 3ZLPA 4Q5RA 1LJRA 1I5GA 1A23A 5J5NA 1A8YA 2IFQA 3E9JB 3KMNA 2H6XA 3QR6A 5D8IA 1NHYA 3EE2A 2GS3A 5ECQB 4HU9A 4KH7A 4K1FA 2GGTA 3GKNA 3IRAA 1SK2A 2FWFA 3VWVA 2CT6A 5JWRB 1FB0A 4NXIA 3MAKA 3WGDA 3RPPA 3EVIA 4OWYA 1THOA 3P7XA 3BD2A 3L9UA 1B9XC 3GA4A 4V2NA 3TKQA 5ID2A 2YCDA 5H5QA 3JCML 3IV4A 3GUSA 5G5FA 5J9BA 2LQQA 2A2SA 1GTUA 4CHSA 3ZMKA 5FT3A 4WETA 4J2FA 5GZZB 3U5RE 2HFDA 1XW5A 1WMJA 3IC4A 5GSTA 2FA4A 2HT9A 3FHKA 4HUAA 3NOFA 2H01A 1I9DA 4TN8A 2VL9A 3VFIA 1VF2A 1F2EA 2JSYA 1OC3A 5IO2A 3DWVA 4H86A 3HJMA 2B5EA 1KBNA 5F07A 6GSYA 5IPHA 1GSUA 3IOSA 2CAIA 2C0EA 4XIHA 4HU7A 4XS4A 4ML6A 3VPTA 2IN3A 1M9BA 3F3RA 2VIMA 2K8SA 4F0BA 2YNXA 4Q5QA 2AB6A 1B48A 4E8EA 2VM2A 4EF0A 2YWOA 4ZXGA 1M7TA 3KM6A 5DAKA 4N0VA 3TGZA 2FA8A 1FOVA 3O76A 3UL3A 1T3BA 3CSHA 1ML6A 1GLPA 3TKSC 2DJKA 5ECRB 2AV4A 2RUEA 2WRTA 4TRXA 4OCFA 3QCPA 4K2DA 3C71A 1ST9A 5IOXA 3QAWA 1O81A 1H75A 2KHPA 4F9ZA 1AQVA 4IJ3A 1JLWA 1DUGA 4QL9A 4K0GA 3GHAA 4Q5NA 3HVVA 4POBA 4ZIJA 10GSA 3TJJA 5JCGA 3GL5A 2C3TA 1YF0A 3APQA 1EGRA 1ILOA 1O73A 2HI7A 2JL4A 1TK8B 2MBSA 1X9SB 1Q98A 4K7NA 1N8JA 2CVDA 2G0FA 4XHMA 2EIQA 2H76A 1SENA 1EOHA 4V1Ag 4L0UA 1MDKA 2H6YA 1DSBA 2ZUPA 3EMPA 2CVKA 1F3BA 3CTFA 3ZFBA 1GSQA 2FGXA 1AC1A 3IK7A 2P5QA 1EGOA 3TJBA 4XCSA 3ZZXA 2GSQA 1BG5A 1UA5A 4V2MA 3UJ1A 1VF1A 1AQXA 1EP8A 1M99A 2I81A 2ON5A 5ECPB 3UAPA 2ZNMA 2OBIA 3ZTLA 4HQZA 4N11A 3F4RA 1KTEA 2CX4A 1AQWA 2LNTA 3J7Yb 5F05A 3EU4A 1FW1A 1PN9A 4NHWA 1YJ6A 3DMLA 4IP6A 3LJRA 1PRXA 2QSIA 4YAVA 4EUYA 2B1LA 3KXOA 1WE0A 2WDUA 3NZNA 3BJ5A 2IMIA 3GFKA 2ZCTA 2OKAA 4L8EA 5GAPD 3EMXA 2I1UA 2WGRA 4ECBA 1B8XA 3TJFA 5A5KA 4GCIA 2H30A 1BEDA 1XFLA 2RLIA 4IS0A 5ENUA 4XTSA 4MH2A 1SK1A 4KDYA 1XCCA 4IGJA 4FYCA 3HYPA 5DQSA 1PD21 2WS2A 4GQFA 1TP9A 2DJ2A 3TOUA 3ZL5A 3C8EA 4TR1B 4V1Ap 2C80A 1GNEA 1XVWA 4EDZA 2B6MA 2HXKA 3PH9A 4XS6A 1YKAA 2AUVA 3EYTA 5GSSA 3L9VA 1Z9HA 3L78A 5CREA 1V98A 3ED3A 3RHCA 5JWQB 3A2VA 3CTGA 4G9HA 5KEJA 1GTBA 1WIKA 4WR4A 4PQ1A 1K0BA 1T8EB 3WT1A 22GSA 4OO4A 1XWAA 3FZAA 2GZZA 3IXRA 2YWMA 3UEMA 4MK3A 1W4VA 3GRXA 3LYKA 3Q19A 2K8VA 1MD3A 2MMAA 1HYUA 3VLNA 4GSNA 3K8NA 2HSHA 2GQKA 3FEUA 4F2IA 4KB3A 2JZRA 3QFBC 3F3QA 4ZB6A 3BBYA 4EL1A 1MDJA 4X43A 4IBPA 6GSXA 3LEFA 1BYEA 2X8HA 4PXOA 4HJ2A 2F8FA 2VCQA 5DALB 3GMFA 2MYGA 1GSDA 2N5FA 2YZUA 3LORA 4GWRA 5D9TA 2C4JA 5J3RA 4GF0A 5F0GA 1GTIA 1F9MA 2DJ3A 1YKCA 3APOA 3FZ5A 1G7OA 4WR5A 5H5SA 2WJUA 1HNCA 2GVPA 3KH7A 1GUHA 5AISA 2H1BA 4KUNA 2GQMA 1J0FA 4DSRA 2YJ7A 1URMA 5JCUA 1SKRB 1MD4A 4KAEA 3MWHA 4X1UA 4YAPA 8GSSA 3VK9A 4P3YB 3F63A 1SJZA 2DC5A 4MA9A 3P90A 3QMXA 2V1MA 1R4WA 4YQVA 3GKMA 3OR5A 2VD0A 3UOMA 1SU9A 3D21A 4FYBA 3QOUA 4AGSA 4G19A 4N10A 3HA9A 5DDLA 4K9ZA 2OADA 1YF1A 1ERVA 1XIYA 2XPEA 4IN0A 4I8BA 3HY2A 1SD9A 4TR1A 1GL8A 2XBIA 4YQMA 4IELA 3F0IA 4BL7A 5IMCA 2X8GA 4NV5A 2VAFA 3TRQA 1TRUA 4MF6A 3P8WA 2FWEA 4JE1A 5EL8A 1U88A 1QUWA 1HNBA 4EC0A 3DKSA 4ECCA 5CRHA 3QPMA 5DAKB 1TU8A 3GSTA 1X5CA 4POLA 3CSIA 1C72A 3DYRA 3FYGA 2OACA 2IMEA 4OO5A 4I5QA 5HFKA 3V1WA 4F0CA 4OMVA 2QC7A 4LA1A 4IKHA 1PL1A 2O7KA 2WFCA 2NVLA 16GSA 1XWBA 2FY6A 1WOUA 1J9BA 3ZITA 5HR0A 3EU3A 3TKPA 1JZRA 3CRTA 2YZHA 1XOAA 2LKUA 2B5XA 3VI5A 5DALA 1YDKA 4I97A 1GNWA 3LXZA 2I9HA 1O85A 3HZ4A 4WBJA 2A2RA 20GSA 4IQ1A 4MH3A 1S3DA 5ECNB 4K8MA 5H5RA 4HZ2A 2NPBA 2X99A 1Y6EA 2H0GA 3CMIA 1GP1A 1K0OA 4GLTA 1BX9A 1DBYA 5DJMA 4IHUA 2B7JA 2HRFA 1ERTA 1WWJA 3IR4A 2WB9A 1MDIA 1MEKA 4TXOB 2B7KA 1WRYA 5B6MA 1R26A 1NHOA 3TJGA 3GURA 4MABA 3Q74A 3VWUA 5G1KA 5ECOB 2FCHA 4TOPA 1SKSB 1RK4A 3ZFLA 2JADA 3BCIA 2DMLA 4RQRA 3TUEA 2RIIA 3C73A 1THXA 1ZZYA 1R5AA 1TDIA 2EIOA 3HXSA 1OYJA 4G2EA 4MZBA 1M9AA 2VCZA 1TK5B 2GT6A 18GSA 3N9JA 5DCHA 2J23A 2R37A 3H93A 5ECIB 1PMTA 4K0NA 1TRWA 1XOBA 3MNGA 4TKYA 4ECIA 3KIJA 4IW9A 5C00A 2M80A 1PKWA 3FR3A 1ERWA 4DSSB 4AJ7A 5LNKe 4HS1A 2JZTA 1G6WA 2QGVA 4OFTA 4GRFA 1PKZA 3TDGA 1CQGA 2IMFA 2JACA 5AGYA 2YP6A 3MSZA 4FYUA 1TK0B 2DMMA 1OE8A 2YOIA 4ZL8A 3VWXA 3GV1A 3N5OA 5LD0A 2LS5A 1O6JA 4WBRD 4MJAA 5HR3A 2M72A 2IMKA 5ECSA 3RDWA 1V2AA 3FZ4A 1DE1A 5KN3A 2VL2A 3BCKA 4JEDA 3GYKA 5ELGA 1TXXA 4L0WA 3KGKA 3C1RA 3HVSA 3QDNA 4F82A 1X9MB 3I69A 2LNSA 4KSOA 4RUVA 3D22A 2X64A 4KCEA 5AIVA 1WPIA 3BOAA 2HE3A 1M2BA 4N30A 3TRPA 1T1VA 1GULA 2JU5A 2VLUA 2VCXA 1E2YA 4D73B 2CV4A 1XXUA 1LU4A 1GWCA 4GXZA 1LBKA 2NDOA 1GSEA 1OKDA 1QGVA 4PUAA 1PX7A 2QKEA 2WZ9A 4EDYA 4YH2A 2B5YA 4LLRA 5EVOA 5B7CA 1SKWB 2GZYA 3ERWA 4FH8A 4TXOA 2R3XA 2E2MA 3I43A 4E8HA 2DIYA 4PQIA 2E0QA 1PGTA 3GNJA 1Z7PA 1GTAA 3US3A 2KOKA 2VD1A 1O8XA 2DJ0A 3IAS2 3RBTA 6GSSA 1A0RP 3LG6A 4PNFA 4Q5FA 2IWTA 2PERA 3TKRA 2LTKA 3R2QA 4MF7A 3UIWA 1V9WA 3D4MA 1T00A 2R2JA 1GUMA 1A2LA 1NW2A 3DRNA 5ECKB 4KX4A 1H4OA 4MMMA 5B6NA 1YY7A 2P31A 3G7IA 3QFAC 5G5EA 1Z6NA 3APSA 3C7MA 3PGTA 3EURA 2OE0A 1HD2A 3DEXA 2L4CA 2YWNA 3FR6A 3EC3A 1B4QA 1TJDA 2K6VA 4WF5A 2VM1A 1JZWA 5HFGA 4DSSA 3U6VA 5IMFA 4HQSA 4GSTA 4OCEA 3C1SA 4LMWA 1EWXA 5J9CA 1V40A 3IE3A 3WGXA 2BTOT 2E7PA 2FWGA 1TW9A 2M46A 1OAZA 3TKSA 1WP0A 2O87A 5CRDA 1U3AA 3WGEA 1USBA 1QQ2A 2KP2A 12GSA 1U87A 9GSSA 2PBJA 3PR8A 4I6XA 2RUFA 1VRSD 3DIEA 2LV3A 4NMUA 4J57E 4FO5A 3UARA 4EE0A 2H73A 2YJHA 3FW2A 3P2AA 1T4ZA 5DVBA 4AJ8A 3D5JA 2V2GA 1J08A 4DSQA 5L71A 3GX0A 2V41A 2CX3A 3ME8A 1SYRA 1M2DA 1PSQA 4EVMA 5J41A 2XC2A 3F9UA 2FHEA 1OE7A 1AIUA 2R6KA 4EO3A 3A5WA 3HHVA 5CAXA 4QQ7A 3KMOA 4ZILA 4HEA2 3LWAA 4D73A 2DIZA 3KJYA 5G2ZA 4BWQA 2JZSA 4MDCA 4PGTA 4O92A 4JR6A 3IHQA 1FVJA 1K3OA 1Z7RA 2MMZA 2CZ3A 2H74A 1FO5A 2H71A 2O85A 3NIVA 5IO0A 5IMDA 2C0DA 5HFIA 3IA1A 3H4KA 3O3TA 2L6DA 2HYXA 5JCWA 3F6DA 2XHFA 4NPBA 2PVQA 3QD9A 1SJIA 2EC4A 5KN1A 2DSAA 4IJIA 1R7HA 3G9BA 4RI6A 3IAM2 3MDKA 4GTUA 4WKWA 1KEBA 1EOGA 4K7OA 1V58A 1ZGNA 4ZBDA 4ML1A 2H1DA 4ISDA 4CW9A 1BQ7A 2KLXA 4I2UA 2AHEA 3GL3A 2KP1A 3ERGA 2OA7A 3M3MA 2IPAA 1NM3A 2MBTA 2YWIA 3L9SA 1KNGA 3HJOA 2MMOA 4MPFA 2F51A 3F6FA 4PUFC 2L6CA 3HDCA 3M9JA 2GSSA 2C0FA 1SL2B 2LSTA 1GUKA 5IMZA 3ERFA 3UVTA 4KDXA 1SL1B 3GKKA 2GQLA 2H0HA 1EEMA 3GN3A 1OVNA 1K0NA 3ZVJD 1ZL9A 1ERUA 2ES7A 4HJMA 1AAZA 5D9VA 3KH9A 4ID0A 5HR1A 1GRXA 1X9WB 1PX6A 3E0UA 2OBKA 4KGIA 3IDVA 2LQOA 2VL3A 3F8UA 4CDOA 2H1AA 1G7EA 4PQHA 4ILFA 1XPVA 1EV9A 1EEJA 3EINA 4ZL9A 2NTOA 3HZ8A 1K3YA 2CQ9A 3ZMLA 4RQXA 1A0FA 1QFNA 2IL3A 1XW9A 2MZCA 3QAGA 5ECMB 3H8QA 5EPFA 2GDRA 4XRAA 1T7PB 4HDEA 5KN0A 5F8BA 2LRTA 2B3SA 4FIWA 4NV2A 1XW6A 5G31A 2CAQA 5CRWA 4MCUA 1A24A 2LRCA 1VF3A 2K18A 2AAWA 1G6YA 1PA3A 5ECHB 2H6ZA 2H19A 2P0GA 1O8WA 2VCTA 5CNWA 5LCZA 4KCAA 3KTLA 1M0UA 4TR3A 2CA8A 2F8AA 3AY8A 3KP8A 3GTUB 4F03A 6GSUA 2VCWA 2D2ZA 2C0GA 3DXBA 3Q18A 4JR4A 2TIRA 3DD3A 2LJAA 2PN8A 1JFUA 19GSA 4IQAA 4ZBBA 2FWHA 1TKDB 5A4WA 1Y25A 4MF5A 3LSZA 3KP9A 3KTBA 1IYIA 2IJYA 2GLRA 4BVXA 3UMAA 1QK8A 3WT2A 5INYA 5COHA 1M2AA 5D93A 2PUKC 3ZYWA 1YEPA 3GIXA 3DGQA 2YPMA 2CZ2A 4JRRA 3GX8A 1VF4A 2VLTA 2H66A 2KUCA 2YN1A 1XWGA 2L4QA 3Q6OA 4L5OA 1XBSA 3VPQA 1HNAA 3TOTA 2MMNA 3DVWA 4NHZA 3DVXA 1R5PA 5G1LA 4I2TA 1GSFA 4AJ6A 2WULA 2N5BA 5CP1A 1EZKA 4PNGA 3CRUA 4O7HA 4OFMA 1XWKA 3HCZA 2N5AA 2G2QA 3HJPA 2GZPA 3IK9A 3HKRA 4LL4B 5CO3A 2RM5A 2DLXA 5G30A 14GSA 1Z6MA 3ISOA 1UN2A 4K6XA 3WYWA 1F6MC 2IMDA 2L5LA 3G7YA 2V6KA 4O32A 4MP4A 1K0MA 1ZOFA 3TB2A 3TJKA 4ECJA 2XPDA 4JZQA 1XVQA 1YEXA 1TTZA 5C04A 1JZDA 4TXVA 3EWLA 4OD7A 2E2GA 4ACSA 4NAXA 2A4VA 1TI3A 3FY7A 4HOJA 4ULXA 3CYNA 2VCVA 4QL7A 2K9FA 4N0ZA 1XZOA 4GQCA 3L0HA 3GTUA 3ZIVA 3M9KA 1AW9A 2OJLA 3HD5A 4WEYA 4MZWA 5AN1A 6GSWA 5IPGA 2AJQB 4DEJA 5J4UA 3TCOA 2XBQA 3RHBA 1OC8A 5F06A 5EY6A 1ZMAA 4IVFA 1A2JA 2WCIA 3RPNA 1PL2A 4LMVA 4KW6A 3RAZA 2PPTA 1ACVA 3E3EA 5D9XA 1K0CA 2R4VA 2C8UA 3ZVJA 2LEGA 4KNDA 1RQMA 2H8LA 2OE3A 2GTUA 4MJCA 1FHEA 2HLSA 4TW5A 2GSTA 4PX1A 4LL1B 4BPYA 5ELAA 2H1GA 2GSRA 3W6GA 5A4VA 2HZEB 4PURA 4K7IA 3G7JA 2P5RA 1FG4A 3M1GA 1A2MA 2RM6A 1BAYA 2I4AA 2Z9SA 4HZ4A 5IMAA 4ZB8A 4EKZA 2C3QA 2R5GA 5D73A 5IQYA 2O89A 1S3AA 1WJKA 1UVZA 5D9WA 2L59A 3FRCA 2F9SA 3PINA 2LRNA 1FAAA 2X8CA 3I9V2 3F4SA 4O5RA 3VURA 6GSVA 1GH2A 2VO4A 2H72A 4G10A 2O8VB 3IBHA 3CSJA 1S3CA 1XWCA 2PMTA 4POKA 2V32A 3FK8A 2YV9A 3M0FA 5ECLB 2BJXA 3KZQA 1TRSA 4MJBA 1T4YA 1SYXA 4KE3A 2PVOC 3FR9A 3D6IA 3O6TA 4L5LA 1U3IA 1OC9B 4JBBA 4OFNA 4HI7A 2YANA 2YV7A 1NSWA 5A4UA 2HRNA 2PU9C 2OE1A 5IMVA 5IOWA 5DJLA 3KCMA 4ZB9A 4XS1A 1B4PA 4Z7XA 3FKFA 5B8AA 2JSZA 3VI7A 2PGTA 2LJRA 2REMA 2TRXA 3ZREA 3QAVA 5FWGA 1ABAA 1YQ1A 4KDUA 4EXJA 4WXTA 5HR2A 1UC7A 5B8BA 3ME7A 2V6OA 1SK0A 2H75A 3LQ7A 2NBSA 4WF4A 3VWWA 1SL0B 1U6TA 3D0ZA 2CVBA 5FHIA 3HVXA 3UVHA 3GH9A 1E6BA 3ZRDA 5E4WA 1GSSA 3SBCA 1CQHA 1X0RA 1QXHA 1AUCA 17GSA 5AIXA 2BMXA 1W89A 3LFLA 5JWOB 1YZXA 2PWJA 2ON7A 1HQOA 2LJKA 5HQPA 1K3LA 1ZYEA 13GSA 1BJXA 1ZCPA 1SD8A 2FUG2 5KN2A 2IFQB 1Z5YE 5DBQA 2GT5A 1V57A 1PQNA 4RI7A 1TRVA 4MZCA 2H70A 3J7Yk 7GSSA 2HZFA 6GSTA 2FD3A 1B9YC 2VUPA
chains in the Genus database with same CATH superfamily
3ZIJA 5ABRA 4BVYA 3KD0A 4YQUA 1PFOA 1O7UA 2FNOA 2HZEA 1DE2A 1K0AA 1GLQA 3M8NA 4GSSA 1X5EA 3IPZA 4AF2A 2IIYA 5GAND 3LXTA 4BWSA 2EIRA 5ID2B 3A3TA 1TU7A 3F4TA 1G0TA 2C3NA 4POMA 3SWLA 11GSA 4JU5A 1VGLA 2C1YA 1AXDA 3CXGA 2L5OA 3TKSE 3WD6A 1F3AA 3A2XA 4TR0A 4NWYA 1GSYA 4KSMA 3GH6A 4V2LA 1TI1A 2H0IA 1OKTA 4IP1A 3W8JA 1SJ6A 3GSSA 3A2WA 4BA7A 3GKXA 2DJ1A 3FZ9A 1JHBA 2HRAA 5IM9A 4TVEA 1EP7A 1N2AA 4KA0A 3LGCA 1OC9A 2L57A 2J9HA 2DJJA 1X5DA 4ZBAA 2FLSA 4XS4B 2AYTA 4KF9A 4TR4A 2TRCP 3H79A 4DVCA 4MLYA 2I3YA 3W8SA 2B1KA 1K0DA 5CYYA 1MTCA 1A8LA 2DBCA 4J56E 1ZYQB 2VOCA 5DCGA 3L4NA 4MJEA 1JZOA 3UBLA 2HNLA 3TRXA 1F37A 1QMVA 5DQYA 4XRDA 1EV4A 5D96A 1RW1A 3H1NA 4MPGA 3I6AA 1TOFA 1FB6A 1FVKA 1Q4JA 1Z3EA 2VLVA 3D4TA 5CRGA 1IYHA 4ZL7A 5E59A 2ALBA 4X0XA 2F3MA 2LUSA 3KEBA 2HSYA 3CBUA 2VL2C 2R0GA 3LYPA 3S9FA 1JLVA 3UBKA 1ON4A 4A5PA 5IIZA 3ZLPA 4Q5RA 1LJRA 1I5GA 1A23A 5J5NA 1A8YA 2IFQA 3E9JB 3KMNA 2H6XA 3QR6A 5D8IA 1NHYA 3EE2A 2GS3A 5ECQB 4HU9A 4KH7A 4K1FA 2GGTA 3GKNA 1ZYPA 3IRAA 1SK2A 2FWFA 3VWVA 2CT6A 5JWRB 1FB0A 4NXIA 3MAKA 3WGDA 3RPPA 3EVIA 4OWYA 1THOA 3P7XA 3BD2A 3L9UA 1B9XC 3GA4A 4V2NA 3TKQA 5ID2A 2YCDA 5H5QA 3JCML 3IV4A 3GUSA 5G5FA 5J9BA 2LQQA 2A2SA 1GTUA 4CHSA 3ZMKA 4K5RA 5FT3A 4WETA 4J2FA 5GZZB 3U5RE 3HVNA 2HFDA 1XW5A 1WMJA 3IC4A 5GSTA 2FA4A 2HT9A 3FHKA 4HUAA 3NOFA 2H01A 1I9DA 4TN8A 2VL9A 3VFIA 1VF2A 1F2EA 2JSYA 1OC3A 5IO2A 3DWVA 4H86A 3HJMA 2B5EA 1KBNA 5F07A 6GSYA 5IPHA 1GSUA 3IOSA 2CAIA 2C0EA 4XIHA 4HU7A 4XS4A 4ML6A 3VPTA 2IN3A 1M9BA 3F3RA 2VIMA 2K8SA 4F0BA 2YNXA 4Q5QA 2AB6A 1B48A 4E8EA 2VM2A 4EF0A 2YWOA 3FMWA 4ZXGA 1M7TA 3KM6A 5DAKA 4N0VA 3TGZA 2FA8A 1FOVA 3O76A 3UL3A 1T3BA 3CSHA 1ML6A 1GLPA 3TKSC 2DJKA 5ECRB 3MIXA 2AV4A 2RUEA 2WRTA 4TRXA 4OCFA 3QCPA 4K2DA 2R0CA 1ST9A 3C71A 5IOXA 3QAWA 1O81A 1H75A 2KHPA 4F9ZA 1AQVA 1ZYNA 4IJ3A 1JLWA 1DUGA 4QL9A 4K0GA 3GHAA 4Q5NA 3HVVA 4POBA 4ZIJA 10GSA 3TJJA 5JCGA 2X4AA 3GL5A 2C3TA 3PPUA 1YF0A 3APQA 1EGRA 1ILOA 1O73A 2HI7A 2JL4A 1TK8B 2MBSA 1X9SB 1Q98A 4K7NA 1N8JA 2CVDA 2G0FA 4XHMA 2EIQA 2H76A 1SENA 1EOHA 4V1Ag 4L0UA 1MDKA 2H6YA 4K2XA 1DSBA 2ZUPA 3EMPA 2CVKA 1F3BA 3CTFA 3ZFBA 1GSQA 2FGXA 1AC1A 3IK7A 2P5QA 1EGOA 3TJBA 4XCSA 3ZZXA 2GSQA 1BG5A 1UA5A 4BVYB 4V2MA 3UJ1A 1VF1A 1AQXA 1EP8A 1M99A 1FOHA 2I81A 2ON5A 5ECPB 3UAPA 2ZNMA 2OBIA 3ZTLA 4HQZA 4N11A 3F4RA 1KTEA 2CX4A 5BMUA 1AQWA 2LNTA 3J7Yb 5F05A 3EU4A 1FW1A 1PN9A 4NHWA 1YJ6A 3DMLA 4IP6A 3LJRA 1PRXA 2QSIA 4YAVA 4EUYA 2B1LA 3KXOA 1WE0A 2WDUA 3NZNA 3BJ5A 2IMIA 3GFKA 2ZCTA 2OKAA 4L8EA 5GAPD 3EMXA 2I1UA 2WGRA 4ECBA 1B8XA 3TJFA 5A5KA 4GCIA 3CQFA 2H30A 1BEDA 1XFLA 2RLIA 4IS0A 5ENUA 4XTSA 4MH2A 1SK1A 4KDYA 1XCCA 4IGJA 4FYCA 3HYPA 5DQSA 1PD21 2WS2A 4GQFA 1TP9A 2DJ2A 3TOUA 3ZL5A 3C8EA 4TR1B 4V1Ap 2C80A 1GNEA 4CY8A 1XVWA 4EDZA 2B6MA 2HXKA 3PH9A 4XS6A 1YKAA 2AUVA 3EYTA 5GSSA 4G0KA 3L9VA 1Z9HA 4BL7B 3L78A 5CREA 1V98A 3ED3A 3RHCA 5JWQB 3A2VA 3CTGA 4G9HA 5KEJA 1GTBA 1WIKA 4WR4A 4PQ1A 1K0BA 1T8EB 3WT1A 22GSA 5KOWA 4OO4A 1XWAA 3FZAA 2GZZA 3IXRA 4G0LA 2YWMA 3UEMA 4MK3A 1W4VA 3GRXA 3LYKA 3Q19A 2K8VA 1MD3A 2MMAA 1HYUA 3VLNA 4GSNA 3K8NA 2HSHA 2GQKA 3FEUA 4F2IA 4KB3A 2JZRA 3QFBC 3F3QA 4ZB6A 3BBYA 4EL1A 1MDJA 4X43A 4IBPA 6GSXA 3LEFA 1BYEA 2X8HA 4PXOA 4HJ2A 2F8FA 2VCQA 5DALB 3GMFA 2MYGA 1GSDA 2N5FA 4Z2TA 2YZUA 3LORA 4GWRA 5D9TA 2C4JA 5J3RA 4GF0A 5F0GA 1GTIA 1F9MA 2DJ3A 1YKCA 3APOA 3FZ5A 4FQUA 1G7OA 2HRKA 4WR5A 5H5SA 2WJUA 1HNCA 2GVPA 3KH7A 1GUHA 5AISA 2H1BA 4KUNA 2GQMA 1J0FA 4DSRA 2YJ7A 1URMA 5JCUA 1SKRB 1MD4A 4KAEA 4MNNA 3MWHA 4X1UA 4YAPA 8GSSA 3VK9A 4P3YB 3F63A 1SJZA 2DC5A 4MA9A 3P90A 3QMXA 2V1MA 1R4WA 4YQVA 3GKMA 3OR5A 2VD0A 3UOMA 1SU9A 3D21A 4FYBA 3QOUA 4AGSA 4G19A 4N10A 3HA9A 5DDLA 4K9ZA 2OADA 1YF1A 1ERVA 1XIYA 2XPEA 4IN0A 4I8BA 3HY2A 1SD9A 4TR1A 1GL8A 2XBIA 4YQMA 4IELA 3F0IA 4BL7A 5IMCA 2X8GA 4NV5A 2VAFA 3TRQA 1TRUA 4MF6A 3P8WA 2FWEA 4JE1A 5EL8A 1U88A 1QUWA 1HNBA 4EC0A 3DKSA 4ECCA 5CRHA 3QPMA 5DAKB 1TU8A 3GSTA 1X5CA 4POLA 3CSIA 1C72A 3DYRA 3FYGA 2OACA 2IMEA 4OO5A 4I5QA 5HFKA 3V1WA 4F0CA 4OMVA 2QC7A 4LA1A 4IKHA 1PL1A 2O7KA 2WFCA 2NVLA 16GSA 1XWBA 2FY6A 1WOUA 1J9BA 3ZITA 5HR0A 3EU3A 3TKPA 1JZRA 3CRTA 2YZHA 1XOAA 2LKUA 2B5XA 3VI5A 5DALA 1YDKA 4I97A 1GNWA 3LXZA 2I9HA 1O85A 3HZ4A 4WBJA 4ICYA 2A2RA 20GSA 4IQ1A 4MH3A 1S3DA 3IC8A 5ECNB 4K8MA 5H5RA 4HZ2A 2NPBA 2X99A 1Y6EA 2H0GA 3CMIA 1GP1A 1K0OA 4GLTA 1BX9A 1DBYA 5DJMA 4IHUA 2B7JA 2HRFA 1ERTA 1WWJA 3IR4A 2WB9A 1MDIA 1MEKA 4TXOB 2B7KA 1WRYA 5B6MA 1R26A 1NHOA 3TJGA 3GURA 4MABA 3Q74A 3VWUA 5G1KA 5ECOB 2FCHA 4TOPA 1SKSB 1RK4A 3ZFLA 2JADA 3BCIA 2DMLA 4RQRA 3TUEA 2RIIA 3C73A 1THXA 1ZZYA 1R5AA 1TDIA 2EIOA 3HXSA 1OYJA 4G2EA 4MZBA 1M9AA 2VCZA 1TK5B 2GT6A 18GSA 3N9JA 5DCHA 2J23A 2R37A 3H93A 5ECIB 1PMTA 4K0NA 1TRWA 1XOBA 3MNGA 4TKYA 4ECIA 3KIJA 4IW9A 5C00A 2M80A 1PKWA 3FR3A 1ERWA 4DSSB 4AJ7A 5LNKe 4HS1A 2JZTA 1G6WA 2QGVA 4OFTA 4G0IA 4GRFA 1PKZA 3TDGA 1CQGA 2IMFA 2JACA 5AGYA 2YP6A 3MSZA 4FYUA 1TK0B 2DMMA 1OE8A 2YOIA 4ZL8A 3VWXA 3GV1A 3N5OA 5LD0A 2LS5A 1O6JA 4WBRD 4MJAA 5HR3A 2M72A 2IMKA 5ECSA 3RDWA 1V2AA 3FZ4A 1DE1A 5KN3A 2VL2A 3BCKA 4JEDA 3GYKA 5ELGA 1TXXA 4L0WA 3KGKA 3C1RA 3HVSA 3QDNA 4F82A 1X9MB 3I69A 2LNSA 4KSOA 4RUVA 4USSA 3D22A 2X64A 1M3JA 4O5UA 4YKGA 4KCEA 5AIVA 1WPIA 3BOAA 2HE3A 3IHGA 1M2BA 4N30A 3TRPA 1T1VA 1GULA 2JU5A 2VLUA 2VCXA 1E2YA 4D73B 2CV4A 1XXUA 1LU4A 1GWCA 4GXZA 1LBKA 2NDOA 1GSEA 1OKDA 1QGVA 4PUAA 1PX7A 2QKEA 2WZ9A 4EDYA 4YH2A 2B5YA 4LLRA 5EVOA 5B7CA 1SKWB 2GZYA 3ERWA 4FH8A 4TXOA 2R3XA 2E2MA 3I43A 4E8HA 2DIYA 4PQIA 2E0QA 1PGTA 3GNJA 1Z7PA 1GTAA 3US3A 2KOKA 2VD1A 1O8XA 2DKHA 2DJ0A 3IAS2 3RBTA 6GSSA 1A0RP 3LG6A 4PNFA 4Q5FA 2IWTA 2PERA 3TKRA 2LTKA 3R2QA 4MF7A 3UIWA 1V9WA 3D4MA 1T00A 2R2JA 1GUMA 1A2LA 1NW2A 3DRNA 5ECKB 4KX4A 1H4OA 4MMMA 5B6NA 1YY7A 2P31A 3G7IA 3QFAC 5G5EA 1Z6NA 3APSA 3C7MA 3PGTA 3EURA 2OE0A 1HD2A 3DEXA 2L4CA 2YWNA 3FR6A 3EC3A 1B4QA 1TJDA 2K6VA 4WF5A 2VM1A 1JZWA 5HFGA 4DSSA 3U6VA 5IMFA 4HQSA 4GSTA 4OCEA 3C1SA 4LMWA 1EWXA 3EPTA 5J9CA 1V40A 3IE3A 3WGXA 2BTOT 2E7PA 2FWGA 1TW9A 2M46A 1OAZA 3TKSA 4Z2RA 1WP0A 2O87A 5CRDA 1U3AA 3WGEA 1USBA 1QQ2A 2KP2A 12GSA 1U87A 9GSSA 2PBJA 3PR8A 4I6XA 2RUFA 1VRSD 3DIEA 2LV3A 4NMUA 4J57E 4FO5A 3UARA 4EE0A 2H73A 2YJHA 3FW2A 3P2AA 1T4ZA 5DVBA 4AJ8A 3D5JA 2V2GA 1J08A 4DSQA 5L71A 3GX0A 2V41A 2CX3A 3ME8A 1SYRA 4YKFA 1M2DA 1PSQA 4EVMA 5J41A 2XC2A 3F9UA 2FHEA 1OE7A 1AIUA 2R6KA 4EO3A 3A5WA 3HHVA 5CAXA 4QQ7A 3KMOA 4ZILA 4HEA2 3LWAA 4D73A 2DIZA 3KJYA 5G2ZA 4BWQA 2JZSA 4MDCA 4PGTA 4O92A 4JR6A 3IHQA 1FVJA 1K3OA 1Z7RA 2MMZA 2CZ3A 2H74A 1FO5A 2H71A 2O85A 3NIVA 5IO0A 5IMDA 2C0DA 5HFIA 3IA1A 5KOXA 3H4KA 3O3TA 2L6DA 2HYXA 5JCWA 3F6DA 2X49A 2XHFA 4NPBA 2PVQA 3QD9A 1SJIA 2EC4A 5KN1A 2DSAA 4IJIA 1R7HA 3G9BA 4RI6A 3IAM2 3MDKA 4GTUA 4WKWA 1KEBA 4CY6A 1EOGA 4K7OA 1V58A 1ZGNA 4ZBDA 4ML1A 2H1DA 4BVXB 4ISDA 4CW9A 1BQ7A 2KLXA 4I2UA 2AHEA 3GL3A 2KP1A 3ERGA 2OA7A 2A4HA 3M3MA 2IPAA 1NM3A 2MBTA 2YWIA 3L9SA 1KNGA 3HJOA 2MMOA 4MPFA 2F51A 3F6FA 4PUFC 2L6CA 3HDCA 3M9JA 2GSSA 2C0FA 1SL2B 2LSTA 1GUKA 5IMZA 3ERFA 3UVTA 4KDXA 1SL1B 3GKKA 2GQLA 2H0HA 1EEMA 3GN3A 1OVNA 2HSMA 5BRTA 1K0NA 3ZVJD 1ZL9A 1ERUA 2ES7A 4HJMA 1AAZA 5D9VA 3KH9A 4ID0A 5HR1A 1GRXA 3A5IA 1X9WB 1PX6A 3E0UA 2OBKA 4KGIA 3IDVA 2LQOA 2VL3A 3F8UA 4CDOA 2H1AA 1G7EA 4PQHA 4ILFA 1XPVA 1EV9A 1EEJA 3EINA 4ZL9A 2NTOA 3HZ8A 1K3YA 2CQ9A 3ZMLA 4RQXA 1A0FA 1QFNA 2IL3A 1XW9A 2MZCA 3QAGA 5ECMB 3H8QA 5EPFA 2GDRA 4XRAA 1T7PB 4HDEA 5KN0A 5F8BA 2LRTA 1PN0A 2B3SA 4FIWA 4NV2A 1XW6A 5G31A 2CAQA 5CRWA 4MCUA 1A24A 2LRCA 1VF3A 2K18A 2AAWA 1G6YA 1PA3A 5ECHB 2H6ZA 2H19A 1S3RA 2P0GA 1O8WA 2VCTA 5CNWA 5LCZA 4KCAA 3KTLA 1M0UA 4TR3A 2CA8A 2F8AA 3AY8A 3KP8A 3GTUB 4F03A 6GSUA 2VCWA 2D2ZA 2C0GA 3DXBA 3Q18A 4JR4A 2TIRA 3DD3A 2LJAA 2PN8A 1JFUA 19GSA 4IQAA 4ZBBA 2FWHA 1TKDB 5A4WA 1Y25A 4MF5A 3LSZA 3KP9A 3KTBA 3LW9A 1IYIA 2IJYA 2GLRA 4BVXA 3UMAA 1QK8A 3WT2A 5INYA 2UZ8A 5COHA 4Z2UA 4X4JA 1M2AA 5D93A 2PUKC 3ZYWA 1YEPA 3GIXA 3DGQA 2YPMA 2CZ2A 4JRRA 3GX8A 1VF4A 2VLTA 2H66A 2KUCA 2YN1A 1XWGA 2L4QA 3Q6OA 4L5OA 1XBSA 3VPQA 1HNAA 3TOTA 2MMNA 3DVWA 4NHZA 4PTSA 3DVXA 1R5PA 5G1LA 4I2TA 1GSFA 4AJ6A 2WULA 2N5BA 5CP1A 1EZKA 4PNGA 3CRUA 4O7HA 4OFMA 1XWKA 3HCZA 2N5AA 2G2QA 3HJPA 2GZPA 3IK9A 3HKRA 2A2PA 4LL4B 5CO3A 2RM5A 2DLXA 5G30A 14GSA 1Z6MA 3ISOA 1UN2A 4K6XA 3WYWA 1F6MC 2IMDA 2L5LA 3G7YA 2V6KA 4O32A 4MP4A 1K0MA 2QA2A 1ZOFA 1M3IA 3TB2A 3TJKA 4ECJA 2XPDA 4JZQA 1XVQA 1YEXA 1TTZA 5C04A 1JZDA 4TXVA 3EWLA 4OD7A 2E2GA 4ACSA 4NAXA 2A4VA 1TI3A 3FY7A 4HOJA 4ULXA 3CYNA 2VCVA 4QL7A 2K9FA 4N0ZA 1XZOA 4GQCA 3L0HA 3GTUA 3ZIVA 3M9KA 1AW9A 2OJLA 3HD5A 4WEYA 4MZWA 5AN1A 6GSWA 5IPGA 2AJQB 4DEJA 5J4UA 3TCOA 2XBQA 3RHBA 1OC8A 5F06A 4O5QA 4K5SA 5EY6A 2DKIA 1ZMAA 4IVFA 1A2JA 2WCIA 1XG8A 3RPNA 1PL2A 4LMVA 4KW6A 3RAZA 2PPTA 1ACVA 3E3EA 5D9XA 1K0CA 2R4VA 2C8UA 3ZVJA 2LEGA 4KNDA 1RQMA 2H8LA 2OE3A 2GTUA 4MJCA 1FHEA 2HLSA 4TW5A 2GSTA 2R0PA 4PX1A 4LL1B 4BPYA 5ELAA 2H1GA 2GSRA 3W6GA 5A4VA 2HZEB 4PURA 4K7IA 3G7JA 2P5RA 1FG4A 2QA1A 3M1GA 1A2MA 2RM6A 4EIPA 1BAYA 2I4AA 2Z9SA 4HZ4A 5IMAA 4ZB8A 4EKZA 2C3QA 2R5GA 5D73A 5IQYA 2O89A 1S3AA 1WJKA 1UVZA 5D9WA 2L59A 3FRCA 2F9SA 3PINA 2LRNA 1FAAA 2X8CA 3I9V2 3R3EA 3F4SA 4O5RA 3VURA 6GSVA 1GH2A 2VO4A 2H72A 4G10A 2O8VB 3IBHA 3CSJA 1S3CA 1XWCA 2PMTA 4POKA 2V32A 3FK8A 2YV9A 3M0FA 5ECLB 2BJXA 3KZQA 1TRSA 4MJBA 1T4YA 1SYXA 4KE3A 2PVOC 3FR9A 3D6IA 3O6TA 4L5LA 1U3IA 1OC9B 4JBBA 4OFNA 4HI7A 2YANA 2YV7A 1NSWA 5A4UA 2HRNA 2PU9C 2OE1A 5IMVA 5IOWA 5DJLA 3KCMA 4ZB9A 4XS1A 1B4PA 4Z7XA 4HSCX 4EIQA 3FKFA 5B8AA 2JSZA 3VI7A 2PGTA 2LJRA 4BIKA 3MYDA 2REMA 2TRXA 3ZREA 3QAVA 5FWGA 1ABAA 1YQ1A 4KDUA 4EXJA 4WXTA 5HR2A 1UC7A 5B8BA 3ME7A 2V6OA 1SK0A 2H75A 3LQ7A 2NBSA 4WF4A 3VWWA 1SL0B 1U6TA 3D0ZA 2CVBA 5FHIA 3HVXA 3UVHA 3GH9A 1E6BA 3ZRDA 5E4WA 1GSSA 3SBCA 1CQHA 1X0RA 1QXHA 1AUCA 17GSA 5AIXA 2BMXA 1W89A 3LFLA 5JWOB 1YZXA 2PWJA 2ON7A 1HQOA 2LJKA 5HQPA 1K3LA 1ZYEA 13GSA 1BJXA 1ZCPA 1SD8A 2FUG2 5KN2A 2IFQB 1Z5YE 5DBQA 2GT5A 1V57A 1PQNA 4RI7A 1TRVA 4MZCA 2H70A 3J7Yk 7GSSA 2HZFA 6GSTA 2FD3A 1B9YC 2VUPA
chains in the Genus database with same CATH topology
3ZIJA 5ABRA 4BVYA 3KD0A 4YQUA 1O7UA 2FNOA 2HZEA 1DE2A 1K0AA 1GLQA 3M8NA 4GSSA 1X5EA 3IPZA 4AF2A 2IIYA 5GAND 3LXTA 4BWSA 2EIRA 5ID2B 3A3TA 1TU7A 3F4TA 1G0TA 2C3NA 4POMA 3SWLA 11GSA 4JU5A 1VGLA 2C1YA 1AXDA 3CXGA 2L5OA 3TKSE 3WD6A 1F3AA 3A2XA 4TR0A 4NWYA 1GSYA 4KSMA 3GH6A 4V2LA 1TI1A 2H0IA 1OKTA 4IP1A 3W8JA 1SJ6A 3GSSA 3A2WA 4BA7A 3GKXA 2DJ1A 3FZ9A 1JHBA 2HRAA 5IM9A 4TVEA 1EP7A 1N2AA 4KA0A 3LGCA 1OC9A 2L57A 2J9HA 2DJJA 1X5DA 4ZBAA 2FLSA 4XS4B 2AYTA 4KF9A 4TR4A 2TRCP 3H79A 4DVCA 4MLYA 2I3YA 3W8SA 2B1KA 1K0DA 5CYYA 1MTCA 1A8LA 2DBCA 4J56E 1ZYQB 2VOCA 5DCGA 3L4NA 4MJEA 1JZOA 3UBLA 2HNLA 3TRXA 1F37A 1QMVA 5DQYA 4XRDA 1EV4A 5D96A 1RW1A 3H1NA 4MPGA 3I6AA 1TOFA 1FB6A 1FVKA 1Q4JA 1Z3EA 2VLVA 3D4TA 5CRGA 1IYHA 4ZL7A 5E59A 2ALBA 4X0XA 2F3MA 2LUSA 3KEBA 2HSYA 3CBUA 2VL2C 2R0GA 3LYPA 3S9FA 1JLVA 3UBKA 1ON4A 4A5PA 5IIZA 3ZLPA 4Q5RA 1LJRA 1I5GA 1A23A 5J5NA 1A8YA 2IFQA 3E9JB 3KMNA 2H6XA 3QR6A 5D8IA 1NHYA 3EE2A 2GS3A 5ECQB 4HU9A 4KH7A 4K1FA 2GGTA 3GKNA 1ZYPA 3IRAA 1SK2A 2FWFA 3VWVA 2CT6A 5JWRB 1FB0A 4NXIA 3MAKA 3WGDA 3RPPA 3EVIA 4OWYA 1THOA 3P7XA 3BD2A 3L9UA 1B9XC 3GA4A 4V2NA 3TKQA 5ID2A 2YCDA 5H5QA 3JCML 3IV4A 3GUSA 5G5FA 5J9BA 2LQQA 2A2SA 1GTUA 4CHSA 3ZMKA 4K5RA 5FT3A 4WETA 4J2FA 5GZZB 3U5RE 2HFDA 1XW5A 1WMJA 3IC4A 5GSTA 2FA4A 2HT9A 3FHKA 4HUAA 3NOFA 2H01A 1I9DA 4TN8A 2VL9A 3VFIA 1VF2A 1F2EA 2JSYA 1OC3A 5IO2A 3DWVA 4H86A 3HJMA 2B5EA 1KBNA 5F07A 6GSYA 5IPHA 1GSUA 3IOSA 2CAIA 2C0EA 4XIHA 4HU7A 4XS4A 4ML6A 3VPTA 2IN3A 1M9BA 3F3RA 2VIMA 2K8SA 4F0BA 2YNXA 4Q5QA 2AB6A 1B48A 4E8EA 2VM2A 4EF0A 2YWOA 3FMWA 4ZXGA 1M7TA 3KM6A 5DAKA 4N0VA 3TGZA 2FA8A 1FOVA 3O76A 3UL3A 1T3BA 3CSHA 1ML6A 1GLPA 3TKSC 2DJKA 5ECRB 3MIXA 2AV4A 2RUEA 2WRTA 4TRXA 4OCFA 3QCPA 4K2DA 2R0CA 1ST9A 3C71A 5IOXA 3QAWA 1O81A 1H75A 2KHPA 4F9ZA 1AQVA 1ZYNA 4IJ3A 1JLWA 1DUGA 4QL9A 4K0GA 3GHAA 4Q5NA 3HVVA 4POBA 4ZIJA 10GSA 3TJJA 5JCGA 2X4AA 3GL5A 2C3TA 3PPUA 1YF0A 3APQA 1EGRA 1ILOA 1O73A 2HI7A 2JL4A 1TK8B 2MBSA 1X9SB 1Q98A 4K7NA 1N8JA 2CVDA 2G0FA 4XHMA 2EIQA 2H76A 1SENA 1EOHA 4V1Ag 4L0UA 1MDKA 2H6YA 4K2XA 1DSBA 2ZUPA 3EMPA 2CVKA 1F3BA 3CTFA 3ZFBA 1GSQA 2FGXA 1AC1A 3IK7A 2P5QA 1EGOA 3TJBA 4XCSA 3ZZXA 2GSQA 1BG5A 1UA5A 4BVYB 4V2MA 3UJ1A 1VF1A 1AQXA 1EP8A 1M99A 1FOHA 2I81A 2ON5A 5ECPB 3UAPA 2ZNMA 2OBIA 3ZTLA 4HQZA 4N11A 3F4RA 1KTEA 2CX4A 5BMUA 1AQWA 2LNTA 3J7Yb 5F05A 3EU4A 1FW1A 1PN9A 4NHWA 1YJ6A 3DMLA 4IP6A 3LJRA 1PRXA 2QSIA 4YAVA 4EUYA 2B1LA 3KXOA 1WE0A 2WDUA 3NZNA 3BJ5A 2IMIA 3GFKA 2ZCTA 2OKAA 4L8EA 5GAPD 3EMXA 2I1UA 2WGRA 4ECBA 1B8XA 3TJFA 5A5KA 4GCIA 2H30A 1BEDA 1XFLA 2RLIA 4IS0A 5ENUA 4XTSA 4MH2A 1SK1A 4KDYA 1XCCA 4IGJA 4FYCA 3HYPA 5DQSA 1PD21 2WS2A 4GQFA 1TP9A 2DJ2A 3TOUA 3ZL5A 3C8EA 4TR1B 4V1Ap 2C80A 1GNEA 4CY8A 1XVWA 4EDZA 2B6MA 2HXKA 3PH9A 4XS6A 1YKAA 2AUVA 3EYTA 5GSSA 4G0KA 3L9VA 1Z9HA 4BL7B 3L78A 5CREA 1V98A 3ED3A 3RHCA 5JWQB 3A2VA 3CTGA 4G9HA 5KEJA 1GTBA 1WIKA 4WR4A 4PQ1A 1K0BA 1T8EB 3WT1A 22GSA 5KOWA 4OO4A 1XWAA 3FZAA 2GZZA 3IXRA 4G0LA 2YWMA 3UEMA 4MK3A 1W4VA 3GRXA 3LYKA 3Q19A 2K8VA 1MD3A 2MMAA 1HYUA 3VLNA 4GSNA 3K8NA 2HSHA 2GQKA 3FEUA 4F2IA 4KB3A 2JZRA 3QFBC 3F3QA 4ZB6A 3BBYA 4EL1A 1MDJA 4X43A 4IBPA 6GSXA 3LEFA 1BYEA 2X8HA 4PXOA 4HJ2A 2F8FA 2VCQA 5DALB 3GMFA 2MYGA 1GSDA 2N5FA 4Z2TA 2YZUA 3LORA 4GWRA 5D9TA 2C4JA 5J3RA 4GF0A 5F0GA 1GTIA 1F9MA 2DJ3A 1YKCA 3APOA 3FZ5A 4FQUA 1G7OA 2HRKA 4WR5A 5H5SA 2WJUA 1HNCA 2GVPA 3KH7A 1GUHA 5AISA 2H1BA 4KUNA 2GQMA 1J0FA 4DSRA 2YJ7A 1URMA 5JCUA 1SKRB 1MD4A 4KAEA 4MNNA 3MWHA 4X1UA 4YAPA 8GSSA 3VK9A 4P3YB 3F63A 1SJZA 2DC5A 4MA9A 3P90A 3QMXA 2V1MA 1R4WA 4YQVA 3GKMA 3OR5A 2VD0A 3UOMA 1SU9A 3D21A 4FYBA 3QOUA 4AGSA 4G19A 4N10A 3HA9A 5DDLA 4K9ZA 2OADA 1YF1A 1ERVA 1XIYA 2XPEA 4IN0A 4I8BA 3HY2A 1SD9A 4TR1A 1GL8A 2XBIA 4YQMA 4IELA 3F0IA 4BL7A 5IMCA 2X8GA 4NV5A 2VAFA 3TRQA 1TRUA 4MF6A 3P8WA 2FWEA 4JE1A 5EL8A 1U88A 1QUWA 1HNBA 4EC0A 3DKSA 4ECCA 5CRHA 3QPMA 5DAKB 1TU8A 3GSTA 1X5CA 4POLA 3CSIA 1C72A 3DYRA 3FYGA 2OACA 2IMEA 4OO5A 4I5QA 5HFKA 3V1WA 4F0CA 4OMVA 2QC7A 4LA1A 4IKHA 1PL1A 2O7KA 2WFCA 2NVLA 16GSA 1XWBA 2FY6A 1WOUA 1J9BA 3ZITA 5HR0A 3EU3A 3TKPA 1JZRA 3CRTA 2YZHA 1XOAA 2LKUA 2B5XA 3VI5A 5DALA 1YDKA 4I97A 1GNWA 3LXZA 2I9HA 1O85A 3HZ4A 4WBJA 4ICYA 2A2RA 20GSA 4IQ1A 4MH3A 1S3DA 3IC8A 5ECNB 4K8MA 5H5RA 4HZ2A 2NPBA 2X99A 1Y6EA 2H0GA 3CMIA 1GP1A 1K0OA 4GLTA 1BX9A 1DBYA 5DJMA 4IHUA 2B7JA 2HRFA 1ERTA 1WWJA 3IR4A 2WB9A 1MDIA 1MEKA 4TXOB 2B7KA 1WRYA 5B6MA 1R26A 1NHOA 3TJGA 3GURA 4MABA 3Q74A 3VWUA 5G1KA 5ECOB 2FCHA 4TOPA 1SKSB 1RK4A 3ZFLA 2JADA 3BCIA 2DMLA 4RQRA 3TUEA 2RIIA 3C73A 1THXA 1ZZYA 1R5AA 1TDIA 2EIOA 3HXSA 1OYJA 4G2EA 4MZBA 1M9AA 2VCZA 1TK5B 2GT6A 18GSA 3N9JA 5DCHA 2J23A 2R37A 3H93A 5ECIB 1PMTA 4K0NA 1TRWA 1XOBA 3MNGA 4TKYA 4ECIA 3KIJA 4IW9A 5C00A 2M80A 1PKWA 3FR3A 1ERWA 4DSSB 4AJ7A 5LNKe 4HS1A 2JZTA 1G6WA 2QGVA 4OFTA 4G0IA 4GRFA 1PKZA 3TDGA 1CQGA 2IMFA 2JACA 5AGYA 2YP6A 3MSZA 4FYUA 1TK0B 2DMMA 1OE8A 2YOIA 4ZL8A 3VWXA 3GV1A 3N5OA 5LD0A 2LS5A 1O6JA 4WBRD 4MJAA 5HR3A 2M72A 2IMKA 5ECSA 3RDWA 1V2AA 3FZ4A 1DE1A 5KN3A 2VL2A 3BCKA 4JEDA 3GYKA 5ELGA 1TXXA 4L0WA 3KGKA 3C1RA 3HVSA 3QDNA 4F82A 1X9MB 3I69A 2LNSA 4KSOA 4RUVA 4USSA 3D22A 2X64A 4O5UA 4YKGA 4KCEA 5AIVA 1WPIA 3BOAA 2HE3A 3IHGA 1M2BA 4N30A 3TRPA 1T1VA 1GULA 2JU5A 2VLUA 2VCXA 1E2YA 4D73B 2CV4A 1XXUA 1LU4A 1GWCA 4GXZA 1LBKA 2NDOA 1GSEA 1OKDA 1QGVA 4PUAA 1PX7A 2QKEA 2WZ9A 4EDYA 4YH2A 2B5YA 4LLRA 5EVOA 5B7CA 1SKWB 2GZYA 3ERWA 4FH8A 4TXOA 2R3XA 2E2MA 3I43A 4E8HA 2DIYA 4PQIA 2E0QA 1PGTA 3GNJA 1Z7PA 1GTAA 3US3A 2KOKA 2VD1A 1O8XA 2DKHA 2DJ0A 3IAS2 3RBTA 6GSSA 1A0RP 3LG6A 4PNFA 4Q5FA 2IWTA 2PERA 3TKRA 2LTKA 3R2QA 4MF7A 3UIWA 1V9WA 3D4MA 1T00A 2R2JA 1GUMA 1A2LA 1NW2A 3DRNA 5ECKB 4KX4A 1H4OA 4MMMA 5B6NA 1YY7A 2P31A 3G7IA 3QFAC 5G5EA 1Z6NA 3APSA 3C7MA 3PGTA 3EURA 2OE0A 1HD2A 3DEXA 2L4CA 2YWNA 3FR6A 3EC3A 1B4QA 1TJDA 2K6VA 4WF5A 2VM1A 1JZWA 5HFGA 4DSSA 3U6VA 5IMFA 4HQSA 4GSTA 4OCEA 3C1SA 4LMWA 1EWXA 3EPTA 5J9CA 1V40A 3IE3A 3WGXA 2BTOT 2E7PA 2FWGA 1TW9A 2M46A 1OAZA 3TKSA 4Z2RA 1WP0A 2O87A 5CRDA 1U3AA 3WGEA 1USBA 1QQ2A 2KP2A 12GSA 1U87A 9GSSA 2PBJA 3PR8A 4I6XA 2RUFA 1VRSD 3DIEA 2LV3A 4NMUA 4J57E 4FO5A 3UARA 4EE0A 2H73A 2YJHA 3FW2A 3P2AA 1T4ZA 5DVBA 4AJ8A 3D5JA 2V2GA 1J08A 4DSQA 5L71A 3GX0A 2V41A 2CX3A 3ME8A 1SYRA 4YKFA 1M2DA 1PSQA 4EVMA 5J41A 2XC2A 3F9UA 2FHEA 1OE7A 1AIUA 2R6KA 4EO3A 3A5WA 3HHVA 5CAXA 4QQ7A 3KMOA 4ZILA 4HEA2 3LWAA 4D73A 2DIZA 3KJYA 5G2ZA 4BWQA 2JZSA 4MDCA 4PGTA 4O92A 4JR6A 3IHQA 1FVJA 1K3OA 1Z7RA 2MMZA 2CZ3A 2H74A 1FO5A 2H71A 2O85A 3NIVA 5IO0A 5IMDA 2C0DA 5HFIA 3IA1A 5KOXA 3H4KA 3O3TA 2L6DA 2HYXA 5JCWA 3F6DA 2X49A 2XHFA 4NPBA 2PVQA 3QD9A 1SJIA 2EC4A 5KN1A 2DSAA 4IJIA 1R7HA 3G9BA 4RI6A 3IAM2 3MDKA 4GTUA 4WKWA 1KEBA 4CY6A 1EOGA 4K7OA 1V58A 1ZGNA 4ZBDA 4ML1A 2H1DA 4BVXB 4ISDA 4CW9A 1BQ7A 2KLXA 4I2UA 2AHEA 3GL3A 2KP1A 3ERGA 2OA7A 2A4HA 3M3MA 2IPAA 1NM3A 2MBTA 2YWIA 3L9SA 1KNGA 3HJOA 2MMOA 4MPFA 2F51A 3F6FA 4PUFC 2L6CA 3HDCA 3M9JA 2GSSA 2C0FA 1SL2B 2LSTA 1GUKA 5IMZA 3ERFA 3UVTA 4KDXA 1SL1B 3GKKA 2GQLA 2H0HA 1EEMA 3GN3A 1OVNA 2HSMA 5BRTA 1K0NA 3ZVJD 1ZL9A 1ERUA 2ES7A 4HJMA 1AAZA 5D9VA 3KH9A 4ID0A 5HR1A 1GRXA 3A5IA 1X9WB 1PX6A 3E0UA 2OBKA 4KGIA 3IDVA 2LQOA 2VL3A 3F8UA 4CDOA 2H1AA 1G7EA 4PQHA 4ILFA 1XPVA 1EV9A 1EEJA 3EINA 4ZL9A 2NTOA 3HZ8A 1K3YA 2CQ9A 3ZMLA 4RQXA 1A0FA 1QFNA 2IL3A 1XW9A 2MZCA 3QAGA 5ECMB 3H8QA 5EPFA 2GDRA 4XRAA 1T7PB 4HDEA 5KN0A 5F8BA 2LRTA 1PN0A 2B3SA 4FIWA 4NV2A 1XW6A 5G31A 2CAQA 5CRWA 4MCUA 1A24A 2LRCA 1VF3A 2K18A 2AAWA 1G6YA 1PA3A 5ECHB 2H6ZA 2H19A 2P0GA 1O8WA 2VCTA 5CNWA 5LCZA 4KCAA 3KTLA 1M0UA 4TR3A 2CA8A 2F8AA 3AY8A 3KP8A 3GTUB 4F03A 6GSUA 2VCWA 2D2ZA 2C0GA 3DXBA 3Q18A 4JR4A 2TIRA 3DD3A 2LJAA 2PN8A 1JFUA 19GSA 4IQAA 4ZBBA 2FWHA 1TKDB 5A4WA 1Y25A 4MF5A 3LSZA 3KP9A 3KTBA 3LW9A 1IYIA 2IJYA 2GLRA 4BVXA 3UMAA 1QK8A 3WT2A 5INYA 2UZ8A 5COHA 4Z2UA 4X4JA 1M2AA 5D93A 2PUKC 3ZYWA 1YEPA 3GIXA 3DGQA 2YPMA 2CZ2A 4JRRA 3GX8A 1VF4A 2VLTA 2H66A 2KUCA 2YN1A 1XWGA 2L4QA 3Q6OA 4L5OA 1XBSA 3VPQA 1HNAA 3TOTA 2MMNA 3DVWA 4NHZA 4PTSA 3DVXA 1R5PA 5G1LA 4I2TA 1GSFA 4AJ6A 2WULA 2N5BA 5CP1A 1EZKA 4PNGA 3CRUA 4O7HA 4OFMA 1XWKA 3HCZA 2N5AA 2G2QA 3HJPA 2GZPA 3IK9A 3HKRA 2A2PA 4LL4B 5CO3A 2RM5A 2DLXA 5G30A 14GSA 1Z6MA 3ISOA 1UN2A 4K6XA 3WYWA 1F6MC 2IMDA 2L5LA 3G7YA 2V6KA 4O32A 4MP4A 1K0MA 2QA2A 1ZOFA 3TB2A 3TJKA 4ECJA 2XPDA 4JZQA 1XVQA 1YEXA 1TTZA 5C04A 1JZDA 4TXVA 3EWLA 4OD7A 2E2GA 4ACSA 4NAXA 2A4VA 1TI3A 3FY7A 4HOJA 4ULXA 3CYNA 2VCVA 4QL7A 2K9FA 4N0ZA 1XZOA 4GQCA 3L0HA 3GTUA 3ZIVA 3M9KA 1AW9A 2OJLA 3HD5A 4WEYA 4MZWA 5AN1A 6GSWA 5IPGA 2AJQB 4DEJA 5J4UA 3TCOA 2XBQA 3RHBA 1OC8A 5F06A 4O5QA 4K5SA 5EY6A 2DKIA 1ZMAA 4IVFA 1A2JA 2WCIA 3RPNA 1PL2A 4LMVA 4KW6A 3RAZA 2PPTA 1ACVA 3E3EA 5D9XA 1K0CA 2R4VA 2C8UA 3ZVJA 2LEGA 4KNDA 1RQMA 2H8LA 2OE3A 2GTUA 4MJCA 1FHEA 2HLSA 4TW5A 2GSTA 2R0PA 4PX1A 4LL1B 4BPYA 5ELAA 2H1GA 2GSRA 3W6GA 5A4VA 2HZEB 4PURA 4K7IA 3G7JA 2P5RA 1FG4A 2QA1A 3M1GA 1A2MA 2RM6A 4EIPA 1BAYA 2I4AA 2Z9SA 4HZ4A 5IMAA 4ZB8A 4EKZA 2C3QA 2R5GA 5D73A 5IQYA 2O89A 1S3AA 1WJKA 1UVZA 5D9WA 2L59A 3FRCA 2F9SA 3PINA 2LRNA 1FAAA 2X8CA 3I9V2 3R3EA 3F4SA 4O5RA 3VURA 6GSVA 1GH2A 2VO4A 2H72A 4G10A 2O8VB 3IBHA 3CSJA 1S3CA 1XWCA 2PMTA 4POKA 2V32A 3FK8A 2YV9A 3M0FA 5ECLB 2BJXA 3KZQA 1TRSA 4MJBA 1T4YA 1SYXA 4KE3A 2PVOC 3FR9A 3D6IA 3O6TA 4L5LA 1U3IA 1OC9B 4JBBA 4OFNA 4HI7A 2YANA 2YV7A 1NSWA 5A4UA 2HRNA 2PU9C 2OE1A 5IMVA 5IOWA 5DJLA 3KCMA 4ZB9A 4XS1A 1B4PA 4Z7XA 4EIQA 3FKFA 5B8AA 2JSZA 3VI7A 2PGTA 2LJRA 3MYDA 2REMA 2TRXA 3ZREA 3QAVA 5FWGA 1ABAA 1YQ1A 4KDUA 4EXJA 4WXTA 5HR2A 1UC7A 5B8BA 3ME7A 2V6OA 1SK0A 2H75A 3LQ7A 2NBSA 4WF4A 3VWWA 1SL0B 1U6TA 3D0ZA 2CVBA 5FHIA 3HVXA 3UVHA 3GH9A 1E6BA 3ZRDA 5E4WA 1GSSA 3SBCA 1CQHA 1X0RA 1QXHA 1AUCA 17GSA 5AIXA 2BMXA 1W89A 3LFLA 5JWOB 1YZXA 2PWJA 2ON7A 1HQOA 2LJKA 5HQPA 1K3LA 1ZYEA 13GSA 1BJXA 1ZCPA 1SD8A 2FUG2 5KN2A 2IFQB 1Z5YE 5DBQA 2GT5A 1V57A 1PQNA 4RI7A 1TRVA 4MZCA 2H70A 3J7Yk 7GSSA 2HZFA 6GSTA 2FD3A 1B9YC 2VUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZIJ A;  5ABR A;  4BVY A;  3KD0 A;  4YQU A;  1O7U A;  2FNO A;  2HZE A;  1DE2 A;  1K0A A;  1GLQ A;  3M8N A;  4GSS A;  1X5E A;  3IPZ A;  4AF2 A;  2IIY A;  5GAN D;  3LXT A;  4BWS A;  2EIR A;  5ID2 B;  3A3T A;  1TU7 A;  3F4T A;  1G0T A;  2C3N A;  4POM A;  3SWL A;  11GS A;  4JU5 A;  1VGL A;  2C1Y A;  1AXD A;  3CXG A;  2L5O A;  3TKS E;  3WD6 A;  1F3A A;  3A2X A;  4TR0 A;  4NWY A;  1GSY A;  4KSM A;  3GH6 A;  4V2L A;  1TI1 A;  2H0I A;  1OKT A;  4IP1 A;  3W8J A;  1SJ6 A;  3GSS A;  3A2W A;  4BA7 A;  3GKX A;  2DJ1 A;  3FZ9 A;  1JHB A;  5IM9 A;  4TVE A;  1EP7 A;  1N2A A;  4KA0 A;  3LGC A;  1OC9 A;  2L57 A;  2J9H A;  2DJJ A;  1X5D A;  4ZBA A;  2FLS A;  4XS4 B;  2AYT A;  4TR4 A;  2TRC P;  3H79 A;  4DVC A;  4MLY A;  2I3Y A;  3W8S A;  2B1K A;  1K0D A;  5CYY A;  1MTC A;  1A8L A;  2DBC A;  4J56 E;  1ZYQ B;  2VOC A;  5DCG A;  3L4N A;  4MJE A;  1JZO A;  3UBL A;  2HNL A;  3TRX A;  1F37 A;  1QMV A;  5DQY A;  4XRD A;  1EV4 A;  5D96 A;  1RW1 A;  3H1N A;  4MPG A;  3I6A A;  1TOF A;  1FB6 A;  1FVK A;  1Q4J A;  1Z3E A;  2VLV A;  3D4T A;  5CRG A;  1IYH A;  4ZL7 A;  5E59 A;  2ALB A;  4X0X A;  2F3M A;  2LUS A;  3KEB A;  2HSY A;  3CBU A;  2VL2 C;  3LYP A;  3S9F A;  1JLV A;  3UBK A;  1ON4 A;  5IIZ A;  3ZLP A;  4Q5R A;  1LJR A;  1I5G A;  1A23 A;  5J5N A;  1A8Y A;  2IFQ A;  3E9J B;  3KMN A;  2H6X A;  3QR6 A;  5D8I A;  1NHY A;  3EE2 A;  2GS3 A;  5ECQ B;  4HU9 A;  4KH7 A;  4K1F A;  2GGT A;  3GKN A;  3IRA A;  1SK2 A;  2FWF A;  3VWV A;  2CT6 A;  5JWR B;  1FB0 A;  4NXI A;  3MAK A;  3WGD A;  3RPP A;  3EVI A;  4OWY A;  1THO A;  3P7X A;  3BD2 A;  3L9U A;  1B9X C;  3GA4 A;  4V2N A;  3TKQ A;  5ID2 A;  2YCD A;  5H5Q A;  3JCM L;  3IV4 A;  3GUS A;  5G5F A;  5J9B A;  2LQQ A;  2A2S A;  1GTU A;  4CHS A;  3ZMK A;  5FT3 A;  4WET A;  4J2F A;  5GZZ B;  3U5R E;  2HFD A;  1XW5 A;  1WMJ A;  3IC4 A;  5GST A;  2FA4 A;  2HT9 A;  3FHK A;  4HUA A;  3NOF A;  2H01 A;  1I9D A;  4TN8 A;  2VL9 A;  3VFI A;  1VF2 A;  1F2E A;  2JSY A;  1OC3 A;  5IO2 A;  3DWV A;  4H86 A;  3HJM A;  2B5E A;  1KBN A;  5F07 A;  6GSY A;  5IPH A;  1GSU A;  3IOS A;  2CAI A;  2C0E A;  4XIH A;  4HU7 A;  4XS4 A;  4ML6 A;  3VPT A;  2IN3 A;  1M9B A;  3F3R A;  2VIM A;  2K8S A;  4F0B A;  2YNX A;  4Q5Q A;  2AB6 A;  1B48 A;  4E8E A;  2VM2 A;  4EF0 A;  2YWO A;  4ZXG A;  1M7T A;  3KM6 A;  5DAK A;  4N0V A;  3TGZ A;  2FA8 A;  1FOV A;  3O76 A;  3UL3 A;  1T3B A;  3CSH A;  1ML6 A;  1GLP A;  3TKS C;  2DJK A;  5ECR B;  2AV4 A;  2RUE A;  2WRT A;  4TRX A;  4OCF A;  3QCP A;  4K2D A;  3C71 A;  1ST9 A;  5IOX A;  3QAW A;  1O81 A;  1H75 A;  2KHP A;  4F9Z A;  1AQV A;  4IJ3 A;  1JLW A;  1DUG A;  4QL9 A;  4K0G A;  3GHA A;  4Q5N A;  3HVV A;  4POB A;  4ZIJ A;  10GS A;  3TJJ A;  5JCG A;  3GL5 A;  2C3T A;  1YF0 A;  3APQ A;  1EGR A;  1ILO A;  1O73 A;  2HI7 A;  2JL4 A;  1TK8 B;  2MBS A;  1X9S B;  1Q98 A;  4K7N A;  1N8J A;  2CVD A;  2G0F A;  4XHM A;  2EIQ A;  2H76 A;  1SEN A;  1EOH A;  4V1A g;  4L0U A;  1MDK A;  2H6Y A;  1DSB A;  2ZUP A;  3EMP A;  2CVK A;  1F3B A;  3CTF A;  3ZFB A;  1GSQ A;  2FGX A;  1AC1 A;  3IK7 A;  2P5Q A;  1EGO A;  3TJB A;  4XCS A;  3ZZX A;  2GSQ A;  1BG5 A;  1UA5 A;  4V2M A;  3UJ1 A;  1VF1 A;  1AQX A;  1EP8 A;  1M99 A;  2I81 A;  2ON5 A;  5ECP B;  3UAP A;  2ZNM A;  2OBI A;  3ZTL A;  4HQZ A;  4N11 A;  3F4R A;  1KTE A;  2CX4 A;  1AQW A;  2LNT A;  3J7Y b;  5F05 A;  3EU4 A;  1FW1 A;  1PN9 A;  4NHW A;  1YJ6 A;  3DML A;  4IP6 A;  3LJR A;  1PRX A;  2QSI A;  4YAV A;  4EUY A;  2B1L A;  3KXO A;  1WE0 A;  2WDU A;  3NZN A;  3BJ5 A;  2IMI A;  3GFK A;  2ZCT A;  2OKA A;  4L8E A;  5GAP D;  3EMX A;  2I1U A;  2WGR A;  4ECB A;  1B8X A;  3TJF A;  5A5K A;  4GCI A;  2H30 A;  1BED A;  1XFL A;  2RLI A;  4IS0 A;  5ENU A;  4XTS A;  4MH2 A;  1SK1 A;  4KDY A;  1XCC A;  4IGJ A;  4FYC A;  3HYP A;  5DQS A;  1PD2 1;  2WS2 A;  4GQF A;  1TP9 A;  2DJ2 A;  3TOU A;  3ZL5 A;  3C8E A;  4TR1 B;  4V1A p;  2C80 A;  1GNE A;  1XVW A;  4EDZ A;  2B6M A;  2HXK A;  3PH9 A;  4XS6 A;  1YKA A;  2AUV A;  3EYT A;  5GSS A;  3L9V A;  1Z9H A;  3L78 A;  5CRE A;  1V98 A;  3ED3 A;  3RHC A;  5JWQ B;  3A2V A;  3CTG A;  4G9H A;  5KEJ A;  1GTB A;  1WIK A;  4WR4 A;  4PQ1 A;  1K0B A;  1T8E B;  3WT1 A;  22GS A;  4OO4 A;  1XWA A;  3FZA A;  2GZZ A;  3IXR A;  2YWM A;  3UEM A;  4MK3 A;  1W4V A;  3GRX A;  3LYK A;  3Q19 A;  2K8V A;  1MD3 A;  2MMA A;  1HYU A;  3VLN A;  4GSN A;  3K8N A;  2HSH A;  2GQK A;  3FEU A;  4F2I A;  4KB3 A;  2JZR A;  3QFB C;  3F3Q A;  4ZB6 A;  3BBY A;  4EL1 A;  1MDJ A;  4X43 A;  4IBP A;  6GSX A;  3LEF A;  1BYE A;  2X8H A;  4PXO A;  4HJ2 A;  2F8F A;  2VCQ A;  5DAL B;  3GMF A;  2MYG A;  1GSD A;  2N5F A;  2YZU A;  3LOR A;  4GWR A;  5D9T A;  2C4J A;  5J3R A;  4GF0 A;  5F0G A;  1GTI A;  1F9M A;  2DJ3 A;  1YKC A;  3APO A;  3FZ5 A;  1G7O A;  4WR5 A;  5H5S A;  2WJU A;  1HNC A;  2GVP A;  3KH7 A;  1GUH A;  5AIS A;  2H1B A;  4KUN A;  2GQM A;  1J0F A;  4DSR A;  2YJ7 A;  1URM A;  5JCU A;  1SKR B;  1MD4 A;  4KAE A;  3MWH A;  4X1U A;  4YAP A;  8GSS A;  3VK9 A;  4P3Y B;  3F63 A;  1SJZ A;  2DC5 A;  4MA9 A;  3P90 A;  3QMX A;  2V1M A;  1R4W A;  4YQV A;  3GKM A;  3OR5 A;  2VD0 A;  3UOM A;  1SU9 A;  3D21 A;  4FYB A;  3QOU A;  4AGS A;  4G19 A;  4N10 A;  3HA9 A;  5DDL A;  4K9Z A;  2OAD A;  1YF1 A;  1ERV A;  1XIY A;  2XPE A;  4IN0 A;  4I8B A;  3HY2 A;  1SD9 A;  4TR1 A;  1GL8 A;  2XBI A;  4YQM A;  4IEL A;  3F0I A;  4BL7 A;  5IMC A;  2X8G A;  4NV5 A;  2VAF A;  3TRQ A;  1TRU A;  4MF6 A;  3P8W A;  2FWE A;  4JE1 A;  5EL8 A;  1U88 A;  1QUW A;  1HNB A;  4EC0 A;  3DKS A;  4ECC A;  5CRH A;  3QPM A;  5DAK B;  1TU8 A;  3GST A;  1X5C A;  4POL A;  3CSI A;  1C72 A;  3DYR A;  3FYG A;  2OAC A;  2IME A;  4OO5 A;  4I5Q A;  5HFK A;  3V1W A;  4F0C A;  4OMV A;  2QC7 A;  4LA1 A;  4IKH A;  1PL1 A;  2O7K A;  2WFC A;  2NVL A;  16GS A;  1XWB A;  2FY6 A;  1WOU A;  1J9B A;  3ZIT A;  5HR0 A;  3EU3 A;  3TKP A;  1JZR A;  3CRT A;  2YZH A;  1XOA A;  2LKU A;  2B5X A;  3VI5 A;  5DAL A;  1YDK A;  4I97 A;  1GNW A;  3LXZ A;  2I9H A;  1O85 A;  3HZ4 A;  4WBJ A;  2A2R A;  20GS A;  4IQ1 A;  4MH3 A;  1S3D A;  5ECN B;  4K8M A;  5H5R A;  4HZ2 A;  2NPB A;  2X99 A;  1Y6E A;  2H0G A;  3CMI A;  1GP1 A;  1K0O A;  4GLT A;  1BX9 A;  1DBY A;  5DJM A;  4IHU A;  2B7J A;  2HRF A;  1ERT A;  1WWJ A;  3IR4 A;  2WB9 A;  1MDI A;  1MEK A;  4TXO B;  2B7K A;  1WRY A;  5B6M A;  1R26 A;  1NHO A;  3TJG A;  3GUR A;  4MAB A;  3Q74 A;  3VWU A;  5G1K A;  5ECO B;  2FCH A;  4TOP A;  1SKS B;  1RK4 A;  3ZFL A;  2JAD A;  3BCI A;  2DML A;  4RQR A;  3TUE A;  2RII A;  3C73 A;  1THX A;  1ZZY A;  1R5A A;  1TDI A;  2EIO A;  3HXS A;  1OYJ A;  4G2E A;  4MZB A;  1M9A A;  2VCZ A;  1TK5 B;  2GT6 A;  18GS A;  3N9J A;  5DCH A;  2J23 A;  2R37 A;  3H93 A;  5ECI B;  1PMT A;  4K0N A;  1TRW A;  1XOB A;  3MNG A;  4TKY A;  4ECI A;  3KIJ A;  4IW9 A;  5C00 A;  2M80 A;  1PKW A;  3FR3 A;  1ERW A;  4DSS B;  4AJ7 A;  5LNK e;  4HS1 A;  2JZT A;  1G6W A;  2QGV A;  4OFT A;  4GRF A;  1PKZ A;  3TDG A;  1CQG A;  2IMF A;  2JAC A;  5AGY A;  2YP6 A;  3MSZ A;  4FYU A;  1TK0 B;  2DMM A;  1OE8 A;  2YOI A;  4ZL8 A;  3VWX A;  3GV1 A;  3N5O A;  5LD0 A;  2LS5 A;  1O6J A;  4WBR D;  4MJA A;  5HR3 A;  2M72 A;  2IMK A;  5ECS A;  3RDW A;  1V2A A;  3FZ4 A;  1DE1 A;  5KN3 A;  2VL2 A;  3BCK A;  4JED A;  3GYK A;  5ELG A;  1TXX A;  4L0W A;  3KGK A;  3C1R A;  3HVS A;  3QDN A;  4F82 A;  1X9M B;  3I69 A;  2LNS A;  4KSO A;  4RUV A;  3D22 A;  2X64 A;  4KCE A;  5AIV A;  1WPI A;  3BOA A;  2HE3 A;  1M2B A;  4N30 A;  3TRP A;  1T1V A;  1GUL A;  2JU5 A;  2VLU A;  2VCX A;  1E2Y A;  4D73 B;  2CV4 A;  1XXU A;  1LU4 A;  1GWC A;  4GXZ A;  1LBK A;  2NDO A;  1GSE A;  1OKD A;  1QGV A;  4PUA A;  1PX7 A;  2QKE A;  2WZ9 A;  4EDY A;  4YH2 A;  2B5Y A;  4LLR A;  5EVO A;  5B7C A;  1SKW B;  2GZY A;  3ERW A;  4FH8 A;  4TXO A;  2R3X A;  2E2M A;  3I43 A;  4E8H A;  2DIY A;  4PQI A;  2E0Q A;  1PGT A;  3GNJ A;  1Z7P A;  1GTA A;  3US3 A;  2KOK A;  2VD1 A;  1O8X A;  2DJ0 A;  3IAS 2;  3RBT A;  6GSS A;  1A0R P;  3LG6 A;  4PNF A;  4Q5F A;  2IWT A;  2PER A;  3TKR A;  2LTK A;  3R2Q A;  4MF7 A;  3UIW A;  1V9W A;  3D4M A;  1T00 A;  2R2J A;  1GUM A;  1A2L A;  1NW2 A;  3DRN A;  5ECK B;  4KX4 A;  1H4O A;  4MMM A;  5B6N A;  1YY7 A;  2P31 A;  3G7I A;  3QFA C;  5G5E A;  1Z6N A;  3APS A;  3C7M A;  3PGT A;  3EUR A;  2OE0 A;  1HD2 A;  3DEX A;  2L4C A;  2YWN A;  3FR6 A;  3EC3 A;  1B4Q A;  1TJD A;  2K6V A;  4WF5 A;  2VM1 A;  1JZW A;  5HFG A;  4DSS A;  3U6V A;  5IMF A;  4HQS A;  4GST A;  4OCE A;  3C1S A;  4LMW A;  1EWX A;  5J9C A;  1V40 A;  3IE3 A;  3WGX A;  2BTO T;  2E7P A;  2FWG A;  1TW9 A;  2M46 A;  1OAZ A;  3TKS A;  1WP0 A;  2O87 A;  5CRD A;  1U3A A;  3WGE A;  1USB A;  1QQ2 A;  2KP2 A;  12GS A;  1U87 A;  9GSS A;  2PBJ A;  3PR8 A;  4I6X A;  2RUF A;  1VRS D;  3DIE A;  2LV3 A;  4NMU A;  4J57 E;  4FO5 A;  3UAR A;  4EE0 A;  2H73 A;  2YJH A;  3FW2 A;  3P2A A;  1T4Z A;  5DVB A;  4AJ8 A;  3D5J A;  2V2G A;  1J08 A;  4DSQ A;  5L71 A;  3GX0 A;  2V41 A;  2CX3 A;  3ME8 A;  1SYR A;  1M2D A;  1PSQ A;  4EVM A;  5J41 A;  2XC2 A;  3F9U A;  2FHE A;  1OE7 A;  1AIU A;  2R6K A;  4EO3 A;  3A5W A;  3HHV A;  5CAX A;  4QQ7 A;  3KMO A;  4ZIL A;  4HEA 2;  3LWA A;  4D73 A;  2DIZ A;  3KJY A;  5G2Z A;  4BWQ A;  2JZS A;  4MDC A;  4PGT A;  4O92 A;  4JR6 A;  3IHQ A;  1FVJ A;  1K3O A;  1Z7R A;  2MMZ A;  2CZ3 A;  2H74 A;  1FO5 A;  2H71 A;  2O85 A;  3NIV A;  5IO0 A;  5IMD A;  2C0D A;  5HFI A;  3IA1 A;  3H4K A;  3O3T A;  2L6D A;  2HYX A;  5JCW A;  3F6D A;  2XHF A;  4NPB A;  2PVQ A;  3QD9 A;  1SJI A;  2EC4 A;  5KN1 A;  2DSA A;  4IJI A;  1R7H A;  3G9B A;  4RI6 A;  3IAM 2;  3MDK A;  4GTU A;  4WKW A;  1KEB A;  1EOG A;  4K7O A;  1V58 A;  1ZGN A;  4ZBD A;  4ML1 A;  2H1D A;  4ISD A;  4CW9 A;  1BQ7 A;  2KLX A;  4I2U A;  2AHE A;  3GL3 A;  2KP1 A;  3ERG A;  2OA7 A;  3M3M A;  2IPA A;  1NM3 A;  2MBT A;  2YWI A;  3L9S A;  1KNG A;  3HJO A;  2MMO A;  4MPF A;  2F51 A;  3F6F A;  4PUF C;  2L6C A;  3HDC A;  3M9J A;  2GSS A;  2C0F A;  1SL2 B;  2LST A;  1GUK A;  5IMZ A;  3ERF A;  3UVT A;  4KDX A;  1SL1 B;  3GKK A;  2GQL A;  2H0H A;  1EEM A;  3GN3 A;  1OVN A;  1K0N A;  3ZVJ D;  1ZL9 A;  1ERU A;  2ES7 A;  4HJM A;  1AAZ A;  5D9V A;  3KH9 A;  4ID0 A;  5HR1 A;  1GRX A;  1X9W B;  1PX6 A;  3E0U A;  2OBK A;  4KGI A;  3IDV A;  2LQO A;  2VL3 A;  3F8U A;  4CDO A;  2H1A A;  1G7E A;  4PQH A;  4ILF A;  1XPV A;  1EV9 A;  1EEJ A;  3EIN A;  4ZL9 A;  2NTO A;  3HZ8 A;  1K3Y A;  2CQ9 A;  3ZML A;  4RQX A;  1A0F A;  1QFN A;  2IL3 A;  1XW9 A;  2MZC A;  3QAG A;  5ECM B;  3H8Q A;  5EPF A;  2GDR A;  4XRA A;  1T7P B;  4HDE A;  5KN0 A;  5F8B A;  2LRT A;  2B3S A;  4FIW A;  4NV2 A;  1XW6 A;  5G31 A;  2CAQ A;  5CRW A;  4MCU A;  1A24 A;  2LRC A;  1VF3 A;  2K18 A;  2AAW A;  1G6Y A;  1PA3 A;  5ECH B;  2H6Z A;  2H19 A;  2P0G A;  1O8W A;  2VCT A;  5CNW A;  5LCZ A;  4KCA A;  3KTL A;  1M0U A;  4TR3 A;  2CA8 A;  2F8A A;  3AY8 A;  3KP8 A;  3GTU B;  4F03 A;  6GSU A;  2VCW A;  2D2Z A;  2C0G A;  3DXB A;  3Q18 A;  4JR4 A;  2TIR A;  3DD3 A;  2LJA A;  2PN8 A;  1JFU A;  19GS A;  4IQA A;  4ZBB A;  2FWH A;  1TKD B;  5A4W A;  1Y25 A;  4MF5 A;  3LSZ A;  3KP9 A;  3KTB A;  1IYI A;  2IJY A;  2GLR A;  4BVX A;  3UMA A;  1QK8 A;  3WT2 A;  5INY A;  5COH A;  1M2A A;  5D93 A;  2PUK C;  3ZYW A;  1YEP A;  3GIX A;  3DGQ A;  2YPM A;  2CZ2 A;  4JRR A;  3GX8 A;  1VF4 A;  2VLT A;  2H66 A;  2KUC A;  2YN1 A;  1XWG A;  2L4Q A;  3Q6O A;  4L5O A;  1XBS A;  3VPQ A;  1HNA A;  3TOT A;  2MMN A;  3DVW A;  4NHZ A;  3DVX A;  1R5P A;  5G1L A;  4I2T A;  1GSF A;  4AJ6 A;  2WUL A;  2N5B A;  5CP1 A;  1EZK A;  4PNG A;  3CRU A;  4O7H A;  4OFM A;  1XWK A;  3HCZ A;  2N5A A;  2G2Q A;  3HJP A;  2GZP A;  3IK9 A;  3HKR A;  4LL4 B;  5CO3 A;  2RM5 A;  2DLX A;  5G30 A;  14GS A;  1Z6M A;  3ISO A;  1UN2 A;  4K6X A;  3WYW A;  1F6M C;  2IMD A;  2L5L A;  3G7Y A;  2V6K A;  4O32 A;  4MP4 A;  1K0M A;  1ZOF A;  3TB2 A;  3TJK A;  4ECJ A;  2XPD A;  4JZQ A;  1XVQ A;  1YEX A;  1TTZ A;  5C04 A;  1JZD A;  4TXV A;  3EWL A;  4OD7 A;  2E2G A;  4ACS A;  4NAX A;  2A4V A;  1TI3 A;  3FY7 A;  4HOJ A;  4ULX A;  3CYN A;  2VCV A;  4QL7 A;  2K9F A;  4N0Z A;  1XZO A;  4GQC A;  3L0H A;  3GTU A;  3ZIV A;  3M9K A;  1AW9 A;  2OJL A;  3HD5 A;  4WEY A;  4MZW A;  5AN1 A;  6GSW A;  5IPG A;  2AJQ B;  4DEJ A;  5J4U A;  3TCO A;  2XBQ A;  3RHB A;  1OC8 A;  5F06 A;  5EY6 A;  1ZMA A;  4IVF A;  1A2J A;  2WCI A;  3RPN A;  1PL2 A;  4LMV A;  4KW6 A;  3RAZ A;  2PPT A;  1ACV A;  3E3E A;  5D9X A;  1K0C A;  2R4V A;  2C8U A;  3ZVJ A;  2LEG A;  4KND A;  1RQM A;  2H8L A;  2OE3 A;  2GTU A;  4MJC A;  1FHE A;  2HLS A;  4TW5 A;  2GST A;  4PX1 A;  4LL1 B;  4BPY A;  5ELA A;  2H1G A;  2GSR A;  3W6G A;  5A4V A;  2HZE B;  4PUR A;  4K7I A;  3G7J A;  2P5R A;  1FG4 A;  3M1G A;  1A2M A;  2RM6 A;  1BAY A;  2I4A A;  2Z9S A;  4HZ4 A;  5IMA A;  4ZB8 A;  4EKZ A;  2C3Q A;  2R5G A;  5D73 A;  5IQY A;  2O89 A;  1S3A A;  1WJK A;  1UVZ A;  5D9W A;  2L59 A;  3FRC A;  2F9S A;  3PIN A;  2LRN A;  1FAA A;  2X8C A;  3I9V 2;  3F4S A;  4O5R A;  3VUR A;  6GSV A;  1GH2 A;  2VO4 A;  2H72 A;  4G10 A;  2O8V B;  3IBH A;  3CSJ A;  1S3C A;  1XWC A;  2PMT A;  4POK A;  2V32 A;  3FK8 A;  2YV9 A;  3M0F A;  5ECL B;  2BJX A;  3KZQ A;  1TRS A;  4MJB A;  1T4Y A;  1SYX A;  4KE3 A;  2PVO C;  3FR9 A;  3D6I A;  3O6T A;  4L5L A;  1U3I A;  1OC9 B;  4JBB A;  4OFN A;  4HI7 A;  2YAN A;  2YV7 A;  1NSW A;  5A4U A;  2HRN A;  2PU9 C;  2OE1 A;  5IMV A;  5IOW A;  5DJL A;  3KCM A;  4ZB9 A;  4XS1 A;  1B4P A;  4Z7X A;  3FKF A;  5B8A A;  2JSZ A;  3VI7 A;  2PGT A;  2LJR A;  2REM A;  2TRX A;  3ZRE A;  3QAV A;  5FWG A;  1ABA A;  1YQ1 A;  4KDU A;  4EXJ A;  4WXT A;  5HR2 A;  1UC7 A;  5B8B A;  3ME7 A;  2V6O A;  1SK0 A;  2H75 A;  3LQ7 A;  2NBS A;  4WF4 A;  3VWW A;  1SL0 B;  1U6T A;  3D0Z A;  2CVB A;  5FHI A;  3HVX A;  3UVH A;  3GH9 A;  1E6B A;  3ZRD A;  5E4W A;  1GSS A;  3SBC A;  1CQH A;  1X0R A;  1QXH A;  1AUC A;  17GS A;  5AIX A;  2BMX A;  1W89 A;  3LFL A;  5JWO B;  1YZX A;  2PWJ A;  2ON7 A;  1HQO A;  2LJK A;  5HQP A;  1K3L A;  1ZYE A;  13GS A;  1BJX A;  1ZCP A;  1SD8 A;  2FUG 2;  5KN2 A;  2IFQ B;  1Z5Y E;  5DBQ A;  2GT5 A;  1V57 A;  1PQN A;  4RI7 A;  1TRV A;  4MZC A;  2H70 A;  3J7Y k;  7GSS A;  2HZF A;  6GST A;  2FD3 A;  1B9Y C;  2VUP A; 
#chains in the Genus database with same CATH topology
 3ZIJ A;  5ABR A;  4BVY A;  3KD0 A;  4YQU A;  1PFO A;  1O7U A;  2FNO A;  2HZE A;  1DE2 A;  1K0A A;  1GLQ A;  3M8N A;  4GSS A;  1X5E A;  3IPZ A;  4AF2 A;  2IIY A;  5GAN D;  3LXT A;  4BWS A;  2EIR A;  5ID2 B;  3A3T A;  1TU7 A;  3F4T A;  1G0T A;  2C3N A;  4POM A;  3SWL A;  11GS A;  4JU5 A;  1VGL A;  2C1Y A;  1AXD A;  3CXG A;  2L5O A;  3TKS E;  3WD6 A;  1F3A A;  3A2X A;  4TR0 A;  4NWY A;  1GSY A;  4KSM A;  3GH6 A;  4V2L A;  1TI1 A;  2H0I A;  1OKT A;  4IP1 A;  3W8J A;  1SJ6 A;  3GSS A;  3A2W A;  4BA7 A;  3GKX A;  2DJ1 A;  3FZ9 A;  1JHB A;  2HRA A;  5IM9 A;  4TVE A;  1EP7 A;  1N2A A;  4KA0 A;  3LGC A;  1OC9 A;  2L57 A;  2J9H A;  2DJJ A;  1X5D A;  4ZBA A;  2FLS A;  4XS4 B;  2AYT A;  4KF9 A;  4TR4 A;  2TRC P;  3H79 A;  4DVC A;  4MLY A;  2I3Y A;  3W8S A;  2B1K A;  1K0D A;  5CYY A;  1MTC A;  1A8L A;  2DBC A;  4J56 E;  1ZYQ B;  2VOC A;  5DCG A;  3L4N A;  4MJE A;  1JZO A;  3UBL A;  2HNL A;  3TRX A;  1F37 A;  1QMV A;  5DQY A;  4XRD A;  1EV4 A;  5D96 A;  1RW1 A;  3H1N A;  4MPG A;  3I6A A;  1TOF A;  1FB6 A;  1FVK A;  1Q4J A;  1Z3E A;  2VLV A;  3D4T A;  5CRG A;  1IYH A;  4ZL7 A;  5E59 A;  2ALB A;  4X0X A;  2F3M A;  2LUS A;  3KEB A;  2HSY A;  3CBU A;  2VL2 C;  2R0G A;  3LYP A;  3S9F A;  1JLV A;  3UBK A;  1ON4 A;  4A5P A;  5IIZ A;  3ZLP A;  4Q5R A;  1LJR A;  1I5G A;  1A23 A;  5J5N A;  1A8Y A;  2IFQ A;  3E9J B;  3KMN A;  2H6X A;  3QR6 A;  5D8I A;  1NHY A;  3EE2 A;  2GS3 A;  5ECQ B;  4HU9 A;  4KH7 A;  4K1F A;  2GGT A;  3GKN A;  1ZYP A;  3IRA A;  1SK2 A;  2FWF A;  3VWV A;  2CT6 A;  5JWR B;  1FB0 A;  4NXI A;  3MAK A;  3WGD A;  3RPP A;  3EVI A;  4OWY A;  1THO A;  3P7X A;  3BD2 A;  3L9U A;  1B9X C;  3GA4 A;  4V2N A;  3TKQ A;  5ID2 A;  2YCD A;  5H5Q A;  3JCM L;  3IV4 A;  3GUS A;  5G5F A;  5J9B A;  2LQQ A;  2A2S A;  1GTU A;  4CHS A;  3ZMK A;  4K5R A;  5FT3 A;  4WET A;  4J2F A;  5GZZ B;  3U5R E;  3HVN A;  2HFD A;  1XW5 A;  1WMJ A;  3IC4 A;  5GST A;  2FA4 A;  2HT9 A;  3FHK A;  4HUA A;  3NOF A;  2H01 A;  1I9D A;  4TN8 A;  2VL9 A;  3VFI A;  1VF2 A;  1F2E A;  2JSY A;  1OC3 A;  5IO2 A;  3DWV A;  4H86 A;  3HJM A;  2B5E A;  1KBN A;  5F07 A;  6GSY A;  5IPH A;  1GSU A;  3IOS A;  2CAI A;  2C0E A;  4XIH A;  4HU7 A;  4XS4 A;  4ML6 A;  3VPT A;  2IN3 A;  1M9B A;  3F3R A;  2VIM A;  2K8S A;  4F0B A;  2YNX A;  4Q5Q A;  2AB6 A;  1B48 A;  4E8E A;  2VM2 A;  4EF0 A;  2YWO A;  3FMW A;  4ZXG A;  1M7T A;  3KM6 A;  5DAK A;  4N0V A;  3TGZ A;  2FA8 A;  1FOV A;  3O76 A;  3UL3 A;  1T3B A;  3CSH A;  1ML6 A;  1GLP A;  3TKS C;  2DJK A;  5ECR B;  3MIX A;  2AV4 A;  2RUE A;  2WRT A;  4TRX A;  4OCF A;  3QCP A;  4K2D A;  2R0C A;  1ST9 A;  3C71 A;  5IOX A;  3QAW A;  1O81 A;  1H75 A;  2KHP A;  4F9Z A;  1AQV A;  1ZYN A;  4IJ3 A;  1JLW A;  1DUG A;  4QL9 A;  4K0G A;  3GHA A;  4Q5N A;  3HVV A;  4POB A;  4ZIJ A;  10GS A;  3TJJ A;  5JCG A;  2X4A A;  3GL5 A;  2C3T A;  3PPU A;  1YF0 A;  3APQ A;  1EGR A;  1ILO A;  1O73 A;  2HI7 A;  2JL4 A;  1TK8 B;  2MBS A;  1X9S B;  1Q98 A;  4K7N A;  1N8J A;  2CVD A;  2G0F A;  4XHM A;  2EIQ A;  2H76 A;  1SEN A;  1EOH A;  4V1A g;  4L0U A;  1MDK A;  2H6Y A;  4K2X A;  1DSB A;  2ZUP A;  3EMP A;  2CVK A;  1F3B A;  3CTF A;  3ZFB A;  1GSQ A;  2FGX A;  1AC1 A;  3IK7 A;  2P5Q A;  1EGO A;  3TJB A;  4XCS A;  3ZZX A;  2GSQ A;  1BG5 A;  1UA5 A;  4BVY B;  4V2M A;  3UJ1 A;  1VF1 A;  1AQX A;  1EP8 A;  1M99 A;  1FOH A;  2I81 A;  2ON5 A;  5ECP B;  3UAP A;  2ZNM A;  2OBI A;  3ZTL A;  4HQZ A;  4N11 A;  3F4R A;  1KTE A;  2CX4 A;  5BMU A;  1AQW A;  2LNT A;  3J7Y b;  5F05 A;  3EU4 A;  1FW1 A;  1PN9 A;  4NHW A;  1YJ6 A;  3DML A;  4IP6 A;  3LJR A;  1PRX A;  2QSI A;  4YAV A;  4EUY A;  2B1L A;  3KXO A;  1WE0 A;  2WDU A;  3NZN A;  3BJ5 A;  2IMI A;  3GFK A;  2ZCT A;  2OKA A;  4L8E A;  5GAP D;  3EMX A;  2I1U A;  2WGR A;  4ECB A;  1B8X A;  3TJF A;  5A5K A;  4GCI A;  3CQF A;  2H30 A;  1BED A;  1XFL A;  2RLI A;  4IS0 A;  5ENU A;  4XTS A;  4MH2 A;  1SK1 A;  4KDY A;  1XCC A;  4IGJ A;  4FYC A;  3HYP A;  5DQS A;  1PD2 1;  2WS2 A;  4GQF A;  1TP9 A;  2DJ2 A;  3TOU A;  3ZL5 A;  3C8E A;  4TR1 B;  4V1A p;  2C80 A;  1GNE A;  4CY8 A;  1XVW A;  4EDZ A;  2B6M A;  2HXK A;  3PH9 A;  4XS6 A;  1YKA A;  2AUV A;  3EYT A;  5GSS A;  4G0K A;  3L9V A;  1Z9H A;  4BL7 B;  3L78 A;  5CRE A;  1V98 A;  3ED3 A;  3RHC A;  5JWQ B;  3A2V A;  3CTG A;  4G9H A;  5KEJ A;  1GTB A;  1WIK A;  4WR4 A;  4PQ1 A;  1K0B A;  1T8E B;  3WT1 A;  22GS A;  5KOW A;  4OO4 A;  1XWA A;  3FZA A;  2GZZ A;  3IXR A;  4G0L A;  2YWM A;  3UEM A;  4MK3 A;  1W4V A;  3GRX A;  3LYK A;  3Q19 A;  2K8V A;  1MD3 A;  2MMA A;  1HYU A;  3VLN A;  4GSN A;  3K8N A;  2HSH A;  2GQK A;  3FEU A;  4F2I A;  4KB3 A;  2JZR A;  3QFB C;  3F3Q A;  4ZB6 A;  3BBY A;  4EL1 A;  1MDJ A;  4X43 A;  4IBP A;  6GSX A;  3LEF A;  1BYE A;  2X8H A;  4PXO A;  4HJ2 A;  2F8F A;  2VCQ A;  5DAL B;  3GMF A;  2MYG A;  1GSD A;  2N5F A;  4Z2T A;  2YZU A;  3LOR A;  4GWR A;  5D9T A;  2C4J A;  5J3R A;  4GF0 A;  5F0G A;  1GTI A;  1F9M A;  2DJ3 A;  1YKC A;  3APO A;  3FZ5 A;  4FQU A;  1G7O A;  2HRK A;  4WR5 A;  5H5S A;  2WJU A;  1HNC A;  2GVP A;  3KH7 A;  1GUH A;  5AIS A;  2H1B A;  4KUN A;  2GQM A;  1J0F A;  4DSR A;  2YJ7 A;  1URM A;  5JCU A;  1SKR B;  1MD4 A;  4KAE A;  4MNN A;  3MWH A;  4X1U A;  4YAP A;  8GSS A;  3VK9 A;  4P3Y B;  3F63 A;  1SJZ A;  2DC5 A;  4MA9 A;  3P90 A;  3QMX A;  2V1M A;  1R4W A;  4YQV A;  3GKM A;  3OR5 A;  2VD0 A;  3UOM A;  1SU9 A;  3D21 A;  4FYB A;  3QOU A;  4AGS A;  4G19 A;  4N10 A;  3HA9 A;  5DDL A;  4K9Z A;  2OAD A;  1YF1 A;  1ERV A;  1XIY A;  2XPE A;  4IN0 A;  4I8B A;  3HY2 A;  1SD9 A;  4TR1 A;  1GL8 A;  2XBI A;  4YQM A;  4IEL A;  3F0I A;  4BL7 A;  5IMC A;  2X8G A;  4NV5 A;  2VAF A;  3TRQ A;  1TRU A;  4MF6 A;  3P8W A;  2FWE A;  4JE1 A;  5EL8 A;  1U88 A;  1QUW A;  1HNB A;  4EC0 A;  3DKS A;  4ECC A;  5CRH A;  3QPM A;  5DAK B;  1TU8 A;  3GST A;  1X5C A;  4POL A;  3CSI A;  1C72 A;  3DYR A;  3FYG A;  2OAC A;  2IME A;  4OO5 A;  4I5Q A;  5HFK A;  3V1W A;  4F0C A;  4OMV A;  2QC7 A;  4LA1 A;  4IKH A;  1PL1 A;  2O7K A;  2WFC A;  2NVL A;  16GS A;  1XWB A;  2FY6 A;  1WOU A;  1J9B A;  3ZIT A;  5HR0 A;  3EU3 A;  3TKP A;  1JZR A;  3CRT A;  2YZH A;  1XOA A;  2LKU A;  2B5X A;  3VI5 A;  5DAL A;  1YDK A;  4I97 A;  1GNW A;  3LXZ A;  2I9H A;  1O85 A;  3HZ4 A;  4WBJ A;  4ICY A;  2A2R A;  20GS A;  4IQ1 A;  4MH3 A;  1S3D A;  3IC8 A;  5ECN B;  4K8M A;  5H5R A;  4HZ2 A;  2NPB A;  2X99 A;  1Y6E A;  2H0G A;  3CMI A;  1GP1 A;  1K0O A;  4GLT A;  1BX9 A;  1DBY A;  5DJM A;  4IHU A;  2B7J A;  2HRF A;  1ERT A;  1WWJ A;  3IR4 A;  2WB9 A;  1MDI A;  1MEK A;  4TXO B;  2B7K A;  1WRY A;  5B6M A;  1R26 A;  1NHO A;  3TJG A;  3GUR A;  4MAB A;  3Q74 A;  3VWU A;  5G1K A;  5ECO B;  2FCH A;  4TOP A;  1SKS B;  1RK4 A;  3ZFL A;  2JAD A;  3BCI A;  2DML A;  4RQR A;  3TUE A;  2RII A;  3C73 A;  1THX A;  1ZZY A;  1R5A A;  1TDI A;  2EIO A;  3HXS A;  1OYJ A;  4G2E A;  4MZB A;  1M9A A;  2VCZ A;  1TK5 B;  2GT6 A;  18GS A;  3N9J A;  5DCH A;  2J23 A;  2R37 A;  3H93 A;  5ECI B;  1PMT A;  4K0N A;  1TRW A;  1XOB A;  3MNG A;  4TKY A;  4ECI A;  3KIJ A;  4IW9 A;  5C00 A;  2M80 A;  1PKW A;  3FR3 A;  1ERW A;  4DSS B;  4AJ7 A;  5LNK e;  4HS1 A;  2JZT A;  1G6W A;  2QGV A;  4OFT A;  4G0I A;  4GRF A;  1PKZ A;  3TDG A;  1CQG A;  2IMF A;  2JAC A;  5AGY A;  2YP6 A;  3MSZ A;  4FYU A;  1TK0 B;  2DMM A;  1OE8 A;  2YOI A;  4ZL8 A;  3VWX A;  3GV1 A;  3N5O A;  5LD0 A;  2LS5 A;  1O6J A;  4WBR D;  4MJA A;  5HR3 A;  2M72 A;  2IMK A;  5ECS A;  3RDW A;  1V2A A;  3FZ4 A;  1DE1 A;  5KN3 A;  2VL2 A;  3BCK A;  4JED A;  3GYK A;  5ELG A;  1TXX A;  4L0W A;  3KGK A;  3C1R A;  3HVS A;  3QDN A;  4F82 A;  1X9M B;  3I69 A;  2LNS A;  4KSO A;  4RUV A;  4USS A;  3D22 A;  2X64 A;  1M3J A;  4O5U A;  4YKG A;  4KCE A;  5AIV A;  1WPI A;  3BOA A;  2HE3 A;  3IHG A;  1M2B A;  4N30 A;  3TRP A;  1T1V A;  1GUL A;  2JU5 A;  2VLU A;  2VCX A;  1E2Y A;  4D73 B;  2CV4 A;  1XXU A;  1LU4 A;  1GWC A;  4GXZ A;  1LBK A;  2NDO A;  1GSE A;  1OKD A;  1QGV A;  4PUA A;  1PX7 A;  2QKE A;  2WZ9 A;  4EDY A;  4YH2 A;  2B5Y A;  4LLR A;  5EVO A;  5B7C A;  1SKW B;  2GZY A;  3ERW A;  4FH8 A;  4TXO A;  2R3X A;  2E2M A;  3I43 A;  4E8H A;  2DIY A;  4PQI A;  2E0Q A;  1PGT A;  3GNJ A;  1Z7P A;  1GTA A;  3US3 A;  2KOK A;  2VD1 A;  1O8X A;  2DKH A;  2DJ0 A;  3IAS 2;  3RBT A;  6GSS A;  1A0R P;  3LG6 A;  4PNF A;  4Q5F A;  2IWT A;  2PER A;  3TKR A;  2LTK A;  3R2Q A;  4MF7 A;  3UIW A;  1V9W A;  3D4M A;  1T00 A;  2R2J A;  1GUM A;  1A2L A;  1NW2 A;  3DRN A;  5ECK B;  4KX4 A;  1H4O A;  4MMM A;  5B6N A;  1YY7 A;  2P31 A;  3G7I A;  3QFA C;  5G5E A;  1Z6N A;  3APS A;  3C7M A;  3PGT A;  3EUR A;  2OE0 A;  1HD2 A;  3DEX A;  2L4C A;  2YWN A;  3FR6 A;  3EC3 A;  1B4Q A;  1TJD A;  2K6V A;  4WF5 A;  2VM1 A;  1JZW A;  5HFG A;  4DSS A;  3U6V A;  5IMF A;  4HQS A;  4GST A;  4OCE A;  3C1S A;  4LMW A;  1EWX A;  3EPT A;  5J9C A;  1V40 A;  3IE3 A;  3WGX A;  2BTO T;  2E7P A;  2FWG A;  1TW9 A;  2M46 A;  1OAZ A;  3TKS A;  4Z2R A;  1WP0 A;  2O87 A;  5CRD A;  1U3A A;  3WGE A;  1USB A;  1QQ2 A;  2KP2 A;  12GS A;  1U87 A;  9GSS A;  2PBJ A;  3PR8 A;  4I6X A;  2RUF A;  1VRS D;  3DIE A;  2LV3 A;  4NMU A;  4J57 E;  4FO5 A;  3UAR A;  4EE0 A;  2H73 A;  2YJH A;  3FW2 A;  3P2A A;  1T4Z A;  5DVB A;  4AJ8 A;  3D5J A;  2V2G A;  1J08 A;  4DSQ A;  5L71 A;  3GX0 A;  2V41 A;  2CX3 A;  3ME8 A;  1SYR A;  4YKF A;  1M2D A;  1PSQ A;  4EVM A;  5J41 A;  2XC2 A;  3F9U A;  2FHE A;  1OE7 A;  1AIU A;  2R6K A;  4EO3 A;  3A5W A;  3HHV A;  5CAX A;  4QQ7 A;  3KMO A;  4ZIL A;  4HEA 2;  3LWA A;  4D73 A;  2DIZ A;  3KJY A;  5G2Z A;  4BWQ A;  2JZS A;  4MDC A;  4PGT A;  4O92 A;  4JR6 A;  3IHQ A;  1FVJ A;  1K3O A;  1Z7R A;  2MMZ A;  2CZ3 A;  2H74 A;  1FO5 A;  2H71 A;  2O85 A;  3NIV A;  5IO0 A;  5IMD A;  2C0D A;  5HFI A;  3IA1 A;  5KOX A;  3H4K A;  3O3T A;  2L6D A;  2HYX A;  5JCW A;  3F6D A;  2X49 A;  2XHF A;  4NPB A;  2PVQ A;  3QD9 A;  1SJI A;  2EC4 A;  5KN1 A;  2DSA A;  4IJI A;  1R7H A;  3G9B A;  4RI6 A;  3IAM 2;  3MDK A;  4GTU A;  4WKW A;  1KEB A;  4CY6 A;  1EOG A;  4K7O A;  1V58 A;  1ZGN A;  4ZBD A;  4ML1 A;  2H1D A;  4BVX B;  4ISD A;  4CW9 A;  1BQ7 A;  2KLX A;  4I2U A;  2AHE A;  3GL3 A;  2KP1 A;  3ERG A;  2OA7 A;  2A4H A;  3M3M A;  2IPA A;  1NM3 A;  2MBT A;  2YWI A;  3L9S A;  1KNG A;  3HJO A;  2MMO A;  4MPF A;  2F51 A;  3F6F A;  4PUF C;  2L6C A;  3HDC A;  3M9J A;  2GSS A;  2C0F A;  1SL2 B;  2LST A;  1GUK A;  5IMZ A;  3ERF A;  3UVT A;  4KDX A;  1SL1 B;  3GKK A;  2GQL A;  2H0H A;  1EEM A;  3GN3 A;  1OVN A;  2HSM A;  5BRT A;  1K0N A;  3ZVJ D;  1ZL9 A;  1ERU A;  2ES7 A;  4HJM A;  1AAZ A;  5D9V A;  3KH9 A;  4ID0 A;  5HR1 A;  1GRX A;  3A5I A;  1X9W B;  1PX6 A;  3E0U A;  2OBK A;  4KGI A;  3IDV A;  2LQO A;  2VL3 A;  3F8U A;  4CDO A;  2H1A A;  1G7E A;  4PQH A;  4ILF A;  1XPV A;  1EV9 A;  1EEJ A;  3EIN A;  4ZL9 A;  2NTO A;  3HZ8 A;  1K3Y A;  2CQ9 A;  3ZML A;  4RQX A;  1A0F A;  1QFN A;  2IL3 A;  1XW9 A;  2MZC A;  3QAG A;  5ECM B;  3H8Q A;  5EPF A;  2GDR A;  4XRA A;  1T7P B;  4HDE A;  5KN0 A;  5F8B A;  2LRT A;  1PN0 A;  2B3S A;  4FIW A;  4NV2 A;  1XW6 A;  5G31 A;  2CAQ A;  5CRW A;  4MCU A;  1A24 A;  2LRC A;  1VF3 A;  2K18 A;  2AAW A;  1G6Y A;  1PA3 A;  5ECH B;  2H6Z A;  2H19 A;  1S3R A;  2P0G A;  1O8W A;  2VCT A;  5CNW A;  5LCZ A;  4KCA A;  3KTL A;  1M0U A;  4TR3 A;  2CA8 A;  2F8A A;  3AY8 A;  3KP8 A;  3GTU B;  4F03 A;  6GSU A;  2VCW A;  2D2Z A;  2C0G A;  3DXB A;  3Q18 A;  4JR4 A;  2TIR A;  3DD3 A;  2LJA A;  2PN8 A;  1JFU A;  19GS A;  4IQA A;  4ZBB A;  2FWH A;  1TKD B;  5A4W A;  1Y25 A;  4MF5 A;  3LSZ A;  3KP9 A;  3KTB A;  3LW9 A;  1IYI A;  2IJY A;  2GLR A;  4BVX A;  3UMA A;  1QK8 A;  3WT2 A;  5INY A;  2UZ8 A;  5COH A;  4Z2U A;  4X4J A;  1M2A A;  5D93 A;  2PUK C;  3ZYW A;  1YEP A;  3GIX A;  3DGQ A;  2YPM A;  2CZ2 A;  4JRR A;  3GX8 A;  1VF4 A;  2VLT A;  2H66 A;  2KUC A;  2YN1 A;  1XWG A;  2L4Q A;  3Q6O A;  4L5O A;  1XBS A;  3VPQ A;  1HNA A;  3TOT A;  2MMN A;  3DVW A;  4NHZ A;  4PTS A;  3DVX A;  1R5P A;  5G1L A;  4I2T A;  1GSF A;  4AJ6 A;  2WUL A;  2N5B A;  5CP1 A;  1EZK A;  4PNG A;  3CRU A;  4O7H A;  4OFM A;  1XWK A;  3HCZ A;  2N5A A;  2G2Q A;  3HJP A;  2GZP A;  3IK9 A;  3HKR A;  2A2P A;  4LL4 B;  5CO3 A;  2RM5 A;  2DLX A;  5G30 A;  14GS A;  1Z6M A;  3ISO A;  1UN2 A;  4K6X A;  3WYW A;  1F6M C;  2IMD A;  2L5L A;  3G7Y A;  2V6K A;  4O32 A;  4MP4 A;  1K0M A;  2QA2 A;  1ZOF A;  1M3I A;  3TB2 A;  3TJK A;  4ECJ A;  2XPD A;  4JZQ A;  1XVQ A;  1YEX A;  1TTZ A;  5C04 A;  1JZD A;  4TXV A;  3EWL A;  4OD7 A;  2E2G A;  4ACS A;  4NAX A;  2A4V A;  1TI3 A;  3FY7 A;  4HOJ A;  4ULX A;  3CYN A;  2VCV A;  4QL7 A;  2K9F A;  4N0Z A;  1XZO A;  4GQC A;  3L0H A;  3GTU A;  3ZIV A;  3M9K A;  1AW9 A;  2OJL A;  3HD5 A;  4WEY A;  4MZW A;  5AN1 A;  6GSW A;  5IPG A;  2AJQ B;  4DEJ A;  5J4U A;  3TCO A;  2XBQ A;  3RHB A;  1OC8 A;  5F06 A;  4O5Q A;  4K5S A;  5EY6 A;  2DKI A;  1ZMA A;  4IVF A;  1A2J A;  2WCI A;  1XG8 A;  3RPN A;  1PL2 A;  4LMV A;  4KW6 A;  3RAZ A;  2PPT A;  1ACV A;  3E3E A;  5D9X A;  1K0C A;  2R4V A;  2C8U A;  3ZVJ A;  2LEG A;  4KND A;  1RQM A;  2H8L A;  2OE3 A;  2GTU A;  4MJC A;  1FHE A;  2HLS A;  4TW5 A;  2GST A;  2R0P A;  4PX1 A;  4LL1 B;  4BPY A;  5ELA A;  2H1G A;  2GSR A;  3W6G A;  5A4V A;  2HZE B;  4PUR A;  4K7I A;  3G7J A;  2P5R A;  1FG4 A;  2QA1 A;  3M1G A;  1A2M A;  2RM6 A;  4EIP A;  1BAY A;  2I4A A;  2Z9S A;  4HZ4 A;  5IMA A;  4ZB8 A;  4EKZ A;  2C3Q A;  2R5G A;  5D73 A;  5IQY A;  2O89 A;  1S3A A;  1WJK A;  1UVZ A;  5D9W A;  2L59 A;  3FRC A;  2F9S A;  3PIN A;  2LRN A;  1FAA A;  2X8C A;  3I9V 2;  3R3E A;  3F4S A;  4O5R A;  3VUR A;  6GSV A;  1GH2 A;  2VO4 A;  2H72 A;  4G10 A;  2O8V B;  3IBH A;  3CSJ A;  1S3C A;  1XWC A;  2PMT A;  4POK A;  2V32 A;  3FK8 A;  2YV9 A;  3M0F A;  5ECL B;  2BJX A;  3KZQ A;  1TRS A;  4MJB A;  1T4Y A;  1SYX A;  4KE3 A;  2PVO C;  3FR9 A;  3D6I A;  3O6T A;  4L5L A;  1U3I A;  1OC9 B;  4JBB A;  4OFN A;  4HI7 A;  2YAN A;  2YV7 A;  1NSW A;  5A4U A;  2HRN A;  2PU9 C;  2OE1 A;  5IMV A;  5IOW A;  5DJL A;  3KCM A;  4ZB9 A;  4XS1 A;  1B4P A;  4Z7X A;  4HSC X;  4EIQ A;  3FKF A;  5B8A A;  2JSZ A;  3VI7 A;  2PGT A;  2LJR A;  4BIK A;  3MYD A;  2REM A;  2TRX A;  3ZRE A;  3QAV A;  5FWG A;  1ABA A;  1YQ1 A;  4KDU A;  4EXJ A;  4WXT A;  5HR2 A;  1UC7 A;  5B8B A;  3ME7 A;  2V6O A;  1SK0 A;  2H75 A;  3LQ7 A;  2NBS A;  4WF4 A;  3VWW A;  1SL0 B;  1U6T A;  3D0Z A;  2CVB A;  5FHI A;  3HVX A;  3UVH A;  3GH9 A;  1E6B A;  3ZRD A;  5E4W A;  1GSS A;  3SBC A;  1CQH A;  1X0R A;  1QXH A;  1AUC A;  17GS A;  5AIX A;  2BMX A;  1W89 A;  3LFL A;  5JWO B;  1YZX A;  2PWJ A;  2ON7 A;  1HQO A;  2LJK A;  5HQP A;  1K3L A;  1ZYE A;  13GS A;  1BJX A;  1ZCP A;  1SD8 A;  2FUG 2;  5KN2 A;  2IFQ B;  1Z5Y E;  5DBQ A;  2GT5 A;  1V57 A;  1PQN A;  4RI7 A;  1TRV A;  4MZC A;  2H70 A;  3J7Y k;  7GSS A;  2HZF A;  6GST A;  2FD3 A;  1B9Y C;  2VUP A; 
#chains in the Genus database with same CATH homology
 3ZIJ A;  5ABR A;  4BVY A;  3KD0 A;  4YQU A;  1O7U A;  2FNO A;  2HZE A;  1DE2 A;  1K0A A;  1GLQ A;  3M8N A;  4GSS A;  1X5E A;  3IPZ A;  4AF2 A;  2IIY A;  5GAN D;  3LXT A;  4BWS A;  2EIR A;  5ID2 B;  3A3T A;  1TU7 A;  3F4T A;  1G0T A;  2C3N A;  4POM A;  3SWL A;  11GS A;  4JU5 A;  1VGL A;  2C1Y A;  1AXD A;  3CXG A;  2L5O A;  3TKS E;  3WD6 A;  1F3A A;  3A2X A;  4TR0 A;  4NWY A;  1GSY A;  4KSM A;  3GH6 A;  4V2L A;  1TI1 A;  2H0I A;  1OKT A;  4IP1 A;  3W8J A;  1SJ6 A;  3GSS A;  3A2W A;  4BA7 A;  3GKX A;  2DJ1 A;  3FZ9 A;  1JHB A;  2HRA A;  5IM9 A;  4TVE A;  1EP7 A;  1N2A A;  4KA0 A;  3LGC A;  1OC9 A;  2L57 A;  2J9H A;  2DJJ A;  1X5D A;  4ZBA A;  2FLS A;  4XS4 B;  2AYT A;  4KF9 A;  4TR4 A;  2TRC P;  3H79 A;  4DVC A;  4MLY A;  2I3Y A;  3W8S A;  2B1K A;  1K0D A;  5CYY A;  1MTC A;  1A8L A;  2DBC A;  4J56 E;  1ZYQ B;  2VOC A;  5DCG A;  3L4N A;  4MJE A;  1JZO A;  3UBL A;  2HNL A;  3TRX A;  1F37 A;  1QMV A;  5DQY A;  4XRD A;  1EV4 A;  5D96 A;  1RW1 A;  3H1N A;  4MPG A;  3I6A A;  1TOF A;  1FB6 A;  1FVK A;  1Q4J A;  1Z3E A;  2VLV A;  3D4T A;  5CRG A;  1IYH A;  4ZL7 A;  5E59 A;  2ALB A;  4X0X A;  2F3M A;  2LUS A;  3KEB A;  2HSY A;  3CBU A;  2VL2 C;  2R0G A;  3LYP A;  3S9F A;  1JLV A;  3UBK A;  1ON4 A;  4A5P A;  5IIZ A;  3ZLP A;  4Q5R A;  1LJR A;  1I5G A;  1A23 A;  5J5N A;  1A8Y A;  2IFQ A;  3E9J B;  3KMN A;  2H6X A;  3QR6 A;  5D8I A;  1NHY A;  3EE2 A;  2GS3 A;  5ECQ B;  4HU9 A;  4KH7 A;  4K1F A;  2GGT A;  3GKN A;  1ZYP A;  3IRA A;  1SK2 A;  2FWF A;  3VWV A;  2CT6 A;  5JWR B;  1FB0 A;  4NXI A;  3MAK A;  3WGD A;  3RPP A;  3EVI A;  4OWY A;  1THO A;  3P7X A;  3BD2 A;  3L9U A;  1B9X C;  3GA4 A;  4V2N A;  3TKQ A;  5ID2 A;  2YCD A;  5H5Q A;  3JCM L;  3IV4 A;  3GUS A;  5G5F A;  5J9B A;  2LQQ A;  2A2S A;  1GTU A;  4CHS A;  3ZMK A;  4K5R A;  5FT3 A;  4WET A;  4J2F A;  5GZZ B;  3U5R E;  2HFD A;  1XW5 A;  1WMJ A;  3IC4 A;  5GST A;  2FA4 A;  2HT9 A;  3FHK A;  4HUA A;  3NOF A;  2H01 A;  1I9D A;  4TN8 A;  2VL9 A;  3VFI A;  1VF2 A;  1F2E A;  2JSY A;  1OC3 A;  5IO2 A;  3DWV A;  4H86 A;  3HJM A;  2B5E A;  1KBN A;  5F07 A;  6GSY A;  5IPH A;  1GSU A;  3IOS A;  2CAI A;  2C0E A;  4XIH A;  4HU7 A;  4XS4 A;  4ML6 A;  3VPT A;  2IN3 A;  1M9B A;  3F3R A;  2VIM A;  2K8S A;  4F0B A;  2YNX A;  4Q5Q A;  2AB6 A;  1B48 A;  4E8E A;  2VM2 A;  4EF0 A;  2YWO A;  3FMW A;  4ZXG A;  1M7T A;  3KM6 A;  5DAK A;  4N0V A;  3TGZ A;  2FA8 A;  1FOV A;  3O76 A;  3UL3 A;  1T3B A;  3CSH A;  1ML6 A;  1GLP A;  3TKS C;  2DJK A;  5ECR B;  3MIX A;  2AV4 A;  2RUE A;  2WRT A;  4TRX A;  4OCF A;  3QCP A;  4K2D A;  2R0C A;  1ST9 A;  3C71 A;  5IOX A;  3QAW A;  1O81 A;  1H75 A;  2KHP A;  4F9Z A;  1AQV A;  1ZYN A;  4IJ3 A;  1JLW A;  1DUG A;  4QL9 A;  4K0G A;  3GHA A;  4Q5N A;  3HVV A;  4POB A;  4ZIJ A;  10GS A;  3TJJ A;  5JCG A;  2X4A A;  3GL5 A;  2C3T A;  3PPU A;  1YF0 A;  3APQ A;  1EGR A;  1ILO A;  1O73 A;  2HI7 A;  2JL4 A;  1TK8 B;  2MBS A;  1X9S B;  1Q98 A;  4K7N A;  1N8J A;  2CVD A;  2G0F A;  4XHM A;  2EIQ A;  2H76 A;  1SEN A;  1EOH A;  4V1A g;  4L0U A;  1MDK A;  2H6Y A;  4K2X A;  1DSB A;  2ZUP A;  3EMP A;  2CVK A;  1F3B A;  3CTF A;  3ZFB A;  1GSQ A;  2FGX A;  1AC1 A;  3IK7 A;  2P5Q A;  1EGO A;  3TJB A;  4XCS A;  3ZZX A;  2GSQ A;  1BG5 A;  1UA5 A;  4BVY B;  4V2M A;  3UJ1 A;  1VF1 A;  1AQX A;  1EP8 A;  1M99 A;  1FOH A;  2I81 A;  2ON5 A;  5ECP B;  3UAP A;  2ZNM A;  2OBI A;  3ZTL A;  4HQZ A;  4N11 A;  3F4R A;  1KTE A;  2CX4 A;  5BMU A;  1AQW A;  2LNT A;  3J7Y b;  5F05 A;  3EU4 A;  1FW1 A;  1PN9 A;  4NHW A;  1YJ6 A;  3DML A;  4IP6 A;  3LJR A;  1PRX A;  2QSI A;  4YAV A;  4EUY A;  2B1L A;  3KXO A;  1WE0 A;  2WDU A;  3NZN A;  3BJ5 A;  2IMI A;  3GFK A;  2ZCT A;  2OKA A;  4L8E A;  5GAP D;  3EMX A;  2I1U A;  2WGR A;  4ECB A;  1B8X A;  3TJF A;  5A5K A;  4GCI A;  2H30 A;  1BED A;  1XFL A;  2RLI A;  4IS0 A;  5ENU A;  4XTS A;  4MH2 A;  1SK1 A;  4KDY A;  1XCC A;  4IGJ A;  4FYC A;  3HYP A;  5DQS A;  1PD2 1;  2WS2 A;  4GQF A;  1TP9 A;  2DJ2 A;  3TOU A;  3ZL5 A;  3C8E A;  4TR1 B;  4V1A p;  2C80 A;  1GNE A;  4CY8 A;  1XVW A;  4EDZ A;  2B6M A;  2HXK A;  3PH9 A;  4XS6 A;  1YKA A;  2AUV A;  3EYT A;  5GSS A;  4G0K A;  3L9V A;  1Z9H A;  4BL7 B;  3L78 A;  5CRE A;  1V98 A;  3ED3 A;  3RHC A;  5JWQ B;  3A2V A;  3CTG A;  4G9H A;  5KEJ A;  1GTB A;  1WIK A;  4WR4 A;  4PQ1 A;  1K0B A;  1T8E B;  3WT1 A;  22GS A;  5KOW A;  4OO4 A;  1XWA A;  3FZA A;  2GZZ A;  3IXR A;  4G0L A;  2YWM A;  3UEM A;  4MK3 A;  1W4V A;  3GRX A;  3LYK A;  3Q19 A;  2K8V A;  1MD3 A;  2MMA A;  1HYU A;  3VLN A;  4GSN A;  3K8N A;  2HSH A;  2GQK A;  3FEU A;  4F2I A;  4KB3 A;  2JZR A;  3QFB C;  3F3Q A;  4ZB6 A;  3BBY A;  4EL1 A;  1MDJ A;  4X43 A;  4IBP A;  6GSX A;  3LEF A;  1BYE A;  2X8H A;  4PXO A;  4HJ2 A;  2F8F A;  2VCQ A;  5DAL B;  3GMF A;  2MYG A;  1GSD A;  2N5F A;  4Z2T A;  2YZU A;  3LOR A;  4GWR A;  5D9T A;  2C4J A;  5J3R A;  4GF0 A;  5F0G A;  1GTI A;  1F9M A;  2DJ3 A;  1YKC A;  3APO A;  3FZ5 A;  4FQU A;  1G7O A;  2HRK A;  4WR5 A;  5H5S A;  2WJU A;  1HNC A;  2GVP A;  3KH7 A;  1GUH A;  5AIS A;  2H1B A;  4KUN A;  2GQM A;  1J0F A;  4DSR A;  2YJ7 A;  1URM A;  5JCU A;  1SKR B;  1MD4 A;  4KAE A;  4MNN A;  3MWH A;  4X1U A;  4YAP A;  8GSS A;  3VK9 A;  4P3Y B;  3F63 A;  1SJZ A;  2DC5 A;  4MA9 A;  3P90 A;  3QMX A;  2V1M A;  1R4W A;  4YQV A;  3GKM A;  3OR5 A;  2VD0 A;  3UOM A;  1SU9 A;  3D21 A;  4FYB A;  3QOU A;  4AGS A;  4G19 A;  4N10 A;  3HA9 A;  5DDL A;  4K9Z A;  2OAD A;  1YF1 A;  1ERV A;  1XIY A;  2XPE A;  4IN0 A;  4I8B A;  3HY2 A;  1SD9 A;  4TR1 A;  1GL8 A;  2XBI A;  4YQM A;  4IEL A;  3F0I A;  4BL7 A;  5IMC A;  2X8G A;  4NV5 A;  2VAF A;  3TRQ A;  1TRU A;  4MF6 A;  3P8W A;  2FWE A;  4JE1 A;  5EL8 A;  1U88 A;  1QUW A;  1HNB A;  4EC0 A;  3DKS A;  4ECC A;  5CRH A;  3QPM A;  5DAK B;  1TU8 A;  3GST A;  1X5C A;  4POL A;  3CSI A;  1C72 A;  3DYR A;  3FYG A;  2OAC A;  2IME A;  4OO5 A;  4I5Q A;  5HFK A;  3V1W A;  4F0C A;  4OMV A;  2QC7 A;  4LA1 A;  4IKH A;  1PL1 A;  2O7K A;  2WFC A;  2NVL A;  16GS A;  1XWB A;  2FY6 A;  1WOU A;  1J9B A;  3ZIT A;  5HR0 A;  3EU3 A;  3TKP A;  1JZR A;  3CRT A;  2YZH A;  1XOA A;  2LKU A;  2B5X A;  3VI5 A;  5DAL A;  1YDK A;  4I97 A;  1GNW A;  3LXZ A;  2I9H A;  1O85 A;  3HZ4 A;  4WBJ A;  4ICY A;  2A2R A;  20GS A;  4IQ1 A;  4MH3 A;  1S3D A;  3IC8 A;  5ECN B;  4K8M A;  5H5R A;  4HZ2 A;  2NPB A;  2X99 A;  1Y6E A;  2H0G A;  3CMI A;  1GP1 A;  1K0O A;  4GLT A;  1BX9 A;  1DBY A;  5DJM A;  4IHU A;  2B7J A;  2HRF A;  1ERT A;  1WWJ A;  3IR4 A;  2WB9 A;  1MDI A;  1MEK A;  4TXO B;  2B7K A;  1WRY A;  5B6M A;  1R26 A;  1NHO A;  3TJG A;  3GUR A;  4MAB A;  3Q74 A;  3VWU A;  5G1K A;  5ECO B;  2FCH A;  4TOP A;  1SKS B;  1RK4 A;  3ZFL A;  2JAD A;  3BCI A;  2DML A;  4RQR A;  3TUE A;  2RII A;  3C73 A;  1THX A;  1ZZY A;  1R5A A;  1TDI A;  2EIO A;  3HXS A;  1OYJ A;  4G2E A;  4MZB A;  1M9A A;  2VCZ A;  1TK5 B;  2GT6 A;  18GS A;  3N9J A;  5DCH A;  2J23 A;  2R37 A;  3H93 A;  5ECI B;  1PMT A;  4K0N A;  1TRW A;  1XOB A;  3MNG A;  4TKY A;  4ECI A;  3KIJ A;  4IW9 A;  5C00 A;  2M80 A;  1PKW A;  3FR3 A;  1ERW A;  4DSS B;  4AJ7 A;  5LNK e;  4HS1 A;  2JZT A;  1G6W A;  2QGV A;  4OFT A;  4G0I A;  4GRF A;  1PKZ A;  3TDG A;  1CQG A;  2IMF A;  2JAC A;  5AGY A;  2YP6 A;  3MSZ A;  4FYU A;  1TK0 B;  2DMM A;  1OE8 A;  2YOI A;  4ZL8 A;  3VWX A;  3GV1 A;  3N5O A;  5LD0 A;  2LS5 A;  1O6J A;  4WBR D;  4MJA A;  5HR3 A;  2M72 A;  2IMK A;  5ECS A;  3RDW A;  1V2A A;  3FZ4 A;  1DE1 A;  5KN3 A;  2VL2 A;  3BCK A;  4JED A;  3GYK A;  5ELG A;  1TXX A;  4L0W A;  3KGK A;  3C1R A;  3HVS A;  3QDN A;  4F82 A;  1X9M B;  3I69 A;  2LNS A;  4KSO A;  4RUV A;  4USS A;  3D22 A;  2X64 A;  4O5U A;  4YKG A;  4KCE A;  5AIV A;  1WPI A;  3BOA A;  2HE3 A;  3IHG A;  1M2B A;  4N30 A;  3TRP A;  1T1V A;  1GUL A;  2JU5 A;  2VLU A;  2VCX A;  1E2Y A;  4D73 B;  2CV4 A;  1XXU A;  1LU4 A;  1GWC A;  4GXZ A;  1LBK A;  2NDO A;  1GSE A;  1OKD A;  1QGV A;  4PUA A;  1PX7 A;  2QKE A;  2WZ9 A;  4EDY A;  4YH2 A;  2B5Y A;  4LLR A;  5EVO A;  5B7C A;  1SKW B;  2GZY A;  3ERW A;  4FH8 A;  4TXO A;  2R3X A;  2E2M A;  3I43 A;  4E8H A;  2DIY A;  4PQI A;  2E0Q A;  1PGT A;  3GNJ A;  1Z7P A;  1GTA A;  3US3 A;  2KOK A;  2VD1 A;  1O8X A;  2DKH A;  2DJ0 A;  3IAS 2;  3RBT A;  6GSS A;  1A0R P;  3LG6 A;  4PNF A;  4Q5F A;  2IWT A;  2PER A;  3TKR A;  2LTK A;  3R2Q A;  4MF7 A;  3UIW A;  1V9W A;  3D4M A;  1T00 A;  2R2J A;  1GUM A;  1A2L A;  1NW2 A;  3DRN A;  5ECK B;  4KX4 A;  1H4O A;  4MMM A;  5B6N A;  1YY7 A;  2P31 A;  3G7I A;  3QFA C;  5G5E A;  1Z6N A;  3APS A;  3C7M A;  3PGT A;  3EUR A;  2OE0 A;  1HD2 A;  3DEX A;  2L4C A;  2YWN A;  3FR6 A;  3EC3 A;  1B4Q A;  1TJD A;  2K6V A;  4WF5 A;  2VM1 A;  1JZW A;  5HFG A;  4DSS A;  3U6V A;  5IMF A;  4HQS A;  4GST A;  4OCE A;  3C1S A;  4LMW A;  1EWX A;  3EPT A;  5J9C A;  1V40 A;  3IE3 A;  3WGX A;  2BTO T;  2E7P A;  2FWG A;  1TW9 A;  2M46 A;  1OAZ A;  3TKS A;  4Z2R A;  1WP0 A;  2O87 A;  5CRD A;  1U3A A;  3WGE A;  1USB A;  1QQ2 A;  2KP2 A;  12GS A;  1U87 A;  9GSS A;  2PBJ A;  3PR8 A;  4I6X A;  2RUF A;  1VRS D;  3DIE A;  2LV3 A;  4NMU A;  4J57 E;  4FO5 A;  3UAR A;  4EE0 A;  2H73 A;  2YJH A;  3FW2 A;  3P2A A;  1T4Z A;  5DVB A;  4AJ8 A;  3D5J A;  2V2G A;  1J08 A;  4DSQ A;  5L71 A;  3GX0 A;  2V41 A;  2CX3 A;  3ME8 A;  1SYR A;  4YKF A;  1M2D A;  1PSQ A;  4EVM A;  5J41 A;  2XC2 A;  3F9U A;  2FHE A;  1OE7 A;  1AIU A;  2R6K A;  4EO3 A;  3A5W A;  3HHV A;  5CAX A;  4QQ7 A;  3KMO A;  4ZIL A;  4HEA 2;  3LWA A;  4D73 A;  2DIZ A;  3KJY A;  5G2Z A;  4BWQ A;  2JZS A;  4MDC A;  4PGT A;  4O92 A;  4JR6 A;  3IHQ A;  1FVJ A;  1K3O A;  1Z7R A;  2MMZ A;  2CZ3 A;  2H74 A;  1FO5 A;  2H71 A;  2O85 A;  3NIV A;  5IO0 A;  5IMD A;  2C0D A;  5HFI A;  3IA1 A;  5KOX A;  3H4K A;  3O3T A;  2L6D A;  2HYX A;  5JCW A;  3F6D A;  2X49 A;  2XHF A;  4NPB A;  2PVQ A;  3QD9 A;  1SJI A;  2EC4 A;  5KN1 A;  2DSA A;  4IJI A;  1R7H A;  3G9B A;  4RI6 A;  3IAM 2;  3MDK A;  4GTU A;  4WKW A;  1KEB A;  4CY6 A;  1EOG A;  4K7O A;  1V58 A;  1ZGN A;  4ZBD A;  4ML1 A;  2H1D A;  4BVX B;  4ISD A;  4CW9 A;  1BQ7 A;  2KLX A;  4I2U A;  2AHE A;  3GL3 A;  2KP1 A;  3ERG A;  2OA7 A;  2A4H A;  3M3M A;  2IPA A;  1NM3 A;  2MBT A;  2YWI A;  3L9S A;  1KNG A;  3HJO A;  2MMO A;  4MPF A;  2F51 A;  3F6F A;  4PUF C;  2L6C A;  3HDC A;  3M9J A;  2GSS A;  2C0F A;  1SL2 B;  2LST A;  1GUK A;  5IMZ A;  3ERF A;  3UVT A;  4KDX A;  1SL1 B;  3GKK A;  2GQL A;  2H0H A;  1EEM A;  3GN3 A;  1OVN A;  2HSM A;  5BRT A;  1K0N A;  3ZVJ D;  1ZL9 A;  1ERU A;  2ES7 A;  4HJM A;  1AAZ A;  5D9V A;  3KH9 A;  4ID0 A;  5HR1 A;  1GRX A;  3A5I A;  1X9W B;  1PX6 A;  3E0U A;  2OBK A;  4KGI A;  3IDV A;  2LQO A;  2VL3 A;  3F8U A;  4CDO A;  2H1A A;  1G7E A;  4PQH A;  4ILF A;  1XPV A;  1EV9 A;  1EEJ A;  3EIN A;  4ZL9 A;  2NTO A;  3HZ8 A;  1K3Y A;  2CQ9 A;  3ZML A;  4RQX A;  1A0F A;  1QFN A;  2IL3 A;  1XW9 A;  2MZC A;  3QAG A;  5ECM B;  3H8Q A;  5EPF A;  2GDR A;  4XRA A;  1T7P B;  4HDE A;  5KN0 A;  5F8B A;  2LRT A;  1PN0 A;  2B3S A;  4FIW A;  4NV2 A;  1XW6 A;  5G31 A;  2CAQ A;  5CRW A;  4MCU A;  1A24 A;  2LRC A;  1VF3 A;  2K18 A;  2AAW A;  1G6Y A;  1PA3 A;  5ECH B;  2H6Z A;  2H19 A;  2P0G A;  1O8W A;  2VCT A;  5CNW A;  5LCZ A;  4KCA A;  3KTL A;  1M0U A;  4TR3 A;  2CA8 A;  2F8A A;  3AY8 A;  3KP8 A;  3GTU B;  4F03 A;  6GSU A;  2VCW A;  2D2Z A;  2C0G A;  3DXB A;  3Q18 A;  4JR4 A;  2TIR A;  3DD3 A;  2LJA A;  2PN8 A;  1JFU A;  19GS A;  4IQA A;  4ZBB A;  2FWH A;  1TKD B;  5A4W A;  1Y25 A;  4MF5 A;  3LSZ A;  3KP9 A;  3KTB A;  3LW9 A;  1IYI A;  2IJY A;  2GLR A;  4BVX A;  3UMA A;  1QK8 A;  3WT2 A;  5INY A;  2UZ8 A;  5COH A;  4Z2U A;  4X4J A;  1M2A A;  5D93 A;  2PUK C;  3ZYW A;  1YEP A;  3GIX A;  3DGQ A;  2YPM A;  2CZ2 A;  4JRR A;  3GX8 A;  1VF4 A;  2VLT A;  2H66 A;  2KUC A;  2YN1 A;  1XWG A;  2L4Q A;  3Q6O A;  4L5O A;  1XBS A;  3VPQ A;  1HNA A;  3TOT A;  2MMN A;  3DVW A;  4NHZ A;  4PTS A;  3DVX A;  1R5P A;  5G1L A;  4I2T A;  1GSF A;  4AJ6 A;  2WUL A;  2N5B A;  5CP1 A;  1EZK A;  4PNG A;  3CRU A;  4O7H A;  4OFM A;  1XWK A;  3HCZ A;  2N5A A;  2G2Q A;  3HJP A;  2GZP A;  3IK9 A;  3HKR A;  2A2P A;  4LL4 B;  5CO3 A;  2RM5 A;  2DLX A;  5G30 A;  14GS A;  1Z6M A;  3ISO A;  1UN2 A;  4K6X A;  3WYW A;  1F6M C;  2IMD A;  2L5L A;  3G7Y A;  2V6K A;  4O32 A;  4MP4 A;  1K0M A;  2QA2 A;  1ZOF A;  3TB2 A;  3TJK A;  4ECJ A;  2XPD A;  4JZQ A;  1XVQ A;  1YEX A;  1TTZ A;  5C04 A;  1JZD A;  4TXV A;  3EWL A;  4OD7 A;  2E2G A;  4ACS A;  4NAX A;  2A4V A;  1TI3 A;  3FY7 A;  4HOJ A;  4ULX A;  3CYN A;  2VCV A;  4QL7 A;  2K9F A;  4N0Z A;  1XZO A;  4GQC A;  3L0H A;  3GTU A;  3ZIV A;  3M9K A;  1AW9 A;  2OJL A;  3HD5 A;  4WEY A;  4MZW A;  5AN1 A;  6GSW A;  5IPG A;  2AJQ B;  4DEJ A;  5J4U A;  3TCO A;  2XBQ A;  3RHB A;  1OC8 A;  5F06 A;  4O5Q A;  4K5S A;  5EY6 A;  2DKI A;  1ZMA A;  4IVF A;  1A2J A;  2WCI A;  3RPN A;  1PL2 A;  4LMV A;  4KW6 A;  3RAZ A;  2PPT A;  1ACV A;  3E3E A;  5D9X A;  1K0C A;  2R4V A;  2C8U A;  3ZVJ A;  2LEG A;  4KND A;  1RQM A;  2H8L A;  2OE3 A;  2GTU A;  4MJC A;  1FHE A;  2HLS A;  4TW5 A;  2GST A;  2R0P A;  4PX1 A;  4LL1 B;  4BPY A;  5ELA A;  2H1G A;  2GSR A;  3W6G A;  5A4V A;  2HZE B;  4PUR A;  4K7I A;  3G7J A;  2P5R A;  1FG4 A;  2QA1 A;  3M1G A;  1A2M A;  2RM6 A;  4EIP A;  1BAY A;  2I4A A;  2Z9S A;  4HZ4 A;  5IMA A;  4ZB8 A;  4EKZ A;  2C3Q A;  2R5G A;  5D73 A;  5IQY A;  2O89 A;  1S3A A;  1WJK A;  1UVZ A;  5D9W A;  2L59 A;  3FRC A;  2F9S A;  3PIN A;  2LRN A;  1FAA A;  2X8C A;  3I9V 2;  3R3E A;  3F4S A;  4O5R A;  3VUR A;  6GSV A;  1GH2 A;  2VO4 A;  2H72 A;  4G10 A;  2O8V B;  3IBH A;  3CSJ A;  1S3C A;  1XWC A;  2PMT A;  4POK A;  2V32 A;  3FK8 A;  2YV9 A;  3M0F A;  5ECL B;  2BJX A;  3KZQ A;  1TRS A;  4MJB A;  1T4Y A;  1SYX A;  4KE3 A;  2PVO C;  3FR9 A;  3D6I A;  3O6T A;  4L5L A;  1U3I A;  1OC9 B;  4JBB A;  4OFN A;  4HI7 A;  2YAN A;  2YV7 A;  1NSW A;  5A4U A;  2HRN A;  2PU9 C;  2OE1 A;  5IMV A;  5IOW A;  5DJL A;  3KCM A;  4ZB9 A;  4XS1 A;  1B4P A;  4Z7X A;  4EIQ A;  3FKF A;  5B8A A;  2JSZ A;  3VI7 A;  2PGT A;  2LJR A;  3MYD A;  2REM A;  2TRX A;  3ZRE A;  3QAV A;  5FWG A;  1ABA A;  1YQ1 A;  4KDU A;  4EXJ A;  4WXT A;  5HR2 A;  1UC7 A;  5B8B A;  3ME7 A;  2V6O A;  1SK0 A;  2H75 A;  3LQ7 A;  2NBS A;  4WF4 A;  3VWW A;  1SL0 B;  1U6T A;  3D0Z A;  2CVB A;  5FHI A;  3HVX A;  3UVH A;  3GH9 A;  1E6B A;  3ZRD A;  5E4W A;  1GSS A;  3SBC A;  1CQH A;  1X0R A;  1QXH A;  1AUC A;  17GS A;  5AIX A;  2BMX A;  1W89 A;  3LFL A;  5JWO B;  1YZX A;  2PWJ A;  2ON7 A;  1HQO A;  2LJK A;  5HQP A;  1K3L A;  1ZYE A;  13GS A;  1BJX A;  1ZCP A;  1SD8 A;  2FUG 2;  5KN2 A;  2IFQ B;  1Z5Y E;  5DBQ A;  2GT5 A;  1V57 A;  1PQN A;  4RI7 A;  1TRV A;  4MZC A;  2H70 A;  3J7Y k;  7GSS A;  2HZF A;  6GST A;  2FD3 A;  1B9Y C;  2VUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...