4JRRA

Crystal structure of disulfide bond oxidoreductase dsba1 from legionella pneumophila
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
188
structure length
188
Chain Sequence
GSHMQFIEGKDYQTVASAQLSTNKDKTPLITEFFSYGCPWCYKIDAPLNDWATRMGKGAHLERVPVVFKPNWDLYAKAYYTAKTLAMSDKMNPILFKAIQEDKNPLATKQSMVDFFVAHGVDREIAKSAFENSPTIDMRVNSGMSLMAHYQINAVPAFVVNNKYKTDLQMAGSEERLFEILNYLVRKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Crystal structure of disulfide bond oxidoreductase DsbA1 from Legionella pneumophila
rcsb
source organism Legionella pneumophila subsp. pneumophila
total genus 65
structure length 188
sequence length 188
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4jrrA00
3KP8A 1VGLA 2JSYA 10GSA 1K0CA 2VD1A 2EIQA 1AW9A 2VCWA 4MJBA 2H1BA 2YPMA 3HDCA 4KCAA 1CQHA 3LXZA 5CREA 4RI7A 2DMMA 4RQRA 4WEYA 5CRHA 3FRCA 2IFQA 2H0IA 4MJEA 3CBUA 3KZQA 1OKDA 4ECIA 3EMPA 1XWCA 2MMOA 3I9V2 3KH7A 1USBA 4PQ1A 1QGVA 1FHEA 1UVZA 5ECRB 1A0FA 2HI7A 5ECMB 3GH6A 1YEXA 5G2ZA 2OJLA 4BA7A 9GSSA 3GKXA 1EP7A 2B3SA 2MMAA 3H79A 3TRXA 3ZTLA 4POLA 2I9HA 2RIIA 3C1RA 1KEBA 1SYXA 5JWRB 2VOCA 2WCIA 2VL3A 1K0BA 2HT9A 2C0FA 4WXTA 2H30A 17GSA 3GH9A 3D4TA 3EVIA 2OBKA 1GUMA 2EC4A 1EWXA 1R26A 2YV9A 3ZFLA 2OKAA 2DBCA 4LMWA 4K1FA 5HR3A 2H73A 1U3AA 5AIXA 2P31A 1X5EA 3CSIA 3M9JA 4YH2A 3H1NA 3RPPA 3IXRA 3KGKA 5IQYA 3AY8A 4JR4A 3KP9A 2NVLA 3A2XA 4POMA 5A4VA 5ABRA 1JZWA 4F03A 1PX6A 1T8EB 2K6VA 4KNDA 3F6FA 4J57E 3IE3A 16GSA 1K0AA 4NHZA 3ZL5A 1TI1A 3BOAA 3FK8A 2GQKA 1GSSA 2P5RA 2HZEA 5G31A 5IOWA 4XRDA 2WDUA 1WMJA 4V1Ag 4OD7A 3UBKA 1X9MB 2WJUA 3VURA 5AN1A 4X43A 5A4UA 2YN1A 3MNGA 2PVOC 1YF1A 5KN2A 2IIYA 2MMNA 5E4WA 4ML1A 2C0EA 2C1YA 3LORA 1GSUA 1G7OA 4KSMA 6GSWA 4J56E 1TK5B 3WGEA 5LCZA 1GUKA 3FW2A 2CVKA 1F6MC 4ECJA 1OYJA 4HJMA 4WKWA 2CZ3A 4F2IA 2VM2A 1XW6A 3TKSA 3SWLA 3CTFA 2HXKA 5GSSA 3VI5A 4YAVA 4WF4A 4OCFA 5F06A 1TRWA 3H4KA 1U6TA 5CRDA 1YZXA 2FA4A 4GRFA 5J9CA 1T1VA 4FYUA 3DIEA 3VK9A 3C71A 4I8BA 3HJOA 2HZFA 3BCKA 1S3CA 2FLSA 1QXHA 4MF5A 1OC3A 2H70A 4D73B 12GSA 2VLTA 3NIVA 4BWSA 3D6IA 2FGXA 3DEXA 4TXOA 1ERVA 3RAZA 5DQYA 4PQIA 1YQ1A 4MJCA 5IMAA 3U6VA 2KLXA 4OWYA 1YEPA 4BL7A 3VPQA 3GSSA 1FO5A 1FVKA 1M9AA 2ZNMA 1A23A 3ZIJA 3IRAA 5ECOB 3G7YA 1Z6MA 3GV1A 4JEDA 3GURA 4N0VA 4ZB9A 2GSQA 4ML6A 1EEMA 2O7KA 5D9WA 3D4MA 3G7IA 4WR4A 3QAWA 2F51A 2HNLA 3HZ4A 3A3TA 4TR4A 2YZHA 1MD4A 4POKA 3VI7A 1B8XA 2RM6A 3A2VA 2HYXA 1XWBA 2LUSA 3CXGA 1OKTA 3L4NA 4PNFA 3HY2A 2VLUA 2YP6A 7GSSA 3Q74A 3BD2A 2NPBA 2H75A 3RHCA 1XWGA 2CVBA 2A2RA 4CHSA 4ZL8A 2B1LA 4V1Ap 3L9UA 3I6AA 3UARA 5IMFA 6GSXA 2X8GA 2H19A 4IGJA 2K8VA 2N5AA 1PMTA 2XHFA 3DWVA 5GZZB 2C8UA 2V41A 3LXTA 4EVMA 4F0BA 4IVFA 1O81A 1XCCA 4MABA 1E6BA 4ECCA 3TKSC 1HNCA 2HE3A 5C00A 5IIZA 1WE0A 5KN1A 3DKSA 1ZOFA 5ELGA 3APQA 4AF2A 2C0DA 2VL2C 2FUG2 4FIWA 2FA8A 2VD0A 5DJLA 4IN0A 4LL1B 5HR2A 5E59A 3QOUA 1Z3EA 1O85A 3GA4A 2B7JA 3IDVA 5D96A 3F4RA 1M2DA 3KXOA 4LMVA 2WULA 5DVBA 3DVWA 4KB3A 1A2LA 1A2JA 1TI3A 3D0ZA 4N11A 2NBSA 4HQZA 4MP4A 2JACA 4FYCA 2XPDA 2OE3A 4MF6A 4KW6A 2AUVA 2A4VA 2VCZA 5CYYA 3GL5A 4IJIA 1TRVA 5G5EA 1O8WA 2LTKA 5IPGA 3D21A 1ST9A 3TKQA 1TU7A 5ECLB 2AJQB 3UVTA 4EC0A 3JCML 6GSTA 4L8EA 2CAQA 3R2QA 2AV4A 3GHAA 1X0RA 3ZZXA 1TDIA 1TRUA 3ZVJD 4KX4A 2ES7A 2FWEA 5HR1A 2C0GA 3WT2A 2LSTA 4N0ZA 3E0UA 1HNBA 5AIVA 4EDYA 19GSA 2OE0A 3TRQA 2X64A 1SKSB 1A2MA 1W4VA 3D22A 3C73A 3VWVA 1AQXA 1BAYA 4F82A 5ECKB 3VWWA 5CP1A 3F9UA 4K7IA 3W6GA 2JZRA 5IMVA 2GZYA 1Z5YE 5IMDA 3US3A 4JZQA 2QKEA 3E3EA 1PN9A 4MMMA 1SKRB 2H6XA 2IWTA 3CRTA 2DMLA 4MH3A 4YQMA 20GSA 1AAZA 2EIRA 5COHA 5B6NA 4KDXA 2GQLA 2VCQA 1OVNA 2O8VB 4HZ2A 1SJ6A 2E2MA 2O85A 5EVOA 3GKMA 4MLYA 4E8EA 5CNWA 1QK8A 4F0CA 3GTUA 3HJMA 4X0XA 1XW5A 5IO0A 2MBSA 4CW9A 4MZBA 3P7XA 4O92A 5IMCA 4TXVA 5F07A 3M9KA 3TJFA 1XOAA 1SJIA 1OE7A 2VAFA 3CSHA 3W8JA 4KDYA 3TOUA 1URMA 3WGXA 3APSA 5ECHB 3Q6OA 1WP0A 4XTSA 2VLVA 4CDOA 2H6ZA 4KAEA 1TP9A 1V58A 4LLRA 4V2MA 2LQOA 1RQMA 3ERWA 5J9BA 1O6JA 2H1AA 3GMFA 1HD2A 2WGRA 1B9YC 4V2NA 3G7JA 2GSSA 3IC4A 4TRXA 2OADA 2G2QA 4HQSA 3FKFA 1THOA 1VF4A 4OFMA 4HEA2 5FT3A 4ZBAA 4MPFA 1C72A 4TR1A 2R3XA 1K0DA 1AQWA 2H1DA 3M0FA 5JWOB 3F4TA 2DIZA 2HRFA 1Z7RA 4MH2A 4ZBDA 6GSSA 6GSVA 2DJJA 1JHBA 2VL9A 3LFLA 1A8YA 4K7OA 3C8EA 4K0GA 3DMLA 2JZTA 1YKCA 4ZB6A 2PN8A 2FWHA 2GT6A 4KA0A 1K0NA 3M8NA 4WETA 5ID2B 4K7NA 2E0QA 3O76A 4TR3A 4JRRA 4WF5A 1EOGA 1WOUA 4KE3A 1JLVA 5ECNB 3EC3A 4RUVA 4LA1A 2GVPA 2LEGA 1M7TA 2NTOA 1ZL9A 1BYEA 1DE2A 2H72A 3C7MA 1A8LA 4MF7A 4ACSA 1KBNA 1WWJA 2AYTA 3TKPA 1NHYA 5D8IA 5H5RA 5IPHA 3KCMA 2C4JA 2J9HA 5LD0A 3D5JA 4HDEA 22GSA 5DAKB 3WT1A 2IL3A 5B7CA 2R4VA 1PKWA 3FZAA 1KTEA 1XXUA 2O87A 4EDZA 3EE2A 2LJAA 1ZYQB 5DALB 1R7HA 2L6CA 1F37A 1QMVA 5DQSA 3ED3A 2R5GA 4MA9A 2GQMA 3FR9A 3LWAA 4EUYA 5D9TA 2X8HA 2OACA 4TW5A 6GSUA 4NXIA 2FWFA 2RUEA 2HRNA 3Q18A 2L5OA 3GFKA 3W8SA 3IAS2 2GSRA 3GKKA 1TJDA 4L0WA 4I5QA 4XS4B 4AGSA 2I1UA 4TVEA 1LU4A 2RUFA 4IP6A 3PR8A 2EIOA 4DSSA 2GGTA 3QFAC 1GLQA 1PQNA 1X5DA 2LS5A 2V6OA 1B9XC 2KP1A 3ZMLA 1PGTA 3MWHA 1AQVA 4WBJA 4NHWA 2CX3A 1WIKA 1FW1A 4TOPA 2M80A 4L5LA 5H5QA 3TUEA 4DSRA 3DGQA 5EL8A 4G10A 2FNOA 3L78A 3RPNA 3LEFA 2CX4A 3GIXA 1U88A 5HQPA 4I2UA 1EV9A 5G5FA 3APOA 2F9SA 2IJYA 3FZ4A 5AGYA 4GWRA 1K0OA 5ENUA 1MDIA 4EF0A 4NAXA 3FY7A 1O7UA 1SKWB 4OMVA 2YWOA 1FB0A 3LYKA 4HI7A 5KEJA 2JSZA 2QGVA 4E8HA 2CZ2A 2XPEA 3WYWA 2R2JA 1A24A 2E7PA 3PGTA 4Q5QA 5KN3A 3ZVJA 3ZLPA 2DJ2A 5ECQB 2DSAA 1GULA 4ZXGA 1V98A 1T4YA 2C80A 3F3QA 1G0TA 2RM5A 4OFNA 3GYKA 4KUNA 1T3BA 1S3AA 1R5AA 3TKRA 1M2BA 1AXDA 4YAPA 3ERGA 1GL8A 4GSSA 2AB6A 3I69A 1XOBA 2V1MA 2PUKC 2YZUA 4YQVA 2R6KA 3PH9A 4F9ZA 1GRXA 1G7EA 2RLIA 4HUAA 2K9FA 1R5PA 8GSSA 5JWQB 3FR3A 4HOJA 3I43A 4IW9A 3GUSA 2IMIA 1GSEA 3QFBC 4K2DA 2TRCP 1JFUA 2MZCA 13GSA 2O89A 3M1GA 1ABAA 1JZRA 2YJHA 4ECBA 4O5RA 3FZ5A 5GSTA 5ECPB 1Z9HA 5EY6A 3L0HA 1V2AA 3MAKA 2PMTA 1XVWA 4TR0A 1EOHA 1XWAA 4KDUA 4PX1A 1MDJA 4PGTA 2CT6A 4Z7XA 4QL7A 4MZWA 2YOIA 1GNWA 4WR5A 2FCHA 2YJ7A 1ZCPA 3A5WA 1J9BA 2G0FA 1ACVA 3HA9A 3GL3A 2VM1A 3H8QA 3TGZA 4EXJA 4ZIJA 1GTAA 1ON4A 2H1GA 3CRUA 4IJ3A 4GXZA 4WBRD 4V2LA 4FH8A 2HSHA 1XPVA 2CQ9A 3HYPA 1EP8A 1ERUA 3KD0A 4L5OA 3TJGA 1SK1A 1XVQA 2BMXA 2FY6A 2IFQB 2PWJA 4L0UA 1GTBA 5D73A 3UMAA 4POBA 4GSNA 4H86A 1OC9A 3ZIVA 3ZITA 1PA3A 2DC5A 2KUCA 3L9SA 3GNJA 2KOKA 1VRSD 1M99A 2F8FA 1PRXA 5EPFA 4PQHA 1FOVA 1QUWA 5LNKe 3LQ7A 3K8NA 4OCEA 3KM6A 2GZPA 3GKNA 2AHEA 1WPIA 1IYIA 3UVHA 2AAWA 3F8UA 1T4ZA 3IK7A 4IELA 1XW9A 3UIWA 3SBCA 3P90A 2H6YA 2FHEA 5DBQA 3Q19A 1NHOA 4GQFA 1R4WA 1YY7A 3QMXA 5J41A 1HQOA 5F0GA 5G1KA 1LBKA 5A4WA 4X1UA 4HZ4A 1SL0B 4PUFC 1TW9A 2YWNA 2YV7A 3KTLA 2ON7A 2LRCA 1BX9A 2GZZA 2LNTA 3HCZA 1B4PA 3N5OA 1PKZA 3UOMA 2WRTA 2V2GA 1JZDA 2DIYA 5CRWA 1HNAA 2VCTA 1GNEA 3C1SA 4OFTA 3EU3A 3LYPA 1TOFA 5JCGA 2VCVA 3EMXA 1M2AA 4FYBA 2YCDA 2L59A 3BJ5A 2LJRA 4K6XA 3CSJA 4Q5FA 3TOTA 2HZEB 5B6MA 4DSQA 4IKHA 2B1KA 1YJ6A 2VIMA 5JCUA 2LQQA 4Q5NA 5D9VA 5A5KA 1QFNA 4HJ2A 4NMUA 3RDWA 3WD6A 1JLWA 3GSTA 2CAIA 5B8AA 2IMKA 3NOFA 3F4SA 5IOXA 2JL4A 4KH7A 5F05A 5J4UA 1F3AA 4OO5A 3ZREA 5ECSA 4MCUA 2C3NA 2VUPA 2YNXA 4FO5A 3BBYA 1X9WB 3HXSA 3RBTA 3IAM2 4AJ8A 5G30A 1TXXA 1K3YA 2I3YA 3GRXA 2N5BA 2K18A 4OO4A 2C3TA 4JR6A 1DSBA 2L4CA 1XIYA 1XFLA 4G9HA 3E9JB 1F3BA 3EINA 2CVDA 5DJMA 5ELAA 1S3DA 1FAAA 3P8WA 2X99A 1VF1A 3TCOA 1K3LA 5L71A 1U3IA 1X5CA 1TKDB 1OC8A 3U5RE 18GSA 1BG5A 4TXOB 5H5SA 2GTUA 3TJKA 1DE1A 5FHIA 3UEMA 1SK0A 4LL4B 4XCSA 3IK9A 1Y6EA 4NV2A 1BJXA 3TRPA 1SD8A 2NDOA 4IBPA 2V32A 4GCIA 1A0RP 4XRAA 2PERA 5D9XA 2IN3A 4DVCA 3IOSA 1SENA 1QQ2A 2XBIA 3KMNA 4ZBBA 3P2AA 3L9VA 4QL9A 4NPBA 3HVXA 2H66A 4PURA 1F9MA 1SD9A 2ZCTA 3VFIA 4HU7A 4TKYA 3HVSA 3QPMA 3LJRA 3ME8A 3IR4A 2XC2A 2B5YA 3F63A 1O8XA 1I5GA 3BCIA 2PPTA 5C04A 3ME7A 2ALBA 5G1LA 4MJAA 2MYGA 1ZYEA 4BPYA 3EU4A 1Z7PA 4N10A 4N30A 1V57A 4O7HA 1GTUA 1O73A 3PINA 1YDKA 3O6TA 5HFGA 1N2AA 3F0IA 2P0GA 3VPTA 2E2GA 3CTGA 1GLPA 2B5EA 3IPZA 2D2ZA 1TK8B 3F3RA 4Q5RA 1MTCA 2I81A 1SU9A 4YQUA 4PUAA 2YANA 1U87A 1PD21 2WFCA 2HSYA 4KCEA 4K9ZA 4KSOA 4O32A 2J23A 2VO4A 1GP1A 3TDGA 2ZUPA 5J5NA 1MEKA 3F6DA 4XHMA 3FEUA 3QD9A 3HHVA 3QR6A 3ISOA 4IHUA 2QC7A 2DJKA 1DUGA 2OBIA 1T7PB 2QSIA 4NV5A 2VL2A 3DD3A 3KEBA 2H74A 3ZRDA 1K3OA 3FZ9A 3UBLA 2KP2A 5INYA 2L4QA 5HR0A 2B7KA 1OC9B 3ZYWA 1IYHA 5B8BA 2VCXA 1TK0B 4PNGA 3MSZA 14GSA 4G2EA 4PXOA 2OA7A 1B4QA 2FD3A 2P5QA 3EWLA 3KIJA 2FWGA 2M46A 3DRNA 4EKZA 3UJ1A 4JU5A 1NSWA 3QCPA 1SJZA 1SL1B 1ILOA 3M3MA 3ERFA 4ZL9A 1HYUA 5ID2A 4MPGA 4IP1A 4GF0A 1WJKA 4BWQA 1X9SB 4ID0A 2F8AA 3GX8A 1AUCA 5IM9A 1Z6NA 1H75A 2YWIA 3TB2A 1XWKA 3QDNA 2Z9SA 6GSYA 4DEJA 1TTZA 2JU5A 1Q4JA 1GSDA 5KN0A 2K8SA 3FHKA 2GT5A 3MDKA 4HS1A 3CYNA 4JE1A 3FYGA 2MMZA 5CO3A 3HJPA 2H71A 4XS1A 2H0HA 1FVJA 3NZNA 1GSQA 3V1WA 1UA5A 2REMA 4IQAA 4AJ6A 2F3MA 5DAKA 1E2YA 1THXA 1CQGA 4GSTA 2DLXA 1N8JA 4ISDA 3IA1A 1PX7A 1BEDA 1ERTA 1RW1A 4ZB8A 4EL1A 4HU9A 2ON5A 3GTUB 2R37A 1EZKA 5DALA 3LSZA 3H93A 3HD5A 1YKAA 1W89A 1XZOA 3TKSE 3EYTA 4AJ7A 1LJRA 2HLSA 5IMZA 2TIRA 5DCHA 3VWXA 5DCGA 3J7Yk 3IHQA 1ZGNA 2GLRA 1GWCA 2LV3A 5AISA 1Q98A 5ECIB 4XS4A 1V40A 2BTOT 4EO3A 1GH2A 4NWYA 4I97A 1EEJA 1ERWA 1Y25A 1M0UA 3A2WA 1DBYA 2IMDA 2XBQA 2DJ1A 3HKRA 1PL1A 1VF3A 1MDKA 2JADA 2H0GA 4RI6A 1T00A 3KTBA 3WGDA 1UN2A 3S9FA 3DXBA 4TR1B 2H8LA 4K8MA 3IV4A 2CA8A 3GX0A 1ML6A 2JZSA 2H76A 1WRYA 1TRSA 5DDLA 3VWUA 2BJXA 2IMFA 4D73A 2L57A 1SL2B 5GAND 2YWMA 3KH9A 2DJ0A 4XS6A 4BVXA 1GSFA 4GLTA 2GSTA 3RHBA 1OE8A 4IS0A 1B48A 1G6WA 1XBSA 5HFKA 3ZMKA 1VF2A 1TU8A 2GS3A 3VLNA 4ILFA 5F8BA 1GSYA 3KJYA 1UC7A 2PVQA 4ZL7A 4P3YB 2PGTA 4TN8A 5HFIA 3O3TA 4GQCA 2A2SA 4MDCA 2KHPA 1EGOA 1YF0A 3DVXA 1K0MA 2OE1A 2GDRA 3GN3A 3QAVA 1KNGA 1NW2A 2WS2A 2HFDA 3HVVA 1GUHA 5FWGA 1J08A 2CV4A 1FG4A 2N5FA 4ULXA 3HZ8A 3CMIA 2TRXA 3KMOA 2PU9C 5IO2A 3J7Yb 1AIUA 1OAZA 2LRNA 1G6YA 1FB6A 3N9JA 3DYRA 2B6MA 1ZMAA 2WZ9A 4XIHA 4J2FA 11GSA 2L6DA 3G9BA 3EURA 2LRTA 3TJJA 2LJKA 5CAXA 4JBBA 4RQXA 1I9DA 1BQ7A 3OR5A 5GAPD 1J0FA 2X8CA 5JCWA 1GTIA 3UAPA 3FR6A 4EE0A 1PL2A 3IBHA 4I6XA 3QAGA 2H01A 2L5LA 1AC1A 1MD3A 1V9WA 4KGIA 2DJ3A 4MZCA 4DSSB 2LNSA 1EV4A 4ZILA 4QQ7A 2IPAA 2LKUA 2PBJA 1H4OA 2B5XA 4BVYA 3TJBA 5J3RA 5CRGA 5D93A 1RK4A 1SK2A 1F2EA 2M72A 2I4AA 2IMEA 2MBTA 1ZZYA 4GTUA 2C3QA 4K0NA 3ZFBA 2WB9A 2V6KA 1PSQA 3UL3A 1M9BA 1EGRA 3LG6A 4IQ1A 1NM3A 4MK3A 3LGCA 1JZOA 4I2TA 4G19A 1SYRA
chains in the Genus database with same CATH superfamily
3KP8A 1VGLA 2JSYA 10GSA 1K0CA 2VD1A 2EIQA 1AW9A 2VCWA 4MJBA 2H1BA 2YPMA 3HDCA 4KCAA 1CQHA 3LXZA 5CREA 4RI7A 2DMMA 4RQRA 4WEYA 5CRHA 3FRCA 2IFQA 4USSA 2H0IA 4MJEA 3CBUA 3KZQA 1OKDA 4ECIA 3EMPA 1XWCA 2MMOA 3I9V2 3KH7A 1USBA 4PQ1A 1QGVA 1FHEA 1UVZA 5ECRB 1A0FA 2HI7A 5ECMB 1S3RA 3GH6A 1YEXA 5G2ZA 2OJLA 4BA7A 9GSSA 3GKXA 1EP7A 2B3SA 2MMAA 4HSCX 3H79A 3TRXA 3ZTLA 4POLA 2I9HA 2RIIA 3C1RA 1KEBA 1SYXA 5JWRB 2VOCA 2WCIA 2VL3A 1K0BA 2HT9A 2C0FA 4WXTA 2H30A 17GSA 3GH9A 3D4TA 3EVIA 2OBKA 1GUMA 2EC4A 1EWXA 1R26A 2YV9A 3ZFLA 2OKAA 2DBCA 4LMWA 4K1FA 5HR3A 2H73A 1U3AA 5AIXA 2P31A 1X5EA 3CSIA 3M9JA 4YH2A 3H1NA 3RPPA 3IXRA 3KGKA 5IQYA 3AY8A 4JR4A 3KP9A 2NVLA 3A2XA 4POMA 5A4VA 5ABRA 1JZWA 4F03A 1PX6A 3HVNA 1T8EB 3A5IA 2K6VA 4KNDA 3F6FA 4J57E 4CY6A 3IE3A 16GSA 1K0AA 4NHZA 3ZL5A 1TI1A 3BOAA 3FK8A 2GQKA 1GSSA 2P5RA 2HZEA 5G31A 5IOWA 4XRDA 2WDUA 1WMJA 4V1Ag 4OD7A 3UBKA 1X9MB 2WJUA 3VURA 5AN1A 4X43A 5A4UA 2YN1A 3MNGA 2PVOC 1YF1A 5KN2A 2IIYA 2MMNA 5E4WA 4ML1A 2C0EA 2C1YA 3LORA 1GSUA 1G7OA 4KSMA 6GSWA 4J56E 1TK5B 3WGEA 5LCZA 1GUKA 3FW2A 2CVKA 1F6MC 4ECJA 1OYJA 4WKWA 4HJMA 2CZ3A 4F2IA 2VM2A 1XW6A 3TKSA 3SWLA 3CTFA 2HXKA 5GSSA 1ZYNA 3VI5A 4YAVA 4WF4A 4OCFA 5F06A 1TRWA 3H4KA 1U6TA 5CRDA 1YZXA 2FA4A 4GRFA 5J9CA 1T1VA 4FYUA 3DIEA 3VK9A 3C71A 4I8BA 3HJOA 2HZFA 3BCKA 4YKGA 1S3CA 2FLSA 1QXHA 4MF5A 1OC3A 2H70A 4D73B 12GSA 2VLTA 3NIVA 4BWSA 3D6IA 2FGXA 3DEXA 4TXOA 1ERVA 3RAZA 5DQYA 4PQIA 1YQ1A 2R0CA 4MJCA 5IMAA 3U6VA 2KLXA 4OWYA 1YEPA 4BL7A 3VPQA 3GSSA 1FO5A 1FVKA 1M9AA 2ZNMA 1A23A 3ZIJA 3IRAA 5ECOB 3G7YA 1Z6MA 3GV1A 4JEDA 3GURA 4N0VA 4ZB9A 4O5QA 2GSQA 4ML6A 1EEMA 2O7KA 5D9WA 3D4MA 3G7IA 4WR4A 3QAWA 2F51A 2HNLA 3HZ4A 3A3TA 4TR4A 2YZHA 1MD4A 4POKA 3VI7A 1B8XA 2RM6A 3A2VA 2HYXA 1XWBA 2LUSA 3CXGA 1OKTA 3L4NA 4PNFA 3HY2A 2VLUA 2YP6A 7GSSA 3Q74A 3BD2A 2HRKA 2NPBA 2H75A 3RHCA 1XWGA 2CVBA 2A2RA 4CHSA 4ZL8A 2B1LA 4V1Ap 1M3JA 3L9UA 3I6AA 3UARA 4K5SA 5IMFA 6GSXA 2X8GA 2H19A 4IGJA 2K8VA 2N5AA 1PMTA 2XHFA 3DWVA 5GZZB 1PN0A 2C8UA 2V41A 3LXTA 4EVMA 4F0BA 4IVFA 1O81A 1XCCA 4MABA 1E6BA 4ECCA 3TKSC 1HNCA 2HE3A 5C00A 5IIZA 1WE0A 5KN1A 3DKSA 1ZOFA 5ELGA 3APQA 4AF2A 2C0DA 2VL2C 2FUG2 4FIWA 2FA8A 2VD0A 5DJLA 4IN0A 4LL1B 4BVYB 5HR2A 5E59A 3QOUA 1Z3EA 1O85A 3GA4A 2B7JA 3IDVA 5D96A 3F4RA 1M2DA 3KXOA 4LMVA 2WULA 5DVBA 3DVWA 4KB3A 1A2LA 1A2JA 1TI3A 3D0ZA 4N11A 4FQUA 2NBSA 4HQZA 4MP4A 2JACA 4FYCA 2XPDA 2OE3A 4MF6A 4KW6A 2AUVA 2A4VA 2VCZA 3GL5A 5CYYA 4IJIA 1TRVA 5G5EA 1O8WA 2LTKA 5IPGA 3D21A 1ST9A 3TKQA 1TU7A 5ECLB 2AJQB 3UVTA 4EC0A 3JCML 6GSTA 4Z2UA 4L8EA 2CAQA 3R2QA 2AV4A 3GHAA 1X0RA 3ZZXA 1TDIA 1TRUA 3ZVJD 4KX4A 2ES7A 2FWEA 5HR1A 2C0GA 3WT2A 2LSTA 4N0ZA 3E0UA 1HNBA 5AIVA 4EDYA 19GSA 2OE0A 3TRQA 2X64A 1SKSB 1A2MA 1W4VA 3D22A 3C73A 3VWVA 1AQXA 1BAYA 4F82A 5ECKB 3VWWA 5CP1A 3F9UA 4K7IA 3W6GA 2JZRA 5IMVA 2GZYA 1Z5YE 5IMDA 3US3A 4JZQA 2QKEA 3E3EA 1PN9A 4MMMA 1SKRB 2H6XA 2IWTA 3CRTA 2DMLA 4MH3A 4YQMA 20GSA 1AAZA 4X4JA 2EIRA 5COHA 5B6NA 4K2XA 4KDXA 2GQLA 2VCQA 1OVNA 2O8VB 4HZ2A 1SJ6A 2E2MA 2O85A 5EVOA 3GKMA 4MLYA 4E8EA 5CNWA 1QK8A 4F0CA 3GTUA 3HJMA 4X0XA 1XW5A 5IO0A 2MBSA 4CW9A 4MZBA 3P7XA 4O92A 5IMCA 4TXVA 5F07A 3M9KA 3TJFA 1XOAA 1SJIA 1OE7A 2VAFA 3CSHA 4MNNA 3W8JA 4KDYA 3TOUA 1URMA 3WGXA 3APSA 5ECHB 3Q6OA 1WP0A 4XTSA 2VLVA 4CDOA 2H6ZA 4KAEA 1TP9A 1V58A 4LLRA 4V2MA 2LQOA 1RQMA 3ERWA 5J9BA 1O6JA 2H1AA 3GMFA 1HD2A 2WGRA 1B9YC 4V2NA 3G7JA 2GSSA 3IC4A 4TRXA 2OADA 2G2QA 4HQSA 3FKFA 1THOA 1VF4A 4OFMA 4HEA2 5FT3A 4ZBAA 4MPFA 1C72A 4TR1A 2R3XA 1K0DA 1AQWA 2H1DA 3M0FA 5JWOB 3F4TA 2DIZA 2HRFA 1Z7RA 4MH2A 4ZBDA 6GSSA 6GSVA 2DJJA 1JHBA 2VL9A 3LFLA 1A8YA 4K7OA 3C8EA 2DKIA 4K0GA 1PFOA 3DMLA 2JZTA 1YKCA 4ZB6A 2PN8A 2FWHA 2GT6A 4KA0A 1K0NA 3M8NA 4WETA 5ID2B 4K7NA 2E0QA 1ZYPA 4G0IA 3O76A 4TR3A 4JRRA 4WF5A 1EOGA 1WOUA 4KE3A 1JLVA 5ECNB 3EC3A 4RUVA 4LA1A 2GVPA 2LEGA 1M7TA 2NTOA 1ZL9A 1BYEA 1DE2A 2H72A 3C7MA 1A8LA 4MF7A 4ACSA 1KBNA 1WWJA 2AYTA 3TKPA 1NHYA 5D8IA 5H5RA 5IPHA 3KCMA 2C4JA 2J9HA 5LD0A 3D5JA 4HDEA 22GSA 5DAKB 3WT1A 2IL3A 5B7CA 2R4VA 1PKWA 3FZAA 1KTEA 1XXUA 2O87A 5KOXA 4EDZA 3EE2A 2LJAA 1ZYQB 5DALB 1R7HA 2L6CA 1F37A 1QMVA 5DQSA 3ED3A 2R5GA 4MA9A 2GQMA 3FR9A 3LWAA 4EUYA 5D9TA 2X8HA 2OACA 4TW5A 6GSUA 4NXIA 2FWFA 2RUEA 2HRNA 3Q18A 2L5OA 3GFKA 3W8SA 3IAS2 2GSRA 3GKKA 1TJDA 4L0WA 4I5QA 4XS4B 4AGSA 2I1UA 4TVEA 1LU4A 2RUFA 4IP6A 3PR8A 2EIOA 4DSSA 2GGTA 3QFAC 1GLQA 1PQNA 1X5DA 2LS5A 2V6OA 1B9XC 2KP1A 3ZMLA 1PGTA 3MWHA 1AQVA 4WBJA 4NHWA 2CX3A 1WIKA 1FW1A 4TOPA 2M80A 4L5LA 5H5QA 3TUEA 4DSRA 3DGQA 5EL8A 4G10A 2FNOA 3L78A 3RPNA 3LEFA 2CX4A 3GIXA 1U88A 5HQPA 4I2UA 1EV9A 5G5FA 3APOA 2F9SA 2IJYA 3FZ4A 5AGYA 4GWRA 1K0OA 5ENUA 1MDIA 4EF0A 4Z2RA 4NAXA 4BVXB 3FY7A 1O7UA 1SKWB 4OMVA 2YWOA 1FB0A 3LYKA 4HI7A 5KEJA 2JSZA 2QGVA 4E8HA 2CZ2A 2XPEA 3WYWA 2R2JA 1A24A 2E7PA 3PGTA 4Q5QA 5KN3A 3ZVJA 3ZLPA 2DJ2A 5ECQB 2DSAA 1GULA 4ZXGA 1V98A 1T4YA 2C80A 3F3QA 1G0TA 2RM5A 4OFNA 3GYKA 5BMUA 4KUNA 1T3BA 1S3AA 1R5AA 3IC8A 3TKRA 1M2BA 1AXDA 4YAPA 3ERGA 1GL8A 4GSSA 2AB6A 3I69A 1XOBA 2V1MA 2PUKC 4CY8A 2YZUA 4YQVA 2R6KA 3PH9A 4F9ZA 1GRXA 1G7EA 2RLIA 4HUAA 2K9FA 1R5PA 8GSSA 5JWQB 3MIXA 3FR3A 4HOJA 3I43A 4IW9A 3GUSA 2IMIA 1GSEA 4ICYA 3QFBC 4K2DA 2TRCP 4EIQA 1JFUA 2MZCA 13GSA 2O89A 3M1GA 2UZ8A 1ABAA 1JZRA 2YJHA 4ECBA 4O5RA 3FZ5A 5GSTA 5ECPB 1Z9HA 5EY6A 3L0HA 1V2AA 3MAKA 2PMTA 1XVWA 2HRAA 4KF9A 4TR0A 1EOHA 1XWAA 4KDUA 4PX1A 1MDJA 4PGTA 2CT6A 4Z7XA 4QL7A 4MZWA 2YOIA 1GNWA 4WR5A 2FCHA 2YJ7A 1ZCPA 3A5WA 1J9BA 2G0FA 1ACVA 3HA9A 3GL3A 2VM1A 3H8QA 3TGZA 2X49A 4EXJA 4ZIJA 1GTAA 1ON4A 2H1GA 3CRUA 4IJ3A 4GXZA 4WBRD 4V2LA 4FH8A 2HSHA 1XPVA 2CQ9A 3HYPA 1EP8A 1ERUA 3KD0A 4L5OA 3TJGA 1SK1A 1XVQA 4EIPA 2BMXA 2FY6A 2IFQB 2PWJA 4L0UA 1GTBA 5D73A 3UMAA 4POBA 4GSNA 4H86A 1OC9A 3ZIVA 3ZITA 1PA3A 2DC5A 2KUCA 3L9SA 3GNJA 2KOKA 1VRSD 1M99A 2F8FA 1PRXA 5EPFA 4PQHA 1FOVA 1QUWA 5LNKe 3LQ7A 3K8NA 4OCEA 3KM6A 2GZPA 3GKNA 4O5UA 2AHEA 3EPTA 1WPIA 1IYIA 3UVHA 2AAWA 3F8UA 1T4ZA 3IK7A 4IELA 1XW9A 3UIWA 3SBCA 3P90A 2H6YA 2FHEA 5DBQA 3Q19A 1NHOA 4GQFA 1R4WA 1YY7A 3QMXA 5J41A 1HQOA 5F0GA 5G1KA 1LBKA 5A4WA 4X1UA 4HZ4A 1SL0B 4PUFC 2R0PA 1TW9A 2YWNA 2YV7A 3KTLA 2ON7A 2LRCA 1BX9A 2GZZA 2LNTA 3HCZA 1B4PA 4K5RA 3N5OA 1PKZA 3UOMA 2WRTA 2V2GA 1JZDA 2DIYA 5CRWA 1HNAA 2VCTA 1GNEA 3C1SA 4OFTA 3EU3A 3LYPA 1TOFA 5JCGA 2VCVA 3EMXA 1M2AA 4FYBA 2YCDA 2L59A 3BJ5A 2LJRA 4K6XA 3CSJA 4G0LA 4Q5FA 3TOTA 2HZEB 5B6MA 4DSQA 4IKHA 2B1KA 1YJ6A 2VIMA 5JCUA 2LQQA 4Q5NA 5D9VA 5A5KA 1QFNA 4HJ2A 4NMUA 3RDWA 3WD6A 1JLWA 3GSTA 2CAIA 5B8AA 2IMKA 3NOFA 3F4SA 5IOXA 2JL4A 4KH7A 5F05A 5J4UA 1F3AA 4OO5A 3ZREA 5ECSA 4MCUA 2C3NA 2VUPA 2YNXA 4FO5A 3BBYA 1X9WB 3HXSA 3RBTA 3IAM2 4AJ8A 5G30A 1TXXA 1K3YA 2I3YA 3GRXA 2N5BA 2K18A 4OO4A 2C3TA 4JR6A 3FMWA 1DSBA 2L4CA 1XIYA 1XFLA 4G9HA 3E9JB 1F3BA 3EINA 2CVDA 5DJMA 5ELAA 1S3DA 1FAAA 3P8WA 2X99A 1VF1A 3TCOA 1K3LA 5L71A 1U3IA 1X5CA 1TKDB 1OC8A 3U5RE 18GSA 1BG5A 4TXOB 5H5SA 2GTUA 3TJKA 1DE1A 5FHIA 3UEMA 4BL7B 1SK0A 4LL4B 4XCSA 3IK9A 1Y6EA 4NV2A 1BJXA 3TRPA 1SD8A 2NDOA 4IBPA 2V32A 4GCIA 1A0RP 4XRAA 2PERA 5D9XA 2IN3A 4DVCA 3IOSA 1SENA 1QQ2A 3PPUA 2XBIA 3KMNA 4ZBBA 3P2AA 3L9VA 2HSMA 4QL9A 4NPBA 3HVXA 2H66A 4PURA 1F9MA 1SD9A 2ZCTA 3VFIA 4HU7A 4TKYA 3HVSA 5KOWA 3QPMA 3LJRA 3ME8A 3IR4A 2XC2A 2B5YA 3F63A 1O8XA 1I5GA 3BCIA 2PPTA 5C04A 3ME7A 2ALBA 5G1LA 4MJAA 2MYGA 1ZYEA 4BPYA 3EU4A 1Z7PA 4N10A 4N30A 1V57A 4O7HA 1GTUA 1O73A 3PINA 1YDKA 3O6TA 5HFGA 1N2AA 3F0IA 2P0GA 3VPTA 2E2GA 3CTGA 1GLPA 2B5EA 3IPZA 2D2ZA 1TK8B 3F3RA 4Q5RA 1MTCA 2I81A 1SU9A 4YQUA 4PUAA 2YANA 1U87A 1PD21 2WFCA 2HSYA 4KCEA 4K9ZA 4KSOA 4O32A 2J23A 2VO4A 1GP1A 3TDGA 2ZUPA 5J5NA 1FOHA 1MEKA 3F6DA 4XHMA 3FEUA 3QD9A 3IHGA 3HHVA 3QR6A 3ISOA 4IHUA 2QC7A 2DJKA 1DUGA 2OBIA 1T7PB 2QSIA 4NV5A 2VL2A 3DD3A 3KEBA 2H74A 3ZRDA 1K3OA 3FZ9A 3UBLA 2KP2A 5INYA 2L4QA 5HR0A 2B7KA 1OC9B 3ZYWA 1IYHA 3CQFA 5B8BA 2VCXA 1TK0B 4PNGA 3MSZA 14GSA 4G2EA 4PXOA 2OA7A 1B4QA 2FD3A 2P5QA 3EWLA 3KIJA 2FWGA 2M46A 3DRNA 4EKZA 3UJ1A 2DKHA 4JU5A 1NSWA 3QCPA 1SJZA 1SL1B 1ILOA 3M3MA 3ERFA 4ZL9A 2QA1A 1HYUA 5ID2A 4MPGA 4IP1A 4GF0A 1WJKA 4BWQA 1X9SB 4ID0A 4Z2TA 2F8AA 3GX8A 1AUCA 5IM9A 1Z6NA 1H75A 2YWIA 3TB2A 1XWKA 3QDNA 2Z9SA 6GSYA 4DEJA 1TTZA 2JU5A 1Q4JA 1GSDA 5KN0A 2K8SA 3FHKA 2GT5A 3MDKA 4HS1A 4G0KA 3CYNA 4JE1A 3FYGA 2R0GA 2MMZA 5CO3A 3HJPA 2H71A 4XS1A 2H0HA 1FVJA 3NZNA 1GSQA 3V1WA 1UA5A 2REMA 4IQAA 4AJ6A 2F3MA 5DAKA 1E2YA 1THXA 1CQGA 4GSTA 3LW9A 2DLXA 1N8JA 4ISDA 3IA1A 1PX7A 1BEDA 1ERTA 1RW1A 4ZB8A 4EL1A 4HU9A 2ON5A 3GTUB 2R37A 1EZKA 5DALA 3LSZA 2X4AA 3H93A 3HD5A 4A5PA 1YKAA 1W89A 1XZOA 4PTSA 3TKSE 3EYTA 4AJ7A 1LJRA 2HLSA 5IMZA 2TIRA 5DCHA 3VWXA 5DCGA 3J7Yk 3IHQA 1ZGNA 2GLRA 1GWCA 2LV3A 5AISA 1Q98A 5ECIB 4XS4A 1V40A 2BTOT 4EO3A 1GH2A 4NWYA 4I97A 1EEJA 1ERWA 1Y25A 1M0UA 3A2WA 1DBYA 2IMDA 2XBQA 2DJ1A 3HKRA 1PL1A 1VF3A 1MDKA 2JADA 2H0GA 4RI6A 1T00A 3KTBA 3WGDA 1UN2A 3S9FA 3DXBA 4TR1B 2H8LA 4K8MA 3IV4A 2CA8A 3GX0A 1ML6A 2JZSA 2H76A 1WRYA 3R3EA 1TRSA 5DDLA 3VWUA 2BJXA 2IMFA 4D73A 2L57A 1SL2B 5GAND 2YWMA 3KH9A 2DJ0A 4XS6A 4BVXA 1GSFA 4GLTA 2GSTA 3RHBA 2QA2A 1OE8A 4IS0A 1B48A 1G6WA 1XBSA 5HFKA 3ZMKA 1VF2A 1TU8A 2GS3A 3VLNA 4ILFA 5F8BA 1GSYA 3KJYA 1UC7A 2PVQA 4ZL7A 4P3YB 2PGTA 4TN8A 5HFIA 3O3TA 4GQCA 2A2SA 4MDCA 2A4HA 2KHPA 1EGOA 1YF0A 3DVXA 1K0MA 2OE1A 2GDRA 3GN3A 3QAVA 1KNGA 1NW2A 2WS2A 5BRTA 2HFDA 3HVVA 1GUHA 5FWGA 1J08A 2CV4A 1FG4A 2N5FA 4ULXA 3HZ8A 3CMIA 2TRXA 3KMOA 2PU9C 5IO2A 3J7Yb 1AIUA 1OAZA 2LRNA 1G6YA 4BIKA 1FB6A 3N9JA 3DYRA 2B6MA 1ZMAA 2WZ9A 4XIHA 4J2FA 11GSA 2L6DA 3G9BA 3EURA 2LRTA 3TJJA 2LJKA 5CAXA 4JBBA 4RQXA 1I9DA 1BQ7A 1XG8A 3OR5A 5GAPD 1J0FA 2X8CA 5JCWA 1GTIA 3UAPA 3FR6A 4EE0A 1PL2A 3IBHA 4I6XA 4YKFA 3QAGA 2H01A 2L5LA 1AC1A 1MD3A 1V9WA 4KGIA 2DJ3A 4MZCA 4DSSB 2LNSA 1EV4A 4ZILA 4QQ7A 2IPAA 2LKUA 2PBJA 1H4OA 2B5XA 4BVYA 3MYDA 3TJBA 5J3RA 5CRGA 5D93A 1RK4A 1SK2A 1F2EA 2M72A 2I4AA 2IMEA 2MBTA 1ZZYA 4GTUA 2C3QA 4K0NA 3ZFBA 2WB9A 2V6KA 1PSQA 2A2PA 3UL3A 1M3IA 1M9BA 1EGRA 3LG6A 4IQ1A 1NM3A 4MK3A 3LGCA 1JZOA 4I2TA 4G19A 1SYRA
chains in the Genus database with same CATH topology
3KP8A 1VGLA 2JSYA 10GSA 1K0CA 2VD1A 2EIQA 1AW9A 2VCWA 4MJBA 2H1BA 2YPMA 3HDCA 4KCAA 1CQHA 3LXZA 5CREA 4RI7A 2DMMA 4RQRA 4WEYA 5CRHA 3FRCA 2IFQA 4USSA 2H0IA 4MJEA 3CBUA 3KZQA 1OKDA 4ECIA 3EMPA 1XWCA 2MMOA 3I9V2 3KH7A 1USBA 4PQ1A 1QGVA 1FHEA 1UVZA 5ECRB 1A0FA 2HI7A 5ECMB 3GH6A 1YEXA 5G2ZA 2OJLA 4BA7A 9GSSA 3GKXA 1EP7A 2B3SA 2MMAA 3H79A 3TRXA 3ZTLA 4POLA 2I9HA 2RIIA 3C1RA 1KEBA 1SYXA 5JWRB 2VOCA 2WCIA 2VL3A 1K0BA 2HT9A 2C0FA 4WXTA 2H30A 17GSA 3GH9A 3D4TA 3EVIA 2OBKA 1GUMA 2EC4A 1EWXA 1R26A 2YV9A 3ZFLA 2OKAA 2DBCA 4LMWA 4K1FA 5HR3A 2H73A 1U3AA 5AIXA 2P31A 1X5EA 3CSIA 3M9JA 4YH2A 3H1NA 3RPPA 3IXRA 3KGKA 5IQYA 3AY8A 4JR4A 3KP9A 2NVLA 3A2XA 4POMA 5A4VA 5ABRA 1JZWA 4F03A 1PX6A 1T8EB 3A5IA 2K6VA 4KNDA 3F6FA 4J57E 4CY6A 3IE3A 16GSA 1K0AA 4NHZA 3ZL5A 1TI1A 3BOAA 3FK8A 2GQKA 1GSSA 2P5RA 2HZEA 5G31A 5IOWA 4XRDA 2WDUA 1WMJA 4V1Ag 4OD7A 3UBKA 1X9MB 2WJUA 3VURA 5AN1A 4X43A 5A4UA 2YN1A 3MNGA 2PVOC 1YF1A 5KN2A 2IIYA 2MMNA 5E4WA 4ML1A 2C0EA 2C1YA 3LORA 1GSUA 1G7OA 4KSMA 6GSWA 4J56E 1TK5B 3WGEA 5LCZA 1GUKA 3FW2A 2CVKA 1F6MC 4ECJA 1OYJA 4WKWA 4HJMA 2CZ3A 4F2IA 2VM2A 1XW6A 3TKSA 3SWLA 3CTFA 2HXKA 5GSSA 1ZYNA 3VI5A 4YAVA 4WF4A 4OCFA 5F06A 1TRWA 3H4KA 1U6TA 5CRDA 1YZXA 2FA4A 4GRFA 5J9CA 1T1VA 4FYUA 3DIEA 3VK9A 3C71A 4I8BA 3HJOA 2HZFA 3BCKA 4YKGA 1S3CA 2FLSA 1QXHA 4MF5A 1OC3A 2H70A 4D73B 12GSA 2VLTA 3NIVA 4BWSA 3D6IA 2FGXA 3DEXA 4TXOA 1ERVA 3RAZA 5DQYA 4PQIA 1YQ1A 2R0CA 4MJCA 5IMAA 3U6VA 2KLXA 4OWYA 1YEPA 4BL7A 3VPQA 3GSSA 1FO5A 1FVKA 1M9AA 2ZNMA 1A23A 3ZIJA 3IRAA 5ECOB 3G7YA 1Z6MA 3GV1A 4JEDA 3GURA 4N0VA 4ZB9A 4O5QA 2GSQA 4ML6A 1EEMA 2O7KA 5D9WA 3D4MA 3G7IA 4WR4A 3QAWA 2F51A 2HNLA 3HZ4A 3A3TA 4TR4A 2YZHA 1MD4A 4POKA 3VI7A 1B8XA 2RM6A 3A2VA 2HYXA 1XWBA 2LUSA 3CXGA 1OKTA 3L4NA 4PNFA 3HY2A 2VLUA 2YP6A 7GSSA 3Q74A 3BD2A 2HRKA 2NPBA 2H75A 3RHCA 1XWGA 2CVBA 2A2RA 4CHSA 4ZL8A 2B1LA 4V1Ap 3L9UA 3I6AA 3UARA 4K5SA 5IMFA 6GSXA 2X8GA 2H19A 4IGJA 2K8VA 2N5AA 1PMTA 2XHFA 3DWVA 5GZZB 1PN0A 2C8UA 2V41A 3LXTA 4EVMA 4F0BA 4IVFA 1O81A 1XCCA 4MABA 1E6BA 4ECCA 3TKSC 1HNCA 2HE3A 5C00A 5IIZA 1WE0A 5KN1A 3DKSA 1ZOFA 5ELGA 3APQA 4AF2A 2C0DA 2VL2C 2FUG2 4FIWA 2FA8A 2VD0A 5DJLA 4IN0A 4LL1B 4BVYB 5HR2A 5E59A 3QOUA 1Z3EA 1O85A 3GA4A 2B7JA 3IDVA 5D96A 3F4RA 1M2DA 3KXOA 4LMVA 2WULA 5DVBA 3DVWA 4KB3A 1A2LA 1A2JA 1TI3A 3D0ZA 4N11A 4FQUA 2NBSA 4HQZA 4MP4A 2JACA 4FYCA 2XPDA 2OE3A 4MF6A 4KW6A 2AUVA 2A4VA 2VCZA 5CYYA 3GL5A 4IJIA 1TRVA 5G5EA 1O8WA 2LTKA 5IPGA 3D21A 1ST9A 3TKQA 1TU7A 5ECLB 2AJQB 3UVTA 4EC0A 3JCML 6GSTA 4Z2UA 4L8EA 2CAQA 3R2QA 2AV4A 3GHAA 1X0RA 3ZZXA 1TDIA 1TRUA 3ZVJD 4KX4A 2ES7A 2FWEA 5HR1A 2C0GA 3WT2A 2LSTA 4N0ZA 3E0UA 1HNBA 5AIVA 4EDYA 19GSA 2OE0A 3TRQA 2X64A 1SKSB 1A2MA 1W4VA 3D22A 3C73A 3VWVA 1AQXA 1BAYA 4F82A 5ECKB 3VWWA 5CP1A 3F9UA 4K7IA 3W6GA 2JZRA 5IMVA 2GZYA 1Z5YE 5IMDA 3US3A 4JZQA 2QKEA 3E3EA 1PN9A 4MMMA 1SKRB 2H6XA 2IWTA 3CRTA 2DMLA 4MH3A 4YQMA 20GSA 1AAZA 4X4JA 2EIRA 5COHA 5B6NA 4K2XA 4KDXA 2GQLA 2VCQA 1OVNA 2O8VB 4HZ2A 1SJ6A 2E2MA 2O85A 5EVOA 3GKMA 4MLYA 4E8EA 5CNWA 1QK8A 4F0CA 3GTUA 3HJMA 4X0XA 1XW5A 5IO0A 2MBSA 4CW9A 4MZBA 3P7XA 4O92A 5IMCA 4TXVA 5F07A 3M9KA 3TJFA 1XOAA 1SJIA 1OE7A 2VAFA 3CSHA 4MNNA 3W8JA 4KDYA 3TOUA 1URMA 3WGXA 3APSA 5ECHB 3Q6OA 1WP0A 4XTSA 2VLVA 4CDOA 2H6ZA 4KAEA 1TP9A 1V58A 4LLRA 4V2MA 2LQOA 1RQMA 3ERWA 5J9BA 1O6JA 2H1AA 3GMFA 1HD2A 2WGRA 1B9YC 4V2NA 3G7JA 2GSSA 3IC4A 4TRXA 2OADA 2G2QA 4HQSA 3FKFA 1THOA 1VF4A 4OFMA 4HEA2 5FT3A 4ZBAA 4MPFA 1C72A 4TR1A 2R3XA 1K0DA 1AQWA 2H1DA 3M0FA 5JWOB 3F4TA 2DIZA 2HRFA 1Z7RA 4MH2A 4ZBDA 6GSSA 6GSVA 2DJJA 1JHBA 2VL9A 3LFLA 1A8YA 4K7OA 3C8EA 2DKIA 4K0GA 3DMLA 2JZTA 1YKCA 4ZB6A 2PN8A 2FWHA 2GT6A 4KA0A 1K0NA 3M8NA 4WETA 5ID2B 4K7NA 2E0QA 1ZYPA 4G0IA 3O76A 4TR3A 4JRRA 4WF5A 1EOGA 1WOUA 4KE3A 1JLVA 5ECNB 3EC3A 4RUVA 4LA1A 2GVPA 2LEGA 1M7TA 2NTOA 1ZL9A 1BYEA 1DE2A 2H72A 3C7MA 1A8LA 4MF7A 4ACSA 1KBNA 1WWJA 2AYTA 3TKPA 1NHYA 5D8IA 5H5RA 5IPHA 3KCMA 2C4JA 2J9HA 5LD0A 3D5JA 4HDEA 22GSA 5DAKB 3WT1A 2IL3A 5B7CA 2R4VA 1PKWA 3FZAA 1KTEA 1XXUA 2O87A 5KOXA 4EDZA 3EE2A 2LJAA 1ZYQB 5DALB 1R7HA 2L6CA 1F37A 1QMVA 5DQSA 3ED3A 2R5GA 4MA9A 2GQMA 3FR9A 3LWAA 4EUYA 5D9TA 2X8HA 2OACA 4TW5A 6GSUA 4NXIA 2FWFA 2RUEA 2HRNA 3Q18A 2L5OA 3GFKA 3W8SA 3IAS2 2GSRA 3GKKA 1TJDA 4L0WA 4I5QA 4XS4B 4AGSA 2I1UA 4TVEA 1LU4A 2RUFA 4IP6A 3PR8A 2EIOA 4DSSA 2GGTA 3QFAC 1GLQA 1PQNA 1X5DA 2LS5A 2V6OA 1B9XC 2KP1A 3ZMLA 1PGTA 3MWHA 1AQVA 4WBJA 4NHWA 2CX3A 1WIKA 1FW1A 4TOPA 2M80A 4L5LA 5H5QA 3TUEA 4DSRA 3DGQA 5EL8A 4G10A 2FNOA 3L78A 3RPNA 3LEFA 2CX4A 3GIXA 1U88A 5HQPA 4I2UA 1EV9A 5G5FA 3APOA 2F9SA 2IJYA 3FZ4A 5AGYA 4GWRA 1K0OA 5ENUA 1MDIA 4EF0A 4Z2RA 4NAXA 4BVXB 3FY7A 1O7UA 1SKWB 4OMVA 2YWOA 1FB0A 3LYKA 4HI7A 5KEJA 2JSZA 2QGVA 4E8HA 2CZ2A 2XPEA 3WYWA 2R2JA 1A24A 2E7PA 3PGTA 4Q5QA 5KN3A 3ZVJA 3ZLPA 2DJ2A 5ECQB 2DSAA 1GULA 4ZXGA 1V98A 1T4YA 2C80A 3F3QA 1G0TA 2RM5A 4OFNA 3GYKA 5BMUA 4KUNA 1T3BA 1S3AA 1R5AA 3IC8A 3TKRA 1M2BA 1AXDA 4YAPA 3ERGA 1GL8A 4GSSA 2AB6A 3I69A 1XOBA 2V1MA 2PUKC 4CY8A 2YZUA 4YQVA 2R6KA 3PH9A 4F9ZA 1GRXA 1G7EA 2RLIA 4HUAA 2K9FA 1R5PA 8GSSA 5JWQB 3MIXA 3FR3A 4HOJA 3I43A 4IW9A 3GUSA 2IMIA 1GSEA 4ICYA 3QFBC 4K2DA 2TRCP 4EIQA 1JFUA 2MZCA 13GSA 2O89A 3M1GA 2UZ8A 1ABAA 1JZRA 2YJHA 4ECBA 4O5RA 3FZ5A 5GSTA 5ECPB 1Z9HA 5EY6A 3L0HA 1V2AA 3MAKA 2PMTA 1XVWA 2HRAA 4KF9A 4TR0A 1EOHA 1XWAA 4KDUA 4PX1A 1MDJA 4PGTA 2CT6A 4Z7XA 4QL7A 4MZWA 2YOIA 1GNWA 4WR5A 2FCHA 2YJ7A 1ZCPA 3A5WA 1J9BA 2G0FA 1ACVA 3HA9A 3GL3A 2VM1A 3H8QA 3TGZA 2X49A 4EXJA 4ZIJA 1GTAA 1ON4A 2H1GA 3CRUA 4IJ3A 4GXZA 4WBRD 4V2LA 4FH8A 2HSHA 1XPVA 2CQ9A 3HYPA 1EP8A 1ERUA 3KD0A 4L5OA 3TJGA 1SK1A 1XVQA 4EIPA 2BMXA 2FY6A 2IFQB 2PWJA 4L0UA 1GTBA 5D73A 3UMAA 4POBA 4GSNA 4H86A 1OC9A 3ZIVA 3ZITA 1PA3A 2DC5A 2KUCA 3L9SA 3GNJA 2KOKA 1VRSD 1M99A 2F8FA 1PRXA 5EPFA 4PQHA 1FOVA 1QUWA 5LNKe 3LQ7A 3K8NA 4OCEA 3KM6A 2GZPA 3GKNA 4O5UA 2AHEA 3EPTA 1WPIA 1IYIA 3UVHA 2AAWA 3F8UA 1T4ZA 3IK7A 4IELA 1XW9A 3UIWA 3SBCA 3P90A 2H6YA 2FHEA 5DBQA 3Q19A 1NHOA 4GQFA 1R4WA 1YY7A 3QMXA 5J41A 1HQOA 5F0GA 5G1KA 1LBKA 5A4WA 4X1UA 4HZ4A 1SL0B 4PUFC 2R0PA 1TW9A 2YWNA 2YV7A 3KTLA 2ON7A 2LRCA 1BX9A 2GZZA 2LNTA 3HCZA 1B4PA 4K5RA 3N5OA 1PKZA 3UOMA 2WRTA 2V2GA 1JZDA 2DIYA 5CRWA 1HNAA 2VCTA 1GNEA 3C1SA 4OFTA 3EU3A 3LYPA 1TOFA 5JCGA 2VCVA 3EMXA 1M2AA 4FYBA 2YCDA 2L59A 3BJ5A 2LJRA 4K6XA 3CSJA 4G0LA 4Q5FA 3TOTA 2HZEB 5B6MA 4DSQA 4IKHA 2B1KA 1YJ6A 2VIMA 5JCUA 2LQQA 4Q5NA 5D9VA 5A5KA 1QFNA 4HJ2A 4NMUA 3RDWA 3WD6A 1JLWA 3GSTA 2CAIA 5B8AA 2IMKA 3NOFA 3F4SA 5IOXA 2JL4A 4KH7A 5F05A 5J4UA 1F3AA 4OO5A 3ZREA 5ECSA 4MCUA 2C3NA 2VUPA 2YNXA 4FO5A 3BBYA 1X9WB 3HXSA 3RBTA 3IAM2 4AJ8A 5G30A 1TXXA 1K3YA 2I3YA 3GRXA 2N5BA 2K18A 4OO4A 2C3TA 4JR6A 3FMWA 1DSBA 2L4CA 1XIYA 1XFLA 4G9HA 3E9JB 1F3BA 3EINA 2CVDA 5DJMA 5ELAA 1S3DA 1FAAA 3P8WA 2X99A 1VF1A 3TCOA 1K3LA 5L71A 1U3IA 1X5CA 1TKDB 1OC8A 3U5RE 18GSA 1BG5A 4TXOB 5H5SA 2GTUA 3TJKA 1DE1A 5FHIA 3UEMA 4BL7B 1SK0A 4LL4B 4XCSA 3IK9A 1Y6EA 4NV2A 1BJXA 3TRPA 1SD8A 2NDOA 4IBPA 2V32A 4GCIA 1A0RP 4XRAA 2PERA 5D9XA 2IN3A 4DVCA 3IOSA 1SENA 1QQ2A 3PPUA 2XBIA 3KMNA 4ZBBA 3P2AA 3L9VA 2HSMA 4QL9A 4NPBA 3HVXA 2H66A 4PURA 1F9MA 1SD9A 2ZCTA 3VFIA 4HU7A 4TKYA 3HVSA 5KOWA 3QPMA 3LJRA 3ME8A 3IR4A 2XC2A 2B5YA 3F63A 1O8XA 1I5GA 3BCIA 2PPTA 5C04A 3ME7A 2ALBA 5G1LA 4MJAA 2MYGA 1ZYEA 4BPYA 3EU4A 1Z7PA 4N10A 4N30A 1V57A 4O7HA 1GTUA 1O73A 3PINA 1YDKA 3O6TA 5HFGA 1N2AA 3F0IA 2P0GA 3VPTA 2E2GA 3CTGA 1GLPA 2B5EA 3IPZA 2D2ZA 1TK8B 3F3RA 4Q5RA 1MTCA 2I81A 1SU9A 4YQUA 4PUAA 2YANA 1U87A 1PD21 2WFCA 2HSYA 4KCEA 4K9ZA 4KSOA 4O32A 2J23A 2VO4A 1GP1A 3TDGA 2ZUPA 5J5NA 1FOHA 1MEKA 3F6DA 4XHMA 3FEUA 3QD9A 3IHGA 3HHVA 3QR6A 3ISOA 4IHUA 2QC7A 2DJKA 1DUGA 2OBIA 1T7PB 2QSIA 4NV5A 2VL2A 3DD3A 3KEBA 2H74A 3ZRDA 1K3OA 3FZ9A 3UBLA 2KP2A 5INYA 2L4QA 5HR0A 2B7KA 1OC9B 3ZYWA 1IYHA 5B8BA 2VCXA 1TK0B 4PNGA 3MSZA 14GSA 4G2EA 4PXOA 2OA7A 1B4QA 2FD3A 2P5QA 3EWLA 3KIJA 2FWGA 2M46A 3DRNA 4EKZA 3UJ1A 2DKHA 4JU5A 1NSWA 3QCPA 1SJZA 1SL1B 1ILOA 3M3MA 3ERFA 4ZL9A 2QA1A 1HYUA 5ID2A 4MPGA 4IP1A 4GF0A 1WJKA 4BWQA 1X9SB 4ID0A 4Z2TA 2F8AA 3GX8A 1AUCA 5IM9A 1Z6NA 1H75A 2YWIA 3TB2A 1XWKA 3QDNA 2Z9SA 6GSYA 4DEJA 1TTZA 2JU5A 1Q4JA 1GSDA 5KN0A 2K8SA 3FHKA 2GT5A 3MDKA 4HS1A 4G0KA 3CYNA 4JE1A 3FYGA 2R0GA 2MMZA 5CO3A 3HJPA 2H71A 4XS1A 2H0HA 1FVJA 3NZNA 1GSQA 3V1WA 1UA5A 2REMA 4IQAA 4AJ6A 2F3MA 5DAKA 1E2YA 1THXA 1CQGA 4GSTA 3LW9A 2DLXA 1N8JA 4ISDA 3IA1A 1PX7A 1BEDA 1ERTA 1RW1A 4ZB8A 4EL1A 4HU9A 2ON5A 3GTUB 2R37A 1EZKA 5DALA 3LSZA 2X4AA 3H93A 3HD5A 4A5PA 1YKAA 1W89A 1XZOA 4PTSA 3TKSE 3EYTA 4AJ7A 1LJRA 2HLSA 5IMZA 2TIRA 5DCHA 3VWXA 5DCGA 3J7Yk 3IHQA 1ZGNA 2GLRA 1GWCA 2LV3A 5AISA 1Q98A 5ECIB 4XS4A 1V40A 2BTOT 4EO3A 1GH2A 4NWYA 4I97A 1EEJA 1ERWA 1Y25A 1M0UA 3A2WA 1DBYA 2IMDA 2XBQA 2DJ1A 3HKRA 1PL1A 1VF3A 1MDKA 2JADA 2H0GA 4RI6A 1T00A 3KTBA 3WGDA 1UN2A 3S9FA 3DXBA 4TR1B 2H8LA 4K8MA 3IV4A 2CA8A 3GX0A 1ML6A 2JZSA 2H76A 1WRYA 3R3EA 1TRSA 5DDLA 3VWUA 2BJXA 2IMFA 4D73A 2L57A 1SL2B 5GAND 2YWMA 3KH9A 2DJ0A 4XS6A 4BVXA 1GSFA 4GLTA 2GSTA 3RHBA 2QA2A 1OE8A 4IS0A 1B48A 1G6WA 1XBSA 5HFKA 3ZMKA 1VF2A 1TU8A 2GS3A 3VLNA 4ILFA 5F8BA 1GSYA 3KJYA 1UC7A 2PVQA 4ZL7A 4P3YB 2PGTA 4TN8A 5HFIA 3O3TA 4GQCA 2A2SA 4MDCA 2A4HA 2KHPA 1EGOA 1YF0A 3DVXA 1K0MA 2OE1A 2GDRA 3GN3A 3QAVA 1KNGA 1NW2A 2WS2A 5BRTA 2HFDA 3HVVA 1GUHA 5FWGA 1J08A 2CV4A 1FG4A 2N5FA 4ULXA 3HZ8A 3CMIA 2TRXA 3KMOA 2PU9C 5IO2A 3J7Yb 1AIUA 1OAZA 2LRNA 1G6YA 1FB6A 3N9JA 3DYRA 2B6MA 1ZMAA 2WZ9A 4XIHA 4J2FA 11GSA 2L6DA 3G9BA 3EURA 2LRTA 3TJJA 2LJKA 5CAXA 4JBBA 4RQXA 1I9DA 1BQ7A 3OR5A 5GAPD 1J0FA 2X8CA 5JCWA 1GTIA 3UAPA 3FR6A 4EE0A 1PL2A 3IBHA 4I6XA 4YKFA 3QAGA 2H01A 2L5LA 1AC1A 1MD3A 1V9WA 4KGIA 2DJ3A 4MZCA 4DSSB 2LNSA 1EV4A 4ZILA 4QQ7A 2IPAA 2LKUA 2PBJA 1H4OA 2B5XA 4BVYA 3MYDA 3TJBA 5J3RA 5CRGA 5D93A 1RK4A 1SK2A 1F2EA 2M72A 2I4AA 2IMEA 2MBTA 1ZZYA 4GTUA 2C3QA 4K0NA 3ZFBA 2WB9A 2V6KA 1PSQA 2A2PA 3UL3A 1M9BA 1EGRA 3LG6A 4IQ1A 1NM3A 4MK3A 3LGCA 1JZOA 4I2TA 4G19A 1SYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP8 A;  1VGL A;  2JSY A;  10GS A;  1K0C A;  2VD1 A;  2EIQ A;  1AW9 A;  2VCW A;  4MJB A;  2H1B A;  2YPM A;  3HDC A;  4KCA A;  1CQH A;  3LXZ A;  5CRE A;  4RI7 A;  2DMM A;  4RQR A;  4WEY A;  5CRH A;  3FRC A;  2IFQ A;  2H0I A;  4MJE A;  3CBU A;  3KZQ A;  1OKD A;  4ECI A;  3EMP A;  1XWC A;  2MMO A;  3I9V 2;  3KH7 A;  1USB A;  4PQ1 A;  1QGV A;  1FHE A;  1UVZ A;  5ECR B;  1A0F A;  2HI7 A;  5ECM B;  3GH6 A;  1YEX A;  5G2Z A;  2OJL A;  4BA7 A;  9GSS A;  3GKX A;  1EP7 A;  2B3S A;  2MMA A;  3H79 A;  3TRX A;  3ZTL A;  4POL A;  2I9H A;  2RII A;  3C1R A;  1KEB A;  1SYX A;  5JWR B;  2VOC A;  2WCI A;  2VL3 A;  1K0B A;  2HT9 A;  2C0F A;  4WXT A;  2H30 A;  17GS A;  3GH9 A;  3D4T A;  3EVI A;  2OBK A;  1GUM A;  2EC4 A;  1EWX A;  1R26 A;  2YV9 A;  3ZFL A;  2OKA A;  2DBC A;  4LMW A;  4K1F A;  5HR3 A;  2H73 A;  1U3A A;  5AIX A;  2P31 A;  1X5E A;  3CSI A;  3M9J A;  4YH2 A;  3H1N A;  3RPP A;  3IXR A;  3KGK A;  5IQY A;  3AY8 A;  4JR4 A;  3KP9 A;  2NVL A;  3A2X A;  4POM A;  5A4V A;  5ABR A;  1JZW A;  4F03 A;  1PX6 A;  1T8E B;  2K6V A;  4KND A;  3F6F A;  4J57 E;  3IE3 A;  16GS A;  1K0A A;  4NHZ A;  3ZL5 A;  1TI1 A;  3BOA A;  3FK8 A;  2GQK A;  1GSS A;  2P5R A;  2HZE A;  5G31 A;  5IOW A;  4XRD A;  2WDU A;  1WMJ A;  4V1A g;  4OD7 A;  3UBK A;  1X9M B;  2WJU A;  3VUR A;  5AN1 A;  4X43 A;  5A4U A;  2YN1 A;  3MNG A;  2PVO C;  1YF1 A;  5KN2 A;  2IIY A;  2MMN A;  5E4W A;  4ML1 A;  2C0E A;  2C1Y A;  3LOR A;  1GSU A;  1G7O A;  4KSM A;  6GSW A;  4J56 E;  1TK5 B;  3WGE A;  5LCZ A;  1GUK A;  3FW2 A;  2CVK A;  1F6M C;  4ECJ A;  1OYJ A;  4HJM A;  4WKW A;  2CZ3 A;  4F2I A;  2VM2 A;  1XW6 A;  3TKS A;  3SWL A;  3CTF A;  2HXK A;  5GSS A;  3VI5 A;  4YAV A;  4WF4 A;  4OCF A;  5F06 A;  1TRW A;  3H4K A;  1U6T A;  5CRD A;  1YZX A;  2FA4 A;  4GRF A;  5J9C A;  1T1V A;  4FYU A;  3DIE A;  3VK9 A;  3C71 A;  4I8B A;  3HJO A;  2HZF A;  3BCK A;  1S3C A;  2FLS A;  1QXH A;  4MF5 A;  1OC3 A;  2H70 A;  4D73 B;  12GS A;  2VLT A;  3NIV A;  4BWS A;  3D6I A;  2FGX A;  3DEX A;  4TXO A;  1ERV A;  3RAZ A;  5DQY A;  4PQI A;  1YQ1 A;  4MJC A;  5IMA A;  3U6V A;  2KLX A;  4OWY A;  1YEP A;  4BL7 A;  3VPQ A;  3GSS A;  1FO5 A;  1FVK A;  1M9A A;  2ZNM A;  1A23 A;  3ZIJ A;  3IRA A;  5ECO B;  3G7Y A;  1Z6M A;  3GV1 A;  4JED A;  3GUR A;  4N0V A;  4ZB9 A;  2GSQ A;  4ML6 A;  1EEM A;  2O7K A;  5D9W A;  3D4M A;  3G7I A;  4WR4 A;  3QAW A;  2F51 A;  2HNL A;  3HZ4 A;  3A3T A;  4TR4 A;  2YZH A;  1MD4 A;  4POK A;  3VI7 A;  1B8X A;  2RM6 A;  3A2V A;  2HYX A;  1XWB A;  2LUS A;  3CXG A;  1OKT A;  3L4N A;  4PNF A;  3HY2 A;  2VLU A;  2YP6 A;  7GSS A;  3Q74 A;  3BD2 A;  2NPB A;  2H75 A;  3RHC A;  1XWG A;  2CVB A;  2A2R A;  4CHS A;  4ZL8 A;  2B1L A;  4V1A p;  3L9U A;  3I6A A;  3UAR A;  5IMF A;  6GSX A;  2X8G A;  2H19 A;  4IGJ A;  2K8V A;  2N5A A;  1PMT A;  2XHF A;  3DWV A;  5GZZ B;  2C8U A;  2V41 A;  3LXT A;  4EVM A;  4F0B A;  4IVF A;  1O81 A;  1XCC A;  4MAB A;  1E6B A;  4ECC A;  3TKS C;  1HNC A;  2HE3 A;  5C00 A;  5IIZ A;  1WE0 A;  5KN1 A;  3DKS A;  1ZOF A;  5ELG A;  3APQ A;  4AF2 A;  2C0D A;  2VL2 C;  2FUG 2;  4FIW A;  2FA8 A;  2VD0 A;  5DJL A;  4IN0 A;  4LL1 B;  5HR2 A;  5E59 A;  3QOU A;  1Z3E A;  1O85 A;  3GA4 A;  2B7J A;  3IDV A;  5D96 A;  3F4R A;  1M2D A;  3KXO A;  4LMV A;  2WUL A;  5DVB A;  3DVW A;  4KB3 A;  1A2L A;  1A2J A;  1TI3 A;  3D0Z A;  4N11 A;  2NBS A;  4HQZ A;  4MP4 A;  2JAC A;  4FYC A;  2XPD A;  2OE3 A;  4MF6 A;  4KW6 A;  2AUV A;  2A4V A;  2VCZ A;  5CYY A;  3GL5 A;  4IJI A;  1TRV A;  5G5E A;  1O8W A;  2LTK A;  5IPG A;  3D21 A;  1ST9 A;  3TKQ A;  1TU7 A;  5ECL B;  2AJQ B;  3UVT A;  4EC0 A;  3JCM L;  6GST A;  4L8E A;  2CAQ A;  3R2Q A;  2AV4 A;  3GHA A;  1X0R A;  3ZZX A;  1TDI A;  1TRU A;  3ZVJ D;  4KX4 A;  2ES7 A;  2FWE A;  5HR1 A;  2C0G A;  3WT2 A;  2LST A;  4N0Z A;  3E0U A;  1HNB A;  5AIV A;  4EDY A;  19GS A;  2OE0 A;  3TRQ A;  2X64 A;  1SKS B;  1A2M A;  1W4V A;  3D22 A;  3C73 A;  3VWV A;  1AQX A;  1BAY A;  4F82 A;  5ECK B;  3VWW A;  5CP1 A;  3F9U A;  4K7I A;  3W6G A;  2JZR A;  5IMV A;  2GZY A;  1Z5Y E;  5IMD A;  3US3 A;  4JZQ A;  2QKE A;  3E3E A;  1PN9 A;  4MMM A;  1SKR B;  2H6X A;  2IWT A;  3CRT A;  2DML A;  4MH3 A;  4YQM A;  20GS A;  1AAZ A;  2EIR A;  5COH A;  5B6N A;  4KDX A;  2GQL A;  2VCQ A;  1OVN A;  2O8V B;  4HZ2 A;  1SJ6 A;  2E2M A;  2O85 A;  5EVO A;  3GKM A;  4MLY A;  4E8E A;  5CNW A;  1QK8 A;  4F0C A;  3GTU A;  3HJM A;  4X0X A;  1XW5 A;  5IO0 A;  2MBS A;  4CW9 A;  4MZB A;  3P7X A;  4O92 A;  5IMC A;  4TXV A;  5F07 A;  3M9K A;  3TJF A;  1XOA A;  1SJI A;  1OE7 A;  2VAF A;  3CSH A;  3W8J A;  4KDY A;  3TOU A;  1URM A;  3WGX A;  3APS A;  5ECH B;  3Q6O A;  1WP0 A;  4XTS A;  2VLV A;  4CDO A;  2H6Z A;  4KAE A;  1TP9 A;  1V58 A;  4LLR A;  4V2M A;  2LQO A;  1RQM A;  3ERW A;  5J9B A;  1O6J A;  2H1A A;  3GMF A;  1HD2 A;  2WGR A;  1B9Y C;  4V2N A;  3G7J A;  2GSS A;  3IC4 A;  4TRX A;  2OAD A;  2G2Q A;  4HQS A;  3FKF A;  1THO A;  1VF4 A;  4OFM A;  4HEA 2;  5FT3 A;  4ZBA A;  4MPF A;  1C72 A;  4TR1 A;  2R3X A;  1K0D A;  1AQW A;  2H1D A;  3M0F A;  5JWO B;  3F4T A;  2DIZ A;  2HRF A;  1Z7R A;  4MH2 A;  4ZBD A;  6GSS A;  6GSV A;  2DJJ A;  1JHB A;  2VL9 A;  3LFL A;  1A8Y A;  4K7O A;  3C8E A;  4K0G A;  3DML A;  2JZT A;  1YKC A;  4ZB6 A;  2PN8 A;  2FWH A;  2GT6 A;  4KA0 A;  1K0N A;  3M8N A;  4WET A;  5ID2 B;  4K7N A;  2E0Q A;  3O76 A;  4TR3 A;  4JRR A;  4WF5 A;  1EOG A;  1WOU A;  4KE3 A;  1JLV A;  5ECN B;  3EC3 A;  4RUV A;  4LA1 A;  2GVP A;  2LEG A;  1M7T A;  2NTO A;  1ZL9 A;  1BYE A;  1DE2 A;  2H72 A;  3C7M A;  1A8L A;  4MF7 A;  4ACS A;  1KBN A;  1WWJ A;  2AYT A;  3TKP A;  1NHY A;  5D8I A;  5H5R A;  5IPH A;  3KCM A;  2C4J A;  2J9H A;  5LD0 A;  3D5J A;  4HDE A;  22GS A;  5DAK B;  3WT1 A;  2IL3 A;  5B7C A;  2R4V A;  1PKW A;  3FZA A;  1KTE A;  1XXU A;  2O87 A;  4EDZ A;  3EE2 A;  2LJA A;  1ZYQ B;  5DAL B;  1R7H A;  2L6C A;  1F37 A;  1QMV A;  5DQS A;  3ED3 A;  2R5G A;  4MA9 A;  2GQM A;  3FR9 A;  3LWA A;  4EUY A;  5D9T A;  2X8H A;  2OAC A;  4TW5 A;  6GSU A;  4NXI A;  2FWF A;  2RUE A;  2HRN A;  3Q18 A;  2L5O A;  3GFK A;  3W8S A;  3IAS 2;  2GSR A;  3GKK A;  1TJD A;  4L0W A;  4I5Q A;  4XS4 B;  4AGS A;  2I1U A;  4TVE A;  1LU4 A;  2RUF A;  4IP6 A;  3PR8 A;  2EIO A;  4DSS A;  2GGT A;  3QFA C;  1GLQ A;  1PQN A;  1X5D A;  2LS5 A;  2V6O A;  1B9X C;  2KP1 A;  3ZML A;  1PGT A;  3MWH A;  1AQV A;  4WBJ A;  4NHW A;  2CX3 A;  1WIK A;  1FW1 A;  4TOP A;  2M80 A;  4L5L A;  5H5Q A;  3TUE A;  4DSR A;  3DGQ A;  5EL8 A;  4G10 A;  2FNO A;  3L78 A;  3RPN A;  3LEF A;  2CX4 A;  3GIX A;  1U88 A;  5HQP A;  4I2U A;  1EV9 A;  5G5F A;  3APO A;  2F9S A;  2IJY A;  3FZ4 A;  5AGY A;  4GWR A;  1K0O A;  5ENU A;  1MDI A;  4EF0 A;  4NAX A;  3FY7 A;  1O7U A;  1SKW B;  4OMV A;  2YWO A;  1FB0 A;  3LYK A;  4HI7 A;  5KEJ A;  2JSZ A;  2QGV A;  4E8H A;  2CZ2 A;  2XPE A;  3WYW A;  2R2J A;  1A24 A;  2E7P A;  3PGT A;  4Q5Q A;  5KN3 A;  3ZVJ A;  3ZLP A;  2DJ2 A;  5ECQ B;  2DSA A;  1GUL A;  4ZXG A;  1V98 A;  1T4Y A;  2C80 A;  3F3Q A;  1G0T A;  2RM5 A;  4OFN A;  3GYK A;  4KUN A;  1T3B A;  1S3A A;  1R5A A;  3TKR A;  1M2B A;  1AXD A;  4YAP A;  3ERG A;  1GL8 A;  4GSS A;  2AB6 A;  3I69 A;  1XOB A;  2V1M A;  2PUK C;  2YZU A;  4YQV A;  2R6K A;  3PH9 A;  4F9Z A;  1GRX A;  1G7E A;  2RLI A;  4HUA A;  2K9F A;  1R5P A;  8GSS A;  5JWQ B;  3FR3 A;  4HOJ A;  3I43 A;  4IW9 A;  3GUS A;  2IMI A;  1GSE A;  3QFB C;  4K2D A;  2TRC P;  1JFU A;  2MZC A;  13GS A;  2O89 A;  3M1G A;  1ABA A;  1JZR A;  2YJH A;  4ECB A;  4O5R A;  3FZ5 A;  5GST A;  5ECP B;  1Z9H A;  5EY6 A;  3L0H A;  1V2A A;  3MAK A;  2PMT A;  1XVW A;  4TR0 A;  1EOH A;  1XWA A;  4KDU A;  4PX1 A;  1MDJ A;  4PGT A;  2CT6 A;  4Z7X A;  4QL7 A;  4MZW A;  2YOI A;  1GNW A;  4WR5 A;  2FCH A;  2YJ7 A;  1ZCP A;  3A5W A;  1J9B A;  2G0F A;  1ACV A;  3HA9 A;  3GL3 A;  2VM1 A;  3H8Q A;  3TGZ A;  4EXJ A;  4ZIJ A;  1GTA A;  1ON4 A;  2H1G A;  3CRU A;  4IJ3 A;  4GXZ A;  4WBR D;  4V2L A;  4FH8 A;  2HSH A;  1XPV A;  2CQ9 A;  3HYP A;  1EP8 A;  1ERU A;  3KD0 A;  4L5O A;  3TJG A;  1SK1 A;  1XVQ A;  2BMX A;  2FY6 A;  2IFQ B;  2PWJ A;  4L0U A;  1GTB A;  5D73 A;  3UMA A;  4POB A;  4GSN A;  4H86 A;  1OC9 A;  3ZIV A;  3ZIT A;  1PA3 A;  2DC5 A;  2KUC A;  3L9S A;  3GNJ A;  2KOK A;  1VRS D;  1M99 A;  2F8F A;  1PRX A;  5EPF A;  4PQH A;  1FOV A;  1QUW A;  5LNK e;  3LQ7 A;  3K8N A;  4OCE A;  3KM6 A;  2GZP A;  3GKN A;  2AHE A;  1WPI A;  1IYI A;  3UVH A;  2AAW A;  3F8U A;  1T4Z A;  3IK7 A;  4IEL A;  1XW9 A;  3UIW A;  3SBC A;  3P90 A;  2H6Y A;  2FHE A;  5DBQ A;  3Q19 A;  1NHO A;  4GQF A;  1R4W A;  1YY7 A;  3QMX A;  5J41 A;  1HQO A;  5F0G A;  5G1K A;  1LBK A;  5A4W A;  4X1U A;  4HZ4 A;  1SL0 B;  4PUF C;  1TW9 A;  2YWN A;  2YV7 A;  3KTL A;  2ON7 A;  2LRC A;  1BX9 A;  2GZZ A;  2LNT A;  3HCZ A;  1B4P A;  3N5O A;  1PKZ A;  3UOM A;  2WRT A;  2V2G A;  1JZD A;  2DIY A;  5CRW A;  1HNA A;  2VCT A;  1GNE A;  3C1S A;  4OFT A;  3EU3 A;  3LYP A;  1TOF A;  5JCG A;  2VCV A;  3EMX A;  1M2A A;  4FYB A;  2YCD A;  2L59 A;  3BJ5 A;  2LJR A;  4K6X A;  3CSJ A;  4Q5F A;  3TOT A;  2HZE B;  5B6M A;  4DSQ A;  4IKH A;  2B1K A;  1YJ6 A;  2VIM A;  5JCU A;  2LQQ A;  4Q5N A;  5D9V A;  5A5K A;  1QFN A;  4HJ2 A;  4NMU A;  3RDW A;  3WD6 A;  1JLW A;  3GST A;  2CAI A;  5B8A A;  2IMK A;  3NOF A;  3F4S A;  5IOX A;  2JL4 A;  4KH7 A;  5F05 A;  5J4U A;  1F3A A;  4OO5 A;  3ZRE A;  5ECS A;  4MCU A;  2C3N A;  2VUP A;  2YNX A;  4FO5 A;  3BBY A;  1X9W B;  3HXS A;  3RBT A;  3IAM 2;  4AJ8 A;  5G30 A;  1TXX A;  1K3Y A;  2I3Y A;  3GRX A;  2N5B A;  2K18 A;  4OO4 A;  2C3T A;  4JR6 A;  1DSB A;  2L4C A;  1XIY A;  1XFL A;  4G9H A;  3E9J B;  1F3B A;  3EIN A;  2CVD A;  5DJM A;  5ELA A;  1S3D A;  1FAA A;  3P8W A;  2X99 A;  1VF1 A;  3TCO A;  1K3L A;  5L71 A;  1U3I A;  1X5C A;  1TKD B;  1OC8 A;  3U5R E;  18GS A;  1BG5 A;  4TXO B;  5H5S A;  2GTU A;  3TJK A;  1DE1 A;  5FHI A;  3UEM A;  1SK0 A;  4LL4 B;  4XCS A;  3IK9 A;  1Y6E A;  4NV2 A;  1BJX A;  3TRP A;  1SD8 A;  2NDO A;  4IBP A;  2V32 A;  4GCI A;  1A0R P;  4XRA A;  2PER A;  5D9X A;  2IN3 A;  4DVC A;  3IOS A;  1SEN A;  1QQ2 A;  2XBI A;  3KMN A;  4ZBB A;  3P2A A;  3L9V A;  4QL9 A;  4NPB A;  3HVX A;  2H66 A;  4PUR A;  1F9M A;  1SD9 A;  2ZCT A;  3VFI A;  4HU7 A;  4TKY A;  3HVS A;  3QPM A;  3LJR A;  3ME8 A;  3IR4 A;  2XC2 A;  2B5Y A;  3F63 A;  1O8X A;  1I5G A;  3BCI A;  2PPT A;  5C04 A;  3ME7 A;  2ALB A;  5G1L A;  4MJA A;  2MYG A;  1ZYE A;  4BPY A;  3EU4 A;  1Z7P A;  4N10 A;  4N30 A;  1V57 A;  4O7H A;  1GTU A;  1O73 A;  3PIN A;  1YDK A;  3O6T A;  5HFG A;  1N2A A;  3F0I A;  2P0G A;  3VPT A;  2E2G A;  3CTG A;  1GLP A;  2B5E A;  3IPZ A;  2D2Z A;  1TK8 B;  3F3R A;  4Q5R A;  1MTC A;  2I81 A;  1SU9 A;  4YQU A;  4PUA A;  2YAN A;  1U87 A;  1PD2 1;  2WFC A;  2HSY A;  4KCE A;  4K9Z A;  4KSO A;  4O32 A;  2J23 A;  2VO4 A;  1GP1 A;  3TDG A;  2ZUP A;  5J5N A;  1MEK A;  3F6D A;  4XHM A;  3FEU A;  3QD9 A;  3HHV A;  3QR6 A;  3ISO A;  4IHU A;  2QC7 A;  2DJK A;  1DUG A;  2OBI A;  1T7P B;  2QSI A;  4NV5 A;  2VL2 A;  3DD3 A;  3KEB A;  2H74 A;  3ZRD A;  1K3O A;  3FZ9 A;  3UBL A;  2KP2 A;  5INY A;  2L4Q A;  5HR0 A;  2B7K A;  1OC9 B;  3ZYW A;  1IYH A;  5B8B A;  2VCX A;  1TK0 B;  4PNG A;  3MSZ A;  14GS A;  4G2E A;  4PXO A;  2OA7 A;  1B4Q A;  2FD3 A;  2P5Q A;  3EWL A;  3KIJ A;  2FWG A;  2M46 A;  3DRN A;  4EKZ A;  3UJ1 A;  4JU5 A;  1NSW A;  3QCP A;  1SJZ A;  1SL1 B;  1ILO A;  3M3M A;  3ERF A;  4ZL9 A;  1HYU A;  5ID2 A;  4MPG A;  4IP1 A;  4GF0 A;  1WJK A;  4BWQ A;  1X9S B;  4ID0 A;  2F8A A;  3GX8 A;  1AUC A;  5IM9 A;  1Z6N A;  1H75 A;  2YWI A;  3TB2 A;  1XWK A;  3QDN A;  2Z9S A;  6GSY A;  4DEJ A;  1TTZ A;  2JU5 A;  1Q4J A;  1GSD A;  5KN0 A;  2K8S A;  3FHK A;  2GT5 A;  3MDK A;  4HS1 A;  3CYN A;  4JE1 A;  3FYG A;  2MMZ A;  5CO3 A;  3HJP A;  2H71 A;  4XS1 A;  2H0H A;  1FVJ A;  3NZN A;  1GSQ A;  3V1W A;  1UA5 A;  2REM A;  4IQA A;  4AJ6 A;  2F3M A;  5DAK A;  1E2Y A;  1THX A;  1CQG A;  4GST A;  2DLX A;  1N8J A;  4ISD A;  3IA1 A;  1PX7 A;  1BED A;  1ERT A;  1RW1 A;  4ZB8 A;  4EL1 A;  4HU9 A;  2ON5 A;  3GTU B;  2R37 A;  1EZK A;  5DAL A;  3LSZ A;  3H93 A;  3HD5 A;  1YKA A;  1W89 A;  1XZO A;  3TKS E;  3EYT A;  4AJ7 A;  1LJR A;  2HLS A;  5IMZ A;  2TIR A;  5DCH A;  3VWX A;  5DCG A;  3J7Y k;  3IHQ A;  1ZGN A;  2GLR A;  1GWC A;  2LV3 A;  5AIS A;  1Q98 A;  5ECI B;  4XS4 A;  1V40 A;  2BTO T;  4EO3 A;  1GH2 A;  4NWY A;  4I97 A;  1EEJ A;  1ERW A;  1Y25 A;  1M0U A;  3A2W A;  1DBY A;  2IMD A;  2XBQ A;  2DJ1 A;  3HKR A;  1PL1 A;  1VF3 A;  1MDK A;  2JAD A;  2H0G A;  4RI6 A;  1T00 A;  3KTB A;  3WGD A;  1UN2 A;  3S9F A;  3DXB A;  4TR1 B;  2H8L A;  4K8M A;  3IV4 A;  2CA8 A;  3GX0 A;  1ML6 A;  2JZS A;  2H76 A;  1WRY A;  1TRS A;  5DDL A;  3VWU A;  2BJX A;  2IMF A;  4D73 A;  2L57 A;  1SL2 B;  5GAN D;  2YWM A;  3KH9 A;  2DJ0 A;  4XS6 A;  4BVX A;  1GSF A;  4GLT A;  2GST A;  3RHB A;  1OE8 A;  4IS0 A;  1B48 A;  1G6W A;  1XBS A;  5HFK A;  3ZMK A;  1VF2 A;  1TU8 A;  2GS3 A;  3VLN A;  4ILF A;  5F8B A;  1GSY A;  3KJY A;  1UC7 A;  2PVQ A;  4ZL7 A;  4P3Y B;  2PGT A;  4TN8 A;  5HFI A;  3O3T A;  4GQC A;  2A2S A;  4MDC A;  2KHP A;  1EGO A;  1YF0 A;  3DVX A;  1K0M A;  2OE1 A;  2GDR A;  3GN3 A;  3QAV A;  1KNG A;  1NW2 A;  2WS2 A;  2HFD A;  3HVV A;  1GUH A;  5FWG A;  1J08 A;  2CV4 A;  1FG4 A;  2N5F A;  4ULX A;  3HZ8 A;  3CMI A;  2TRX A;  3KMO A;  2PU9 C;  5IO2 A;  3J7Y b;  1AIU A;  1OAZ A;  2LRN A;  1G6Y A;  1FB6 A;  3N9J A;  3DYR A;  2B6M A;  1ZMA A;  2WZ9 A;  4XIH A;  4J2F A;  11GS A;  2L6D A;  3G9B A;  3EUR A;  2LRT A;  3TJJ A;  2LJK A;  5CAX A;  4JBB A;  4RQX A;  1I9D A;  1BQ7 A;  3OR5 A;  5GAP D;  1J0F A;  2X8C A;  5JCW A;  1GTI A;  3UAP A;  3FR6 A;  4EE0 A;  1PL2 A;  3IBH A;  4I6X A;  3QAG A;  2H01 A;  2L5L A;  1AC1 A;  1MD3 A;  1V9W A;  4KGI A;  2DJ3 A;  4MZC A;  4DSS B;  2LNS A;  1EV4 A;  4ZIL A;  4QQ7 A;  2IPA A;  2LKU A;  2PBJ A;  1H4O A;  2B5X A;  4BVY A;  3TJB A;  5J3R A;  5CRG A;  5D93 A;  1RK4 A;  1SK2 A;  1F2E A;  2M72 A;  2I4A A;  2IME A;  2MBT A;  1ZZY A;  4GTU A;  2C3Q A;  4K0N A;  3ZFB A;  2WB9 A;  2V6K A;  1PSQ A;  3UL3 A;  1M9B A;  1EGR A;  3LG6 A;  4IQ1 A;  1NM3 A;  4MK3 A;  3LGC A;  1JZO A;  4I2T A;  4G19 A;  1SYR A; 
#chains in the Genus database with same CATH topology
 3KP8 A;  1VGL A;  2JSY A;  10GS A;  1K0C A;  2VD1 A;  2EIQ A;  1AW9 A;  2VCW A;  4MJB A;  2H1B A;  2YPM A;  3HDC A;  4KCA A;  1CQH A;  3LXZ A;  5CRE A;  4RI7 A;  2DMM A;  4RQR A;  4WEY A;  5CRH A;  3FRC A;  2IFQ A;  4USS A;  2H0I A;  4MJE A;  3CBU A;  3KZQ A;  1OKD A;  4ECI A;  3EMP A;  1XWC A;  2MMO A;  3I9V 2;  3KH7 A;  1USB A;  4PQ1 A;  1QGV A;  1FHE A;  1UVZ A;  5ECR B;  1A0F A;  2HI7 A;  5ECM B;  1S3R A;  3GH6 A;  1YEX A;  5G2Z A;  2OJL A;  4BA7 A;  9GSS A;  3GKX A;  1EP7 A;  2B3S A;  2MMA A;  4HSC X;  3H79 A;  3TRX A;  3ZTL A;  4POL A;  2I9H A;  2RII A;  3C1R A;  1KEB A;  1SYX A;  5JWR B;  2VOC A;  2WCI A;  2VL3 A;  1K0B A;  2HT9 A;  2C0F A;  4WXT A;  2H30 A;  17GS A;  3GH9 A;  3D4T A;  3EVI A;  2OBK A;  1GUM A;  2EC4 A;  1EWX A;  1R26 A;  2YV9 A;  3ZFL A;  2OKA A;  2DBC A;  4LMW A;  4K1F A;  5HR3 A;  2H73 A;  1U3A A;  5AIX A;  2P31 A;  1X5E A;  3CSI A;  3M9J A;  4YH2 A;  3H1N A;  3RPP A;  3IXR A;  3KGK A;  5IQY A;  3AY8 A;  4JR4 A;  3KP9 A;  2NVL A;  3A2X A;  4POM A;  5A4V A;  5ABR A;  1JZW A;  4F03 A;  1PX6 A;  3HVN A;  1T8E B;  3A5I A;  2K6V A;  4KND A;  3F6F A;  4J57 E;  4CY6 A;  3IE3 A;  16GS A;  1K0A A;  4NHZ A;  3ZL5 A;  1TI1 A;  3BOA A;  3FK8 A;  2GQK A;  1GSS A;  2P5R A;  2HZE A;  5G31 A;  5IOW A;  4XRD A;  2WDU A;  1WMJ A;  4V1A g;  4OD7 A;  3UBK A;  1X9M B;  2WJU A;  3VUR A;  5AN1 A;  4X43 A;  5A4U A;  2YN1 A;  3MNG A;  2PVO C;  1YF1 A;  5KN2 A;  2IIY A;  2MMN A;  5E4W A;  4ML1 A;  2C0E A;  2C1Y A;  3LOR A;  1GSU A;  1G7O A;  4KSM A;  6GSW A;  4J56 E;  1TK5 B;  3WGE A;  5LCZ A;  1GUK A;  3FW2 A;  2CVK A;  1F6M C;  4ECJ A;  1OYJ A;  4WKW A;  4HJM A;  2CZ3 A;  4F2I A;  2VM2 A;  1XW6 A;  3TKS A;  3SWL A;  3CTF A;  2HXK A;  5GSS A;  1ZYN A;  3VI5 A;  4YAV A;  4WF4 A;  4OCF A;  5F06 A;  1TRW A;  3H4K A;  1U6T A;  5CRD A;  1YZX A;  2FA4 A;  4GRF A;  5J9C A;  1T1V A;  4FYU A;  3DIE A;  3VK9 A;  3C71 A;  4I8B A;  3HJO A;  2HZF A;  3BCK A;  4YKG A;  1S3C A;  2FLS A;  1QXH A;  4MF5 A;  1OC3 A;  2H70 A;  4D73 B;  12GS A;  2VLT A;  3NIV A;  4BWS A;  3D6I A;  2FGX A;  3DEX A;  4TXO A;  1ERV A;  3RAZ A;  5DQY A;  4PQI A;  1YQ1 A;  2R0C A;  4MJC A;  5IMA A;  3U6V A;  2KLX A;  4OWY A;  1YEP A;  4BL7 A;  3VPQ A;  3GSS A;  1FO5 A;  1FVK A;  1M9A A;  2ZNM A;  1A23 A;  3ZIJ A;  3IRA A;  5ECO B;  3G7Y A;  1Z6M A;  3GV1 A;  4JED A;  3GUR A;  4N0V A;  4ZB9 A;  4O5Q A;  2GSQ A;  4ML6 A;  1EEM A;  2O7K A;  5D9W A;  3D4M A;  3G7I A;  4WR4 A;  3QAW A;  2F51 A;  2HNL A;  3HZ4 A;  3A3T A;  4TR4 A;  2YZH A;  1MD4 A;  4POK A;  3VI7 A;  1B8X A;  2RM6 A;  3A2V A;  2HYX A;  1XWB A;  2LUS A;  3CXG A;  1OKT A;  3L4N A;  4PNF A;  3HY2 A;  2VLU A;  2YP6 A;  7GSS A;  3Q74 A;  3BD2 A;  2HRK A;  2NPB A;  2H75 A;  3RHC A;  1XWG A;  2CVB A;  2A2R A;  4CHS A;  4ZL8 A;  2B1L A;  4V1A p;  1M3J A;  3L9U A;  3I6A A;  3UAR A;  4K5S A;  5IMF A;  6GSX A;  2X8G A;  2H19 A;  4IGJ A;  2K8V A;  2N5A A;  1PMT A;  2XHF A;  3DWV A;  5GZZ B;  1PN0 A;  2C8U A;  2V41 A;  3LXT A;  4EVM A;  4F0B A;  4IVF A;  1O81 A;  1XCC A;  4MAB A;  1E6B A;  4ECC A;  3TKS C;  1HNC A;  2HE3 A;  5C00 A;  5IIZ A;  1WE0 A;  5KN1 A;  3DKS A;  1ZOF A;  5ELG A;  3APQ A;  4AF2 A;  2C0D A;  2VL2 C;  2FUG 2;  4FIW A;  2FA8 A;  2VD0 A;  5DJL A;  4IN0 A;  4LL1 B;  4BVY B;  5HR2 A;  5E59 A;  3QOU A;  1Z3E A;  1O85 A;  3GA4 A;  2B7J A;  3IDV A;  5D96 A;  3F4R A;  1M2D A;  3KXO A;  4LMV A;  2WUL A;  5DVB A;  3DVW A;  4KB3 A;  1A2L A;  1A2J A;  1TI3 A;  3D0Z A;  4N11 A;  4FQU A;  2NBS A;  4HQZ A;  4MP4 A;  2JAC A;  4FYC A;  2XPD A;  2OE3 A;  4MF6 A;  4KW6 A;  2AUV A;  2A4V A;  2VCZ A;  3GL5 A;  5CYY A;  4IJI A;  1TRV A;  5G5E A;  1O8W A;  2LTK A;  5IPG A;  3D21 A;  1ST9 A;  3TKQ A;  1TU7 A;  5ECL B;  2AJQ B;  3UVT A;  4EC0 A;  3JCM L;  6GST A;  4Z2U A;  4L8E A;  2CAQ A;  3R2Q A;  2AV4 A;  3GHA A;  1X0R A;  3ZZX A;  1TDI A;  1TRU A;  3ZVJ D;  4KX4 A;  2ES7 A;  2FWE A;  5HR1 A;  2C0G A;  3WT2 A;  2LST A;  4N0Z A;  3E0U A;  1HNB A;  5AIV A;  4EDY A;  19GS A;  2OE0 A;  3TRQ A;  2X64 A;  1SKS B;  1A2M A;  1W4V A;  3D22 A;  3C73 A;  3VWV A;  1AQX A;  1BAY A;  4F82 A;  5ECK B;  3VWW A;  5CP1 A;  3F9U A;  4K7I A;  3W6G A;  2JZR A;  5IMV A;  2GZY A;  1Z5Y E;  5IMD A;  3US3 A;  4JZQ A;  2QKE A;  3E3E A;  1PN9 A;  4MMM A;  1SKR B;  2H6X A;  2IWT A;  3CRT A;  2DML A;  4MH3 A;  4YQM A;  20GS A;  1AAZ A;  4X4J A;  2EIR A;  5COH A;  5B6N A;  4K2X A;  4KDX A;  2GQL A;  2VCQ A;  1OVN A;  2O8V B;  4HZ2 A;  1SJ6 A;  2E2M A;  2O85 A;  5EVO A;  3GKM A;  4MLY A;  4E8E A;  5CNW A;  1QK8 A;  4F0C A;  3GTU A;  3HJM A;  4X0X A;  1XW5 A;  5IO0 A;  2MBS A;  4CW9 A;  4MZB A;  3P7X A;  4O92 A;  5IMC A;  4TXV A;  5F07 A;  3M9K A;  3TJF A;  1XOA A;  1SJI A;  1OE7 A;  2VAF A;  3CSH A;  4MNN A;  3W8J A;  4KDY A;  3TOU A;  1URM A;  3WGX A;  3APS A;  5ECH B;  3Q6O A;  1WP0 A;  4XTS A;  2VLV A;  4CDO A;  2H6Z A;  4KAE A;  1TP9 A;  1V58 A;  4LLR A;  4V2M A;  2LQO A;  1RQM A;  3ERW A;  5J9B A;  1O6J A;  2H1A A;  3GMF A;  1HD2 A;  2WGR A;  1B9Y C;  4V2N A;  3G7J A;  2GSS A;  3IC4 A;  4TRX A;  2OAD A;  2G2Q A;  4HQS A;  3FKF A;  1THO A;  1VF4 A;  4OFM A;  4HEA 2;  5FT3 A;  4ZBA A;  4MPF A;  1C72 A;  4TR1 A;  2R3X A;  1K0D A;  1AQW A;  2H1D A;  3M0F A;  5JWO B;  3F4T A;  2DIZ A;  2HRF A;  1Z7R A;  4MH2 A;  4ZBD A;  6GSS A;  6GSV A;  2DJJ A;  1JHB A;  2VL9 A;  3LFL A;  1A8Y A;  4K7O A;  3C8E A;  2DKI A;  4K0G A;  1PFO A;  3DML A;  2JZT A;  1YKC A;  4ZB6 A;  2PN8 A;  2FWH A;  2GT6 A;  4KA0 A;  1K0N A;  3M8N A;  4WET A;  5ID2 B;  4K7N A;  2E0Q A;  1ZYP A;  4G0I A;  3O76 A;  4TR3 A;  4JRR A;  4WF5 A;  1EOG A;  1WOU A;  4KE3 A;  1JLV A;  5ECN B;  3EC3 A;  4RUV A;  4LA1 A;  2GVP A;  2LEG A;  1M7T A;  2NTO A;  1ZL9 A;  1BYE A;  1DE2 A;  2H72 A;  3C7M A;  1A8L A;  4MF7 A;  4ACS A;  1KBN A;  1WWJ A;  2AYT A;  3TKP A;  1NHY A;  5D8I A;  5H5R A;  5IPH A;  3KCM A;  2C4J A;  2J9H A;  5LD0 A;  3D5J A;  4HDE A;  22GS A;  5DAK B;  3WT1 A;  2IL3 A;  5B7C A;  2R4V A;  1PKW A;  3FZA A;  1KTE A;  1XXU A;  2O87 A;  5KOX A;  4EDZ A;  3EE2 A;  2LJA A;  1ZYQ B;  5DAL B;  1R7H A;  2L6C A;  1F37 A;  1QMV A;  5DQS A;  3ED3 A;  2R5G A;  4MA9 A;  2GQM A;  3FR9 A;  3LWA A;  4EUY A;  5D9T A;  2X8H A;  2OAC A;  4TW5 A;  6GSU A;  4NXI A;  2FWF A;  2RUE A;  2HRN A;  3Q18 A;  2L5O A;  3GFK A;  3W8S A;  3IAS 2;  2GSR A;  3GKK A;  1TJD A;  4L0W A;  4I5Q A;  4XS4 B;  4AGS A;  2I1U A;  4TVE A;  1LU4 A;  2RUF A;  4IP6 A;  3PR8 A;  2EIO A;  4DSS A;  2GGT A;  3QFA C;  1GLQ A;  1PQN A;  1X5D A;  2LS5 A;  2V6O A;  1B9X C;  2KP1 A;  3ZML A;  1PGT A;  3MWH A;  1AQV A;  4WBJ A;  4NHW A;  2CX3 A;  1WIK A;  1FW1 A;  4TOP A;  2M80 A;  4L5L A;  5H5Q A;  3TUE A;  4DSR A;  3DGQ A;  5EL8 A;  4G10 A;  2FNO A;  3L78 A;  3RPN A;  3LEF A;  2CX4 A;  3GIX A;  1U88 A;  5HQP A;  4I2U A;  1EV9 A;  5G5F A;  3APO A;  2F9S A;  2IJY A;  3FZ4 A;  5AGY A;  4GWR A;  1K0O A;  5ENU A;  1MDI A;  4EF0 A;  4Z2R A;  4NAX A;  4BVX B;  3FY7 A;  1O7U A;  1SKW B;  4OMV A;  2YWO A;  1FB0 A;  3LYK A;  4HI7 A;  5KEJ A;  2JSZ A;  2QGV A;  4E8H A;  2CZ2 A;  2XPE A;  3WYW A;  2R2J A;  1A24 A;  2E7P A;  3PGT A;  4Q5Q A;  5KN3 A;  3ZVJ A;  3ZLP A;  2DJ2 A;  5ECQ B;  2DSA A;  1GUL A;  4ZXG A;  1V98 A;  1T4Y A;  2C80 A;  3F3Q A;  1G0T A;  2RM5 A;  4OFN A;  3GYK A;  5BMU A;  4KUN A;  1T3B A;  1S3A A;  1R5A A;  3IC8 A;  3TKR A;  1M2B A;  1AXD A;  4YAP A;  3ERG A;  1GL8 A;  4GSS A;  2AB6 A;  3I69 A;  1XOB A;  2V1M A;  2PUK C;  4CY8 A;  2YZU A;  4YQV A;  2R6K A;  3PH9 A;  4F9Z A;  1GRX A;  1G7E A;  2RLI A;  4HUA A;  2K9F A;  1R5P A;  8GSS A;  5JWQ B;  3MIX A;  3FR3 A;  4HOJ A;  3I43 A;  4IW9 A;  3GUS A;  2IMI A;  1GSE A;  4ICY A;  3QFB C;  4K2D A;  2TRC P;  4EIQ A;  1JFU A;  2MZC A;  13GS A;  2O89 A;  3M1G A;  2UZ8 A;  1ABA A;  1JZR A;  2YJH A;  4ECB A;  4O5R A;  3FZ5 A;  5GST A;  5ECP B;  1Z9H A;  5EY6 A;  3L0H A;  1V2A A;  3MAK A;  2PMT A;  1XVW A;  2HRA A;  4KF9 A;  4TR0 A;  1EOH A;  1XWA A;  4KDU A;  4PX1 A;  1MDJ A;  4PGT A;  2CT6 A;  4Z7X A;  4QL7 A;  4MZW A;  2YOI A;  1GNW A;  4WR5 A;  2FCH A;  2YJ7 A;  1ZCP A;  3A5W A;  1J9B A;  2G0F A;  1ACV A;  3HA9 A;  3GL3 A;  2VM1 A;  3H8Q A;  3TGZ A;  2X49 A;  4EXJ A;  4ZIJ A;  1GTA A;  1ON4 A;  2H1G A;  3CRU A;  4IJ3 A;  4GXZ A;  4WBR D;  4V2L A;  4FH8 A;  2HSH A;  1XPV A;  2CQ9 A;  3HYP A;  1EP8 A;  1ERU A;  3KD0 A;  4L5O A;  3TJG A;  1SK1 A;  1XVQ A;  4EIP A;  2BMX A;  2FY6 A;  2IFQ B;  2PWJ A;  4L0U A;  1GTB A;  5D73 A;  3UMA A;  4POB A;  4GSN A;  4H86 A;  1OC9 A;  3ZIV A;  3ZIT A;  1PA3 A;  2DC5 A;  2KUC A;  3L9S A;  3GNJ A;  2KOK A;  1VRS D;  1M99 A;  2F8F A;  1PRX A;  5EPF A;  4PQH A;  1FOV A;  1QUW A;  5LNK e;  3LQ7 A;  3K8N A;  4OCE A;  3KM6 A;  2GZP A;  3GKN A;  4O5U A;  2AHE A;  3EPT A;  1WPI A;  1IYI A;  3UVH A;  2AAW A;  3F8U A;  1T4Z A;  3IK7 A;  4IEL A;  1XW9 A;  3UIW A;  3SBC A;  3P90 A;  2H6Y A;  2FHE A;  5DBQ A;  3Q19 A;  1NHO A;  4GQF A;  1R4W A;  1YY7 A;  3QMX A;  5J41 A;  1HQO A;  5F0G A;  5G1K A;  1LBK A;  5A4W A;  4X1U A;  4HZ4 A;  1SL0 B;  4PUF C;  2R0P A;  1TW9 A;  2YWN A;  2YV7 A;  3KTL A;  2ON7 A;  2LRC A;  1BX9 A;  2GZZ A;  2LNT A;  3HCZ A;  1B4P A;  4K5R A;  3N5O A;  1PKZ A;  3UOM A;  2WRT A;  2V2G A;  1JZD A;  2DIY A;  5CRW A;  1HNA A;  2VCT A;  1GNE A;  3C1S A;  4OFT A;  3EU3 A;  3LYP A;  1TOF A;  5JCG A;  2VCV A;  3EMX A;  1M2A A;  4FYB A;  2YCD A;  2L59 A;  3BJ5 A;  2LJR A;  4K6X A;  3CSJ A;  4G0L A;  4Q5F A;  3TOT A;  2HZE B;  5B6M A;  4DSQ A;  4IKH A;  2B1K A;  1YJ6 A;  2VIM A;  5JCU A;  2LQQ A;  4Q5N A;  5D9V A;  5A5K A;  1QFN A;  4HJ2 A;  4NMU A;  3RDW A;  3WD6 A;  1JLW A;  3GST A;  2CAI A;  5B8A A;  2IMK A;  3NOF A;  3F4S A;  5IOX A;  2JL4 A;  4KH7 A;  5F05 A;  5J4U A;  1F3A A;  4OO5 A;  3ZRE A;  5ECS A;  4MCU A;  2C3N A;  2VUP A;  2YNX A;  4FO5 A;  3BBY A;  1X9W B;  3HXS A;  3RBT A;  3IAM 2;  4AJ8 A;  5G30 A;  1TXX A;  1K3Y A;  2I3Y A;  3GRX A;  2N5B A;  2K18 A;  4OO4 A;  2C3T A;  4JR6 A;  3FMW A;  1DSB A;  2L4C A;  1XIY A;  1XFL A;  4G9H A;  3E9J B;  1F3B A;  3EIN A;  2CVD A;  5DJM A;  5ELA A;  1S3D A;  1FAA A;  3P8W A;  2X99 A;  1VF1 A;  3TCO A;  1K3L A;  5L71 A;  1U3I A;  1X5C A;  1TKD B;  1OC8 A;  3U5R E;  18GS A;  1BG5 A;  4TXO B;  5H5S A;  2GTU A;  3TJK A;  1DE1 A;  5FHI A;  3UEM A;  4BL7 B;  1SK0 A;  4LL4 B;  4XCS A;  3IK9 A;  1Y6E A;  4NV2 A;  1BJX A;  3TRP A;  1SD8 A;  2NDO A;  4IBP A;  2V32 A;  4GCI A;  1A0R P;  4XRA A;  2PER A;  5D9X A;  2IN3 A;  4DVC A;  3IOS A;  1SEN A;  1QQ2 A;  3PPU A;  2XBI A;  3KMN A;  4ZBB A;  3P2A A;  3L9V A;  2HSM A;  4QL9 A;  4NPB A;  3HVX A;  2H66 A;  4PUR A;  1F9M A;  1SD9 A;  2ZCT A;  3VFI A;  4HU7 A;  4TKY A;  3HVS A;  5KOW A;  3QPM A;  3LJR A;  3ME8 A;  3IR4 A;  2XC2 A;  2B5Y A;  3F63 A;  1O8X A;  1I5G A;  3BCI A;  2PPT A;  5C04 A;  3ME7 A;  2ALB A;  5G1L A;  4MJA A;  2MYG A;  1ZYE A;  4BPY A;  3EU4 A;  1Z7P A;  4N10 A;  4N30 A;  1V57 A;  4O7H A;  1GTU A;  1O73 A;  3PIN A;  1YDK A;  3O6T A;  5HFG A;  1N2A A;  3F0I A;  2P0G A;  3VPT A;  2E2G A;  3CTG A;  1GLP A;  2B5E A;  3IPZ A;  2D2Z A;  1TK8 B;  3F3R A;  4Q5R A;  1MTC A;  2I81 A;  1SU9 A;  4YQU A;  4PUA A;  2YAN A;  1U87 A;  1PD2 1;  2WFC A;  2HSY A;  4KCE A;  4K9Z A;  4KSO A;  4O32 A;  2J23 A;  2VO4 A;  1GP1 A;  3TDG A;  2ZUP A;  5J5N A;  1FOH A;  1MEK A;  3F6D A;  4XHM A;  3FEU A;  3QD9 A;  3IHG A;  3HHV A;  3QR6 A;  3ISO A;  4IHU A;  2QC7 A;  2DJK A;  1DUG A;  2OBI A;  1T7P B;  2QSI A;  4NV5 A;  2VL2 A;  3DD3 A;  3KEB A;  2H74 A;  3ZRD A;  1K3O A;  3FZ9 A;  3UBL A;  2KP2 A;  5INY A;  2L4Q A;  5HR0 A;  2B7K A;  1OC9 B;  3ZYW A;  1IYH A;  3CQF A;  5B8B A;  2VCX A;  1TK0 B;  4PNG A;  3MSZ A;  14GS A;  4G2E A;  4PXO A;  2OA7 A;  1B4Q A;  2FD3 A;  2P5Q A;  3EWL A;  3KIJ A;  2FWG A;  2M46 A;  3DRN A;  4EKZ A;  3UJ1 A;  2DKH A;  4JU5 A;  1NSW A;  3QCP A;  1SJZ A;  1SL1 B;  1ILO A;  3M3M A;  3ERF A;  4ZL9 A;  2QA1 A;  1HYU A;  5ID2 A;  4MPG A;  4IP1 A;  4GF0 A;  1WJK A;  4BWQ A;  1X9S B;  4ID0 A;  4Z2T A;  2F8A A;  3GX8 A;  1AUC A;  5IM9 A;  1Z6N A;  1H75 A;  2YWI A;  3TB2 A;  1XWK A;  3QDN A;  2Z9S A;  6GSY A;  4DEJ A;  1TTZ A;  2JU5 A;  1Q4J A;  1GSD A;  5KN0 A;  2K8S A;  3FHK A;  2GT5 A;  3MDK A;  4HS1 A;  4G0K A;  3CYN A;  4JE1 A;  3FYG A;  2R0G A;  2MMZ A;  5CO3 A;  3HJP A;  2H71 A;  4XS1 A;  2H0H A;  1FVJ A;  3NZN A;  1GSQ A;  3V1W A;  1UA5 A;  2REM A;  4IQA A;  4AJ6 A;  2F3M A;  5DAK A;  1E2Y A;  1THX A;  1CQG A;  4GST A;  3LW9 A;  2DLX A;  1N8J A;  4ISD A;  3IA1 A;  1PX7 A;  1BED A;  1ERT A;  1RW1 A;  4ZB8 A;  4EL1 A;  4HU9 A;  2ON5 A;  3GTU B;  2R37 A;  1EZK A;  5DAL A;  3LSZ A;  2X4A A;  3H93 A;  3HD5 A;  4A5P A;  1YKA A;  1W89 A;  1XZO A;  4PTS A;  3TKS E;  3EYT A;  4AJ7 A;  1LJR A;  2HLS A;  5IMZ A;  2TIR A;  5DCH A;  3VWX A;  5DCG A;  3J7Y k;  3IHQ A;  1ZGN A;  2GLR A;  1GWC A;  2LV3 A;  5AIS A;  1Q98 A;  5ECI B;  4XS4 A;  1V40 A;  2BTO T;  4EO3 A;  1GH2 A;  4NWY A;  4I97 A;  1EEJ A;  1ERW A;  1Y25 A;  1M0U A;  3A2W A;  1DBY A;  2IMD A;  2XBQ A;  2DJ1 A;  3HKR A;  1PL1 A;  1VF3 A;  1MDK A;  2JAD A;  2H0G A;  4RI6 A;  1T00 A;  3KTB A;  3WGD A;  1UN2 A;  3S9F A;  3DXB A;  4TR1 B;  2H8L A;  4K8M A;  3IV4 A;  2CA8 A;  3GX0 A;  1ML6 A;  2JZS A;  2H76 A;  1WRY A;  3R3E A;  1TRS A;  5DDL A;  3VWU A;  2BJX A;  2IMF A;  4D73 A;  2L57 A;  1SL2 B;  5GAN D;  2YWM A;  3KH9 A;  2DJ0 A;  4XS6 A;  4BVX A;  1GSF A;  4GLT A;  2GST A;  3RHB A;  2QA2 A;  1OE8 A;  4IS0 A;  1B48 A;  1G6W A;  1XBS A;  5HFK A;  3ZMK A;  1VF2 A;  1TU8 A;  2GS3 A;  3VLN A;  4ILF A;  5F8B A;  1GSY A;  3KJY A;  1UC7 A;  2PVQ A;  4ZL7 A;  4P3Y B;  2PGT A;  4TN8 A;  5HFI A;  3O3T A;  4GQC A;  2A2S A;  4MDC A;  2A4H A;  2KHP A;  1EGO A;  1YF0 A;  3DVX A;  1K0M A;  2OE1 A;  2GDR A;  3GN3 A;  3QAV A;  1KNG A;  1NW2 A;  2WS2 A;  5BRT A;  2HFD A;  3HVV A;  1GUH A;  5FWG A;  1J08 A;  2CV4 A;  1FG4 A;  2N5F A;  4ULX A;  3HZ8 A;  3CMI A;  2TRX A;  3KMO A;  2PU9 C;  5IO2 A;  3J7Y b;  1AIU A;  1OAZ A;  2LRN A;  1G6Y A;  4BIK A;  1FB6 A;  3N9J A;  3DYR A;  2B6M A;  1ZMA A;  2WZ9 A;  4XIH A;  4J2F A;  11GS A;  2L6D A;  3G9B A;  3EUR A;  2LRT A;  3TJJ A;  2LJK A;  5CAX A;  4JBB A;  4RQX A;  1I9D A;  1BQ7 A;  1XG8 A;  3OR5 A;  5GAP D;  1J0F A;  2X8C A;  5JCW A;  1GTI A;  3UAP A;  3FR6 A;  4EE0 A;  1PL2 A;  3IBH A;  4I6X A;  4YKF A;  3QAG A;  2H01 A;  2L5L A;  1AC1 A;  1MD3 A;  1V9W A;  4KGI A;  2DJ3 A;  4MZC A;  4DSS B;  2LNS A;  1EV4 A;  4ZIL A;  4QQ7 A;  2IPA A;  2LKU A;  2PBJ A;  1H4O A;  2B5X A;  4BVY A;  3MYD A;  3TJB A;  5J3R A;  5CRG A;  5D93 A;  1RK4 A;  1SK2 A;  1F2E A;  2M72 A;  2I4A A;  2IME A;  2MBT A;  1ZZY A;  4GTU A;  2C3Q A;  4K0N A;  3ZFB A;  2WB9 A;  2V6K A;  1PSQ A;  2A2P A;  3UL3 A;  1M3I A;  1M9B A;  1EGR A;  3LG6 A;  4IQ1 A;  1NM3 A;  4MK3 A;  3LGC A;  1JZO A;  4I2T A;  4G19 A;  1SYR A; 
#chains in the Genus database with same CATH homology
 3KP8 A;  1VGL A;  2JSY A;  10GS A;  1K0C A;  2VD1 A;  2EIQ A;  1AW9 A;  2VCW A;  4MJB A;  2H1B A;  2YPM A;  3HDC A;  4KCA A;  1CQH A;  3LXZ A;  5CRE A;  4RI7 A;  2DMM A;  4RQR A;  4WEY A;  5CRH A;  3FRC A;  2IFQ A;  4USS A;  2H0I A;  4MJE A;  3CBU A;  3KZQ A;  1OKD A;  4ECI A;  3EMP A;  1XWC A;  2MMO A;  3I9V 2;  3KH7 A;  1USB A;  4PQ1 A;  1QGV A;  1FHE A;  1UVZ A;  5ECR B;  1A0F A;  2HI7 A;  5ECM B;  3GH6 A;  1YEX A;  5G2Z A;  2OJL A;  4BA7 A;  9GSS A;  3GKX A;  1EP7 A;  2B3S A;  2MMA A;  3H79 A;  3TRX A;  3ZTL A;  4POL A;  2I9H A;  2RII A;  3C1R A;  1KEB A;  1SYX A;  5JWR B;  2VOC A;  2WCI A;  2VL3 A;  1K0B A;  2HT9 A;  2C0F A;  4WXT A;  2H30 A;  17GS A;  3GH9 A;  3D4T A;  3EVI A;  2OBK A;  1GUM A;  2EC4 A;  1EWX A;  1R26 A;  2YV9 A;  3ZFL A;  2OKA A;  2DBC A;  4LMW A;  4K1F A;  5HR3 A;  2H73 A;  1U3A A;  5AIX A;  2P31 A;  1X5E A;  3CSI A;  3M9J A;  4YH2 A;  3H1N A;  3RPP A;  3IXR A;  3KGK A;  5IQY A;  3AY8 A;  4JR4 A;  3KP9 A;  2NVL A;  3A2X A;  4POM A;  5A4V A;  5ABR A;  1JZW A;  4F03 A;  1PX6 A;  1T8E B;  3A5I A;  2K6V A;  4KND A;  3F6F A;  4J57 E;  4CY6 A;  3IE3 A;  16GS A;  1K0A A;  4NHZ A;  3ZL5 A;  1TI1 A;  3BOA A;  3FK8 A;  2GQK A;  1GSS A;  2P5R A;  2HZE A;  5G31 A;  5IOW A;  4XRD A;  2WDU A;  1WMJ A;  4V1A g;  4OD7 A;  3UBK A;  1X9M B;  2WJU A;  3VUR A;  5AN1 A;  4X43 A;  5A4U A;  2YN1 A;  3MNG A;  2PVO C;  1YF1 A;  5KN2 A;  2IIY A;  2MMN A;  5E4W A;  4ML1 A;  2C0E A;  2C1Y A;  3LOR A;  1GSU A;  1G7O A;  4KSM A;  6GSW A;  4J56 E;  1TK5 B;  3WGE A;  5LCZ A;  1GUK A;  3FW2 A;  2CVK A;  1F6M C;  4ECJ A;  1OYJ A;  4WKW A;  4HJM A;  2CZ3 A;  4F2I A;  2VM2 A;  1XW6 A;  3TKS A;  3SWL A;  3CTF A;  2HXK A;  5GSS A;  1ZYN A;  3VI5 A;  4YAV A;  4WF4 A;  4OCF A;  5F06 A;  1TRW A;  3H4K A;  1U6T A;  5CRD A;  1YZX A;  2FA4 A;  4GRF A;  5J9C A;  1T1V A;  4FYU A;  3DIE A;  3VK9 A;  3C71 A;  4I8B A;  3HJO A;  2HZF A;  3BCK A;  4YKG A;  1S3C A;  2FLS A;  1QXH A;  4MF5 A;  1OC3 A;  2H70 A;  4D73 B;  12GS A;  2VLT A;  3NIV A;  4BWS A;  3D6I A;  2FGX A;  3DEX A;  4TXO A;  1ERV A;  3RAZ A;  5DQY A;  4PQI A;  1YQ1 A;  2R0C A;  4MJC A;  5IMA A;  3U6V A;  2KLX A;  4OWY A;  1YEP A;  4BL7 A;  3VPQ A;  3GSS A;  1FO5 A;  1FVK A;  1M9A A;  2ZNM A;  1A23 A;  3ZIJ A;  3IRA A;  5ECO B;  3G7Y A;  1Z6M A;  3GV1 A;  4JED A;  3GUR A;  4N0V A;  4ZB9 A;  4O5Q A;  2GSQ A;  4ML6 A;  1EEM A;  2O7K A;  5D9W A;  3D4M A;  3G7I A;  4WR4 A;  3QAW A;  2F51 A;  2HNL A;  3HZ4 A;  3A3T A;  4TR4 A;  2YZH A;  1MD4 A;  4POK A;  3VI7 A;  1B8X A;  2RM6 A;  3A2V A;  2HYX A;  1XWB A;  2LUS A;  3CXG A;  1OKT A;  3L4N A;  4PNF A;  3HY2 A;  2VLU A;  2YP6 A;  7GSS A;  3Q74 A;  3BD2 A;  2HRK A;  2NPB A;  2H75 A;  3RHC A;  1XWG A;  2CVB A;  2A2R A;  4CHS A;  4ZL8 A;  2B1L A;  4V1A p;  3L9U A;  3I6A A;  3UAR A;  4K5S A;  5IMF A;  6GSX A;  2X8G A;  2H19 A;  4IGJ A;  2K8V A;  2N5A A;  1PMT A;  2XHF A;  3DWV A;  5GZZ B;  1PN0 A;  2C8U A;  2V41 A;  3LXT A;  4EVM A;  4F0B A;  4IVF A;  1O81 A;  1XCC A;  4MAB A;  1E6B A;  4ECC A;  3TKS C;  1HNC A;  2HE3 A;  5C00 A;  5IIZ A;  1WE0 A;  5KN1 A;  3DKS A;  1ZOF A;  5ELG A;  3APQ A;  4AF2 A;  2C0D A;  2VL2 C;  2FUG 2;  4FIW A;  2FA8 A;  2VD0 A;  5DJL A;  4IN0 A;  4LL1 B;  4BVY B;  5HR2 A;  5E59 A;  3QOU A;  1Z3E A;  1O85 A;  3GA4 A;  2B7J A;  3IDV A;  5D96 A;  3F4R A;  1M2D A;  3KXO A;  4LMV A;  2WUL A;  5DVB A;  3DVW A;  4KB3 A;  1A2L A;  1A2J A;  1TI3 A;  3D0Z A;  4N11 A;  4FQU A;  2NBS A;  4HQZ A;  4MP4 A;  2JAC A;  4FYC A;  2XPD A;  2OE3 A;  4MF6 A;  4KW6 A;  2AUV A;  2A4V A;  2VCZ A;  5CYY A;  3GL5 A;  4IJI A;  1TRV A;  5G5E A;  1O8W A;  2LTK A;  5IPG A;  3D21 A;  1ST9 A;  3TKQ A;  1TU7 A;  5ECL B;  2AJQ B;  3UVT A;  4EC0 A;  3JCM L;  6GST A;  4Z2U A;  4L8E A;  2CAQ A;  3R2Q A;  2AV4 A;  3GHA A;  1X0R A;  3ZZX A;  1TDI A;  1TRU A;  3ZVJ D;  4KX4 A;  2ES7 A;  2FWE A;  5HR1 A;  2C0G A;  3WT2 A;  2LST A;  4N0Z A;  3E0U A;  1HNB A;  5AIV A;  4EDY A;  19GS A;  2OE0 A;  3TRQ A;  2X64 A;  1SKS B;  1A2M A;  1W4V A;  3D22 A;  3C73 A;  3VWV A;  1AQX A;  1BAY A;  4F82 A;  5ECK B;  3VWW A;  5CP1 A;  3F9U A;  4K7I A;  3W6G A;  2JZR A;  5IMV A;  2GZY A;  1Z5Y E;  5IMD A;  3US3 A;  4JZQ A;  2QKE A;  3E3E A;  1PN9 A;  4MMM A;  1SKR B;  2H6X A;  2IWT A;  3CRT A;  2DML A;  4MH3 A;  4YQM A;  20GS A;  1AAZ A;  4X4J A;  2EIR A;  5COH A;  5B6N A;  4K2X A;  4KDX A;  2GQL A;  2VCQ A;  1OVN A;  2O8V B;  4HZ2 A;  1SJ6 A;  2E2M A;  2O85 A;  5EVO A;  3GKM A;  4MLY A;  4E8E A;  5CNW A;  1QK8 A;  4F0C A;  3GTU A;  3HJM A;  4X0X A;  1XW5 A;  5IO0 A;  2MBS A;  4CW9 A;  4MZB A;  3P7X A;  4O92 A;  5IMC A;  4TXV A;  5F07 A;  3M9K A;  3TJF A;  1XOA A;  1SJI A;  1OE7 A;  2VAF A;  3CSH A;  4MNN A;  3W8J A;  4KDY A;  3TOU A;  1URM A;  3WGX A;  3APS A;  5ECH B;  3Q6O A;  1WP0 A;  4XTS A;  2VLV A;  4CDO A;  2H6Z A;  4KAE A;  1TP9 A;  1V58 A;  4LLR A;  4V2M A;  2LQO A;  1RQM A;  3ERW A;  5J9B A;  1O6J A;  2H1A A;  3GMF A;  1HD2 A;  2WGR A;  1B9Y C;  4V2N A;  3G7J A;  2GSS A;  3IC4 A;  4TRX A;  2OAD A;  2G2Q A;  4HQS A;  3FKF A;  1THO A;  1VF4 A;  4OFM A;  4HEA 2;  5FT3 A;  4ZBA A;  4MPF A;  1C72 A;  4TR1 A;  2R3X A;  1K0D A;  1AQW A;  2H1D A;  3M0F A;  5JWO B;  3F4T A;  2DIZ A;  2HRF A;  1Z7R A;  4MH2 A;  4ZBD A;  6GSS A;  6GSV A;  2DJJ A;  1JHB A;  2VL9 A;  3LFL A;  1A8Y A;  4K7O A;  3C8E A;  2DKI A;  4K0G A;  3DML A;  2JZT A;  1YKC A;  4ZB6 A;  2PN8 A;  2FWH A;  2GT6 A;  4KA0 A;  1K0N A;  3M8N A;  4WET A;  5ID2 B;  4K7N A;  2E0Q A;  1ZYP A;  4G0I A;  3O76 A;  4TR3 A;  4JRR A;  4WF5 A;  1EOG A;  1WOU A;  4KE3 A;  1JLV A;  5ECN B;  3EC3 A;  4RUV A;  4LA1 A;  2GVP A;  2LEG A;  1M7T A;  2NTO A;  1ZL9 A;  1BYE A;  1DE2 A;  2H72 A;  3C7M A;  1A8L A;  4MF7 A;  4ACS A;  1KBN A;  1WWJ A;  2AYT A;  3TKP A;  1NHY A;  5D8I A;  5H5R A;  5IPH A;  3KCM A;  2C4J A;  2J9H A;  5LD0 A;  3D5J A;  4HDE A;  22GS A;  5DAK B;  3WT1 A;  2IL3 A;  5B7C A;  2R4V A;  1PKW A;  3FZA A;  1KTE A;  1XXU A;  2O87 A;  5KOX A;  4EDZ A;  3EE2 A;  2LJA A;  1ZYQ B;  5DAL B;  1R7H A;  2L6C A;  1F37 A;  1QMV A;  5DQS A;  3ED3 A;  2R5G A;  4MA9 A;  2GQM A;  3FR9 A;  3LWA A;  4EUY A;  5D9T A;  2X8H A;  2OAC A;  4TW5 A;  6GSU A;  4NXI A;  2FWF A;  2RUE A;  2HRN A;  3Q18 A;  2L5O A;  3GFK A;  3W8S A;  3IAS 2;  2GSR A;  3GKK A;  1TJD A;  4L0W A;  4I5Q A;  4XS4 B;  4AGS A;  2I1U A;  4TVE A;  1LU4 A;  2RUF A;  4IP6 A;  3PR8 A;  2EIO A;  4DSS A;  2GGT A;  3QFA C;  1GLQ A;  1PQN A;  1X5D A;  2LS5 A;  2V6O A;  1B9X C;  2KP1 A;  3ZML A;  1PGT A;  3MWH A;  1AQV A;  4WBJ A;  4NHW A;  2CX3 A;  1WIK A;  1FW1 A;  4TOP A;  2M80 A;  4L5L A;  5H5Q A;  3TUE A;  4DSR A;  3DGQ A;  5EL8 A;  4G10 A;  2FNO A;  3L78 A;  3RPN A;  3LEF A;  2CX4 A;  3GIX A;  1U88 A;  5HQP A;  4I2U A;  1EV9 A;  5G5F A;  3APO A;  2F9S A;  2IJY A;  3FZ4 A;  5AGY A;  4GWR A;  1K0O A;  5ENU A;  1MDI A;  4EF0 A;  4Z2R A;  4NAX A;  4BVX B;  3FY7 A;  1O7U A;  1SKW B;  4OMV A;  2YWO A;  1FB0 A;  3LYK A;  4HI7 A;  5KEJ A;  2JSZ A;  2QGV A;  4E8H A;  2CZ2 A;  2XPE A;  3WYW A;  2R2J A;  1A24 A;  2E7P A;  3PGT A;  4Q5Q A;  5KN3 A;  3ZVJ A;  3ZLP A;  2DJ2 A;  5ECQ B;  2DSA A;  1GUL A;  4ZXG A;  1V98 A;  1T4Y A;  2C80 A;  3F3Q A;  1G0T A;  2RM5 A;  4OFN A;  3GYK A;  5BMU A;  4KUN A;  1T3B A;  1S3A A;  1R5A A;  3IC8 A;  3TKR A;  1M2B A;  1AXD A;  4YAP A;  3ERG A;  1GL8 A;  4GSS A;  2AB6 A;  3I69 A;  1XOB A;  2V1M A;  2PUK C;  4CY8 A;  2YZU A;  4YQV A;  2R6K A;  3PH9 A;  4F9Z A;  1GRX A;  1G7E A;  2RLI A;  4HUA A;  2K9F A;  1R5P A;  8GSS A;  5JWQ B;  3MIX A;  3FR3 A;  4HOJ A;  3I43 A;  4IW9 A;  3GUS A;  2IMI A;  1GSE A;  4ICY A;  3QFB C;  4K2D A;  2TRC P;  4EIQ A;  1JFU A;  2MZC A;  13GS A;  2O89 A;  3M1G A;  2UZ8 A;  1ABA A;  1JZR A;  2YJH A;  4ECB A;  4O5R A;  3FZ5 A;  5GST A;  5ECP B;  1Z9H A;  5EY6 A;  3L0H A;  1V2A A;  3MAK A;  2PMT A;  1XVW A;  2HRA A;  4KF9 A;  4TR0 A;  1EOH A;  1XWA A;  4KDU A;  4PX1 A;  1MDJ A;  4PGT A;  2CT6 A;  4Z7X A;  4QL7 A;  4MZW A;  2YOI A;  1GNW A;  4WR5 A;  2FCH A;  2YJ7 A;  1ZCP A;  3A5W A;  1J9B A;  2G0F A;  1ACV A;  3HA9 A;  3GL3 A;  2VM1 A;  3H8Q A;  3TGZ A;  2X49 A;  4EXJ A;  4ZIJ A;  1GTA A;  1ON4 A;  2H1G A;  3CRU A;  4IJ3 A;  4GXZ A;  4WBR D;  4V2L A;  4FH8 A;  2HSH A;  1XPV A;  2CQ9 A;  3HYP A;  1EP8 A;  1ERU A;  3KD0 A;  4L5O A;  3TJG A;  1SK1 A;  1XVQ A;  4EIP A;  2BMX A;  2FY6 A;  2IFQ B;  2PWJ A;  4L0U A;  1GTB A;  5D73 A;  3UMA A;  4POB A;  4GSN A;  4H86 A;  1OC9 A;  3ZIV A;  3ZIT A;  1PA3 A;  2DC5 A;  2KUC A;  3L9S A;  3GNJ A;  2KOK A;  1VRS D;  1M99 A;  2F8F A;  1PRX A;  5EPF A;  4PQH A;  1FOV A;  1QUW A;  5LNK e;  3LQ7 A;  3K8N A;  4OCE A;  3KM6 A;  2GZP A;  3GKN A;  4O5U A;  2AHE A;  3EPT A;  1WPI A;  1IYI A;  3UVH A;  2AAW A;  3F8U A;  1T4Z A;  3IK7 A;  4IEL A;  1XW9 A;  3UIW A;  3SBC A;  3P90 A;  2H6Y A;  2FHE A;  5DBQ A;  3Q19 A;  1NHO A;  4GQF A;  1R4W A;  1YY7 A;  3QMX A;  5J41 A;  1HQO A;  5F0G A;  5G1K A;  1LBK A;  5A4W A;  4X1U A;  4HZ4 A;  1SL0 B;  4PUF C;  2R0P A;  1TW9 A;  2YWN A;  2YV7 A;  3KTL A;  2ON7 A;  2LRC A;  1BX9 A;  2GZZ A;  2LNT A;  3HCZ A;  1B4P A;  4K5R A;  3N5O A;  1PKZ A;  3UOM A;  2WRT A;  2V2G A;  1JZD A;  2DIY A;  5CRW A;  1HNA A;  2VCT A;  1GNE A;  3C1S A;  4OFT A;  3EU3 A;  3LYP A;  1TOF A;  5JCG A;  2VCV A;  3EMX A;  1M2A A;  4FYB A;  2YCD A;  2L59 A;  3BJ5 A;  2LJR A;  4K6X A;  3CSJ A;  4G0L A;  4Q5F A;  3TOT A;  2HZE B;  5B6M A;  4DSQ A;  4IKH A;  2B1K A;  1YJ6 A;  2VIM A;  5JCU A;  2LQQ A;  4Q5N A;  5D9V A;  5A5K A;  1QFN A;  4HJ2 A;  4NMU A;  3RDW A;  3WD6 A;  1JLW A;  3GST A;  2CAI A;  5B8A A;  2IMK A;  3NOF A;  3F4S A;  5IOX A;  2JL4 A;  4KH7 A;  5F05 A;  5J4U A;  1F3A A;  4OO5 A;  3ZRE A;  5ECS A;  4MCU A;  2C3N A;  2VUP A;  2YNX A;  4FO5 A;  3BBY A;  1X9W B;  3HXS A;  3RBT A;  3IAM 2;  4AJ8 A;  5G30 A;  1TXX A;  1K3Y A;  2I3Y A;  3GRX A;  2N5B A;  2K18 A;  4OO4 A;  2C3T A;  4JR6 A;  3FMW A;  1DSB A;  2L4C A;  1XIY A;  1XFL A;  4G9H A;  3E9J B;  1F3B A;  3EIN A;  2CVD A;  5DJM A;  5ELA A;  1S3D A;  1FAA A;  3P8W A;  2X99 A;  1VF1 A;  3TCO A;  1K3L A;  5L71 A;  1U3I A;  1X5C A;  1TKD B;  1OC8 A;  3U5R E;  18GS A;  1BG5 A;  4TXO B;  5H5S A;  2GTU A;  3TJK A;  1DE1 A;  5FHI A;  3UEM A;  4BL7 B;  1SK0 A;  4LL4 B;  4XCS A;  3IK9 A;  1Y6E A;  4NV2 A;  1BJX A;  3TRP A;  1SD8 A;  2NDO A;  4IBP A;  2V32 A;  4GCI A;  1A0R P;  4XRA A;  2PER A;  5D9X A;  2IN3 A;  4DVC A;  3IOS A;  1SEN A;  1QQ2 A;  3PPU A;  2XBI A;  3KMN A;  4ZBB A;  3P2A A;  3L9V A;  2HSM A;  4QL9 A;  4NPB A;  3HVX A;  2H66 A;  4PUR A;  1F9M A;  1SD9 A;  2ZCT A;  3VFI A;  4HU7 A;  4TKY A;  3HVS A;  5KOW A;  3QPM A;  3LJR A;  3ME8 A;  3IR4 A;  2XC2 A;  2B5Y A;  3F63 A;  1O8X A;  1I5G A;  3BCI A;  2PPT A;  5C04 A;  3ME7 A;  2ALB A;  5G1L A;  4MJA A;  2MYG A;  1ZYE A;  4BPY A;  3EU4 A;  1Z7P A;  4N10 A;  4N30 A;  1V57 A;  4O7H A;  1GTU A;  1O73 A;  3PIN A;  1YDK A;  3O6T A;  5HFG A;  1N2A A;  3F0I A;  2P0G A;  3VPT A;  2E2G A;  3CTG A;  1GLP A;  2B5E A;  3IPZ A;  2D2Z A;  1TK8 B;  3F3R A;  4Q5R A;  1MTC A;  2I81 A;  1SU9 A;  4YQU A;  4PUA A;  2YAN A;  1U87 A;  1PD2 1;  2WFC A;  2HSY A;  4KCE A;  4K9Z A;  4KSO A;  4O32 A;  2J23 A;  2VO4 A;  1GP1 A;  3TDG A;  2ZUP A;  5J5N A;  1FOH A;  1MEK A;  3F6D A;  4XHM A;  3FEU A;  3QD9 A;  3IHG A;  3HHV A;  3QR6 A;  3ISO A;  4IHU A;  2QC7 A;  2DJK A;  1DUG A;  2OBI A;  1T7P B;  2QSI A;  4NV5 A;  2VL2 A;  3DD3 A;  3KEB A;  2H74 A;  3ZRD A;  1K3O A;  3FZ9 A;  3UBL A;  2KP2 A;  5INY A;  2L4Q A;  5HR0 A;  2B7K A;  1OC9 B;  3ZYW A;  1IYH A;  5B8B A;  2VCX A;  1TK0 B;  4PNG A;  3MSZ A;  14GS A;  4G2E A;  4PXO A;  2OA7 A;  1B4Q A;  2FD3 A;  2P5Q A;  3EWL A;  3KIJ A;  2FWG A;  2M46 A;  3DRN A;  4EKZ A;  3UJ1 A;  2DKH A;  4JU5 A;  1NSW A;  3QCP A;  1SJZ A;  1SL1 B;  1ILO A;  3M3M A;  3ERF A;  4ZL9 A;  2QA1 A;  1HYU A;  5ID2 A;  4MPG A;  4IP1 A;  4GF0 A;  1WJK A;  4BWQ A;  1X9S B;  4ID0 A;  4Z2T A;  2F8A A;  3GX8 A;  1AUC A;  5IM9 A;  1Z6N A;  1H75 A;  2YWI A;  3TB2 A;  1XWK A;  3QDN A;  2Z9S A;  6GSY A;  4DEJ A;  1TTZ A;  2JU5 A;  1Q4J A;  1GSD A;  5KN0 A;  2K8S A;  3FHK A;  2GT5 A;  3MDK A;  4HS1 A;  4G0K A;  3CYN A;  4JE1 A;  3FYG A;  2R0G A;  2MMZ A;  5CO3 A;  3HJP A;  2H71 A;  4XS1 A;  2H0H A;  1FVJ A;  3NZN A;  1GSQ A;  3V1W A;  1UA5 A;  2REM A;  4IQA A;  4AJ6 A;  2F3M A;  5DAK A;  1E2Y A;  1THX A;  1CQG A;  4GST A;  3LW9 A;  2DLX A;  1N8J A;  4ISD A;  3IA1 A;  1PX7 A;  1BED A;  1ERT A;  1RW1 A;  4ZB8 A;  4EL1 A;  4HU9 A;  2ON5 A;  3GTU B;  2R37 A;  1EZK A;  5DAL A;  3LSZ A;  2X4A A;  3H93 A;  3HD5 A;  4A5P A;  1YKA A;  1W89 A;  1XZO A;  4PTS A;  3TKS E;  3EYT A;  4AJ7 A;  1LJR A;  2HLS A;  5IMZ A;  2TIR A;  5DCH A;  3VWX A;  5DCG A;  3J7Y k;  3IHQ A;  1ZGN A;  2GLR A;  1GWC A;  2LV3 A;  5AIS A;  1Q98 A;  5ECI B;  4XS4 A;  1V40 A;  2BTO T;  4EO3 A;  1GH2 A;  4NWY A;  4I97 A;  1EEJ A;  1ERW A;  1Y25 A;  1M0U A;  3A2W A;  1DBY A;  2IMD A;  2XBQ A;  2DJ1 A;  3HKR A;  1PL1 A;  1VF3 A;  1MDK A;  2JAD A;  2H0G A;  4RI6 A;  1T00 A;  3KTB A;  3WGD A;  1UN2 A;  3S9F A;  3DXB A;  4TR1 B;  2H8L A;  4K8M A;  3IV4 A;  2CA8 A;  3GX0 A;  1ML6 A;  2JZS A;  2H76 A;  1WRY A;  3R3E A;  1TRS A;  5DDL A;  3VWU A;  2BJX A;  2IMF A;  4D73 A;  2L57 A;  1SL2 B;  5GAN D;  2YWM A;  3KH9 A;  2DJ0 A;  4XS6 A;  4BVX A;  1GSF A;  4GLT A;  2GST A;  3RHB A;  2QA2 A;  1OE8 A;  4IS0 A;  1B48 A;  1G6W A;  1XBS A;  5HFK A;  3ZMK A;  1VF2 A;  1TU8 A;  2GS3 A;  3VLN A;  4ILF A;  5F8B A;  1GSY A;  3KJY A;  1UC7 A;  2PVQ A;  4ZL7 A;  4P3Y B;  2PGT A;  4TN8 A;  5HFI A;  3O3T A;  4GQC A;  2A2S A;  4MDC A;  2A4H A;  2KHP A;  1EGO A;  1YF0 A;  3DVX A;  1K0M A;  2OE1 A;  2GDR A;  3GN3 A;  3QAV A;  1KNG A;  1NW2 A;  2WS2 A;  5BRT A;  2HFD A;  3HVV A;  1GUH A;  5FWG A;  1J08 A;  2CV4 A;  1FG4 A;  2N5F A;  4ULX A;  3HZ8 A;  3CMI A;  2TRX A;  3KMO A;  2PU9 C;  5IO2 A;  3J7Y b;  1AIU A;  1OAZ A;  2LRN A;  1G6Y A;  1FB6 A;  3N9J A;  3DYR A;  2B6M A;  1ZMA A;  2WZ9 A;  4XIH A;  4J2F A;  11GS A;  2L6D A;  3G9B A;  3EUR A;  2LRT A;  3TJJ A;  2LJK A;  5CAX A;  4JBB A;  4RQX A;  1I9D A;  1BQ7 A;  3OR5 A;  5GAP D;  1J0F A;  2X8C A;  5JCW A;  1GTI A;  3UAP A;  3FR6 A;  4EE0 A;  1PL2 A;  3IBH A;  4I6X A;  4YKF A;  3QAG A;  2H01 A;  2L5L A;  1AC1 A;  1MD3 A;  1V9W A;  4KGI A;  2DJ3 A;  4MZC A;  4DSS B;  2LNS A;  1EV4 A;  4ZIL A;  4QQ7 A;  2IPA A;  2LKU A;  2PBJ A;  1H4O A;  2B5X A;  4BVY A;  3MYD A;  3TJB A;  5J3R A;  5CRG A;  5D93 A;  1RK4 A;  1SK2 A;  1F2E A;  2M72 A;  2I4A A;  2IME A;  2MBT A;  1ZZY A;  4GTU A;  2C3Q A;  4K0N A;  3ZFB A;  2WB9 A;  2V6K A;  1PSQ A;  2A2P A;  3UL3 A;  1M9B A;  1EGR A;  3LG6 A;  4IQ1 A;  1NM3 A;  4MK3 A;  3LGC A;  1JZO A;  4I2T A;  4G19 A;  1SYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...