3F9UA

Crystal structure of c-terminal domain of putative exported cytochrome c biogenesis-related protein from bacteroides fragilis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
145
structure length
145
Chain Sequence
EVHAKFDDYDLGMEYARQHNKPVMLDFTGYGCVNCRKMELAVWTDPKVSSIINNDYVLITLYVDNKTPLTEPVKIMENGTERTLRTVGDKWSYLQRVKFGANAQPFYVLIDNEGNPLNKSYAYDEDISKYINFLQTGLENYRKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative exported cytochrome C biogenesis-related protein
publication title Crystal structure of C-terminal domain of putative exported cytochrome C biogenesis-related protein from Bacteroides fragilis
rcsb
source organism Bacteroides fragilis nctc 9343
molecule tags Structural genomics, unknown function
total genus 46
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f9uA00
2ON5A 4HZ2A 4Z7XA 1XWAA 3GTUB 3RPPA 1M9BA 1OC8A 1TDIA 3QFAC 3APQA 3ZIVA 3BCIA 3UBLA 5IMFA 4I2UA 4MJAA 5HFIA 4HZ4A 1SKSB 3D0ZA 3ERWA 1XVWA 5EPFA 1GSDA 2OJLA 5HFGA 2IJYA 1WPIA 2P5RA 4LA1A 4TR3A 2RLIA 3F3QA 3UMAA 4ZL7A 2LNTA 1TU7A 2X8CA 3DYRA 1Z9HA 2CZ3A 2LNSA 1G6WA 2FA8A 1A23A 1AXDA 1FB6A 2FWHA 5CRWA 2JZRA 3KGKA 2YWMA 1ILOA 1SL2B 4PX1A 1BG5A 4XS4B 4I8BA 2C0EA 1VGLA 3C7MA 3A2XA 2GS3A 4GXZA 2CAQA 2DMLA 3W6GA 1TXXA 3H1NA 3D6IA 4XRDA 5IO2A 4ILFA 3TOUA 1GTIA 2DJKA 3PINA 4JBBA 2MMOA 4MF6A 3CSJA 1WOUA 3H79A 2CA8A 3GSSA 2DJ2A 2VAFA 2YWOA 2M46A 3P7XA 4MJBA 3C73A 5EL8A 1MTCA 3UVTA 4HUAA 2H01A 2HFDA 3CYNA 3GFKA 4NWYA 4AGSA 4EUYA 1JZRA 3D22A 3E9JB 1YY7A 1PA3A 3ZLPA 1DE1A 4EO3A 5E4WA 3UL3A 1PL2A 4OD7A 3MAKA 3TKPA 4WBRD 1X0RA 3ED3A 3L9VA 2B5EA 1XW6A 5F07A 6GSTA 2R4VA 1NSWA 2V2GA 1USBA 3DWVA 2NTOA 1TU8A 2OA7A 3DVWA 1GSEA 2MMZA 1THXA 1F9MA 1Z7RA 2LS5A 1PX7A 1OKTA 4IJ3A 5ECPB 1SD9A 4KCAA 2LQOA 4NPBA 4Q5RA 3IHQA 4QQ7A 3ZL5A 1M9AA 2WRTA 3ZTLA 1K3OA 1XWGA 4I6XA 3QFBC 1EV4A 1AIUA 1Z5YE 2E2GA 2VCZA 2N5BA 1ZOFA 3LYPA 1NW2A 4WBJA 3TKSA 1TK8B 1K0BA 4O32A 1MD4A 6GSSA 1KTEA 2PN8A 3GSTA 3J7Yk 1MDIA 4X1UA 4IW9A 3WGXA 5INYA 4OCEA 3VPQA 2YZHA 2H30A 4EE0A 4MJEA 3D21A 2PPTA 7GSSA 1SJIA 3SBCA 2PERA 5ID2B 1WP0A 4HEA2 1XOBA 2DIZA 4FIWA 3IR4A 3TKSE 3EWLA 2GSRA 1J0FA 1VRSD 1AW9A 5CAXA 4XCSA 4K6XA 2WZ9A 5IO0A 4E8HA 4KA0A 1BEDA 2NDOA 1Z7PA 2WS2A 4MMMA 5FWGA 2N5FA 2H66A 4HU7A 1SJ6A 2YWNA 3GV1A 3QD9A 1ACVA 2F3MA 1M2BA 5DDLA 5AN1A 2A2RA 3TRPA 5JWQB 2OE0A 3F6FA 2YJHA 3VWUA 1PQNA 3MNGA 3TKSC 4YH2A 4BWQA 2QC7A 1XWBA 4WXTA 2V32A 5HR2A 2CAIA 3VWWA 2YP6A 2CVKA 1FVKA 3IV4A 2C0DA 3UIWA 2K18A 1XFLA 2B1LA 2YZUA 2LJRA 3C1SA 2H0HA 2YPMA 4LLRA 2MBTA 1KEBA 4QL9A 1TRWA 3L0HA 2VM1A 3DIEA 4TVEA 3LQ7A 5ECKB 4KB3A 1XVQA 2BTOT 1AAZA 2V1MA 3M0FA 5JCUA 4HJ2A 4LL1B 3G9BA 4K7IA 3IA1A 5G1LA 3KD0A 1B8XA 2WCIA 3CRUA 1EZKA 3UVHA 1OE7A 5GSSA 3TJFA 4EXJA 4V2LA 1H4OA 5DQSA 3S9FA 2L57A 4ML6A 3WT1A 2MMAA 3KMOA 3APSA 2IMIA 3TGZA 5J4UA 1U3AA 4X43A 3IC4A 4MA9A 3U6VA 5D9WA 3G7YA 2AYTA 4N0VA 4IHUA 3DKSA 5HQPA 4P3YB 5B7CA 5J9CA 3WYWA 2LSTA 3GKNA 4Q5FA 2I81A 3ZREA 2YJ7A 4KUNA 4OFMA 3F8UA 2IN3A 5J5NA 3P2AA 2PU9C 3MSZA 1Q4JA 3GX0A 4OFTA 1ERUA 3F6DA 5D73A 1TK5B 4K7OA 2CX3A 1QQ2A 1GTBA 2L6CA 1TKDB 4GSTA 2GZZA 1X9MB 2VD0A 1FOVA 1URMA 4NMUA 5IMVA 1EEMA 2DJ1A 3GN3A 2J9HA 2FHEA 3CXGA 2H8LA 2L4QA 2HRNA 3VFIA 4MPGA 4L5LA 3KP9A 3VURA 3ZIJA 4DSSA 3QDNA 4XS6A 2HZEB 4G19A 4K9ZA 3IBHA 3DXBA 4JZQA 2PWJA 1ERVA 1Z3EA 2FCHA 2B3SA 2H70A 2OBIA 4L0UA 5FT3A 1G7EA 4YQMA 4KDYA 2E0QA 2WB9A 5J3RA 4FH8A 3CBUA 4TW5A 3L9SA 2X8GA 2VM2A 2VLTA 3ZRDA 5DCHA 1ZL9A 3HA9A 2RM6A 4MABA 4GWRA 5ECRB 1ST9A 4F9ZA 3KJYA 3APOA 4OO4A 2VL9A 4JEDA 1JLWA 3HJOA 5AIVA 2H0IA 5CRDA 3H4KA 4AF2A 4L8EA 2OE3A 5ELAA 1YF0A 3KEBA 4TR4A 1EEJA 2V41A 3A5WA 4AJ6A 1S3DA 8GSSA 5IIZA 5H5RA 1A24A 5LD0A 1M7TA 5GAPD 1WMJA 2VLUA 4Q5QA 3HHVA 2C1YA 2VOCA 1XPVA 3QPMA 2Z9SA 5JWOB 2KOKA 1VF1A 1G0TA 1GH2A 4TOPA 2GZPA 4ZB9A 5AISA 1WJKA 4MZCA 2C3TA 5F05A 4ECJA 4YAVA 3C8EA 1R5AA 3HZ8A 1DSBA 5CREA 2CZ2A 4KE3A 2PVOC 4TXOB 4EF0A 2N5AA 1TI3A 3LG6A 1G6YA 3ZVJA 4F2IA 2QGVA 3FY7A 2JACA 1XZOA 3QAWA 3ISOA 2B5XA 2K8SA 2YCDA 1GSYA 1O8XA 5FHIA 2O89A 4ECBA 4OMVA 3IXRA 4ULXA 2HI7A 4RQRA 5ECMB 2H71A 2LRCA 4ZILA 3FYGA 1M2DA 5D93A 2X64A 1OKDA 4IQ1A 16GSA 2OACA 1AQXA 4I2TA 3M9JA 3F4RA 2K8VA 4GSNA 1VF4A 4YQVA 2QSIA 5ELGA 3KH7A 6GSYA 3O6TA 3BD2A 3HKRA 1A8LA 3FW2A 2JSZA 4J2FA 2OE1A 5HFKA 3LEFA 1AC1A 1THOA 1PMTA 4KW6A 3LSZA 2F8AA 5GAND 4NXIA 3WGEA 1Q98A 2R2JA 1TRSA 1GP1A 1BJXA 3O3TA 3ERFA 2H0GA 3TDGA 4MJCA 1XWCA 2L5LA 3RDWA 2H1DA 3SWLA 1XBSA 20GSA 1GLQA 1ZGNA 2IPAA 5ECSA 2J23A 18GSA 2VCVA 3ZMKA 5E59A 4POLA 1GUMA 1EGRA 2IL3A 1OC9A 1F6MC 3GURA 3HXSA 2VUPA 5JCGA 4WEYA 1LBKA 1PN9A 4J57E 4N10A 2CVBA 4WKWA 3TJBA 3FZAA 2C8UA 4DEJA 4IQAA 1WIKA 1QK8A 3BCKA 4HU9A 4PXOA 2WULA 1GLPA 1B4QA 4EDZA 1PL1A 1H75A 1PSQA 4JRRA 1OAZA 5ECLB 2H6ZA 3GMFA 1O6JA 4KSOA 3QCPA 5L71A 4NHWA 4XTSA 3TKQA 3ZMLA 1LJRA 1EV9A 1MDKA 5CP1A 5C04A 1IYHA 2A4VA 5B6NA 3ERGA 2EIQA 3I6AA 3EE2A 3W8JA 3LYKA 3HJPA 1MDJA 4BWSA 4RQXA 2JU5A 2LEGA 1M2AA 1ZZYA 4I5QA 4NV5A 3IPZA 3HVXA 1U88A 4K8MA 2DC5A 2VLVA 3RHCA 4ZIJA 3HY2A 4BVYA 2H6XA 1O85A 4OFNA 2K9FA 3GIXA 2DSAA 1J9BA 19GSA 2H1BA 1TTZA 2F51A 3HDCA 2KP1A 3LXZA 4ECCA 2L5OA 2RUEA 5CNWA 3BBYA 3LORA 1TP9A 22GSA 3TOTA 5G30A 1FG4A 2YV9A 4GF0A 3EVIA 2IMEA 3WGDA 5GSTA 3UBKA 5D9TA 4XRAA 2MZCA 2VCXA 2EIRA 2O8VB 1ERWA 1K0AA 12GSA 2YANA 5D8IA 3VWVA 1R4WA 3PR8A 2HE3A 3O76A 5DCGA 3F63A 4L0WA 1PD21 2O87A 2B1KA 3VI7A 1ZMAA 2WGRA 2KP2A 4PUAA 1B4PA 3DGQA 2LTKA 1FB0A 1PX6A 1QXHA 1OVNA 4EL1A 3CTGA 1QGVA 4TR1A 3FK8A 4ID0A 2IMFA 2TIRA 3TUEA 4NV2A 4KDUA 1JZWA 3GL5A 2JADA 3F3RA 2HXKA 4YAPA 3CRTA 2O85A 4AJ8A 1SL0B 5DALA 1B48A 5JWRB 1BYEA 3VI5A 2EC4A 4K0NA 2IFQA 5IMZA 4CHSA 1T7PB 3N5OA 4GCIA 5DJMA 11GSA 5B6MA 2H75A 1QUWA 4NHZA 3GA4A 2JZSA 5A4UA 4ZB6A 1UA5A 3FR6A 3FRCA 1FO5A 3FZ4A 4POKA 3FKFA 1TJDA 4D73A 2ZNMA 1SYXA 3ME8A 3E3EA 2H73A 3GX8A 4PGTA 2JL4A 1A0FA 2CQ9A 4K1FA 3VLNA 1ZYEA 2GT6A 3GH6A 4TKYA 5A4VA 3EINA 4RUVA 1DE2A 2C3NA 4ZL8A 3I9V2 4XHMA 3NZNA 1M0UA 1FVJA 1GSFA 3KXOA 2ES7A 2AB6A 3GL3A 3QAGA 3GRXA 1B9YC 2XC2A 2YOIA 1SU9A 3DD3A 3R2QA 2RUFA 4MP4A 4IP6A 2H72A 4N30A 2REMA 1EOGA 3W8SA 5ABRA 1X9WB 1CQHA 2L59A 5G5FA 4MK3A 1R26A 1GTUA 4PQ1A 5ENUA 1TRUA 5EVOA 5G2ZA 5D9XA 2HYXA 1JHBA 1BX9A 2NPBA 4G10A 3Q6OA 1K0DA 4IGJA 1UC7A 3KP8A 5JCWA 2H76A 1T00A 3GH9A 5IOWA 4MH2A 1EP8A 5IMDA 3EU3A 3F4TA 3GTUA 1U87A 2HT9A 4GQCA 1T8EB 4XS1A 2ON7A 3EMXA 1FW1A 4Q5NA 4GLTA 3H93A 2H1GA 1XXUA 4OWYA 1GWCA 2GDRA 3Q18A 3ZZXA 2A2SA 5CO3A 4RI6A 1Z6MA 2P0GA 1OE8A 1AQWA 2FWGA 5F0GA 5KN0A 3OR5A 3ZITA 2D2ZA 2DJ0A 4GQFA 2DJJA 2GVPA 9GSSA 2JZTA 3L9UA 4JU5A 4O92A 3IRAA 4XS4A 5COHA 3RAZA 4HDEA 2GLRA 3QMXA 5DAKA 1HNBA 3TB2A 3FZ5A 3A2WA 4N0ZA 3HZ4A 2OBKA 5D96A 1O81A 1T1VA 2GSQA 3GUSA 1EOHA 3HYPA 2C0GA 2L4CA 2LJAA 2DBCA 4IBPA 2H74A 5H5QA 3LFLA 1GSUA 1GNEA 3PGTA 5AGYA 1MD3A 1GULA 2VD1A 4KGIA 2JSYA 3K8NA 1F3AA 3IDVA 5DBQA 10GSA 1PRXA 4PUFC 2TRCP 1U6TA 4JE1A 2BMXA 1K0NA 2VO4A 2NBSA 1YF1A 1SK1A 3Q19A 3HJMA 2IMDA 1S3AA 4IJIA 2WFCA 2BJXA 4F82A 2AV4A 3FR9A 3IAS2 4O7HA 1YQ1A 2PMTA 4HJMA 2KUCA 1UVZA 1ON4A 5HR0A 3DMLA 4IN0A 4WF4A 1JZDA 4KH7A 1RW1A 2IIYA 6GSUA 1TOFA 1GRXA 1G7OA 4MLYA 1NM3A 17GSA 5D9VA 1AUCA 1F2EA 3F9UA 1BAYA 2VCTA 1SK2A 3ZFBA 4ZB8A 4FYCA 1PKZA 3GNJA 4PNFA 3QAVA 1I9DA 4NAXA 2WDUA 2XBIA 3KTLA 5ECIB 4POMA 3EYTA 5H5SA 1YZXA 3KMNA 2PBJA 2OKAA 1TK0B 2WJUA 3A2VA 4KDXA 1R5PA 4ZBDA 1A2JA 1KBNA 4POBA 5ID2A 3L4NA 2LQQA 4L5OA 2IMKA 1LU4A 3CSIA 4G2EA 3US3A 4TXVA 2EIOA 2LRNA 5ECHB 2YNXA 1SL1B 1RQMA 2AJQB 1V9WA 1V58A 4DSSB 1GNWA 4KX4A 1X9SB 1E2YA 1K0OA 3BOAA 2FY6A 1B9XC 4ISDA 3M3MA 3VPTA 4E8EA 1V57A 1JZOA 2YN1A 4O5RA 3TJJA 1K3YA 1E6BA 1KNGA 2MBSA 2V6KA 3TCOA 1UN2A 5B8BA 5CRHA 3M1GA 1SJZA 2FNOA 1HD2A 1W4VA 5DAKB 3G7IA 1HNCA 2PUKC 1SYRA 2FA4A 4ML1A 1DUGA 2X99A 1A0RP 3Q74A 3TKRA 1O8WA 3CSHA 4MF7A 1ML6A 2YWIA 1T3BA 1SD8A 3FZ9A 2MYGA 1WE0A 5KEJA 2I3YA 5IPHA 4J56E 3GKMA 4V1Ap 1K0CA 3D4MA 3JCML 2TRXA 1MEKA 1M99A 1XCCA 1VF3A 1HQOA 6GSWA 3L78A 2DLXA 2VCQA 5G31A 2XPEA 5LNKe 1N8JA 1HNAA 4IELA 4IVFA 2GSSA 2DIYA 3G7JA 4TN8A 2HNLA 2R5GA 4HS1A 1ERTA 4YQUA 4MH3A 2XPDA 5GZZB 5IMCA 2GQMA 1AQVA 2GGTA 1YKCA 1V2AA 5DJLA 1TRVA 5IMAA 2B5YA 1X5DA 3LJRA 4HQSA 2IWTA 3BJ5A 3GYKA 3MDKA 3KCMA 1QMVA 3D5JA 1VF2A 4KSMA 4V1Ag 3RHBA 2FLSA 2MMNA 3VK9A 4LMWA 2H1AA 4WF5A 4WR5A 2QKEA 2LKUA 14GSA 3VWXA 4GSSA 1R7HA 4F0BA 2E7PA 1GSQA 2CV4A 4H86A 4DSQA 1OYJA 2LJKA 2HZFA 1GL8A 4LL4B 4FYBA 5A5KA 3IK9A 4MDCA 4V2NA 4ZBAA 3IK7A 1K0MA 1F37A 1EWXA 4MZWA 5IPGA 3KM6A 1SK0A 4K2DA 3QOUA 4F03A 1S3CA 1N2AA 2HZEA 4QL7A 2G2QA 1EP7A 2C80A 1T4YA 2KLXA 2C4JA 2R37A 3LXTA 1OC9B 4EC0A 2P31A 3UARA 2NVLA 5CYYA 1JLVA 2R6KA 3IOSA 5EY6A 2B7JA 1ZCPA 3KTBA 2XBQA 2PVQA 4MZBA 1WWJA 1CQGA 4OO5A 2VL2A 1ABAA 2LV3A 4EVMA 3IAM2 2B7KA 4AJ7A 2I1UA 3NIVA 4HOJA 3WD6A 2ZCTA 1OC3A 1XIYA 2CX4A 2OADA 1YDKA 4KAEA 2HSHA 4JR6A 3UJ1A 2PGTA 5ECOB 4TR0A 4ECIA 1F3BA 5HR3A 4K7NA 2ZUPA 1Z6NA 3LWAA 1YKAA 1FHEA 4X0XA 3E0UA 1IYIA 5HR1A 2CVDA 1GSSA 3FEUA 1HYUA 6GSXA 5KN3A 2M72A 4EKZA 5CRGA 4TXOA 4F0CA 4IS0A 5F8BA 2VCWA 3RBTA 3D4TA 4IP1A 5G5EA 2I9HA 3CMIA 3MWHA 2B6MA 4BL7A 3KZQA 3UOMA 4CW9A 2VL2C 2GTUA 3KH9A 3HVSA 3UAPA 3N9JA 4XIHA 2H6YA 4KNDA 1PKWA 1PGTA 5KN1A 2P5QA 4BVXA 1EGOA 4WETA 3HVVA 2LUSA 4PNGA 2L6DA 3I43A 3GKKA 3C1RA 3NOFA 1QFNA 2AAWA 1A2MA 1T4ZA 5J9BA 1WRYA 5J41A 2LRTA 1YEPA 5ECQB 2AUVA 3DEXA 1FAAA 3F4SA 2K6VA 1XOAA 4RI7A 2FUG2 5KN2A 5DQYA 1GUHA 5DVBA 4I97A 4V2MA 3TRXA 1V98A 3QR6A 3H8QA 1JFUA 4MF5A 4TR1B 1Y25A 4PQIA 1GUKA 3RPNA 5IOXA 4GTUA 3EU4A 1SENA 2VL3A 4WR4A 2C3QA 3ZYWA 1NHOA 4LMVA 5ECNB 4BPYA 2I4AA 2C0FA 3M8NA 1RK4A 5A4WA 3HD5A 3TJGA 3TRQA 4PQHA 5DALB 3ZFLA 4MPFA 3I69A 1TI1A 2IFQB 2GSTA 4BA7A 2FWEA 2V6OA 1XW5A 5IM9A 2G0FA 1XW9A 1W89A 1TW9A 4DVCA 4FYUA 3EURA 1XWKA 1O73A 1U3IA 4FO5A 3TJKA 3M9KA 1YEXA 4ZBBA 1I5GA 2R3XA 4D73B 5IQYA 1GTAA 4HQZA 4JR4A 3U5RE 2YV7A 1V40A 2F9SA 2AHEA 1X5CA 3ME7A 4ZL9A 2RIIA 4HI7A 2X8HA 1A2LA 3KIJA 3IE3A 5AIXA 1NHYA 2FD3A 4TRXA 3A3TA 5F06A 2F8FA 5G1KA 2HLSA 2HRFA 4ACSA 1A8YA 1ZYQB 2XHFA 3LGCA 3GKXA 1J08A 1SKRB 1YJ6A 2KHPA 4EDYA 3EC3A 3ZVJD 1X5EA 3AY8A 5LCZA 3F0IA 2FGXA 3HCZA 2FWFA 3FHKA 4K0GA 3DVXA 3V1WA 4G9HA 2RM5A 1Y6EA 3PH9A 3CTFA 3EMPA 2O7KA 6GSVA 2DJ3A 1C72A 1DBYA 4MCUA 4OCFA 1SKWB 4KCEA 2GQKA 1O7UA 4CDOA 3FR3A 1BQ7A 3C71A 4ZXGA 2CT6A 2DMMA 3GHAA 5C00A 4GRFA 3P90A 13GSA 4PURA 4IKHA 2GQLA 5B8AA 4N11A 2HSYA 2M80A 3J7Yb 3UEMA 1K3LA 2H19A 2E2MA 2GT5A 4DSRA 2VIMA 3WT2A 2ALBA 2GZYA 3DRNA 3P8WA
chains in the Genus database with same CATH superfamily
2ON5A 4HZ2A 4Z7XA 1XWAA 3A5IA 3GTUB 3RPPA 1M9BA 1OC8A 1TDIA 3QFAC 3APQA 3ZIVA 3BCIA 3UBLA 5IMFA 4I2UA 4MJAA 5HFIA 4HZ4A 1SKSB 3D0ZA 3ERWA 1XVWA 5EPFA 1GSDA 2OJLA 5HFGA 2IJYA 1WPIA 2P5RA 4LA1A 4TR3A 2RLIA 3F3QA 3UMAA 4ZL7A 2LNTA 1TU7A 2X8CA 3DYRA 1Z9HA 2CZ3A 2LNSA 1G6WA 2FA8A 1A23A 1AXDA 1FB6A 2FWHA 5CRWA 2JZRA 3KGKA 2YWMA 1ILOA 1SL2B 4PX1A 1BG5A 4XS4B 4I8BA 2C0EA 1VGLA 3C7MA 3A2XA 2GS3A 4GXZA 2CAQA 2DMLA 3W6GA 1TXXA 3H1NA 3D6IA 4XRDA 5IO2A 4ILFA 3TOUA 1GTIA 2DJKA 3PINA 4JBBA 2MMOA 4HSCX 4MF6A 3PPUA 3CSJA 1WOUA 3H79A 2CA8A 3GSSA 2DJ2A 2VAFA 2YWOA 2M46A 3P7XA 4MJBA 3C73A 5EL8A 1MTCA 3UVTA 1ZYPA 4HUAA 2H01A 2HFDA 3CYNA 3GFKA 4NWYA 4AGSA 4EUYA 1JZRA 3D22A 3E9JB 1YY7A 1PA3A 3ZLPA 1DE1A 4EO3A 5E4WA 3UL3A 1PL2A 4OD7A 3MAKA 3TKPA 2A2PA 2DKHA 4WBRD 1X0RA 3ED3A 3L9VA 2B5EA 1XW6A 5F07A 6GSTA 2R4VA 1NSWA 2V2GA 1USBA 3DWVA 2NTOA 1TU8A 2OA7A 3DVWA 1GSEA 1PN0A 2MMZA 1THXA 1F9MA 1Z7RA 2LS5A 1PX7A 1OKTA 4IJ3A 5ECPB 1SD9A 4Z2RA 4KCAA 2LQOA 4NPBA 4Q5RA 3IHQA 4QQ7A 3ZL5A 1M9AA 2WRTA 3ZTLA 1K3OA 1XWGA 4I6XA 3QFBC 1EV4A 1AIUA 1Z5YE 2E2GA 2VCZA 4Z2TA 2N5BA 1ZOFA 3LYPA 1NW2A 4WBJA 3TKSA 1TK8B 1K0BA 4O32A 1MD4A 6GSSA 1KTEA 2PN8A 3GSTA 3J7Yk 1MDIA 4X1UA 4IW9A 3WGXA 5INYA 2DKIA 4OCEA 3VPQA 2YZHA 2H30A 4EE0A 4MJEA 3D21A 2PPTA 7GSSA 1SJIA 3SBCA 2PERA 5ID2B 1WP0A 4HEA2 1XOBA 2DIZA 4FIWA 3IR4A 3TKSE 3EWLA 2GSRA 1J0FA 1VRSD 1AW9A 5CAXA 4XCSA 4K6XA 2WZ9A 5IO0A 4E8HA 4KA0A 1BEDA 2NDOA 1Z7PA 2WS2A 4G0KA 4MMMA 5FWGA 2N5FA 2H66A 4HU7A 1SJ6A 2YWNA 3GV1A 3QD9A 1ACVA 2F3MA 1M2BA 5DDLA 5AN1A 2A2RA 3TRPA 5JWQB 2OE0A 3F6FA 2YJHA 3VWUA 2UZ8A 1PQNA 3MNGA 3TKSC 4YH2A 4BWQA 2QC7A 1XWBA 4WXTA 2V32A 5HR2A 2CAIA 3VWWA 2YP6A 2CVKA 1FVKA 3IV4A 2C0DA 3UIWA 5KOXA 2K18A 1XFLA 2B1LA 2YZUA 2LJRA 3C1SA 2H0HA 2YPMA 4LLRA 2MBTA 1KEBA 4QL9A 1TRWA 3L0HA 2VM1A 3DIEA 4TVEA 3LQ7A 5ECKB 4KB3A 1XVQA 2BTOT 1AAZA 2V1MA 3M0FA 5JCUA 4HJ2A 4LL1B 3G9BA 4K7IA 3IA1A 5G1LA 3KD0A 1B8XA 2WCIA 4EIQA 3CRUA 1EZKA 3UVHA 1OE7A 5GSSA 3TJFA 4EXJA 4V2LA 4O5UA 1H4OA 5DQSA 3S9FA 2L57A 4ML6A 3WT1A 2MMAA 3KMOA 3APSA 2IMIA 3TGZA 5J4UA 1U3AA 4X43A 3IC4A 4MA9A 3U6VA 5D9WA 3G7YA 2AYTA 4N0VA 4IHUA 3DKSA 5HQPA 4P3YB 5B7CA 5J9CA 3WYWA 2LSTA 4Q5FA 3GKNA 2I81A 3MYDA 3ZREA 2YJ7A 4KUNA 4OFMA 3F8UA 2IN3A 5J5NA 3P2AA 2PU9C 3MSZA 1Q4JA 3GX0A 4OFTA 1ERUA 3F6DA 5D73A 1TK5B 4K7OA 2CX3A 1QQ2A 1GTBA 2L6CA 1TKDB 4GSTA 2GZZA 1X9MB 2VD0A 1FOVA 1URMA 4NMUA 5IMVA 1EEMA 2DJ1A 2X49A 3GN3A 2J9HA 2FHEA 3CXGA 2H8LA 2L4QA 2HRNA 3VFIA 4MPGA 4L5LA 3KP9A 3VURA 3ZIJA 4DSSA 3QDNA 4XS6A 2HZEB 4G19A 4K9ZA 3IBHA 3DXBA 4JZQA 2PWJA 1ERVA 1Z3EA 2FCHA 2B3SA 2H70A 2OBIA 4L0UA 5FT3A 1G7EA 4EIPA 4YQMA 4KDYA 2E0QA 2WB9A 5J3RA 4FH8A 3CBUA 4TW5A 4O5QA 3L9SA 2X8GA 2VM2A 2VLTA 3ZRDA 5DCHA 1ZL9A 3HA9A 4FQUA 2RM6A 4MABA 4GWRA 5ECRB 1ST9A 4F9ZA 3KJYA 3APOA 4OO4A 2VL9A 4JEDA 1JLWA 3HJOA 5AIVA 2H0IA 5CRDA 3H4KA 4AF2A 4X4JA 4L8EA 2OE3A 5ELAA 1YF0A 3KEBA 4TR4A 1EEJA 2V41A 3A5WA 4AJ6A 1S3DA 8GSSA 5IIZA 5H5RA 1A24A 5LD0A 1M7TA 5GAPD 1WMJA 2VLUA 4Q5QA 3HHVA 2C1YA 2VOCA 1XPVA 3QPMA 2Z9SA 5JWOB 2KOKA 1VF1A 1G0TA 1GH2A 4TOPA 2GZPA 4ZB9A 5AISA 1WJKA 4MZCA 2C3TA 5F05A 4ECJA 4YAVA 3C8EA 1R5AA 3HZ8A 2QA1A 1DSBA 5CREA 2CZ2A 4KE3A 2PVOC 4TXOB 4EF0A 2N5AA 1TI3A 3LG6A 1G6YA 3ZVJA 4F2IA 2QGVA 3FY7A 2JACA 1XZOA 3QAWA 3ISOA 2B5XA 2K8SA 2YCDA 1GSYA 1O8XA 5FHIA 2O89A 4ECBA 4OMVA 3IXRA 4ULXA 2HI7A 4RQRA 5ECMB 2H71A 2LRCA 4ZILA 3FYGA 1M2DA 5D93A 2X64A 1OKDA 4IQ1A 16GSA 2OACA 1AQXA 4I2TA 3M9JA 4BVXB 3F4RA 2K8VA 4GSNA 1VF4A 4YQVA 2QSIA 5ELGA 3KH7A 6GSYA 3O6TA 3BD2A 3HKRA 1A8LA 3FW2A 2JSZA 4J2FA 2OE1A 5HFKA 3LEFA 1AC1A 1THOA 1PMTA 4KW6A 3LSZA 2F8AA 5GAND 4NXIA 3WGEA 1Q98A 2R2JA 3MIXA 1TRSA 1GP1A 1BJXA 3O3TA 3ERFA 2H0GA 3TDGA 4MJCA 1XWCA 2L5LA 3RDWA 2H1DA 4KF9A 3SWLA 1XBSA 20GSA 1GLQA 1ZGNA 2IPAA 5ECSA 2J23A 18GSA 2VCVA 3ZMKA 5E59A 4POLA 1GUMA 1EGRA 2IL3A 1OC9A 1F6MC 3GURA 3HXSA 2VUPA 5JCGA 4WEYA 4K5RA 1LBKA 1PN9A 4J57E 4N10A 2CVBA 4WKWA 3TJBA 3FZAA 2C8UA 4DEJA 4IQAA 1WIKA 4MNNA 1QK8A 3BCKA 4HU9A 4PXOA 3IC8A 2WULA 1GLPA 1B4QA 4EDZA 1PL1A 1H75A 4K5SA 1PSQA 4JRRA 1OAZA 5ECLB 2H6ZA 3GMFA 1O6JA 4KSOA 3QCPA 5L71A 4NHWA 4XTSA 3TKQA 3ZMLA 1LJRA 1EV9A 1MDKA 5CP1A 5C04A 1IYHA 2A4VA 5B6NA 3ERGA 2EIQA 3I6AA 3EE2A 3W8JA 3LYKA 3HJPA 1MDJA 4BWSA 4RQXA 2JU5A 2LEGA 1M2AA 1ZZYA 4I5QA 4NV5A 3IPZA 3HVXA 1U88A 4K8MA 2DC5A 2VLVA 3RHCA 4ZIJA 2HSMA 3HY2A 4BVYA 2H6XA 1O85A 4OFNA 2K9FA 3GIXA 2DSAA 1J9BA 19GSA 2H1BA 1TTZA 2F51A 3HDCA 2KP1A 3LXZA 4ECCA 2L5OA 2RUEA 5CNWA 3BBYA 3FMWA 1TP9A 3LORA 22GSA 3TOTA 5G30A 1FG4A 2YV9A 4GF0A 3EVIA 2IMEA 3WGDA 5GSTA 3UBKA 5D9TA 4XRAA 2MZCA 2VCXA 2EIRA 2O8VB 1ERWA 1K0AA 12GSA 2YANA 5D8IA 3VWVA 1R4WA 3PR8A 2HE3A 3O76A 5DCGA 3F63A 4L0WA 1PD21 2O87A 2B1KA 3VI7A 1ZMAA 2WGRA 2KP2A 4PUAA 1B4PA 3DGQA 2LTKA 5BMUA 1FB0A 1PX6A 1QXHA 1OVNA 4EL1A 3CTGA 1QGVA 4TR1A 3FK8A 4ID0A 2IMFA 2TIRA 3TUEA 4NV2A 4KDUA 1JZWA 3GL5A 2JADA 3F3RA 2HXKA 4YAPA 3CRTA 2O85A 4AJ8A 1SL0B 5DALA 1B48A 5JWRB 1BYEA 3VI5A 2EC4A 4K0NA 2IFQA 5IMZA 4CHSA 1T7PB 3N5OA 4GCIA 5DJMA 11GSA 5B6MA 2H75A 1QUWA 4NHZA 3GA4A 1FOHA 2JZSA 5A4UA 4ZB6A 1UA5A 3FR6A 3FRCA 1FO5A 3FZ4A 4POKA 3FKFA 1TJDA 4D73A 2ZNMA 1SYXA 3ME8A 3E3EA 2H73A 3GX8A 4PGTA 2JL4A 1A0FA 2CQ9A 4K1FA 3VLNA 1ZYEA 4USSA 2GT6A 3GH6A 4TKYA 5A4VA 3EINA 4RUVA 1DE2A 2C3NA 4ZL8A 3I9V2 4XHMA 3NZNA 1M0UA 1FVJA 1GSFA 3KXOA 2ES7A 2AB6A 3GL3A 3QAGA 3GRXA 1B9YC 2XC2A 2YOIA 2QA2A 1SU9A 3DD3A 3R2QA 2RUFA 4MP4A 4IP6A 2H72A 4N30A 2REMA 1EOGA 3W8SA 5ABRA 1X9WB 1CQHA 1ZYNA 2L59A 5G5FA 4MK3A 1R26A 1GTUA 4PQ1A 2X4AA 5ENUA 1TRUA 5EVOA 5G2ZA 5D9XA 2HYXA 1JHBA 1BX9A 2NPBA 4G10A 3Q6OA 1K0DA 4IGJA 1UC7A 3KP8A 5JCWA 2HRKA 2H76A 1T00A 3GH9A 5IOWA 4MH2A 1EP8A 5IMDA 3EU3A 3F4TA 3GTUA 1U87A 2HT9A 4GQCA 1T8EB 4XS1A 2ON7A 3EMXA 1FW1A 4Q5NA 4GLTA 3H93A 2H1GA 4G0IA 1XXUA 4OWYA 1GWCA 2GDRA 3Q18A 3ZZXA 2A2SA 5CO3A 4RI6A 1Z6MA 2P0GA 1OE8A 1AQWA 2FWGA 5F0GA 5KN0A 3OR5A 3ZITA 2D2ZA 2DJ0A 4GQFA 2DJJA 2GVPA 9GSSA 2JZTA 3L9UA 4JU5A 4O92A 3IRAA 1S3RA 4XS4A 5COHA 3RAZA 4HDEA 2GLRA 3QMXA 5DAKA 1HNBA 4YKFA 3TB2A 3FZ5A 3A2WA 4N0ZA 3HZ4A 2OBKA 5D96A 1O81A 1T1VA 2GSQA 3GUSA 1EOHA 3HYPA 2C0GA 4K2XA 2L4CA 2LJAA 2DBCA 1M3IA 4IBPA 2H74A 5H5QA 3LFLA 1GSUA 1GNEA 3PGTA 5AGYA 1M3JA 1MD3A 1GULA 2VD1A 4KGIA 2JSYA 3K8NA 1F3AA 3IDVA 5DBQA 10GSA 1PRXA 4PUFC 2TRCP 1U6TA 4JE1A 2BMXA 1K0NA 2VO4A 2NBSA 1YF1A 1SK1A 3Q19A 3HJMA 2IMDA 1S3AA 4IJIA 2WFCA 2BJXA 4F82A 2AV4A 3FR9A 3IAS2 4O7HA 1YQ1A 2PMTA 4HJMA 2KUCA 1UVZA 1ON4A 5HR0A 3DMLA 4IN0A 4WF4A 4YKGA 1JZDA 4KH7A 1RW1A 2IIYA 6GSUA 1TOFA 1GRXA 1G7OA 4MLYA 1NM3A 17GSA 5D9VA 1AUCA 1F2EA 3F9UA 1BAYA 2VCTA 1SK2A 3ZFBA 4ZB8A 4FYCA 1PKZA 4PTSA 3GNJA 4PNFA 3QAVA 1I9DA 4NAXA 2WDUA 2XBIA 3KTLA 5ECIB 4POMA 3EYTA 5H5SA 1YZXA 3KMNA 2PBJA 2OKAA 1TK0B 2WJUA 3A2VA 4KDXA 1R5PA 4ZBDA 1A2JA 1KBNA 3LW9A 4POBA 5ID2A 3L4NA 2LQQA 4L5OA 2IMKA 1LU4A 3CSIA 4G2EA 3US3A 4TXVA 2EIOA 2LRNA 5ECHB 2YNXA 1SL1B 1RQMA 2AJQB 1XG8A 1V9WA 1V58A 4DSSB 1GNWA 4KX4A 1X9SB 4ICYA 1E2YA 1K0OA 3BOAA 2FY6A 1B9XC 4ISDA 3M3MA 3VPTA 4E8EA 1V57A 1JZOA 2YN1A 4O5RA 3TJJA 1K3YA 2R0GA 1E6BA 1KNGA 2MBSA 2V6KA 3TCOA 1UN2A 5B8BA 5CRHA 3M1GA 1SJZA 2FNOA 1HD2A 1W4VA 5DAKB 3G7IA 1HNCA 2PUKC 1SYRA 2FA4A 4ML1A 1DUGA 2X99A 1A0RP 3Q74A 3TKRA 1O8WA 3CSHA 4MF7A 1ML6A 2YWIA 1T3BA 4A5PA 1SD8A 3FZ9A 2MYGA 1WE0A 5KEJA 2I3YA 5IPHA 3IHGA 4J56E 3GKMA 4V1Ap 1K0CA 3D4MA 3JCML 2TRXA 1MEKA 1M99A 1XCCA 1VF3A 1HQOA 6GSWA 3L78A 2DLXA 2VCQA 5G31A 2XPEA 5LNKe 1N8JA 1HNAA 4IELA 4IVFA 1PFOA 2GSSA 2DIYA 3G7JA 4TN8A 2HNLA 2R5GA 4HS1A 1ERTA 4YQUA 4MH3A 2XPDA 5GZZB 5IMCA 2GQMA 1AQVA 2GGTA 1YKCA 1V2AA 5DJLA 3R3EA 1TRVA 5IMAA 2B5YA 1X5DA 3LJRA 4HQSA 2IWTA 3BJ5A 3GYKA 3MDKA 3KCMA 1QMVA 3D5JA 1VF2A 4KSMA 4V1Ag 5BRTA 3RHBA 2FLSA 2MMNA 3VK9A 4LMWA 2H1AA 4WF5A 4WR5A 2QKEA 2LKUA 14GSA 3VWXA 4GSSA 4G0LA 1R7HA 3EPTA 2E7PA 4F0BA 1GSQA 2CV4A 4H86A 4DSQA 1OYJA 2LJKA 2HZFA 1GL8A 4LL4B 4FYBA 5A5KA 3IK9A 4MDCA 2A4HA 4V2NA 4ZBAA 3IK7A 1K0MA 1F37A 1EWXA 4MZWA 5IPGA 3KM6A 1SK0A 4K2DA 3QOUA 4F03A 1S3CA 1N2AA 2HZEA 4QL7A 2G2QA 5KOWA 1EP7A 2C80A 1T4YA 2KLXA 2C4JA 2R37A 3LXTA 1OC9B 4EC0A 2P31A 3UARA 2NVLA 5CYYA 1JLVA 2R6KA 3IOSA 5EY6A 2B7JA 1ZCPA 3KTBA 2XBQA 2PVQA 4MZBA 1WWJA 1CQGA 4OO5A 2VL2A 1ABAA 2LV3A 4EVMA 3IAM2 2B7KA 4AJ7A 2I1UA 3NIVA 4HOJA 3WD6A 3HVNA 2ZCTA 1OC3A 1XIYA 2CX4A 2OADA 1YDKA 4KAEA 2HSHA 4JR6A 3UJ1A 2PGTA 5ECOB 4TR0A 4ECIA 1F3BA 5HR3A 4K7NA 2ZUPA 1Z6NA 3LWAA 1YKAA 1FHEA 4X0XA 3E0UA 1IYIA 5HR1A 2CVDA 1GSSA 3FEUA 1HYUA 6GSXA 5KN3A 2M72A 4EKZA 5CRGA 4TXOA 4F0CA 4IS0A 5F8BA 2VCWA 3RBTA 3D4TA 4IP1A 5G5EA 2I9HA 3CMIA 3MWHA 2B6MA 4BL7A 3KZQA 3UOMA 4CW9A 2VL2C 2GTUA 3KH9A 4BVYB 3HVSA 3UAPA 3N9JA 4XIHA 3CQFA 4CY8A 2H6YA 4KNDA 1PKWA 1PGTA 5KN1A 2P5QA 4BVXA 1EGOA 4WETA 3HVVA 2LUSA 4PNGA 2L6DA 3I43A 3GKKA 3C1RA 3NOFA 1QFNA 2AAWA 1A2MA 1T4ZA 5J9BA 1WRYA 4Z2UA 5J41A 2LRTA 1YEPA 5ECQB 2AUVA 3DEXA 1FAAA 3F4SA 2K6VA 1XOAA 4RI7A 2FUG2 5KN2A 5DQYA 1GUHA 5DVBA 4I97A 4V2MA 3TRXA 4BIKA 1V98A 3QR6A 3H8QA 1JFUA 4MF5A 4TR1B 1Y25A 4PQIA 1GUKA 3RPNA 5IOXA 4GTUA 3EU4A 1SENA 2HRAA 2VL3A 4WR4A 2C3QA 3ZYWA 1NHOA 4LMVA 5ECNB 4BPYA 2I4AA 2C0FA 3M8NA 1RK4A 5A4WA 3HD5A 3TJGA 3TRQA 4PQHA 5DALB 3ZFLA 4MPFA 3I69A 1TI1A 2IFQB 2GSTA 4BA7A 2R0PA 2FWEA 2V6OA 1XW5A 5IM9A 2G0FA 1XW9A 4CY6A 1W89A 1TW9A 4DVCA 4FYUA 3EURA 1XWKA 1O73A 1U3IA 4FO5A 3TJKA 2R0CA 3M9KA 1YEXA 4ZBBA 1I5GA 2R3XA 4D73B 5IQYA 1GTAA 4HQZA 4JR4A 3U5RE 2YV7A 1V40A 2F9SA 2AHEA 1X5CA 3ME7A 4ZL9A 2RIIA 4HI7A 2X8HA 1A2LA 3KIJA 3IE3A 5AIXA 1NHYA 2FD3A 4TRXA 3A3TA 5F06A 2F8FA 5G1KA 2HLSA 2HRFA 4ACSA 1A8YA 1ZYQB 2XHFA 3LGCA 3GKXA 1J08A 1SKRB 1YJ6A 2KHPA 4EDYA 3EC3A 3ZVJD 1X5EA 3AY8A 5LCZA 3F0IA 2FGXA 3HCZA 2FWFA 3FHKA 4K0GA 3DVXA 3V1WA 4G9HA 2RM5A 1Y6EA 3PH9A 4BL7B 3CTFA 3EMPA 2O7KA 6GSVA 2DJ3A 1C72A 1DBYA 4MCUA 4OCFA 1SKWB 4KCEA 2GQKA 1O7UA 4CDOA 3FR3A 1BQ7A 3C71A 4ZXGA 2CT6A 2DMMA 3GHAA 5C00A 4GRFA 3P90A 4PURA 13GSA 4IKHA 2GQLA 5B8AA 4N11A 2HSYA 2M80A 3J7Yb 3UEMA 1K3LA 2H19A 2E2MA 2GT5A 4DSRA 2VIMA 3WT2A 2ALBA 2GZYA 3DRNA 3P8WA
chains in the Genus database with same CATH topology
2ON5A 4HZ2A 4Z7XA 1XWAA 3A5IA 3GTUB 3RPPA 1M9BA 1OC8A 1TDIA 3QFAC 3APQA 3ZIVA 3BCIA 3UBLA 5IMFA 4I2UA 4MJAA 5HFIA 4HZ4A 1SKSB 3D0ZA 3ERWA 1XVWA 5EPFA 1GSDA 2OJLA 5HFGA 2IJYA 1WPIA 2P5RA 4LA1A 4TR3A 2RLIA 3F3QA 3UMAA 4ZL7A 2LNTA 1TU7A 2X8CA 3DYRA 1Z9HA 2CZ3A 2LNSA 1G6WA 2FA8A 1A23A 1AXDA 1FB6A 2FWHA 5CRWA 2JZRA 3KGKA 2YWMA 1ILOA 1SL2B 4PX1A 1BG5A 4XS4B 4I8BA 2C0EA 1VGLA 3C7MA 3A2XA 2GS3A 4GXZA 2CAQA 2DMLA 3W6GA 1TXXA 3H1NA 3D6IA 4XRDA 5IO2A 4ILFA 3TOUA 1GTIA 2DJKA 3PINA 4JBBA 2MMOA 4MF6A 3PPUA 3CSJA 1WOUA 3H79A 2CA8A 3GSSA 2DJ2A 2VAFA 2YWOA 2M46A 3P7XA 4MJBA 3C73A 5EL8A 1MTCA 3UVTA 1ZYPA 4HUAA 2H01A 2HFDA 3CYNA 3GFKA 4NWYA 4AGSA 4EUYA 1JZRA 3D22A 3E9JB 1YY7A 1PA3A 3ZLPA 1DE1A 4EO3A 5E4WA 3UL3A 1PL2A 4OD7A 3MAKA 3TKPA 2A2PA 2DKHA 4WBRD 1X0RA 3ED3A 3L9VA 2B5EA 1XW6A 5F07A 6GSTA 2R4VA 1NSWA 2V2GA 1USBA 3DWVA 2NTOA 1TU8A 2OA7A 3DVWA 1GSEA 1PN0A 2MMZA 1THXA 1F9MA 1Z7RA 2LS5A 1PX7A 1OKTA 4IJ3A 5ECPB 1SD9A 4Z2RA 4KCAA 2LQOA 4NPBA 4Q5RA 3IHQA 4QQ7A 3ZL5A 1M9AA 2WRTA 3ZTLA 1K3OA 1XWGA 4I6XA 3QFBC 1EV4A 1AIUA 1Z5YE 2E2GA 2VCZA 4Z2TA 2N5BA 1ZOFA 3LYPA 1NW2A 4WBJA 3TKSA 1TK8B 1K0BA 4O32A 1MD4A 6GSSA 1KTEA 2PN8A 3GSTA 3J7Yk 1MDIA 4X1UA 4IW9A 3WGXA 5INYA 2DKIA 4OCEA 3VPQA 2YZHA 2H30A 4EE0A 4MJEA 3D21A 2PPTA 7GSSA 1SJIA 3SBCA 2PERA 5ID2B 1WP0A 4HEA2 1XOBA 2DIZA 4FIWA 3IR4A 3TKSE 3EWLA 2GSRA 1J0FA 1VRSD 1AW9A 5CAXA 4XCSA 4K6XA 2WZ9A 5IO0A 4E8HA 4KA0A 1BEDA 2NDOA 1Z7PA 2WS2A 4G0KA 4MMMA 5FWGA 2N5FA 2H66A 4HU7A 1SJ6A 2YWNA 3GV1A 3QD9A 1ACVA 2F3MA 1M2BA 5DDLA 5AN1A 2A2RA 3TRPA 5JWQB 2OE0A 3F6FA 2YJHA 3VWUA 2UZ8A 1PQNA 3MNGA 3TKSC 4YH2A 4BWQA 2QC7A 1XWBA 4WXTA 2V32A 5HR2A 2CAIA 3VWWA 2YP6A 2CVKA 1FVKA 3IV4A 2C0DA 3UIWA 5KOXA 2K18A 1XFLA 2B1LA 2YZUA 2LJRA 3C1SA 2H0HA 2YPMA 4LLRA 2MBTA 1KEBA 4QL9A 1TRWA 3L0HA 2VM1A 3DIEA 4TVEA 3LQ7A 5ECKB 4KB3A 1XVQA 2BTOT 1AAZA 2V1MA 3M0FA 5JCUA 4HJ2A 4LL1B 3G9BA 4K7IA 3IA1A 5G1LA 3KD0A 1B8XA 2WCIA 4EIQA 3CRUA 1EZKA 3UVHA 1OE7A 5GSSA 3TJFA 4EXJA 4V2LA 4O5UA 1H4OA 5DQSA 3S9FA 2L57A 4ML6A 3WT1A 2MMAA 3KMOA 3APSA 2IMIA 3TGZA 5J4UA 1U3AA 4X43A 3IC4A 4MA9A 3U6VA 5D9WA 3G7YA 2AYTA 4N0VA 4IHUA 3DKSA 5HQPA 4P3YB 5B7CA 5J9CA 3WYWA 2LSTA 4Q5FA 3GKNA 2I81A 3MYDA 3ZREA 2YJ7A 4KUNA 4OFMA 3F8UA 2IN3A 5J5NA 3P2AA 2PU9C 3MSZA 1Q4JA 3GX0A 4OFTA 1ERUA 3F6DA 5D73A 1TK5B 4K7OA 2CX3A 1QQ2A 1GTBA 2L6CA 1TKDB 4GSTA 2GZZA 1X9MB 2VD0A 1FOVA 1URMA 4NMUA 5IMVA 1EEMA 2DJ1A 2X49A 3GN3A 2J9HA 2FHEA 3CXGA 2H8LA 2L4QA 2HRNA 3VFIA 4MPGA 4L5LA 3KP9A 3VURA 3ZIJA 4DSSA 3QDNA 4XS6A 2HZEB 4G19A 4K9ZA 3IBHA 3DXBA 4JZQA 2PWJA 1ERVA 1Z3EA 2FCHA 2B3SA 2H70A 2OBIA 4L0UA 5FT3A 1G7EA 4EIPA 4YQMA 4KDYA 2E0QA 2WB9A 5J3RA 4FH8A 3CBUA 4TW5A 4O5QA 3L9SA 2X8GA 2VM2A 2VLTA 3ZRDA 5DCHA 1ZL9A 3HA9A 4FQUA 2RM6A 4MABA 4GWRA 5ECRB 1ST9A 4F9ZA 3KJYA 3APOA 4OO4A 2VL9A 4JEDA 1JLWA 3HJOA 5AIVA 2H0IA 5CRDA 3H4KA 4AF2A 4X4JA 4L8EA 2OE3A 5ELAA 1YF0A 3KEBA 4TR4A 1EEJA 2V41A 3A5WA 4AJ6A 1S3DA 8GSSA 5IIZA 5H5RA 1A24A 5LD0A 1M7TA 5GAPD 1WMJA 2VLUA 4Q5QA 3HHVA 2C1YA 2VOCA 1XPVA 3QPMA 2Z9SA 5JWOB 2KOKA 1VF1A 1G0TA 1GH2A 4TOPA 2GZPA 4ZB9A 5AISA 1WJKA 4MZCA 2C3TA 5F05A 4ECJA 4YAVA 3C8EA 1R5AA 3HZ8A 2QA1A 1DSBA 5CREA 2CZ2A 4KE3A 2PVOC 4TXOB 4EF0A 2N5AA 1TI3A 3LG6A 1G6YA 3ZVJA 4F2IA 2QGVA 3FY7A 2JACA 1XZOA 3QAWA 3ISOA 2B5XA 2K8SA 2YCDA 1GSYA 1O8XA 5FHIA 2O89A 4ECBA 4OMVA 3IXRA 4ULXA 2HI7A 4RQRA 5ECMB 2H71A 2LRCA 4ZILA 3FYGA 1M2DA 5D93A 2X64A 1OKDA 4IQ1A 16GSA 2OACA 1AQXA 4I2TA 3M9JA 4BVXB 3F4RA 2K8VA 4GSNA 1VF4A 4YQVA 2QSIA 5ELGA 3KH7A 6GSYA 3O6TA 3BD2A 3HKRA 1A8LA 3FW2A 2JSZA 4J2FA 2OE1A 5HFKA 3LEFA 1AC1A 1THOA 1PMTA 4KW6A 3LSZA 2F8AA 5GAND 4NXIA 3WGEA 1Q98A 2R2JA 3MIXA 1TRSA 1GP1A 1BJXA 3O3TA 3ERFA 2H0GA 3TDGA 4MJCA 1XWCA 2L5LA 3RDWA 2H1DA 4KF9A 3SWLA 1XBSA 20GSA 1GLQA 1ZGNA 2IPAA 5ECSA 2J23A 18GSA 2VCVA 3ZMKA 5E59A 4POLA 1GUMA 1EGRA 2IL3A 1OC9A 1F6MC 3GURA 3HXSA 2VUPA 5JCGA 4WEYA 4K5RA 1LBKA 1PN9A 4J57E 4N10A 2CVBA 4WKWA 3TJBA 3FZAA 2C8UA 4DEJA 4IQAA 1WIKA 4MNNA 1QK8A 3BCKA 4HU9A 4PXOA 3IC8A 2WULA 1GLPA 1B4QA 4EDZA 1PL1A 1H75A 4K5SA 1PSQA 4JRRA 1OAZA 5ECLB 2H6ZA 3GMFA 1O6JA 4KSOA 3QCPA 5L71A 4NHWA 4XTSA 3TKQA 3ZMLA 1LJRA 1EV9A 1MDKA 5CP1A 5C04A 1IYHA 2A4VA 5B6NA 3ERGA 2EIQA 3I6AA 3EE2A 3W8JA 3LYKA 3HJPA 1MDJA 4BWSA 4RQXA 2JU5A 2LEGA 1M2AA 1ZZYA 4I5QA 4NV5A 3IPZA 3HVXA 1U88A 4K8MA 2DC5A 2VLVA 3RHCA 4ZIJA 2HSMA 3HY2A 4BVYA 2H6XA 1O85A 4OFNA 2K9FA 3GIXA 2DSAA 1J9BA 19GSA 2H1BA 1TTZA 2F51A 3HDCA 2KP1A 3LXZA 4ECCA 2L5OA 2RUEA 5CNWA 3BBYA 3FMWA 1TP9A 3LORA 22GSA 3TOTA 5G30A 1FG4A 2YV9A 4GF0A 3EVIA 2IMEA 3WGDA 5GSTA 3UBKA 5D9TA 4XRAA 2MZCA 2VCXA 2EIRA 2O8VB 1ERWA 1K0AA 12GSA 2YANA 5D8IA 3VWVA 1R4WA 3PR8A 2HE3A 3O76A 5DCGA 3F63A 4L0WA 1PD21 2O87A 2B1KA 3VI7A 1ZMAA 2WGRA 2KP2A 4PUAA 1B4PA 3DGQA 2LTKA 5BMUA 1FB0A 1PX6A 1QXHA 1OVNA 4EL1A 3CTGA 1QGVA 4TR1A 3FK8A 4ID0A 2IMFA 2TIRA 3TUEA 4NV2A 4KDUA 1JZWA 3GL5A 2JADA 3F3RA 2HXKA 4YAPA 3CRTA 2O85A 4AJ8A 1SL0B 5DALA 1B48A 5JWRB 1BYEA 3VI5A 2EC4A 4K0NA 2IFQA 5IMZA 4CHSA 1T7PB 3N5OA 4GCIA 5DJMA 11GSA 5B6MA 2H75A 1QUWA 4NHZA 3GA4A 1FOHA 2JZSA 5A4UA 4ZB6A 1UA5A 3FR6A 3FRCA 1FO5A 3FZ4A 4POKA 3FKFA 1TJDA 4D73A 2ZNMA 1SYXA 3ME8A 3E3EA 2H73A 3GX8A 4PGTA 2JL4A 1A0FA 2CQ9A 4K1FA 3VLNA 1ZYEA 4USSA 2GT6A 3GH6A 4TKYA 5A4VA 3EINA 4RUVA 1DE2A 2C3NA 4ZL8A 3I9V2 4XHMA 3NZNA 1M0UA 1FVJA 1GSFA 3KXOA 2ES7A 2AB6A 3GL3A 3QAGA 3GRXA 1B9YC 2XC2A 2YOIA 2QA2A 1SU9A 3DD3A 3R2QA 2RUFA 4MP4A 4IP6A 2H72A 4N30A 2REMA 1EOGA 3W8SA 5ABRA 1X9WB 1CQHA 1ZYNA 2L59A 5G5FA 4MK3A 1R26A 1GTUA 4PQ1A 2X4AA 5ENUA 1TRUA 5EVOA 5G2ZA 5D9XA 2HYXA 1JHBA 1BX9A 2NPBA 4G10A 3Q6OA 1K0DA 4IGJA 1UC7A 3KP8A 5JCWA 2HRKA 2H76A 1T00A 3GH9A 5IOWA 4MH2A 1EP8A 5IMDA 3EU3A 3F4TA 3GTUA 1U87A 2HT9A 4GQCA 1T8EB 4XS1A 2ON7A 3EMXA 1FW1A 4Q5NA 4GLTA 3H93A 2H1GA 4G0IA 1XXUA 4OWYA 1GWCA 2GDRA 3Q18A 3ZZXA 2A2SA 5CO3A 4RI6A 1Z6MA 2P0GA 1OE8A 1AQWA 2FWGA 5F0GA 5KN0A 3OR5A 3ZITA 2D2ZA 2DJ0A 4GQFA 2DJJA 2GVPA 9GSSA 2JZTA 3L9UA 4JU5A 4O92A 3IRAA 4XS4A 5COHA 3RAZA 4HDEA 2GLRA 3QMXA 5DAKA 1HNBA 4YKFA 3TB2A 3FZ5A 3A2WA 4N0ZA 3HZ4A 2OBKA 5D96A 1O81A 1T1VA 2GSQA 3GUSA 1EOHA 3HYPA 2C0GA 4K2XA 2L4CA 2LJAA 2DBCA 4IBPA 2H74A 5H5QA 3LFLA 1GSUA 1GNEA 3PGTA 5AGYA 1MD3A 1GULA 2VD1A 4KGIA 2JSYA 3K8NA 1F3AA 3IDVA 5DBQA 10GSA 1PRXA 4PUFC 2TRCP 1U6TA 4JE1A 2BMXA 1K0NA 2VO4A 2NBSA 1YF1A 1SK1A 3Q19A 3HJMA 2IMDA 1S3AA 4IJIA 2WFCA 2BJXA 4F82A 2AV4A 3FR9A 3IAS2 4O7HA 1YQ1A 2PMTA 4HJMA 2KUCA 1UVZA 1ON4A 5HR0A 3DMLA 4IN0A 4WF4A 4YKGA 1JZDA 4KH7A 1RW1A 2IIYA 6GSUA 1TOFA 1GRXA 1G7OA 4MLYA 1NM3A 17GSA 5D9VA 1AUCA 1F2EA 3F9UA 1BAYA 2VCTA 1SK2A 3ZFBA 4ZB8A 4FYCA 1PKZA 4PTSA 3GNJA 4PNFA 3QAVA 1I9DA 4NAXA 2WDUA 2XBIA 3KTLA 5ECIB 4POMA 3EYTA 5H5SA 1YZXA 3KMNA 2PBJA 2OKAA 1TK0B 2WJUA 3A2VA 4KDXA 1R5PA 4ZBDA 1A2JA 1KBNA 3LW9A 4POBA 5ID2A 3L4NA 2LQQA 4L5OA 2IMKA 1LU4A 3CSIA 4G2EA 3US3A 4TXVA 2EIOA 2LRNA 5ECHB 2YNXA 1SL1B 1RQMA 2AJQB 1V9WA 1V58A 4DSSB 1GNWA 4KX4A 1X9SB 4ICYA 1E2YA 1K0OA 3BOAA 2FY6A 1B9XC 4ISDA 3M3MA 3VPTA 4E8EA 1V57A 1JZOA 2YN1A 4O5RA 3TJJA 1K3YA 2R0GA 1E6BA 1KNGA 2MBSA 2V6KA 3TCOA 1UN2A 5B8BA 5CRHA 3M1GA 1SJZA 2FNOA 1HD2A 1W4VA 5DAKB 3G7IA 1HNCA 2PUKC 1SYRA 2FA4A 4ML1A 1DUGA 2X99A 1A0RP 3Q74A 3TKRA 1O8WA 3CSHA 4MF7A 1ML6A 2YWIA 1T3BA 4A5PA 1SD8A 3FZ9A 2MYGA 1WE0A 5KEJA 2I3YA 5IPHA 3IHGA 4J56E 3GKMA 4V1Ap 1K0CA 3D4MA 3JCML 2TRXA 1MEKA 1M99A 1XCCA 1VF3A 1HQOA 6GSWA 3L78A 2DLXA 2VCQA 5G31A 2XPEA 5LNKe 1N8JA 1HNAA 4IELA 4IVFA 2GSSA 2DIYA 3G7JA 4TN8A 2HNLA 2R5GA 4HS1A 1ERTA 4YQUA 4MH3A 2XPDA 5GZZB 5IMCA 2GQMA 1AQVA 2GGTA 1YKCA 1V2AA 5DJLA 3R3EA 1TRVA 5IMAA 2B5YA 1X5DA 3LJRA 4HQSA 2IWTA 3BJ5A 3GYKA 3MDKA 3KCMA 1QMVA 3D5JA 1VF2A 4KSMA 4V1Ag 5BRTA 3RHBA 2FLSA 2MMNA 3VK9A 4LMWA 2H1AA 4WF5A 4WR5A 2QKEA 2LKUA 14GSA 3VWXA 4GSSA 4G0LA 1R7HA 3EPTA 2E7PA 4F0BA 1GSQA 2CV4A 4H86A 4DSQA 1OYJA 2LJKA 2HZFA 1GL8A 4LL4B 4FYBA 5A5KA 3IK9A 4MDCA 2A4HA 4V2NA 4ZBAA 3IK7A 1K0MA 1F37A 1EWXA 4MZWA 5IPGA 3KM6A 1SK0A 4K2DA 3QOUA 4F03A 1S3CA 1N2AA 2HZEA 4QL7A 2G2QA 5KOWA 1EP7A 2C80A 1T4YA 2KLXA 2C4JA 2R37A 3LXTA 1OC9B 4EC0A 2P31A 3UARA 2NVLA 5CYYA 1JLVA 2R6KA 3IOSA 5EY6A 2B7JA 1ZCPA 3KTBA 2XBQA 2PVQA 4MZBA 1WWJA 1CQGA 4OO5A 2VL2A 1ABAA 2LV3A 4EVMA 3IAM2 2B7KA 4AJ7A 2I1UA 3NIVA 4HOJA 3WD6A 2ZCTA 1OC3A 1XIYA 2CX4A 2OADA 1YDKA 4KAEA 2HSHA 4JR6A 3UJ1A 2PGTA 5ECOB 4TR0A 4ECIA 1F3BA 5HR3A 4K7NA 2ZUPA 1Z6NA 3LWAA 1YKAA 1FHEA 4X0XA 3E0UA 1IYIA 5HR1A 2CVDA 1GSSA 3FEUA 1HYUA 6GSXA 5KN3A 2M72A 4EKZA 5CRGA 4TXOA 4F0CA 4IS0A 5F8BA 2VCWA 3RBTA 3D4TA 4IP1A 5G5EA 2I9HA 3CMIA 3MWHA 2B6MA 4BL7A 3KZQA 3UOMA 4CW9A 2VL2C 2GTUA 3KH9A 4BVYB 3HVSA 3UAPA 3N9JA 4XIHA 4CY8A 2H6YA 4KNDA 1PKWA 1PGTA 5KN1A 2P5QA 4BVXA 1EGOA 4WETA 3HVVA 2LUSA 4PNGA 2L6DA 3I43A 3GKKA 3C1RA 3NOFA 1QFNA 2AAWA 1A2MA 1T4ZA 5J9BA 1WRYA 4Z2UA 5J41A 2LRTA 1YEPA 5ECQB 2AUVA 3DEXA 1FAAA 3F4SA 2K6VA 1XOAA 4RI7A 2FUG2 5KN2A 5DQYA 1GUHA 5DVBA 4I97A 4V2MA 3TRXA 1V98A 3QR6A 3H8QA 1JFUA 4MF5A 4TR1B 1Y25A 4PQIA 1GUKA 3RPNA 5IOXA 4GTUA 3EU4A 1SENA 2HRAA 2VL3A 4WR4A 2C3QA 3ZYWA 1NHOA 4LMVA 5ECNB 4BPYA 2I4AA 2C0FA 3M8NA 1RK4A 5A4WA 3HD5A 3TJGA 3TRQA 4PQHA 5DALB 3ZFLA 4MPFA 3I69A 1TI1A 2IFQB 2GSTA 4BA7A 2R0PA 2FWEA 2V6OA 1XW5A 5IM9A 2G0FA 1XW9A 4CY6A 1W89A 1TW9A 4DVCA 4FYUA 3EURA 1XWKA 1O73A 1U3IA 4FO5A 3TJKA 2R0CA 3M9KA 1YEXA 4ZBBA 1I5GA 2R3XA 4D73B 5IQYA 1GTAA 4HQZA 4JR4A 3U5RE 2YV7A 1V40A 2F9SA 2AHEA 1X5CA 3ME7A 4ZL9A 2RIIA 4HI7A 2X8HA 1A2LA 3KIJA 3IE3A 5AIXA 1NHYA 2FD3A 4TRXA 3A3TA 5F06A 2F8FA 5G1KA 2HLSA 2HRFA 4ACSA 1A8YA 1ZYQB 2XHFA 3LGCA 3GKXA 1J08A 1SKRB 1YJ6A 2KHPA 4EDYA 3EC3A 3ZVJD 1X5EA 3AY8A 5LCZA 3F0IA 2FGXA 3HCZA 2FWFA 3FHKA 4K0GA 3DVXA 3V1WA 4G9HA 2RM5A 1Y6EA 3PH9A 4BL7B 3CTFA 3EMPA 2O7KA 6GSVA 2DJ3A 1C72A 1DBYA 4MCUA 4OCFA 1SKWB 4KCEA 2GQKA 1O7UA 4CDOA 3FR3A 1BQ7A 3C71A 4ZXGA 2CT6A 2DMMA 3GHAA 5C00A 4GRFA 3P90A 13GSA 4PURA 4IKHA 2GQLA 5B8AA 4N11A 2HSYA 2M80A 3J7Yb 3UEMA 1K3LA 2H19A 2E2MA 2GT5A 4DSRA 2VIMA 3WT2A 2ALBA 2GZYA 3DRNA 3P8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ON5 A;  4HZ2 A;  4Z7X A;  1XWA A;  3GTU B;  3RPP A;  1M9B A;  1OC8 A;  1TDI A;  3QFA C;  3APQ A;  3ZIV A;  3BCI A;  3UBL A;  5IMF A;  4I2U A;  4MJA A;  5HFI A;  4HZ4 A;  1SKS B;  3D0Z A;  3ERW A;  1XVW A;  5EPF A;  1GSD A;  2OJL A;  5HFG A;  2IJY A;  1WPI A;  2P5R A;  4LA1 A;  4TR3 A;  2RLI A;  3F3Q A;  3UMA A;  4ZL7 A;  2LNT A;  1TU7 A;  2X8C A;  3DYR A;  1Z9H A;  2CZ3 A;  2LNS A;  1G6W A;  2FA8 A;  1A23 A;  1AXD A;  1FB6 A;  2FWH A;  5CRW A;  2JZR A;  3KGK A;  2YWM A;  1ILO A;  1SL2 B;  4PX1 A;  1BG5 A;  4XS4 B;  4I8B A;  2C0E A;  1VGL A;  3C7M A;  3A2X A;  2GS3 A;  4GXZ A;  2CAQ A;  2DML A;  3W6G A;  1TXX A;  3H1N A;  3D6I A;  4XRD A;  5IO2 A;  4ILF A;  3TOU A;  1GTI A;  2DJK A;  3PIN A;  4JBB A;  2MMO A;  4MF6 A;  3CSJ A;  1WOU A;  3H79 A;  2CA8 A;  3GSS A;  2DJ2 A;  2VAF A;  2YWO A;  2M46 A;  3P7X A;  4MJB A;  3C73 A;  5EL8 A;  1MTC A;  3UVT A;  4HUA A;  2H01 A;  2HFD A;  3CYN A;  3GFK A;  4NWY A;  4AGS A;  4EUY A;  1JZR A;  3D22 A;  3E9J B;  1YY7 A;  1PA3 A;  3ZLP A;  1DE1 A;  4EO3 A;  5E4W A;  3UL3 A;  1PL2 A;  4OD7 A;  3MAK A;  3TKP A;  4WBR D;  1X0R A;  3ED3 A;  3L9V A;  2B5E A;  1XW6 A;  5F07 A;  6GST A;  2R4V A;  1NSW A;  2V2G A;  1USB A;  3DWV A;  2NTO A;  1TU8 A;  2OA7 A;  3DVW A;  1GSE A;  2MMZ A;  1THX A;  1F9M A;  1Z7R A;  2LS5 A;  1PX7 A;  1OKT A;  4IJ3 A;  5ECP B;  1SD9 A;  4KCA A;  2LQO A;  4NPB A;  4Q5R A;  3IHQ A;  4QQ7 A;  3ZL5 A;  1M9A A;  2WRT A;  3ZTL A;  1K3O A;  1XWG A;  4I6X A;  3QFB C;  1EV4 A;  1AIU A;  1Z5Y E;  2E2G A;  2VCZ A;  2N5B A;  1ZOF A;  3LYP A;  1NW2 A;  4WBJ A;  3TKS A;  1TK8 B;  1K0B A;  4O32 A;  1MD4 A;  6GSS A;  1KTE A;  2PN8 A;  3GST A;  3J7Y k;  1MDI A;  4X1U A;  4IW9 A;  3WGX A;  5INY A;  4OCE A;  3VPQ A;  2YZH A;  2H30 A;  4EE0 A;  4MJE A;  3D21 A;  2PPT A;  7GSS A;  1SJI A;  3SBC A;  2PER A;  5ID2 B;  1WP0 A;  4HEA 2;  1XOB A;  2DIZ A;  4FIW A;  3IR4 A;  3TKS E;  3EWL A;  2GSR A;  1J0F A;  1VRS D;  1AW9 A;  5CAX A;  4XCS A;  4K6X A;  2WZ9 A;  5IO0 A;  4E8H A;  4KA0 A;  1BED A;  2NDO A;  1Z7P A;  2WS2 A;  4MMM A;  5FWG A;  2N5F A;  2H66 A;  4HU7 A;  1SJ6 A;  2YWN A;  3GV1 A;  3QD9 A;  1ACV A;  2F3M A;  1M2B A;  5DDL A;  5AN1 A;  2A2R A;  3TRP A;  5JWQ B;  2OE0 A;  3F6F A;  2YJH A;  3VWU A;  1PQN A;  3MNG A;  3TKS C;  4YH2 A;  4BWQ A;  2QC7 A;  1XWB A;  4WXT A;  2V32 A;  5HR2 A;  2CAI A;  3VWW A;  2YP6 A;  2CVK A;  1FVK A;  3IV4 A;  2C0D A;  3UIW A;  2K18 A;  1XFL A;  2B1L A;  2YZU A;  2LJR A;  3C1S A;  2H0H A;  2YPM A;  4LLR A;  2MBT A;  1KEB A;  4QL9 A;  1TRW A;  3L0H A;  2VM1 A;  3DIE A;  4TVE A;  3LQ7 A;  5ECK B;  4KB3 A;  1XVQ A;  2BTO T;  1AAZ A;  2V1M A;  3M0F A;  5JCU A;  4HJ2 A;  4LL1 B;  3G9B A;  4K7I A;  3IA1 A;  5G1L A;  3KD0 A;  1B8X A;  2WCI A;  3CRU A;  1EZK A;  3UVH A;  1OE7 A;  5GSS A;  3TJF A;  4EXJ A;  4V2L A;  1H4O A;  5DQS A;  3S9F A;  2L57 A;  4ML6 A;  3WT1 A;  2MMA A;  3KMO A;  3APS A;  2IMI A;  3TGZ A;  5J4U A;  1U3A A;  4X43 A;  3IC4 A;  4MA9 A;  3U6V A;  5D9W A;  3G7Y A;  2AYT A;  4N0V A;  4IHU A;  3DKS A;  5HQP A;  4P3Y B;  5B7C A;  5J9C A;  3WYW A;  2LST A;  3GKN A;  4Q5F A;  2I81 A;  3ZRE A;  2YJ7 A;  4KUN A;  4OFM A;  3F8U A;  2IN3 A;  5J5N A;  3P2A A;  2PU9 C;  3MSZ A;  1Q4J A;  3GX0 A;  4OFT A;  1ERU A;  3F6D A;  5D73 A;  1TK5 B;  4K7O A;  2CX3 A;  1QQ2 A;  1GTB A;  2L6C A;  1TKD B;  4GST A;  2GZZ A;  1X9M B;  2VD0 A;  1FOV A;  1URM A;  4NMU A;  5IMV A;  1EEM A;  2DJ1 A;  3GN3 A;  2J9H A;  2FHE A;  3CXG A;  2H8L A;  2L4Q A;  2HRN A;  3VFI A;  4MPG A;  4L5L A;  3KP9 A;  3VUR A;  3ZIJ A;  4DSS A;  3QDN A;  4XS6 A;  2HZE B;  4G19 A;  4K9Z A;  3IBH A;  3DXB A;  4JZQ A;  2PWJ A;  1ERV A;  1Z3E A;  2FCH A;  2B3S A;  2H70 A;  2OBI A;  4L0U A;  5FT3 A;  1G7E A;  4YQM A;  4KDY A;  2E0Q A;  2WB9 A;  5J3R A;  4FH8 A;  3CBU A;  4TW5 A;  3L9S A;  2X8G A;  2VM2 A;  2VLT A;  3ZRD A;  5DCH A;  1ZL9 A;  3HA9 A;  2RM6 A;  4MAB A;  4GWR A;  5ECR B;  1ST9 A;  4F9Z A;  3KJY A;  3APO A;  4OO4 A;  2VL9 A;  4JED A;  1JLW A;  3HJO A;  5AIV A;  2H0I A;  5CRD A;  3H4K A;  4AF2 A;  4L8E A;  2OE3 A;  5ELA A;  1YF0 A;  3KEB A;  4TR4 A;  1EEJ A;  2V41 A;  3A5W A;  4AJ6 A;  1S3D A;  8GSS A;  5IIZ A;  5H5R A;  1A24 A;  5LD0 A;  1M7T A;  5GAP D;  1WMJ A;  2VLU A;  4Q5Q A;  3HHV A;  2C1Y A;  2VOC A;  1XPV A;  3QPM A;  2Z9S A;  5JWO B;  2KOK A;  1VF1 A;  1G0T A;  1GH2 A;  4TOP A;  2GZP A;  4ZB9 A;  5AIS A;  1WJK A;  4MZC A;  2C3T A;  5F05 A;  4ECJ A;  4YAV A;  3C8E A;  1R5A A;  3HZ8 A;  1DSB A;  5CRE A;  2CZ2 A;  4KE3 A;  2PVO C;  4TXO B;  4EF0 A;  2N5A A;  1TI3 A;  3LG6 A;  1G6Y A;  3ZVJ A;  4F2I A;  2QGV A;  3FY7 A;  2JAC A;  1XZO A;  3QAW A;  3ISO A;  2B5X A;  2K8S A;  2YCD A;  1GSY A;  1O8X A;  5FHI A;  2O89 A;  4ECB A;  4OMV A;  3IXR A;  4ULX A;  2HI7 A;  4RQR A;  5ECM B;  2H71 A;  2LRC A;  4ZIL A;  3FYG A;  1M2D A;  5D93 A;  2X64 A;  1OKD A;  4IQ1 A;  16GS A;  2OAC A;  1AQX A;  4I2T A;  3M9J A;  3F4R A;  2K8V A;  4GSN A;  1VF4 A;  4YQV A;  2QSI A;  5ELG A;  3KH7 A;  6GSY A;  3O6T A;  3BD2 A;  3HKR A;  1A8L A;  3FW2 A;  2JSZ A;  4J2F A;  2OE1 A;  5HFK A;  3LEF A;  1AC1 A;  1THO A;  1PMT A;  4KW6 A;  3LSZ A;  2F8A A;  5GAN D;  4NXI A;  3WGE A;  1Q98 A;  2R2J A;  1TRS A;  1GP1 A;  1BJX A;  3O3T A;  3ERF A;  2H0G A;  3TDG A;  4MJC A;  1XWC A;  2L5L A;  3RDW A;  2H1D A;  3SWL A;  1XBS A;  20GS A;  1GLQ A;  1ZGN A;  2IPA A;  5ECS A;  2J23 A;  18GS A;  2VCV A;  3ZMK A;  5E59 A;  4POL A;  1GUM A;  1EGR A;  2IL3 A;  1OC9 A;  1F6M C;  3GUR A;  3HXS A;  2VUP A;  5JCG A;  4WEY A;  1LBK A;  1PN9 A;  4J57 E;  4N10 A;  2CVB A;  4WKW A;  3TJB A;  3FZA A;  2C8U A;  4DEJ A;  4IQA A;  1WIK A;  1QK8 A;  3BCK A;  4HU9 A;  4PXO A;  2WUL A;  1GLP A;  1B4Q A;  4EDZ A;  1PL1 A;  1H75 A;  1PSQ A;  4JRR A;  1OAZ A;  5ECL B;  2H6Z A;  3GMF A;  1O6J A;  4KSO A;  3QCP A;  5L71 A;  4NHW A;  4XTS A;  3TKQ A;  3ZML A;  1LJR A;  1EV9 A;  1MDK A;  5CP1 A;  5C04 A;  1IYH A;  2A4V A;  5B6N A;  3ERG A;  2EIQ A;  3I6A A;  3EE2 A;  3W8J A;  3LYK A;  3HJP A;  1MDJ A;  4BWS A;  4RQX A;  2JU5 A;  2LEG A;  1M2A A;  1ZZY A;  4I5Q A;  4NV5 A;  3IPZ A;  3HVX A;  1U88 A;  4K8M A;  2DC5 A;  2VLV A;  3RHC A;  4ZIJ A;  3HY2 A;  4BVY A;  2H6X A;  1O85 A;  4OFN A;  2K9F A;  3GIX A;  2DSA A;  1J9B A;  19GS A;  2H1B A;  1TTZ A;  2F51 A;  3HDC A;  2KP1 A;  3LXZ A;  4ECC A;  2L5O A;  2RUE A;  5CNW A;  3BBY A;  3LOR A;  1TP9 A;  22GS A;  3TOT A;  5G30 A;  1FG4 A;  2YV9 A;  4GF0 A;  3EVI A;  2IME A;  3WGD A;  5GST A;  3UBK A;  5D9T A;  4XRA A;  2MZC A;  2VCX A;  2EIR A;  2O8V B;  1ERW A;  1K0A A;  12GS A;  2YAN A;  5D8I A;  3VWV A;  1R4W A;  3PR8 A;  2HE3 A;  3O76 A;  5DCG A;  3F63 A;  4L0W A;  1PD2 1;  2O87 A;  2B1K A;  3VI7 A;  1ZMA A;  2WGR A;  2KP2 A;  4PUA A;  1B4P A;  3DGQ A;  2LTK A;  1FB0 A;  1PX6 A;  1QXH A;  1OVN A;  4EL1 A;  3CTG A;  1QGV A;  4TR1 A;  3FK8 A;  4ID0 A;  2IMF A;  2TIR A;  3TUE A;  4NV2 A;  4KDU A;  1JZW A;  3GL5 A;  2JAD A;  3F3R A;  2HXK A;  4YAP A;  3CRT A;  2O85 A;  4AJ8 A;  1SL0 B;  5DAL A;  1B48 A;  5JWR B;  1BYE A;  3VI5 A;  2EC4 A;  4K0N A;  2IFQ A;  5IMZ A;  4CHS A;  1T7P B;  3N5O A;  4GCI A;  5DJM A;  11GS A;  5B6M A;  2H75 A;  1QUW A;  4NHZ A;  3GA4 A;  2JZS A;  5A4U A;  4ZB6 A;  1UA5 A;  3FR6 A;  3FRC A;  1FO5 A;  3FZ4 A;  4POK A;  3FKF A;  1TJD A;  4D73 A;  2ZNM A;  1SYX A;  3ME8 A;  3E3E A;  2H73 A;  3GX8 A;  4PGT A;  2JL4 A;  1A0F A;  2CQ9 A;  4K1F A;  3VLN A;  1ZYE A;  2GT6 A;  3GH6 A;  4TKY A;  5A4V A;  3EIN A;  4RUV A;  1DE2 A;  2C3N A;  4ZL8 A;  3I9V 2;  4XHM A;  3NZN A;  1M0U A;  1FVJ A;  1GSF A;  3KXO A;  2ES7 A;  2AB6 A;  3GL3 A;  3QAG A;  3GRX A;  1B9Y C;  2XC2 A;  2YOI A;  1SU9 A;  3DD3 A;  3R2Q A;  2RUF A;  4MP4 A;  4IP6 A;  2H72 A;  4N30 A;  2REM A;  1EOG A;  3W8S A;  5ABR A;  1X9W B;  1CQH A;  2L59 A;  5G5F A;  4MK3 A;  1R26 A;  1GTU A;  4PQ1 A;  5ENU A;  1TRU A;  5EVO A;  5G2Z A;  5D9X A;  2HYX A;  1JHB A;  1BX9 A;  2NPB A;  4G10 A;  3Q6O A;  1K0D A;  4IGJ A;  1UC7 A;  3KP8 A;  5JCW A;  2H76 A;  1T00 A;  3GH9 A;  5IOW A;  4MH2 A;  1EP8 A;  5IMD A;  3EU3 A;  3F4T A;  3GTU A;  1U87 A;  2HT9 A;  4GQC A;  1T8E B;  4XS1 A;  2ON7 A;  3EMX A;  1FW1 A;  4Q5N A;  4GLT A;  3H93 A;  2H1G A;  1XXU A;  4OWY A;  1GWC A;  2GDR A;  3Q18 A;  3ZZX A;  2A2S A;  5CO3 A;  4RI6 A;  1Z6M A;  2P0G A;  1OE8 A;  1AQW A;  2FWG A;  5F0G A;  5KN0 A;  3OR5 A;  3ZIT A;  2D2Z A;  2DJ0 A;  4GQF A;  2DJJ A;  2GVP A;  9GSS A;  2JZT A;  3L9U A;  4JU5 A;  4O92 A;  3IRA A;  4XS4 A;  5COH A;  3RAZ A;  4HDE A;  2GLR A;  3QMX A;  5DAK A;  1HNB A;  3TB2 A;  3FZ5 A;  3A2W A;  4N0Z A;  3HZ4 A;  2OBK A;  5D96 A;  1O81 A;  1T1V A;  2GSQ A;  3GUS A;  1EOH A;  3HYP A;  2C0G A;  2L4C A;  2LJA A;  2DBC A;  4IBP A;  2H74 A;  5H5Q A;  3LFL A;  1GSU A;  1GNE A;  3PGT A;  5AGY A;  1MD3 A;  1GUL A;  2VD1 A;  4KGI A;  2JSY A;  3K8N A;  1F3A A;  3IDV A;  5DBQ A;  10GS A;  1PRX A;  4PUF C;  2TRC P;  1U6T A;  4JE1 A;  2BMX A;  1K0N A;  2VO4 A;  2NBS A;  1YF1 A;  1SK1 A;  3Q19 A;  3HJM A;  2IMD A;  1S3A A;  4IJI A;  2WFC A;  2BJX A;  4F82 A;  2AV4 A;  3FR9 A;  3IAS 2;  4O7H A;  1YQ1 A;  2PMT A;  4HJM A;  2KUC A;  1UVZ A;  1ON4 A;  5HR0 A;  3DML A;  4IN0 A;  4WF4 A;  1JZD A;  4KH7 A;  1RW1 A;  2IIY A;  6GSU A;  1TOF A;  1GRX A;  1G7O A;  4MLY A;  1NM3 A;  17GS A;  5D9V A;  1AUC A;  1F2E A;  3F9U A;  1BAY A;  2VCT A;  1SK2 A;  3ZFB A;  4ZB8 A;  4FYC A;  1PKZ A;  3GNJ A;  4PNF A;  3QAV A;  1I9D A;  4NAX A;  2WDU A;  2XBI A;  3KTL A;  5ECI B;  4POM A;  3EYT A;  5H5S A;  1YZX A;  3KMN A;  2PBJ A;  2OKA A;  1TK0 B;  2WJU A;  3A2V A;  4KDX A;  1R5P A;  4ZBD A;  1A2J A;  1KBN A;  4POB A;  5ID2 A;  3L4N A;  2LQQ A;  4L5O A;  2IMK A;  1LU4 A;  3CSI A;  4G2E A;  3US3 A;  4TXV A;  2EIO A;  2LRN A;  5ECH B;  2YNX A;  1SL1 B;  1RQM A;  2AJQ B;  1V9W A;  1V58 A;  4DSS B;  1GNW A;  4KX4 A;  1X9S B;  1E2Y A;  1K0O A;  3BOA A;  2FY6 A;  1B9X C;  4ISD A;  3M3M A;  3VPT A;  4E8E A;  1V57 A;  1JZO A;  2YN1 A;  4O5R A;  3TJJ A;  1K3Y A;  1E6B A;  1KNG A;  2MBS A;  2V6K A;  3TCO A;  1UN2 A;  5B8B A;  5CRH A;  3M1G A;  1SJZ A;  2FNO A;  1HD2 A;  1W4V A;  5DAK B;  3G7I A;  1HNC A;  2PUK C;  1SYR A;  2FA4 A;  4ML1 A;  1DUG A;  2X99 A;  1A0R P;  3Q74 A;  3TKR A;  1O8W A;  3CSH A;  4MF7 A;  1ML6 A;  2YWI A;  1T3B A;  1SD8 A;  3FZ9 A;  2MYG A;  1WE0 A;  5KEJ A;  2I3Y A;  5IPH A;  4J56 E;  3GKM A;  4V1A p;  1K0C A;  3D4M A;  3JCM L;  2TRX A;  1MEK A;  1M99 A;  1XCC A;  1VF3 A;  1HQO A;  6GSW A;  3L78 A;  2DLX A;  2VCQ A;  5G31 A;  2XPE A;  5LNK e;  1N8J A;  1HNA A;  4IEL A;  4IVF A;  2GSS A;  2DIY A;  3G7J A;  4TN8 A;  2HNL A;  2R5G A;  4HS1 A;  1ERT A;  4YQU A;  4MH3 A;  2XPD A;  5GZZ B;  5IMC A;  2GQM A;  1AQV A;  2GGT A;  1YKC A;  1V2A A;  5DJL A;  1TRV A;  5IMA A;  2B5Y A;  1X5D A;  3LJR A;  4HQS A;  2IWT A;  3BJ5 A;  3GYK A;  3MDK A;  3KCM A;  1QMV A;  3D5J A;  1VF2 A;  4KSM A;  4V1A g;  3RHB A;  2FLS A;  2MMN A;  3VK9 A;  4LMW A;  2H1A A;  4WF5 A;  4WR5 A;  2QKE A;  2LKU A;  14GS A;  3VWX A;  4GSS A;  1R7H A;  4F0B A;  2E7P A;  1GSQ A;  2CV4 A;  4H86 A;  4DSQ A;  1OYJ A;  2LJK A;  2HZF A;  1GL8 A;  4LL4 B;  4FYB A;  5A5K A;  3IK9 A;  4MDC A;  4V2N A;  4ZBA A;  3IK7 A;  1K0M A;  1F37 A;  1EWX A;  4MZW A;  5IPG A;  3KM6 A;  1SK0 A;  4K2D A;  3QOU A;  4F03 A;  1S3C A;  1N2A A;  2HZE A;  4QL7 A;  2G2Q A;  1EP7 A;  2C80 A;  1T4Y A;  2KLX A;  2C4J A;  2R37 A;  3LXT A;  1OC9 B;  4EC0 A;  2P31 A;  3UAR A;  2NVL A;  5CYY A;  1JLV A;  2R6K A;  3IOS A;  5EY6 A;  2B7J A;  1ZCP A;  3KTB A;  2XBQ A;  2PVQ A;  4MZB A;  1WWJ A;  1CQG A;  4OO5 A;  2VL2 A;  1ABA A;  2LV3 A;  4EVM A;  3IAM 2;  2B7K A;  4AJ7 A;  2I1U A;  3NIV A;  4HOJ A;  3WD6 A;  2ZCT A;  1OC3 A;  1XIY A;  2CX4 A;  2OAD A;  1YDK A;  4KAE A;  2HSH A;  4JR6 A;  3UJ1 A;  2PGT A;  5ECO B;  4TR0 A;  4ECI A;  1F3B A;  5HR3 A;  4K7N A;  2ZUP A;  1Z6N A;  3LWA A;  1YKA A;  1FHE A;  4X0X A;  3E0U A;  1IYI A;  5HR1 A;  2CVD A;  1GSS A;  3FEU A;  1HYU A;  6GSX A;  5KN3 A;  2M72 A;  4EKZ A;  5CRG A;  4TXO A;  4F0C A;  4IS0 A;  5F8B A;  2VCW A;  3RBT A;  3D4T A;  4IP1 A;  5G5E A;  2I9H A;  3CMI A;  3MWH A;  2B6M A;  4BL7 A;  3KZQ A;  3UOM A;  4CW9 A;  2VL2 C;  2GTU A;  3KH9 A;  3HVS A;  3UAP A;  3N9J A;  4XIH A;  2H6Y A;  4KND A;  1PKW A;  1PGT A;  5KN1 A;  2P5Q A;  4BVX A;  1EGO A;  4WET A;  3HVV A;  2LUS A;  4PNG A;  2L6D A;  3I43 A;  3GKK A;  3C1R A;  3NOF A;  1QFN A;  2AAW A;  1A2M A;  1T4Z A;  5J9B A;  1WRY A;  5J41 A;  2LRT A;  1YEP A;  5ECQ B;  2AUV A;  3DEX A;  1FAA A;  3F4S A;  2K6V A;  1XOA A;  4RI7 A;  2FUG 2;  5KN2 A;  5DQY A;  1GUH A;  5DVB A;  4I97 A;  4V2M A;  3TRX A;  1V98 A;  3QR6 A;  3H8Q A;  1JFU A;  4MF5 A;  4TR1 B;  1Y25 A;  4PQI A;  1GUK A;  3RPN A;  5IOX A;  4GTU A;  3EU4 A;  1SEN A;  2VL3 A;  4WR4 A;  2C3Q A;  3ZYW A;  1NHO A;  4LMV A;  5ECN B;  4BPY A;  2I4A A;  2C0F A;  3M8N A;  1RK4 A;  5A4W A;  3HD5 A;  3TJG A;  3TRQ A;  4PQH A;  5DAL B;  3ZFL A;  4MPF A;  3I69 A;  1TI1 A;  2IFQ B;  2GST A;  4BA7 A;  2FWE A;  2V6O A;  1XW5 A;  5IM9 A;  2G0F A;  1XW9 A;  1W89 A;  1TW9 A;  4DVC A;  4FYU A;  3EUR A;  1XWK A;  1O73 A;  1U3I A;  4FO5 A;  3TJK A;  3M9K A;  1YEX A;  4ZBB A;  1I5G A;  2R3X A;  4D73 B;  5IQY A;  1GTA A;  4HQZ A;  4JR4 A;  3U5R E;  2YV7 A;  1V40 A;  2F9S A;  2AHE A;  1X5C A;  3ME7 A;  4ZL9 A;  2RII A;  4HI7 A;  2X8H A;  1A2L A;  3KIJ A;  3IE3 A;  5AIX A;  1NHY A;  2FD3 A;  4TRX A;  3A3T A;  5F06 A;  2F8F A;  5G1K A;  2HLS A;  2HRF A;  4ACS A;  1A8Y A;  1ZYQ B;  2XHF A;  3LGC A;  3GKX A;  1J08 A;  1SKR B;  1YJ6 A;  2KHP A;  4EDY A;  3EC3 A;  3ZVJ D;  1X5E A;  3AY8 A;  5LCZ A;  3F0I A;  2FGX A;  3HCZ A;  2FWF A;  3FHK A;  4K0G A;  3DVX A;  3V1W A;  4G9H A;  2RM5 A;  1Y6E A;  3PH9 A;  3CTF A;  3EMP A;  2O7K A;  6GSV A;  2DJ3 A;  1C72 A;  1DBY A;  4MCU A;  4OCF A;  1SKW B;  4KCE A;  2GQK A;  1O7U A;  4CDO A;  3FR3 A;  1BQ7 A;  3C71 A;  4ZXG A;  2CT6 A;  2DMM A;  3GHA A;  5C00 A;  4GRF A;  3P90 A;  13GS A;  4PUR A;  4IKH A;  2GQL A;  5B8A A;  4N11 A;  2HSY A;  2M80 A;  3J7Y b;  3UEM A;  1K3L A;  2H19 A;  2E2M A;  2GT5 A;  4DSR A;  2VIM A;  3WT2 A;  2ALB A;  2GZY A;  3DRN A;  3P8W A; 
#chains in the Genus database with same CATH topology
 2ON5 A;  4HZ2 A;  4Z7X A;  1XWA A;  3A5I A;  3GTU B;  3RPP A;  1M9B A;  1OC8 A;  1TDI A;  3QFA C;  3APQ A;  3ZIV A;  3BCI A;  3UBL A;  5IMF A;  4I2U A;  4MJA A;  5HFI A;  4HZ4 A;  1SKS B;  3D0Z A;  3ERW A;  1XVW A;  5EPF A;  1GSD A;  2OJL A;  5HFG A;  2IJY A;  1WPI A;  2P5R A;  4LA1 A;  4TR3 A;  2RLI A;  3F3Q A;  3UMA A;  4ZL7 A;  2LNT A;  1TU7 A;  2X8C A;  3DYR A;  1Z9H A;  2CZ3 A;  2LNS A;  1G6W A;  2FA8 A;  1A23 A;  1AXD A;  1FB6 A;  2FWH A;  5CRW A;  2JZR A;  3KGK A;  2YWM A;  1ILO A;  1SL2 B;  4PX1 A;  1BG5 A;  4XS4 B;  4I8B A;  2C0E A;  1VGL A;  3C7M A;  3A2X A;  2GS3 A;  4GXZ A;  2CAQ A;  2DML A;  3W6G A;  1TXX A;  3H1N A;  3D6I A;  4XRD A;  5IO2 A;  4ILF A;  3TOU A;  1GTI A;  2DJK A;  3PIN A;  4JBB A;  2MMO A;  4HSC X;  4MF6 A;  3PPU A;  3CSJ A;  1WOU A;  3H79 A;  2CA8 A;  3GSS A;  2DJ2 A;  2VAF A;  2YWO A;  2M46 A;  3P7X A;  4MJB A;  3C73 A;  5EL8 A;  1MTC A;  3UVT A;  1ZYP A;  4HUA A;  2H01 A;  2HFD A;  3CYN A;  3GFK A;  4NWY A;  4AGS A;  4EUY A;  1JZR A;  3D22 A;  3E9J B;  1YY7 A;  1PA3 A;  3ZLP A;  1DE1 A;  4EO3 A;  5E4W A;  3UL3 A;  1PL2 A;  4OD7 A;  3MAK A;  3TKP A;  2A2P A;  2DKH A;  4WBR D;  1X0R A;  3ED3 A;  3L9V A;  2B5E A;  1XW6 A;  5F07 A;  6GST A;  2R4V A;  1NSW A;  2V2G A;  1USB A;  3DWV A;  2NTO A;  1TU8 A;  2OA7 A;  3DVW A;  1GSE A;  1PN0 A;  2MMZ A;  1THX A;  1F9M A;  1Z7R A;  2LS5 A;  1PX7 A;  1OKT A;  4IJ3 A;  5ECP B;  1SD9 A;  4Z2R A;  4KCA A;  2LQO A;  4NPB A;  4Q5R A;  3IHQ A;  4QQ7 A;  3ZL5 A;  1M9A A;  2WRT A;  3ZTL A;  1K3O A;  1XWG A;  4I6X A;  3QFB C;  1EV4 A;  1AIU A;  1Z5Y E;  2E2G A;  2VCZ A;  4Z2T A;  2N5B A;  1ZOF A;  3LYP A;  1NW2 A;  4WBJ A;  3TKS A;  1TK8 B;  1K0B A;  4O32 A;  1MD4 A;  6GSS A;  1KTE A;  2PN8 A;  3GST A;  3J7Y k;  1MDI A;  4X1U A;  4IW9 A;  3WGX A;  5INY A;  2DKI A;  4OCE A;  3VPQ A;  2YZH A;  2H30 A;  4EE0 A;  4MJE A;  3D21 A;  2PPT A;  7GSS A;  1SJI A;  3SBC A;  2PER A;  5ID2 B;  1WP0 A;  4HEA 2;  1XOB A;  2DIZ A;  4FIW A;  3IR4 A;  3TKS E;  3EWL A;  2GSR A;  1J0F A;  1VRS D;  1AW9 A;  5CAX A;  4XCS A;  4K6X A;  2WZ9 A;  5IO0 A;  4E8H A;  4KA0 A;  1BED A;  2NDO A;  1Z7P A;  2WS2 A;  4G0K A;  4MMM A;  5FWG A;  2N5F A;  2H66 A;  4HU7 A;  1SJ6 A;  2YWN A;  3GV1 A;  3QD9 A;  1ACV A;  2F3M A;  1M2B A;  5DDL A;  5AN1 A;  2A2R A;  3TRP A;  5JWQ B;  2OE0 A;  3F6F A;  2YJH A;  3VWU A;  2UZ8 A;  1PQN A;  3MNG A;  3TKS C;  4YH2 A;  4BWQ A;  2QC7 A;  1XWB A;  4WXT A;  2V32 A;  5HR2 A;  2CAI A;  3VWW A;  2YP6 A;  2CVK A;  1FVK A;  3IV4 A;  2C0D A;  3UIW A;  5KOX A;  2K18 A;  1XFL A;  2B1L A;  2YZU A;  2LJR A;  3C1S A;  2H0H A;  2YPM A;  4LLR A;  2MBT A;  1KEB A;  4QL9 A;  1TRW A;  3L0H A;  2VM1 A;  3DIE A;  4TVE A;  3LQ7 A;  5ECK B;  4KB3 A;  1XVQ A;  2BTO T;  1AAZ A;  2V1M A;  3M0F A;  5JCU A;  4HJ2 A;  4LL1 B;  3G9B A;  4K7I A;  3IA1 A;  5G1L A;  3KD0 A;  1B8X A;  2WCI A;  4EIQ A;  3CRU A;  1EZK A;  3UVH A;  1OE7 A;  5GSS A;  3TJF A;  4EXJ A;  4V2L A;  4O5U A;  1H4O A;  5DQS A;  3S9F A;  2L57 A;  4ML6 A;  3WT1 A;  2MMA A;  3KMO A;  3APS A;  2IMI A;  3TGZ A;  5J4U A;  1U3A A;  4X43 A;  3IC4 A;  4MA9 A;  3U6V A;  5D9W A;  3G7Y A;  2AYT A;  4N0V A;  4IHU A;  3DKS A;  5HQP A;  4P3Y B;  5B7C A;  5J9C A;  3WYW A;  2LST A;  4Q5F A;  3GKN A;  2I81 A;  3MYD A;  3ZRE A;  2YJ7 A;  4KUN A;  4OFM A;  3F8U A;  2IN3 A;  5J5N A;  3P2A A;  2PU9 C;  3MSZ A;  1Q4J A;  3GX0 A;  4OFT A;  1ERU A;  3F6D A;  5D73 A;  1TK5 B;  4K7O A;  2CX3 A;  1QQ2 A;  1GTB A;  2L6C A;  1TKD B;  4GST A;  2GZZ A;  1X9M B;  2VD0 A;  1FOV A;  1URM A;  4NMU A;  5IMV A;  1EEM A;  2DJ1 A;  2X49 A;  3GN3 A;  2J9H A;  2FHE A;  3CXG A;  2H8L A;  2L4Q A;  2HRN A;  3VFI A;  4MPG A;  4L5L A;  3KP9 A;  3VUR A;  3ZIJ A;  4DSS A;  3QDN A;  4XS6 A;  2HZE B;  4G19 A;  4K9Z A;  3IBH A;  3DXB A;  4JZQ A;  2PWJ A;  1ERV A;  1Z3E A;  2FCH A;  2B3S A;  2H70 A;  2OBI A;  4L0U A;  5FT3 A;  1G7E A;  4EIP A;  4YQM A;  4KDY A;  2E0Q A;  2WB9 A;  5J3R A;  4FH8 A;  3CBU A;  4TW5 A;  4O5Q A;  3L9S A;  2X8G A;  2VM2 A;  2VLT A;  3ZRD A;  5DCH A;  1ZL9 A;  3HA9 A;  4FQU A;  2RM6 A;  4MAB A;  4GWR A;  5ECR B;  1ST9 A;  4F9Z A;  3KJY A;  3APO A;  4OO4 A;  2VL9 A;  4JED A;  1JLW A;  3HJO A;  5AIV A;  2H0I A;  5CRD A;  3H4K A;  4AF2 A;  4X4J A;  4L8E A;  2OE3 A;  5ELA A;  1YF0 A;  3KEB A;  4TR4 A;  1EEJ A;  2V41 A;  3A5W A;  4AJ6 A;  1S3D A;  8GSS A;  5IIZ A;  5H5R A;  1A24 A;  5LD0 A;  1M7T A;  5GAP D;  1WMJ A;  2VLU A;  4Q5Q A;  3HHV A;  2C1Y A;  2VOC A;  1XPV A;  3QPM A;  2Z9S A;  5JWO B;  2KOK A;  1VF1 A;  1G0T A;  1GH2 A;  4TOP A;  2GZP A;  4ZB9 A;  5AIS A;  1WJK A;  4MZC A;  2C3T A;  5F05 A;  4ECJ A;  4YAV A;  3C8E A;  1R5A A;  3HZ8 A;  2QA1 A;  1DSB A;  5CRE A;  2CZ2 A;  4KE3 A;  2PVO C;  4TXO B;  4EF0 A;  2N5A A;  1TI3 A;  3LG6 A;  1G6Y A;  3ZVJ A;  4F2I A;  2QGV A;  3FY7 A;  2JAC A;  1XZO A;  3QAW A;  3ISO A;  2B5X A;  2K8S A;  2YCD A;  1GSY A;  1O8X A;  5FHI A;  2O89 A;  4ECB A;  4OMV A;  3IXR A;  4ULX A;  2HI7 A;  4RQR A;  5ECM B;  2H71 A;  2LRC A;  4ZIL A;  3FYG A;  1M2D A;  5D93 A;  2X64 A;  1OKD A;  4IQ1 A;  16GS A;  2OAC A;  1AQX A;  4I2T A;  3M9J A;  4BVX B;  3F4R A;  2K8V A;  4GSN A;  1VF4 A;  4YQV A;  2QSI A;  5ELG A;  3KH7 A;  6GSY A;  3O6T A;  3BD2 A;  3HKR A;  1A8L A;  3FW2 A;  2JSZ A;  4J2F A;  2OE1 A;  5HFK A;  3LEF A;  1AC1 A;  1THO A;  1PMT A;  4KW6 A;  3LSZ A;  2F8A A;  5GAN D;  4NXI A;  3WGE A;  1Q98 A;  2R2J A;  3MIX A;  1TRS A;  1GP1 A;  1BJX A;  3O3T A;  3ERF A;  2H0G A;  3TDG A;  4MJC A;  1XWC A;  2L5L A;  3RDW A;  2H1D A;  4KF9 A;  3SWL A;  1XBS A;  20GS A;  1GLQ A;  1ZGN A;  2IPA A;  5ECS A;  2J23 A;  18GS A;  2VCV A;  3ZMK A;  5E59 A;  4POL A;  1GUM A;  1EGR A;  2IL3 A;  1OC9 A;  1F6M C;  3GUR A;  3HXS A;  2VUP A;  5JCG A;  4WEY A;  4K5R A;  1LBK A;  1PN9 A;  4J57 E;  4N10 A;  2CVB A;  4WKW A;  3TJB A;  3FZA A;  2C8U A;  4DEJ A;  4IQA A;  1WIK A;  4MNN A;  1QK8 A;  3BCK A;  4HU9 A;  4PXO A;  3IC8 A;  2WUL A;  1GLP A;  1B4Q A;  4EDZ A;  1PL1 A;  1H75 A;  4K5S A;  1PSQ A;  4JRR A;  1OAZ A;  5ECL B;  2H6Z A;  3GMF A;  1O6J A;  4KSO A;  3QCP A;  5L71 A;  4NHW A;  4XTS A;  3TKQ A;  3ZML A;  1LJR A;  1EV9 A;  1MDK A;  5CP1 A;  5C04 A;  1IYH A;  2A4V A;  5B6N A;  3ERG A;  2EIQ A;  3I6A A;  3EE2 A;  3W8J A;  3LYK A;  3HJP A;  1MDJ A;  4BWS A;  4RQX A;  2JU5 A;  2LEG A;  1M2A A;  1ZZY A;  4I5Q A;  4NV5 A;  3IPZ A;  3HVX A;  1U88 A;  4K8M A;  2DC5 A;  2VLV A;  3RHC A;  4ZIJ A;  2HSM A;  3HY2 A;  4BVY A;  2H6X A;  1O85 A;  4OFN A;  2K9F A;  3GIX A;  2DSA A;  1J9B A;  19GS A;  2H1B A;  1TTZ A;  2F51 A;  3HDC A;  2KP1 A;  3LXZ A;  4ECC A;  2L5O A;  2RUE A;  5CNW A;  3BBY A;  3FMW A;  1TP9 A;  3LOR A;  22GS A;  3TOT A;  5G30 A;  1FG4 A;  2YV9 A;  4GF0 A;  3EVI A;  2IME A;  3WGD A;  5GST A;  3UBK A;  5D9T A;  4XRA A;  2MZC A;  2VCX A;  2EIR A;  2O8V B;  1ERW A;  1K0A A;  12GS A;  2YAN A;  5D8I A;  3VWV A;  1R4W A;  3PR8 A;  2HE3 A;  3O76 A;  5DCG A;  3F63 A;  4L0W A;  1PD2 1;  2O87 A;  2B1K A;  3VI7 A;  1ZMA A;  2WGR A;  2KP2 A;  4PUA A;  1B4P A;  3DGQ A;  2LTK A;  5BMU A;  1FB0 A;  1PX6 A;  1QXH A;  1OVN A;  4EL1 A;  3CTG A;  1QGV A;  4TR1 A;  3FK8 A;  4ID0 A;  2IMF A;  2TIR A;  3TUE A;  4NV2 A;  4KDU A;  1JZW A;  3GL5 A;  2JAD A;  3F3R A;  2HXK A;  4YAP A;  3CRT A;  2O85 A;  4AJ8 A;  1SL0 B;  5DAL A;  1B48 A;  5JWR B;  1BYE A;  3VI5 A;  2EC4 A;  4K0N A;  2IFQ A;  5IMZ A;  4CHS A;  1T7P B;  3N5O A;  4GCI A;  5DJM A;  11GS A;  5B6M A;  2H75 A;  1QUW A;  4NHZ A;  3GA4 A;  1FOH A;  2JZS A;  5A4U A;  4ZB6 A;  1UA5 A;  3FR6 A;  3FRC A;  1FO5 A;  3FZ4 A;  4POK A;  3FKF A;  1TJD A;  4D73 A;  2ZNM A;  1SYX A;  3ME8 A;  3E3E A;  2H73 A;  3GX8 A;  4PGT A;  2JL4 A;  1A0F A;  2CQ9 A;  4K1F A;  3VLN A;  1ZYE A;  4USS A;  2GT6 A;  3GH6 A;  4TKY A;  5A4V A;  3EIN A;  4RUV A;  1DE2 A;  2C3N A;  4ZL8 A;  3I9V 2;  4XHM A;  3NZN A;  1M0U A;  1FVJ A;  1GSF A;  3KXO A;  2ES7 A;  2AB6 A;  3GL3 A;  3QAG A;  3GRX A;  1B9Y C;  2XC2 A;  2YOI A;  2QA2 A;  1SU9 A;  3DD3 A;  3R2Q A;  2RUF A;  4MP4 A;  4IP6 A;  2H72 A;  4N30 A;  2REM A;  1EOG A;  3W8S A;  5ABR A;  1X9W B;  1CQH A;  1ZYN A;  2L59 A;  5G5F A;  4MK3 A;  1R26 A;  1GTU A;  4PQ1 A;  2X4A A;  5ENU A;  1TRU A;  5EVO A;  5G2Z A;  5D9X A;  2HYX A;  1JHB A;  1BX9 A;  2NPB A;  4G10 A;  3Q6O A;  1K0D A;  4IGJ A;  1UC7 A;  3KP8 A;  5JCW A;  2HRK A;  2H76 A;  1T00 A;  3GH9 A;  5IOW A;  4MH2 A;  1EP8 A;  5IMD A;  3EU3 A;  3F4T A;  3GTU A;  1U87 A;  2HT9 A;  4GQC A;  1T8E B;  4XS1 A;  2ON7 A;  3EMX A;  1FW1 A;  4Q5N A;  4GLT A;  3H93 A;  2H1G A;  4G0I A;  1XXU A;  4OWY A;  1GWC A;  2GDR A;  3Q18 A;  3ZZX A;  2A2S A;  5CO3 A;  4RI6 A;  1Z6M A;  2P0G A;  1OE8 A;  1AQW A;  2FWG A;  5F0G A;  5KN0 A;  3OR5 A;  3ZIT A;  2D2Z A;  2DJ0 A;  4GQF A;  2DJJ A;  2GVP A;  9GSS A;  2JZT A;  3L9U A;  4JU5 A;  4O92 A;  3IRA A;  1S3R A;  4XS4 A;  5COH A;  3RAZ A;  4HDE A;  2GLR A;  3QMX A;  5DAK A;  1HNB A;  4YKF A;  3TB2 A;  3FZ5 A;  3A2W A;  4N0Z A;  3HZ4 A;  2OBK A;  5D96 A;  1O81 A;  1T1V A;  2GSQ A;  3GUS A;  1EOH A;  3HYP A;  2C0G A;  4K2X A;  2L4C A;  2LJA A;  2DBC A;  1M3I A;  4IBP A;  2H74 A;  5H5Q A;  3LFL A;  1GSU A;  1GNE A;  3PGT A;  5AGY A;  1M3J A;  1MD3 A;  1GUL A;  2VD1 A;  4KGI A;  2JSY A;  3K8N A;  1F3A A;  3IDV A;  5DBQ A;  10GS A;  1PRX A;  4PUF C;  2TRC P;  1U6T A;  4JE1 A;  2BMX A;  1K0N A;  2VO4 A;  2NBS A;  1YF1 A;  1SK1 A;  3Q19 A;  3HJM A;  2IMD A;  1S3A A;  4IJI A;  2WFC A;  2BJX A;  4F82 A;  2AV4 A;  3FR9 A;  3IAS 2;  4O7H A;  1YQ1 A;  2PMT A;  4HJM A;  2KUC A;  1UVZ A;  1ON4 A;  5HR0 A;  3DML A;  4IN0 A;  4WF4 A;  4YKG A;  1JZD A;  4KH7 A;  1RW1 A;  2IIY A;  6GSU A;  1TOF A;  1GRX A;  1G7O A;  4MLY A;  1NM3 A;  17GS A;  5D9V A;  1AUC A;  1F2E A;  3F9U A;  1BAY A;  2VCT A;  1SK2 A;  3ZFB A;  4ZB8 A;  4FYC A;  1PKZ A;  4PTS A;  3GNJ A;  4PNF A;  3QAV A;  1I9D A;  4NAX A;  2WDU A;  2XBI A;  3KTL A;  5ECI B;  4POM A;  3EYT A;  5H5S A;  1YZX A;  3KMN A;  2PBJ A;  2OKA A;  1TK0 B;  2WJU A;  3A2V A;  4KDX A;  1R5P A;  4ZBD A;  1A2J A;  1KBN A;  3LW9 A;  4POB A;  5ID2 A;  3L4N A;  2LQQ A;  4L5O A;  2IMK A;  1LU4 A;  3CSI A;  4G2E A;  3US3 A;  4TXV A;  2EIO A;  2LRN A;  5ECH B;  2YNX A;  1SL1 B;  1RQM A;  2AJQ B;  1XG8 A;  1V9W A;  1V58 A;  4DSS B;  1GNW A;  4KX4 A;  1X9S B;  4ICY A;  1E2Y A;  1K0O A;  3BOA A;  2FY6 A;  1B9X C;  4ISD A;  3M3M A;  3VPT A;  4E8E A;  1V57 A;  1JZO A;  2YN1 A;  4O5R A;  3TJJ A;  1K3Y A;  2R0G A;  1E6B A;  1KNG A;  2MBS A;  2V6K A;  3TCO A;  1UN2 A;  5B8B A;  5CRH A;  3M1G A;  1SJZ A;  2FNO A;  1HD2 A;  1W4V A;  5DAK B;  3G7I A;  1HNC A;  2PUK C;  1SYR A;  2FA4 A;  4ML1 A;  1DUG A;  2X99 A;  1A0R P;  3Q74 A;  3TKR A;  1O8W A;  3CSH A;  4MF7 A;  1ML6 A;  2YWI A;  1T3B A;  4A5P A;  1SD8 A;  3FZ9 A;  2MYG A;  1WE0 A;  5KEJ A;  2I3Y A;  5IPH A;  3IHG A;  4J56 E;  3GKM A;  4V1A p;  1K0C A;  3D4M A;  3JCM L;  2TRX A;  1MEK A;  1M99 A;  1XCC A;  1VF3 A;  1HQO A;  6GSW A;  3L78 A;  2DLX A;  2VCQ A;  5G31 A;  2XPE A;  5LNK e;  1N8J A;  1HNA A;  4IEL A;  4IVF A;  1PFO A;  2GSS A;  2DIY A;  3G7J A;  4TN8 A;  2HNL A;  2R5G A;  4HS1 A;  1ERT A;  4YQU A;  4MH3 A;  2XPD A;  5GZZ B;  5IMC A;  2GQM A;  1AQV A;  2GGT A;  1YKC A;  1V2A A;  5DJL A;  3R3E A;  1TRV A;  5IMA A;  2B5Y A;  1X5D A;  3LJR A;  4HQS A;  2IWT A;  3BJ5 A;  3GYK A;  3MDK A;  3KCM A;  1QMV A;  3D5J A;  1VF2 A;  4KSM A;  4V1A g;  5BRT A;  3RHB A;  2FLS A;  2MMN A;  3VK9 A;  4LMW A;  2H1A A;  4WF5 A;  4WR5 A;  2QKE A;  2LKU A;  14GS A;  3VWX A;  4GSS A;  4G0L A;  1R7H A;  3EPT A;  2E7P A;  4F0B A;  1GSQ A;  2CV4 A;  4H86 A;  4DSQ A;  1OYJ A;  2LJK A;  2HZF A;  1GL8 A;  4LL4 B;  4FYB A;  5A5K A;  3IK9 A;  4MDC A;  2A4H A;  4V2N A;  4ZBA A;  3IK7 A;  1K0M A;  1F37 A;  1EWX A;  4MZW A;  5IPG A;  3KM6 A;  1SK0 A;  4K2D A;  3QOU A;  4F03 A;  1S3C A;  1N2A A;  2HZE A;  4QL7 A;  2G2Q A;  5KOW A;  1EP7 A;  2C80 A;  1T4Y A;  2KLX A;  2C4J A;  2R37 A;  3LXT A;  1OC9 B;  4EC0 A;  2P31 A;  3UAR A;  2NVL A;  5CYY A;  1JLV A;  2R6K A;  3IOS A;  5EY6 A;  2B7J A;  1ZCP A;  3KTB A;  2XBQ A;  2PVQ A;  4MZB A;  1WWJ A;  1CQG A;  4OO5 A;  2VL2 A;  1ABA A;  2LV3 A;  4EVM A;  3IAM 2;  2B7K A;  4AJ7 A;  2I1U A;  3NIV A;  4HOJ A;  3WD6 A;  3HVN A;  2ZCT A;  1OC3 A;  1XIY A;  2CX4 A;  2OAD A;  1YDK A;  4KAE A;  2HSH A;  4JR6 A;  3UJ1 A;  2PGT A;  5ECO B;  4TR0 A;  4ECI A;  1F3B A;  5HR3 A;  4K7N A;  2ZUP A;  1Z6N A;  3LWA A;  1YKA A;  1FHE A;  4X0X A;  3E0U A;  1IYI A;  5HR1 A;  2CVD A;  1GSS A;  3FEU A;  1HYU A;  6GSX A;  5KN3 A;  2M72 A;  4EKZ A;  5CRG A;  4TXO A;  4F0C A;  4IS0 A;  5F8B A;  2VCW A;  3RBT A;  3D4T A;  4IP1 A;  5G5E A;  2I9H A;  3CMI A;  3MWH A;  2B6M A;  4BL7 A;  3KZQ A;  3UOM A;  4CW9 A;  2VL2 C;  2GTU A;  3KH9 A;  4BVY B;  3HVS A;  3UAP A;  3N9J A;  4XIH A;  3CQF A;  4CY8 A;  2H6Y A;  4KND A;  1PKW A;  1PGT A;  5KN1 A;  2P5Q A;  4BVX A;  1EGO A;  4WET A;  3HVV A;  2LUS A;  4PNG A;  2L6D A;  3I43 A;  3GKK A;  3C1R A;  3NOF A;  1QFN A;  2AAW A;  1A2M A;  1T4Z A;  5J9B A;  1WRY A;  4Z2U A;  5J41 A;  2LRT A;  1YEP A;  5ECQ B;  2AUV A;  3DEX A;  1FAA A;  3F4S A;  2K6V A;  1XOA A;  4RI7 A;  2FUG 2;  5KN2 A;  5DQY A;  1GUH A;  5DVB A;  4I97 A;  4V2M A;  3TRX A;  4BIK A;  1V98 A;  3QR6 A;  3H8Q A;  1JFU A;  4MF5 A;  4TR1 B;  1Y25 A;  4PQI A;  1GUK A;  3RPN A;  5IOX A;  4GTU A;  3EU4 A;  1SEN A;  2HRA A;  2VL3 A;  4WR4 A;  2C3Q A;  3ZYW A;  1NHO A;  4LMV A;  5ECN B;  4BPY A;  2I4A A;  2C0F A;  3M8N A;  1RK4 A;  5A4W A;  3HD5 A;  3TJG A;  3TRQ A;  4PQH A;  5DAL B;  3ZFL A;  4MPF A;  3I69 A;  1TI1 A;  2IFQ B;  2GST A;  4BA7 A;  2R0P A;  2FWE A;  2V6O A;  1XW5 A;  5IM9 A;  2G0F A;  1XW9 A;  4CY6 A;  1W89 A;  1TW9 A;  4DVC A;  4FYU A;  3EUR A;  1XWK A;  1O73 A;  1U3I A;  4FO5 A;  3TJK A;  2R0C A;  3M9K A;  1YEX A;  4ZBB A;  1I5G A;  2R3X A;  4D73 B;  5IQY A;  1GTA A;  4HQZ A;  4JR4 A;  3U5R E;  2YV7 A;  1V40 A;  2F9S A;  2AHE A;  1X5C A;  3ME7 A;  4ZL9 A;  2RII A;  4HI7 A;  2X8H A;  1A2L A;  3KIJ A;  3IE3 A;  5AIX A;  1NHY A;  2FD3 A;  4TRX A;  3A3T A;  5F06 A;  2F8F A;  5G1K A;  2HLS A;  2HRF A;  4ACS A;  1A8Y A;  1ZYQ B;  2XHF A;  3LGC A;  3GKX A;  1J08 A;  1SKR B;  1YJ6 A;  2KHP A;  4EDY A;  3EC3 A;  3ZVJ D;  1X5E A;  3AY8 A;  5LCZ A;  3F0I A;  2FGX A;  3HCZ A;  2FWF A;  3FHK A;  4K0G A;  3DVX A;  3V1W A;  4G9H A;  2RM5 A;  1Y6E A;  3PH9 A;  4BL7 B;  3CTF A;  3EMP A;  2O7K A;  6GSV A;  2DJ3 A;  1C72 A;  1DBY A;  4MCU A;  4OCF A;  1SKW B;  4KCE A;  2GQK A;  1O7U A;  4CDO A;  3FR3 A;  1BQ7 A;  3C71 A;  4ZXG A;  2CT6 A;  2DMM A;  3GHA A;  5C00 A;  4GRF A;  3P90 A;  4PUR A;  13GS A;  4IKH A;  2GQL A;  5B8A A;  4N11 A;  2HSY A;  2M80 A;  3J7Y b;  3UEM A;  1K3L A;  2H19 A;  2E2M A;  2GT5 A;  4DSR A;  2VIM A;  3WT2 A;  2ALB A;  2GZY A;  3DRN A;  3P8W A; 
#chains in the Genus database with same CATH homology
 2ON5 A;  4HZ2 A;  4Z7X A;  1XWA A;  3A5I A;  3GTU B;  3RPP A;  1M9B A;  1OC8 A;  1TDI A;  3QFA C;  3APQ A;  3ZIV A;  3BCI A;  3UBL A;  5IMF A;  4I2U A;  4MJA A;  5HFI A;  4HZ4 A;  1SKS B;  3D0Z A;  3ERW A;  1XVW A;  5EPF A;  1GSD A;  2OJL A;  5HFG A;  2IJY A;  1WPI A;  2P5R A;  4LA1 A;  4TR3 A;  2RLI A;  3F3Q A;  3UMA A;  4ZL7 A;  2LNT A;  1TU7 A;  2X8C A;  3DYR A;  1Z9H A;  2CZ3 A;  2LNS A;  1G6W A;  2FA8 A;  1A23 A;  1AXD A;  1FB6 A;  2FWH A;  5CRW A;  2JZR A;  3KGK A;  2YWM A;  1ILO A;  1SL2 B;  4PX1 A;  1BG5 A;  4XS4 B;  4I8B A;  2C0E A;  1VGL A;  3C7M A;  3A2X A;  2GS3 A;  4GXZ A;  2CAQ A;  2DML A;  3W6G A;  1TXX A;  3H1N A;  3D6I A;  4XRD A;  5IO2 A;  4ILF A;  3TOU A;  1GTI A;  2DJK A;  3PIN A;  4JBB A;  2MMO A;  4MF6 A;  3PPU A;  3CSJ A;  1WOU A;  3H79 A;  2CA8 A;  3GSS A;  2DJ2 A;  2VAF A;  2YWO A;  2M46 A;  3P7X A;  4MJB A;  3C73 A;  5EL8 A;  1MTC A;  3UVT A;  1ZYP A;  4HUA A;  2H01 A;  2HFD A;  3CYN A;  3GFK A;  4NWY A;  4AGS A;  4EUY A;  1JZR A;  3D22 A;  3E9J B;  1YY7 A;  1PA3 A;  3ZLP A;  1DE1 A;  4EO3 A;  5E4W A;  3UL3 A;  1PL2 A;  4OD7 A;  3MAK A;  3TKP A;  2A2P A;  2DKH A;  4WBR D;  1X0R A;  3ED3 A;  3L9V A;  2B5E A;  1XW6 A;  5F07 A;  6GST A;  2R4V A;  1NSW A;  2V2G A;  1USB A;  3DWV A;  2NTO A;  1TU8 A;  2OA7 A;  3DVW A;  1GSE A;  1PN0 A;  2MMZ A;  1THX A;  1F9M A;  1Z7R A;  2LS5 A;  1PX7 A;  1OKT A;  4IJ3 A;  5ECP B;  1SD9 A;  4Z2R A;  4KCA A;  2LQO A;  4NPB A;  4Q5R A;  3IHQ A;  4QQ7 A;  3ZL5 A;  1M9A A;  2WRT A;  3ZTL A;  1K3O A;  1XWG A;  4I6X A;  3QFB C;  1EV4 A;  1AIU A;  1Z5Y E;  2E2G A;  2VCZ A;  4Z2T A;  2N5B A;  1ZOF A;  3LYP A;  1NW2 A;  4WBJ A;  3TKS A;  1TK8 B;  1K0B A;  4O32 A;  1MD4 A;  6GSS A;  1KTE A;  2PN8 A;  3GST A;  3J7Y k;  1MDI A;  4X1U A;  4IW9 A;  3WGX A;  5INY A;  2DKI A;  4OCE A;  3VPQ A;  2YZH A;  2H30 A;  4EE0 A;  4MJE A;  3D21 A;  2PPT A;  7GSS A;  1SJI A;  3SBC A;  2PER A;  5ID2 B;  1WP0 A;  4HEA 2;  1XOB A;  2DIZ A;  4FIW A;  3IR4 A;  3TKS E;  3EWL A;  2GSR A;  1J0F A;  1VRS D;  1AW9 A;  5CAX A;  4XCS A;  4K6X A;  2WZ9 A;  5IO0 A;  4E8H A;  4KA0 A;  1BED A;  2NDO A;  1Z7P A;  2WS2 A;  4G0K A;  4MMM A;  5FWG A;  2N5F A;  2H66 A;  4HU7 A;  1SJ6 A;  2YWN A;  3GV1 A;  3QD9 A;  1ACV A;  2F3M A;  1M2B A;  5DDL A;  5AN1 A;  2A2R A;  3TRP A;  5JWQ B;  2OE0 A;  3F6F A;  2YJH A;  3VWU A;  2UZ8 A;  1PQN A;  3MNG A;  3TKS C;  4YH2 A;  4BWQ A;  2QC7 A;  1XWB A;  4WXT A;  2V32 A;  5HR2 A;  2CAI A;  3VWW A;  2YP6 A;  2CVK A;  1FVK A;  3IV4 A;  2C0D A;  3UIW A;  5KOX A;  2K18 A;  1XFL A;  2B1L A;  2YZU A;  2LJR A;  3C1S A;  2H0H A;  2YPM A;  4LLR A;  2MBT A;  1KEB A;  4QL9 A;  1TRW A;  3L0H A;  2VM1 A;  3DIE A;  4TVE A;  3LQ7 A;  5ECK B;  4KB3 A;  1XVQ A;  2BTO T;  1AAZ A;  2V1M A;  3M0F A;  5JCU A;  4HJ2 A;  4LL1 B;  3G9B A;  4K7I A;  3IA1 A;  5G1L A;  3KD0 A;  1B8X A;  2WCI A;  4EIQ A;  3CRU A;  1EZK A;  3UVH A;  1OE7 A;  5GSS A;  3TJF A;  4EXJ A;  4V2L A;  4O5U A;  1H4O A;  5DQS A;  3S9F A;  2L57 A;  4ML6 A;  3WT1 A;  2MMA A;  3KMO A;  3APS A;  2IMI A;  3TGZ A;  5J4U A;  1U3A A;  4X43 A;  3IC4 A;  4MA9 A;  3U6V A;  5D9W A;  3G7Y A;  2AYT A;  4N0V A;  4IHU A;  3DKS A;  5HQP A;  4P3Y B;  5B7C A;  5J9C A;  3WYW A;  2LST A;  4Q5F A;  3GKN A;  2I81 A;  3MYD A;  3ZRE A;  2YJ7 A;  4KUN A;  4OFM A;  3F8U A;  2IN3 A;  5J5N A;  3P2A A;  2PU9 C;  3MSZ A;  1Q4J A;  3GX0 A;  4OFT A;  1ERU A;  3F6D A;  5D73 A;  1TK5 B;  4K7O A;  2CX3 A;  1QQ2 A;  1GTB A;  2L6C A;  1TKD B;  4GST A;  2GZZ A;  1X9M B;  2VD0 A;  1FOV A;  1URM A;  4NMU A;  5IMV A;  1EEM A;  2DJ1 A;  2X49 A;  3GN3 A;  2J9H A;  2FHE A;  3CXG A;  2H8L A;  2L4Q A;  2HRN A;  3VFI A;  4MPG A;  4L5L A;  3KP9 A;  3VUR A;  3ZIJ A;  4DSS A;  3QDN A;  4XS6 A;  2HZE B;  4G19 A;  4K9Z A;  3IBH A;  3DXB A;  4JZQ A;  2PWJ A;  1ERV A;  1Z3E A;  2FCH A;  2B3S A;  2H70 A;  2OBI A;  4L0U A;  5FT3 A;  1G7E A;  4EIP A;  4YQM A;  4KDY A;  2E0Q A;  2WB9 A;  5J3R A;  4FH8 A;  3CBU A;  4TW5 A;  4O5Q A;  3L9S A;  2X8G A;  2VM2 A;  2VLT A;  3ZRD A;  5DCH A;  1ZL9 A;  3HA9 A;  4FQU A;  2RM6 A;  4MAB A;  4GWR A;  5ECR B;  1ST9 A;  4F9Z A;  3KJY A;  3APO A;  4OO4 A;  2VL9 A;  4JED A;  1JLW A;  3HJO A;  5AIV A;  2H0I A;  5CRD A;  3H4K A;  4AF2 A;  4X4J A;  4L8E A;  2OE3 A;  5ELA A;  1YF0 A;  3KEB A;  4TR4 A;  1EEJ A;  2V41 A;  3A5W A;  4AJ6 A;  1S3D A;  8GSS A;  5IIZ A;  5H5R A;  1A24 A;  5LD0 A;  1M7T A;  5GAP D;  1WMJ A;  2VLU A;  4Q5Q A;  3HHV A;  2C1Y A;  2VOC A;  1XPV A;  3QPM A;  2Z9S A;  5JWO B;  2KOK A;  1VF1 A;  1G0T A;  1GH2 A;  4TOP A;  2GZP A;  4ZB9 A;  5AIS A;  1WJK A;  4MZC A;  2C3T A;  5F05 A;  4ECJ A;  4YAV A;  3C8E A;  1R5A A;  3HZ8 A;  2QA1 A;  1DSB A;  5CRE A;  2CZ2 A;  4KE3 A;  2PVO C;  4TXO B;  4EF0 A;  2N5A A;  1TI3 A;  3LG6 A;  1G6Y A;  3ZVJ A;  4F2I A;  2QGV A;  3FY7 A;  2JAC A;  1XZO A;  3QAW A;  3ISO A;  2B5X A;  2K8S A;  2YCD A;  1GSY A;  1O8X A;  5FHI A;  2O89 A;  4ECB A;  4OMV A;  3IXR A;  4ULX A;  2HI7 A;  4RQR A;  5ECM B;  2H71 A;  2LRC A;  4ZIL A;  3FYG A;  1M2D A;  5D93 A;  2X64 A;  1OKD A;  4IQ1 A;  16GS A;  2OAC A;  1AQX A;  4I2T A;  3M9J A;  4BVX B;  3F4R A;  2K8V A;  4GSN A;  1VF4 A;  4YQV A;  2QSI A;  5ELG A;  3KH7 A;  6GSY A;  3O6T A;  3BD2 A;  3HKR A;  1A8L A;  3FW2 A;  2JSZ A;  4J2F A;  2OE1 A;  5HFK A;  3LEF A;  1AC1 A;  1THO A;  1PMT A;  4KW6 A;  3LSZ A;  2F8A A;  5GAN D;  4NXI A;  3WGE A;  1Q98 A;  2R2J A;  3MIX A;  1TRS A;  1GP1 A;  1BJX A;  3O3T A;  3ERF A;  2H0G A;  3TDG A;  4MJC A;  1XWC A;  2L5L A;  3RDW A;  2H1D A;  4KF9 A;  3SWL A;  1XBS A;  20GS A;  1GLQ A;  1ZGN A;  2IPA A;  5ECS A;  2J23 A;  18GS A;  2VCV A;  3ZMK A;  5E59 A;  4POL A;  1GUM A;  1EGR A;  2IL3 A;  1OC9 A;  1F6M C;  3GUR A;  3HXS A;  2VUP A;  5JCG A;  4WEY A;  4K5R A;  1LBK A;  1PN9 A;  4J57 E;  4N10 A;  2CVB A;  4WKW A;  3TJB A;  3FZA A;  2C8U A;  4DEJ A;  4IQA A;  1WIK A;  4MNN A;  1QK8 A;  3BCK A;  4HU9 A;  4PXO A;  3IC8 A;  2WUL A;  1GLP A;  1B4Q A;  4EDZ A;  1PL1 A;  1H75 A;  4K5S A;  1PSQ A;  4JRR A;  1OAZ A;  5ECL B;  2H6Z A;  3GMF A;  1O6J A;  4KSO A;  3QCP A;  5L71 A;  4NHW A;  4XTS A;  3TKQ A;  3ZML A;  1LJR A;  1EV9 A;  1MDK A;  5CP1 A;  5C04 A;  1IYH A;  2A4V A;  5B6N A;  3ERG A;  2EIQ A;  3I6A A;  3EE2 A;  3W8J A;  3LYK A;  3HJP A;  1MDJ A;  4BWS A;  4RQX A;  2JU5 A;  2LEG A;  1M2A A;  1ZZY A;  4I5Q A;  4NV5 A;  3IPZ A;  3HVX A;  1U88 A;  4K8M A;  2DC5 A;  2VLV A;  3RHC A;  4ZIJ A;  2HSM A;  3HY2 A;  4BVY A;  2H6X A;  1O85 A;  4OFN A;  2K9F A;  3GIX A;  2DSA A;  1J9B A;  19GS A;  2H1B A;  1TTZ A;  2F51 A;  3HDC A;  2KP1 A;  3LXZ A;  4ECC A;  2L5O A;  2RUE A;  5CNW A;  3BBY A;  3FMW A;  1TP9 A;  3LOR A;  22GS A;  3TOT A;  5G30 A;  1FG4 A;  2YV9 A;  4GF0 A;  3EVI A;  2IME A;  3WGD A;  5GST A;  3UBK A;  5D9T A;  4XRA A;  2MZC A;  2VCX A;  2EIR A;  2O8V B;  1ERW A;  1K0A A;  12GS A;  2YAN A;  5D8I A;  3VWV A;  1R4W A;  3PR8 A;  2HE3 A;  3O76 A;  5DCG A;  3F63 A;  4L0W A;  1PD2 1;  2O87 A;  2B1K A;  3VI7 A;  1ZMA A;  2WGR A;  2KP2 A;  4PUA A;  1B4P A;  3DGQ A;  2LTK A;  5BMU A;  1FB0 A;  1PX6 A;  1QXH A;  1OVN A;  4EL1 A;  3CTG A;  1QGV A;  4TR1 A;  3FK8 A;  4ID0 A;  2IMF A;  2TIR A;  3TUE A;  4NV2 A;  4KDU A;  1JZW A;  3GL5 A;  2JAD A;  3F3R A;  2HXK A;  4YAP A;  3CRT A;  2O85 A;  4AJ8 A;  1SL0 B;  5DAL A;  1B48 A;  5JWR B;  1BYE A;  3VI5 A;  2EC4 A;  4K0N A;  2IFQ A;  5IMZ A;  4CHS A;  1T7P B;  3N5O A;  4GCI A;  5DJM A;  11GS A;  5B6M A;  2H75 A;  1QUW A;  4NHZ A;  3GA4 A;  1FOH A;  2JZS A;  5A4U A;  4ZB6 A;  1UA5 A;  3FR6 A;  3FRC A;  1FO5 A;  3FZ4 A;  4POK A;  3FKF A;  1TJD A;  4D73 A;  2ZNM A;  1SYX A;  3ME8 A;  3E3E A;  2H73 A;  3GX8 A;  4PGT A;  2JL4 A;  1A0F A;  2CQ9 A;  4K1F A;  3VLN A;  1ZYE A;  4USS A;  2GT6 A;  3GH6 A;  4TKY A;  5A4V A;  3EIN A;  4RUV A;  1DE2 A;  2C3N A;  4ZL8 A;  3I9V 2;  4XHM A;  3NZN A;  1M0U A;  1FVJ A;  1GSF A;  3KXO A;  2ES7 A;  2AB6 A;  3GL3 A;  3QAG A;  3GRX A;  1B9Y C;  2XC2 A;  2YOI A;  2QA2 A;  1SU9 A;  3DD3 A;  3R2Q A;  2RUF A;  4MP4 A;  4IP6 A;  2H72 A;  4N30 A;  2REM A;  1EOG A;  3W8S A;  5ABR A;  1X9W B;  1CQH A;  1ZYN A;  2L59 A;  5G5F A;  4MK3 A;  1R26 A;  1GTU A;  4PQ1 A;  2X4A A;  5ENU A;  1TRU A;  5EVO A;  5G2Z A;  5D9X A;  2HYX A;  1JHB A;  1BX9 A;  2NPB A;  4G10 A;  3Q6O A;  1K0D A;  4IGJ A;  1UC7 A;  3KP8 A;  5JCW A;  2HRK A;  2H76 A;  1T00 A;  3GH9 A;  5IOW A;  4MH2 A;  1EP8 A;  5IMD A;  3EU3 A;  3F4T A;  3GTU A;  1U87 A;  2HT9 A;  4GQC A;  1T8E B;  4XS1 A;  2ON7 A;  3EMX A;  1FW1 A;  4Q5N A;  4GLT A;  3H93 A;  2H1G A;  4G0I A;  1XXU A;  4OWY A;  1GWC A;  2GDR A;  3Q18 A;  3ZZX A;  2A2S A;  5CO3 A;  4RI6 A;  1Z6M A;  2P0G A;  1OE8 A;  1AQW A;  2FWG A;  5F0G A;  5KN0 A;  3OR5 A;  3ZIT A;  2D2Z A;  2DJ0 A;  4GQF A;  2DJJ A;  2GVP A;  9GSS A;  2JZT A;  3L9U A;  4JU5 A;  4O92 A;  3IRA A;  4XS4 A;  5COH A;  3RAZ A;  4HDE A;  2GLR A;  3QMX A;  5DAK A;  1HNB A;  4YKF A;  3TB2 A;  3FZ5 A;  3A2W A;  4N0Z A;  3HZ4 A;  2OBK A;  5D96 A;  1O81 A;  1T1V A;  2GSQ A;  3GUS A;  1EOH A;  3HYP A;  2C0G A;  4K2X A;  2L4C A;  2LJA A;  2DBC A;  4IBP A;  2H74 A;  5H5Q A;  3LFL A;  1GSU A;  1GNE A;  3PGT A;  5AGY A;  1MD3 A;  1GUL A;  2VD1 A;  4KGI A;  2JSY A;  3K8N A;  1F3A A;  3IDV A;  5DBQ A;  10GS A;  1PRX A;  4PUF C;  2TRC P;  1U6T A;  4JE1 A;  2BMX A;  1K0N A;  2VO4 A;  2NBS A;  1YF1 A;  1SK1 A;  3Q19 A;  3HJM A;  2IMD A;  1S3A A;  4IJI A;  2WFC A;  2BJX A;  4F82 A;  2AV4 A;  3FR9 A;  3IAS 2;  4O7H A;  1YQ1 A;  2PMT A;  4HJM A;  2KUC A;  1UVZ A;  1ON4 A;  5HR0 A;  3DML A;  4IN0 A;  4WF4 A;  4YKG A;  1JZD A;  4KH7 A;  1RW1 A;  2IIY A;  6GSU A;  1TOF A;  1GRX A;  1G7O A;  4MLY A;  1NM3 A;  17GS A;  5D9V A;  1AUC A;  1F2E A;  3F9U A;  1BAY A;  2VCT A;  1SK2 A;  3ZFB A;  4ZB8 A;  4FYC A;  1PKZ A;  4PTS A;  3GNJ A;  4PNF A;  3QAV A;  1I9D A;  4NAX A;  2WDU A;  2XBI A;  3KTL A;  5ECI B;  4POM A;  3EYT A;  5H5S A;  1YZX A;  3KMN A;  2PBJ A;  2OKA A;  1TK0 B;  2WJU A;  3A2V A;  4KDX A;  1R5P A;  4ZBD A;  1A2J A;  1KBN A;  3LW9 A;  4POB A;  5ID2 A;  3L4N A;  2LQQ A;  4L5O A;  2IMK A;  1LU4 A;  3CSI A;  4G2E A;  3US3 A;  4TXV A;  2EIO A;  2LRN A;  5ECH B;  2YNX A;  1SL1 B;  1RQM A;  2AJQ B;  1V9W A;  1V58 A;  4DSS B;  1GNW A;  4KX4 A;  1X9S B;  4ICY A;  1E2Y A;  1K0O A;  3BOA A;  2FY6 A;  1B9X C;  4ISD A;  3M3M A;  3VPT A;  4E8E A;  1V57 A;  1JZO A;  2YN1 A;  4O5R A;  3TJJ A;  1K3Y A;  2R0G A;  1E6B A;  1KNG A;  2MBS A;  2V6K A;  3TCO A;  1UN2 A;  5B8B A;  5CRH A;  3M1G A;  1SJZ A;  2FNO A;  1HD2 A;  1W4V A;  5DAK B;  3G7I A;  1HNC A;  2PUK C;  1SYR A;  2FA4 A;  4ML1 A;  1DUG A;  2X99 A;  1A0R P;  3Q74 A;  3TKR A;  1O8W A;  3CSH A;  4MF7 A;  1ML6 A;  2YWI A;  1T3B A;  4A5P A;  1SD8 A;  3FZ9 A;  2MYG A;  1WE0 A;  5KEJ A;  2I3Y A;  5IPH A;  3IHG A;  4J56 E;  3GKM A;  4V1A p;  1K0C A;  3D4M A;  3JCM L;  2TRX A;  1MEK A;  1M99 A;  1XCC A;  1VF3 A;  1HQO A;  6GSW A;  3L78 A;  2DLX A;  2VCQ A;  5G31 A;  2XPE A;  5LNK e;  1N8J A;  1HNA A;  4IEL A;  4IVF A;  2GSS A;  2DIY A;  3G7J A;  4TN8 A;  2HNL A;  2R5G A;  4HS1 A;  1ERT A;  4YQU A;  4MH3 A;  2XPD A;  5GZZ B;  5IMC A;  2GQM A;  1AQV A;  2GGT A;  1YKC A;  1V2A A;  5DJL A;  3R3E A;  1TRV A;  5IMA A;  2B5Y A;  1X5D A;  3LJR A;  4HQS A;  2IWT A;  3BJ5 A;  3GYK A;  3MDK A;  3KCM A;  1QMV A;  3D5J A;  1VF2 A;  4KSM A;  4V1A g;  5BRT A;  3RHB A;  2FLS A;  2MMN A;  3VK9 A;  4LMW A;  2H1A A;  4WF5 A;  4WR5 A;  2QKE A;  2LKU A;  14GS A;  3VWX A;  4GSS A;  4G0L A;  1R7H A;  3EPT A;  2E7P A;  4F0B A;  1GSQ A;  2CV4 A;  4H86 A;  4DSQ A;  1OYJ A;  2LJK A;  2HZF A;  1GL8 A;  4LL4 B;  4FYB A;  5A5K A;  3IK9 A;  4MDC A;  2A4H A;  4V2N A;  4ZBA A;  3IK7 A;  1K0M A;  1F37 A;  1EWX A;  4MZW A;  5IPG A;  3KM6 A;  1SK0 A;  4K2D A;  3QOU A;  4F03 A;  1S3C A;  1N2A A;  2HZE A;  4QL7 A;  2G2Q A;  5KOW A;  1EP7 A;  2C80 A;  1T4Y A;  2KLX A;  2C4J A;  2R37 A;  3LXT A;  1OC9 B;  4EC0 A;  2P31 A;  3UAR A;  2NVL A;  5CYY A;  1JLV A;  2R6K A;  3IOS A;  5EY6 A;  2B7J A;  1ZCP A;  3KTB A;  2XBQ A;  2PVQ A;  4MZB A;  1WWJ A;  1CQG A;  4OO5 A;  2VL2 A;  1ABA A;  2LV3 A;  4EVM A;  3IAM 2;  2B7K A;  4AJ7 A;  2I1U A;  3NIV A;  4HOJ A;  3WD6 A;  2ZCT A;  1OC3 A;  1XIY A;  2CX4 A;  2OAD A;  1YDK A;  4KAE A;  2HSH A;  4JR6 A;  3UJ1 A;  2PGT A;  5ECO B;  4TR0 A;  4ECI A;  1F3B A;  5HR3 A;  4K7N A;  2ZUP A;  1Z6N A;  3LWA A;  1YKA A;  1FHE A;  4X0X A;  3E0U A;  1IYI A;  5HR1 A;  2CVD A;  1GSS A;  3FEU A;  1HYU A;  6GSX A;  5KN3 A;  2M72 A;  4EKZ A;  5CRG A;  4TXO A;  4F0C A;  4IS0 A;  5F8B A;  2VCW A;  3RBT A;  3D4T A;  4IP1 A;  5G5E A;  2I9H A;  3CMI A;  3MWH A;  2B6M A;  4BL7 A;  3KZQ A;  3UOM A;  4CW9 A;  2VL2 C;  2GTU A;  3KH9 A;  4BVY B;  3HVS A;  3UAP A;  3N9J A;  4XIH A;  4CY8 A;  2H6Y A;  4KND A;  1PKW A;  1PGT A;  5KN1 A;  2P5Q A;  4BVX A;  1EGO A;  4WET A;  3HVV A;  2LUS A;  4PNG A;  2L6D A;  3I43 A;  3GKK A;  3C1R A;  3NOF A;  1QFN A;  2AAW A;  1A2M A;  1T4Z A;  5J9B A;  1WRY A;  4Z2U A;  5J41 A;  2LRT A;  1YEP A;  5ECQ B;  2AUV A;  3DEX A;  1FAA A;  3F4S A;  2K6V A;  1XOA A;  4RI7 A;  2FUG 2;  5KN2 A;  5DQY A;  1GUH A;  5DVB A;  4I97 A;  4V2M A;  3TRX A;  1V98 A;  3QR6 A;  3H8Q A;  1JFU A;  4MF5 A;  4TR1 B;  1Y25 A;  4PQI A;  1GUK A;  3RPN A;  5IOX A;  4GTU A;  3EU4 A;  1SEN A;  2HRA A;  2VL3 A;  4WR4 A;  2C3Q A;  3ZYW A;  1NHO A;  4LMV A;  5ECN B;  4BPY A;  2I4A A;  2C0F A;  3M8N A;  1RK4 A;  5A4W A;  3HD5 A;  3TJG A;  3TRQ A;  4PQH A;  5DAL B;  3ZFL A;  4MPF A;  3I69 A;  1TI1 A;  2IFQ B;  2GST A;  4BA7 A;  2R0P A;  2FWE A;  2V6O A;  1XW5 A;  5IM9 A;  2G0F A;  1XW9 A;  4CY6 A;  1W89 A;  1TW9 A;  4DVC A;  4FYU A;  3EUR A;  1XWK A;  1O73 A;  1U3I A;  4FO5 A;  3TJK A;  2R0C A;  3M9K A;  1YEX A;  4ZBB A;  1I5G A;  2R3X A;  4D73 B;  5IQY A;  1GTA A;  4HQZ A;  4JR4 A;  3U5R E;  2YV7 A;  1V40 A;  2F9S A;  2AHE A;  1X5C A;  3ME7 A;  4ZL9 A;  2RII A;  4HI7 A;  2X8H A;  1A2L A;  3KIJ A;  3IE3 A;  5AIX A;  1NHY A;  2FD3 A;  4TRX A;  3A3T A;  5F06 A;  2F8F A;  5G1K A;  2HLS A;  2HRF A;  4ACS A;  1A8Y A;  1ZYQ B;  2XHF A;  3LGC A;  3GKX A;  1J08 A;  1SKR B;  1YJ6 A;  2KHP A;  4EDY A;  3EC3 A;  3ZVJ D;  1X5E A;  3AY8 A;  5LCZ A;  3F0I A;  2FGX A;  3HCZ A;  2FWF A;  3FHK A;  4K0G A;  3DVX A;  3V1W A;  4G9H A;  2RM5 A;  1Y6E A;  3PH9 A;  4BL7 B;  3CTF A;  3EMP A;  2O7K A;  6GSV A;  2DJ3 A;  1C72 A;  1DBY A;  4MCU A;  4OCF A;  1SKW B;  4KCE A;  2GQK A;  1O7U A;  4CDO A;  3FR3 A;  1BQ7 A;  3C71 A;  4ZXG A;  2CT6 A;  2DMM A;  3GHA A;  5C00 A;  4GRF A;  3P90 A;  13GS A;  4PUR A;  4IKH A;  2GQL A;  5B8A A;  4N11 A;  2HSY A;  2M80 A;  3J7Y b;  3UEM A;  1K3L A;  2H19 A;  2E2M A;  2GT5 A;  4DSR A;  2VIM A;  3WT2 A;  2ALB A;  2GZY A;  3DRN A;  3P8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...