2MBTA

Nmr study of padsba
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
190
structure length
190
Chain Sequence
b'GDDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLESMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Fragment library screening identifies hits that bind to the non-catalytic surface of Pseudomonas aeruginosa DsbA1.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 52
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2013-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2mbtA00
1FB6A 2AJQB 3UVTA 3F4TA 4MZWA 4POMA 1SD8A 2HXKA 3DKSA 1EP8A 4Q5FA 2C4JA 5G2ZA 1ILOA 2F8FA 5D96A 4TVEA 2X99A 1J0FA 5FT3A 4YAPA 2RM5A 2WS2A 2C0FA 2H0IA 5D9WA 1K0MA 2E2MA 1YKCA 1HNAA 2DC5A 5EVOA 3UJ1A 4RQRA 1BYEA 5LD0A 1X0RA 5IPHA 3RDWA 1X9MB 5ECIB 2VOCA 4KE3A 1GSYA 3TB2A 3W8JA 1TI1A 3VFIA 2IMEA 3ZRDA 4N10A 2O7KA 4WETA 1SK0A 1UN2A 2IFQB 2RIIA 3FZAA 3L4NA 4BA7A 4N11A 1URMA 1F3BA 2VL2A 4YQUA 3EVIA 5DBQA 5D9TA 4TKYA 3VWWA 2XBQA 2CVKA 2Z9SA 5AN1A 5ID2B 1K0NA 4GF0A 4F9ZA 5IQYA 3F63A 4XCSA 5ECOB 3ZTLA 4PUAA 2H0HA 3HJOA 3US3A 3GFKA 2DMMA 5G1KA 6GSTA 3RPNA 3FZ9A 4TR0A 4OMVA 1XWCA 4FYUA 1Z6MA 4G19A 3C71A 4MJAA 4ML1A 2GZPA 4IW9A 3DVXA 5HFIA 4O5RA 1EZKA 4K9ZA 4NPBA 1EEMA 5FHIA 3UAPA 4V2MA 1GRXA 9GSSA 1UVZA 1VF1A 1A0FA 2YJ7A 1F3AA 2VL3A 1V57A 1MDKA 2OE3A 3CSIA 2YZHA 4JZQA 4KUNA 4K2DA 4HUAA 1QFNA 5IMFA 2IIYA 4IBPA 2LRNA 4MPGA 2FUG2 1UC7A 2H0GA 3BJ5A 2VCVA 3FKFA 2REMA 1CQGA 3WGEA 3KTBA 4PXOA 1U87A 3GURA 2ES7A 4KA0A 4EDZA 5E59A 1HNCA 2MBSA 3CYNA 3F3QA 1K0BA 3TKSE 1H75A 1GNEA 3KD0A 4JBBA 5IIZA 3A2VA 5F06A 2LUSA 4PNFA 1WRYA 3MNGA 4OFTA 4TRXA 1JFUA 1XW5A 4IP1A 2FCHA 1NSWA 3BOAA 2IMDA 4I6XA 3MDKA 3E0UA 2FLSA 3H8QA 4MF5A 1LU4A 1PL2A 1ERUA 3GIXA 4I2TA 1OVNA 3KP8A 2YPMA 3WT1A 4WKWA 2NPBA 2XBIA 2HFDA 1B4QA 3IHQA 3VPQA 2E0QA 1O8XA 6GSWA 2IMKA 5AIXA 1PKWA 2XPEA 4HZ2A 4IQAA 1MTCA 3ZIJA 2B5YA 2OACA 3FRCA 3A2XA 2CA8A 3A3TA 2VL2C 13GSA 1EGOA 4V2NA 2V2GA 2V32A 1Y6EA 3PH9A 5KN3A 1ZOFA 3M3MA 3VK9A 2XPDA 3QCPA 5J5NA 2WULA 3RBTA 4XIHA 2H72A 3D0ZA 1PSQA 4FIWA 1QXHA 4IP6A 5DAKA 3GN3A 1YEPA 2DBCA 1GSFA 1EEJA 1M99A 3ZVJA 3N5OA 3KH7A 3RAZA 2H01A 3CSJA 8GSSA 2VCWA 5IMCA 1I9DA 3IDVA 3KMNA 17GSA 2GTUA 2P5RA 4HS1A 3VWUA 1WWJA 1KTEA 4DVCA 3HHVA 2GSSA 1A2JA 3F9UA 2IFQA 4MLYA 2GQMA 4EF0A 2PUKC 3ZMKA 2QKEA 2FNOA 1F9MA 5L71A 2K9FA 2O85A 4OFNA 2E7PA 2JSZA 3QAWA 5ID2A 4F0BA 4AJ7A 4CW9A 12GSA 3IR4A 1USBA 4H86A 4K7NA 3W8SA 2CAQA 3NZNA 2DIYA 4IKHA 4DSRA 1WMJA 1TRVA 2KOKA 1XWGA 1LBKA 3TKPA 3TRXA 1YQ1A 1QUWA 2KLXA 1SYRA 3HCZA 1SK2A 4G10A 1MD4A 2RLIA 3CSHA 3MAKA 1TKDB 1O85A 2VM2A 2CAIA 2JZRA 5F0GA 1AXDA 2OJLA 3AY8A 2FWFA 1BJXA 1O8WA 4EKZA 3H4KA 1K0DA 2GSRA 1AAZA 3LG6A 1XW9A 1GUMA 4MK3A 2C0EA 6GSVA 1GSUA 1B9XC 4MA9A 1DE2A 2QC7A 1Z7PA 4QL7A 2R4VA 4G2EA 4E8HA 2BJXA 4LMVA 5IO0A 1XWKA 3LWAA 3QAGA 1ACVA 1ERTA 2R6KA 1TK0B 1FO5A 3HD5A 3NIVA 1GTIA 1TI3A 3C8EA 2A4VA 3FR6A 1KBNA 3UBKA 1GULA 2VCXA 1B9YC 5ECLB 5CRGA 2G0FA 3HKRA 3BCKA 2YNXA 2NBSA 1SL0B 2H71A 3GRXA 1X9WB 1PMTA 4LLRA 4KGIA 1FAAA 2WDUA 1R4WA 4L5LA 2WFCA 4J2FA 3LJRA 1T4ZA 5B6NA 2GDRA 5JCGA 4HQSA 3VI5A 4HOJA 2PBJA 3QDNA 1NHYA 1AQWA 1BX9A 5HR3A 4TOPA 4MH3A 1EP7A 4CHSA 3GHAA 3ZYWA 5JWOB 2YCDA 2B3SA 5IMZA 5GZZB 3QOUA 3KM6A 5EPFA 3CBUA 3RPPA 3J7Yb 3WGDA 3CTFA 1Z7RA 1SKWB 4LA1A 4YQVA 4AJ8A 3I6AA 1X9SB 5G1LA 1N2AA 3EMPA 1Q4JA 2PVQA 3FHKA 1G7EA 4K1FA 2DJ3A 1U3IA 3H93A 1GTAA 5CYYA 1WE0A 4LMWA 3QAVA 3CMIA 4MH2A 2ALBA 2WGRA 1J9BA 2VO4A 3KXOA 3HYPA 2ON7A 5B7CA 2F8AA 1GP1A 4PQ1A 5ECNB 2M46A 3LEFA 4F03A 1GSQA 2WCIA 5J4UA 5DALB 1DSBA 4I97A 1ERVA 1O81A 4KCAA 4EXJA 2DSAA 3LYPA 3E9JB 2ZUPA 3HJMA 4KDXA 3GL5A 4ZBDA 2AYTA 3CRTA 3FY7A 5HR1A 5D9VA 3ZFLA 1JHBA 3ZIVA 4GSSA 4MCUA 3F8UA 3LGCA 2QSIA 4KB3A 3GX8A 1OC9B 3UEMA 5ECRB 3EU4A 1WOUA 3HA9A 3DGQA 2NDOA 1TP9A 3DMLA 1XOBA 1S3AA 2C0DA 1K3OA 4G9HA 3TUEA 5HR0A 4IS0A 2TRCP 1THOA 7GSSA 2FHEA 2QGVA 1T8EB 1V2AA 5IOWA 2DLXA 1DUGA 2I3YA 2RUEA 1RW1A 2XC2A 3IV4A 5DCGA 3M8NA 5KN0A 1T4YA 2YWNA 3LORA 2EC4A 2ZCTA 1A23A 3DXBA 5GSTA 1TK5B 3WT2A 1A8YA 2FGXA 2VCTA 4ZXGA 3H1NA 4OCEA 2N5AA 4I5QA 3L9SA 3TRQA 1SYXA 3APOA 4NV5A 2IJYA 2LNTA 5ECKB 1QGVA 3FW2A 1XCCA 3KCMA 3IK9A 4IELA 3ZVJD 3F0IA 4X43A 4Q5RA 4JU5A 2JU5A 1YKAA 1VF3A 3M9KA 3O3TA 2AAWA 4HDEA 4IGJA 5B8BA 4FH8A 4QQ7A 2AB6A 2GS3A 3G9BA 4WBRD 3HVXA 1YF0A 1TU7A 2GQKA 5CREA 1R5AA 1PRXA 3VURA 1VF4A 4XRDA 1THXA 5ECMB 5CP1A 3DEXA 3HY2A 4F82A 1GSEA 2R2JA 3O6TA 1ERWA 5G31A 3DRNA 2H66A 2YANA 1ABAA 2FA8A 4TXVA 2AUVA 2FD3A 4FYCA 2WRTA 1Z9HA 2H6ZA 3G7IA 3UOMA 2B7JA 3GH6A 2HZFA 3D4MA 1BEDA 4MPFA 2NVLA 2OBIA 1HQOA 4KCEA 1NW2A 1PA3A 5COHA 1PX6A 4DSSB 1SJIA 2O89A 4DSQA 3F3RA 3M1GA 1Z3EA 3N9JA 1XBSA 2LQOA 4POBA 3PGTA 1F37A 1OYJA 4NMUA 4YAVA 4ECJA 5CNWA 1B8XA 3G7YA 2LNSA 2P0GA 4IQ1A 4KH7A 2WZ9A 2MBTA 3V1WA 1H4OA 5B8AA 2YOIA 6GSUA 3KTLA 1T00A 4ID0A 1RQMA 1K3YA 1EGRA 4RI7A 1SKRB 2C3NA 3F4RA 4TR1B 1FOVA 3GUSA 3Q18A 4MP4A 2VL9A 2N5BA 3JCML 3IRAA 4EDYA 4GQFA 5LNKe 3F6FA 3C7MA 3W6GA 3QD9A 4GQCA 4MABA 2YV7A 3HXSA 2R5GA 3HZ8A 4KAEA 4XS4B 5DQSA 3Q19A 3UIWA 5GAND 2B5EA 3APSA 2GVPA 3EINA 3LYKA 3CRUA 2HYXA 3HDCA 5HQPA 1DBYA 5DALA 1R26A 1BAYA 2LRCA 5D9XA 5J9BA 4IN0A 5B6MA 2H1DA 19GSA 2NTOA 4NHWA 4WXTA 2M80A 1YF1A 3K8NA 5F05A 2JZSA 1OKDA 2X64A 2CV4A 3D22A 4P3YB 3LQ7A 3IBHA 4EL1A 1JZDA 3UL3A 4HI7A 2A2RA 1TRSA 3I43A 5ENUA 4HJ2A 3WD6A 1AIUA 4OO5A 1M0UA 2GT6A 2I81A 3IC4A 5IMDA 1FHEA 2LJKA 5ECQB 1K0CA 4TW5A 3UMAA 1ML6A 2MMOA 3ZITA 4XTSA 4D73B 2IMIA 4OD7A 1AQXA 3C73A 1SU9A 2EIOA 3KP9A 3QPMA 5CRWA 1EV9A 5H5QA 1E6BA 2GGTA 4IHUA 4IJIA 5EY6A 1XZOA 1V58A 4N30A 1XVQA 1C72A 2V6OA 5FWGA 4JE1A 2D2ZA 3DYRA 1K0OA 3GNJA 1S3DA 2C0GA 2YWMA 4BVXA 1SD9A 2HI7A 4MJEA 2C80A 18GSA 4O92A 1A8LA 2K8SA 4BWQA 2OADA 4L0WA 1VF2A 1GSSA 1M2DA 1ZL9A 3QFBC 4WEYA 4WR4A 1IYHA 3GKXA 4PUFC 3TJFA 2VLUA 2VCQA 3PR8A 5JCUA 1U88A 3CXGA 2OKAA 1X5CA 3TDGA 2P31A 1FW1A 5ECSA 3F6DA 2JADA 2H1GA 2VLTA 3TJKA 5HFKA 3QFAC 1UA5A 5DQYA 4AGSA 3SBCA 5IPGA 1XPVA 1TOFA 4X0XA 5J3RA 4KDUA 3L9VA 4KNDA 3ME8A 1SJZA 3GV1A 2OA7A 3KGKA 3KZQA 4XS1A 1V9WA 1F6MC 1QK8A 4YQMA 2LJRA 1KEBA 2LQQA 4WR5A 2H19A 1KNGA 3RHBA 2GT5A 2YV9A 5KEJA 2GQLA 3DWVA 4BWSA 2HZEB 2I1UA 2X8CA 3MWHA 4WBJA 2HT9A 3HVVA 1FVJA 3KEBA 2HRFA 2K8VA 1T1VA 3IOSA 2I9HA 4ZBAA 4DSSA 1BG5A 4FYBA 3FR9A 2H74A 2C3TA 4TXOB 1JZRA 2LRTA 2I4AA 4I2UA 1XVWA 3LXTA 5GAPD 1TTZA 3EE2A 1Y25A 1O73A 4HQZA 2R3XA 4N0VA 2H1BA 1O6JA 4I8BA 1YDKA 3BCIA 4JRRA 4PQIA 3D21A 1B4PA 5IMVA 5J9CA 3LXZA 5KN1A 3HVSA 2K18A 4ISDA 2TRXA 22GSA 2GSTA 4GWRA 2BTOT 1K3LA 3IA1A 1HYUA 4TR1A 3EYTA 4LL1B 1N8JA 1X5EA 3P7XA 1AUCA 1U6TA 2PVOC 1V40A 3BBYA 4MZCA 4F2IA 3TKQA 2EIQA 1HD2A 4MDCA 2YN1A 2HSYA 4XRAA 4GTUA 4NAXA 1JLVA 3C1RA 3IAS2 2B7KA 3ED3A 5ABRA 2PWJA 2PN8A 3APQA 2H70A 3ZZXA 2LKUA 4IJ3A 4MF7A 1TU8A 5ECPB 2FWHA 2CX3A 2V1MA 3ZLPA 1XWAA 1TW9A 4MMMA 1M9AA 3P2AA 4V1Ag 1JZWA 3L9UA 3HZ4A 5IO2A 1OKTA 16GSA 3ME7A 3EMXA 2FWGA 4BPYA 2F3MA 5CRDA 2CVDA 3R2QA 2CZ2A 5GSSA 2X8HA 4ZBBA 2FA4A 1R5PA 2CQ9A 2RUFA 2H6XA 3CTGA 3LFLA 1DE1A 4D73A 4NV2A 2JSYA 3Q74A 4RUVA 3QMXA 1ON4A 4Z7XA 5DAKB 1GTUA 4CDOA 5C04A 1ST9A 1OE8A 5EL8A 3TCOA 1FB0A 3FR3A 4ECBA 1TK8B 2YZUA 5JWQB 4AJ6A 2YJHA 3I69A 2N5FA 1A2LA 5KN2A 3LSZA 4ECCA 3KMOA 4PX1A 4ZB9A 1MEKA 1X5DA 3UVHA 1TRUA 2L57A 1G6WA 2E2GA 3Q6OA 1ZZYA 3IK7A 2LSTA 5ECHB 4BVYA 3KH9A 3O76A 3IXRA 2H30A 3FEUA 1T7PB 3GMFA 5DJMA 3U5RE 1A24A 1QMVA 1YZXA 5AGYA 3WYWA 2YP6A 1AW9A 2MYGA 2L5LA 1TXXA 4RI6A 1G0TA 1GSDA 3UARA 4K7IA 3GSSA 1PN9A 2MMAA 4ULXA 3SWLA 3NOFA 4EE0A 2DJJA 1XWBA 3HJPA 3RHCA 2IL3A 3UBLA 4FO5A 1AQVA 2L59A 1MDJA 3ZFBA 4NWYA 4E8EA 2LEGA 2L4QA 4J57E 4ZB6A 3BD2A 4HJMA 4HU9A 2HZEA 3ZMLA 1XXUA 3TKRA 4HU7A 2C3QA 3KIJA 1ZYEA 2C8UA 1XW6A 2VUPA 1PGTA 1PL1A 1WP0A 2DJ0A 2HRNA 4MJCA 4K7OA 2O8VB 4JR4A 3P8WA 3IE3A 2KUCA 1Z6NA 3FZ5A 4TXOA 3TJJA 4GCIA 2GZYA 3TJGA 4GRFA 2HSHA 4O32A 1A2MA 3VPTA 4L0UA 5DDLA 3M0FA 2KP1A 2GZZA 5AISA 3ERGA 1I5GA 2GLRA 3U6VA 1QQ2A 2EIRA 2A2SA 5D8IA 3QR6A 1AC1A 1U3AA 3IAM2 3L78A 1WJKA 2OE1A 2JZTA 2DIZA 5HFGA 2LS5A 2ZNMA 1GH2A 4TN8A 1GTBA 3D6IA 4WF5A 2CVBA 1MD3A 2RM6A 3A2WA 5ELGA 1NM3A 3DD3A 2IWTA 4QL9A 2DJ1A 4PURA 3M9JA 4K6XA 2PPTA 1EOGA 3EU3A 2HE3A 2V6KA 3E3EA 4XHMA 1W4VA 2KHPA 2MMZA 3G7JA 4ML6A 2JL4A 2K6VA 2VCZA 4F0CA 1EWXA 3F4SA 3GKNA 5CAXA 2FWEA 4Q5NA 2H6YA 3ISOA 1V98A 1VGLA 5DVBA 4HEA2 1SKSB 2L4CA 5ELAA 2F9SA 4PGTA 1O7UA 1ZYQB 3GTUB 1GUHA 4ZL7A 4EO3A 1NHOA 2CZ3A 1VRSD 2B1KA 3I9V2 3FK8A 4L8EA 1PKZA 1R7HA 2H75A 2R37A 4DEJA 2AV4A 3GYKA 5F07A 1T3BA 2PGTA 4POLA 3TKSA 2HLSA 4AF2A 5JCWA 2BMXA 1XOAA 4N0ZA 1PQNA 4POKA 4K0NA 1Q98A 4MF6A 2B6MA 3EC3A 5LCZA 20GSA 5INYA 1OAZA 1OC9A 3L0HA 3TOUA 4GSNA 4MZBA 4OO4A 1ZCPA 2DJKA 3TJBA 1GL8A 4ACSA 2IPAA 3EWLA 1TDIA 4TR3A 3DIEA 3H79A 5CRHA 3GSTA 3FZ4A 6GSYA 3EURA 2J9HA 4XS6A 1Z5YE 3GH9A 2CX4A 2YWIA 1M9BA 1SL1B 1GLQA 4GXZA 3GA4A 2LTKA 2AHEA 3ERWA 1RK4A 2VD1A 3OR5A 4NHZA 4EUYA 1YEXA 2O87A 2OBKA 3C1SA 3J7Yk 4ZIJA 3TOTA 5A4WA 1J08A 3PINA 4KSMA 2FY6A 1SENA 4RQXA 1YJ6A 2VD0A 1G7OA 5JWRB 1XFLA 4KX4A 1SJ6A 11GSA 1G6YA 1JZOA 5A4UA 1TJDA 4JR6A 4ZILA 1FG4A 3ZREA 2L5OA 2H8LA 4KDYA 4K0GA 2G2QA 4WF4A 2PU9C 3ERFA 2DJ2A 1WPIA 5G5FA 4PNGA 1PD21 1XIYA 5E4WA 14GSA 2B5XA 4NXIA 1S3CA 4ILFA 2H1AA 3VWXA 1OC8A 2B1LA 1TRWA 4OWYA 2DMLA 2WJUA 1M7TA 3IPZA 3VWVA 4JEDA 1K0AA 1EOHA 1IYIA 5F8BA 1YY7A 5A4VA 5IOXA 4IVFA 1W89A 4ZL9A 1M2BA 1B48A 2JACA 2PMTA 1SL2B 3S9FA 1EV4A 4ZL8A 2F51A 5G5EA 2VLVA 3P90A 5H5RA 2VAFA 4EC0A 3A5WA 4KSOA 2MZCA 1MDIA 2M72A 4X1UA 1ZMAA 5DJLA 3TKSC 4L5OA 3GKMA 1JLWA 4Q5QA 4TR4A 1FVKA 3VLNA 1M2AA 5H5SA 4O7HA 4YH2A 5HR2A 3D5JA 4HZ4A 2KP2A 2YWOA 2ON5A 2L6CA 2TIRA 2P5QA 4EVMA 4OCFA 3TGZA 2WB9A 6GSXA 1SK1A 3VI7A 1F2EA 5G30A 2GSQA 5AIVA 4KW6A 1E2YA 1GLPA 4J56E 3GTUA 2IMFA 5A5KA 4XS4A 1HNBA 1CQHA 2V41A 4MJBA 1WIKA 3GL3A 2H73A 2X8GA 5C00A 4V1Ap 6GSSA 3TRPA 1GUKA 1A0RP 2L6DA 1ZGNA 3KJYA 1BQ7A 1LJRA 4PQHA 4K8MA 2MMNA 4ECIA 4GLTA 5D73A 5D93A 3FYGA 4BL7A 3GX0A 1GWCA 3WGXA 4V2LA 4ZB8A 4LL4B 3ZL5A 3DVWA 2VM1A 2C1YA 3MSZA 5CO3A 2HNLA 1GNWA 5DCHA 5IMAA 4OFMA 5J41A 1PX7A 2OE0A 2H76A 3GKKA 2XHFA 1OC3A 2VIMA 2LJAA 1OE7A 3D4TA 10GSA 2CT6A 2J23A 5IM9A 2IN3A 4GSTA 2LV3A 2PERA
chains in the Genus database with same CATH superfamily
1FB6A 2AJQB 3UVTA 3F4TA 4MZWA 4POMA 2A2PA 1SD8A 2HXKA 3DKSA 1EP8A 4Q5FA 2C4JA 5G2ZA 1ILOA 2F8FA 5D96A 4TVEA 2X99A 1J0FA 5FT3A 4YAPA 1S3RA 2RM5A 2C0FA 2H0IA 2WS2A 5D9WA 1K0MA 2E2MA 1YKCA 1HNAA 2DC5A 5EVOA 3UJ1A 4RQRA 1BYEA 5LD0A 1X0RA 5IPHA 3RDWA 1X9MB 5ECIB 2VOCA 4KE3A 1GSYA 3TB2A 3W8JA 1TI1A 3VFIA 2IMEA 3ZRDA 4N10A 2O7KA 4WETA 1SK0A 1UN2A 2IFQB 2RIIA 3FZAA 3L4NA 4BA7A 4N11A 1URMA 1F3BA 2VL2A 4YQUA 3EVIA 5DBQA 5D9TA 4TKYA 3VWWA 2XBQA 2CVKA 2Z9SA 5AN1A 5ID2B 1K0NA 4GF0A 4F9ZA 5IQYA 3F63A 5BRTA 4XCSA 5ECOB 3ZTLA 4PUAA 2H0HA 3HJOA 3US3A 3GFKA 2DMMA 5G1KA 6GSTA 3RPNA 3FZ9A 4TR0A 4OMVA 1XWCA 4FYUA 1Z6MA 4G19A 3C71A 4MJAA 4ML1A 2GZPA 4IW9A 3DVXA 5HFIA 4O5RA 1EZKA 4K9ZA 4X4JA 4NPBA 1EEMA 5FHIA 3UAPA 4V2MA 1GRXA 9GSSA 1UVZA 1VF1A 1A0FA 2YJ7A 1M3JA 1F3AA 5KOWA 2VL3A 1V57A 1MDKA 2OE3A 3CSIA 2YZHA 4JZQA 4KUNA 4K2DA 4HUAA 1QFNA 1M3IA 5IMFA 2IIYA 4IBPA 2LRNA 4MPGA 2FUG2 1UC7A 2H0GA 3BJ5A 2VCVA 3FKFA 2REMA 1CQGA 3WGEA 3KTBA 4PXOA 1U87A 3GURA 2ES7A 4KA0A 4EDZA 4O5QA 5E59A 1HNCA 2MBSA 2HRKA 3CYNA 3F3QA 1K0BA 3TKSE 1H75A 1GNEA 3KD0A 4JBBA 5IIZA 3A2VA 5F06A 2LUSA 4PNFA 1WRYA 3MNGA 1ZYPA 4OFTA 4TRXA 1JFUA 1XW5A 4IP1A 2FCHA 1NSWA 3BOAA 2IMDA 4I6XA 3MDKA 3E0UA 2FLSA 3H8QA 4MF5A 1LU4A 1PL2A 1ERUA 3GIXA 4I2TA 1OVNA 3KP8A 2YPMA 3WT1A 4WKWA 2NPBA 2XBIA 2HFDA 1B4QA 3IHQA 3VPQA 2E0QA 1O8XA 6GSWA 2IMKA 5AIXA 1PKWA 2XPEA 4HZ2A 4IQAA 4BIKA 1MTCA 3ZIJA 2B5YA 2OACA 3FRCA 3A2XA 2CA8A 3A3TA 4CY8A 2VL2C 13GSA 1EGOA 4V2NA 2V2GA 2V32A 1Y6EA 3PH9A 5KN3A 1ZOFA 3M3MA 3VK9A 2XPDA 3QCPA 5J5NA 2WULA 3RBTA 4XIHA 2H72A 3D0ZA 1PSQA 4FIWA 1QXHA 4IP6A 5DAKA 3GN3A 1YEPA 2DBCA 1GSFA 1EEJA 1M99A 3ZVJA 3N5OA 3KH7A 3RAZA 2H01A 3CSJA 8GSSA 2VCWA 5IMCA 3MIXA 1I9DA 3IDVA 3KMNA 17GSA 2GTUA 2P5RA 4HS1A 3VWUA 1WWJA 1KTEA 4DVCA 3HHVA 2GSSA 1A2JA 3F9UA 2IFQA 4MLYA 2GQMA 4EF0A 2PUKC 3ZMKA 2QKEA 2FNOA 3MYDA 1F9MA 5L71A 2K9FA 2O85A 4OFNA 4K5RA 2E7PA 2JSZA 3QAWA 5ID2A 4F0BA 4AJ7A 4CW9A 12GSA 3IR4A 1USBA 4H86A 4K7NA 3W8SA 2CAQA 3NZNA 2DIYA 4IKHA 4DSRA 1WMJA 1TRVA 2KOKA 1XWGA 1LBKA 3TKPA 3TRXA 1YQ1A 1QUWA 2KLXA 1SYRA 3HCZA 1SK2A 4G10A 1MD4A 2RLIA 3CSHA 3MAKA 4BVYB 1TKDB 1O85A 2VM2A 2CAIA 2JZRA 5F0GA 1AXDA 2OJLA 3AY8A 2FWFA 1BJXA 1O8WA 4EKZA 3H4KA 1K0DA 2GSRA 4K5SA 1AAZA 3LG6A 1XW9A 1GUMA 4MK3A 2C0EA 6GSVA 1GSUA 1B9XC 4MA9A 1DE2A 2QC7A 1Z7PA 4QL7A 2R4VA 2R0GA 4G2EA 4E8HA 2BJXA 4LMVA 5IO0A 1XWKA 3LWAA 3QAGA 1ACVA 1ERTA 2R6KA 1TK0B 1FO5A 3HD5A 3NIVA 1GTIA 1TI3A 3C8EA 2A4VA 3FR6A 1KBNA 3UBKA 1GULA 2VCXA 1B9YC 4MNNA 5ECLB 5CRGA 2G0FA 3HKRA 2R0CA 2X4AA 3BCKA 2YNXA 2NBSA 1SL0B 2H71A 3GRXA 1X9WB 1PMTA 4LLRA 4KGIA 1FAAA 2WDUA 1R4WA 4L5LA 2WFCA 4J2FA 2HSMA 3LJRA 1T4ZA 5B6NA 2GDRA 5JCGA 4HQSA 3VI5A 4HOJA 2PBJA 3QDNA 1NHYA 1AQWA 1BX9A 5HR3A 4TOPA 4MH3A 1EP7A 4CHSA 3GHAA 3ZYWA 5JWOB 2YCDA 2B3SA 5IMZA 5GZZB 3QOUA 3KM6A 5EPFA 3CBUA 3CQFA 3RPPA 3J7Yb 4YKFA 3WGDA 3CTFA 1Z7RA 1SKWB 4LA1A 4YQVA 4AJ8A 3I6AA 1X9SB 5G1LA 1N2AA 3EMPA 1Q4JA 2PVQA 3FHKA 1G7EA 4K1FA 2DJ3A 1U3IA 1PN0A 3H93A 1GTAA 4FQUA 5CYYA 1WE0A 4LMWA 3QAVA 3CMIA 4MH2A 4Z2RA 2ALBA 2WGRA 1J9BA 3R3EA 2VO4A 3KXOA 3HYPA 2ON7A 5B7CA 2F8AA 1GP1A 4PQ1A 5ECNB 2M46A 3LEFA 4F03A 1GSQA 2WCIA 5J4UA 5DALB 1DSBA 4I97A 1ERVA 1O81A 4KCAA 4EXJA 2DSAA 3LYPA 3E9JB 2ZUPA 3HJMA 4KDXA 3GL5A 4ZBDA 2AYTA 3CRTA 3FY7A 5HR1A 5D9VA 2A4HA 3ZFLA 1JHBA 3ZIVA 4GSSA 4MCUA 3F8UA 3LGCA 2QSIA 4KB3A 3GX8A 1OC9B 3UEMA 5ECRB 3EU4A 1WOUA 3HA9A 3DGQA 2NDOA 1TP9A 3DMLA 1XOBA 1S3AA 2C0DA 1K3OA 4G9HA 3TUEA 5HR0A 4IS0A 2TRCP 1THOA 7GSSA 2FHEA 2QGVA 1T8EB 1V2AA 5IOWA 2DLXA 1DUGA 2I3YA 2RUEA 1RW1A 2XC2A 3IV4A 5DCGA 3M8NA 5KN0A 1T4YA 2YWNA 3LORA 2EC4A 2ZCTA 1A23A 3DXBA 5GSTA 1TK5B 3WT2A 2X49A 1A8YA 2FGXA 2VCTA 4ZXGA 3IHGA 3H1NA 4OCEA 2N5AA 4I5QA 3L9SA 3TRQA 1SYXA 3APOA 4NV5A 2IJYA 2LNTA 5ECKB 1QGVA 3FW2A 1XCCA 3KCMA 3IK9A 4BVXB 4IELA 3FMWA 3ZVJD 3F0IA 4X43A 4Q5RA 4JU5A 2JU5A 1YKAA 1VF3A 3M9KA 3O3TA 2AAWA 4HDEA 4IGJA 5B8BA 4FH8A 4QQ7A 2AB6A 2GS3A 3G9BA 4WBRD 3HVXA 1YF0A 1TU7A 2GQKA 5CREA 1R5AA 1PRXA 3VURA 1VF4A 4XRDA 1THXA 5ECMB 5CP1A 3DEXA 3HY2A 4F82A 1GSEA 2R2JA 3O6TA 1ERWA 5G31A 3DRNA 2H66A 2YANA 1ABAA 2FA8A 4TXVA 2AUVA 2FD3A 4FYCA 2WRTA 4HSCX 1Z9HA 2H6ZA 3G7IA 3UOMA 2B7JA 3GH6A 2HZFA 2UZ8A 3D4MA 1BEDA 4MPFA 2NVLA 2OBIA 1HQOA 4KCEA 1NW2A 1PA3A 5COHA 1PX6A 4DSSB 1SJIA 2O89A 4DSQA 3F3RA 3M1GA 1Z3EA 3N9JA 1XBSA 2LQOA 4POBA 3PGTA 1F37A 1OYJA 4NMUA 4YAVA 4A5PA 4ECJA 5CNWA 1B8XA 3G7YA 2LNSA 2P0GA 4IQ1A 4KH7A 2WZ9A 2MBTA 4G0KA 3V1WA 1H4OA 5B8AA 3IC8A 2YOIA 6GSUA 3KTLA 1T00A 4ID0A 1RQMA 1K3YA 1EGRA 4RI7A 1SKRB 4CY6A 2C3NA 3F4RA 4TR1B 1FOVA 3GUSA 3Q18A 4MP4A 2VL9A 2N5BA 3JCML 3IRAA 4EDYA 4GQFA 5LNKe 3F6FA 3C7MA 5BMUA 3W6GA 3QD9A 4GQCA 4MABA 2YV7A 3HXSA 2R5GA 3HZ8A 4KAEA 4XS4B 5DQSA 3Q19A 3UIWA 5GAND 2B5EA 3APSA 2GVPA 3EINA 3LYKA 3CRUA 2HYXA 3HDCA 5HQPA 1DBYA 5DALA 1R26A 1BAYA 2LRCA 5D9XA 5J9BA 4IN0A 5B6MA 2H1DA 19GSA 2NTOA 4NHWA 4WXTA 2M80A 1YF1A 3K8NA 5F05A 2JZSA 1OKDA 2X64A 2CV4A 3D22A 4P3YB 3LQ7A 3IBHA 4EL1A 1JZDA 3UL3A 4HI7A 2A2RA 1TRSA 3I43A 5ENUA 4HJ2A 3WD6A 1AIUA 4OO5A 1M0UA 2GT6A 2I81A 3IC4A 5IMDA 1FHEA 2LJKA 5ECQB 1K0CA 4TW5A 3UMAA 1ML6A 2MMOA 3ZITA 4XTSA 4D73B 2IMIA 4OD7A 1AQXA 3C73A 1SU9A 2EIOA 3KP9A 3QPMA 5CRWA 1EV9A 5H5QA 1E6BA 2GGTA 4IHUA 4IJIA 5EY6A 1XZOA 1V58A 4N30A 1XVQA 1C72A 2V6OA 5FWGA 4O5UA 4JE1A 2D2ZA 3DYRA 1ZYNA 1K0OA 3GNJA 1S3DA 2C0GA 2YWMA 4BVXA 5KOXA 1SD9A 2HI7A 4MJEA 2C80A 18GSA 4O92A 1A8LA 2K8SA 4BWQA 2OADA 4L0WA 1VF2A 1GSSA 1M2DA 1ZL9A 3QFBC 4WEYA 4WR4A 1IYHA 3GKXA 4PUFC 3TJFA 2VLUA 2VCQA 3PR8A 5JCUA 1U88A 3CXGA 2OKAA 1X5CA 3TDGA 2P31A 1FW1A 5ECSA 3F6DA 2JADA 2H1GA 2VLTA 3TJKA 5HFKA 3QFAC 1UA5A 5DQYA 4AGSA 3SBCA 5IPGA 1XPVA 1TOFA 4X0XA 5J3RA 4KDUA 3L9VA 4KNDA 3ME8A 1SJZA 3GV1A 2OA7A 3KGKA 3KZQA 4XS1A 1V9WA 1F6MC 1QK8A 4YQMA 2LJRA 1KEBA 2LQQA 4WR5A 2H19A 1KNGA 3RHBA 2GT5A 2YV9A 5KEJA 2GQLA 3DWVA 4BWSA 2HZEB 2I1UA 2X8CA 3MWHA 4WBJA 2HT9A 3HVVA 1FVJA 3KEBA 2HRFA 4G0IA 2K8VA 1T1VA 3IOSA 2I9HA 4ZBAA 4DSSA 1BG5A 4FYBA 3FR9A 2H74A 2C3TA 4TXOB 1JZRA 2LRTA 2I4AA 4I2UA 1XVWA 3LXTA 5GAPD 1TTZA 3EE2A 1Y25A 1O73A 4HQZA 2R3XA 4N0VA 2H1BA 1O6JA 4I8BA 1YDKA 3BCIA 4JRRA 4PQIA 3D21A 1B4PA 5IMVA 5J9CA 3LXZA 5KN1A 3PPUA 3HVSA 2K18A 4ISDA 2TRXA 22GSA 2GSTA 4GWRA 2BTOT 1K3LA 3IA1A 1HYUA 4TR1A 3EYTA 4LL1B 1N8JA 1X5EA 3P7XA 1AUCA 1U6TA 2PVOC 1V40A 3BBYA 4MZCA 4F2IA 3TKQA 2EIQA 1HD2A 4MDCA 2YN1A 2HSYA 4XRAA 4GTUA 4NAXA 1JLVA 3C1RA 3IAS2 2B7KA 3ED3A 5ABRA 2PWJA 2PN8A 3APQA 2H70A 3ZZXA 2LKUA 4IJ3A 4MF7A 1TU8A 5ECPB 2FWHA 2CX3A 2V1MA 3ZLPA 1FOHA 1XWAA 1TW9A 4MMMA 1M9AA 3P2AA 3HVNA 4V1Ag 1JZWA 3L9UA 3HZ4A 5IO2A 1OKTA 16GSA 3ME7A 3EMXA 2FWGA 4BPYA 2F3MA 5CRDA 2CVDA 3R2QA 2CZ2A 5GSSA 2X8HA 4ZBBA 3EPTA 2FA4A 1R5PA 2CQ9A 2RUFA 3LW9A 2H6XA 3CTGA 3LFLA 1DE1A 4D73A 4NV2A 2JSYA 3Q74A 4RUVA 4USSA 3QMXA 1ON4A 4Z7XA 5DAKB 1GTUA 4CDOA 5C04A 1ST9A 1OE8A 5EL8A 3TCOA 1FB0A 3FR3A 4ECBA 1TK8B 2YZUA 5JWQB 4AJ6A 2YJHA 3I69A 2N5FA 1A2LA 5KN2A 3LSZA 4ECCA 3KMOA 4PX1A 4ZB9A 1MEKA 1X5DA 3UVHA 1TRUA 2L57A 1G6WA 2E2GA 3Q6OA 1ZZYA 3IK7A 2LSTA 5ECHB 4BVYA 3KH9A 3O76A 3IXRA 2H30A 3FEUA 1T7PB 3GMFA 5DJMA 3U5RE 1A24A 1QMVA 1YZXA 5AGYA 3WYWA 2YP6A 1AW9A 2MYGA 2L5LA 4G0LA 1TXXA 4RI6A 1G0TA 1GSDA 2HRAA 3UARA 4K7IA 3GSSA 1PN9A 2MMAA 4ULXA 3SWLA 3NOFA 4EE0A 2DJJA 1XWBA 3HJPA 3RHCA 2IL3A 3UBLA 4FO5A 1AQVA 2L59A 1MDJA 3ZFBA 4NWYA 4E8EA 2LEGA 2L4QA 4J57E 4ZB6A 3BD2A 4HJMA 4HU9A 2HZEA 3ZMLA 1XXUA 3TKRA 4HU7A 2C3QA 3KIJA 1ZYEA 2C8UA 1XW6A 2VUPA 1PGTA 1PL1A 1WP0A 2DJ0A 2HRNA 4MJCA 4K7OA 2O8VB 4JR4A 3P8WA 3IE3A 2KUCA 1Z6NA 3FZ5A 4TXOA 3TJJA 4GCIA 2GZYA 3TJGA 4GRFA 2HSHA 4ICYA 4O32A 1A2MA 3VPTA 4L0UA 5DDLA 3M0FA 2KP1A 2GZZA 5AISA 3ERGA 1I5GA 2GLRA 3U6VA 1QQ2A 2EIRA 2A2SA 5D8IA 3QR6A 1AC1A 1U3AA 3IAM2 3L78A 1WJKA 2R0PA 2OE1A 2JZTA 2DIZA 5HFGA 2LS5A 2ZNMA 1GH2A 4TN8A 1GTBA 3D6IA 4WF5A 2CVBA 1MD3A 2RM6A 3A2WA 5ELGA 1NM3A 3DD3A 2IWTA 4QL9A 2DJ1A 4PURA 3M9JA 4K6XA 2PPTA 1EOGA 3EU3A 4KF9A 2HE3A 2V6KA 3E3EA 2QA2A 4XHMA 1W4VA 2KHPA 2MMZA 3G7JA 4ML6A 2JL4A 2K6VA 2VCZA 4F0CA 1EWXA 3F4SA 3GKNA 5CAXA 2FWEA 4Q5NA 2H6YA 3ISOA 1V98A 1VGLA 5DVBA 4HEA2 1SKSB 2L4CA 5ELAA 2F9SA 4PGTA 1O7UA 1ZYQB 3GTUB 4Z2TA 4EIPA 1GUHA 4ZL7A 4EO3A 1NHOA 2CZ3A 1VRSD 2B1KA 3I9V2 3FK8A 4L8EA 1PKZA 1R7HA 2H75A 2R37A 4DEJA 2AV4A 3GYKA 5F07A 1T3BA 2PGTA 4POLA 3TKSA 2HLSA 4AF2A 5JCWA 2BMXA 4BL7B 1XOAA 4N0ZA 1PQNA 4POKA 4K0NA 1Q98A 4MF6A 2B6MA 3EC3A 5LCZA 20GSA 5INYA 1OAZA 1OC9A 3L0HA 3TOUA 4K2XA 4GSNA 4MZBA 4OO4A 1ZCPA 2DJKA 3TJBA 1GL8A 4ACSA 2IPAA 3EWLA 1TDIA 2QA1A 4TR3A 3DIEA 3H79A 5CRHA 3GSTA 3FZ4A 6GSYA 3EURA 2J9HA 4XS6A 1Z5YE 3GH9A 2CX4A 2YWIA 1M9BA 1SL1B 1GLQA 4GXZA 3GA4A 2LTKA 2AHEA 3ERWA 4Z2UA 1RK4A 2VD1A 3OR5A 4NHZA 4EUYA 1YEXA 2O87A 2OBKA 3C1SA 3J7Yk 4ZIJA 3TOTA 5A4WA 1J08A 3PINA 4KSMA 4PTSA 2FY6A 1SENA 4RQXA 1YJ6A 2VD0A 1G7OA 5JWRB 1XFLA 4KX4A 1SJ6A 11GSA 1G6YA 1JZOA 5A4UA 1TJDA 4JR6A 4ZILA 1FG4A 3ZREA 2L5OA 2H8LA 4KDYA 4K0GA 2G2QA 4WF4A 2PU9C 3ERFA 2DJ2A 1WPIA 5G5FA 4PNGA 1PD21 1XIYA 5E4WA 14GSA 2B5XA 4NXIA 4EIQA 1S3CA 4ILFA 2H1AA 3VWXA 1OC8A 2B1LA 1TRWA 4OWYA 2DMLA 2WJUA 1M7TA 3IPZA 3VWVA 4JEDA 1K0AA 1EOHA 1IYIA 5F8BA 1YY7A 5A4VA 5IOXA 4IVFA 1W89A 4ZL9A 1M2BA 1B48A 2JACA 2PMTA 1SL2B 3S9FA 1EV4A 4ZL8A 1PFOA 2F51A 5G5EA 2VLVA 3P90A 4YKGA 5H5RA 2VAFA 4EC0A 3A5WA 4KSOA 2MZCA 1MDIA 2M72A 4X1UA 1XG8A 1ZMAA 5DJLA 3TKSC 4L5OA 3GKMA 1JLWA 4Q5QA 4TR4A 1FVKA 3VLNA 1M2AA 5H5SA 2DKHA 4O7HA 4YH2A 5HR2A 3D5JA 4HZ4A 2KP2A 2YWOA 2ON5A 2L6CA 2TIRA 2P5QA 4EVMA 4OCFA 3TGZA 2WB9A 6GSXA 1SK1A 3VI7A 1F2EA 5G30A 2GSQA 5AIVA 4KW6A 1E2YA 1GLPA 4J56E 3GTUA 2IMFA 5A5KA 4XS4A 1HNBA 1CQHA 2V41A 4MJBA 1WIKA 3GL3A 2H73A 2X8GA 5C00A 3A5IA 4V1Ap 6GSSA 3TRPA 1GUKA 1A0RP 2L6DA 1ZGNA 3KJYA 1BQ7A 1LJRA 4PQHA 4K8MA 2MMNA 4ECIA 4GLTA 5D73A 5D93A 3FYGA 4BL7A 3GX0A 1GWCA 3WGXA 4V2LA 4ZB8A 4LL4B 3ZL5A 3DVWA 2VM1A 2C1YA 3MSZA 5CO3A 2HNLA 1GNWA 5DCHA 5IMAA 4OFMA 5J41A 1PX7A 2OE0A 2H76A 3GKKA 2XHFA 1OC3A 2VIMA 2LJAA 1OE7A 3D4TA 10GSA 2CT6A 2DKIA 2J23A 5IM9A 2IN3A 4GSTA 2LV3A 2PERA
chains in the Genus database with same CATH topology
1FB6A 2AJQB 3UVTA 3F4TA 4MZWA 4POMA 2A2PA 1SD8A 2HXKA 3DKSA 1EP8A 4Q5FA 2C4JA 5G2ZA 1ILOA 2F8FA 5D96A 4TVEA 2X99A 1J0FA 5FT3A 4YAPA 2RM5A 2WS2A 2C0FA 2H0IA 5D9WA 1K0MA 2E2MA 1YKCA 1HNAA 2DC5A 5EVOA 3UJ1A 4RQRA 1BYEA 5LD0A 1X0RA 5IPHA 3RDWA 1X9MB 5ECIB 2VOCA 4KE3A 1GSYA 3TB2A 3W8JA 1TI1A 3VFIA 2IMEA 3ZRDA 4N10A 2O7KA 4WETA 1SK0A 1UN2A 2IFQB 2RIIA 3FZAA 3L4NA 4BA7A 4N11A 1URMA 1F3BA 2VL2A 4YQUA 3EVIA 5DBQA 5D9TA 4TKYA 3VWWA 2XBQA 2CVKA 2Z9SA 5AN1A 5ID2B 1K0NA 4GF0A 4F9ZA 5IQYA 3F63A 5BRTA 4XCSA 5ECOB 3ZTLA 4PUAA 2H0HA 3HJOA 3US3A 3GFKA 2DMMA 5G1KA 6GSTA 3RPNA 3FZ9A 4TR0A 4OMVA 1XWCA 4FYUA 1Z6MA 4G19A 3C71A 4MJAA 4ML1A 2GZPA 4IW9A 3DVXA 5HFIA 4O5RA 1EZKA 4K9ZA 4X4JA 4NPBA 1EEMA 5FHIA 3UAPA 4V2MA 1GRXA 9GSSA 1UVZA 1VF1A 1A0FA 2YJ7A 1F3AA 5KOWA 2VL3A 1V57A 1MDKA 2OE3A 3CSIA 2YZHA 4JZQA 4KUNA 4K2DA 4HUAA 1QFNA 5IMFA 2IIYA 4IBPA 2LRNA 4MPGA 2FUG2 1UC7A 2H0GA 3BJ5A 2VCVA 3FKFA 2REMA 1CQGA 3WGEA 3KTBA 4PXOA 1U87A 3GURA 2ES7A 4KA0A 4EDZA 4O5QA 5E59A 1HNCA 2MBSA 2HRKA 3CYNA 3F3QA 1K0BA 3TKSE 1H75A 1GNEA 3KD0A 4JBBA 5IIZA 3A2VA 5F06A 2LUSA 4PNFA 1WRYA 3MNGA 1ZYPA 4OFTA 4TRXA 1JFUA 1XW5A 4IP1A 2FCHA 1NSWA 3BOAA 2IMDA 4I6XA 3MDKA 3E0UA 2FLSA 3H8QA 4MF5A 1LU4A 1PL2A 1ERUA 3GIXA 4I2TA 1OVNA 3KP8A 2YPMA 3WT1A 4WKWA 2NPBA 2XBIA 2HFDA 1B4QA 3IHQA 3VPQA 2E0QA 1O8XA 6GSWA 2IMKA 5AIXA 1PKWA 2XPEA 4HZ2A 4IQAA 1MTCA 3ZIJA 2B5YA 2OACA 3FRCA 3A2XA 2CA8A 3A3TA 4CY8A 2VL2C 13GSA 1EGOA 4V2NA 2V2GA 2V32A 1Y6EA 3PH9A 5KN3A 1ZOFA 3M3MA 3VK9A 2XPDA 3QCPA 5J5NA 2WULA 3RBTA 4XIHA 2H72A 3D0ZA 1PSQA 4FIWA 1QXHA 4IP6A 5DAKA 3GN3A 1YEPA 2DBCA 1GSFA 1EEJA 1M99A 3ZVJA 3N5OA 3KH7A 3RAZA 2H01A 3CSJA 8GSSA 2VCWA 5IMCA 3MIXA 1I9DA 3IDVA 3KMNA 17GSA 2GTUA 2P5RA 4HS1A 3VWUA 1WWJA 1KTEA 4DVCA 3HHVA 2GSSA 1A2JA 3F9UA 2IFQA 4MLYA 2GQMA 4EF0A 2PUKC 3ZMKA 2QKEA 2FNOA 3MYDA 1F9MA 5L71A 2K9FA 2O85A 4OFNA 4K5RA 2E7PA 2JSZA 3QAWA 5ID2A 4F0BA 4AJ7A 4CW9A 12GSA 3IR4A 1USBA 4H86A 4K7NA 3W8SA 2CAQA 3NZNA 2DIYA 4IKHA 4DSRA 1WMJA 1TRVA 2KOKA 1XWGA 1LBKA 3TKPA 3TRXA 1YQ1A 1QUWA 2KLXA 1SYRA 3HCZA 1SK2A 4G10A 1MD4A 2RLIA 3CSHA 3MAKA 4BVYB 1TKDB 1O85A 2VM2A 2CAIA 2JZRA 5F0GA 1AXDA 2OJLA 3AY8A 2FWFA 1BJXA 1O8WA 4EKZA 3H4KA 1K0DA 2GSRA 4K5SA 1AAZA 3LG6A 1XW9A 1GUMA 4MK3A 2C0EA 6GSVA 1GSUA 1B9XC 4MA9A 1DE2A 2QC7A 1Z7PA 4QL7A 2R4VA 2R0GA 4G2EA 4E8HA 2BJXA 4LMVA 5IO0A 1XWKA 3LWAA 3QAGA 1ACVA 1ERTA 2R6KA 1TK0B 1FO5A 3HD5A 3NIVA 1GTIA 1TI3A 3C8EA 2A4VA 3FR6A 1KBNA 3UBKA 1GULA 2VCXA 1B9YC 4MNNA 5ECLB 5CRGA 2G0FA 3HKRA 2R0CA 2X4AA 3BCKA 2YNXA 2NBSA 1SL0B 2H71A 3GRXA 1X9WB 1PMTA 4LLRA 4KGIA 1FAAA 2WDUA 1R4WA 4L5LA 2WFCA 4J2FA 2HSMA 3LJRA 1T4ZA 5B6NA 2GDRA 5JCGA 4HQSA 3VI5A 4HOJA 2PBJA 3QDNA 1NHYA 1AQWA 1BX9A 5HR3A 4TOPA 4MH3A 1EP7A 4CHSA 3GHAA 3ZYWA 5JWOB 2YCDA 2B3SA 5IMZA 5GZZB 3QOUA 3KM6A 5EPFA 3CBUA 3RPPA 3J7Yb 4YKFA 3WGDA 3CTFA 1Z7RA 1SKWB 4LA1A 4YQVA 4AJ8A 3I6AA 1X9SB 5G1LA 1N2AA 3EMPA 1Q4JA 2PVQA 3FHKA 1G7EA 4K1FA 2DJ3A 1U3IA 1PN0A 3H93A 1GTAA 4FQUA 5CYYA 1WE0A 4LMWA 3QAVA 3CMIA 4MH2A 4Z2RA 2ALBA 2WGRA 1J9BA 3R3EA 2VO4A 3KXOA 3HYPA 2ON7A 5B7CA 2F8AA 1GP1A 4PQ1A 5ECNB 2M46A 3LEFA 4F03A 1GSQA 2WCIA 5J4UA 5DALB 1DSBA 4I97A 1ERVA 1O81A 4KCAA 4EXJA 2DSAA 3LYPA 3E9JB 2ZUPA 3HJMA 4KDXA 3GL5A 4ZBDA 2AYTA 3CRTA 3FY7A 5HR1A 5D9VA 2A4HA 3ZFLA 1JHBA 3ZIVA 4GSSA 4MCUA 3F8UA 3LGCA 2QSIA 4KB3A 3GX8A 1OC9B 3UEMA 5ECRB 3EU4A 1WOUA 3HA9A 3DGQA 2NDOA 1TP9A 3DMLA 1XOBA 1S3AA 2C0DA 1K3OA 4G9HA 3TUEA 5HR0A 4IS0A 2TRCP 1THOA 7GSSA 2FHEA 2QGVA 1T8EB 1V2AA 5IOWA 2DLXA 1DUGA 2I3YA 2RUEA 1RW1A 2XC2A 3IV4A 5DCGA 3M8NA 5KN0A 1T4YA 2YWNA 3LORA 2EC4A 2ZCTA 1A23A 3DXBA 5GSTA 1TK5B 3WT2A 2X49A 1A8YA 2FGXA 2VCTA 4ZXGA 3IHGA 3H1NA 4OCEA 2N5AA 4I5QA 3L9SA 3TRQA 1SYXA 3APOA 4NV5A 2IJYA 2LNTA 5ECKB 1QGVA 3FW2A 1XCCA 3KCMA 3IK9A 4BVXB 4IELA 3FMWA 3ZVJD 3F0IA 4X43A 4Q5RA 4JU5A 2JU5A 1YKAA 1VF3A 3M9KA 3O3TA 2AAWA 4HDEA 4IGJA 5B8BA 4FH8A 4QQ7A 2AB6A 2GS3A 3G9BA 4WBRD 3HVXA 1YF0A 1TU7A 2GQKA 5CREA 1R5AA 1PRXA 3VURA 1VF4A 4XRDA 1THXA 5ECMB 5CP1A 3DEXA 3HY2A 4F82A 1GSEA 2R2JA 3O6TA 1ERWA 5G31A 3DRNA 2H66A 2YANA 1ABAA 2FA8A 4TXVA 2AUVA 2FD3A 4FYCA 2WRTA 1Z9HA 2H6ZA 3G7IA 3UOMA 2B7JA 3GH6A 2HZFA 2UZ8A 3D4MA 1BEDA 4MPFA 2NVLA 2OBIA 1HQOA 4KCEA 1NW2A 1PA3A 5COHA 1PX6A 4DSSB 1SJIA 2O89A 4DSQA 3F3RA 3M1GA 1Z3EA 3N9JA 1XBSA 2LQOA 4POBA 3PGTA 1F37A 1OYJA 4NMUA 4YAVA 4A5PA 4ECJA 5CNWA 1B8XA 3G7YA 2LNSA 2P0GA 4IQ1A 4KH7A 2WZ9A 2MBTA 4G0KA 3V1WA 1H4OA 5B8AA 3IC8A 2YOIA 6GSUA 3KTLA 1T00A 4ID0A 1RQMA 1K3YA 1EGRA 4RI7A 1SKRB 4CY6A 2C3NA 3F4RA 4TR1B 1FOVA 3GUSA 3Q18A 4MP4A 2VL9A 2N5BA 3JCML 3IRAA 4EDYA 4GQFA 5LNKe 3F6FA 3C7MA 5BMUA 3W6GA 3QD9A 4GQCA 4MABA 2YV7A 3HXSA 2R5GA 3HZ8A 4KAEA 4XS4B 5DQSA 3Q19A 3UIWA 5GAND 2B5EA 3APSA 2GVPA 3EINA 3LYKA 3CRUA 2HYXA 3HDCA 5HQPA 1DBYA 5DALA 1R26A 1BAYA 2LRCA 5D9XA 5J9BA 4IN0A 5B6MA 2H1DA 19GSA 2NTOA 4NHWA 4WXTA 2M80A 1YF1A 3K8NA 5F05A 2JZSA 1OKDA 2X64A 2CV4A 3D22A 4P3YB 3LQ7A 3IBHA 4EL1A 1JZDA 3UL3A 4HI7A 2A2RA 1TRSA 3I43A 5ENUA 4HJ2A 3WD6A 1AIUA 4OO5A 1M0UA 2GT6A 2I81A 3IC4A 5IMDA 1FHEA 2LJKA 5ECQB 1K0CA 4TW5A 3UMAA 1ML6A 2MMOA 3ZITA 4XTSA 4D73B 2IMIA 4OD7A 1AQXA 3C73A 1SU9A 2EIOA 3KP9A 3QPMA 5CRWA 1EV9A 5H5QA 1E6BA 2GGTA 4IHUA 4IJIA 5EY6A 1XZOA 1V58A 4N30A 1XVQA 1C72A 2V6OA 5FWGA 4O5UA 4JE1A 2D2ZA 3DYRA 1ZYNA 1K0OA 3GNJA 1S3DA 2C0GA 2YWMA 4BVXA 5KOXA 1SD9A 2HI7A 4MJEA 2C80A 18GSA 4O92A 1A8LA 2K8SA 4BWQA 2OADA 4L0WA 1VF2A 1GSSA 1M2DA 1ZL9A 3QFBC 4WEYA 4WR4A 1IYHA 3GKXA 4PUFC 3TJFA 2VLUA 2VCQA 3PR8A 5JCUA 1U88A 3CXGA 2OKAA 1X5CA 3TDGA 2P31A 1FW1A 5ECSA 3F6DA 2JADA 2H1GA 2VLTA 3TJKA 5HFKA 3QFAC 1UA5A 5DQYA 4AGSA 3SBCA 5IPGA 1XPVA 1TOFA 4X0XA 5J3RA 4KDUA 3L9VA 4KNDA 3ME8A 1SJZA 3GV1A 2OA7A 3KGKA 3KZQA 4XS1A 1V9WA 1F6MC 1QK8A 4YQMA 2LJRA 1KEBA 2LQQA 4WR5A 2H19A 1KNGA 3RHBA 2GT5A 2YV9A 5KEJA 2GQLA 3DWVA 4BWSA 2HZEB 2I1UA 2X8CA 3MWHA 4WBJA 2HT9A 3HVVA 1FVJA 3KEBA 2HRFA 4G0IA 2K8VA 1T1VA 3IOSA 2I9HA 4ZBAA 4DSSA 1BG5A 4FYBA 3FR9A 2H74A 2C3TA 4TXOB 1JZRA 2LRTA 2I4AA 4I2UA 1XVWA 3LXTA 5GAPD 1TTZA 3EE2A 1Y25A 1O73A 4HQZA 2R3XA 4N0VA 2H1BA 1O6JA 4I8BA 1YDKA 3BCIA 4JRRA 4PQIA 3D21A 1B4PA 5IMVA 5J9CA 3LXZA 5KN1A 3PPUA 3HVSA 2K18A 4ISDA 2TRXA 22GSA 2GSTA 4GWRA 2BTOT 1K3LA 3IA1A 1HYUA 4TR1A 3EYTA 4LL1B 1N8JA 1X5EA 3P7XA 1AUCA 1U6TA 2PVOC 1V40A 3BBYA 4MZCA 4F2IA 3TKQA 2EIQA 1HD2A 4MDCA 2YN1A 2HSYA 4XRAA 4GTUA 4NAXA 1JLVA 3C1RA 3IAS2 2B7KA 3ED3A 5ABRA 2PWJA 2PN8A 3APQA 2H70A 3ZZXA 2LKUA 4IJ3A 4MF7A 1TU8A 5ECPB 2FWHA 2CX3A 2V1MA 3ZLPA 1FOHA 1XWAA 1TW9A 4MMMA 1M9AA 3P2AA 4V1Ag 1JZWA 3L9UA 3HZ4A 5IO2A 1OKTA 16GSA 3ME7A 3EMXA 2FWGA 4BPYA 2F3MA 5CRDA 2CVDA 3R2QA 2CZ2A 5GSSA 2X8HA 4ZBBA 3EPTA 2FA4A 1R5PA 2CQ9A 2RUFA 3LW9A 2H6XA 3CTGA 3LFLA 1DE1A 4D73A 4NV2A 2JSYA 3Q74A 4RUVA 4USSA 3QMXA 1ON4A 4Z7XA 5DAKB 1GTUA 4CDOA 5C04A 1ST9A 1OE8A 5EL8A 3TCOA 1FB0A 3FR3A 4ECBA 1TK8B 2YZUA 5JWQB 4AJ6A 2YJHA 3I69A 2N5FA 1A2LA 5KN2A 3LSZA 4ECCA 3KMOA 4PX1A 4ZB9A 1MEKA 1X5DA 3UVHA 1TRUA 2L57A 1G6WA 2E2GA 3Q6OA 1ZZYA 3IK7A 2LSTA 5ECHB 4BVYA 3KH9A 3O76A 3IXRA 2H30A 3FEUA 1T7PB 3GMFA 5DJMA 3U5RE 1A24A 1QMVA 1YZXA 5AGYA 3WYWA 2YP6A 1AW9A 2MYGA 2L5LA 4G0LA 1TXXA 4RI6A 1G0TA 1GSDA 2HRAA 3UARA 4K7IA 3GSSA 1PN9A 2MMAA 4ULXA 3SWLA 3NOFA 4EE0A 2DJJA 1XWBA 3HJPA 3RHCA 2IL3A 3UBLA 4FO5A 1AQVA 2L59A 1MDJA 3ZFBA 4NWYA 4E8EA 2LEGA 2L4QA 4J57E 4ZB6A 3BD2A 4HJMA 4HU9A 2HZEA 3ZMLA 1XXUA 3TKRA 4HU7A 2C3QA 3KIJA 1ZYEA 2C8UA 1XW6A 2VUPA 1PGTA 1PL1A 1WP0A 2DJ0A 2HRNA 4MJCA 4K7OA 2O8VB 4JR4A 3P8WA 3IE3A 2KUCA 1Z6NA 3FZ5A 4TXOA 3TJJA 4GCIA 2GZYA 3TJGA 4GRFA 2HSHA 4ICYA 4O32A 1A2MA 3VPTA 4L0UA 5DDLA 3M0FA 2KP1A 2GZZA 5AISA 3ERGA 1I5GA 2GLRA 3U6VA 1QQ2A 2EIRA 2A2SA 5D8IA 3QR6A 1AC1A 1U3AA 3IAM2 3L78A 1WJKA 2R0PA 2OE1A 2JZTA 2DIZA 5HFGA 2LS5A 2ZNMA 1GH2A 4TN8A 1GTBA 3D6IA 4WF5A 2CVBA 1MD3A 2RM6A 3A2WA 5ELGA 1NM3A 3DD3A 2IWTA 4QL9A 2DJ1A 4PURA 3M9JA 4K6XA 2PPTA 1EOGA 3EU3A 4KF9A 2HE3A 2V6KA 3E3EA 2QA2A 4XHMA 1W4VA 2KHPA 2MMZA 3G7JA 4ML6A 2JL4A 2K6VA 2VCZA 4F0CA 1EWXA 3F4SA 3GKNA 5CAXA 2FWEA 4Q5NA 2H6YA 3ISOA 1V98A 1VGLA 5DVBA 4HEA2 1SKSB 2L4CA 5ELAA 2F9SA 4PGTA 1O7UA 1ZYQB 3GTUB 4Z2TA 4EIPA 1GUHA 4ZL7A 4EO3A 1NHOA 2CZ3A 1VRSD 2B1KA 3I9V2 3FK8A 4L8EA 1PKZA 1R7HA 2H75A 2R37A 4DEJA 2AV4A 3GYKA 5F07A 1T3BA 2PGTA 4POLA 3TKSA 2HLSA 4AF2A 5JCWA 2BMXA 4BL7B 1XOAA 4N0ZA 1PQNA 4POKA 4K0NA 1Q98A 4MF6A 2B6MA 3EC3A 5LCZA 20GSA 5INYA 1OAZA 1OC9A 3L0HA 3TOUA 4K2XA 4GSNA 4MZBA 4OO4A 1ZCPA 2DJKA 3TJBA 1GL8A 4ACSA 2IPAA 3EWLA 1TDIA 2QA1A 4TR3A 3DIEA 3H79A 5CRHA 3GSTA 3FZ4A 6GSYA 3EURA 2J9HA 4XS6A 1Z5YE 3GH9A 2CX4A 2YWIA 1M9BA 1SL1B 1GLQA 4GXZA 3GA4A 2LTKA 2AHEA 3ERWA 4Z2UA 1RK4A 2VD1A 3OR5A 4NHZA 4EUYA 1YEXA 2O87A 2OBKA 3C1SA 3J7Yk 4ZIJA 3TOTA 5A4WA 1J08A 3PINA 4KSMA 4PTSA 2FY6A 1SENA 4RQXA 1YJ6A 2VD0A 1G7OA 5JWRB 1XFLA 4KX4A 1SJ6A 11GSA 1G6YA 1JZOA 5A4UA 1TJDA 4JR6A 4ZILA 1FG4A 3ZREA 2L5OA 2H8LA 4KDYA 4K0GA 2G2QA 4WF4A 2PU9C 3ERFA 2DJ2A 1WPIA 5G5FA 4PNGA 1PD21 1XIYA 5E4WA 14GSA 2B5XA 4NXIA 4EIQA 1S3CA 4ILFA 2H1AA 3VWXA 1OC8A 2B1LA 1TRWA 4OWYA 2DMLA 2WJUA 1M7TA 3IPZA 3VWVA 4JEDA 1K0AA 1EOHA 1IYIA 5F8BA 1YY7A 5A4VA 5IOXA 4IVFA 1W89A 4ZL9A 1M2BA 1B48A 2JACA 2PMTA 1SL2B 3S9FA 1EV4A 4ZL8A 2F51A 5G5EA 2VLVA 3P90A 4YKGA 5H5RA 2VAFA 4EC0A 3A5WA 4KSOA 2MZCA 1MDIA 2M72A 4X1UA 1ZMAA 5DJLA 3TKSC 4L5OA 3GKMA 1JLWA 4Q5QA 4TR4A 1FVKA 3VLNA 1M2AA 5H5SA 2DKHA 4O7HA 4YH2A 5HR2A 3D5JA 4HZ4A 2KP2A 2YWOA 2ON5A 2L6CA 2TIRA 2P5QA 4EVMA 4OCFA 3TGZA 2WB9A 6GSXA 1SK1A 3VI7A 1F2EA 5G30A 2GSQA 5AIVA 4KW6A 1E2YA 1GLPA 4J56E 3GTUA 2IMFA 5A5KA 4XS4A 1HNBA 1CQHA 2V41A 4MJBA 1WIKA 3GL3A 2H73A 2X8GA 5C00A 3A5IA 4V1Ap 6GSSA 3TRPA 1GUKA 1A0RP 2L6DA 1ZGNA 3KJYA 1BQ7A 1LJRA 4PQHA 4K8MA 2MMNA 4ECIA 4GLTA 5D73A 5D93A 3FYGA 4BL7A 3GX0A 1GWCA 3WGXA 4V2LA 4ZB8A 4LL4B 3ZL5A 3DVWA 2VM1A 2C1YA 3MSZA 5CO3A 2HNLA 1GNWA 5DCHA 5IMAA 4OFMA 5J41A 1PX7A 2OE0A 2H76A 3GKKA 2XHFA 1OC3A 2VIMA 2LJAA 1OE7A 3D4TA 10GSA 2CT6A 2DKIA 2J23A 5IM9A 2IN3A 4GSTA 2LV3A 2PERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FB6 A;  2AJQ B;  3UVT A;  3F4T A;  4MZW A;  4POM A;  1SD8 A;  2HXK A;  3DKS A;  1EP8 A;  4Q5F A;  2C4J A;  5G2Z A;  1ILO A;  2F8F A;  5D96 A;  4TVE A;  2X99 A;  1J0F A;  5FT3 A;  4YAP A;  2RM5 A;  2WS2 A;  2C0F A;  2H0I A;  5D9W A;  1K0M A;  2E2M A;  1YKC A;  1HNA A;  2DC5 A;  5EVO A;  3UJ1 A;  4RQR A;  1BYE A;  5LD0 A;  1X0R A;  5IPH A;  3RDW A;  1X9M B;  5ECI B;  2VOC A;  4KE3 A;  1GSY A;  3TB2 A;  3W8J A;  1TI1 A;  3VFI A;  2IME A;  3ZRD A;  4N10 A;  2O7K A;  4WET A;  1SK0 A;  1UN2 A;  2IFQ B;  2RII A;  3FZA A;  3L4N A;  4BA7 A;  4N11 A;  1URM A;  1F3B A;  2VL2 A;  4YQU A;  3EVI A;  5DBQ A;  5D9T A;  4TKY A;  3VWW A;  2XBQ A;  2CVK A;  2Z9S A;  5AN1 A;  5ID2 B;  1K0N A;  4GF0 A;  4F9Z A;  5IQY A;  3F63 A;  4XCS A;  5ECO B;  3ZTL A;  4PUA A;  2H0H A;  3HJO A;  3US3 A;  3GFK A;  2DMM A;  5G1K A;  6GST A;  3RPN A;  3FZ9 A;  4TR0 A;  4OMV A;  1XWC A;  4FYU A;  1Z6M A;  4G19 A;  3C71 A;  4MJA A;  4ML1 A;  2GZP A;  4IW9 A;  3DVX A;  5HFI A;  4O5R A;  1EZK A;  4K9Z A;  4NPB A;  1EEM A;  5FHI A;  3UAP A;  4V2M A;  1GRX A;  9GSS A;  1UVZ A;  1VF1 A;  1A0F A;  2YJ7 A;  1F3A A;  2VL3 A;  1V57 A;  1MDK A;  2OE3 A;  3CSI A;  2YZH A;  4JZQ A;  4KUN A;  4K2D A;  4HUA A;  1QFN A;  5IMF A;  2IIY A;  4IBP A;  2LRN A;  4MPG A;  2FUG 2;  1UC7 A;  2H0G A;  3BJ5 A;  2VCV A;  3FKF A;  2REM A;  1CQG A;  3WGE A;  3KTB A;  4PXO A;  1U87 A;  3GUR A;  2ES7 A;  4KA0 A;  4EDZ A;  5E59 A;  1HNC A;  2MBS A;  3CYN A;  3F3Q A;  1K0B A;  3TKS E;  1H75 A;  1GNE A;  3KD0 A;  4JBB A;  5IIZ A;  3A2V A;  5F06 A;  2LUS A;  4PNF A;  1WRY A;  3MNG A;  4OFT A;  4TRX A;  1JFU A;  1XW5 A;  4IP1 A;  2FCH A;  1NSW A;  3BOA A;  2IMD A;  4I6X A;  3MDK A;  3E0U A;  2FLS A;  3H8Q A;  4MF5 A;  1LU4 A;  1PL2 A;  1ERU A;  3GIX A;  4I2T A;  1OVN A;  3KP8 A;  2YPM A;  3WT1 A;  4WKW A;  2NPB A;  2XBI A;  2HFD A;  1B4Q A;  3IHQ A;  3VPQ A;  2E0Q A;  1O8X A;  6GSW A;  2IMK A;  5AIX A;  1PKW A;  2XPE A;  4HZ2 A;  4IQA A;  1MTC A;  3ZIJ A;  2B5Y A;  2OAC A;  3FRC A;  3A2X A;  2CA8 A;  3A3T A;  2VL2 C;  13GS A;  1EGO A;  4V2N A;  2V2G A;  2V32 A;  1Y6E A;  3PH9 A;  5KN3 A;  1ZOF A;  3M3M A;  3VK9 A;  2XPD A;  3QCP A;  5J5N A;  2WUL A;  3RBT A;  4XIH A;  2H72 A;  3D0Z A;  1PSQ A;  4FIW A;  1QXH A;  4IP6 A;  5DAK A;  3GN3 A;  1YEP A;  2DBC A;  1GSF A;  1EEJ A;  1M99 A;  3ZVJ A;  3N5O A;  3KH7 A;  3RAZ A;  2H01 A;  3CSJ A;  8GSS A;  2VCW A;  5IMC A;  1I9D A;  3IDV A;  3KMN A;  17GS A;  2GTU A;  2P5R A;  4HS1 A;  3VWU A;  1WWJ A;  1KTE A;  4DVC A;  3HHV A;  2GSS A;  1A2J A;  3F9U A;  2IFQ A;  4MLY A;  2GQM A;  4EF0 A;  2PUK C;  3ZMK A;  2QKE A;  2FNO A;  1F9M A;  5L71 A;  2K9F A;  2O85 A;  4OFN A;  2E7P A;  2JSZ A;  3QAW A;  5ID2 A;  4F0B A;  4AJ7 A;  4CW9 A;  12GS A;  3IR4 A;  1USB A;  4H86 A;  4K7N A;  3W8S A;  2CAQ A;  3NZN A;  2DIY A;  4IKH A;  4DSR A;  1WMJ A;  1TRV A;  2KOK A;  1XWG A;  1LBK A;  3TKP A;  3TRX A;  1YQ1 A;  1QUW A;  2KLX A;  1SYR A;  3HCZ A;  1SK2 A;  4G10 A;  1MD4 A;  2RLI A;  3CSH A;  3MAK A;  1TKD B;  1O85 A;  2VM2 A;  2CAI A;  2JZR A;  5F0G A;  1AXD A;  2OJL A;  3AY8 A;  2FWF A;  1BJX A;  1O8W A;  4EKZ A;  3H4K A;  1K0D A;  2GSR A;  1AAZ A;  3LG6 A;  1XW9 A;  1GUM A;  4MK3 A;  2C0E A;  6GSV A;  1GSU A;  1B9X C;  4MA9 A;  1DE2 A;  2QC7 A;  1Z7P A;  4QL7 A;  2R4V A;  4G2E A;  4E8H A;  2BJX A;  4LMV A;  5IO0 A;  1XWK A;  3LWA A;  3QAG A;  1ACV A;  1ERT A;  2R6K A;  1TK0 B;  1FO5 A;  3HD5 A;  3NIV A;  1GTI A;  1TI3 A;  3C8E A;  2A4V A;  3FR6 A;  1KBN A;  3UBK A;  1GUL A;  2VCX A;  1B9Y C;  5ECL B;  5CRG A;  2G0F A;  3HKR A;  3BCK A;  2YNX A;  2NBS A;  1SL0 B;  2H71 A;  3GRX A;  1X9W B;  1PMT A;  4LLR A;  4KGI A;  1FAA A;  2WDU A;  1R4W A;  4L5L A;  2WFC A;  4J2F A;  3LJR A;  1T4Z A;  5B6N A;  2GDR A;  5JCG A;  4HQS A;  3VI5 A;  4HOJ A;  2PBJ A;  3QDN A;  1NHY A;  1AQW A;  1BX9 A;  5HR3 A;  4TOP A;  4MH3 A;  1EP7 A;  4CHS A;  3GHA A;  3ZYW A;  5JWO B;  2YCD A;  2B3S A;  5IMZ A;  5GZZ B;  3QOU A;  3KM6 A;  5EPF A;  3CBU A;  3RPP A;  3J7Y b;  3WGD A;  3CTF A;  1Z7R A;  1SKW B;  4LA1 A;  4YQV A;  4AJ8 A;  3I6A A;  1X9S B;  5G1L A;  1N2A A;  3EMP A;  1Q4J A;  2PVQ A;  3FHK A;  1G7E A;  4K1F A;  2DJ3 A;  1U3I A;  3H93 A;  1GTA A;  5CYY A;  1WE0 A;  4LMW A;  3QAV A;  3CMI A;  4MH2 A;  2ALB A;  2WGR A;  1J9B A;  2VO4 A;  3KXO A;  3HYP A;  2ON7 A;  5B7C A;  2F8A A;  1GP1 A;  4PQ1 A;  5ECN B;  2M46 A;  3LEF A;  4F03 A;  1GSQ A;  2WCI A;  5J4U A;  5DAL B;  1DSB A;  4I97 A;  1ERV A;  1O81 A;  4KCA A;  4EXJ A;  2DSA A;  3LYP A;  3E9J B;  2ZUP A;  3HJM A;  4KDX A;  3GL5 A;  4ZBD A;  2AYT A;  3CRT A;  3FY7 A;  5HR1 A;  5D9V A;  3ZFL A;  1JHB A;  3ZIV A;  4GSS A;  4MCU A;  3F8U A;  3LGC A;  2QSI A;  4KB3 A;  3GX8 A;  1OC9 B;  3UEM A;  5ECR B;  3EU4 A;  1WOU A;  3HA9 A;  3DGQ A;  2NDO A;  1TP9 A;  3DML A;  1XOB A;  1S3A A;  2C0D A;  1K3O A;  4G9H A;  3TUE A;  5HR0 A;  4IS0 A;  2TRC P;  1THO A;  7GSS A;  2FHE A;  2QGV A;  1T8E B;  1V2A A;  5IOW A;  2DLX A;  1DUG A;  2I3Y A;  2RUE A;  1RW1 A;  2XC2 A;  3IV4 A;  5DCG A;  3M8N A;  5KN0 A;  1T4Y A;  2YWN A;  3LOR A;  2EC4 A;  2ZCT A;  1A23 A;  3DXB A;  5GST A;  1TK5 B;  3WT2 A;  1A8Y A;  2FGX A;  2VCT A;  4ZXG A;  3H1N A;  4OCE A;  2N5A A;  4I5Q A;  3L9S A;  3TRQ A;  1SYX A;  3APO A;  4NV5 A;  2IJY A;  2LNT A;  5ECK B;  1QGV A;  3FW2 A;  1XCC A;  3KCM A;  3IK9 A;  4IEL A;  3ZVJ D;  3F0I A;  4X43 A;  4Q5R A;  4JU5 A;  2JU5 A;  1YKA A;  1VF3 A;  3M9K A;  3O3T A;  2AAW A;  4HDE A;  4IGJ A;  5B8B A;  4FH8 A;  4QQ7 A;  2AB6 A;  2GS3 A;  3G9B A;  4WBR D;  3HVX A;  1YF0 A;  1TU7 A;  2GQK A;  5CRE A;  1R5A A;  1PRX A;  3VUR A;  1VF4 A;  4XRD A;  1THX A;  5ECM B;  5CP1 A;  3DEX A;  3HY2 A;  4F82 A;  1GSE A;  2R2J A;  3O6T A;  1ERW A;  5G31 A;  3DRN A;  2H66 A;  2YAN A;  1ABA A;  2FA8 A;  4TXV A;  2AUV A;  2FD3 A;  4FYC A;  2WRT A;  1Z9H A;  2H6Z A;  3G7I A;  3UOM A;  2B7J A;  3GH6 A;  2HZF A;  3D4M A;  1BED A;  4MPF A;  2NVL A;  2OBI A;  1HQO A;  4KCE A;  1NW2 A;  1PA3 A;  5COH A;  1PX6 A;  4DSS B;  1SJI A;  2O89 A;  4DSQ A;  3F3R A;  3M1G A;  1Z3E A;  3N9J A;  1XBS A;  2LQO A;  4POB A;  3PGT A;  1F37 A;  1OYJ A;  4NMU A;  4YAV A;  4ECJ A;  5CNW A;  1B8X A;  3G7Y A;  2LNS A;  2P0G A;  4IQ1 A;  4KH7 A;  2WZ9 A;  2MBT A;  3V1W A;  1H4O A;  5B8A A;  2YOI A;  6GSU A;  3KTL A;  1T00 A;  4ID0 A;  1RQM A;  1K3Y A;  1EGR A;  4RI7 A;  1SKR B;  2C3N A;  3F4R A;  4TR1 B;  1FOV A;  3GUS A;  3Q18 A;  4MP4 A;  2VL9 A;  2N5B A;  3JCM L;  3IRA A;  4EDY A;  4GQF A;  5LNK e;  3F6F A;  3C7M A;  3W6G A;  3QD9 A;  4GQC A;  4MAB A;  2YV7 A;  3HXS A;  2R5G A;  3HZ8 A;  4KAE A;  4XS4 B;  5DQS A;  3Q19 A;  3UIW A;  5GAN D;  2B5E A;  3APS A;  2GVP A;  3EIN A;  3LYK A;  3CRU A;  2HYX A;  3HDC A;  5HQP A;  1DBY A;  5DAL A;  1R26 A;  1BAY A;  2LRC A;  5D9X A;  5J9B A;  4IN0 A;  5B6M A;  2H1D A;  19GS A;  2NTO A;  4NHW A;  4WXT A;  2M80 A;  1YF1 A;  3K8N A;  5F05 A;  2JZS A;  1OKD A;  2X64 A;  2CV4 A;  3D22 A;  4P3Y B;  3LQ7 A;  3IBH A;  4EL1 A;  1JZD A;  3UL3 A;  4HI7 A;  2A2R A;  1TRS A;  3I43 A;  5ENU A;  4HJ2 A;  3WD6 A;  1AIU A;  4OO5 A;  1M0U A;  2GT6 A;  2I81 A;  3IC4 A;  5IMD A;  1FHE A;  2LJK A;  5ECQ B;  1K0C A;  4TW5 A;  3UMA A;  1ML6 A;  2MMO A;  3ZIT A;  4XTS A;  4D73 B;  2IMI A;  4OD7 A;  1AQX A;  3C73 A;  1SU9 A;  2EIO A;  3KP9 A;  3QPM A;  5CRW A;  1EV9 A;  5H5Q A;  1E6B A;  2GGT A;  4IHU A;  4IJI A;  5EY6 A;  1XZO A;  1V58 A;  4N30 A;  1XVQ A;  1C72 A;  2V6O A;  5FWG A;  4JE1 A;  2D2Z A;  3DYR A;  1K0O A;  3GNJ A;  1S3D A;  2C0G A;  2YWM A;  4BVX A;  1SD9 A;  2HI7 A;  4MJE A;  2C80 A;  18GS A;  4O92 A;  1A8L A;  2K8S A;  4BWQ A;  2OAD A;  4L0W A;  1VF2 A;  1GSS A;  1M2D A;  1ZL9 A;  3QFB C;  4WEY A;  4WR4 A;  1IYH A;  3GKX A;  4PUF C;  3TJF A;  2VLU A;  2VCQ A;  3PR8 A;  5JCU A;  1U88 A;  3CXG A;  2OKA A;  1X5C A;  3TDG A;  2P31 A;  1FW1 A;  5ECS A;  3F6D A;  2JAD A;  2H1G A;  2VLT A;  3TJK A;  5HFK A;  3QFA C;  1UA5 A;  5DQY A;  4AGS A;  3SBC A;  5IPG A;  1XPV A;  1TOF A;  4X0X A;  5J3R A;  4KDU A;  3L9V A;  4KND A;  3ME8 A;  1SJZ A;  3GV1 A;  2OA7 A;  3KGK A;  3KZQ A;  4XS1 A;  1V9W A;  1F6M C;  1QK8 A;  4YQM A;  2LJR A;  1KEB A;  2LQQ A;  4WR5 A;  2H19 A;  1KNG A;  3RHB A;  2GT5 A;  2YV9 A;  5KEJ A;  2GQL A;  3DWV A;  4BWS A;  2HZE B;  2I1U A;  2X8C A;  3MWH A;  4WBJ A;  2HT9 A;  3HVV A;  1FVJ A;  3KEB A;  2HRF A;  2K8V A;  1T1V A;  3IOS A;  2I9H A;  4ZBA A;  4DSS A;  1BG5 A;  4FYB A;  3FR9 A;  2H74 A;  2C3T A;  4TXO B;  1JZR A;  2LRT A;  2I4A A;  4I2U A;  1XVW A;  3LXT A;  5GAP D;  1TTZ A;  3EE2 A;  1Y25 A;  1O73 A;  4HQZ A;  2R3X A;  4N0V A;  2H1B A;  1O6J A;  4I8B A;  1YDK A;  3BCI A;  4JRR A;  4PQI A;  3D21 A;  1B4P A;  5IMV A;  5J9C A;  3LXZ A;  5KN1 A;  3HVS A;  2K18 A;  4ISD A;  2TRX A;  22GS A;  2GST A;  4GWR A;  2BTO T;  1K3L A;  3IA1 A;  1HYU A;  4TR1 A;  3EYT A;  4LL1 B;  1N8J A;  1X5E A;  3P7X A;  1AUC A;  1U6T A;  2PVO C;  1V40 A;  3BBY A;  4MZC A;  4F2I A;  3TKQ A;  2EIQ A;  1HD2 A;  4MDC A;  2YN1 A;  2HSY A;  4XRA A;  4GTU A;  4NAX A;  1JLV A;  3C1R A;  3IAS 2;  2B7K A;  3ED3 A;  5ABR A;  2PWJ A;  2PN8 A;  3APQ A;  2H70 A;  3ZZX A;  2LKU A;  4IJ3 A;  4MF7 A;  1TU8 A;  5ECP B;  2FWH A;  2CX3 A;  2V1M A;  3ZLP A;  1XWA A;  1TW9 A;  4MMM A;  1M9A A;  3P2A A;  4V1A g;  1JZW A;  3L9U A;  3HZ4 A;  5IO2 A;  1OKT A;  16GS A;  3ME7 A;  3EMX A;  2FWG A;  4BPY A;  2F3M A;  5CRD A;  2CVD A;  3R2Q A;  2CZ2 A;  5GSS A;  2X8H A;  4ZBB A;  2FA4 A;  1R5P A;  2CQ9 A;  2RUF A;  2H6X A;  3CTG A;  3LFL A;  1DE1 A;  4D73 A;  4NV2 A;  2JSY A;  3Q74 A;  4RUV A;  3QMX A;  1ON4 A;  4Z7X A;  5DAK B;  1GTU A;  4CDO A;  5C04 A;  1ST9 A;  1OE8 A;  5EL8 A;  3TCO A;  1FB0 A;  3FR3 A;  4ECB A;  1TK8 B;  2YZU A;  5JWQ B;  4AJ6 A;  2YJH A;  3I69 A;  2N5F A;  1A2L A;  5KN2 A;  3LSZ A;  4ECC A;  3KMO A;  4PX1 A;  4ZB9 A;  1MEK A;  1X5D A;  3UVH A;  1TRU A;  2L57 A;  1G6W A;  2E2G A;  3Q6O A;  1ZZY A;  3IK7 A;  2LST A;  5ECH B;  4BVY A;  3KH9 A;  3O76 A;  3IXR A;  2H30 A;  3FEU A;  1T7P B;  3GMF A;  5DJM A;  3U5R E;  1A24 A;  1QMV A;  1YZX A;  5AGY A;  3WYW A;  2YP6 A;  1AW9 A;  2MYG A;  2L5L A;  1TXX A;  4RI6 A;  1G0T A;  1GSD A;  3UAR A;  4K7I A;  3GSS A;  1PN9 A;  2MMA A;  4ULX A;  3SWL A;  3NOF A;  4EE0 A;  2DJJ A;  1XWB A;  3HJP A;  3RHC A;  2IL3 A;  3UBL A;  4FO5 A;  1AQV A;  2L59 A;  1MDJ A;  3ZFB A;  4NWY A;  4E8E A;  2LEG A;  2L4Q A;  4J57 E;  4ZB6 A;  3BD2 A;  4HJM A;  4HU9 A;  2HZE A;  3ZML A;  1XXU A;  3TKR A;  4HU7 A;  2C3Q A;  3KIJ A;  1ZYE A;  2C8U A;  1XW6 A;  2VUP A;  1PGT A;  1PL1 A;  1WP0 A;  2DJ0 A;  2HRN A;  4MJC A;  4K7O A;  2O8V B;  4JR4 A;  3P8W A;  3IE3 A;  2KUC A;  1Z6N A;  3FZ5 A;  4TXO A;  3TJJ A;  4GCI A;  2GZY A;  3TJG A;  4GRF A;  2HSH A;  4O32 A;  1A2M A;  3VPT A;  4L0U A;  5DDL A;  3M0F A;  2KP1 A;  2GZZ A;  5AIS A;  3ERG A;  1I5G A;  2GLR A;  3U6V A;  1QQ2 A;  2EIR A;  2A2S A;  5D8I A;  3QR6 A;  1AC1 A;  1U3A A;  3IAM 2;  3L78 A;  1WJK A;  2OE1 A;  2JZT A;  2DIZ A;  5HFG A;  2LS5 A;  2ZNM A;  1GH2 A;  4TN8 A;  1GTB A;  3D6I A;  4WF5 A;  2CVB A;  1MD3 A;  2RM6 A;  3A2W A;  5ELG A;  1NM3 A;  3DD3 A;  2IWT A;  4QL9 A;  2DJ1 A;  4PUR A;  3M9J A;  4K6X A;  2PPT A;  1EOG A;  3EU3 A;  2HE3 A;  2V6K A;  3E3E A;  4XHM A;  1W4V A;  2KHP A;  2MMZ A;  3G7J A;  4ML6 A;  2JL4 A;  2K6V A;  2VCZ A;  4F0C A;  1EWX A;  3F4S A;  3GKN A;  5CAX A;  2FWE A;  4Q5N A;  2H6Y A;  3ISO A;  1V98 A;  1VGL A;  5DVB A;  4HEA 2;  1SKS B;  2L4C A;  5ELA A;  2F9S A;  4PGT A;  1O7U A;  1ZYQ B;  3GTU B;  1GUH A;  4ZL7 A;  4EO3 A;  1NHO A;  2CZ3 A;  1VRS D;  2B1K A;  3I9V 2;  3FK8 A;  4L8E A;  1PKZ A;  1R7H A;  2H75 A;  2R37 A;  4DEJ A;  2AV4 A;  3GYK A;  5F07 A;  1T3B A;  2PGT A;  4POL A;  3TKS A;  2HLS A;  4AF2 A;  5JCW A;  2BMX A;  1XOA A;  4N0Z A;  1PQN A;  4POK A;  4K0N A;  1Q98 A;  4MF6 A;  2B6M A;  3EC3 A;  5LCZ A;  20GS A;  5INY A;  1OAZ A;  1OC9 A;  3L0H A;  3TOU A;  4GSN A;  4MZB A;  4OO4 A;  1ZCP A;  2DJK A;  3TJB A;  1GL8 A;  4ACS A;  2IPA A;  3EWL A;  1TDI A;  4TR3 A;  3DIE A;  3H79 A;  5CRH A;  3GST A;  3FZ4 A;  6GSY A;  3EUR A;  2J9H A;  4XS6 A;  1Z5Y E;  3GH9 A;  2CX4 A;  2YWI A;  1M9B A;  1SL1 B;  1GLQ A;  4GXZ A;  3GA4 A;  2LTK A;  2AHE A;  3ERW A;  1RK4 A;  2VD1 A;  3OR5 A;  4NHZ A;  4EUY A;  1YEX A;  2O87 A;  2OBK A;  3C1S A;  3J7Y k;  4ZIJ A;  3TOT A;  5A4W A;  1J08 A;  3PIN A;  4KSM A;  2FY6 A;  1SEN A;  4RQX A;  1YJ6 A;  2VD0 A;  1G7O A;  5JWR B;  1XFL A;  4KX4 A;  1SJ6 A;  11GS A;  1G6Y A;  1JZO A;  5A4U A;  1TJD A;  4JR6 A;  4ZIL A;  1FG4 A;  3ZRE A;  2L5O A;  2H8L A;  4KDY A;  4K0G A;  2G2Q A;  4WF4 A;  2PU9 C;  3ERF A;  2DJ2 A;  1WPI A;  5G5F A;  4PNG A;  1PD2 1;  1XIY A;  5E4W A;  14GS A;  2B5X A;  4NXI A;  1S3C A;  4ILF A;  2H1A A;  3VWX A;  1OC8 A;  2B1L A;  1TRW A;  4OWY A;  2DML A;  2WJU A;  1M7T A;  3IPZ A;  3VWV A;  4JED A;  1K0A A;  1EOH A;  1IYI A;  5F8B A;  1YY7 A;  5A4V A;  5IOX A;  4IVF A;  1W89 A;  4ZL9 A;  1M2B A;  1B48 A;  2JAC A;  2PMT A;  1SL2 B;  3S9F A;  1EV4 A;  4ZL8 A;  2F51 A;  5G5E A;  2VLV A;  3P90 A;  5H5R A;  2VAF A;  4EC0 A;  3A5W A;  4KSO A;  2MZC A;  1MDI A;  2M72 A;  4X1U A;  1ZMA A;  5DJL A;  3TKS C;  4L5O A;  3GKM A;  1JLW A;  4Q5Q A;  4TR4 A;  1FVK A;  3VLN A;  1M2A A;  5H5S A;  4O7H A;  4YH2 A;  5HR2 A;  3D5J A;  4HZ4 A;  2KP2 A;  2YWO A;  2ON5 A;  2L6C A;  2TIR A;  2P5Q A;  4EVM A;  4OCF A;  3TGZ A;  2WB9 A;  6GSX A;  1SK1 A;  3VI7 A;  1F2E A;  5G30 A;  2GSQ A;  5AIV A;  4KW6 A;  1E2Y A;  1GLP A;  4J56 E;  3GTU A;  2IMF A;  5A5K A;  4XS4 A;  1HNB A;  1CQH A;  2V41 A;  4MJB A;  1WIK A;  3GL3 A;  2H73 A;  2X8G A;  5C00 A;  4V1A p;  6GSS A;  3TRP A;  1GUK A;  1A0R P;  2L6D A;  1ZGN A;  3KJY A;  1BQ7 A;  1LJR A;  4PQH A;  4K8M A;  2MMN A;  4ECI A;  4GLT A;  5D73 A;  5D93 A;  3FYG A;  4BL7 A;  3GX0 A;  1GWC A;  3WGX A;  4V2L A;  4ZB8 A;  4LL4 B;  3ZL5 A;  3DVW A;  2VM1 A;  2C1Y A;  3MSZ A;  5CO3 A;  2HNL A;  1GNW A;  5DCH A;  5IMA A;  4OFM A;  5J41 A;  1PX7 A;  2OE0 A;  2H76 A;  3GKK A;  2XHF A;  1OC3 A;  2VIM A;  2LJA A;  1OE7 A;  3D4T A;  10GS A;  2CT6 A;  2J23 A;  5IM9 A;  2IN3 A;  4GST A;  2LV3 A;  2PER A; 
#chains in the Genus database with same CATH topology
 1FB6 A;  2AJQ B;  3UVT A;  3F4T A;  4MZW A;  4POM A;  2A2P A;  1SD8 A;  2HXK A;  3DKS A;  1EP8 A;  4Q5F A;  2C4J A;  5G2Z A;  1ILO A;  2F8F A;  5D96 A;  4TVE A;  2X99 A;  1J0F A;  5FT3 A;  4YAP A;  1S3R A;  2RM5 A;  2C0F A;  2H0I A;  2WS2 A;  5D9W A;  1K0M A;  2E2M A;  1YKC A;  1HNA A;  2DC5 A;  5EVO A;  3UJ1 A;  4RQR A;  1BYE A;  5LD0 A;  1X0R A;  5IPH A;  3RDW A;  1X9M B;  5ECI B;  2VOC A;  4KE3 A;  1GSY A;  3TB2 A;  3W8J A;  1TI1 A;  3VFI A;  2IME A;  3ZRD A;  4N10 A;  2O7K A;  4WET A;  1SK0 A;  1UN2 A;  2IFQ B;  2RII A;  3FZA A;  3L4N A;  4BA7 A;  4N11 A;  1URM A;  1F3B A;  2VL2 A;  4YQU A;  3EVI A;  5DBQ A;  5D9T A;  4TKY A;  3VWW A;  2XBQ A;  2CVK A;  2Z9S A;  5AN1 A;  5ID2 B;  1K0N A;  4GF0 A;  4F9Z A;  5IQY A;  3F63 A;  5BRT A;  4XCS A;  5ECO B;  3ZTL A;  4PUA A;  2H0H A;  3HJO A;  3US3 A;  3GFK A;  2DMM A;  5G1K A;  6GST A;  3RPN A;  3FZ9 A;  4TR0 A;  4OMV A;  1XWC A;  4FYU A;  1Z6M A;  4G19 A;  3C71 A;  4MJA A;  4ML1 A;  2GZP A;  4IW9 A;  3DVX A;  5HFI A;  4O5R A;  1EZK A;  4K9Z A;  4X4J A;  4NPB A;  1EEM A;  5FHI A;  3UAP A;  4V2M A;  1GRX A;  9GSS A;  1UVZ A;  1VF1 A;  1A0F A;  2YJ7 A;  1M3J A;  1F3A A;  5KOW A;  2VL3 A;  1V57 A;  1MDK A;  2OE3 A;  3CSI A;  2YZH A;  4JZQ A;  4KUN A;  4K2D A;  4HUA A;  1QFN A;  1M3I A;  5IMF A;  2IIY A;  4IBP A;  2LRN A;  4MPG A;  2FUG 2;  1UC7 A;  2H0G A;  3BJ5 A;  2VCV A;  3FKF A;  2REM A;  1CQG A;  3WGE A;  3KTB A;  4PXO A;  1U87 A;  3GUR A;  2ES7 A;  4KA0 A;  4EDZ A;  4O5Q A;  5E59 A;  1HNC A;  2MBS A;  2HRK A;  3CYN A;  3F3Q A;  1K0B A;  3TKS E;  1H75 A;  1GNE A;  3KD0 A;  4JBB A;  5IIZ A;  3A2V A;  5F06 A;  2LUS A;  4PNF A;  1WRY A;  3MNG A;  1ZYP A;  4OFT A;  4TRX A;  1JFU A;  1XW5 A;  4IP1 A;  2FCH A;  1NSW A;  3BOA A;  2IMD A;  4I6X A;  3MDK A;  3E0U A;  2FLS A;  3H8Q A;  4MF5 A;  1LU4 A;  1PL2 A;  1ERU A;  3GIX A;  4I2T A;  1OVN A;  3KP8 A;  2YPM A;  3WT1 A;  4WKW A;  2NPB A;  2XBI A;  2HFD A;  1B4Q A;  3IHQ A;  3VPQ A;  2E0Q A;  1O8X A;  6GSW A;  2IMK A;  5AIX A;  1PKW A;  2XPE A;  4HZ2 A;  4IQA A;  4BIK A;  1MTC A;  3ZIJ A;  2B5Y A;  2OAC A;  3FRC A;  3A2X A;  2CA8 A;  3A3T A;  4CY8 A;  2VL2 C;  13GS A;  1EGO A;  4V2N A;  2V2G A;  2V32 A;  1Y6E A;  3PH9 A;  5KN3 A;  1ZOF A;  3M3M A;  3VK9 A;  2XPD A;  3QCP A;  5J5N A;  2WUL A;  3RBT A;  4XIH A;  2H72 A;  3D0Z A;  1PSQ A;  4FIW A;  1QXH A;  4IP6 A;  5DAK A;  3GN3 A;  1YEP A;  2DBC A;  1GSF A;  1EEJ A;  1M99 A;  3ZVJ A;  3N5O A;  3KH7 A;  3RAZ A;  2H01 A;  3CSJ A;  8GSS A;  2VCW A;  5IMC A;  3MIX A;  1I9D A;  3IDV A;  3KMN A;  17GS A;  2GTU A;  2P5R A;  4HS1 A;  3VWU A;  1WWJ A;  1KTE A;  4DVC A;  3HHV A;  2GSS A;  1A2J A;  3F9U A;  2IFQ A;  4MLY A;  2GQM A;  4EF0 A;  2PUK C;  3ZMK A;  2QKE A;  2FNO A;  3MYD A;  1F9M A;  5L71 A;  2K9F A;  2O85 A;  4OFN A;  4K5R A;  2E7P A;  2JSZ A;  3QAW A;  5ID2 A;  4F0B A;  4AJ7 A;  4CW9 A;  12GS A;  3IR4 A;  1USB A;  4H86 A;  4K7N A;  3W8S A;  2CAQ A;  3NZN A;  2DIY A;  4IKH A;  4DSR A;  1WMJ A;  1TRV A;  2KOK A;  1XWG A;  1LBK A;  3TKP A;  3TRX A;  1YQ1 A;  1QUW A;  2KLX A;  1SYR A;  3HCZ A;  1SK2 A;  4G10 A;  1MD4 A;  2RLI A;  3CSH A;  3MAK A;  4BVY B;  1TKD B;  1O85 A;  2VM2 A;  2CAI A;  2JZR A;  5F0G A;  1AXD A;  2OJL A;  3AY8 A;  2FWF A;  1BJX A;  1O8W A;  4EKZ A;  3H4K A;  1K0D A;  2GSR A;  4K5S A;  1AAZ A;  3LG6 A;  1XW9 A;  1GUM A;  4MK3 A;  2C0E A;  6GSV A;  1GSU A;  1B9X C;  4MA9 A;  1DE2 A;  2QC7 A;  1Z7P A;  4QL7 A;  2R4V A;  2R0G A;  4G2E A;  4E8H A;  2BJX A;  4LMV A;  5IO0 A;  1XWK A;  3LWA A;  3QAG A;  1ACV A;  1ERT A;  2R6K A;  1TK0 B;  1FO5 A;  3HD5 A;  3NIV A;  1GTI A;  1TI3 A;  3C8E A;  2A4V A;  3FR6 A;  1KBN A;  3UBK A;  1GUL A;  2VCX A;  1B9Y C;  4MNN A;  5ECL B;  5CRG A;  2G0F A;  3HKR A;  2R0C A;  2X4A A;  3BCK A;  2YNX A;  2NBS A;  1SL0 B;  2H71 A;  3GRX A;  1X9W B;  1PMT A;  4LLR A;  4KGI A;  1FAA A;  2WDU A;  1R4W A;  4L5L A;  2WFC A;  4J2F A;  2HSM A;  3LJR A;  1T4Z A;  5B6N A;  2GDR A;  5JCG A;  4HQS A;  3VI5 A;  4HOJ A;  2PBJ A;  3QDN A;  1NHY A;  1AQW A;  1BX9 A;  5HR3 A;  4TOP A;  4MH3 A;  1EP7 A;  4CHS A;  3GHA A;  3ZYW A;  5JWO B;  2YCD A;  2B3S A;  5IMZ A;  5GZZ B;  3QOU A;  3KM6 A;  5EPF A;  3CBU A;  3CQF A;  3RPP A;  3J7Y b;  4YKF A;  3WGD A;  3CTF A;  1Z7R A;  1SKW B;  4LA1 A;  4YQV A;  4AJ8 A;  3I6A A;  1X9S B;  5G1L A;  1N2A A;  3EMP A;  1Q4J A;  2PVQ A;  3FHK A;  1G7E A;  4K1F A;  2DJ3 A;  1U3I A;  1PN0 A;  3H93 A;  1GTA A;  4FQU A;  5CYY A;  1WE0 A;  4LMW A;  3QAV A;  3CMI A;  4MH2 A;  4Z2R A;  2ALB A;  2WGR A;  1J9B A;  3R3E A;  2VO4 A;  3KXO A;  3HYP A;  2ON7 A;  5B7C A;  2F8A A;  1GP1 A;  4PQ1 A;  5ECN B;  2M46 A;  3LEF A;  4F03 A;  1GSQ A;  2WCI A;  5J4U A;  5DAL B;  1DSB A;  4I97 A;  1ERV A;  1O81 A;  4KCA A;  4EXJ A;  2DSA A;  3LYP A;  3E9J B;  2ZUP A;  3HJM A;  4KDX A;  3GL5 A;  4ZBD A;  2AYT A;  3CRT A;  3FY7 A;  5HR1 A;  5D9V A;  2A4H A;  3ZFL A;  1JHB A;  3ZIV A;  4GSS A;  4MCU A;  3F8U A;  3LGC A;  2QSI A;  4KB3 A;  3GX8 A;  1OC9 B;  3UEM A;  5ECR B;  3EU4 A;  1WOU A;  3HA9 A;  3DGQ A;  2NDO A;  1TP9 A;  3DML A;  1XOB A;  1S3A A;  2C0D A;  1K3O A;  4G9H A;  3TUE A;  5HR0 A;  4IS0 A;  2TRC P;  1THO A;  7GSS A;  2FHE A;  2QGV A;  1T8E B;  1V2A A;  5IOW A;  2DLX A;  1DUG A;  2I3Y A;  2RUE A;  1RW1 A;  2XC2 A;  3IV4 A;  5DCG A;  3M8N A;  5KN0 A;  1T4Y A;  2YWN A;  3LOR A;  2EC4 A;  2ZCT A;  1A23 A;  3DXB A;  5GST A;  1TK5 B;  3WT2 A;  2X49 A;  1A8Y A;  2FGX A;  2VCT A;  4ZXG A;  3IHG A;  3H1N A;  4OCE A;  2N5A A;  4I5Q A;  3L9S A;  3TRQ A;  1SYX A;  3APO A;  4NV5 A;  2IJY A;  2LNT A;  5ECK B;  1QGV A;  3FW2 A;  1XCC A;  3KCM A;  3IK9 A;  4BVX B;  4IEL A;  3FMW A;  3ZVJ D;  3F0I A;  4X43 A;  4Q5R A;  4JU5 A;  2JU5 A;  1YKA A;  1VF3 A;  3M9K A;  3O3T A;  2AAW A;  4HDE A;  4IGJ A;  5B8B A;  4FH8 A;  4QQ7 A;  2AB6 A;  2GS3 A;  3G9B A;  4WBR D;  3HVX A;  1YF0 A;  1TU7 A;  2GQK A;  5CRE A;  1R5A A;  1PRX A;  3VUR A;  1VF4 A;  4XRD A;  1THX A;  5ECM B;  5CP1 A;  3DEX A;  3HY2 A;  4F82 A;  1GSE A;  2R2J A;  3O6T A;  1ERW A;  5G31 A;  3DRN A;  2H66 A;  2YAN A;  1ABA A;  2FA8 A;  4TXV A;  2AUV A;  2FD3 A;  4FYC A;  2WRT A;  4HSC X;  1Z9H A;  2H6Z A;  3G7I A;  3UOM A;  2B7J A;  3GH6 A;  2HZF A;  2UZ8 A;  3D4M A;  1BED A;  4MPF A;  2NVL A;  2OBI A;  1HQO A;  4KCE A;  1NW2 A;  1PA3 A;  5COH A;  1PX6 A;  4DSS B;  1SJI A;  2O89 A;  4DSQ A;  3F3R A;  3M1G A;  1Z3E A;  3N9J A;  1XBS A;  2LQO A;  4POB A;  3PGT A;  1F37 A;  1OYJ A;  4NMU A;  4YAV A;  4A5P A;  4ECJ A;  5CNW A;  1B8X A;  3G7Y A;  2LNS A;  2P0G A;  4IQ1 A;  4KH7 A;  2WZ9 A;  2MBT A;  4G0K A;  3V1W A;  1H4O A;  5B8A A;  3IC8 A;  2YOI A;  6GSU A;  3KTL A;  1T00 A;  4ID0 A;  1RQM A;  1K3Y A;  1EGR A;  4RI7 A;  1SKR B;  4CY6 A;  2C3N A;  3F4R A;  4TR1 B;  1FOV A;  3GUS A;  3Q18 A;  4MP4 A;  2VL9 A;  2N5B A;  3JCM L;  3IRA A;  4EDY A;  4GQF A;  5LNK e;  3F6F A;  3C7M A;  5BMU A;  3W6G A;  3QD9 A;  4GQC A;  4MAB A;  2YV7 A;  3HXS A;  2R5G A;  3HZ8 A;  4KAE A;  4XS4 B;  5DQS A;  3Q19 A;  3UIW A;  5GAN D;  2B5E A;  3APS A;  2GVP A;  3EIN A;  3LYK A;  3CRU A;  2HYX A;  3HDC A;  5HQP A;  1DBY A;  5DAL A;  1R26 A;  1BAY A;  2LRC A;  5D9X A;  5J9B A;  4IN0 A;  5B6M A;  2H1D A;  19GS A;  2NTO A;  4NHW A;  4WXT A;  2M80 A;  1YF1 A;  3K8N A;  5F05 A;  2JZS A;  1OKD A;  2X64 A;  2CV4 A;  3D22 A;  4P3Y B;  3LQ7 A;  3IBH A;  4EL1 A;  1JZD A;  3UL3 A;  4HI7 A;  2A2R A;  1TRS A;  3I43 A;  5ENU A;  4HJ2 A;  3WD6 A;  1AIU A;  4OO5 A;  1M0U A;  2GT6 A;  2I81 A;  3IC4 A;  5IMD A;  1FHE A;  2LJK A;  5ECQ B;  1K0C A;  4TW5 A;  3UMA A;  1ML6 A;  2MMO A;  3ZIT A;  4XTS A;  4D73 B;  2IMI A;  4OD7 A;  1AQX A;  3C73 A;  1SU9 A;  2EIO A;  3KP9 A;  3QPM A;  5CRW A;  1EV9 A;  5H5Q A;  1E6B A;  2GGT A;  4IHU A;  4IJI A;  5EY6 A;  1XZO A;  1V58 A;  4N30 A;  1XVQ A;  1C72 A;  2V6O A;  5FWG A;  4O5U A;  4JE1 A;  2D2Z A;  3DYR A;  1ZYN A;  1K0O A;  3GNJ A;  1S3D A;  2C0G A;  2YWM A;  4BVX A;  5KOX A;  1SD9 A;  2HI7 A;  4MJE A;  2C80 A;  18GS A;  4O92 A;  1A8L A;  2K8S A;  4BWQ A;  2OAD A;  4L0W A;  1VF2 A;  1GSS A;  1M2D A;  1ZL9 A;  3QFB C;  4WEY A;  4WR4 A;  1IYH A;  3GKX A;  4PUF C;  3TJF A;  2VLU A;  2VCQ A;  3PR8 A;  5JCU A;  1U88 A;  3CXG A;  2OKA A;  1X5C A;  3TDG A;  2P31 A;  1FW1 A;  5ECS A;  3F6D A;  2JAD A;  2H1G A;  2VLT A;  3TJK A;  5HFK A;  3QFA C;  1UA5 A;  5DQY A;  4AGS A;  3SBC A;  5IPG A;  1XPV A;  1TOF A;  4X0X A;  5J3R A;  4KDU A;  3L9V A;  4KND A;  3ME8 A;  1SJZ A;  3GV1 A;  2OA7 A;  3KGK A;  3KZQ A;  4XS1 A;  1V9W A;  1F6M C;  1QK8 A;  4YQM A;  2LJR A;  1KEB A;  2LQQ A;  4WR5 A;  2H19 A;  1KNG A;  3RHB A;  2GT5 A;  2YV9 A;  5KEJ A;  2GQL A;  3DWV A;  4BWS A;  2HZE B;  2I1U A;  2X8C A;  3MWH A;  4WBJ A;  2HT9 A;  3HVV A;  1FVJ A;  3KEB A;  2HRF A;  4G0I A;  2K8V A;  1T1V A;  3IOS A;  2I9H A;  4ZBA A;  4DSS A;  1BG5 A;  4FYB A;  3FR9 A;  2H74 A;  2C3T A;  4TXO B;  1JZR A;  2LRT A;  2I4A A;  4I2U A;  1XVW A;  3LXT A;  5GAP D;  1TTZ A;  3EE2 A;  1Y25 A;  1O73 A;  4HQZ A;  2R3X A;  4N0V A;  2H1B A;  1O6J A;  4I8B A;  1YDK A;  3BCI A;  4JRR A;  4PQI A;  3D21 A;  1B4P A;  5IMV A;  5J9C A;  3LXZ A;  5KN1 A;  3PPU A;  3HVS A;  2K18 A;  4ISD A;  2TRX A;  22GS A;  2GST A;  4GWR A;  2BTO T;  1K3L A;  3IA1 A;  1HYU A;  4TR1 A;  3EYT A;  4LL1 B;  1N8J A;  1X5E A;  3P7X A;  1AUC A;  1U6T A;  2PVO C;  1V40 A;  3BBY A;  4MZC A;  4F2I A;  3TKQ A;  2EIQ A;  1HD2 A;  4MDC A;  2YN1 A;  2HSY A;  4XRA A;  4GTU A;  4NAX A;  1JLV A;  3C1R A;  3IAS 2;  2B7K A;  3ED3 A;  5ABR A;  2PWJ A;  2PN8 A;  3APQ A;  2H70 A;  3ZZX A;  2LKU A;  4IJ3 A;  4MF7 A;  1TU8 A;  5ECP B;  2FWH A;  2CX3 A;  2V1M A;  3ZLP A;  1FOH A;  1XWA A;  1TW9 A;  4MMM A;  1M9A A;  3P2A A;  3HVN A;  4V1A g;  1JZW A;  3L9U A;  3HZ4 A;  5IO2 A;  1OKT A;  16GS A;  3ME7 A;  3EMX A;  2FWG A;  4BPY A;  2F3M A;  5CRD A;  2CVD A;  3R2Q A;  2CZ2 A;  5GSS A;  2X8H A;  4ZBB A;  3EPT A;  2FA4 A;  1R5P A;  2CQ9 A;  2RUF A;  3LW9 A;  2H6X A;  3CTG A;  3LFL A;  1DE1 A;  4D73 A;  4NV2 A;  2JSY A;  3Q74 A;  4RUV A;  4USS A;  3QMX A;  1ON4 A;  4Z7X A;  5DAK B;  1GTU A;  4CDO A;  5C04 A;  1ST9 A;  1OE8 A;  5EL8 A;  3TCO A;  1FB0 A;  3FR3 A;  4ECB A;  1TK8 B;  2YZU A;  5JWQ B;  4AJ6 A;  2YJH A;  3I69 A;  2N5F A;  1A2L A;  5KN2 A;  3LSZ A;  4ECC A;  3KMO A;  4PX1 A;  4ZB9 A;  1MEK A;  1X5D A;  3UVH A;  1TRU A;  2L57 A;  1G6W A;  2E2G A;  3Q6O A;  1ZZY A;  3IK7 A;  2LST A;  5ECH B;  4BVY A;  3KH9 A;  3O76 A;  3IXR A;  2H30 A;  3FEU A;  1T7P B;  3GMF A;  5DJM A;  3U5R E;  1A24 A;  1QMV A;  1YZX A;  5AGY A;  3WYW A;  2YP6 A;  1AW9 A;  2MYG A;  2L5L A;  4G0L A;  1TXX A;  4RI6 A;  1G0T A;  1GSD A;  2HRA A;  3UAR A;  4K7I A;  3GSS A;  1PN9 A;  2MMA A;  4ULX A;  3SWL A;  3NOF A;  4EE0 A;  2DJJ A;  1XWB A;  3HJP A;  3RHC A;  2IL3 A;  3UBL A;  4FO5 A;  1AQV A;  2L59 A;  1MDJ A;  3ZFB A;  4NWY A;  4E8E A;  2LEG A;  2L4Q A;  4J57 E;  4ZB6 A;  3BD2 A;  4HJM A;  4HU9 A;  2HZE A;  3ZML A;  1XXU A;  3TKR A;  4HU7 A;  2C3Q A;  3KIJ A;  1ZYE A;  2C8U A;  1XW6 A;  2VUP A;  1PGT A;  1PL1 A;  1WP0 A;  2DJ0 A;  2HRN A;  4MJC A;  4K7O A;  2O8V B;  4JR4 A;  3P8W A;  3IE3 A;  2KUC A;  1Z6N A;  3FZ5 A;  4TXO A;  3TJJ A;  4GCI A;  2GZY A;  3TJG A;  4GRF A;  2HSH A;  4ICY A;  4O32 A;  1A2M A;  3VPT A;  4L0U A;  5DDL A;  3M0F A;  2KP1 A;  2GZZ A;  5AIS A;  3ERG A;  1I5G A;  2GLR A;  3U6V A;  1QQ2 A;  2EIR A;  2A2S A;  5D8I A;  3QR6 A;  1AC1 A;  1U3A A;  3IAM 2;  3L78 A;  1WJK A;  2R0P A;  2OE1 A;  2JZT A;  2DIZ A;  5HFG A;  2LS5 A;  2ZNM A;  1GH2 A;  4TN8 A;  1GTB A;  3D6I A;  4WF5 A;  2CVB A;  1MD3 A;  2RM6 A;  3A2W A;  5ELG A;  1NM3 A;  3DD3 A;  2IWT A;  4QL9 A;  2DJ1 A;  4PUR A;  3M9J A;  4K6X A;  2PPT A;  1EOG A;  3EU3 A;  4KF9 A;  2HE3 A;  2V6K A;  3E3E A;  2QA2 A;  4XHM A;  1W4V A;  2KHP A;  2MMZ A;  3G7J A;  4ML6 A;  2JL4 A;  2K6V A;  2VCZ A;  4F0C A;  1EWX A;  3F4S A;  3GKN A;  5CAX A;  2FWE A;  4Q5N A;  2H6Y A;  3ISO A;  1V98 A;  1VGL A;  5DVB A;  4HEA 2;  1SKS B;  2L4C A;  5ELA A;  2F9S A;  4PGT A;  1O7U A;  1ZYQ B;  3GTU B;  4Z2T A;  4EIP A;  1GUH A;  4ZL7 A;  4EO3 A;  1NHO A;  2CZ3 A;  1VRS D;  2B1K A;  3I9V 2;  3FK8 A;  4L8E A;  1PKZ A;  1R7H A;  2H75 A;  2R37 A;  4DEJ A;  2AV4 A;  3GYK A;  5F07 A;  1T3B A;  2PGT A;  4POL A;  3TKS A;  2HLS A;  4AF2 A;  5JCW A;  2BMX A;  4BL7 B;  1XOA A;  4N0Z A;  1PQN A;  4POK A;  4K0N A;  1Q98 A;  4MF6 A;  2B6M A;  3EC3 A;  5LCZ A;  20GS A;  5INY A;  1OAZ A;  1OC9 A;  3L0H A;  3TOU A;  4K2X A;  4GSN A;  4MZB A;  4OO4 A;  1ZCP A;  2DJK A;  3TJB A;  1GL8 A;  4ACS A;  2IPA A;  3EWL A;  1TDI A;  2QA1 A;  4TR3 A;  3DIE A;  3H79 A;  5CRH A;  3GST A;  3FZ4 A;  6GSY A;  3EUR A;  2J9H A;  4XS6 A;  1Z5Y E;  3GH9 A;  2CX4 A;  2YWI A;  1M9B A;  1SL1 B;  1GLQ A;  4GXZ A;  3GA4 A;  2LTK A;  2AHE A;  3ERW A;  4Z2U A;  1RK4 A;  2VD1 A;  3OR5 A;  4NHZ A;  4EUY A;  1YEX A;  2O87 A;  2OBK A;  3C1S A;  3J7Y k;  4ZIJ A;  3TOT A;  5A4W A;  1J08 A;  3PIN A;  4KSM A;  4PTS A;  2FY6 A;  1SEN A;  4RQX A;  1YJ6 A;  2VD0 A;  1G7O A;  5JWR B;  1XFL A;  4KX4 A;  1SJ6 A;  11GS A;  1G6Y A;  1JZO A;  5A4U A;  1TJD A;  4JR6 A;  4ZIL A;  1FG4 A;  3ZRE A;  2L5O A;  2H8L A;  4KDY A;  4K0G A;  2G2Q A;  4WF4 A;  2PU9 C;  3ERF A;  2DJ2 A;  1WPI A;  5G5F A;  4PNG A;  1PD2 1;  1XIY A;  5E4W A;  14GS A;  2B5X A;  4NXI A;  4EIQ A;  1S3C A;  4ILF A;  2H1A A;  3VWX A;  1OC8 A;  2B1L A;  1TRW A;  4OWY A;  2DML A;  2WJU A;  1M7T A;  3IPZ A;  3VWV A;  4JED A;  1K0A A;  1EOH A;  1IYI A;  5F8B A;  1YY7 A;  5A4V A;  5IOX A;  4IVF A;  1W89 A;  4ZL9 A;  1M2B A;  1B48 A;  2JAC A;  2PMT A;  1SL2 B;  3S9F A;  1EV4 A;  4ZL8 A;  1PFO A;  2F51 A;  5G5E A;  2VLV A;  3P90 A;  4YKG A;  5H5R A;  2VAF A;  4EC0 A;  3A5W A;  4KSO A;  2MZC A;  1MDI A;  2M72 A;  4X1U A;  1XG8 A;  1ZMA A;  5DJL A;  3TKS C;  4L5O A;  3GKM A;  1JLW A;  4Q5Q A;  4TR4 A;  1FVK A;  3VLN A;  1M2A A;  5H5S A;  2DKH A;  4O7H A;  4YH2 A;  5HR2 A;  3D5J A;  4HZ4 A;  2KP2 A;  2YWO A;  2ON5 A;  2L6C A;  2TIR A;  2P5Q A;  4EVM A;  4OCF A;  3TGZ A;  2WB9 A;  6GSX A;  1SK1 A;  3VI7 A;  1F2E A;  5G30 A;  2GSQ A;  5AIV A;  4KW6 A;  1E2Y A;  1GLP A;  4J56 E;  3GTU A;  2IMF A;  5A5K A;  4XS4 A;  1HNB A;  1CQH A;  2V41 A;  4MJB A;  1WIK A;  3GL3 A;  2H73 A;  2X8G A;  5C00 A;  3A5I A;  4V1A p;  6GSS A;  3TRP A;  1GUK A;  1A0R P;  2L6D A;  1ZGN A;  3KJY A;  1BQ7 A;  1LJR A;  4PQH A;  4K8M A;  2MMN A;  4ECI A;  4GLT A;  5D73 A;  5D93 A;  3FYG A;  4BL7 A;  3GX0 A;  1GWC A;  3WGX A;  4V2L A;  4ZB8 A;  4LL4 B;  3ZL5 A;  3DVW A;  2VM1 A;  2C1Y A;  3MSZ A;  5CO3 A;  2HNL A;  1GNW A;  5DCH A;  5IMA A;  4OFM A;  5J41 A;  1PX7 A;  2OE0 A;  2H76 A;  3GKK A;  2XHF A;  1OC3 A;  2VIM A;  2LJA A;  1OE7 A;  3D4T A;  10GS A;  2CT6 A;  2DKI A;  2J23 A;  5IM9 A;  2IN3 A;  4GST A;  2LV3 A;  2PER A; 
#chains in the Genus database with same CATH homology
 1FB6 A;  2AJQ B;  3UVT A;  3F4T A;  4MZW A;  4POM A;  2A2P A;  1SD8 A;  2HXK A;  3DKS A;  1EP8 A;  4Q5F A;  2C4J A;  5G2Z A;  1ILO A;  2F8F A;  5D96 A;  4TVE A;  2X99 A;  1J0F A;  5FT3 A;  4YAP A;  2RM5 A;  2WS2 A;  2C0F A;  2H0I A;  5D9W A;  1K0M A;  2E2M A;  1YKC A;  1HNA A;  2DC5 A;  5EVO A;  3UJ1 A;  4RQR A;  1BYE A;  5LD0 A;  1X0R A;  5IPH A;  3RDW A;  1X9M B;  5ECI B;  2VOC A;  4KE3 A;  1GSY A;  3TB2 A;  3W8J A;  1TI1 A;  3VFI A;  2IME A;  3ZRD A;  4N10 A;  2O7K A;  4WET A;  1SK0 A;  1UN2 A;  2IFQ B;  2RII A;  3FZA A;  3L4N A;  4BA7 A;  4N11 A;  1URM A;  1F3B A;  2VL2 A;  4YQU A;  3EVI A;  5DBQ A;  5D9T A;  4TKY A;  3VWW A;  2XBQ A;  2CVK A;  2Z9S A;  5AN1 A;  5ID2 B;  1K0N A;  4GF0 A;  4F9Z A;  5IQY A;  3F63 A;  5BRT A;  4XCS A;  5ECO B;  3ZTL A;  4PUA A;  2H0H A;  3HJO A;  3US3 A;  3GFK A;  2DMM A;  5G1K A;  6GST A;  3RPN A;  3FZ9 A;  4TR0 A;  4OMV A;  1XWC A;  4FYU A;  1Z6M A;  4G19 A;  3C71 A;  4MJA A;  4ML1 A;  2GZP A;  4IW9 A;  3DVX A;  5HFI A;  4O5R A;  1EZK A;  4K9Z A;  4X4J A;  4NPB A;  1EEM A;  5FHI A;  3UAP A;  4V2M A;  1GRX A;  9GSS A;  1UVZ A;  1VF1 A;  1A0F A;  2YJ7 A;  1F3A A;  5KOW A;  2VL3 A;  1V57 A;  1MDK A;  2OE3 A;  3CSI A;  2YZH A;  4JZQ A;  4KUN A;  4K2D A;  4HUA A;  1QFN A;  5IMF A;  2IIY A;  4IBP A;  2LRN A;  4MPG A;  2FUG 2;  1UC7 A;  2H0G A;  3BJ5 A;  2VCV A;  3FKF A;  2REM A;  1CQG A;  3WGE A;  3KTB A;  4PXO A;  1U87 A;  3GUR A;  2ES7 A;  4KA0 A;  4EDZ A;  4O5Q A;  5E59 A;  1HNC A;  2MBS A;  2HRK A;  3CYN A;  3F3Q A;  1K0B A;  3TKS E;  1H75 A;  1GNE A;  3KD0 A;  4JBB A;  5IIZ A;  3A2V A;  5F06 A;  2LUS A;  4PNF A;  1WRY A;  3MNG A;  1ZYP A;  4OFT A;  4TRX A;  1JFU A;  1XW5 A;  4IP1 A;  2FCH A;  1NSW A;  3BOA A;  2IMD A;  4I6X A;  3MDK A;  3E0U A;  2FLS A;  3H8Q A;  4MF5 A;  1LU4 A;  1PL2 A;  1ERU A;  3GIX A;  4I2T A;  1OVN A;  3KP8 A;  2YPM A;  3WT1 A;  4WKW A;  2NPB A;  2XBI A;  2HFD A;  1B4Q A;  3IHQ A;  3VPQ A;  2E0Q A;  1O8X A;  6GSW A;  2IMK A;  5AIX A;  1PKW A;  2XPE A;  4HZ2 A;  4IQA A;  1MTC A;  3ZIJ A;  2B5Y A;  2OAC A;  3FRC A;  3A2X A;  2CA8 A;  3A3T A;  4CY8 A;  2VL2 C;  13GS A;  1EGO A;  4V2N A;  2V2G A;  2V32 A;  1Y6E A;  3PH9 A;  5KN3 A;  1ZOF A;  3M3M A;  3VK9 A;  2XPD A;  3QCP A;  5J5N A;  2WUL A;  3RBT A;  4XIH A;  2H72 A;  3D0Z A;  1PSQ A;  4FIW A;  1QXH A;  4IP6 A;  5DAK A;  3GN3 A;  1YEP A;  2DBC A;  1GSF A;  1EEJ A;  1M99 A;  3ZVJ A;  3N5O A;  3KH7 A;  3RAZ A;  2H01 A;  3CSJ A;  8GSS A;  2VCW A;  5IMC A;  3MIX A;  1I9D A;  3IDV A;  3KMN A;  17GS A;  2GTU A;  2P5R A;  4HS1 A;  3VWU A;  1WWJ A;  1KTE A;  4DVC A;  3HHV A;  2GSS A;  1A2J A;  3F9U A;  2IFQ A;  4MLY A;  2GQM A;  4EF0 A;  2PUK C;  3ZMK A;  2QKE A;  2FNO A;  3MYD A;  1F9M A;  5L71 A;  2K9F A;  2O85 A;  4OFN A;  4K5R A;  2E7P A;  2JSZ A;  3QAW A;  5ID2 A;  4F0B A;  4AJ7 A;  4CW9 A;  12GS A;  3IR4 A;  1USB A;  4H86 A;  4K7N A;  3W8S A;  2CAQ A;  3NZN A;  2DIY A;  4IKH A;  4DSR A;  1WMJ A;  1TRV A;  2KOK A;  1XWG A;  1LBK A;  3TKP A;  3TRX A;  1YQ1 A;  1QUW A;  2KLX A;  1SYR A;  3HCZ A;  1SK2 A;  4G10 A;  1MD4 A;  2RLI A;  3CSH A;  3MAK A;  4BVY B;  1TKD B;  1O85 A;  2VM2 A;  2CAI A;  2JZR A;  5F0G A;  1AXD A;  2OJL A;  3AY8 A;  2FWF A;  1BJX A;  1O8W A;  4EKZ A;  3H4K A;  1K0D A;  2GSR A;  4K5S A;  1AAZ A;  3LG6 A;  1XW9 A;  1GUM A;  4MK3 A;  2C0E A;  6GSV A;  1GSU A;  1B9X C;  4MA9 A;  1DE2 A;  2QC7 A;  1Z7P A;  4QL7 A;  2R4V A;  2R0G A;  4G2E A;  4E8H A;  2BJX A;  4LMV A;  5IO0 A;  1XWK A;  3LWA A;  3QAG A;  1ACV A;  1ERT A;  2R6K A;  1TK0 B;  1FO5 A;  3HD5 A;  3NIV A;  1GTI A;  1TI3 A;  3C8E A;  2A4V A;  3FR6 A;  1KBN A;  3UBK A;  1GUL A;  2VCX A;  1B9Y C;  4MNN A;  5ECL B;  5CRG A;  2G0F A;  3HKR A;  2R0C A;  2X4A A;  3BCK A;  2YNX A;  2NBS A;  1SL0 B;  2H71 A;  3GRX A;  1X9W B;  1PMT A;  4LLR A;  4KGI A;  1FAA A;  2WDU A;  1R4W A;  4L5L A;  2WFC A;  4J2F A;  2HSM A;  3LJR A;  1T4Z A;  5B6N A;  2GDR A;  5JCG A;  4HQS A;  3VI5 A;  4HOJ A;  2PBJ A;  3QDN A;  1NHY A;  1AQW A;  1BX9 A;  5HR3 A;  4TOP A;  4MH3 A;  1EP7 A;  4CHS A;  3GHA A;  3ZYW A;  5JWO B;  2YCD A;  2B3S A;  5IMZ A;  5GZZ B;  3QOU A;  3KM6 A;  5EPF A;  3CBU A;  3RPP A;  3J7Y b;  4YKF A;  3WGD A;  3CTF A;  1Z7R A;  1SKW B;  4LA1 A;  4YQV A;  4AJ8 A;  3I6A A;  1X9S B;  5G1L A;  1N2A A;  3EMP A;  1Q4J A;  2PVQ A;  3FHK A;  1G7E A;  4K1F A;  2DJ3 A;  1U3I A;  1PN0 A;  3H93 A;  1GTA A;  4FQU A;  5CYY A;  1WE0 A;  4LMW A;  3QAV A;  3CMI A;  4MH2 A;  4Z2R A;  2ALB A;  2WGR A;  1J9B A;  3R3E A;  2VO4 A;  3KXO A;  3HYP A;  2ON7 A;  5B7C A;  2F8A A;  1GP1 A;  4PQ1 A;  5ECN B;  2M46 A;  3LEF A;  4F03 A;  1GSQ A;  2WCI A;  5J4U A;  5DAL B;  1DSB A;  4I97 A;  1ERV A;  1O81 A;  4KCA A;  4EXJ A;  2DSA A;  3LYP A;  3E9J B;  2ZUP A;  3HJM A;  4KDX A;  3GL5 A;  4ZBD A;  2AYT A;  3CRT A;  3FY7 A;  5HR1 A;  5D9V A;  2A4H A;  3ZFL A;  1JHB A;  3ZIV A;  4GSS A;  4MCU A;  3F8U A;  3LGC A;  2QSI A;  4KB3 A;  3GX8 A;  1OC9 B;  3UEM A;  5ECR B;  3EU4 A;  1WOU A;  3HA9 A;  3DGQ A;  2NDO A;  1TP9 A;  3DML A;  1XOB A;  1S3A A;  2C0D A;  1K3O A;  4G9H A;  3TUE A;  5HR0 A;  4IS0 A;  2TRC P;  1THO A;  7GSS A;  2FHE A;  2QGV A;  1T8E B;  1V2A A;  5IOW A;  2DLX A;  1DUG A;  2I3Y A;  2RUE A;  1RW1 A;  2XC2 A;  3IV4 A;  5DCG A;  3M8N A;  5KN0 A;  1T4Y A;  2YWN A;  3LOR A;  2EC4 A;  2ZCT A;  1A23 A;  3DXB A;  5GST A;  1TK5 B;  3WT2 A;  2X49 A;  1A8Y A;  2FGX A;  2VCT A;  4ZXG A;  3IHG A;  3H1N A;  4OCE A;  2N5A A;  4I5Q A;  3L9S A;  3TRQ A;  1SYX A;  3APO A;  4NV5 A;  2IJY A;  2LNT A;  5ECK B;  1QGV A;  3FW2 A;  1XCC A;  3KCM A;  3IK9 A;  4BVX B;  4IEL A;  3FMW A;  3ZVJ D;  3F0I A;  4X43 A;  4Q5R A;  4JU5 A;  2JU5 A;  1YKA A;  1VF3 A;  3M9K A;  3O3T A;  2AAW A;  4HDE A;  4IGJ A;  5B8B A;  4FH8 A;  4QQ7 A;  2AB6 A;  2GS3 A;  3G9B A;  4WBR D;  3HVX A;  1YF0 A;  1TU7 A;  2GQK A;  5CRE A;  1R5A A;  1PRX A;  3VUR A;  1VF4 A;  4XRD A;  1THX A;  5ECM B;  5CP1 A;  3DEX A;  3HY2 A;  4F82 A;  1GSE A;  2R2J A;  3O6T A;  1ERW A;  5G31 A;  3DRN A;  2H66 A;  2YAN A;  1ABA A;  2FA8 A;  4TXV A;  2AUV A;  2FD3 A;  4FYC A;  2WRT A;  1Z9H A;  2H6Z A;  3G7I A;  3UOM A;  2B7J A;  3GH6 A;  2HZF A;  2UZ8 A;  3D4M A;  1BED A;  4MPF A;  2NVL A;  2OBI A;  1HQO A;  4KCE A;  1NW2 A;  1PA3 A;  5COH A;  1PX6 A;  4DSS B;  1SJI A;  2O89 A;  4DSQ A;  3F3R A;  3M1G A;  1Z3E A;  3N9J A;  1XBS A;  2LQO A;  4POB A;  3PGT A;  1F37 A;  1OYJ A;  4NMU A;  4YAV A;  4A5P A;  4ECJ A;  5CNW A;  1B8X A;  3G7Y A;  2LNS A;  2P0G A;  4IQ1 A;  4KH7 A;  2WZ9 A;  2MBT A;  4G0K A;  3V1W A;  1H4O A;  5B8A A;  3IC8 A;  2YOI A;  6GSU A;  3KTL A;  1T00 A;  4ID0 A;  1RQM A;  1K3Y A;  1EGR A;  4RI7 A;  1SKR B;  4CY6 A;  2C3N A;  3F4R A;  4TR1 B;  1FOV A;  3GUS A;  3Q18 A;  4MP4 A;  2VL9 A;  2N5B A;  3JCM L;  3IRA A;  4EDY A;  4GQF A;  5LNK e;  3F6F A;  3C7M A;  5BMU A;  3W6G A;  3QD9 A;  4GQC A;  4MAB A;  2YV7 A;  3HXS A;  2R5G A;  3HZ8 A;  4KAE A;  4XS4 B;  5DQS A;  3Q19 A;  3UIW A;  5GAN D;  2B5E A;  3APS A;  2GVP A;  3EIN A;  3LYK A;  3CRU A;  2HYX A;  3HDC A;  5HQP A;  1DBY A;  5DAL A;  1R26 A;  1BAY A;  2LRC A;  5D9X A;  5J9B A;  4IN0 A;  5B6M A;  2H1D A;  19GS A;  2NTO A;  4NHW A;  4WXT A;  2M80 A;  1YF1 A;  3K8N A;  5F05 A;  2JZS A;  1OKD A;  2X64 A;  2CV4 A;  3D22 A;  4P3Y B;  3LQ7 A;  3IBH A;  4EL1 A;  1JZD A;  3UL3 A;  4HI7 A;  2A2R A;  1TRS A;  3I43 A;  5ENU A;  4HJ2 A;  3WD6 A;  1AIU A;  4OO5 A;  1M0U A;  2GT6 A;  2I81 A;  3IC4 A;  5IMD A;  1FHE A;  2LJK A;  5ECQ B;  1K0C A;  4TW5 A;  3UMA A;  1ML6 A;  2MMO A;  3ZIT A;  4XTS A;  4D73 B;  2IMI A;  4OD7 A;  1AQX A;  3C73 A;  1SU9 A;  2EIO A;  3KP9 A;  3QPM A;  5CRW A;  1EV9 A;  5H5Q A;  1E6B A;  2GGT A;  4IHU A;  4IJI A;  5EY6 A;  1XZO A;  1V58 A;  4N30 A;  1XVQ A;  1C72 A;  2V6O A;  5FWG A;  4O5U A;  4JE1 A;  2D2Z A;  3DYR A;  1ZYN A;  1K0O A;  3GNJ A;  1S3D A;  2C0G A;  2YWM A;  4BVX A;  5KOX A;  1SD9 A;  2HI7 A;  4MJE A;  2C80 A;  18GS A;  4O92 A;  1A8L A;  2K8S A;  4BWQ A;  2OAD A;  4L0W A;  1VF2 A;  1GSS A;  1M2D A;  1ZL9 A;  3QFB C;  4WEY A;  4WR4 A;  1IYH A;  3GKX A;  4PUF C;  3TJF A;  2VLU A;  2VCQ A;  3PR8 A;  5JCU A;  1U88 A;  3CXG A;  2OKA A;  1X5C A;  3TDG A;  2P31 A;  1FW1 A;  5ECS A;  3F6D A;  2JAD A;  2H1G A;  2VLT A;  3TJK A;  5HFK A;  3QFA C;  1UA5 A;  5DQY A;  4AGS A;  3SBC A;  5IPG A;  1XPV A;  1TOF A;  4X0X A;  5J3R A;  4KDU A;  3L9V A;  4KND A;  3ME8 A;  1SJZ A;  3GV1 A;  2OA7 A;  3KGK A;  3KZQ A;  4XS1 A;  1V9W A;  1F6M C;  1QK8 A;  4YQM A;  2LJR A;  1KEB A;  2LQQ A;  4WR5 A;  2H19 A;  1KNG A;  3RHB A;  2GT5 A;  2YV9 A;  5KEJ A;  2GQL A;  3DWV A;  4BWS A;  2HZE B;  2I1U A;  2X8C A;  3MWH A;  4WBJ A;  2HT9 A;  3HVV A;  1FVJ A;  3KEB A;  2HRF A;  4G0I A;  2K8V A;  1T1V A;  3IOS A;  2I9H A;  4ZBA A;  4DSS A;  1BG5 A;  4FYB A;  3FR9 A;  2H74 A;  2C3T A;  4TXO B;  1JZR A;  2LRT A;  2I4A A;  4I2U A;  1XVW A;  3LXT A;  5GAP D;  1TTZ A;  3EE2 A;  1Y25 A;  1O73 A;  4HQZ A;  2R3X A;  4N0V A;  2H1B A;  1O6J A;  4I8B A;  1YDK A;  3BCI A;  4JRR A;  4PQI A;  3D21 A;  1B4P A;  5IMV A;  5J9C A;  3LXZ A;  5KN1 A;  3PPU A;  3HVS A;  2K18 A;  4ISD A;  2TRX A;  22GS A;  2GST A;  4GWR A;  2BTO T;  1K3L A;  3IA1 A;  1HYU A;  4TR1 A;  3EYT A;  4LL1 B;  1N8J A;  1X5E A;  3P7X A;  1AUC A;  1U6T A;  2PVO C;  1V40 A;  3BBY A;  4MZC A;  4F2I A;  3TKQ A;  2EIQ A;  1HD2 A;  4MDC A;  2YN1 A;  2HSY A;  4XRA A;  4GTU A;  4NAX A;  1JLV A;  3C1R A;  3IAS 2;  2B7K A;  3ED3 A;  5ABR A;  2PWJ A;  2PN8 A;  3APQ A;  2H70 A;  3ZZX A;  2LKU A;  4IJ3 A;  4MF7 A;  1TU8 A;  5ECP B;  2FWH A;  2CX3 A;  2V1M A;  3ZLP A;  1FOH A;  1XWA A;  1TW9 A;  4MMM A;  1M9A A;  3P2A A;  4V1A g;  1JZW A;  3L9U A;  3HZ4 A;  5IO2 A;  1OKT A;  16GS A;  3ME7 A;  3EMX A;  2FWG A;  4BPY A;  2F3M A;  5CRD A;  2CVD A;  3R2Q A;  2CZ2 A;  5GSS A;  2X8H A;  4ZBB A;  3EPT A;  2FA4 A;  1R5P A;  2CQ9 A;  2RUF A;  3LW9 A;  2H6X A;  3CTG A;  3LFL A;  1DE1 A;  4D73 A;  4NV2 A;  2JSY A;  3Q74 A;  4RUV A;  4USS A;  3QMX A;  1ON4 A;  4Z7X A;  5DAK B;  1GTU A;  4CDO A;  5C04 A;  1ST9 A;  1OE8 A;  5EL8 A;  3TCO A;  1FB0 A;  3FR3 A;  4ECB A;  1TK8 B;  2YZU A;  5JWQ B;  4AJ6 A;  2YJH A;  3I69 A;  2N5F A;  1A2L A;  5KN2 A;  3LSZ A;  4ECC A;  3KMO A;  4PX1 A;  4ZB9 A;  1MEK A;  1X5D A;  3UVH A;  1TRU A;  2L57 A;  1G6W A;  2E2G A;  3Q6O A;  1ZZY A;  3IK7 A;  2LST A;  5ECH B;  4BVY A;  3KH9 A;  3O76 A;  3IXR A;  2H30 A;  3FEU A;  1T7P B;  3GMF A;  5DJM A;  3U5R E;  1A24 A;  1QMV A;  1YZX A;  5AGY A;  3WYW A;  2YP6 A;  1AW9 A;  2MYG A;  2L5L A;  4G0L A;  1TXX A;  4RI6 A;  1G0T A;  1GSD A;  2HRA A;  3UAR A;  4K7I A;  3GSS A;  1PN9 A;  2MMA A;  4ULX A;  3SWL A;  3NOF A;  4EE0 A;  2DJJ A;  1XWB A;  3HJP A;  3RHC A;  2IL3 A;  3UBL A;  4FO5 A;  1AQV A;  2L59 A;  1MDJ A;  3ZFB A;  4NWY A;  4E8E A;  2LEG A;  2L4Q A;  4J57 E;  4ZB6 A;  3BD2 A;  4HJM A;  4HU9 A;  2HZE A;  3ZML A;  1XXU A;  3TKR A;  4HU7 A;  2C3Q A;  3KIJ A;  1ZYE A;  2C8U A;  1XW6 A;  2VUP A;  1PGT A;  1PL1 A;  1WP0 A;  2DJ0 A;  2HRN A;  4MJC A;  4K7O A;  2O8V B;  4JR4 A;  3P8W A;  3IE3 A;  2KUC A;  1Z6N A;  3FZ5 A;  4TXO A;  3TJJ A;  4GCI A;  2GZY A;  3TJG A;  4GRF A;  2HSH A;  4ICY A;  4O32 A;  1A2M A;  3VPT A;  4L0U A;  5DDL A;  3M0F A;  2KP1 A;  2GZZ A;  5AIS A;  3ERG A;  1I5G A;  2GLR A;  3U6V A;  1QQ2 A;  2EIR A;  2A2S A;  5D8I A;  3QR6 A;  1AC1 A;  1U3A A;  3IAM 2;  3L78 A;  1WJK A;  2R0P A;  2OE1 A;  2JZT A;  2DIZ A;  5HFG A;  2LS5 A;  2ZNM A;  1GH2 A;  4TN8 A;  1GTB A;  3D6I A;  4WF5 A;  2CVB A;  1MD3 A;  2RM6 A;  3A2W A;  5ELG A;  1NM3 A;  3DD3 A;  2IWT A;  4QL9 A;  2DJ1 A;  4PUR A;  3M9J A;  4K6X A;  2PPT A;  1EOG A;  3EU3 A;  4KF9 A;  2HE3 A;  2V6K A;  3E3E A;  2QA2 A;  4XHM A;  1W4V A;  2KHP A;  2MMZ A;  3G7J A;  4ML6 A;  2JL4 A;  2K6V A;  2VCZ A;  4F0C A;  1EWX A;  3F4S A;  3GKN A;  5CAX A;  2FWE A;  4Q5N A;  2H6Y A;  3ISO A;  1V98 A;  1VGL A;  5DVB A;  4HEA 2;  1SKS B;  2L4C A;  5ELA A;  2F9S A;  4PGT A;  1O7U A;  1ZYQ B;  3GTU B;  4Z2T A;  4EIP A;  1GUH A;  4ZL7 A;  4EO3 A;  1NHO A;  2CZ3 A;  1VRS D;  2B1K A;  3I9V 2;  3FK8 A;  4L8E A;  1PKZ A;  1R7H A;  2H75 A;  2R37 A;  4DEJ A;  2AV4 A;  3GYK A;  5F07 A;  1T3B A;  2PGT A;  4POL A;  3TKS A;  2HLS A;  4AF2 A;  5JCW A;  2BMX A;  4BL7 B;  1XOA A;  4N0Z A;  1PQN A;  4POK A;  4K0N A;  1Q98 A;  4MF6 A;  2B6M A;  3EC3 A;  5LCZ A;  20GS A;  5INY A;  1OAZ A;  1OC9 A;  3L0H A;  3TOU A;  4K2X A;  4GSN A;  4MZB A;  4OO4 A;  1ZCP A;  2DJK A;  3TJB A;  1GL8 A;  4ACS A;  2IPA A;  3EWL A;  1TDI A;  2QA1 A;  4TR3 A;  3DIE A;  3H79 A;  5CRH A;  3GST A;  3FZ4 A;  6GSY A;  3EUR A;  2J9H A;  4XS6 A;  1Z5Y E;  3GH9 A;  2CX4 A;  2YWI A;  1M9B A;  1SL1 B;  1GLQ A;  4GXZ A;  3GA4 A;  2LTK A;  2AHE A;  3ERW A;  4Z2U A;  1RK4 A;  2VD1 A;  3OR5 A;  4NHZ A;  4EUY A;  1YEX A;  2O87 A;  2OBK A;  3C1S A;  3J7Y k;  4ZIJ A;  3TOT A;  5A4W A;  1J08 A;  3PIN A;  4KSM A;  4PTS A;  2FY6 A;  1SEN A;  4RQX A;  1YJ6 A;  2VD0 A;  1G7O A;  5JWR B;  1XFL A;  4KX4 A;  1SJ6 A;  11GS A;  1G6Y A;  1JZO A;  5A4U A;  1TJD A;  4JR6 A;  4ZIL A;  1FG4 A;  3ZRE A;  2L5O A;  2H8L A;  4KDY A;  4K0G A;  2G2Q A;  4WF4 A;  2PU9 C;  3ERF A;  2DJ2 A;  1WPI A;  5G5F A;  4PNG A;  1PD2 1;  1XIY A;  5E4W A;  14GS A;  2B5X A;  4NXI A;  4EIQ A;  1S3C A;  4ILF A;  2H1A A;  3VWX A;  1OC8 A;  2B1L A;  1TRW A;  4OWY A;  2DML A;  2WJU A;  1M7T A;  3IPZ A;  3VWV A;  4JED A;  1K0A A;  1EOH A;  1IYI A;  5F8B A;  1YY7 A;  5A4V A;  5IOX A;  4IVF A;  1W89 A;  4ZL9 A;  1M2B A;  1B48 A;  2JAC A;  2PMT A;  1SL2 B;  3S9F A;  1EV4 A;  4ZL8 A;  2F51 A;  5G5E A;  2VLV A;  3P90 A;  4YKG A;  5H5R A;  2VAF A;  4EC0 A;  3A5W A;  4KSO A;  2MZC A;  1MDI A;  2M72 A;  4X1U A;  1ZMA A;  5DJL A;  3TKS C;  4L5O A;  3GKM A;  1JLW A;  4Q5Q A;  4TR4 A;  1FVK A;  3VLN A;  1M2A A;  5H5S A;  2DKH A;  4O7H A;  4YH2 A;  5HR2 A;  3D5J A;  4HZ4 A;  2KP2 A;  2YWO A;  2ON5 A;  2L6C A;  2TIR A;  2P5Q A;  4EVM A;  4OCF A;  3TGZ A;  2WB9 A;  6GSX A;  1SK1 A;  3VI7 A;  1F2E A;  5G30 A;  2GSQ A;  5AIV A;  4KW6 A;  1E2Y A;  1GLP A;  4J56 E;  3GTU A;  2IMF A;  5A5K A;  4XS4 A;  1HNB A;  1CQH A;  2V41 A;  4MJB A;  1WIK A;  3GL3 A;  2H73 A;  2X8G A;  5C00 A;  3A5I A;  4V1A p;  6GSS A;  3TRP A;  1GUK A;  1A0R P;  2L6D A;  1ZGN A;  3KJY A;  1BQ7 A;  1LJR A;  4PQH A;  4K8M A;  2MMN A;  4ECI A;  4GLT A;  5D73 A;  5D93 A;  3FYG A;  4BL7 A;  3GX0 A;  1GWC A;  3WGX A;  4V2L A;  4ZB8 A;  4LL4 B;  3ZL5 A;  3DVW A;  2VM1 A;  2C1Y A;  3MSZ A;  5CO3 A;  2HNL A;  1GNW A;  5DCH A;  5IMA A;  4OFM A;  5J41 A;  1PX7 A;  2OE0 A;  2H76 A;  3GKK A;  2XHF A;  1OC3 A;  2VIM A;  2LJA A;  1OE7 A;  3D4T A;  10GS A;  2CT6 A;  2DKI A;  2J23 A;  5IM9 A;  2IN3 A;  4GST A;  2LV3 A;  2PER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...