2MBTA

Nmr study of padsba
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
190
structure length
190
Chain Sequence
GDDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLESMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Fragment library screening identifies hits that bind to the non-catalytic surface of Pseudomonas aeruginosa DsbA1.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 52
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2013-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2mbtA00
2WS2A 3ZIJA 4F03A 4EXJA 2LRCA 1K0MA 1R5AA 3KH7A 4HQZA 2LUSA 2JZTA 3KCMA 2C8UA 1VGLA 4EVMA 2A4VA 2GSQA 3U6VA 2DSAA 5D9XA 1FAAA 3DGQA 4F0CA 5HR0A 4KDXA 1K3YA 3VFIA 3HJOA 4MMMA 1GTUA 2PWJA 1OE8A 1M2AA 2IPAA 2IMIA 1EEMA 3GFKA 4CHSA 3L9SA 2FNOA 1OVNA 2X8HA 4XS4A 2AUVA 3FHKA 1Q4JA 3NIVA 2MMAA 2VLTA 5LD0A 2HSYA 1PKZA 1PMTA 4OMVA 1SJ6A 4FYCA 6GSXA 5DJLA 3EC3A 1QUWA 2LEGA 3RHCA 1DE1A 2HI7A 5D9TA 6GSVA 1TRUA 3VK9A 4IELA 4XS1A 1WRYA 3ME7A 2CQ9A 2DJ3A 1WMJA 2VL2C 1Z5YE 2H1GA 1JLVA 4QL7A 2KUCA 1CQHA 5IO0A 1PQNA 4POLA 1TRWA 4K6XA 2CT6A 3HDCA 5ELAA 5DJMA 2PPTA 4AJ7A 2WJUA 2YOIA 3EINA 5L71A 4PUFC 4MA9A 1J9BA 1AQVA 5DALB 2RUFA 1UN2A 3DD3A 3GA4A 1TXXA 2C3TA 5ECQB 3DWVA 1XW5A 2REMA 4JBBA 1ZCPA 4OO5A 2OACA 3KTBA 3P2AA 3HJMA 2GGTA 3GN3A 1THXA 3F6FA 2EIQA 4TR0A 2YWMA 1SK0A 5KEJA 5LNKe 1EOHA 2EIRA 3I6AA 4KNDA 1NW2A 4XTSA 1GSDA 1Z6MA 3KMOA 4GSTA 3MDKA 4V1Ap 1EV9A 2R37A 5ELGA 2BJXA 3I69A 1T4YA 1B9YC 4YAPA 1T7PB 1JZDA 1PD21 2YCDA 1ST9A 3UEMA 3TOTA 2IL3A 2VIMA 1OE7A 5CRGA 4HOJA 4WF4A 1AXDA 3KP9A 3M0FA 3G7JA 3TJGA 1MDKA 2NTOA 2G0FA 2HNLA 1PL1A 2O7KA 1B48A 3KIJA 2VM2A 3ERWA 4K7OA 3TB2A 4D73A 2OKAA 3KMNA 1AQWA 4GQFA 4ZB6A 6GSSA 1JZRA 1EOGA 5IMDA 4K9ZA 1GULA 2MMOA 4KCAA 3M3MA 1TOFA 2HZEB 3UVHA 1YKCA 3FKFA 5COHA 5CNWA 5CRWA 3C1SA 5HR1A 4EUYA 5GSSA 2I81A 4J57E 5A4UA 5ECPB 1NHOA 2VO4A 1GSQA 2GQKA 2PBJA 1XCCA 1A24A 3IAS2 2HSHA 5EY6A 3C1RA 5EVOA 4E8EA 1SKRB 3TJKA 3D21A 1T3BA 2WDUA 5E4WA 5EPFA 4NHZA 2NPBA 1WP0A 2C3QA 2HE3A 1ERTA 5CP1A 3VURA 3J7Yb 4EF0A 2P5RA 2L6DA 2LJKA 4ECIA 2D2ZA 3EMPA 2DMMA 3CRUA 4OCFA 5G1LA 3EWLA 5ECIB 3Q74A 3WT1A 1EGOA 2OE1A 5JWQB 4X43A 2F51A 5AN1A 4WBRD 2PVQA 5H5RA 2IFQB 3OR5A 2IMFA 4EE0A 4ECBA 2RIIA 3APOA 2GS3A 2H0IA 4HU9A 5J41A 2B7JA 3ZYWA 5ID2A 2FLSA 4OWYA 4G19A 1DBYA 3FZAA 1TDIA 3RHBA 4Q5RA 3DEXA 4JEDA 1M9AA 5AIVA 2EIOA 3ZFBA 3QDNA 6GSTA 1FG4A 1VRSD 2O87A 1A0FA 1Y6EA 3GTUB 3UL3A 2LKUA 1I5GA 5H5QA 5D96A 20GSA 1A2MA 3BOAA 3F9UA 4BVYA 1YEPA 2NBSA 4MK3A 3UMAA 3L9VA 4IJIA 2OE3A 3F0IA 2I3YA 2TRXA 5IOWA 2V1MA 1F9MA 4HEA2 4POBA 4DSSA 5HFIA 5IMCA 2GDRA 2I1UA 4MJEA 1YJ6A 2C3NA 2RUEA 3A2WA 2JL4A 2FD3A 3ZTLA 3H79A 1LBKA 3UAPA 5ECMB 2P31A 1GLQA 3AY8A 3IBHA 3ZIVA 3LEFA 3BCIA 3GSTA 2V41A 3TKQA 4NV5A 9GSSA 4MF7A 1M99A 3A3TA 2H74A 4GRFA 5IMAA 4NWYA 2E2GA 2J9HA 3VLNA 3US3A 1TJDA 3GNJA 4TKYA 3KTLA 2AHEA 3NZNA 4TVEA 3F3QA 2YJHA 4Q5NA 3TJJA 2ZUPA 2FWGA 2XPEA 4ZBAA 3W6GA 3GH6A 4IHUA 3APQA 3EVIA 4MH3A 2MBSA 3KGKA 2R6KA 3SWLA 4DEJA 2JZRA 3O76A 3GKXA 4MABA 3TKSC 4IQAA 5A4WA 3TKSA 3VPQA 4KDYA 2XHFA 3KEBA 2XBQA 1WOUA 3FW2A 1GUHA 1R4WA 4HQSA 3ZREA 3FR9A 3RBTA 3L0HA 5JWOB 3P90A 1NHYA 2GT6A 4IP6A 3IXRA 3GL3A 4HZ4A 1MDIA 2GVPA 3IV4A 3DRNA 3F3RA 5GSTA 3F4RA 4IW9A 1TKDB 1SYXA 2MYGA 1M2BA 4TXOA 1SD9A 2G2QA 1URMA 2GZPA 3Q6OA 1LJRA 5F07A 1F2EA 1B8XA 2OA7A 3W8JA 3DKSA 1PKWA 2GSTA 4BWQA 2R5GA 5IM9A 4HU7A 1Z6NA 4PX1A 4PQIA 3VWVA 4MJBA 1NSWA 3TOUA 2CZ2A 2ZNMA 4IVFA 4ZBDA 2AJQB 1KTEA 1VF4A 3U5RE 3PINA 1M2DA 1Z9HA 3TKSE 1O73A 2JZSA 1A8LA 1XW9A 1O85A 2JSYA 5ABRA 2K8SA 4TR4A 1IYIA 1W89A 3FZ9A 1M0UA 2L6CA 3C73A 3R2QA 4N0VA 5CRDA 4F9ZA 2CAQA 2QGVA 3FK8A 3ZLPA 1GNWA 5JWRB 3ZRDA 2H8LA 1WJKA 2R4VA 4LL4B 5DCGA 5JCGA 1AW9A 2KLXA 3D5JA 1SENA 1T8EB 4FIWA 5IPHA 5AGYA 1MTCA 4ZIJA 4WKWA 3GX0A 1QQ2A 1GP1A 2RM6A 4IJ3A 2CZ3A 2DJ0A 2GSRA 5KN3A 1WIKA 3HXSA 4F0BA 1PL2A 1ERWA 4ZXGA 4WEYA 3QCPA 5KN1A 5GAPD 4OD7A 2E7PA 2VL3A 3MNGA 4HJMA 1TU8A 2ES7A 5KN2A 3GMFA 3F63A 4GQCA 2L57A 4IS0A 3GV1A 3LGCA 4LMWA 2HYXA 4AJ6A 4KGIA 3TUEA 1XWCA 2J23A 1KBNA 5D8IA 2L59A 4ZL9A 1OYJA 3IDVA 1U3AA 3VWWA 4LA1A 1O8XA 1TK0B 1R5PA 4KW6A 2I4AA 2BMXA 2LNTA 2PMTA 4O5RA 3N5OA 3K8NA 1SK2A 1YF0A 3QAWA 2H72A 3EU4A 1T00A 2GZYA 3QOUA 1BJXA 4DVCA 2DIZA 5IMVA 2LQQA 1ZYQB 3WGXA 2OJLA 1Z7RA 5D93A 2IMKA 10GSA 4MJCA 4I97A 2VOCA 4WXTA 2F8FA 4TR3A 2FA8A 3GKMA 4IQ1A 3VI7A 2H76A 4IKHA 1ABAA 1TRSA 2GZZA 4YQMA 2H1BA 3UBLA 1SK1A 2CVDA 4F2IA 3LXZA 3TJBA 4GCIA 1EWXA 2LQOA 4KE3A 2ZCTA 1UC7A 4MZWA 1R7HA 3UVTA 1XWBA 2FA4A 2LRTA 5EL8A 1XWAA 3QMXA 1XBSA 1YKAA 3BJ5A 3GKKA 4N11A 2B5XA 5IMFA 3RAZA 4FYUA 2H0GA 4MJAA 1V2AA 2ON5A 2DIYA 4WF5A 5IPGA 3DVXA 1K3LA 3GH9A 2F9SA 3J7Yk 1AIUA 3E0UA 2FGXA 4KCEA 5J5NA 1TP9A 2FY6A 2O89A 1VF2A 2RLIA 2NVLA 3DVWA 1FO5A 1OAZA 1ERUA 2VCQA 3CTFA 3HKRA 4ZB8A 3CTGA 4EDZA 3I43A 3EMXA 2VD0A 4BVXA 5G5FA 3G7YA 2LJAA 1EZKA 2WRTA 2HZEA 2DBCA 4PURA 3GHAA 4JR4A 2R3XA 5IQYA 4JE1A 1DSBA 3KJYA 5H5SA 1ACVA 2B1KA 2E2MA 2FWEA 3HY2A 1SU9A 3TGZA 1BYEA 5ECKB 4NMUA 2AB6A 5F0GA 1X9SB 4I2TA 2CVKA 4ML6A 2GSSA 4N0ZA 1GNEA 2B5YA 4ZB9A 1QK8A 2H6YA 1OC9B 4JZQA 4ACSA 1EP8A 1JZOA 2YP6A 2M46A 1V9WA 1BAYA 4EDYA 3UIWA 3L4NA 5FWGA 2C0DA 1YF1A 1HQOA 4Q5FA 4K7NA 2H1DA 3EE2A 3MAKA 2H6ZA 4Q5QA 2DC5A 4K0NA 2C4JA 2TRCP 2DMLA 2MMNA 4MCUA 1SL1B 4V2MA 4EC0A 2GQMA 4AF2A 1PRXA 4PQHA 3WYWA 2EC4A 4H86A 4KA0A 2IFQA 1DUGA 6GSUA 1MDJA 1XVQA 2LJRA 2C1YA 3P7XA 1A0RP 5J3RA 2C80A 3TCOA 2LSTA 4G9HA 3G7IA 4V2NA 2A2RA 1RW1A 1QGVA 3VWXA 2VCZA 1T1VA 1SL0B 6GSWA 1K0BA 1XIYA 1UVZA 2QSIA 3PH9A 4FO5A 3M9JA 1JFUA 5KN0A 1BG5A 4IBPA 3ZVJD 4KB3A 5C04A 3VWUA 1R26A 4J2FA 2V2GA 1A23A 3KH9A 3ZITA 3TDGA 1JLWA 5F05A 4KUNA 5A5KA 16GSA 3ED3A 1GSSA 12GSA 5F06A 4AGSA 3UOMA 5B7CA 3TRPA 1Z3EA 4TR1B 2YZUA 3BBYA 1V57A 4K2DA 3QPMA 3UJ1A 2CX3A 3GRXA 2FCHA 1J08A 3EYTA 3I9V2 3E9JB 3LXTA 3CMIA 5DAKB 5B6NA 3LWAA 4YQVA 2AAWA 4MF5A 3TJFA 5ECNB 1GSEA 2HZFA 4G2EA 3GIXA 2P5QA 3M1GA 3APSA 1S3CA 2HT9A 4YAVA 4DSQA 4YH2A 2ALBA 4NV2A 1CQGA 3FY7A 2KHPA 4OFMA 1QXHA 1EEJA 1Q98A 5FHIA 4EL1A 1EGRA 2K9FA 3GSSA 5E59A 3HCZA 3RDWA 4POKA 3TRQA 2HFDA 2VCVA 5G5EA 2OBKA 3V1WA 1GUKA 2IIYA 2IMEA 4O7HA 3ZMLA 4KX4A 2FUG2 2IN3A 2YJ7A 3PGTA 1HNCA 1PN9A 3N9JA 5J9BA 4POMA 4GSSA 5CO3A 4MH2A 2VM1A 4QL9A 1O8WA 3LORA 5GZZB 2HXKA 4ZL8A 4PUAA 1XWKA 1OKTA 3H4KA 4X1UA 2L5LA 2FHEA 3D4MA 2H71A 2PN8A 1HYUA 7GSSA 2CA8A 3RPPA 3O3TA 2N5FA 2MMZA 2GTUA 1K0AA 4ID0A 2HLSA 3D22A 5G31A 1JHBA 2VCWA 3WT2A 2GQLA 1QMVA 2H73A 2OE0A 1XW6A 1SD8A 5C00A 5CRHA 1JZWA 2M80A 2F3MA 3IR4A 4P3YB 1WWJA 1XXUA 4FH8A 4G10A 1XZOA 1B4PA 5ECSA 1AC1A 3L78A 5AIXA 2B1LA 4MF6A 2H0HA 1FVKA 1ZZYA 4GF0A 4MZBA 4OFTA 2LV3A 2FWHA 1OC3A 3QAVA 3KZQA 3HZ8A 4L5LA 2KP2A 1SJIA 2MBTA 2QC7A 1LU4A 2L5OA 3LYPA 3MWHA 5HQPA 5JCUA 4KDUA 2CX4A 2WULA 2FWFA 4HS1A 4MLYA 3IAM2 5INYA 2O8VB 3CSHA 1SKWB 1FVJA 2RM5A 1WE0A 3F6DA 3HA9A 2H01A 3C8EA 4E8HA 4ZL7A 4XRAA 1FW1A 1ZOFA 1X5DA 4RUVA 4HUAA 2YNXA 11GSA 3TKPA 4O32A 1GUMA 3BD2A 1A8YA 1ML6A 1ON4A 4DSRA 2KP1A 3E3EA 3G9BA 1PA3A 4ILFA 2V32A 2X8GA 1GTBA 3WGEA 3F4TA 2PVOC 1PSQA 1TRVA 1XOAA 4HZ2A 3P8WA 1GSYA 4XCSA 2M72A 4XS4B 4I8BA 3A2VA 4ECJA 1EV4A 4N10A 2QKEA 18GSA 4NHWA 5DBQA 2B7KA 2R2JA 1NM3A 1PX6A 2VLVA 3LSZA 1HNAA 2N5BA 3KM6A 1V40A 4RQRA 4EKZA 3M9KA 1S3DA 1AUCA 4CDOA 2DJKA 5CAXA 1N8JA 3HVSA 3IHQA 3D6IA 3KXOA 1QFNA 2PU9C 3IK9A 1H75A 3FR6A 14GSA 2B5EA 8GSSA 1BQ7A 4TN8A 1TK8B 3CBUA 4LMVA 2WGRA 1ILOA 3VI5A 2C0EA 1WPIA 4CW9A 1MEKA 3GL5A 2VL2A 3QAGA 4ISDA 1X5CA 3QR6A 1B9XC 4LL1B 4ZBBA 19GSA 2KOKA 5AISA 2OADA 1FB0A 4V2LA 1TI3A 2YN1A 1F3BA 4WETA 5HR2A 3S9FA 5DALA 1W4VA 2YANA 1TW9A 4JU5A 3DIEA 4K1FA 2C0FA 2VLUA 2YWIA 2VAFA 3GYKA 1ZYEA 22GSA 4PXOA 3ZMKA 4ECCA 1E6BA 3JCML 1BEDA 5G30A 2PGTA 1Z7PA 2DLXA 2H75A 3GX8A 3EURA 1TU7A 4PQ1A 1F37A 3Q19A 1YDKA 3O6TA 3HZ4A 2GT5A 1RK4A 1U3IA 3VPTA 4N30A 2X64A 3UARA 2H66A 1IYHA 2JU5A 1YZXA 4O92A 1PX7A 4I2UA 1K0DA 5HR3A 4D73B 3RPNA 1RQMA 1X0RA 3FZ5A 2Z9SA 2WB9A 4HJ2A 3WGDA 5G2ZA 4RI6A 4QQ7A 1XOBA 3ME8A 3ZFLA 2WCIA 5B8BA 3H8QA 3MSZA 2H6XA 3BCKA 5ECRB 1DE2A 1TI1A 3C71A 5D73A 3LG6A 2A2SA 4WBJA 2VUPA 2F8AA 1H4OA 1XFLA 1MD3A 4KSMA 1U87A 3L9UA 2WZ9A 2DJ2A 5ECHB 2AYTA 1XWGA 3ISOA 1YEXA 5GAND 1Y25A 1KNGA 2H19A 1K3OA 3PR8A 1GSUA 3SBCA 5B8AA 3HYPA 1SYRA 1AQXA 1G7EA 3IE3A 3CXGA 2VCTA 3IA1A 2B3SA 2IMDA 17GSA 1OC9A 4XRDA 2L4QA 3HHVA 4I5QA 3IC4A 3HD5A 2LRNA 3CSIA 5ECOB 1MD4A 4TRXA 4XS6A 2V6OA 2GLRA 1YQ1A 1G7OA 4WR4A 1HNBA 4NAXA 2CAIA 3FYGA 1UA5A 1OKDA 1USBA 2PERA 3TRXA 3Q18A 5ID2B 1GRXA 1F6MC 1BX9A 4MP4A 5J9CA 3FZ4A 4RI7A 4XHMA 2CV4A 3UBKA 3DXBA 5IOXA 3LFLA 4Z7XA 3QFAC 1ZGNA 2BTOT 3ZVJA 1G6WA 5DVBA 2YWNA 2YV9A 4MZCA 3LYKA 4BA7A 2X8CA 2HRNA 1YY7A 3LQ7A 1GTIA 2E0QA 4NPBA 1I9DA 2XC2A 1GLPA 1KEBA 5J4UA 2OBIA 5G1KA 3F8UA 5F8BA 4L0WA 1J0FA 2NDOA 3GTUA 2WFCA 1EP7A 1GWCA 2N5AA 1SJZA 1TK5B 2X99A 2IJYA 5DQSA 3ERGA 5B6MA 3EU3A 4ZILA 4DSSB 3GKNA 4ULXA 4KH7A 3GUSA 1O6JA 2ON7A 5A4VA 2I9HA 3LJRA 5FT3A 4TR1A 1FHEA 2H70A 3DYRA 5LCZA 1K0OA 3A2XA 2AV4A 1N2AA 4EO3A 2V6KA 1V98A 5DAKA 4PNGA 1M9BA 1F3AA 2H1AA 5DDLA 3H1NA 1HD2A 2YV7A 2K6VA 5D9VA 1GTAA 1SL2B 4HDEA 2IWTA 2TIRA 4PNFA 2PUKC 3FEUA 1AAZA 4IP1A 4KSOA 2YPMA 4GLTA 2P0GA 4ML1A 3A5WA 2CVBA 3F4SA 1X5EA 2MZCA 4GWRA 1E2YA 5IMZA 3W8SA 2VD1A 1U88A 3H93A 3IRAA 4L0UA 4HI7A 4JRRA 3FR3A 3IOSA 2XPDA 3ERFA 1A2LA 3ZL5A 4XIHA 3HVVA 3D0ZA 1V58A 4GSNA 4LLRA 4TXVA 3IPZA 5CYYA 4L8EA 1U6TA 1XVWA 2YWOA 3KD0A 2YZHA 3GURA 4X0XA 4IN0A 1GH2A 4PGTA 5DCHA 2DJJA 2JSZA 4OCEA 4BWSA 4GXZA 13GSA 4JR6A 2O85A 1S3AA 4TOPA 1TTZA 4FYBA 3IK7A 4AJ8A 2K18A 1G0TA 2K8VA 5HFKA 3QFBC 4MDCA 3NOFA 4TXOB 2VL9A 3C7MA 1G6YA 4BL7A 5IIZA 4TW5A 5D9WA 2XBIA 2LS5A 1VF3A 1ZL9A 4V1Ag 4K7IA 4I6XA 1THOA 4F82A 1VF1A 4L5OA 3KP8A 5ENUA 4MPFA 2B6MA 1K0NA 1O7UA 4K0GA 3TKRA 3D4TA 2LTKA 2VCXA 4KAEA 1GSFA 1PGTA 1FB6A 1ZMAA 1A2JA 3HJPA 6GSYA 1X9WB 5JCWA 1OC8A 1ERVA 4K8MA 2L4CA 1K0CA 2JADA 4MPGA 3FRCA 2C0GA 4OO4A 4J56E 1SKSB 1XPVA 2H30A 3M8NA 3HVXA 3DMLA 5ECLB 3WD6A 1X9MB 4OFNA 3ZZXA 5IO2A 5DQYA 3CRTA 1O81A 2HRFA 2JACA 1B4QA 4BPYA 2LNSA 4IGJA 3CSJA 4RQXA 1FOVA 4NXIA 5CREA 1C72A 2DJ1A 4GTUA 3CYNA 5HFGA 4YQUA 4WR5A 1GL8A 1M7TA 1T4ZA 3QD9A
chains in the Genus database with same CATH superfamily
2WS2A 3ZIJA 4F03A 4EXJA 2LRCA 1K0MA 1R5AA 2QA2A 4CY8A 3KH7A 4HQZA 2LUSA 2JZTA 3KCMA 2C8UA 1VGLA 4EVMA 2A4VA 2GSQA 3U6VA 2DSAA 5D9XA 1ZYPA 1FAAA 3DGQA 4F0CA 5HR0A 4KDXA 1K3YA 4USSA 3HJOA 3VFIA 4MMMA 1GTUA 2PWJA 1OE8A 1M2AA 2IPAA 2IMIA 1EEMA 3GFKA 4CHSA 3L9SA 2FNOA 1OVNA 2X8HA 4XS4A 2AUVA 3FHKA 1Q4JA 3NIVA 2MMAA 4MNNA 2VLTA 5LD0A 2HSYA 1PKZA 1PMTA 4OMVA 1SJ6A 4FYCA 6GSXA 1M3IA 5DJLA 3EC3A 1QUWA 2LEGA 3RHCA 1DE1A 2HI7A 5D9TA 3FMWA 6GSVA 1TRUA 3VK9A 4IELA 4XS1A 1WRYA 3ME7A 2CQ9A 2DJ3A 1WMJA 2VL2C 1Z5YE 2H1GA 1JLVA 4QL7A 2KUCA 1CQHA 5IO0A 1PQNA 4POLA 1TRWA 4K6XA 2CT6A 3HDCA 5ELAA 5DJMA 4EIPA 2PPTA 4AJ7A 2WJUA 2YOIA 3EINA 5L71A 4PUFC 4MA9A 1J9BA 1AQVA 5DALB 2RUFA 1UN2A 3DD3A 3GA4A 1TXXA 2C3TA 5ECQB 3DWVA 1XW5A 2REMA 4JBBA 1ZCPA 4OO5A 2OACA 3KTBA 3P2AA 3HJMA 2GGTA 4KF9A 1FOHA 3GN3A 1THXA 3F6FA 2EIQA 4TR0A 2YWMA 1SK0A 5KEJA 5LNKe 1EOHA 2EIRA 3I6AA 4KNDA 1NW2A 4XTSA 1GSDA 1Z6MA 3KMOA 4GSTA 3MDKA 4V1Ap 2A2PA 1EV9A 2R37A 5ELGA 2BJXA 3I69A 1T4YA 1B9YC 4YAPA 1T7PB 1JZDA 1PD21 2YCDA 1ST9A 3UEMA 3PPUA 3TOTA 2IL3A 2VIMA 1OE7A 5CRGA 4HOJA 4WF4A 1AXDA 3KP9A 3M0FA 3G7JA 3TJGA 1MDKA 2NTOA 2G0FA 2HNLA 1PL1A 2O7KA 1B48A 3KIJA 2VM2A 3ERWA 4K7OA 3TB2A 4D73A 2OKAA 3KMNA 1AQWA 4GQFA 4ZB6A 6GSSA 1JZRA 1EOGA 5IMDA 4K9ZA 4BVXB 1GULA 2MMOA 4KCAA 3M3MA 1TOFA 2HZEB 3UVHA 1YKCA 3FKFA 3IHGA 5COHA 5CNWA 5CRWA 3C1SA 5HR1A 4EUYA 5GSSA 2I81A 4J57E 5A4UA 5ECPB 5BMUA 1NHOA 2VO4A 1GSQA 2GQKA 2PBJA 1XCCA 1A24A 3IAS2 2HSHA 5EY6A 3C1RA 5EVOA 4YKFA 4E8EA 1SKRB 3TJKA 3D21A 1T3BA 2WDUA 5E4WA 5EPFA 4NHZA 2NPBA 1WP0A 2C3QA 2HE3A 1ERTA 5CP1A 3VURA 3J7Yb 4EF0A 2P5RA 2L6DA 2LJKA 4O5UA 4ECIA 2D2ZA 3MYDA 3EMPA 2DMMA 3CRUA 4OCFA 5G1LA 3EWLA 5ECIB 3Q74A 3WT1A 1EGOA 5BRTA 2OE1A 5JWQB 4X43A 2F51A 5AN1A 4WBRD 2PVQA 5H5RA 2IFQB 3OR5A 2IMFA 4EE0A 4ECBA 2RIIA 3APOA 2GS3A 2H0IA 4HU9A 5J41A 2B7JA 3ZYWA 1XG8A 5ID2A 2FLSA 4OWYA 4G19A 1DBYA 3FZAA 3CQFA 1TDIA 3RHBA 4Q5RA 3DEXA 4G0LA 4JEDA 1M9AA 5AIVA 2EIOA 3ZFBA 3QDNA 6GSTA 1FG4A 1VRSD 2O87A 1A0FA 1Y6EA 3GTUB 3UL3A 2LKUA 1I5GA 5H5QA 5D96A 20GSA 1A2MA 3BOAA 3F9UA 4BVYA 1YEPA 2NBSA 4MK3A 3UMAA 3L9VA 4IJIA 2OE3A 3F0IA 2I3YA 2TRXA 5IOWA 2V1MA 1F9MA 4HEA2 4POBA 4DSSA 5HFIA 5IMCA 2GDRA 2I1UA 4MJEA 1YJ6A 2C3NA 4ICYA 2RUEA 3A2WA 2JL4A 2FD3A 3ZTLA 3H79A 1LBKA 3UAPA 5ECMB 2P31A 1PFOA 1GLQA 3AY8A 3IBHA 3ZIVA 3LEFA 3BCIA 3GSTA 2V41A 3TKQA 4NV5A 9GSSA 4MF7A 1M99A 3A3TA 2H74A 4GRFA 5IMAA 4NWYA 2E2GA 2J9HA 3VLNA 3US3A 1TJDA 3GNJA 4TKYA 3KTLA 2AHEA 3NZNA 4TVEA 3F3QA 2YJHA 4Q5NA 3TJJA 2ZUPA 2FWGA 2XPEA 4ZBAA 3W6GA 3GH6A 4IHUA 3APQA 3EVIA 4MH3A 2MBSA 3KGKA 2R6KA 3SWLA 4DEJA 2JZRA 3O76A 3GKXA 4MABA 3TKSC 4IQAA 5A4WA 3TKSA 3VPQA 4KDYA 2XHFA 3KEBA 2XBQA 1WOUA 3FW2A 1GUHA 1R4WA 4HQSA 3ZREA 4Z2UA 3FR9A 3RBTA 4K5RA 3L0HA 5JWOB 1ZYNA 3P90A 1NHYA 2X4AA 2GT6A 4IP6A 3IXRA 3GL3A 4HZ4A 1MDIA 2GVPA 3IV4A 3DRNA 3F3RA 5GSTA 3F4RA 4IW9A 1TKDB 1SYXA 2MYGA 1M2BA 4Z2RA 4TXOA 1SD9A 2G2QA 1URMA 2GZPA 3Q6OA 1LJRA 5F07A 1F2EA 1B8XA 2OA7A 3W8JA 3DKSA 1PKWA 2GSTA 4BWQA 2R5GA 4X4JA 5IM9A 4HU7A 1Z6NA 2HSMA 4PX1A 4PQIA 3VWVA 4MJBA 1NSWA 3TOUA 4Z2TA 2CZ2A 2ZNMA 4IVFA 4ZBDA 2AJQB 1KTEA 2UZ8A 1VF4A 3U5RE 3PINA 1M2DA 1Z9HA 3TKSE 1O73A 2JZSA 1A8LA 1XW9A 1O85A 2JSYA 5ABRA 2K8SA 4TR4A 1IYIA 1W89A 3FZ9A 1M0UA 2L6CA 3C73A 3R2QA 4N0VA 5CRDA 4F9ZA 2CAQA 2QGVA 3FK8A 3ZLPA 1GNWA 5JWRB 3ZRDA 2H8LA 1WJKA 2R4VA 2R0PA 4LL4B 5DCGA 5JCGA 1AW9A 2KLXA 3D5JA 1SENA 1T8EB 4FIWA 5IPHA 2A4HA 5AGYA 1MTCA 4ZIJA 4WKWA 3GX0A 1QQ2A 1GP1A 2RM6A 4IJ3A 2CZ3A 2DJ0A 2GSRA 5KN3A 1WIKA 3HXSA 4F0BA 1PL2A 1ERWA 4ZXGA 4WEYA 3QCPA 5KN1A 5GAPD 4OD7A 2E7PA 2VL3A 3MNGA 4HJMA 1TU8A 2ES7A 5KN2A 3GMFA 3F63A 4GQCA 2L57A 4IS0A 3GV1A 3LGCA 4LMWA 2HYXA 4AJ6A 4KGIA 3TUEA 1XWCA 2J23A 1KBNA 5D8IA 2L59A 4ZL9A 1OYJA 3IDVA 1U3AA 3VWWA 4LA1A 1O8XA 1TK0B 1R5PA 4KW6A 2I4AA 2BMXA 2LNTA 2PMTA 4O5RA 3N5OA 3K8NA 1SK2A 1YF0A 3QAWA 2H72A 3EU4A 1T00A 2GZYA 3QOUA 1BJXA 4DVCA 2DIZA 5IMVA 2LQQA 1ZYQB 3WGXA 2OJLA 1Z7RA 5D93A 2IMKA 10GSA 4MJCA 4I97A 2VOCA 4WXTA 2F8FA 4TR3A 2FA8A 3GKMA 4IQ1A 3VI7A 2H76A 4IKHA 1ABAA 1TRSA 4YKGA 2GZZA 4YQMA 2HRAA 2H1BA 3UBLA 1SK1A 2CVDA 4F2IA 3LXZA 3TJBA 4GCIA 1EWXA 2LQOA 4KE3A 2ZCTA 1UC7A 4MZWA 1R7HA 3UVTA 1XWBA 2FA4A 2LRTA 5EL8A 1XWAA 3QMXA 1XBSA 1YKAA 3BJ5A 3GKKA 2QA1A 4N11A 2B5XA 5IMFA 3RAZA 4FYUA 2H0GA 4MJAA 1V2AA 2ON5A 2DIYA 4WF5A 5IPGA 3DVXA 1K3LA 3GH9A 2F9SA 3J7Yk 1AIUA 3MIXA 3E0UA 2FGXA 4KCEA 5J5NA 1TP9A 2FY6A 2O89A 1VF2A 2RLIA 2NVLA 3DVWA 1FO5A 1OAZA 3HVNA 1ERUA 2VCQA 3CTFA 1M3JA 3HKRA 4ZB8A 3CTGA 4EDZA 3I43A 3EMXA 2VD0A 4BVXA 5G5FA 3G7YA 2LJAA 1EZKA 2WRTA 2HZEA 2DBCA 4PURA 3GHAA 4JR4A 2R3XA 5IQYA 4JE1A 1DSBA 3KJYA 5H5SA 1ACVA 2B1KA 2E2MA 2FWEA 3HY2A 1SU9A 3TGZA 1BYEA 5ECKB 4NMUA 2AB6A 5F0GA 1X9SB 4I2TA 2CVKA 4ML6A 2GSSA 4N0ZA 1GNEA 2B5YA 4ZB9A 1QK8A 2H6YA 1OC9B 4JZQA 4ACSA 4FQUA 1EP8A 1JZOA 2YP6A 2M46A 1V9WA 1BAYA 4EDYA 3UIWA 3L4NA 5FWGA 2C0DA 1YF1A 1HQOA 4Q5FA 4K7NA 2H1DA 3EE2A 3MAKA 2H6ZA 4Q5QA 2DC5A 4K0NA 2C4JA 2TRCP 2DMLA 2MMNA 4MCUA 4A5PA 4V2MA 1SL1B 4EC0A 2GQMA 4AF2A 2DKIA 1PRXA 4PQHA 3WYWA 2EC4A 4H86A 4KA0A 2IFQA 1DUGA 6GSUA 1MDJA 1XVQA 2LJRA 2C1YA 3P7XA 1A0RP 5J3RA 2C80A 3TCOA 2LSTA 4G9HA 3G7IA 4V2NA 2A2RA 1RW1A 1QGVA 3VWXA 2VCZA 1T1VA 1SL0B 6GSWA 1K0BA 1XIYA 1UVZA 2QSIA 3PH9A 4FO5A 3M9JA 1JFUA 5KN0A 1BG5A 4IBPA 3ZVJD 4KB3A 5C04A 3VWUA 1R26A 4J2FA 2V2GA 1A23A 3KH9A 4BVYB 3ZITA 3TDGA 1JLWA 5F05A 4KUNA 5A5KA 16GSA 3ED3A 1GSSA 12GSA 5F06A 4AGSA 3UOMA 5B7CA 3TRPA 1Z3EA 4TR1B 2YZUA 3BBYA 1V57A 4K2DA 3QPMA 3UJ1A 2CX3A 3GRXA 4HSCX 2FCHA 1J08A 3EYTA 3I9V2 3E9JB 3LXTA 3CMIA 5DAKB 5B6NA 3LWAA 4YQVA 2AAWA 4MF5A 3TJFA 5ECNB 1GSEA 2HZFA 4G2EA 3GIXA 2P5QA 3M1GA 3APSA 1S3CA 2HT9A 4YAVA 4CY6A 4DSQA 4YH2A 2ALBA 4NV2A 1CQGA 3FY7A 2KHPA 4OFMA 1QXHA 1EEJA 1Q98A 5FHIA 4EL1A 3IC8A 1EGRA 2K9FA 3GSSA 5E59A 3HCZA 3RDWA 4POKA 3TRQA 2HFDA 2VCVA 5G5EA 2OBKA 3V1WA 1GUKA 2IIYA 2IMEA 4O7HA 3ZMLA 4KX4A 2FUG2 2IN3A 2YJ7A 3PGTA 1HNCA 1PN9A 3N9JA 5J9BA 4EIQA 4POMA 4GSSA 5CO3A 4MH2A 2VM1A 4QL9A 1O8WA 3LORA 5GZZB 2HXKA 4ZL8A 4PUAA 1XWKA 1OKTA 3H4KA 4X1UA 2L5LA 2R0GA 2FHEA 3D4MA 4O5QA 2H71A 2PN8A 1HYUA 7GSSA 2CA8A 3RPPA 3O3TA 2N5FA 2MMZA 2GTUA 1K0AA 4ID0A 4BL7B 2HLSA 3D22A 5G31A 1JHBA 2VCWA 3WT2A 2GQLA 1QMVA 2H73A 2OE0A 1XW6A 1SD8A 5C00A 5CRHA 1JZWA 2M80A 2F3MA 3IR4A 4P3YB 1WWJA 1XXUA 4FH8A 4G10A 1XZOA 1B4PA 5ECSA 1AC1A 3L78A 5AIXA 2B1LA 4MF6A 2H0HA 1FVKA 1ZZYA 4GF0A 4MZBA 4OFTA 2LV3A 2FWHA 1OC3A 3QAVA 3KZQA 3HZ8A 4L5LA 2KP2A 1SJIA 2MBTA 2QC7A 1LU4A 2L5OA 3LYPA 3MWHA 5HQPA 5JCUA 4KDUA 2CX4A 2WULA 2FWFA 4HS1A 4MLYA 3IAM2 5INYA 2O8VB 4G0KA 3CSHA 1SKWB 1FVJA 2RM5A 1WE0A 3F6DA 3HA9A 2H01A 3C8EA 4E8HA 4ZL7A 4XRAA 1FW1A 1ZOFA 1X5DA 4RUVA 4HUAA 2YNXA 11GSA 3TKPA 4O32A 1GUMA 3BD2A 1A8YA 1ML6A 1ON4A 4DSRA 2KP1A 3E3EA 3G9BA 1PA3A 4ILFA 2V32A 2X8GA 1GTBA 3WGEA 3F4TA 2PVOC 1PSQA 1TRVA 1XOAA 4HZ2A 3P8WA 1GSYA 4XCSA 2M72A 4XS4B 4I8BA 3A2VA 4ECJA 1EV4A 4N10A 2QKEA 18GSA 4NHWA 5DBQA 2B7KA 2R2JA 1NM3A 1PX6A 2VLVA 3LSZA 1HNAA 2N5BA 3KM6A 1V40A 4RQRA 4EKZA 3M9KA 1S3DA 1AUCA 4CDOA 2DJKA 5CAXA 1N8JA 3HVSA 3IHQA 3D6IA 3KXOA 1QFNA 2PU9C 3IK9A 1H75A 3FR6A 14GSA 2B5EA 8GSSA 1BQ7A 3A5IA 4TN8A 1TK8B 3CBUA 4LMVA 2WGRA 1ILOA 3VI5A 2C0EA 4PTSA 1WPIA 4CW9A 1MEKA 3GL5A 2VL2A 3QAGA 4ISDA 1X5CA 3QR6A 1B9XC 4LL1B 4ZBBA 19GSA 2KOKA 5AISA 2OADA 1FB0A 4V2LA 1TI3A 2YN1A 1F3BA 4WETA 5HR2A 3S9FA 5DALA 1W4VA 2YANA 2R0CA 1TW9A 4JU5A 3DIEA 4K1FA 2C0FA 2VLUA 2YWIA 2VAFA 3GYKA 1ZYEA 22GSA 4PXOA 3ZMKA 4ECCA 1E6BA 3JCML 1BEDA 5G30A 2PGTA 1Z7PA 2DLXA 2H75A 3GX8A 3EURA 1TU7A 4PQ1A 1F37A 3Q19A 1YDKA 5KOWA 3O6TA 3HZ4A 2GT5A 1RK4A 1U3IA 3VPTA 4N30A 2X64A 3UARA 2H66A 1IYHA 2JU5A 1YZXA 4O92A 1PX7A 4I2UA 1K0DA 5HR3A 4D73B 3RPNA 1RQMA 1X0RA 3FZ5A 2Z9SA 2WB9A 4HJ2A 3WGDA 5G2ZA 4RI6A 4QQ7A 1XOBA 3ME8A 3ZFLA 2WCIA 5B8BA 2X49A 3H8QA 3MSZA 2H6XA 3BCKA 5ECRB 1DE2A 1TI1A 1PN0A 3C71A 5D73A 3LG6A 2A2SA 4WBJA 2VUPA 2F8AA 1H4OA 1XFLA 1MD3A 4KSMA 1U87A 3L9UA 2WZ9A 2DJ2A 5ECHB 2AYTA 1XWGA 3ISOA 1YEXA 5GAND 1Y25A 1KNGA 2H19A 1K3OA 3PR8A 1GSUA 3SBCA 5B8AA 3HYPA 1SYRA 1AQXA 1G7EA 3IE3A 3CXGA 2VCTA 3IA1A 2B3SA 2IMDA 17GSA 1OC9A 4XRDA 2L4QA 3HHVA 4I5QA 3IC4A 3HD5A 2LRNA 3CSIA 5ECOB 1MD4A 4TRXA 4XS6A 2V6OA 2GLRA 1YQ1A 1G7OA 4WR4A 1HNBA 4NAXA 2CAIA 3FYGA 1UA5A 1OKDA 1USBA 2PERA 3TRXA 3Q18A 5ID2B 1GRXA 1F6MC 1BX9A 4MP4A 5J9CA 3FZ4A 4RI7A 4XHMA 2CV4A 3UBKA 3DXBA 5IOXA 3LFLA 4Z7XA 3QFAC 1ZGNA 2BTOT 3ZVJA 1G6WA 5DVBA 2YWNA 2YV9A 4MZCA 3LYKA 3EPTA 4BA7A 2X8CA 2HRNA 1YY7A 3LQ7A 1GTIA 2E0QA 4NPBA 1I9DA 2XC2A 1GLPA 1KEBA 5J4UA 2OBIA 4K5SA 5G1KA 3F8UA 5F8BA 4L0WA 1J0FA 2NDOA 3GTUA 2WFCA 1EP7A 1GWCA 2N5AA 1SJZA 1TK5B 2DKHA 2IJYA 2X99A 5DQSA 3ERGA 5B6MA 3EU3A 4ZILA 4DSSB 3GKNA 4ULXA 4KH7A 3GUSA 1O6JA 2ON7A 5A4VA 2I9HA 3LJRA 5FT3A 4TR1A 1FHEA 2H70A 3DYRA 5LCZA 1K0OA 3A2XA 2AV4A 1N2AA 4EO3A 2V6KA 1V98A 5DAKA 4PNGA 1M9BA 5KOXA 1F3AA 2H1AA 5DDLA 3H1NA 1HD2A 2HRKA 3LW9A 2YV7A 2K6VA 5D9VA 1GTAA 1SL2B 4HDEA 2IWTA 2TIRA 4PNFA 2PUKC 3FEUA 1AAZA 4IP1A 4KSOA 2YPMA 4GLTA 2P0GA 4ML1A 3A5WA 2CVBA 3F4SA 1X5EA 2MZCA 4GWRA 1E2YA 5IMZA 3W8SA 2VD1A 4G0IA 1U88A 3H93A 3IRAA 4L0UA 4HI7A 4JRRA 3FR3A 3IOSA 2XPDA 3ERFA 1A2LA 3ZL5A 4XIHA 3HVVA 3D0ZA 1V58A 4GSNA 4LLRA 4TXVA 3IPZA 5CYYA 4L8EA 1U6TA 1XVWA 2YWOA 3KD0A 2YZHA 3GURA 4X0XA 4IN0A 1GH2A 4PGTA 5DCHA 2DJJA 2JSZA 4OCEA 4BWSA 4GXZA 13GSA 4JR6A 2O85A 1S3AA 4TOPA 1TTZA 4FYBA 3IK7A 4AJ8A 2K18A 1G0TA 2K8VA 5HFKA 3QFBC 4MDCA 3NOFA 4TXOB 2VL9A 3C7MA 1G6YA 4BL7A 5IIZA 4TW5A 5D9WA 2XBIA 2LS5A 1VF3A 1ZL9A 4V1Ag 4K7IA 4I6XA 1THOA 3R3EA 4F82A 1VF1A 4L5OA 3KP8A 5ENUA 4MPFA 2B6MA 1K0NA 1O7UA 4K0GA 3TKRA 3D4TA 2LTKA 2VCXA 4KAEA 1GSFA 1PGTA 1FB6A 1ZMAA 1A2JA 3HJPA 4K2XA 6GSYA 1X9WB 5JCWA 1OC8A 1ERVA 4K8MA 2L4CA 1K0CA 2JADA 4MPGA 3FRCA 4BIKA 2C0GA 4OO4A 4J56E 1SKSB 1XPVA 2H30A 3M8NA 3HVXA 3DMLA 5ECLB 3WD6A 1X9MB 4OFNA 3ZZXA 1S3RA 5IO2A 5DQYA 3CRTA 1O81A 2HRFA 2JACA 1B4QA 4BPYA 2LNSA 4IGJA 3CSJA 4RQXA 1FOVA 4NXIA 5CREA 1C72A 2DJ1A 4GTUA 3CYNA 5HFGA 4YQUA 4WR5A 1GL8A 1M7TA 1T4ZA 3QD9A
chains in the Genus database with same CATH topology
2WS2A 3ZIJA 4F03A 4EXJA 2LRCA 1K0MA 1R5AA 2QA2A 4CY8A 3KH7A 4HQZA 2LUSA 2JZTA 3KCMA 2C8UA 1VGLA 4EVMA 2A4VA 2GSQA 3U6VA 2DSAA 5D9XA 1ZYPA 1FAAA 3DGQA 4F0CA 5HR0A 4KDXA 1K3YA 4USSA 3HJOA 3VFIA 4MMMA 1GTUA 2PWJA 1OE8A 1M2AA 2IPAA 2IMIA 1EEMA 3GFKA 4CHSA 3L9SA 2FNOA 1OVNA 2X8HA 4XS4A 2AUVA 3FHKA 1Q4JA 3NIVA 2MMAA 4MNNA 2VLTA 5LD0A 2HSYA 1PKZA 1PMTA 4OMVA 1SJ6A 4FYCA 6GSXA 5DJLA 3EC3A 1QUWA 2LEGA 3RHCA 1DE1A 2HI7A 5D9TA 3FMWA 6GSVA 1TRUA 3VK9A 4IELA 4XS1A 1WRYA 3ME7A 2CQ9A 2DJ3A 1WMJA 2VL2C 1Z5YE 2H1GA 1JLVA 4QL7A 2KUCA 1CQHA 5IO0A 1PQNA 4POLA 1TRWA 4K6XA 2CT6A 3HDCA 5ELAA 5DJMA 4EIPA 2PPTA 4AJ7A 2WJUA 2YOIA 3EINA 5L71A 4PUFC 4MA9A 1J9BA 1AQVA 5DALB 2RUFA 1UN2A 3DD3A 3GA4A 1TXXA 2C3TA 5ECQB 3DWVA 1XW5A 2REMA 4JBBA 1ZCPA 4OO5A 2OACA 3KTBA 3P2AA 3HJMA 2GGTA 4KF9A 1FOHA 3GN3A 1THXA 3F6FA 2EIQA 4TR0A 2YWMA 1SK0A 5KEJA 5LNKe 1EOHA 2EIRA 3I6AA 4KNDA 1NW2A 4XTSA 1GSDA 1Z6MA 3KMOA 4GSTA 3MDKA 4V1Ap 2A2PA 1EV9A 2R37A 5ELGA 2BJXA 3I69A 1T4YA 1B9YC 4YAPA 1T7PB 1JZDA 1PD21 2YCDA 1ST9A 3UEMA 3PPUA 3TOTA 2IL3A 2VIMA 1OE7A 5CRGA 4HOJA 4WF4A 1AXDA 3KP9A 3M0FA 3G7JA 3TJGA 1MDKA 2NTOA 2G0FA 2HNLA 1PL1A 2O7KA 1B48A 3KIJA 2VM2A 3ERWA 4K7OA 3TB2A 4D73A 2OKAA 3KMNA 1AQWA 4GQFA 4ZB6A 6GSSA 1JZRA 1EOGA 5IMDA 4K9ZA 4BVXB 1GULA 2MMOA 4KCAA 3M3MA 1TOFA 2HZEB 3UVHA 1YKCA 3FKFA 3IHGA 5COHA 5CNWA 5CRWA 3C1SA 5HR1A 4EUYA 5GSSA 2I81A 4J57E 5A4UA 5ECPB 5BMUA 1NHOA 2VO4A 1GSQA 2GQKA 2PBJA 1XCCA 1A24A 3IAS2 2HSHA 5EY6A 3C1RA 5EVOA 4YKFA 4E8EA 1SKRB 3TJKA 3D21A 1T3BA 2WDUA 5E4WA 5EPFA 4NHZA 2NPBA 1WP0A 2C3QA 2HE3A 1ERTA 5CP1A 3VURA 3J7Yb 4EF0A 2P5RA 2L6DA 2LJKA 4O5UA 4ECIA 2D2ZA 3MYDA 3EMPA 2DMMA 3CRUA 4OCFA 5G1LA 3EWLA 5ECIB 3Q74A 3WT1A 1EGOA 5BRTA 2OE1A 5JWQB 4X43A 2F51A 5AN1A 4WBRD 2PVQA 5H5RA 2IFQB 3OR5A 2IMFA 4EE0A 4ECBA 2RIIA 3APOA 2GS3A 2H0IA 4HU9A 5J41A 2B7JA 3ZYWA 5ID2A 2FLSA 4OWYA 4G19A 1DBYA 3FZAA 1TDIA 3RHBA 4Q5RA 3DEXA 4G0LA 4JEDA 1M9AA 5AIVA 2EIOA 3ZFBA 3QDNA 6GSTA 1FG4A 1VRSD 2O87A 1A0FA 1Y6EA 3GTUB 3UL3A 2LKUA 1I5GA 5H5QA 5D96A 20GSA 1A2MA 3BOAA 3F9UA 4BVYA 1YEPA 2NBSA 4MK3A 3UMAA 3L9VA 4IJIA 2OE3A 3F0IA 2I3YA 2TRXA 5IOWA 2V1MA 1F9MA 4HEA2 4POBA 4DSSA 5HFIA 5IMCA 2GDRA 2I1UA 4MJEA 1YJ6A 2C3NA 4ICYA 2RUEA 3A2WA 2JL4A 2FD3A 3ZTLA 3H79A 1LBKA 3UAPA 5ECMB 2P31A 1GLQA 3AY8A 3IBHA 3ZIVA 3LEFA 3BCIA 3GSTA 2V41A 3TKQA 4NV5A 9GSSA 4MF7A 1M99A 3A3TA 2H74A 4GRFA 5IMAA 4NWYA 2E2GA 2J9HA 3VLNA 3US3A 1TJDA 3GNJA 4TKYA 3KTLA 2AHEA 3NZNA 4TVEA 3F3QA 2YJHA 4Q5NA 3TJJA 2ZUPA 2FWGA 2XPEA 4ZBAA 3W6GA 3GH6A 4IHUA 3APQA 3EVIA 4MH3A 2MBSA 3KGKA 2R6KA 3SWLA 4DEJA 2JZRA 3O76A 3GKXA 4MABA 3TKSC 4IQAA 5A4WA 3TKSA 3VPQA 4KDYA 2XHFA 3KEBA 2XBQA 1WOUA 3FW2A 1GUHA 1R4WA 4HQSA 3ZREA 4Z2UA 3FR9A 3RBTA 4K5RA 3L0HA 5JWOB 1ZYNA 3P90A 1NHYA 2X4AA 2GT6A 4IP6A 3IXRA 3GL3A 4HZ4A 1MDIA 2GVPA 3IV4A 3DRNA 3F3RA 5GSTA 3F4RA 4IW9A 1TKDB 1SYXA 2MYGA 1M2BA 4Z2RA 4TXOA 1SD9A 2G2QA 1URMA 2GZPA 3Q6OA 1LJRA 5F07A 1F2EA 1B8XA 2OA7A 3W8JA 3DKSA 1PKWA 2GSTA 4BWQA 2R5GA 4X4JA 5IM9A 4HU7A 1Z6NA 2HSMA 4PX1A 4PQIA 3VWVA 4MJBA 1NSWA 3TOUA 4Z2TA 2CZ2A 2ZNMA 4IVFA 4ZBDA 2AJQB 1KTEA 2UZ8A 1VF4A 3U5RE 3PINA 1M2DA 1Z9HA 3TKSE 1O73A 2JZSA 1A8LA 1XW9A 1O85A 2JSYA 5ABRA 2K8SA 4TR4A 1IYIA 1W89A 3FZ9A 1M0UA 2L6CA 3C73A 3R2QA 4N0VA 5CRDA 4F9ZA 2CAQA 2QGVA 3FK8A 3ZLPA 1GNWA 5JWRB 3ZRDA 2H8LA 1WJKA 2R4VA 2R0PA 4LL4B 5DCGA 5JCGA 1AW9A 2KLXA 3D5JA 1SENA 1T8EB 4FIWA 5IPHA 2A4HA 5AGYA 1MTCA 4ZIJA 4WKWA 3GX0A 1QQ2A 1GP1A 2RM6A 4IJ3A 2CZ3A 2DJ0A 2GSRA 5KN3A 1WIKA 3HXSA 4F0BA 1PL2A 1ERWA 4ZXGA 4WEYA 3QCPA 5KN1A 5GAPD 4OD7A 2E7PA 2VL3A 3MNGA 4HJMA 1TU8A 2ES7A 5KN2A 3GMFA 3F63A 4GQCA 2L57A 4IS0A 3GV1A 3LGCA 4LMWA 2HYXA 4AJ6A 4KGIA 3TUEA 1XWCA 2J23A 1KBNA 5D8IA 2L59A 4ZL9A 1OYJA 3IDVA 1U3AA 3VWWA 4LA1A 1O8XA 1TK0B 1R5PA 4KW6A 2I4AA 2BMXA 2LNTA 2PMTA 4O5RA 3N5OA 3K8NA 1SK2A 1YF0A 3QAWA 2H72A 3EU4A 1T00A 2GZYA 3QOUA 1BJXA 4DVCA 2DIZA 5IMVA 2LQQA 1ZYQB 3WGXA 2OJLA 1Z7RA 5D93A 2IMKA 10GSA 4MJCA 4I97A 2VOCA 4WXTA 2F8FA 4TR3A 2FA8A 3GKMA 4IQ1A 3VI7A 2H76A 4IKHA 1ABAA 1TRSA 4YKGA 2GZZA 4YQMA 2HRAA 2H1BA 3UBLA 1SK1A 2CVDA 4F2IA 3LXZA 3TJBA 4GCIA 1EWXA 2LQOA 4KE3A 2ZCTA 1UC7A 4MZWA 1R7HA 3UVTA 1XWBA 2FA4A 2LRTA 5EL8A 1XWAA 3QMXA 1XBSA 1YKAA 3BJ5A 3GKKA 2QA1A 4N11A 2B5XA 5IMFA 3RAZA 4FYUA 2H0GA 4MJAA 1V2AA 2ON5A 2DIYA 4WF5A 5IPGA 3DVXA 1K3LA 3GH9A 2F9SA 3J7Yk 1AIUA 3MIXA 3E0UA 2FGXA 4KCEA 5J5NA 1TP9A 2FY6A 2O89A 1VF2A 2RLIA 2NVLA 3DVWA 1FO5A 1OAZA 1ERUA 2VCQA 3CTFA 3HKRA 4ZB8A 3CTGA 4EDZA 3I43A 3EMXA 2VD0A 4BVXA 5G5FA 3G7YA 2LJAA 1EZKA 2WRTA 2HZEA 2DBCA 4PURA 3GHAA 4JR4A 2R3XA 5IQYA 4JE1A 1DSBA 3KJYA 5H5SA 1ACVA 2B1KA 2E2MA 2FWEA 3HY2A 1SU9A 3TGZA 1BYEA 5ECKB 4NMUA 2AB6A 5F0GA 1X9SB 4I2TA 2CVKA 4ML6A 2GSSA 4N0ZA 1GNEA 2B5YA 4ZB9A 1QK8A 2H6YA 1OC9B 4JZQA 4ACSA 4FQUA 1EP8A 1JZOA 2YP6A 2M46A 1V9WA 1BAYA 4EDYA 3UIWA 3L4NA 5FWGA 2C0DA 1YF1A 1HQOA 4Q5FA 4K7NA 2H1DA 3EE2A 3MAKA 2H6ZA 4Q5QA 2DC5A 4K0NA 2C4JA 2TRCP 2DMLA 2MMNA 4MCUA 4A5PA 4V2MA 1SL1B 4EC0A 2GQMA 4AF2A 2DKIA 1PRXA 4PQHA 3WYWA 2EC4A 4H86A 4KA0A 2IFQA 1DUGA 6GSUA 1MDJA 1XVQA 2LJRA 2C1YA 3P7XA 1A0RP 5J3RA 2C80A 3TCOA 2LSTA 4G9HA 3G7IA 4V2NA 2A2RA 1RW1A 1QGVA 3VWXA 2VCZA 1T1VA 1SL0B 6GSWA 1K0BA 1XIYA 1UVZA 2QSIA 3PH9A 4FO5A 3M9JA 1JFUA 5KN0A 1BG5A 4IBPA 3ZVJD 4KB3A 5C04A 3VWUA 1R26A 4J2FA 2V2GA 1A23A 3KH9A 4BVYB 3ZITA 3TDGA 1JLWA 5F05A 4KUNA 5A5KA 16GSA 3ED3A 1GSSA 12GSA 5F06A 4AGSA 3UOMA 5B7CA 3TRPA 1Z3EA 4TR1B 2YZUA 3BBYA 1V57A 4K2DA 3QPMA 3UJ1A 2CX3A 3GRXA 2FCHA 1J08A 3EYTA 3I9V2 3E9JB 3LXTA 3CMIA 5DAKB 5B6NA 3LWAA 4YQVA 2AAWA 4MF5A 3TJFA 5ECNB 1GSEA 2HZFA 4G2EA 3GIXA 2P5QA 3M1GA 3APSA 1S3CA 2HT9A 4YAVA 4CY6A 4DSQA 4YH2A 2ALBA 4NV2A 1CQGA 3FY7A 2KHPA 4OFMA 1QXHA 1EEJA 1Q98A 5FHIA 4EL1A 3IC8A 1EGRA 2K9FA 3GSSA 5E59A 3HCZA 3RDWA 4POKA 3TRQA 2HFDA 2VCVA 5G5EA 2OBKA 3V1WA 1GUKA 2IIYA 2IMEA 4O7HA 3ZMLA 4KX4A 2FUG2 2IN3A 2YJ7A 3PGTA 1HNCA 1PN9A 3N9JA 5J9BA 4EIQA 4POMA 4GSSA 5CO3A 4MH2A 2VM1A 4QL9A 1O8WA 3LORA 5GZZB 2HXKA 4ZL8A 4PUAA 1XWKA 1OKTA 3H4KA 4X1UA 2L5LA 2R0GA 2FHEA 3D4MA 4O5QA 2H71A 2PN8A 1HYUA 7GSSA 2CA8A 3RPPA 3O3TA 2N5FA 2MMZA 2GTUA 1K0AA 4ID0A 4BL7B 2HLSA 3D22A 5G31A 1JHBA 2VCWA 3WT2A 2GQLA 1QMVA 2H73A 2OE0A 1XW6A 1SD8A 5C00A 5CRHA 1JZWA 2M80A 2F3MA 3IR4A 4P3YB 1WWJA 1XXUA 4FH8A 4G10A 1XZOA 1B4PA 5ECSA 1AC1A 3L78A 5AIXA 2B1LA 4MF6A 2H0HA 1FVKA 1ZZYA 4GF0A 4MZBA 4OFTA 2LV3A 2FWHA 1OC3A 3QAVA 3KZQA 3HZ8A 4L5LA 2KP2A 1SJIA 2MBTA 2QC7A 1LU4A 2L5OA 3LYPA 3MWHA 5HQPA 5JCUA 4KDUA 2CX4A 2WULA 2FWFA 4HS1A 4MLYA 3IAM2 5INYA 2O8VB 4G0KA 3CSHA 1SKWB 1FVJA 2RM5A 1WE0A 3F6DA 3HA9A 2H01A 3C8EA 4E8HA 4ZL7A 4XRAA 1FW1A 1ZOFA 1X5DA 4RUVA 4HUAA 2YNXA 11GSA 3TKPA 4O32A 1GUMA 3BD2A 1A8YA 1ML6A 1ON4A 4DSRA 2KP1A 3E3EA 3G9BA 1PA3A 4ILFA 2V32A 2X8GA 1GTBA 3WGEA 3F4TA 2PVOC 1PSQA 1TRVA 1XOAA 4HZ2A 3P8WA 1GSYA 4XCSA 2M72A 4XS4B 4I8BA 3A2VA 4ECJA 1EV4A 4N10A 2QKEA 18GSA 4NHWA 5DBQA 2B7KA 2R2JA 1NM3A 1PX6A 2VLVA 3LSZA 1HNAA 2N5BA 3KM6A 1V40A 4RQRA 4EKZA 3M9KA 1S3DA 1AUCA 4CDOA 2DJKA 5CAXA 1N8JA 3HVSA 3IHQA 3D6IA 3KXOA 1QFNA 2PU9C 3IK9A 1H75A 3FR6A 14GSA 2B5EA 8GSSA 1BQ7A 3A5IA 4TN8A 1TK8B 3CBUA 4LMVA 2WGRA 1ILOA 3VI5A 2C0EA 4PTSA 1WPIA 4CW9A 1MEKA 3GL5A 2VL2A 3QAGA 4ISDA 1X5CA 3QR6A 1B9XC 4LL1B 4ZBBA 19GSA 2KOKA 5AISA 2OADA 1FB0A 4V2LA 1TI3A 2YN1A 1F3BA 4WETA 5HR2A 3S9FA 5DALA 1W4VA 2YANA 2R0CA 1TW9A 4JU5A 3DIEA 4K1FA 2C0FA 2VLUA 2YWIA 2VAFA 3GYKA 1ZYEA 22GSA 4PXOA 3ZMKA 4ECCA 1E6BA 3JCML 1BEDA 5G30A 2PGTA 1Z7PA 2DLXA 2H75A 3GX8A 3EURA 1TU7A 4PQ1A 1F37A 3Q19A 1YDKA 5KOWA 3O6TA 3HZ4A 2GT5A 1RK4A 1U3IA 3VPTA 4N30A 2X64A 3UARA 2H66A 1IYHA 2JU5A 1YZXA 4O92A 1PX7A 4I2UA 1K0DA 5HR3A 4D73B 3RPNA 1RQMA 1X0RA 3FZ5A 2Z9SA 2WB9A 4HJ2A 3WGDA 5G2ZA 4RI6A 4QQ7A 1XOBA 3ME8A 3ZFLA 2WCIA 5B8BA 2X49A 3H8QA 3MSZA 2H6XA 3BCKA 5ECRB 1DE2A 1TI1A 1PN0A 3C71A 5D73A 3LG6A 2A2SA 4WBJA 2VUPA 2F8AA 1H4OA 1XFLA 1MD3A 4KSMA 1U87A 3L9UA 2WZ9A 2DJ2A 5ECHB 2AYTA 1XWGA 3ISOA 1YEXA 5GAND 1Y25A 1KNGA 2H19A 1K3OA 3PR8A 1GSUA 3SBCA 5B8AA 3HYPA 1SYRA 1AQXA 1G7EA 3IE3A 3CXGA 2VCTA 3IA1A 2B3SA 2IMDA 17GSA 1OC9A 4XRDA 2L4QA 3HHVA 4I5QA 3IC4A 3HD5A 2LRNA 3CSIA 5ECOB 1MD4A 4TRXA 4XS6A 2V6OA 2GLRA 1YQ1A 1G7OA 4WR4A 1HNBA 4NAXA 2CAIA 3FYGA 1UA5A 1OKDA 1USBA 2PERA 3TRXA 3Q18A 5ID2B 1GRXA 1F6MC 1BX9A 4MP4A 5J9CA 3FZ4A 4RI7A 4XHMA 2CV4A 3UBKA 3DXBA 5IOXA 3LFLA 4Z7XA 3QFAC 1ZGNA 2BTOT 3ZVJA 1G6WA 5DVBA 2YWNA 2YV9A 4MZCA 3LYKA 3EPTA 4BA7A 2X8CA 2HRNA 1YY7A 3LQ7A 1GTIA 2E0QA 4NPBA 1I9DA 2XC2A 1GLPA 1KEBA 5J4UA 2OBIA 4K5SA 5G1KA 3F8UA 5F8BA 4L0WA 1J0FA 2NDOA 3GTUA 2WFCA 1EP7A 1GWCA 2N5AA 1SJZA 1TK5B 2DKHA 2IJYA 2X99A 5DQSA 3ERGA 5B6MA 3EU3A 4ZILA 4DSSB 3GKNA 4ULXA 4KH7A 3GUSA 1O6JA 2ON7A 5A4VA 2I9HA 3LJRA 5FT3A 4TR1A 1FHEA 2H70A 3DYRA 5LCZA 1K0OA 3A2XA 2AV4A 1N2AA 4EO3A 2V6KA 1V98A 5DAKA 4PNGA 1M9BA 5KOXA 1F3AA 2H1AA 5DDLA 3H1NA 1HD2A 2HRKA 3LW9A 2YV7A 2K6VA 5D9VA 1GTAA 1SL2B 4HDEA 2IWTA 2TIRA 4PNFA 2PUKC 3FEUA 1AAZA 4IP1A 4KSOA 2YPMA 4GLTA 2P0GA 4ML1A 3A5WA 2CVBA 3F4SA 1X5EA 2MZCA 4GWRA 1E2YA 5IMZA 3W8SA 2VD1A 4G0IA 1U88A 3H93A 3IRAA 4L0UA 4HI7A 4JRRA 3FR3A 3IOSA 2XPDA 3ERFA 1A2LA 3ZL5A 4XIHA 3HVVA 3D0ZA 1V58A 4GSNA 4LLRA 4TXVA 3IPZA 5CYYA 4L8EA 1U6TA 1XVWA 2YWOA 3KD0A 2YZHA 3GURA 4X0XA 4IN0A 1GH2A 4PGTA 5DCHA 2DJJA 2JSZA 4OCEA 4BWSA 4GXZA 13GSA 4JR6A 2O85A 1S3AA 4TOPA 1TTZA 4FYBA 3IK7A 4AJ8A 2K18A 1G0TA 2K8VA 5HFKA 3QFBC 4MDCA 3NOFA 4TXOB 2VL9A 3C7MA 1G6YA 4BL7A 5IIZA 4TW5A 5D9WA 2XBIA 2LS5A 1VF3A 1ZL9A 4V1Ag 4K7IA 4I6XA 1THOA 3R3EA 4F82A 1VF1A 4L5OA 3KP8A 5ENUA 4MPFA 2B6MA 1K0NA 1O7UA 4K0GA 3TKRA 3D4TA 2LTKA 2VCXA 4KAEA 1GSFA 1PGTA 1FB6A 1ZMAA 1A2JA 3HJPA 4K2XA 6GSYA 1X9WB 5JCWA 1OC8A 1ERVA 4K8MA 2L4CA 1K0CA 2JADA 4MPGA 3FRCA 2C0GA 4OO4A 4J56E 1SKSB 1XPVA 2H30A 3M8NA 3HVXA 3DMLA 5ECLB 3WD6A 1X9MB 4OFNA 3ZZXA 5IO2A 5DQYA 3CRTA 1O81A 2HRFA 2JACA 1B4QA 4BPYA 2LNSA 4IGJA 3CSJA 4RQXA 1FOVA 4NXIA 5CREA 1C72A 2DJ1A 4GTUA 3CYNA 5HFGA 4YQUA 4WR5A 1GL8A 1M7TA 1T4ZA 3QD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WS2 A;  3ZIJ A;  4F03 A;  4EXJ A;  2LRC A;  1K0M A;  1R5A A;  3KH7 A;  4HQZ A;  2LUS A;  2JZT A;  3KCM A;  2C8U A;  1VGL A;  4EVM A;  2A4V A;  2GSQ A;  3U6V A;  2DSA A;  5D9X A;  1FAA A;  3DGQ A;  4F0C A;  5HR0 A;  4KDX A;  1K3Y A;  3VFI A;  3HJO A;  4MMM A;  1GTU A;  2PWJ A;  1OE8 A;  1M2A A;  2IPA A;  2IMI A;  1EEM A;  3GFK A;  4CHS A;  3L9S A;  2FNO A;  1OVN A;  2X8H A;  4XS4 A;  2AUV A;  3FHK A;  1Q4J A;  3NIV A;  2MMA A;  2VLT A;  5LD0 A;  2HSY A;  1PKZ A;  1PMT A;  4OMV A;  1SJ6 A;  4FYC A;  6GSX A;  5DJL A;  3EC3 A;  1QUW A;  2LEG A;  3RHC A;  1DE1 A;  2HI7 A;  5D9T A;  6GSV A;  1TRU A;  3VK9 A;  4IEL A;  4XS1 A;  1WRY A;  3ME7 A;  2CQ9 A;  2DJ3 A;  1WMJ A;  2VL2 C;  1Z5Y E;  2H1G A;  1JLV A;  4QL7 A;  2KUC A;  1CQH A;  5IO0 A;  1PQN A;  4POL A;  1TRW A;  4K6X A;  2CT6 A;  3HDC A;  5ELA A;  5DJM A;  2PPT A;  4AJ7 A;  2WJU A;  2YOI A;  3EIN A;  5L71 A;  4PUF C;  4MA9 A;  1J9B A;  1AQV A;  5DAL B;  2RUF A;  1UN2 A;  3DD3 A;  3GA4 A;  1TXX A;  2C3T A;  5ECQ B;  3DWV A;  1XW5 A;  2REM A;  4JBB A;  1ZCP A;  4OO5 A;  2OAC A;  3KTB A;  3P2A A;  3HJM A;  2GGT A;  3GN3 A;  1THX A;  3F6F A;  2EIQ A;  4TR0 A;  2YWM A;  1SK0 A;  5KEJ A;  5LNK e;  1EOH A;  2EIR A;  3I6A A;  4KND A;  1NW2 A;  4XTS A;  1GSD A;  1Z6M A;  3KMO A;  4GST A;  3MDK A;  4V1A p;  1EV9 A;  2R37 A;  5ELG A;  2BJX A;  3I69 A;  1T4Y A;  1B9Y C;  4YAP A;  1T7P B;  1JZD A;  1PD2 1;  2YCD A;  1ST9 A;  3UEM A;  3TOT A;  2IL3 A;  2VIM A;  1OE7 A;  5CRG A;  4HOJ A;  4WF4 A;  1AXD A;  3KP9 A;  3M0F A;  3G7J A;  3TJG A;  1MDK A;  2NTO A;  2G0F A;  2HNL A;  1PL1 A;  2O7K A;  1B48 A;  3KIJ A;  2VM2 A;  3ERW A;  4K7O A;  3TB2 A;  4D73 A;  2OKA A;  3KMN A;  1AQW A;  4GQF A;  4ZB6 A;  6GSS A;  1JZR A;  1EOG A;  5IMD A;  4K9Z A;  1GUL A;  2MMO A;  4KCA A;  3M3M A;  1TOF A;  2HZE B;  3UVH A;  1YKC A;  3FKF A;  5COH A;  5CNW A;  5CRW A;  3C1S A;  5HR1 A;  4EUY A;  5GSS A;  2I81 A;  4J57 E;  5A4U A;  5ECP B;  1NHO A;  2VO4 A;  1GSQ A;  2GQK A;  2PBJ A;  1XCC A;  1A24 A;  3IAS 2;  2HSH A;  5EY6 A;  3C1R A;  5EVO A;  4E8E A;  1SKR B;  3TJK A;  3D21 A;  1T3B A;  2WDU A;  5E4W A;  5EPF A;  4NHZ A;  2NPB A;  1WP0 A;  2C3Q A;  2HE3 A;  1ERT A;  5CP1 A;  3VUR A;  3J7Y b;  4EF0 A;  2P5R A;  2L6D A;  2LJK A;  4ECI A;  2D2Z A;  3EMP A;  2DMM A;  3CRU A;  4OCF A;  5G1L A;  3EWL A;  5ECI B;  3Q74 A;  3WT1 A;  1EGO A;  2OE1 A;  5JWQ B;  4X43 A;  2F51 A;  5AN1 A;  4WBR D;  2PVQ A;  5H5R A;  2IFQ B;  3OR5 A;  2IMF A;  4EE0 A;  4ECB A;  2RII A;  3APO A;  2GS3 A;  2H0I A;  4HU9 A;  5J41 A;  2B7J A;  3ZYW A;  5ID2 A;  2FLS A;  4OWY A;  4G19 A;  1DBY A;  3FZA A;  1TDI A;  3RHB A;  4Q5R A;  3DEX A;  4JED A;  1M9A A;  5AIV A;  2EIO A;  3ZFB A;  3QDN A;  6GST A;  1FG4 A;  1VRS D;  2O87 A;  1A0F A;  1Y6E A;  3GTU B;  3UL3 A;  2LKU A;  1I5G A;  5H5Q A;  5D96 A;  20GS A;  1A2M A;  3BOA A;  3F9U A;  4BVY A;  1YEP A;  2NBS A;  4MK3 A;  3UMA A;  3L9V A;  4IJI A;  2OE3 A;  3F0I A;  2I3Y A;  2TRX A;  5IOW A;  2V1M A;  1F9M A;  4HEA 2;  4POB A;  4DSS A;  5HFI A;  5IMC A;  2GDR A;  2I1U A;  4MJE A;  1YJ6 A;  2C3N A;  2RUE A;  3A2W A;  2JL4 A;  2FD3 A;  3ZTL A;  3H79 A;  1LBK A;  3UAP A;  5ECM B;  2P31 A;  1GLQ A;  3AY8 A;  3IBH A;  3ZIV A;  3LEF A;  3BCI A;  3GST A;  2V41 A;  3TKQ A;  4NV5 A;  9GSS A;  4MF7 A;  1M99 A;  3A3T A;  2H74 A;  4GRF A;  5IMA A;  4NWY A;  2E2G A;  2J9H A;  3VLN A;  3US3 A;  1TJD A;  3GNJ A;  4TKY A;  3KTL A;  2AHE A;  3NZN A;  4TVE A;  3F3Q A;  2YJH A;  4Q5N A;  3TJJ A;  2ZUP A;  2FWG A;  2XPE A;  4ZBA A;  3W6G A;  3GH6 A;  4IHU A;  3APQ A;  3EVI A;  4MH3 A;  2MBS A;  3KGK A;  2R6K A;  3SWL A;  4DEJ A;  2JZR A;  3O76 A;  3GKX A;  4MAB A;  3TKS C;  4IQA A;  5A4W A;  3TKS A;  3VPQ A;  4KDY A;  2XHF A;  3KEB A;  2XBQ A;  1WOU A;  3FW2 A;  1GUH A;  1R4W A;  4HQS A;  3ZRE A;  3FR9 A;  3RBT A;  3L0H A;  5JWO B;  3P90 A;  1NHY A;  2GT6 A;  4IP6 A;  3IXR A;  3GL3 A;  4HZ4 A;  1MDI A;  2GVP A;  3IV4 A;  3DRN A;  3F3R A;  5GST A;  3F4R A;  4IW9 A;  1TKD B;  1SYX A;  2MYG A;  1M2B A;  4TXO A;  1SD9 A;  2G2Q A;  1URM A;  2GZP A;  3Q6O A;  1LJR A;  5F07 A;  1F2E A;  1B8X A;  2OA7 A;  3W8J A;  3DKS A;  1PKW A;  2GST A;  4BWQ A;  2R5G A;  5IM9 A;  4HU7 A;  1Z6N A;  4PX1 A;  4PQI A;  3VWV A;  4MJB A;  1NSW A;  3TOU A;  2CZ2 A;  2ZNM A;  4IVF A;  4ZBD A;  2AJQ B;  1KTE A;  1VF4 A;  3U5R E;  3PIN A;  1M2D A;  1Z9H A;  3TKS E;  1O73 A;  2JZS A;  1A8L A;  1XW9 A;  1O85 A;  2JSY A;  5ABR A;  2K8S A;  4TR4 A;  1IYI A;  1W89 A;  3FZ9 A;  1M0U A;  2L6C A;  3C73 A;  3R2Q A;  4N0V A;  5CRD A;  4F9Z A;  2CAQ A;  2QGV A;  3FK8 A;  3ZLP A;  1GNW A;  5JWR B;  3ZRD A;  2H8L A;  1WJK A;  2R4V A;  4LL4 B;  5DCG A;  5JCG A;  1AW9 A;  2KLX A;  3D5J A;  1SEN A;  1T8E B;  4FIW A;  5IPH A;  5AGY A;  1MTC A;  4ZIJ A;  4WKW A;  3GX0 A;  1QQ2 A;  1GP1 A;  2RM6 A;  4IJ3 A;  2CZ3 A;  2DJ0 A;  2GSR A;  5KN3 A;  1WIK A;  3HXS A;  4F0B A;  1PL2 A;  1ERW A;  4ZXG A;  4WEY A;  3QCP A;  5KN1 A;  5GAP D;  4OD7 A;  2E7P A;  2VL3 A;  3MNG A;  4HJM A;  1TU8 A;  2ES7 A;  5KN2 A;  3GMF A;  3F63 A;  4GQC A;  2L57 A;  4IS0 A;  3GV1 A;  3LGC A;  4LMW A;  2HYX A;  4AJ6 A;  4KGI A;  3TUE A;  1XWC A;  2J23 A;  1KBN A;  5D8I A;  2L59 A;  4ZL9 A;  1OYJ A;  3IDV A;  1U3A A;  3VWW A;  4LA1 A;  1O8X A;  1TK0 B;  1R5P A;  4KW6 A;  2I4A A;  2BMX A;  2LNT A;  2PMT A;  4O5R A;  3N5O A;  3K8N A;  1SK2 A;  1YF0 A;  3QAW A;  2H72 A;  3EU4 A;  1T00 A;  2GZY A;  3QOU A;  1BJX A;  4DVC A;  2DIZ A;  5IMV A;  2LQQ A;  1ZYQ B;  3WGX A;  2OJL A;  1Z7R A;  5D93 A;  2IMK A;  10GS A;  4MJC A;  4I97 A;  2VOC A;  4WXT A;  2F8F A;  4TR3 A;  2FA8 A;  3GKM A;  4IQ1 A;  3VI7 A;  2H76 A;  4IKH A;  1ABA A;  1TRS A;  2GZZ A;  4YQM A;  2H1B A;  3UBL A;  1SK1 A;  2CVD A;  4F2I A;  3LXZ A;  3TJB A;  4GCI A;  1EWX A;  2LQO A;  4KE3 A;  2ZCT A;  1UC7 A;  4MZW A;  1R7H A;  3UVT A;  1XWB A;  2FA4 A;  2LRT A;  5EL8 A;  1XWA A;  3QMX A;  1XBS A;  1YKA A;  3BJ5 A;  3GKK A;  4N11 A;  2B5X A;  5IMF A;  3RAZ A;  4FYU A;  2H0G A;  4MJA A;  1V2A A;  2ON5 A;  2DIY A;  4WF5 A;  5IPG A;  3DVX A;  1K3L A;  3GH9 A;  2F9S A;  3J7Y k;  1AIU A;  3E0U A;  2FGX A;  4KCE A;  5J5N A;  1TP9 A;  2FY6 A;  2O89 A;  1VF2 A;  2RLI A;  2NVL A;  3DVW A;  1FO5 A;  1OAZ A;  1ERU A;  2VCQ A;  3CTF A;  3HKR A;  4ZB8 A;  3CTG A;  4EDZ A;  3I43 A;  3EMX A;  2VD0 A;  4BVX A;  5G5F A;  3G7Y A;  2LJA A;  1EZK A;  2WRT A;  2HZE A;  2DBC A;  4PUR A;  3GHA A;  4JR4 A;  2R3X A;  5IQY A;  4JE1 A;  1DSB A;  3KJY A;  5H5S A;  1ACV A;  2B1K A;  2E2M A;  2FWE A;  3HY2 A;  1SU9 A;  3TGZ A;  1BYE A;  5ECK B;  4NMU A;  2AB6 A;  5F0G A;  1X9S B;  4I2T A;  2CVK A;  4ML6 A;  2GSS A;  4N0Z A;  1GNE A;  2B5Y A;  4ZB9 A;  1QK8 A;  2H6Y A;  1OC9 B;  4JZQ A;  4ACS A;  1EP8 A;  1JZO A;  2YP6 A;  2M46 A;  1V9W A;  1BAY A;  4EDY A;  3UIW A;  3L4N A;  5FWG A;  2C0D A;  1YF1 A;  1HQO A;  4Q5F A;  4K7N A;  2H1D A;  3EE2 A;  3MAK A;  2H6Z A;  4Q5Q A;  2DC5 A;  4K0N A;  2C4J A;  2TRC P;  2DML A;  2MMN A;  4MCU A;  1SL1 B;  4V2M A;  4EC0 A;  2GQM A;  4AF2 A;  1PRX A;  4PQH A;  3WYW A;  2EC4 A;  4H86 A;  4KA0 A;  2IFQ A;  1DUG A;  6GSU A;  1MDJ A;  1XVQ A;  2LJR A;  2C1Y A;  3P7X A;  1A0R P;  5J3R A;  2C80 A;  3TCO A;  2LST A;  4G9H A;  3G7I A;  4V2N A;  2A2R A;  1RW1 A;  1QGV A;  3VWX A;  2VCZ A;  1T1V A;  1SL0 B;  6GSW A;  1K0B A;  1XIY A;  1UVZ A;  2QSI A;  3PH9 A;  4FO5 A;  3M9J A;  1JFU A;  5KN0 A;  1BG5 A;  4IBP A;  3ZVJ D;  4KB3 A;  5C04 A;  3VWU A;  1R26 A;  4J2F A;  2V2G A;  1A23 A;  3KH9 A;  3ZIT A;  3TDG A;  1JLW A;  5F05 A;  4KUN A;  5A5K A;  16GS A;  3ED3 A;  1GSS A;  12GS A;  5F06 A;  4AGS A;  3UOM A;  5B7C A;  3TRP A;  1Z3E A;  4TR1 B;  2YZU A;  3BBY A;  1V57 A;  4K2D A;  3QPM A;  3UJ1 A;  2CX3 A;  3GRX A;  2FCH A;  1J08 A;  3EYT A;  3I9V 2;  3E9J B;  3LXT A;  3CMI A;  5DAK B;  5B6N A;  3LWA A;  4YQV A;  2AAW A;  4MF5 A;  3TJF A;  5ECN B;  1GSE A;  2HZF A;  4G2E A;  3GIX A;  2P5Q A;  3M1G A;  3APS A;  1S3C A;  2HT9 A;  4YAV A;  4DSQ A;  4YH2 A;  2ALB A;  4NV2 A;  1CQG A;  3FY7 A;  2KHP A;  4OFM A;  1QXH A;  1EEJ A;  1Q98 A;  5FHI A;  4EL1 A;  1EGR A;  2K9F A;  3GSS A;  5E59 A;  3HCZ A;  3RDW A;  4POK A;  3TRQ A;  2HFD A;  2VCV A;  5G5E A;  2OBK A;  3V1W A;  1GUK A;  2IIY A;  2IME A;  4O7H A;  3ZML A;  4KX4 A;  2FUG 2;  2IN3 A;  2YJ7 A;  3PGT A;  1HNC A;  1PN9 A;  3N9J A;  5J9B A;  4POM A;  4GSS A;  5CO3 A;  4MH2 A;  2VM1 A;  4QL9 A;  1O8W A;  3LOR A;  5GZZ B;  2HXK A;  4ZL8 A;  4PUA A;  1XWK A;  1OKT A;  3H4K A;  4X1U A;  2L5L A;  2FHE A;  3D4M A;  2H71 A;  2PN8 A;  1HYU A;  7GSS A;  2CA8 A;  3RPP A;  3O3T A;  2N5F A;  2MMZ A;  2GTU A;  1K0A A;  4ID0 A;  2HLS A;  3D22 A;  5G31 A;  1JHB A;  2VCW A;  3WT2 A;  2GQL A;  1QMV A;  2H73 A;  2OE0 A;  1XW6 A;  1SD8 A;  5C00 A;  5CRH A;  1JZW A;  2M80 A;  2F3M A;  3IR4 A;  4P3Y B;  1WWJ A;  1XXU A;  4FH8 A;  4G10 A;  1XZO A;  1B4P A;  5ECS A;  1AC1 A;  3L78 A;  5AIX A;  2B1L A;  4MF6 A;  2H0H A;  1FVK A;  1ZZY A;  4GF0 A;  4MZB A;  4OFT A;  2LV3 A;  2FWH A;  1OC3 A;  3QAV A;  3KZQ A;  3HZ8 A;  4L5L A;  2KP2 A;  1SJI A;  2MBT A;  2QC7 A;  1LU4 A;  2L5O A;  3LYP A;  3MWH A;  5HQP A;  5JCU A;  4KDU A;  2CX4 A;  2WUL A;  2FWF A;  4HS1 A;  4MLY A;  3IAM 2;  5INY A;  2O8V B;  3CSH A;  1SKW B;  1FVJ A;  2RM5 A;  1WE0 A;  3F6D A;  3HA9 A;  2H01 A;  3C8E A;  4E8H A;  4ZL7 A;  4XRA A;  1FW1 A;  1ZOF A;  1X5D A;  4RUV A;  4HUA A;  2YNX A;  11GS A;  3TKP A;  4O32 A;  1GUM A;  3BD2 A;  1A8Y A;  1ML6 A;  1ON4 A;  4DSR A;  2KP1 A;  3E3E A;  3G9B A;  1PA3 A;  4ILF A;  2V32 A;  2X8G A;  1GTB A;  3WGE A;  3F4T A;  2PVO C;  1PSQ A;  1TRV A;  1XOA A;  4HZ2 A;  3P8W A;  1GSY A;  4XCS A;  2M72 A;  4XS4 B;  4I8B A;  3A2V A;  4ECJ A;  1EV4 A;  4N10 A;  2QKE A;  18GS A;  4NHW A;  5DBQ A;  2B7K A;  2R2J A;  1NM3 A;  1PX6 A;  2VLV A;  3LSZ A;  1HNA A;  2N5B A;  3KM6 A;  1V40 A;  4RQR A;  4EKZ A;  3M9K A;  1S3D A;  1AUC A;  4CDO A;  2DJK A;  5CAX A;  1N8J A;  3HVS A;  3IHQ A;  3D6I A;  3KXO A;  1QFN A;  2PU9 C;  3IK9 A;  1H75 A;  3FR6 A;  14GS A;  2B5E A;  8GSS A;  1BQ7 A;  4TN8 A;  1TK8 B;  3CBU A;  4LMV A;  2WGR A;  1ILO A;  3VI5 A;  2C0E A;  1WPI A;  4CW9 A;  1MEK A;  3GL5 A;  2VL2 A;  3QAG A;  4ISD A;  1X5C A;  3QR6 A;  1B9X C;  4LL1 B;  4ZBB A;  19GS A;  2KOK A;  5AIS A;  2OAD A;  1FB0 A;  4V2L A;  1TI3 A;  2YN1 A;  1F3B A;  4WET A;  5HR2 A;  3S9F A;  5DAL A;  1W4V A;  2YAN A;  1TW9 A;  4JU5 A;  3DIE A;  4K1F A;  2C0F A;  2VLU A;  2YWI A;  2VAF A;  3GYK A;  1ZYE A;  22GS A;  4PXO A;  3ZMK A;  4ECC A;  1E6B A;  3JCM L;  1BED A;  5G30 A;  2PGT A;  1Z7P A;  2DLX A;  2H75 A;  3GX8 A;  3EUR A;  1TU7 A;  4PQ1 A;  1F37 A;  3Q19 A;  1YDK A;  3O6T A;  3HZ4 A;  2GT5 A;  1RK4 A;  1U3I A;  3VPT A;  4N30 A;  2X64 A;  3UAR A;  2H66 A;  1IYH A;  2JU5 A;  1YZX A;  4O92 A;  1PX7 A;  4I2U A;  1K0D A;  5HR3 A;  4D73 B;  3RPN A;  1RQM A;  1X0R A;  3FZ5 A;  2Z9S A;  2WB9 A;  4HJ2 A;  3WGD A;  5G2Z A;  4RI6 A;  4QQ7 A;  1XOB A;  3ME8 A;  3ZFL A;  2WCI A;  5B8B A;  3H8Q A;  3MSZ A;  2H6X A;  3BCK A;  5ECR B;  1DE2 A;  1TI1 A;  3C71 A;  5D73 A;  3LG6 A;  2A2S A;  4WBJ A;  2VUP A;  2F8A A;  1H4O A;  1XFL A;  1MD3 A;  4KSM A;  1U87 A;  3L9U A;  2WZ9 A;  2DJ2 A;  5ECH B;  2AYT A;  1XWG A;  3ISO A;  1YEX A;  5GAN D;  1Y25 A;  1KNG A;  2H19 A;  1K3O A;  3PR8 A;  1GSU A;  3SBC A;  5B8A A;  3HYP A;  1SYR A;  1AQX A;  1G7E A;  3IE3 A;  3CXG A;  2VCT A;  3IA1 A;  2B3S A;  2IMD A;  17GS A;  1OC9 A;  4XRD A;  2L4Q A;  3HHV A;  4I5Q A;  3IC4 A;  3HD5 A;  2LRN A;  3CSI A;  5ECO B;  1MD4 A;  4TRX A;  4XS6 A;  2V6O A;  2GLR A;  1YQ1 A;  1G7O A;  4WR4 A;  1HNB A;  4NAX A;  2CAI A;  3FYG A;  1UA5 A;  1OKD A;  1USB A;  2PER A;  3TRX A;  3Q18 A;  5ID2 B;  1GRX A;  1F6M C;  1BX9 A;  4MP4 A;  5J9C A;  3FZ4 A;  4RI7 A;  4XHM A;  2CV4 A;  3UBK A;  3DXB A;  5IOX A;  3LFL A;  4Z7X A;  3QFA C;  1ZGN A;  2BTO T;  3ZVJ A;  1G6W A;  5DVB A;  2YWN A;  2YV9 A;  4MZC A;  3LYK A;  4BA7 A;  2X8C A;  2HRN A;  1YY7 A;  3LQ7 A;  1GTI A;  2E0Q A;  4NPB A;  1I9D A;  2XC2 A;  1GLP A;  1KEB A;  5J4U A;  2OBI A;  5G1K A;  3F8U A;  5F8B A;  4L0W A;  1J0F A;  2NDO A;  3GTU A;  2WFC A;  1EP7 A;  1GWC A;  2N5A A;  1SJZ A;  1TK5 B;  2X99 A;  2IJY A;  5DQS A;  3ERG A;  5B6M A;  3EU3 A;  4ZIL A;  4DSS B;  3GKN A;  4ULX A;  4KH7 A;  3GUS A;  1O6J A;  2ON7 A;  5A4V A;  2I9H A;  3LJR A;  5FT3 A;  4TR1 A;  1FHE A;  2H70 A;  3DYR A;  5LCZ A;  1K0O A;  3A2X A;  2AV4 A;  1N2A A;  4EO3 A;  2V6K A;  1V98 A;  5DAK A;  4PNG A;  1M9B A;  1F3A A;  2H1A A;  5DDL A;  3H1N A;  1HD2 A;  2YV7 A;  2K6V A;  5D9V A;  1GTA A;  1SL2 B;  4HDE A;  2IWT A;  2TIR A;  4PNF A;  2PUK C;  3FEU A;  1AAZ A;  4IP1 A;  4KSO A;  2YPM A;  4GLT A;  2P0G A;  4ML1 A;  3A5W A;  2CVB A;  3F4S A;  1X5E A;  2MZC A;  4GWR A;  1E2Y A;  5IMZ A;  3W8S A;  2VD1 A;  1U88 A;  3H93 A;  3IRA A;  4L0U A;  4HI7 A;  4JRR A;  3FR3 A;  3IOS A;  2XPD A;  3ERF A;  1A2L A;  3ZL5 A;  4XIH A;  3HVV A;  3D0Z A;  1V58 A;  4GSN A;  4LLR A;  4TXV A;  3IPZ A;  5CYY A;  4L8E A;  1U6T A;  1XVW A;  2YWO A;  3KD0 A;  2YZH A;  3GUR A;  4X0X A;  4IN0 A;  1GH2 A;  4PGT A;  5DCH A;  2DJJ A;  2JSZ A;  4OCE A;  4BWS A;  4GXZ A;  13GS A;  4JR6 A;  2O85 A;  1S3A A;  4TOP A;  1TTZ A;  4FYB A;  3IK7 A;  4AJ8 A;  2K18 A;  1G0T A;  2K8V A;  5HFK A;  3QFB C;  4MDC A;  3NOF A;  4TXO B;  2VL9 A;  3C7M A;  1G6Y A;  4BL7 A;  5IIZ A;  4TW5 A;  5D9W A;  2XBI A;  2LS5 A;  1VF3 A;  1ZL9 A;  4V1A g;  4K7I A;  4I6X A;  1THO A;  4F82 A;  1VF1 A;  4L5O A;  3KP8 A;  5ENU A;  4MPF A;  2B6M A;  1K0N A;  1O7U A;  4K0G A;  3TKR A;  3D4T A;  2LTK A;  2VCX A;  4KAE A;  1GSF A;  1PGT A;  1FB6 A;  1ZMA A;  1A2J A;  3HJP A;  6GSY A;  1X9W B;  5JCW A;  1OC8 A;  1ERV A;  4K8M A;  2L4C A;  1K0C A;  2JAD A;  4MPG A;  3FRC A;  2C0G A;  4OO4 A;  4J56 E;  1SKS B;  1XPV A;  2H30 A;  3M8N A;  3HVX A;  3DML A;  5ECL B;  3WD6 A;  1X9M B;  4OFN A;  3ZZX A;  5IO2 A;  5DQY A;  3CRT A;  1O81 A;  2HRF A;  2JAC A;  1B4Q A;  4BPY A;  2LNS A;  4IGJ A;  3CSJ A;  4RQX A;  1FOV A;  4NXI A;  5CRE A;  1C72 A;  2DJ1 A;  4GTU A;  3CYN A;  5HFG A;  4YQU A;  4WR5 A;  1GL8 A;  1M7T A;  1T4Z A;  3QD9 A; 
#chains in the Genus database with same CATH topology
 2WS2 A;  3ZIJ A;  4F03 A;  4EXJ A;  2LRC A;  1K0M A;  1R5A A;  2QA2 A;  4CY8 A;  3KH7 A;  4HQZ A;  2LUS A;  2JZT A;  3KCM A;  2C8U A;  1VGL A;  4EVM A;  2A4V A;  2GSQ A;  3U6V A;  2DSA A;  5D9X A;  1ZYP A;  1FAA A;  3DGQ A;  4F0C A;  5HR0 A;  4KDX A;  1K3Y A;  4USS A;  3HJO A;  3VFI A;  4MMM A;  1GTU A;  2PWJ A;  1OE8 A;  1M2A A;  2IPA A;  2IMI A;  1EEM A;  3GFK A;  4CHS A;  3L9S A;  2FNO A;  1OVN A;  2X8H A;  4XS4 A;  2AUV A;  3FHK A;  1Q4J A;  3NIV A;  2MMA A;  4MNN A;  2VLT A;  5LD0 A;  2HSY A;  1PKZ A;  1PMT A;  4OMV A;  1SJ6 A;  4FYC A;  6GSX A;  1M3I A;  5DJL A;  3EC3 A;  1QUW A;  2LEG A;  3RHC A;  1DE1 A;  2HI7 A;  5D9T A;  3FMW A;  6GSV A;  1TRU A;  3VK9 A;  4IEL A;  4XS1 A;  1WRY A;  3ME7 A;  2CQ9 A;  2DJ3 A;  1WMJ A;  2VL2 C;  1Z5Y E;  2H1G A;  1JLV A;  4QL7 A;  2KUC A;  1CQH A;  5IO0 A;  1PQN A;  4POL A;  1TRW A;  4K6X A;  2CT6 A;  3HDC A;  5ELA A;  5DJM A;  4EIP A;  2PPT A;  4AJ7 A;  2WJU A;  2YOI A;  3EIN A;  5L71 A;  4PUF C;  4MA9 A;  1J9B A;  1AQV A;  5DAL B;  2RUF A;  1UN2 A;  3DD3 A;  3GA4 A;  1TXX A;  2C3T A;  5ECQ B;  3DWV A;  1XW5 A;  2REM A;  4JBB A;  1ZCP A;  4OO5 A;  2OAC A;  3KTB A;  3P2A A;  3HJM A;  2GGT A;  4KF9 A;  1FOH A;  3GN3 A;  1THX A;  3F6F A;  2EIQ A;  4TR0 A;  2YWM A;  1SK0 A;  5KEJ A;  5LNK e;  1EOH A;  2EIR A;  3I6A A;  4KND A;  1NW2 A;  4XTS A;  1GSD A;  1Z6M A;  3KMO A;  4GST A;  3MDK A;  4V1A p;  2A2P A;  1EV9 A;  2R37 A;  5ELG A;  2BJX A;  3I69 A;  1T4Y A;  1B9Y C;  4YAP A;  1T7P B;  1JZD A;  1PD2 1;  2YCD A;  1ST9 A;  3UEM A;  3PPU A;  3TOT A;  2IL3 A;  2VIM A;  1OE7 A;  5CRG A;  4HOJ A;  4WF4 A;  1AXD A;  3KP9 A;  3M0F A;  3G7J A;  3TJG A;  1MDK A;  2NTO A;  2G0F A;  2HNL A;  1PL1 A;  2O7K A;  1B48 A;  3KIJ A;  2VM2 A;  3ERW A;  4K7O A;  3TB2 A;  4D73 A;  2OKA A;  3KMN A;  1AQW A;  4GQF A;  4ZB6 A;  6GSS A;  1JZR A;  1EOG A;  5IMD A;  4K9Z A;  4BVX B;  1GUL A;  2MMO A;  4KCA A;  3M3M A;  1TOF A;  2HZE B;  3UVH A;  1YKC A;  3FKF A;  3IHG A;  5COH A;  5CNW A;  5CRW A;  3C1S A;  5HR1 A;  4EUY A;  5GSS A;  2I81 A;  4J57 E;  5A4U A;  5ECP B;  5BMU A;  1NHO A;  2VO4 A;  1GSQ A;  2GQK A;  2PBJ A;  1XCC A;  1A24 A;  3IAS 2;  2HSH A;  5EY6 A;  3C1R A;  5EVO A;  4YKF A;  4E8E A;  1SKR B;  3TJK A;  3D21 A;  1T3B A;  2WDU A;  5E4W A;  5EPF A;  4NHZ A;  2NPB A;  1WP0 A;  2C3Q A;  2HE3 A;  1ERT A;  5CP1 A;  3VUR A;  3J7Y b;  4EF0 A;  2P5R A;  2L6D A;  2LJK A;  4O5U A;  4ECI A;  2D2Z A;  3MYD A;  3EMP A;  2DMM A;  3CRU A;  4OCF A;  5G1L A;  3EWL A;  5ECI B;  3Q74 A;  3WT1 A;  1EGO A;  5BRT A;  2OE1 A;  5JWQ B;  4X43 A;  2F51 A;  5AN1 A;  4WBR D;  2PVQ A;  5H5R A;  2IFQ B;  3OR5 A;  2IMF A;  4EE0 A;  4ECB A;  2RII A;  3APO A;  2GS3 A;  2H0I A;  4HU9 A;  5J41 A;  2B7J A;  3ZYW A;  1XG8 A;  5ID2 A;  2FLS A;  4OWY A;  4G19 A;  1DBY A;  3FZA A;  3CQF A;  1TDI A;  3RHB A;  4Q5R A;  3DEX A;  4G0L A;  4JED A;  1M9A A;  5AIV A;  2EIO A;  3ZFB A;  3QDN A;  6GST A;  1FG4 A;  1VRS D;  2O87 A;  1A0F A;  1Y6E A;  3GTU B;  3UL3 A;  2LKU A;  1I5G A;  5H5Q A;  5D96 A;  20GS A;  1A2M A;  3BOA A;  3F9U A;  4BVY A;  1YEP A;  2NBS A;  4MK3 A;  3UMA A;  3L9V A;  4IJI A;  2OE3 A;  3F0I A;  2I3Y A;  2TRX A;  5IOW A;  2V1M A;  1F9M A;  4HEA 2;  4POB A;  4DSS A;  5HFI A;  5IMC A;  2GDR A;  2I1U A;  4MJE A;  1YJ6 A;  2C3N A;  4ICY A;  2RUE A;  3A2W A;  2JL4 A;  2FD3 A;  3ZTL A;  3H79 A;  1LBK A;  3UAP A;  5ECM B;  2P31 A;  1PFO A;  1GLQ A;  3AY8 A;  3IBH A;  3ZIV A;  3LEF A;  3BCI A;  3GST A;  2V41 A;  3TKQ A;  4NV5 A;  9GSS A;  4MF7 A;  1M99 A;  3A3T A;  2H74 A;  4GRF A;  5IMA A;  4NWY A;  2E2G A;  2J9H A;  3VLN A;  3US3 A;  1TJD A;  3GNJ A;  4TKY A;  3KTL A;  2AHE A;  3NZN A;  4TVE A;  3F3Q A;  2YJH A;  4Q5N A;  3TJJ A;  2ZUP A;  2FWG A;  2XPE A;  4ZBA A;  3W6G A;  3GH6 A;  4IHU A;  3APQ A;  3EVI A;  4MH3 A;  2MBS A;  3KGK A;  2R6K A;  3SWL A;  4DEJ A;  2JZR A;  3O76 A;  3GKX A;  4MAB A;  3TKS C;  4IQA A;  5A4W A;  3TKS A;  3VPQ A;  4KDY A;  2XHF A;  3KEB A;  2XBQ A;  1WOU A;  3FW2 A;  1GUH A;  1R4W A;  4HQS A;  3ZRE A;  4Z2U A;  3FR9 A;  3RBT A;  4K5R A;  3L0H A;  5JWO B;  1ZYN A;  3P90 A;  1NHY A;  2X4A A;  2GT6 A;  4IP6 A;  3IXR A;  3GL3 A;  4HZ4 A;  1MDI A;  2GVP A;  3IV4 A;  3DRN A;  3F3R A;  5GST A;  3F4R A;  4IW9 A;  1TKD B;  1SYX A;  2MYG A;  1M2B A;  4Z2R A;  4TXO A;  1SD9 A;  2G2Q A;  1URM A;  2GZP A;  3Q6O A;  1LJR A;  5F07 A;  1F2E A;  1B8X A;  2OA7 A;  3W8J A;  3DKS A;  1PKW A;  2GST A;  4BWQ A;  2R5G A;  4X4J A;  5IM9 A;  4HU7 A;  1Z6N A;  2HSM A;  4PX1 A;  4PQI A;  3VWV A;  4MJB A;  1NSW A;  3TOU A;  4Z2T A;  2CZ2 A;  2ZNM A;  4IVF A;  4ZBD A;  2AJQ B;  1KTE A;  2UZ8 A;  1VF4 A;  3U5R E;  3PIN A;  1M2D A;  1Z9H A;  3TKS E;  1O73 A;  2JZS A;  1A8L A;  1XW9 A;  1O85 A;  2JSY A;  5ABR A;  2K8S A;  4TR4 A;  1IYI A;  1W89 A;  3FZ9 A;  1M0U A;  2L6C A;  3C73 A;  3R2Q A;  4N0V A;  5CRD A;  4F9Z A;  2CAQ A;  2QGV A;  3FK8 A;  3ZLP A;  1GNW A;  5JWR B;  3ZRD A;  2H8L A;  1WJK A;  2R4V A;  2R0P A;  4LL4 B;  5DCG A;  5JCG A;  1AW9 A;  2KLX A;  3D5J A;  1SEN A;  1T8E B;  4FIW A;  5IPH A;  2A4H A;  5AGY A;  1MTC A;  4ZIJ A;  4WKW A;  3GX0 A;  1QQ2 A;  1GP1 A;  2RM6 A;  4IJ3 A;  2CZ3 A;  2DJ0 A;  2GSR A;  5KN3 A;  1WIK A;  3HXS A;  4F0B A;  1PL2 A;  1ERW A;  4ZXG A;  4WEY A;  3QCP A;  5KN1 A;  5GAP D;  4OD7 A;  2E7P A;  2VL3 A;  3MNG A;  4HJM A;  1TU8 A;  2ES7 A;  5KN2 A;  3GMF A;  3F63 A;  4GQC A;  2L57 A;  4IS0 A;  3GV1 A;  3LGC A;  4LMW A;  2HYX A;  4AJ6 A;  4KGI A;  3TUE A;  1XWC A;  2J23 A;  1KBN A;  5D8I A;  2L59 A;  4ZL9 A;  1OYJ A;  3IDV A;  1U3A A;  3VWW A;  4LA1 A;  1O8X A;  1TK0 B;  1R5P A;  4KW6 A;  2I4A A;  2BMX A;  2LNT A;  2PMT A;  4O5R A;  3N5O A;  3K8N A;  1SK2 A;  1YF0 A;  3QAW A;  2H72 A;  3EU4 A;  1T00 A;  2GZY A;  3QOU A;  1BJX A;  4DVC A;  2DIZ A;  5IMV A;  2LQQ A;  1ZYQ B;  3WGX A;  2OJL A;  1Z7R A;  5D93 A;  2IMK A;  10GS A;  4MJC A;  4I97 A;  2VOC A;  4WXT A;  2F8F A;  4TR3 A;  2FA8 A;  3GKM A;  4IQ1 A;  3VI7 A;  2H76 A;  4IKH A;  1ABA A;  1TRS A;  4YKG A;  2GZZ A;  4YQM A;  2HRA A;  2H1B A;  3UBL A;  1SK1 A;  2CVD A;  4F2I A;  3LXZ A;  3TJB A;  4GCI A;  1EWX A;  2LQO A;  4KE3 A;  2ZCT A;  1UC7 A;  4MZW A;  1R7H A;  3UVT A;  1XWB A;  2FA4 A;  2LRT A;  5EL8 A;  1XWA A;  3QMX A;  1XBS A;  1YKA A;  3BJ5 A;  3GKK A;  2QA1 A;  4N11 A;  2B5X A;  5IMF A;  3RAZ A;  4FYU A;  2H0G A;  4MJA A;  1V2A A;  2ON5 A;  2DIY A;  4WF5 A;  5IPG A;  3DVX A;  1K3L A;  3GH9 A;  2F9S A;  3J7Y k;  1AIU A;  3MIX A;  3E0U A;  2FGX A;  4KCE A;  5J5N A;  1TP9 A;  2FY6 A;  2O89 A;  1VF2 A;  2RLI A;  2NVL A;  3DVW A;  1FO5 A;  1OAZ A;  3HVN A;  1ERU A;  2VCQ A;  3CTF A;  1M3J A;  3HKR A;  4ZB8 A;  3CTG A;  4EDZ A;  3I43 A;  3EMX A;  2VD0 A;  4BVX A;  5G5F A;  3G7Y A;  2LJA A;  1EZK A;  2WRT A;  2HZE A;  2DBC A;  4PUR A;  3GHA A;  4JR4 A;  2R3X A;  5IQY A;  4JE1 A;  1DSB A;  3KJY A;  5H5S A;  1ACV A;  2B1K A;  2E2M A;  2FWE A;  3HY2 A;  1SU9 A;  3TGZ A;  1BYE A;  5ECK B;  4NMU A;  2AB6 A;  5F0G A;  1X9S B;  4I2T A;  2CVK A;  4ML6 A;  2GSS A;  4N0Z A;  1GNE A;  2B5Y A;  4ZB9 A;  1QK8 A;  2H6Y A;  1OC9 B;  4JZQ A;  4ACS A;  4FQU A;  1EP8 A;  1JZO A;  2YP6 A;  2M46 A;  1V9W A;  1BAY A;  4EDY A;  3UIW A;  3L4N A;  5FWG A;  2C0D A;  1YF1 A;  1HQO A;  4Q5F A;  4K7N A;  2H1D A;  3EE2 A;  3MAK A;  2H6Z A;  4Q5Q A;  2DC5 A;  4K0N A;  2C4J A;  2TRC P;  2DML A;  2MMN A;  4MCU A;  4A5P A;  4V2M A;  1SL1 B;  4EC0 A;  2GQM A;  4AF2 A;  2DKI A;  1PRX A;  4PQH A;  3WYW A;  2EC4 A;  4H86 A;  4KA0 A;  2IFQ A;  1DUG A;  6GSU A;  1MDJ A;  1XVQ A;  2LJR A;  2C1Y A;  3P7X A;  1A0R P;  5J3R A;  2C80 A;  3TCO A;  2LST A;  4G9H A;  3G7I A;  4V2N A;  2A2R A;  1RW1 A;  1QGV A;  3VWX A;  2VCZ A;  1T1V A;  1SL0 B;  6GSW A;  1K0B A;  1XIY A;  1UVZ A;  2QSI A;  3PH9 A;  4FO5 A;  3M9J A;  1JFU A;  5KN0 A;  1BG5 A;  4IBP A;  3ZVJ D;  4KB3 A;  5C04 A;  3VWU A;  1R26 A;  4J2F A;  2V2G A;  1A23 A;  3KH9 A;  4BVY B;  3ZIT A;  3TDG A;  1JLW A;  5F05 A;  4KUN A;  5A5K A;  16GS A;  3ED3 A;  1GSS A;  12GS A;  5F06 A;  4AGS A;  3UOM A;  5B7C A;  3TRP A;  1Z3E A;  4TR1 B;  2YZU A;  3BBY A;  1V57 A;  4K2D A;  3QPM A;  3UJ1 A;  2CX3 A;  3GRX A;  4HSC X;  2FCH A;  1J08 A;  3EYT A;  3I9V 2;  3E9J B;  3LXT A;  3CMI A;  5DAK B;  5B6N A;  3LWA A;  4YQV A;  2AAW A;  4MF5 A;  3TJF A;  5ECN B;  1GSE A;  2HZF A;  4G2E A;  3GIX A;  2P5Q A;  3M1G A;  3APS A;  1S3C A;  2HT9 A;  4YAV A;  4CY6 A;  4DSQ A;  4YH2 A;  2ALB A;  4NV2 A;  1CQG A;  3FY7 A;  2KHP A;  4OFM A;  1QXH A;  1EEJ A;  1Q98 A;  5FHI A;  4EL1 A;  3IC8 A;  1EGR A;  2K9F A;  3GSS A;  5E59 A;  3HCZ A;  3RDW A;  4POK A;  3TRQ A;  2HFD A;  2VCV A;  5G5E A;  2OBK A;  3V1W A;  1GUK A;  2IIY A;  2IME A;  4O7H A;  3ZML A;  4KX4 A;  2FUG 2;  2IN3 A;  2YJ7 A;  3PGT A;  1HNC A;  1PN9 A;  3N9J A;  5J9B A;  4EIQ A;  4POM A;  4GSS A;  5CO3 A;  4MH2 A;  2VM1 A;  4QL9 A;  1O8W A;  3LOR A;  5GZZ B;  2HXK A;  4ZL8 A;  4PUA A;  1XWK A;  1OKT A;  3H4K A;  4X1U A;  2L5L A;  2R0G A;  2FHE A;  3D4M A;  4O5Q A;  2H71 A;  2PN8 A;  1HYU A;  7GSS A;  2CA8 A;  3RPP A;  3O3T A;  2N5F A;  2MMZ A;  2GTU A;  1K0A A;  4ID0 A;  4BL7 B;  2HLS A;  3D22 A;  5G31 A;  1JHB A;  2VCW A;  3WT2 A;  2GQL A;  1QMV A;  2H73 A;  2OE0 A;  1XW6 A;  1SD8 A;  5C00 A;  5CRH A;  1JZW A;  2M80 A;  2F3M A;  3IR4 A;  4P3Y B;  1WWJ A;  1XXU A;  4FH8 A;  4G10 A;  1XZO A;  1B4P A;  5ECS A;  1AC1 A;  3L78 A;  5AIX A;  2B1L A;  4MF6 A;  2H0H A;  1FVK A;  1ZZY A;  4GF0 A;  4MZB A;  4OFT A;  2LV3 A;  2FWH A;  1OC3 A;  3QAV A;  3KZQ A;  3HZ8 A;  4L5L A;  2KP2 A;  1SJI A;  2MBT A;  2QC7 A;  1LU4 A;  2L5O A;  3LYP A;  3MWH A;  5HQP A;  5JCU A;  4KDU A;  2CX4 A;  2WUL A;  2FWF A;  4HS1 A;  4MLY A;  3IAM 2;  5INY A;  2O8V B;  4G0K A;  3CSH A;  1SKW B;  1FVJ A;  2RM5 A;  1WE0 A;  3F6D A;  3HA9 A;  2H01 A;  3C8E A;  4E8H A;  4ZL7 A;  4XRA A;  1FW1 A;  1ZOF A;  1X5D A;  4RUV A;  4HUA A;  2YNX A;  11GS A;  3TKP A;  4O32 A;  1GUM A;  3BD2 A;  1A8Y A;  1ML6 A;  1ON4 A;  4DSR A;  2KP1 A;  3E3E A;  3G9B A;  1PA3 A;  4ILF A;  2V32 A;  2X8G A;  1GTB A;  3WGE A;  3F4T A;  2PVO C;  1PSQ A;  1TRV A;  1XOA A;  4HZ2 A;  3P8W A;  1GSY A;  4XCS A;  2M72 A;  4XS4 B;  4I8B A;  3A2V A;  4ECJ A;  1EV4 A;  4N10 A;  2QKE A;  18GS A;  4NHW A;  5DBQ A;  2B7K A;  2R2J A;  1NM3 A;  1PX6 A;  2VLV A;  3LSZ A;  1HNA A;  2N5B A;  3KM6 A;  1V40 A;  4RQR A;  4EKZ A;  3M9K A;  1S3D A;  1AUC A;  4CDO A;  2DJK A;  5CAX A;  1N8J A;  3HVS A;  3IHQ A;  3D6I A;  3KXO A;  1QFN A;  2PU9 C;  3IK9 A;  1H75 A;  3FR6 A;  14GS A;  2B5E A;  8GSS A;  1BQ7 A;  3A5I A;  4TN8 A;  1TK8 B;  3CBU A;  4LMV A;  2WGR A;  1ILO A;  3VI5 A;  2C0E A;  4PTS A;  1WPI A;  4CW9 A;  1MEK A;  3GL5 A;  2VL2 A;  3QAG A;  4ISD A;  1X5C A;  3QR6 A;  1B9X C;  4LL1 B;  4ZBB A;  19GS A;  2KOK A;  5AIS A;  2OAD A;  1FB0 A;  4V2L A;  1TI3 A;  2YN1 A;  1F3B A;  4WET A;  5HR2 A;  3S9F A;  5DAL A;  1W4V A;  2YAN A;  2R0C A;  1TW9 A;  4JU5 A;  3DIE A;  4K1F A;  2C0F A;  2VLU A;  2YWI A;  2VAF A;  3GYK A;  1ZYE A;  22GS A;  4PXO A;  3ZMK A;  4ECC A;  1E6B A;  3JCM L;  1BED A;  5G30 A;  2PGT A;  1Z7P A;  2DLX A;  2H75 A;  3GX8 A;  3EUR A;  1TU7 A;  4PQ1 A;  1F37 A;  3Q19 A;  1YDK A;  5KOW A;  3O6T A;  3HZ4 A;  2GT5 A;  1RK4 A;  1U3I A;  3VPT A;  4N30 A;  2X64 A;  3UAR A;  2H66 A;  1IYH A;  2JU5 A;  1YZX A;  4O92 A;  1PX7 A;  4I2U A;  1K0D A;  5HR3 A;  4D73 B;  3RPN A;  1RQM A;  1X0R A;  3FZ5 A;  2Z9S A;  2WB9 A;  4HJ2 A;  3WGD A;  5G2Z A;  4RI6 A;  4QQ7 A;  1XOB A;  3ME8 A;  3ZFL A;  2WCI A;  5B8B A;  2X49 A;  3H8Q A;  3MSZ A;  2H6X A;  3BCK A;  5ECR B;  1DE2 A;  1TI1 A;  1PN0 A;  3C71 A;  5D73 A;  3LG6 A;  2A2S A;  4WBJ A;  2VUP A;  2F8A A;  1H4O A;  1XFL A;  1MD3 A;  4KSM A;  1U87 A;  3L9U A;  2WZ9 A;  2DJ2 A;  5ECH B;  2AYT A;  1XWG A;  3ISO A;  1YEX A;  5GAN D;  1Y25 A;  1KNG A;  2H19 A;  1K3O A;  3PR8 A;  1GSU A;  3SBC A;  5B8A A;  3HYP A;  1SYR A;  1AQX A;  1G7E A;  3IE3 A;  3CXG A;  2VCT A;  3IA1 A;  2B3S A;  2IMD A;  17GS A;  1OC9 A;  4XRD A;  2L4Q A;  3HHV A;  4I5Q A;  3IC4 A;  3HD5 A;  2LRN A;  3CSI A;  5ECO B;  1MD4 A;  4TRX A;  4XS6 A;  2V6O A;  2GLR A;  1YQ1 A;  1G7O A;  4WR4 A;  1HNB A;  4NAX A;  2CAI A;  3FYG A;  1UA5 A;  1OKD A;  1USB A;  2PER A;  3TRX A;  3Q18 A;  5ID2 B;  1GRX A;  1F6M C;  1BX9 A;  4MP4 A;  5J9C A;  3FZ4 A;  4RI7 A;  4XHM A;  2CV4 A;  3UBK A;  3DXB A;  5IOX A;  3LFL A;  4Z7X A;  3QFA C;  1ZGN A;  2BTO T;  3ZVJ A;  1G6W A;  5DVB A;  2YWN A;  2YV9 A;  4MZC A;  3LYK A;  3EPT A;  4BA7 A;  2X8C A;  2HRN A;  1YY7 A;  3LQ7 A;  1GTI A;  2E0Q A;  4NPB A;  1I9D A;  2XC2 A;  1GLP A;  1KEB A;  5J4U A;  2OBI A;  4K5S A;  5G1K A;  3F8U A;  5F8B A;  4L0W A;  1J0F A;  2NDO A;  3GTU A;  2WFC A;  1EP7 A;  1GWC A;  2N5A A;  1SJZ A;  1TK5 B;  2DKH A;  2IJY A;  2X99 A;  5DQS A;  3ERG A;  5B6M A;  3EU3 A;  4ZIL A;  4DSS B;  3GKN A;  4ULX A;  4KH7 A;  3GUS A;  1O6J A;  2ON7 A;  5A4V A;  2I9H A;  3LJR A;  5FT3 A;  4TR1 A;  1FHE A;  2H70 A;  3DYR A;  5LCZ A;  1K0O A;  3A2X A;  2AV4 A;  1N2A A;  4EO3 A;  2V6K A;  1V98 A;  5DAK A;  4PNG A;  1M9B A;  5KOX A;  1F3A A;  2H1A A;  5DDL A;  3H1N A;  1HD2 A;  2HRK A;  3LW9 A;  2YV7 A;  2K6V A;  5D9V A;  1GTA A;  1SL2 B;  4HDE A;  2IWT A;  2TIR A;  4PNF A;  2PUK C;  3FEU A;  1AAZ A;  4IP1 A;  4KSO A;  2YPM A;  4GLT A;  2P0G A;  4ML1 A;  3A5W A;  2CVB A;  3F4S A;  1X5E A;  2MZC A;  4GWR A;  1E2Y A;  5IMZ A;  3W8S A;  2VD1 A;  4G0I A;  1U88 A;  3H93 A;  3IRA A;  4L0U A;  4HI7 A;  4JRR A;  3FR3 A;  3IOS A;  2XPD A;  3ERF A;  1A2L A;  3ZL5 A;  4XIH A;  3HVV A;  3D0Z A;  1V58 A;  4GSN A;  4LLR A;  4TXV A;  3IPZ A;  5CYY A;  4L8E A;  1U6T A;  1XVW A;  2YWO A;  3KD0 A;  2YZH A;  3GUR A;  4X0X A;  4IN0 A;  1GH2 A;  4PGT A;  5DCH A;  2DJJ A;  2JSZ A;  4OCE A;  4BWS A;  4GXZ A;  13GS A;  4JR6 A;  2O85 A;  1S3A A;  4TOP A;  1TTZ A;  4FYB A;  3IK7 A;  4AJ8 A;  2K18 A;  1G0T A;  2K8V A;  5HFK A;  3QFB C;  4MDC A;  3NOF A;  4TXO B;  2VL9 A;  3C7M A;  1G6Y A;  4BL7 A;  5IIZ A;  4TW5 A;  5D9W A;  2XBI A;  2LS5 A;  1VF3 A;  1ZL9 A;  4V1A g;  4K7I A;  4I6X A;  1THO A;  3R3E A;  4F82 A;  1VF1 A;  4L5O A;  3KP8 A;  5ENU A;  4MPF A;  2B6M A;  1K0N A;  1O7U A;  4K0G A;  3TKR A;  3D4T A;  2LTK A;  2VCX A;  4KAE A;  1GSF A;  1PGT A;  1FB6 A;  1ZMA A;  1A2J A;  3HJP A;  4K2X A;  6GSY A;  1X9W B;  5JCW A;  1OC8 A;  1ERV A;  4K8M A;  2L4C A;  1K0C A;  2JAD A;  4MPG A;  3FRC A;  4BIK A;  2C0G A;  4OO4 A;  4J56 E;  1SKS B;  1XPV A;  2H30 A;  3M8N A;  3HVX A;  3DML A;  5ECL B;  3WD6 A;  1X9M B;  4OFN A;  3ZZX A;  1S3R A;  5IO2 A;  5DQY A;  3CRT A;  1O81 A;  2HRF A;  2JAC A;  1B4Q A;  4BPY A;  2LNS A;  4IGJ A;  3CSJ A;  4RQX A;  1FOV A;  4NXI A;  5CRE A;  1C72 A;  2DJ1 A;  4GTU A;  3CYN A;  5HFG A;  4YQU A;  4WR5 A;  1GL8 A;  1M7T A;  1T4Z A;  3QD9 A; 
#chains in the Genus database with same CATH homology
 2WS2 A;  3ZIJ A;  4F03 A;  4EXJ A;  2LRC A;  1K0M A;  1R5A A;  2QA2 A;  4CY8 A;  3KH7 A;  4HQZ A;  2LUS A;  2JZT A;  3KCM A;  2C8U A;  1VGL A;  4EVM A;  2A4V A;  2GSQ A;  3U6V A;  2DSA A;  5D9X A;  1ZYP A;  1FAA A;  3DGQ A;  4F0C A;  5HR0 A;  4KDX A;  1K3Y A;  4USS A;  3HJO A;  3VFI A;  4MMM A;  1GTU A;  2PWJ A;  1OE8 A;  1M2A A;  2IPA A;  2IMI A;  1EEM A;  3GFK A;  4CHS A;  3L9S A;  2FNO A;  1OVN A;  2X8H A;  4XS4 A;  2AUV A;  3FHK A;  1Q4J A;  3NIV A;  2MMA A;  4MNN A;  2VLT A;  5LD0 A;  2HSY A;  1PKZ A;  1PMT A;  4OMV A;  1SJ6 A;  4FYC A;  6GSX A;  5DJL A;  3EC3 A;  1QUW A;  2LEG A;  3RHC A;  1DE1 A;  2HI7 A;  5D9T A;  3FMW A;  6GSV A;  1TRU A;  3VK9 A;  4IEL A;  4XS1 A;  1WRY A;  3ME7 A;  2CQ9 A;  2DJ3 A;  1WMJ A;  2VL2 C;  1Z5Y E;  2H1G A;  1JLV A;  4QL7 A;  2KUC A;  1CQH A;  5IO0 A;  1PQN A;  4POL A;  1TRW A;  4K6X A;  2CT6 A;  3HDC A;  5ELA A;  5DJM A;  4EIP A;  2PPT A;  4AJ7 A;  2WJU A;  2YOI A;  3EIN A;  5L71 A;  4PUF C;  4MA9 A;  1J9B A;  1AQV A;  5DAL B;  2RUF A;  1UN2 A;  3DD3 A;  3GA4 A;  1TXX A;  2C3T A;  5ECQ B;  3DWV A;  1XW5 A;  2REM A;  4JBB A;  1ZCP A;  4OO5 A;  2OAC A;  3KTB A;  3P2A A;  3HJM A;  2GGT A;  4KF9 A;  1FOH A;  3GN3 A;  1THX A;  3F6F A;  2EIQ A;  4TR0 A;  2YWM A;  1SK0 A;  5KEJ A;  5LNK e;  1EOH A;  2EIR A;  3I6A A;  4KND A;  1NW2 A;  4XTS A;  1GSD A;  1Z6M A;  3KMO A;  4GST A;  3MDK A;  4V1A p;  2A2P A;  1EV9 A;  2R37 A;  5ELG A;  2BJX A;  3I69 A;  1T4Y A;  1B9Y C;  4YAP A;  1T7P B;  1JZD A;  1PD2 1;  2YCD A;  1ST9 A;  3UEM A;  3PPU A;  3TOT A;  2IL3 A;  2VIM A;  1OE7 A;  5CRG A;  4HOJ A;  4WF4 A;  1AXD A;  3KP9 A;  3M0F A;  3G7J A;  3TJG A;  1MDK A;  2NTO A;  2G0F A;  2HNL A;  1PL1 A;  2O7K A;  1B48 A;  3KIJ A;  2VM2 A;  3ERW A;  4K7O A;  3TB2 A;  4D73 A;  2OKA A;  3KMN A;  1AQW A;  4GQF A;  4ZB6 A;  6GSS A;  1JZR A;  1EOG A;  5IMD A;  4K9Z A;  4BVX B;  1GUL A;  2MMO A;  4KCA A;  3M3M A;  1TOF A;  2HZE B;  3UVH A;  1YKC A;  3FKF A;  3IHG A;  5COH A;  5CNW A;  5CRW A;  3C1S A;  5HR1 A;  4EUY A;  5GSS A;  2I81 A;  4J57 E;  5A4U A;  5ECP B;  5BMU A;  1NHO A;  2VO4 A;  1GSQ A;  2GQK A;  2PBJ A;  1XCC A;  1A24 A;  3IAS 2;  2HSH A;  5EY6 A;  3C1R A;  5EVO A;  4YKF A;  4E8E A;  1SKR B;  3TJK A;  3D21 A;  1T3B A;  2WDU A;  5E4W A;  5EPF A;  4NHZ A;  2NPB A;  1WP0 A;  2C3Q A;  2HE3 A;  1ERT A;  5CP1 A;  3VUR A;  3J7Y b;  4EF0 A;  2P5R A;  2L6D A;  2LJK A;  4O5U A;  4ECI A;  2D2Z A;  3MYD A;  3EMP A;  2DMM A;  3CRU A;  4OCF A;  5G1L A;  3EWL A;  5ECI B;  3Q74 A;  3WT1 A;  1EGO A;  5BRT A;  2OE1 A;  5JWQ B;  4X43 A;  2F51 A;  5AN1 A;  4WBR D;  2PVQ A;  5H5R A;  2IFQ B;  3OR5 A;  2IMF A;  4EE0 A;  4ECB A;  2RII A;  3APO A;  2GS3 A;  2H0I A;  4HU9 A;  5J41 A;  2B7J A;  3ZYW A;  5ID2 A;  2FLS A;  4OWY A;  4G19 A;  1DBY A;  3FZA A;  1TDI A;  3RHB A;  4Q5R A;  3DEX A;  4G0L A;  4JED A;  1M9A A;  5AIV A;  2EIO A;  3ZFB A;  3QDN A;  6GST A;  1FG4 A;  1VRS D;  2O87 A;  1A0F A;  1Y6E A;  3GTU B;  3UL3 A;  2LKU A;  1I5G A;  5H5Q A;  5D96 A;  20GS A;  1A2M A;  3BOA A;  3F9U A;  4BVY A;  1YEP A;  2NBS A;  4MK3 A;  3UMA A;  3L9V A;  4IJI A;  2OE3 A;  3F0I A;  2I3Y A;  2TRX A;  5IOW A;  2V1M A;  1F9M A;  4HEA 2;  4POB A;  4DSS A;  5HFI A;  5IMC A;  2GDR A;  2I1U A;  4MJE A;  1YJ6 A;  2C3N A;  4ICY A;  2RUE A;  3A2W A;  2JL4 A;  2FD3 A;  3ZTL A;  3H79 A;  1LBK A;  3UAP A;  5ECM B;  2P31 A;  1GLQ A;  3AY8 A;  3IBH A;  3ZIV A;  3LEF A;  3BCI A;  3GST A;  2V41 A;  3TKQ A;  4NV5 A;  9GSS A;  4MF7 A;  1M99 A;  3A3T A;  2H74 A;  4GRF A;  5IMA A;  4NWY A;  2E2G A;  2J9H A;  3VLN A;  3US3 A;  1TJD A;  3GNJ A;  4TKY A;  3KTL A;  2AHE A;  3NZN A;  4TVE A;  3F3Q A;  2YJH A;  4Q5N A;  3TJJ A;  2ZUP A;  2FWG A;  2XPE A;  4ZBA A;  3W6G A;  3GH6 A;  4IHU A;  3APQ A;  3EVI A;  4MH3 A;  2MBS A;  3KGK A;  2R6K A;  3SWL A;  4DEJ A;  2JZR A;  3O76 A;  3GKX A;  4MAB A;  3TKS C;  4IQA A;  5A4W A;  3TKS A;  3VPQ A;  4KDY A;  2XHF A;  3KEB A;  2XBQ A;  1WOU A;  3FW2 A;  1GUH A;  1R4W A;  4HQS A;  3ZRE A;  4Z2U A;  3FR9 A;  3RBT A;  4K5R A;  3L0H A;  5JWO B;  1ZYN A;  3P90 A;  1NHY A;  2X4A A;  2GT6 A;  4IP6 A;  3IXR A;  3GL3 A;  4HZ4 A;  1MDI A;  2GVP A;  3IV4 A;  3DRN A;  3F3R A;  5GST A;  3F4R A;  4IW9 A;  1TKD B;  1SYX A;  2MYG A;  1M2B A;  4Z2R A;  4TXO A;  1SD9 A;  2G2Q A;  1URM A;  2GZP A;  3Q6O A;  1LJR A;  5F07 A;  1F2E A;  1B8X A;  2OA7 A;  3W8J A;  3DKS A;  1PKW A;  2GST A;  4BWQ A;  2R5G A;  4X4J A;  5IM9 A;  4HU7 A;  1Z6N A;  2HSM A;  4PX1 A;  4PQI A;  3VWV A;  4MJB A;  1NSW A;  3TOU A;  4Z2T A;  2CZ2 A;  2ZNM A;  4IVF A;  4ZBD A;  2AJQ B;  1KTE A;  2UZ8 A;  1VF4 A;  3U5R E;  3PIN A;  1M2D A;  1Z9H A;  3TKS E;  1O73 A;  2JZS A;  1A8L A;  1XW9 A;  1O85 A;  2JSY A;  5ABR A;  2K8S A;  4TR4 A;  1IYI A;  1W89 A;  3FZ9 A;  1M0U A;  2L6C A;  3C73 A;  3R2Q A;  4N0V A;  5CRD A;  4F9Z A;  2CAQ A;  2QGV A;  3FK8 A;  3ZLP A;  1GNW A;  5JWR B;  3ZRD A;  2H8L A;  1WJK A;  2R4V A;  2R0P A;  4LL4 B;  5DCG A;  5JCG A;  1AW9 A;  2KLX A;  3D5J A;  1SEN A;  1T8E B;  4FIW A;  5IPH A;  2A4H A;  5AGY A;  1MTC A;  4ZIJ A;  4WKW A;  3GX0 A;  1QQ2 A;  1GP1 A;  2RM6 A;  4IJ3 A;  2CZ3 A;  2DJ0 A;  2GSR A;  5KN3 A;  1WIK A;  3HXS A;  4F0B A;  1PL2 A;  1ERW A;  4ZXG A;  4WEY A;  3QCP A;  5KN1 A;  5GAP D;  4OD7 A;  2E7P A;  2VL3 A;  3MNG A;  4HJM A;  1TU8 A;  2ES7 A;  5KN2 A;  3GMF A;  3F63 A;  4GQC A;  2L57 A;  4IS0 A;  3GV1 A;  3LGC A;  4LMW A;  2HYX A;  4AJ6 A;  4KGI A;  3TUE A;  1XWC A;  2J23 A;  1KBN A;  5D8I A;  2L59 A;  4ZL9 A;  1OYJ A;  3IDV A;  1U3A A;  3VWW A;  4LA1 A;  1O8X A;  1TK0 B;  1R5P A;  4KW6 A;  2I4A A;  2BMX A;  2LNT A;  2PMT A;  4O5R A;  3N5O A;  3K8N A;  1SK2 A;  1YF0 A;  3QAW A;  2H72 A;  3EU4 A;  1T00 A;  2GZY A;  3QOU A;  1BJX A;  4DVC A;  2DIZ A;  5IMV A;  2LQQ A;  1ZYQ B;  3WGX A;  2OJL A;  1Z7R A;  5D93 A;  2IMK A;  10GS A;  4MJC A;  4I97 A;  2VOC A;  4WXT A;  2F8F A;  4TR3 A;  2FA8 A;  3GKM A;  4IQ1 A;  3VI7 A;  2H76 A;  4IKH A;  1ABA A;  1TRS A;  4YKG A;  2GZZ A;  4YQM A;  2HRA A;  2H1B A;  3UBL A;  1SK1 A;  2CVD A;  4F2I A;  3LXZ A;  3TJB A;  4GCI A;  1EWX A;  2LQO A;  4KE3 A;  2ZCT A;  1UC7 A;  4MZW A;  1R7H A;  3UVT A;  1XWB A;  2FA4 A;  2LRT A;  5EL8 A;  1XWA A;  3QMX A;  1XBS A;  1YKA A;  3BJ5 A;  3GKK A;  2QA1 A;  4N11 A;  2B5X A;  5IMF A;  3RAZ A;  4FYU A;  2H0G A;  4MJA A;  1V2A A;  2ON5 A;  2DIY A;  4WF5 A;  5IPG A;  3DVX A;  1K3L A;  3GH9 A;  2F9S A;  3J7Y k;  1AIU A;  3MIX A;  3E0U A;  2FGX A;  4KCE A;  5J5N A;  1TP9 A;  2FY6 A;  2O89 A;  1VF2 A;  2RLI A;  2NVL A;  3DVW A;  1FO5 A;  1OAZ A;  1ERU A;  2VCQ A;  3CTF A;  3HKR A;  4ZB8 A;  3CTG A;  4EDZ A;  3I43 A;  3EMX A;  2VD0 A;  4BVX A;  5G5F A;  3G7Y A;  2LJA A;  1EZK A;  2WRT A;  2HZE A;  2DBC A;  4PUR A;  3GHA A;  4JR4 A;  2R3X A;  5IQY A;  4JE1 A;  1DSB A;  3KJY A;  5H5S A;  1ACV A;  2B1K A;  2E2M A;  2FWE A;  3HY2 A;  1SU9 A;  3TGZ A;  1BYE A;  5ECK B;  4NMU A;  2AB6 A;  5F0G A;  1X9S B;  4I2T A;  2CVK A;  4ML6 A;  2GSS A;  4N0Z A;  1GNE A;  2B5Y A;  4ZB9 A;  1QK8 A;  2H6Y A;  1OC9 B;  4JZQ A;  4ACS A;  4FQU A;  1EP8 A;  1JZO A;  2YP6 A;  2M46 A;  1V9W A;  1BAY A;  4EDY A;  3UIW A;  3L4N A;  5FWG A;  2C0D A;  1YF1 A;  1HQO A;  4Q5F A;  4K7N A;  2H1D A;  3EE2 A;  3MAK A;  2H6Z A;  4Q5Q A;  2DC5 A;  4K0N A;  2C4J A;  2TRC P;  2DML A;  2MMN A;  4MCU A;  4A5P A;  4V2M A;  1SL1 B;  4EC0 A;  2GQM A;  4AF2 A;  2DKI A;  1PRX A;  4PQH A;  3WYW A;  2EC4 A;  4H86 A;  4KA0 A;  2IFQ A;  1DUG A;  6GSU A;  1MDJ A;  1XVQ A;  2LJR A;  2C1Y A;  3P7X A;  1A0R P;  5J3R A;  2C80 A;  3TCO A;  2LST A;  4G9H A;  3G7I A;  4V2N A;  2A2R A;  1RW1 A;  1QGV A;  3VWX A;  2VCZ A;  1T1V A;  1SL0 B;  6GSW A;  1K0B A;  1XIY A;  1UVZ A;  2QSI A;  3PH9 A;  4FO5 A;  3M9J A;  1JFU A;  5KN0 A;  1BG5 A;  4IBP A;  3ZVJ D;  4KB3 A;  5C04 A;  3VWU A;  1R26 A;  4J2F A;  2V2G A;  1A23 A;  3KH9 A;  4BVY B;  3ZIT A;  3TDG A;  1JLW A;  5F05 A;  4KUN A;  5A5K A;  16GS A;  3ED3 A;  1GSS A;  12GS A;  5F06 A;  4AGS A;  3UOM A;  5B7C A;  3TRP A;  1Z3E A;  4TR1 B;  2YZU A;  3BBY A;  1V57 A;  4K2D A;  3QPM A;  3UJ1 A;  2CX3 A;  3GRX A;  2FCH A;  1J08 A;  3EYT A;  3I9V 2;  3E9J B;  3LXT A;  3CMI A;  5DAK B;  5B6N A;  3LWA A;  4YQV A;  2AAW A;  4MF5 A;  3TJF A;  5ECN B;  1GSE A;  2HZF A;  4G2E A;  3GIX A;  2P5Q A;  3M1G A;  3APS A;  1S3C A;  2HT9 A;  4YAV A;  4CY6 A;  4DSQ A;  4YH2 A;  2ALB A;  4NV2 A;  1CQG A;  3FY7 A;  2KHP A;  4OFM A;  1QXH A;  1EEJ A;  1Q98 A;  5FHI A;  4EL1 A;  3IC8 A;  1EGR A;  2K9F A;  3GSS A;  5E59 A;  3HCZ A;  3RDW A;  4POK A;  3TRQ A;  2HFD A;  2VCV A;  5G5E A;  2OBK A;  3V1W A;  1GUK A;  2IIY A;  2IME A;  4O7H A;  3ZML A;  4KX4 A;  2FUG 2;  2IN3 A;  2YJ7 A;  3PGT A;  1HNC A;  1PN9 A;  3N9J A;  5J9B A;  4EIQ A;  4POM A;  4GSS A;  5CO3 A;  4MH2 A;  2VM1 A;  4QL9 A;  1O8W A;  3LOR A;  5GZZ B;  2HXK A;  4ZL8 A;  4PUA A;  1XWK A;  1OKT A;  3H4K A;  4X1U A;  2L5L A;  2R0G A;  2FHE A;  3D4M A;  4O5Q A;  2H71 A;  2PN8 A;  1HYU A;  7GSS A;  2CA8 A;  3RPP A;  3O3T A;  2N5F A;  2MMZ A;  2GTU A;  1K0A A;  4ID0 A;  4BL7 B;  2HLS A;  3D22 A;  5G31 A;  1JHB A;  2VCW A;  3WT2 A;  2GQL A;  1QMV A;  2H73 A;  2OE0 A;  1XW6 A;  1SD8 A;  5C00 A;  5CRH A;  1JZW A;  2M80 A;  2F3M A;  3IR4 A;  4P3Y B;  1WWJ A;  1XXU A;  4FH8 A;  4G10 A;  1XZO A;  1B4P A;  5ECS A;  1AC1 A;  3L78 A;  5AIX A;  2B1L A;  4MF6 A;  2H0H A;  1FVK A;  1ZZY A;  4GF0 A;  4MZB A;  4OFT A;  2LV3 A;  2FWH A;  1OC3 A;  3QAV A;  3KZQ A;  3HZ8 A;  4L5L A;  2KP2 A;  1SJI A;  2MBT A;  2QC7 A;  1LU4 A;  2L5O A;  3LYP A;  3MWH A;  5HQP A;  5JCU A;  4KDU A;  2CX4 A;  2WUL A;  2FWF A;  4HS1 A;  4MLY A;  3IAM 2;  5INY A;  2O8V B;  4G0K A;  3CSH A;  1SKW B;  1FVJ A;  2RM5 A;  1WE0 A;  3F6D A;  3HA9 A;  2H01 A;  3C8E A;  4E8H A;  4ZL7 A;  4XRA A;  1FW1 A;  1ZOF A;  1X5D A;  4RUV A;  4HUA A;  2YNX A;  11GS A;  3TKP A;  4O32 A;  1GUM A;  3BD2 A;  1A8Y A;  1ML6 A;  1ON4 A;  4DSR A;  2KP1 A;  3E3E A;  3G9B A;  1PA3 A;  4ILF A;  2V32 A;  2X8G A;  1GTB A;  3WGE A;  3F4T A;  2PVO C;  1PSQ A;  1TRV A;  1XOA A;  4HZ2 A;  3P8W A;  1GSY A;  4XCS A;  2M72 A;  4XS4 B;  4I8B A;  3A2V A;  4ECJ A;  1EV4 A;  4N10 A;  2QKE A;  18GS A;  4NHW A;  5DBQ A;  2B7K A;  2R2J A;  1NM3 A;  1PX6 A;  2VLV A;  3LSZ A;  1HNA A;  2N5B A;  3KM6 A;  1V40 A;  4RQR A;  4EKZ A;  3M9K A;  1S3D A;  1AUC A;  4CDO A;  2DJK A;  5CAX A;  1N8J A;  3HVS A;  3IHQ A;  3D6I A;  3KXO A;  1QFN A;  2PU9 C;  3IK9 A;  1H75 A;  3FR6 A;  14GS A;  2B5E A;  8GSS A;  1BQ7 A;  3A5I A;  4TN8 A;  1TK8 B;  3CBU A;  4LMV A;  2WGR A;  1ILO A;  3VI5 A;  2C0E A;  4PTS A;  1WPI A;  4CW9 A;  1MEK A;  3GL5 A;  2VL2 A;  3QAG A;  4ISD A;  1X5C A;  3QR6 A;  1B9X C;  4LL1 B;  4ZBB A;  19GS A;  2KOK A;  5AIS A;  2OAD A;  1FB0 A;  4V2L A;  1TI3 A;  2YN1 A;  1F3B A;  4WET A;  5HR2 A;  3S9F A;  5DAL A;  1W4V A;  2YAN A;  2R0C A;  1TW9 A;  4JU5 A;  3DIE A;  4K1F A;  2C0F A;  2VLU A;  2YWI A;  2VAF A;  3GYK A;  1ZYE A;  22GS A;  4PXO A;  3ZMK A;  4ECC A;  1E6B A;  3JCM L;  1BED A;  5G30 A;  2PGT A;  1Z7P A;  2DLX A;  2H75 A;  3GX8 A;  3EUR A;  1TU7 A;  4PQ1 A;  1F37 A;  3Q19 A;  1YDK A;  5KOW A;  3O6T A;  3HZ4 A;  2GT5 A;  1RK4 A;  1U3I A;  3VPT A;  4N30 A;  2X64 A;  3UAR A;  2H66 A;  1IYH A;  2JU5 A;  1YZX A;  4O92 A;  1PX7 A;  4I2U A;  1K0D A;  5HR3 A;  4D73 B;  3RPN A;  1RQM A;  1X0R A;  3FZ5 A;  2Z9S A;  2WB9 A;  4HJ2 A;  3WGD A;  5G2Z A;  4RI6 A;  4QQ7 A;  1XOB A;  3ME8 A;  3ZFL A;  2WCI A;  5B8B A;  2X49 A;  3H8Q A;  3MSZ A;  2H6X A;  3BCK A;  5ECR B;  1DE2 A;  1TI1 A;  1PN0 A;  3C71 A;  5D73 A;  3LG6 A;  2A2S A;  4WBJ A;  2VUP A;  2F8A A;  1H4O A;  1XFL A;  1MD3 A;  4KSM A;  1U87 A;  3L9U A;  2WZ9 A;  2DJ2 A;  5ECH B;  2AYT A;  1XWG A;  3ISO A;  1YEX A;  5GAN D;  1Y25 A;  1KNG A;  2H19 A;  1K3O A;  3PR8 A;  1GSU A;  3SBC A;  5B8A A;  3HYP A;  1SYR A;  1AQX A;  1G7E A;  3IE3 A;  3CXG A;  2VCT A;  3IA1 A;  2B3S A;  2IMD A;  17GS A;  1OC9 A;  4XRD A;  2L4Q A;  3HHV A;  4I5Q A;  3IC4 A;  3HD5 A;  2LRN A;  3CSI A;  5ECO B;  1MD4 A;  4TRX A;  4XS6 A;  2V6O A;  2GLR A;  1YQ1 A;  1G7O A;  4WR4 A;  1HNB A;  4NAX A;  2CAI A;  3FYG A;  1UA5 A;  1OKD A;  1USB A;  2PER A;  3TRX A;  3Q18 A;  5ID2 B;  1GRX A;  1F6M C;  1BX9 A;  4MP4 A;  5J9C A;  3FZ4 A;  4RI7 A;  4XHM A;  2CV4 A;  3UBK A;  3DXB A;  5IOX A;  3LFL A;  4Z7X A;  3QFA C;  1ZGN A;  2BTO T;  3ZVJ A;  1G6W A;  5DVB A;  2YWN A;  2YV9 A;  4MZC A;  3LYK A;  3EPT A;  4BA7 A;  2X8C A;  2HRN A;  1YY7 A;  3LQ7 A;  1GTI A;  2E0Q A;  4NPB A;  1I9D A;  2XC2 A;  1GLP A;  1KEB A;  5J4U A;  2OBI A;  4K5S A;  5G1K A;  3F8U A;  5F8B A;  4L0W A;  1J0F A;  2NDO A;  3GTU A;  2WFC A;  1EP7 A;  1GWC A;  2N5A A;  1SJZ A;  1TK5 B;  2DKH A;  2IJY A;  2X99 A;  5DQS A;  3ERG A;  5B6M A;  3EU3 A;  4ZIL A;  4DSS B;  3GKN A;  4ULX A;  4KH7 A;  3GUS A;  1O6J A;  2ON7 A;  5A4V A;  2I9H A;  3LJR A;  5FT3 A;  4TR1 A;  1FHE A;  2H70 A;  3DYR A;  5LCZ A;  1K0O A;  3A2X A;  2AV4 A;  1N2A A;  4EO3 A;  2V6K A;  1V98 A;  5DAK A;  4PNG A;  1M9B A;  5KOX A;  1F3A A;  2H1A A;  5DDL A;  3H1N A;  1HD2 A;  2HRK A;  3LW9 A;  2YV7 A;  2K6V A;  5D9V A;  1GTA A;  1SL2 B;  4HDE A;  2IWT A;  2TIR A;  4PNF A;  2PUK C;  3FEU A;  1AAZ A;  4IP1 A;  4KSO A;  2YPM A;  4GLT A;  2P0G A;  4ML1 A;  3A5W A;  2CVB A;  3F4S A;  1X5E A;  2MZC A;  4GWR A;  1E2Y A;  5IMZ A;  3W8S A;  2VD1 A;  4G0I A;  1U88 A;  3H93 A;  3IRA A;  4L0U A;  4HI7 A;  4JRR A;  3FR3 A;  3IOS A;  2XPD A;  3ERF A;  1A2L A;  3ZL5 A;  4XIH A;  3HVV A;  3D0Z A;  1V58 A;  4GSN A;  4LLR A;  4TXV A;  3IPZ A;  5CYY A;  4L8E A;  1U6T A;  1XVW A;  2YWO A;  3KD0 A;  2YZH A;  3GUR A;  4X0X A;  4IN0 A;  1GH2 A;  4PGT A;  5DCH A;  2DJJ A;  2JSZ A;  4OCE A;  4BWS A;  4GXZ A;  13GS A;  4JR6 A;  2O85 A;  1S3A A;  4TOP A;  1TTZ A;  4FYB A;  3IK7 A;  4AJ8 A;  2K18 A;  1G0T A;  2K8V A;  5HFK A;  3QFB C;  4MDC A;  3NOF A;  4TXO B;  2VL9 A;  3C7M A;  1G6Y A;  4BL7 A;  5IIZ A;  4TW5 A;  5D9W A;  2XBI A;  2LS5 A;  1VF3 A;  1ZL9 A;  4V1A g;  4K7I A;  4I6X A;  1THO A;  3R3E A;  4F82 A;  1VF1 A;  4L5O A;  3KP8 A;  5ENU A;  4MPF A;  2B6M A;  1K0N A;  1O7U A;  4K0G A;  3TKR A;  3D4T A;  2LTK A;  2VCX A;  4KAE A;  1GSF A;  1PGT A;  1FB6 A;  1ZMA A;  1A2J A;  3HJP A;  4K2X A;  6GSY A;  1X9W B;  5JCW A;  1OC8 A;  1ERV A;  4K8M A;  2L4C A;  1K0C A;  2JAD A;  4MPG A;  3FRC A;  2C0G A;  4OO4 A;  4J56 E;  1SKS B;  1XPV A;  2H30 A;  3M8N A;  3HVX A;  3DML A;  5ECL B;  3WD6 A;  1X9M B;  4OFN A;  3ZZX A;  5IO2 A;  5DQY A;  3CRT A;  1O81 A;  2HRF A;  2JAC A;  1B4Q A;  4BPY A;  2LNS A;  4IGJ A;  3CSJ A;  4RQX A;  1FOV A;  4NXI A;  5CRE A;  1C72 A;  2DJ1 A;  4GTU A;  3CYN A;  5HFG A;  4YQU A;  4WR5 A;  1GL8 A;  1M7T A;  1T4Z A;  3QD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...