2MBTA

Nmr study of padsba
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
190
structure length
190
Chain Sequence
GDDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLESMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Fragment library screening identifies hits that bind to the non-catalytic surface of Pseudomonas aeruginosa DsbA1.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 52
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2013-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2mbtA00
3HJPA 3DIEA 1DBYA 5G30A 1ABAA 3E3EA 4IW9A 1JLVA 3GKNA 3IBHA 2L6CA 4PQ1A 1VF4A 1J9BA 3D0ZA 2D2ZA 1O85A 2VCQA 2A2RA 2O85A 1E2YA 2NBSA 5F06A 2H0GA 5DAKA 1G6WA 1PGTA 3APQA 3C71A 3P7XA 5B8BA 4ZXGA 3F3QA 5IMAA 4WBRD 1F3AA 4X1UA 5INYA 3RDWA 5D9TA 3ZMLA 5H5QA 3TJGA 4ML6A 1XWCA 2DMMA 4HQZA 1XWAA 3DYRA 1PD21 1AXDA 4IP6A 4LA1A 1OYJA 2YV7A 1XFLA 1FB0A 4PQIA 2WULA 3TRPA 2LJAA 3GRXA 3IRAA 2RM6A 3LYKA 4XS4B 4HI7A 1ML6A 2JZRA 2CZ3A 2L5LA 5HFIA 1TP9A 5B7CA 2HSYA 4OFMA 1ZCPA 2VLVA 5D9WA 1HNBA 4MJBA 6GSTA 2GSRA 2H6XA 4FYCA 4KDYA 1GSUA 2IJYA 5A4VA 3S9FA 3EC3A 2KUCA 5G1LA 3EVIA 4MP4A 4XRDA 2GSQA 3VK9A 1GH2A 13GSA 4MA9A 3O76A 4K7IA 5DBQA 4HJ2A 3NZNA 2EIOA 3K8NA 4OCEA 2R6KA 2B5XA 1EP8A 2V32A 3HJMA 4MK3A 5KN3A 1V98A 5CREA 5LNKe 2H1BA 5J9BA 2H6YA 4JR4A 1TRSA 3CYNA 3H8QA 4EXJA 3Q6OA 5C04A 3C1SA 4EKZA 1XCCA 4RUVA 2I1UA 1Z6NA 3DRNA 2CX3A 3FK8A 2WFCA 1OC9A 4EDZA 4ZILA 3KP8A 2M72A 4Q5RA 5IO2A 3GTUB 2J9HA 1T4ZA 2NTOA 2H01A 4GF0A 1YJ6A 2CVKA 3CXGA 4GSTA 4QL7A 2I3YA 1XPVA 5ABRA 1FAAA 3DMLA 3HVVA 3TRXA 1HD2A 4MF6A 3FYGA 5AISA 5EPFA 1O8WA 1UVZA 2O7KA 4BVXA 4D73A 5J9CA 1E6BA 2GQMA 3GHAA 3HKRA 2QC7A 4J2FA 2MBTA 3WT2A 4TXVA 1N8JA 3ME7A 1F37A 1B4PA 3TJBA 12GSA 4TR1A 5E59A 3VWXA 1ERVA 2VD1A 3D21A 1YZXA 2YN1A 2FWHA 4TR4A 1AQXA 4AJ6A 3UBLA 11GSA 3KH9A 1FHEA 4KE3A 1BJXA 3QCPA 5LCZA 4F0CA 1A24A 2MYGA 5DJMA 3EWLA 3GIXA 2FWFA 3CSHA 5HR1A 1XXUA 3TJFA 4KDXA 2H72A 3D4TA 3HD5A 4Q5FA 1S3DA 3G7IA 2WZ9A 3CTFA 1GRXA 2LTKA 2YV9A 2V6OA 3WGEA 2LJKA 4YQMA 4N10A 1SD9A 5CAXA 3ERWA 3Q74A 5J3RA 3QMXA 4IBPA 3KD0A 2H0HA 1GTAA 2C8UA 1JZOA 1NW2A 3NOFA 1XWBA 5IMZA 2L57A 4NV5A 1EGOA 5GSTA 4P3YB 3FR9A 1A2MA 1V9WA 4WF5A 4WF4A 3VWWA 1GL8A 5IQYA 1I9DA 2DJKA 1XOAA 1TRUA 2E0QA 5H5SA 1F3BA 3WT1A 3GX8A 2DJ1A 1TK8B 3DEXA 1X9WB 5G5EA 1M2DA 4OO5A 1MDIA 2HZEA 1TK0B 1U3IA 3IDVA 2IMFA 4L5LA 4WETA 1PL1A 5FHIA 5ECNB 1SYRA 1R5PA 1VF2A 3EU4A 4HDEA 1B9YC 3VWUA 1O7UA 6GSUA 2ZUPA 1ACVA 1Q98A 2IFQA 3LWAA 5IIZA 3IK7A 2DC5A 1OC9B 4G2EA 5JWOB 1WE0A 1GSEA 1K0OA 1GTIA 1YKAA 2AUVA 4O92A 4GXZA 4F82A 2WJUA 3QR6A 1PSQA 2B1LA 4J57E 4MCUA 4EDYA 4DSRA 3TDGA 3KJYA 1OVNA 4ILFA 3ZFLA 5EVOA 3QDNA 4POLA 4OCFA 4D73B 2P5RA 4DEJA 2WRTA 4L0WA 2H1GA 2HT9A 2LUSA 4AJ7A 2V41A 3M0FA 4I5QA 2GS3A 1G0TA 1NHOA 3W8JA 4CW9A 3HJOA 2PGTA 4TR1B 1JZRA 2Z9SA 1O8XA 2PN8A 2MZCA 2EIQA 2H1DA 4IJ3A 1TJDA 2XHFA 2CVBA 7GSSA 4HZ4A 3TKSC 1ERWA 1BAYA 1FG4A 3F4TA 2YWMA 4ZB9A 2G2QA 3FEUA 4NHWA 3GYKA 2YOIA 3UBKA 2A2SA 4MABA 5HFKA 2VCXA 17GSA 3UL3A 5G31A 1GUHA 5ELAA 3L78A 1GSQA 2C3NA 1QXHA 1SJIA 2CQ9A 2K8VA 1VF3A 3HYPA 1TU8A 2YNXA 4G9HA 1F2EA 4V2LA 1GSYA 3CSJA 3ZREA 1HNCA 2B5YA 4E8EA 2H30A 2HFDA 2PVQA 4E8HA 1Z3EA 2FWEA 3E9JB 1EGRA 2C1YA 4POMA 4PURA 1TK5B 1WOUA 1OKTA 1YF0A 4JRRA 4NWYA 2G0FA 3F4RA 2GSTA 2IL3A 4GWRA 4J56E 4KCAA 5D8IA 1Z9HA 3W6GA 4NMUA 3W8SA 4Q5QA 3TB2A 2WDUA 1M9AA 1PKZA 4G19A 4GSNA 4IKHA 5IM9A 4JU5A 5E4WA 3MAKA 4WR4A 1K0MA 1K3YA 3M8NA 1G7EA 4GLTA 3HZ8A 2M46A 2H73A 3FZ9A 1MEKA 2DJ0A 2FGXA 2K18A 1ILOA 1HQOA 4XTSA 2GQLA 4ZB6A 4K9ZA 4TVEA 1M0UA 2HZEB 4MZCA 1GNWA 3GURA 5B6MA 5GAPD 4IS0A 2YJ7A 3VPTA 4KAEA 4X0XA 3Q19A 1MD3A 3A3TA 2HRNA 2CAQA 5F8BA 1XVQA 2B7JA 3LQ7A 2IFQB 2XPEA 3A2WA 1WWJA 3BOAA 2ON7A 3L4NA 1C72A 3D6IA 4MMMA 1X0RA 2LEGA 1ZL9A 1JLWA 2XBIA 3ERFA 5CNWA 1IYIA 2OBKA 3EMXA 2E2GA 5F07A 4XHMA 1KEBA 5CRDA 3KMNA 2R4VA 1A8YA 2GT6A 4IJIA 1RW1A 5D9XA 2ZCTA 4XIHA 3H1NA 3SWLA 3UMAA 2K9FA 2C80A 2V2GA 5CRGA 4N11A 4QQ7A 1MDJA 1EOHA 1K0NA 3ZMKA 4ECJA 5DDLA 3IAS2 2L59A 2HI7A 4LLRA 4TN8A 3ZTLA 2REMA 2RUFA 4FIWA 3MDKA 3LEFA 3FZ5A 2LRNA 4RQRA 2IMKA 1R26A 5EY6A 1FW1A 4LMWA 2OADA 5IMDA 1CQHA 1TW9A 1ON4A 5DCGA 4OMVA 3L9VA 3EURA 2V1MA 2KOKA 2AYTA 4AF2A 2BMXA 2B5EA 2JADA 1QMVA 2IPAA 2ES7A 2AJQB 5JCUA 4IP1A 3M9JA 3BD2A 5ECMB 2XBQA 5JCGA 3QAGA 3MSZA 4HS1A 2WGRA 2VL2A 4OO4A 3ZZXA 3ZVJA 1DUGA 2TRXA 1PMTA 3VI7A 1RQMA 4WKWA 1BYEA 1O6JA 3BCKA 1T4YA 5ECIB 3LGCA 2H1AA 3HXSA 4MF5A 2XC2A 5HR3A 3F4SA 1XOBA 1M7TA 2LNSA 1OE8A 2DIZA 2MMAA 3CBUA 1GWCA 1JHBA 3F3RA 5F0GA 5AN1A 3RAZA 3KTBA 1XW5A 4HUAA 5F05A 1TU7A 1IYHA 1LBKA 2B1KA 2FUG2 3EINA 4XRAA 1CQGA 3FR6A 2C0EA 1YKCA 4FYBA 2WB9A 4JR6A 3MNGA 2PERA 3VLNA 1A2JA 2F3MA 3GSTA 4V1Ap 1T7PB 4I2UA 3GL3A 2P31A 1XVWA 5DALA 2GTUA 1PX7A 4DSSA 4QL9A 1J0FA 3D22A 3C1RA 3GSSA 1GSDA 4MZBA 2F9SA 3LXTA 1QQ2A 4YQUA 1Y6EA 1V57A 4EO3A 3ZRDA 1TKDB 2L6DA 1X5EA 3QAWA 4N0VA 1YDKA 5B6NA 3UOMA 1H75A 1ERTA 4KSMA 4YAVA 3F9UA 1GULA 2H0IA 3H79A 3KM6A 3LORA 3HDCA 1SL1B 4PXOA 2R37A 5ECPB 2H75A 2XPDA 1WJKA 1BG5A 2DLXA 1ZOFA 4HOJA 9GSSA 4L8EA 3JCML 2GGTA 1AC1A 1F6MC 4POBA 1DSBA 2QKEA 2L5OA 4CHSA 4ZL8A 2IMEA 5D73A 5DAKB 1FO5A 4I6XA 3PGTA 3N5OA 2IMIA 4LMVA 4HU9A 2VL2C 4ZBAA 5DQYA 2F8FA 4K0GA 5IO0A 4KCEA 1R7HA 2H6ZA 5FT3A 4OWYA 2YZUA 2GZZA 5ECHB 2RM5A 5COHA 4HJMA 1A23A 3TKSA 1NSWA 2VUPA 3WYWA 1PQNA 1M99A 1GSFA 1Z7RA 1FB6A 4MH2A 5A5KA 3O3TA 2ZNMA 1HNAA 1ST9A 4JBBA 2DIYA 4IQ1A 3V1WA 4EE0A 4KNDA 5KN1A 2LKUA 1X9MB 1XZOA 3U5RE 5ECRB 3TKPA 1X5CA 3ZIJA 1SD8A 4PQHA 1URMA 1KNGA 1XIYA 2YCDA 2JZSA 2MMOA 1FVKA 5GZZB 2PBJA 1M2AA 4EC0A 2H70A 3P2AA 2PVOC 2RIIA 2FHEA 1EEMA 4TW5A 3GL5A 2P0GA 4WEYA 4IVFA 2HE3A 3P8WA 3TCOA 2DMLA 3RBTA 1A0FA 10GSA 4MJEA 2DBCA 4NAXA 5CRHA 5J4UA 3DXBA 3IHQA 2FWGA 1ZGNA 3TJJA 20GSA 4PUAA 4GTUA 1G7OA 1USBA 4Z7XA 1KBNA 2VCTA 1JFUA 2FY6A 3EMPA 3TUEA 2QSIA 2VCZA 4KSOA 4EF0A 5IOWA 2B3SA 1VF1A 1SYXA 2M80A 4JZQA 3UEMA 5IMVA 4K7NA 5DALB 4V1Ag 1GSSA 3US3A 4DSSB 3BBYA 3C73A 3F6DA 1XWKA 2AAWA 1S3CA 1SJZA 4NHZA 4ISDA 1PKWA 2CT6A 3GKKA 4PX1A 4OD7A 3U6VA 3D5JA 2HZFA 22GSA 1WIKA 3GMFA 3WGXA 2I9HA 2OACA 1TRVA 2B7KA 1SJ6A 2PU9C 4K1FA 5GAND 6GSSA 1KTEA 1AQWA 3VFIA 1SENA 5JCWA 1AQVA 2VM1A 3KZQA 2CZ2A 1M9BA 2IWTA 1OE7A 2AHEA 5LD0A 4F9ZA 1FVJA 1V2AA 2ALBA 4EUYA 1XWGA 3KXOA 1MTCA 1W89A 4EL1A 2C3TA 5IMCA 3F0IA 3TKRA 1WPIA 5KEJA 4DSQA 3FRCA 3BJ5A 3ZL5A 3BCIA 4F03A 2KHPA 1K0CA 3GN3A 4IN0A 5KN2A 1A2LA 3RPPA 3F63A 2QGVA 3PINA 4TXOA 5ECKB 1U6TA 4IQAA 4XS6A 5HQPA 1X5DA 4O5RA 5L71A 2PUKC 3WGDA 3NIVA 2YJHA 4N30A 2GLRA 1BX9A 4BA7A 3M1GA 2MBSA 2NDOA 4ML1A 4Q5NA 4ZIJA 4K7OA 2FA4A 3C7MA 2KP2A 2CX4A 2EC4A 2R2JA 4KB3A 4ECCA 3FY7A 2VCWA 1K0DA 4MPFA 2JSZA 1I5GA 2FA8A 2N5BA 4L5OA 4PUFC 3F8UA 1R4WA 4GQCA 5ECOB 4H86A 3VURA 3PR8A 2K8SA 3J7Yb 3KMOA 1TI1A 2LJRA 4MJAA 1QGVA 1AW9A 1O81A 3F6FA 4RI6A 4BVYA 3A5WA 4FYUA 4BL7A 2LRTA 4O32A 1R5AA 2HNLA 5J41A 18GSA 4OFNA 5IMFA 2IN3A 3HZ4A 2C0GA 1T00A 2GZYA 3CMIA 3FR3A 3GNJA 4DVCA 3LSZA 3O6TA 8GSSA 4ULXA 3FZAA 4HU7A 3I43A 3CRUA 2A4VA 3DD3A 3IA1A 5A4UA 1V40A 1T8EB 3RHCA 2EIRA 2FD3A 4GSSA 1LJRA 1THXA 3UJ1A 3PH9A 3FW2A 4V2MA 5CP1A 1GNEA 3ZLPA 2LV3A 3L0HA 3ZITA 1PX6A 2WS2A 4PNFA 3VI5A 1WRYA 1BEDA 1THOA 3G7YA 5JWQB 1PRXA 4K6XA 1OC8A 1PA3A 2JSYA 2BJXA 4TKYA 1A8LA 3I69A 3ZVJD 1K0BA 5KN0A 4ZBDA 2O89A 2HRFA 1UN2A 3ME8A 2GZPA 4RQXA 3GUSA 2I4AA 3KH7A 4G10A 3I6AA 1T3BA 1GTUA 3QOUA 5B8AA 4TXOB 2I81A 1VGLA 2GSSA 3OR5A 3EYTA 3RPNA 4I97A 2JACA 2C0FA 4ECIA 2VLUA 1QK8A 1YEPA 2O87A 3TKQA 1WP0A 5CO3A 3IAM2 5DQSA 1ERUA 3IOSA 3D4MA 2FNOA 1AIUA 4BWQA 1Q4JA 5EL8A 1DE1A 1PL2A 1G6YA 2MMNA 2X8GA 1K0AA 2NPBA 1SKSB 2JU5A 3TOTA 2BTOT 2X8HA 3KGKA 3H4KA 3M3MA 1SK1A 2DJ3A 5G5FA 5DJLA 4MZWA 1DE2A 2OE3A 4KH7A 1U88A 3KEBA 4NXIA 3APSA 4ECBA 3H93A 1GLPA 2ON5A 3Q18A 1Y25A 3N9JA 3ISOA 2YZHA 4IHUA 2OA7A 4K8MA 5AIXA 3TOUA 4POKA 2CA8A 5AIVA 3LFLA 1TDIA 19GSA 2VL9A 3GH9A 1NHYA 4MH3A 3FHKA 1Z5YE 1YF1A 3DGQA 2B6MA 1W4VA 4XCSA 4MF7A 1SK2A 3ZFBA 4HZ2A 4XS1A 2CV4A 3FZ4A 5G2ZA 3UAPA 3KTLA 1MD4A 5ECLB 2H76A 2N5FA 3RHBA 2LQQA 4RI7A 1AAZA 1VRSD 4JEDA 4F0BA 1RK4A 5D96A 5C00A 4NPBA 2RUEA 1X9SB 2VCVA 3QAVA 14GSA 3GA4A 4L0UA 2KP1A 2HYXA 2OBIA 5IPGA 1OKDA 2RLIA 1ZZYA 1H4OA 3TGZA 2C3QA 1O73A 1EOGA 3CSIA 2HLSA 4BWSA 4IGJA 3L9SA 5H5RA 4YAPA 3IXRA 2YWNA 3CTGA 2N5AA 4LL4B 2KLXA 1ZYEA 2GQKA 2K6VA 3MWHA 2JZTA 2YPMA 1J08A 5HFGA 2PMTA 3HVXA 1UA5A 2E2MA 3IR4A 3EE2A 5A4WA 2LS5A 3G9BA 5ELGA 1OAZA 2L4CA 3G7JA 5FWGA 2H19A 3M9KA 3A2VA 1YQ1A 3UVHA 1QUWA 4ZL9A 4TR3A 3HVSA 3DVWA 3LJRA 5IOXA 4ZL7A 4F2IA 2VM2A 5ECSA 4O7HA 2CAIA 2H8LA 1B8XA 5ID2A 4MDCA 4LL1B 3VWVA 3HHVA 2YWIA 2R5GA 4MPGA 4EVMA 2IIYA 5ENUA 4AJ8A 4PNGA 1UC7A 4GQFA 3IV4A 3GH6A 1YY7A 2C0DA 6GSXA 5IPHA 4IELA 3SBCA 1LU4A 1V58A 2DJ2A 1TTZA 1SU9A 4ID0A 1SL2B 2C4JA 2R3XA 2AB6A 3IK9A 3TRQA 3GKXA 2X64A 3GV1A 3ZIVA 2VLTA 2PPTA 2MMZA 2GVPA 2X8CA 3IC4A 1K3LA 3LYPA 4K0NA 4TOPA 3DWVA 3DVXA 4WBJA 2AV4A 3I9V2 3QFAC 4KDUA 4ZBBA 3TJKA 5J5NA 4JE1A 4MJCA 2VL3A 2OE0A 6GSVA 1EEJA 4X43A 3LG6A 1A0RP 2YANA 4PGTA 1B9XC 1T1VA 2FCHA 3QFBC 2JL4A 3VPQA 1WMJA 2E7PA 1TRWA 1U3AA 5CYYA 4ZB8A 3ZYWA 2IMDA 2VOCA 4KW6A 1GLQA 3ED3A 3KCMA 3P90A 2OKAA 1Z6MA 3J7Yk 1GTBA 1HYUA 2WCIA 3DKSA 1M2BA 2O8VB 1OC3A 2DSAA 1K3OA 3QD9A 2VD0A 4HQSA 5JWRB 4K2DA 2TRCP 1U87A 1B4QA 2FLSA 2H66A 5GSSA 1SK0A 2OJLA 4YQVA 2F8AA 3IPZA 4HEA2 5HR2A 5DCHA 1XW9A 2L4QA 1ZMAA 4OFTA 4V2NA 2VAFA 4XS4A 1Z7PA 1TXXA 4N0ZA 3AY8A 1BQ7A 4TRXA 3R2QA 4KA0A 4ACSA 1B48A 3A2XA 2X99A 1ZYQB 1EV9A 4I8BA 1MDKA 4GRFA 1SKWB 3L9UA 2LSTA 1AUCA 1EP7A 2OE1A 4AGSA 2H71A 3TKSE 1EZKA 3CRTA 3GX0A 1GUKA 1XW6A 3GKMA 3C8EA 2NVLA 1S3AA 1PN9A 4MLYA 1GP1A 5G1KA 1SKRB 3HA9A 4YH2A 3UIWA 1SL0B 6GSYA 4NV2A 2V6KA 3APOA 2VIMA 5D9VA 3LXZA 4TR0A 16GSA 2F51A 5ID2B 2GDRA 6GSWA 1JZWA 1QFNA 3UVTA 4KX4A 4FO5A 2CVDA 2DJJA 4GCIA 3QPMA 2GT5A 4WR5A 3KIJA 3GTUA 1NM3A 2HXKA 2YP6A 2LQOA 2HSHA 2TIRA 1EV4A 3E0UA 3FKFA 3WD6A 3UARA 1N2AA 1GUMA 2J23A 4WXTA 5DVBA 4BPYA 3IE3A 1EWXA 1FOVA 5HR0A 5D93A 1TI3A 2YWOA 2PWJA 1F9MA 4KGIA 1YEXA 3GFKA 4I2TA 2LRCA 2LNTA 3EU3A 5AGYA 2P5QA 1XBSA 2VO4A 1TOFA 4KUNA 4CDOA 3HCZA 5ECQB 5CRWA 1JZDA 3ERGA 3KP9A 4FH8A 2H74A 3HY2A
chains in the Genus database with same CATH superfamily
3HJPA 3DIEA 1DBYA 5G30A 1ABAA 3E3EA 4IW9A 1JLVA 3GKNA 3IBHA 2L6CA 4PQ1A 1VF4A 1J9BA 3D0ZA 2D2ZA 1O85A 2VCQA 2A2RA 2O85A 1E2YA 2NBSA 5F06A 2H0GA 5DAKA 1G6WA 1PGTA 3APQA 3C71A 3P7XA 5B8BA 4ZXGA 3F3QA 5IMAA 4MNNA 4WBRD 1F3AA 4X1UA 5INYA 3RDWA 5D9TA 3ZMLA 5H5QA 3TJGA 4ML6A 1XWCA 2DMMA 4HQZA 1XWAA 3DYRA 3A5IA 1PD21 1AXDA 4IP6A 4LA1A 1OYJA 2YV7A 1XFLA 1FB0A 4PQIA 2WULA 3TRPA 2LJAA 3GRXA 3IRAA 2RM6A 3LYKA 4XS4B 4HI7A 1ML6A 2JZRA 2CZ3A 2L5LA 5HFIA 1TP9A 5B7CA 2HSYA 4OFMA 1ZCPA 2VLVA 5D9WA 1HNBA 4MJBA 6GSTA 2GSRA 2H6XA 4FYCA 4KDYA 1GSUA 2IJYA 5A4VA 3S9FA 3EC3A 2KUCA 5G1LA 3EVIA 4MP4A 4XRDA 2GSQA 3VK9A 1GH2A 13GSA 4MA9A 3O76A 4K7IA 5DBQA 1M3JA 4HJ2A 3NZNA 2EIOA 3K8NA 4OCEA 2R6KA 2B5XA 1EP8A 2V32A 3HJMA 4MK3A 5KN3A 1V98A 5CREA 5LNKe 2H1BA 5J9BA 2H6YA 4JR4A 1TRSA 3CYNA 3H8QA 4EXJA 3Q6OA 5C04A 3C1SA 4EKZA 1XCCA 4RUVA 2I1UA 1Z6NA 3DRNA 2CX3A 3FK8A 2WFCA 1OC9A 4EDZA 4ZILA 3KP8A 2M72A 4Q5RA 5IO2A 4BL7B 5KOXA 3GTUB 2J9HA 1T4ZA 2NTOA 4Z2TA 2H01A 4GF0A 1YJ6A 2CVKA 3CXGA 4GSTA 4QL7A 2I3YA 1XPVA 5ABRA 1FAAA 3DMLA 3HVVA 3TRXA 1HD2A 4MF6A 3FYGA 5AISA 3CQFA 5EPFA 1O8WA 1UVZA 2O7KA 4BVXA 4D73A 5J9CA 1E6BA 2GQMA 3GHAA 3HKRA 2QC7A 4J2FA 2MBTA 3WT2A 4TXVA 1N8JA 3ME7A 1F37A 1B4PA 3TJBA 12GSA 4TR1A 5E59A 3VWXA 1ERVA 2VD1A 3D21A 1YZXA 2YN1A 2FWHA 4TR4A 1AQXA 4AJ6A 3UBLA 11GSA 3KH9A 1FHEA 4KE3A 1BJXA 3QCPA 5LCZA 2X49A 4F0CA 1A24A 2MYGA 5DJMA 3EWLA 4Z2UA 3GIXA 2FWFA 3CSHA 3FMWA 5HR1A 1XXUA 3TJFA 4KDXA 2H72A 3D4TA 3HD5A 4Q5FA 1S3DA 3G7IA 2WZ9A 3CTFA 1GRXA 2LTKA 2YV9A 2V6OA 3WGEA 2LJKA 4YQMA 4N10A 1SD9A 5CAXA 3ERWA 3Q74A 5J3RA 3QMXA 4IBPA 3KD0A 2H0HA 1GTAA 2C8UA 1JZOA 1NW2A 3NOFA 1XWBA 5IMZA 2L57A 4NV5A 1EGOA 5GSTA 4P3YB 3FR9A 4Z2RA 1A2MA 1V9WA 4WF5A 4WF4A 3VWWA 1GL8A 5IQYA 1I9DA 2DJKA 1XOAA 1TRUA 2E0QA 5H5SA 1F3BA 2X4AA 3WT1A 3GX8A 2DJ1A 1TK8B 2DKIA 3DEXA 1X9WB 5G5EA 1M2DA 4OO5A 1MDIA 2HZEA 1TK0B 1U3IA 3IDVA 2IMFA 4L5LA 4WETA 1PL1A 5FHIA 5ECNB 1SYRA 1R5PA 1VF2A 3EU4A 4HDEA 1B9YC 3VWUA 1O7UA 6GSUA 2ZUPA 1ACVA 1Q98A 2IFQA 3LWAA 5IIZA 3IK7A 2DC5A 1OC9B 4G2EA 5JWOB 1WE0A 1GSEA 1K0OA 1GTIA 1YKAA 2AUVA 3HVNA 4O92A 4GXZA 4F82A 2WJUA 2HRKA 3QR6A 1PSQA 2B1LA 4J57E 2R0PA 4MCUA 4EDYA 4DSRA 3TDGA 3KJYA 1OVNA 4ILFA 3ZFLA 5EVOA 3QDNA 4POLA 4OCFA 4BVXB 4D73B 2P5RA 4DEJA 2WRTA 1FOHA 4L0WA 2H1GA 2HT9A 2LUSA 4AJ7A 2V41A 3M0FA 4I5QA 4CY8A 2GS3A 1G0TA 1NHOA 3W8JA 4CW9A 3HJOA 2PGTA 4TR1B 1JZRA 2Z9SA 1O8XA 2PN8A 2MZCA 2EIQA 2H1DA 4IJ3A 1TJDA 2XHFA 2CVBA 7GSSA 4HZ4A 3TKSC 1ERWA 1BAYA 1FG4A 3F4TA 2YWMA 4ZB9A 2G2QA 3FEUA 4NHWA 3GYKA 2YOIA 3UBKA 2A2SA 4MABA 5HFKA 2VCXA 17GSA 3UL3A 5G31A 1GUHA 5ELAA 3L78A 1GSQA 2C3NA 4PTSA 1QXHA 1SJIA 2CQ9A 2K8VA 1VF3A 3HYPA 1TU8A 2YNXA 4G9HA 1F2EA 4V2LA 1GSYA 3CSJA 3ZREA 1HNCA 2B5YA 4E8EA 2H30A 2HFDA 2PVQA 4E8HA 1Z3EA 2FWEA 3E9JB 1EGRA 2C1YA 4POMA 4PURA 1TK5B 1WOUA 1OKTA 1YF0A 4JRRA 4NWYA 2G0FA 3F4RA 2GSTA 2IL3A 4GWRA 4J56E 4KCAA 5D8IA 1Z9HA 3W6GA 4NMUA 3W8SA 4Q5QA 3TB2A 2WDUA 1M9AA 1PKZA 1PFOA 4G19A 4GSNA 4IKHA 5IM9A 4JU5A 5E4WA 3MAKA 4WR4A 1K0MA 1K3YA 3M8NA 1G7EA 4GLTA 3HZ8A 2M46A 2H73A 3FZ9A 1MEKA 2DJ0A 2FGXA 2K18A 1ILOA 1HQOA 4XTSA 2GQLA 4ZB6A 4K9ZA 4TVEA 1M0UA 2HZEB 4MZCA 1GNWA 3GURA 5B6MA 5GAPD 4IS0A 2YJ7A 3VPTA 4KAEA 4X0XA 3Q19A 1MD3A 3A3TA 2HRNA 2CAQA 5F8BA 1XVQA 2B7JA 3LQ7A 2IFQB 2XPEA 3A2WA 1WWJA 3BOAA 2ON7A 3L4NA 1C72A 3D6IA 4MMMA 1X0RA 2LEGA 1ZL9A 1JLWA 5CNWA 2XBIA 3ERFA 1IYIA 2OBKA 3EMXA 2E2GA 4CY6A 5F07A 4XHMA 1KEBA 5CRDA 3KMNA 2R4VA 1A8YA 2GT6A 4IJIA 1RW1A 5D9XA 2ZCTA 4XIHA 3H1NA 3SWLA 3UMAA 2K9FA 2C80A 2V2GA 5CRGA 4N11A 4QQ7A 1MDJA 1EOHA 1K0NA 3ZMKA 4ECJA 5DDLA 3IAS2 2L59A 2HI7A 4LLRA 4TN8A 3ZTLA 2REMA 2RUFA 4FIWA 3MDKA 3LEFA 3FZ5A 2LRNA 4RQRA 2IMKA 1R26A 5EY6A 1FW1A 4LMWA 2OADA 5IMDA 1CQHA 1TW9A 1ON4A 5DCGA 4OMVA 3L9VA 3EURA 2V1MA 2KOKA 2AYTA 4AF2A 2BMXA 4G0KA 2B5EA 2JADA 1QMVA 2IPAA 2ES7A 2AJQB 5JCUA 4IP1A 3M9JA 3BD2A 5ECMB 2XBQA 5JCGA 3QAGA 3MSZA 4HS1A 2WGRA 2VL2A 4OO4A 3ZZXA 3ZVJA 1DUGA 2TRXA 1PMTA 3VI7A 1RQMA 4WKWA 1BYEA 1O6JA 3BCKA 1T4YA 5ECIB 3LGCA 2H1AA 3HXSA 4MF5A 2XC2A 5HR3A 3F4SA 1XOBA 1M7TA 2LNSA 1OE8A 2DIZA 2MMAA 3CBUA 1GWCA 1JHBA 3F3RA 5F0GA 5AN1A 3RAZA 3KTBA 1XW5A 4HUAA 5F05A 1TU7A 1IYHA 1S3RA 1LBKA 2B1KA 2FUG2 3EINA 4XRAA 1CQGA 3FR6A 1M3IA 2C0EA 1YKCA 4FYBA 2WB9A 4JR6A 3MNGA 2PERA 3VLNA 1A2JA 2F3MA 3GSTA 4V1Ap 1T7PB 4I2UA 3GL3A 2P31A 1XVWA 4FQUA 3IC8A 5DALA 2GTUA 1PX7A 4DSSA 4QL9A 1J0FA 3D22A 3C1RA 3GSSA 1GSDA 4MZBA 2F9SA 3LXTA 1QQ2A 4YQUA 1Y6EA 1V57A 4EO3A 3ZRDA 1TKDB 2L6DA 1X5EA 3QAWA 4N0VA 1YDKA 5B6NA 3UOMA 1H75A 4O5UA 1ERTA 4KSMA 4YAVA 3F9UA 1GULA 2H0IA 3H79A 3KM6A 3LORA 3HDCA 1SL1B 4PXOA 2R37A 5ECPB 4USSA 2H75A 2XPDA 1WJKA 1BG5A 2DLXA 1ZOFA 4HOJA 9GSSA 4L8EA 3JCML 4G0IA 2GGTA 1AC1A 3MIXA 1F6MC 4POBA 1DSBA 2QKEA 2L5OA 4CHSA 4ZL8A 2IMEA 5D73A 5DAKB 1FO5A 4I6XA 3PGTA 3N5OA 2IMIA 4LMVA 4HU9A 2VL2C 4ZBAA 5DQYA 2F8FA 4K0GA 5IO0A 4KCEA 1R7HA 2H6ZA 5FT3A 4OWYA 2YZUA 2GZZA 5ECHB 2RM5A 5COHA 4HJMA 1A23A 3TKSA 1NSWA 2VUPA 3WYWA 1PQNA 1M99A 1GSFA 1Z7RA 4K5RA 1FB6A 2R0CA 4MH2A 5A5KA 3O3TA 2ZNMA 1HNAA 1ST9A 4JBBA 2DIYA 4IQ1A 3V1WA 4EE0A 4KNDA 5KN1A 1ZYPA 2LKUA 1X9MB 1XZOA 3U5RE 5ECRB 3TKPA 1X5CA 3ZIJA 1SD8A 4PQHA 1URMA 1KNGA 1XIYA 2YCDA 2JZSA 2MMOA 1FVKA 5GZZB 2PBJA 1M2AA 4EC0A 2H70A 3P2AA 2PVOC 2RIIA 2FHEA 1EEMA 4TW5A 3GL5A 2P0GA 4WEYA 4IVFA 2HE3A 3P8WA 3TCOA 2DMLA 3RBTA 1A0FA 10GSA 4MJEA 2DBCA 4NAXA 5CRHA 5J4UA 3DXBA 3IHQA 2FWGA 1ZGNA 3TJJA 20GSA 4PUAA 4GTUA 1G7OA 1USBA 4Z7XA 1KBNA 2VCTA 1JFUA 2FY6A 3EMPA 3TUEA 2QSIA 2VCZA 4KSOA 4EF0A 5IOWA 2B3SA 1VF1A 1SYXA 2M80A 4JZQA 3UEMA 5IMVA 4K7NA 5DALB 4V1Ag 1GSSA 3US3A 4DSSB 3BBYA 3C73A 3F6DA 1XWKA 2AAWA 1S3CA 1SJZA 4NHZA 4ISDA 1PKWA 2CT6A 3GKKA 4PX1A 4OD7A 3U6VA 3D5JA 2HZFA 22GSA 1WIKA 3GMFA 3WGXA 2I9HA 2OACA 1TRVA 2B7KA 1SJ6A 2PU9C 4K1FA 5GAND 6GSSA 1KTEA 1AQWA 3VFIA 1SENA 5JCWA 1AQVA 2VM1A 3KZQA 2CZ2A 1M9BA 2IWTA 1OE7A 2AHEA 5LD0A 4F9ZA 1FVJA 1V2AA 2ALBA 4EUYA 3IHGA 1XWGA 3EPTA 3KXOA 1MTCA 1W89A 5KOWA 4EL1A 2C3TA 5IMCA 3F0IA 3TKRA 1WPIA 5KEJA 4DSQA 3FRCA 3BJ5A 3ZL5A 3BCIA 4F03A 2A4HA 2KHPA 1K0CA 3GN3A 4IN0A 5KN2A 1A2LA 3RPPA 3F63A 2QGVA 3PINA 4TXOA 5ECKB 1U6TA 4IQAA 4XS6A 5HQPA 1X5DA 4O5RA 5L71A 2PUKC 3WGDA 3NIVA 2YJHA 4A5PA 4N30A 2GLRA 1BX9A 4BA7A 3M1GA 2MBSA 2NDOA 4ML1A 4Q5NA 4ZIJA 4K7OA 2FA4A 3C7MA 2KP2A 2CX4A 2EC4A 2R2JA 4KB3A 4ECCA 3FY7A 2VCWA 1K0DA 4MPFA 2JSZA 1I5GA 2FA8A 2N5BA 4L5OA 4PUFC 4KF9A 3F8UA 1R4WA 4GQCA 5ECOB 4H86A 3VURA 3PR8A 2K8SA 3J7Yb 3KMOA 1TI1A 2LJRA 4MJAA 1QGVA 1AW9A 1O81A 3F6FA 4RI6A 4BVYA 3A5WA 4FYUA 4BL7A 2LRTA 4O32A 1R5AA 2HNLA 5J41A 18GSA 4OFNA 5IMFA 4K2XA 2IN3A 3HZ4A 2C0GA 1T00A 2GZYA 3CMIA 3FR3A 3GNJA 4DVCA 3LSZA 3O6TA 8GSSA 4ULXA 3FZAA 4HU7A 3I43A 3CRUA 2A4VA 3DD3A 3IA1A 5A4UA 1V40A 1T8EB 3RHCA 2EIRA 2FD3A 4GSSA 1LJRA 1THXA 3MYDA 3UJ1A 4HSCX 3PH9A 3FW2A 4V2MA 5CP1A 1GNEA 3ZLPA 2LV3A 3L0HA 3ZITA 1PX6A 2WS2A 4PNFA 3VI5A 1WRYA 1BEDA 1THOA 3G7YA 5JWQB 1PRXA 4K6XA 1OC8A 1PA3A 4YKGA 2JSYA 1ZYNA 2BJXA 4TKYA 1A8LA 3I69A 4YKFA 3ZVJD 1K0BA 4ICYA 5KN0A 4ZBDA 2O89A 2HRFA 1UN2A 3ME8A 2GZPA 4RQXA 3GUSA 2I4AA 3KH7A 4G10A 3I6AA 1T3BA 1GTUA 3QOUA 5B8AA 4TXOB 2I81A 1VGLA 2GSSA 3OR5A 3EYTA 3RPNA 4I97A 2JACA 2C0FA 4ECIA 2VLUA 1QK8A 4G0LA 1YEPA 2O87A 3TKQA 1WP0A 5CO3A 3IAM2 5DQSA 1ERUA 3IOSA 3D4MA 2FNOA 1AIUA 4BWQA 1Q4JA 5EL8A 1DE1A 1PL2A 1G6YA 2MMNA 2X8GA 1K0AA 2NPBA 1SKSB 2JU5A 3TOTA 2BTOT 2X8HA 3KGKA 3H4KA 3M3MA 1SK1A 4BIKA 2DJ3A 5G5FA 2UZ8A 5DJLA 4MZWA 1DE2A 2OE3A 4KH7A 1U88A 3KEBA 4NXIA 3APSA 4ECBA 3H93A 1GLPA 2ON5A 3Q18A 1Y25A 3N9JA 3ISOA 4BVYB 2YZHA 4IHUA 2OA7A 4K8MA 5AIXA 3TOUA 4POKA 3R3EA 2CA8A 5AIVA 3LFLA 1TDIA 19GSA 2VL9A 3GH9A 1NHYA 4MH3A 3FHKA 1Z5YE 1YF1A 3DGQA 2B6MA 1W4VA 4XCSA 4MF7A 1SK2A 3ZFBA 4HZ2A 4XS1A 2CV4A 3FZ4A 5G2ZA 3UAPA 4EIPA 3KTLA 1MD4A 5ECLB 2H76A 1PN0A 2N5FA 3RHBA 2LQQA 4RI7A 1AAZA 1VRSD 4JEDA 4F0BA 1RK4A 5D96A 4X4JA 2QA1A 1XG8A 5C00A 4NPBA 2RUEA 1X9SB 2VCVA 3QAVA 14GSA 3GA4A 4L0UA 2KP1A 2HYXA 2OBIA 5IPGA 1OKDA 2RLIA 1ZZYA 1H4OA 3TGZA 2C3QA 1O73A 1EOGA 3CSIA 2HLSA 4BWSA 4IGJA 3L9SA 5H5RA 4YAPA 3IXRA 2YWNA 3CTGA 2N5AA 4LL4B 2KLXA 1ZYEA 3LW9A 2GQKA 2K6VA 3MWHA 2JZTA 2YPMA 1J08A 5HFGA 2PMTA 3HVXA 1UA5A 2E2MA 3IR4A 3EE2A 5A4WA 2LS5A 3G9BA 5ELGA 1OAZA 2L4CA 5BMUA 3G7JA 5FWGA 2H19A 3M9KA 3A2VA 2A2PA 1YQ1A 3UVHA 1QUWA 4ZL9A 4TR3A 3HVSA 3DVWA 3LJRA 5IOXA 4ZL7A 4F2IA 2VM2A 5ECSA 4O7HA 2CAIA 2H8LA 1B8XA 5ID2A 4MDCA 4LL1B 3VWVA 3HHVA 2YWIA 2R5GA 4MPGA 4EVMA 2IIYA 5ENUA 4AJ8A 4PNGA 1UC7A 4EIQA 4GQFA 3IV4A 3GH6A 1YY7A 2C0DA 6GSXA 5IPHA 2QA2A 4IELA 2DKHA 3SBCA 1LU4A 1V58A 2DJ2A 1TTZA 1SU9A 4ID0A 1SL2B 2C4JA 2R3XA 2AB6A 4O5QA 3IK9A 3TRQA 3GKXA 2X64A 3GV1A 3ZIVA 2VLTA 2PPTA 2MMZA 2GVPA 2X8CA 3IC4A 1K3LA 3LYPA 4K0NA 4TOPA 3DWVA 3DVXA 4WBJA 2AV4A 3I9V2 3QFAC 4KDUA 4ZBBA 3TJKA 5J5NA 4JE1A 4MJCA 2VL3A 2HRAA 2OE0A 6GSVA 1EEJA 4X43A 3LG6A 1A0RP 2YANA 4PGTA 1B9XC 1T1VA 2FCHA 3QFBC 2JL4A 3VPQA 1WMJA 2E7PA 1TRWA 1U3AA 5CYYA 4ZB8A 3ZYWA 2IMDA 2VOCA 4KW6A 1GLQA 3ED3A 3KCMA 3P90A 2OKAA 1Z6MA 3J7Yk 1GTBA 1HYUA 2WCIA 3DKSA 1M2BA 2O8VB 1OC3A 2DSAA 1K3OA 3QD9A 2VD0A 4HQSA 5JWRB 4K2DA 2TRCP 1U87A 1B4QA 2FLSA 2H66A 5GSSA 1SK0A 2OJLA 4YQVA 2F8AA 2R0GA 3IPZA 4HEA2 5HR2A 5DCHA 1XW9A 2L4QA 1ZMAA 4OFTA 4V2NA 2VAFA 4XS4A 1Z7PA 1TXXA 4N0ZA 3AY8A 1BQ7A 4TRXA 3R2QA 4KA0A 4ACSA 1B48A 3A2XA 2X99A 1ZYQB 1EV9A 4I8BA 1MDKA 4GRFA 1SKWB 3L9UA 2LSTA 1AUCA 1EP7A 2OE1A 4AGSA 2H71A 3TKSE 1EZKA 3CRTA 3GX0A 1GUKA 1XW6A 5BRTA 3GKMA 3C8EA 2NVLA 1S3AA 1PN9A 4MLYA 1GP1A 5G1KA 1SKRB 3HA9A 4YH2A 3UIWA 2HSMA 1SL0B 6GSYA 4NV2A 2V6KA 3APOA 2VIMA 5D9VA 3LXZA 4TR0A 16GSA 2F51A 5ID2B 2GDRA 6GSWA 1JZWA 1QFNA 3UVTA 4KX4A 4FO5A 2CVDA 2DJJA 4GCIA 3QPMA 3PPUA 2GT5A 4WR5A 3KIJA 3GTUA 1NM3A 2HXKA 2YP6A 2LQOA 2HSHA 2TIRA 1EV4A 3E0UA 3FKFA 3WD6A 3UARA 1N2AA 1GUMA 2J23A 4WXTA 5DVBA 4BPYA 3IE3A 1EWXA 1FOVA 5HR0A 5D93A 1TI3A 2YWOA 2PWJA 1F9MA 4KGIA 1YEXA 3GFKA 4I2TA 2LRCA 2LNTA 3EU3A 5AGYA 2P5QA 1XBSA 2VO4A 1TOFA 4KUNA 4CDOA 3HCZA 5ECQB 5CRWA 1JZDA 3ERGA 3KP9A 4FH8A 2H74A 4K5SA 3HY2A
chains in the Genus database with same CATH topology
3HJPA 3DIEA 1DBYA 5G30A 1ABAA 3E3EA 4IW9A 1JLVA 3GKNA 3IBHA 2L6CA 4PQ1A 1VF4A 1J9BA 3D0ZA 2D2ZA 1O85A 2VCQA 2A2RA 2O85A 1E2YA 2NBSA 5F06A 2H0GA 5DAKA 1G6WA 1PGTA 3APQA 3C71A 3P7XA 5B8BA 4ZXGA 3F3QA 5IMAA 4MNNA 4WBRD 1F3AA 4X1UA 5INYA 3RDWA 5D9TA 3ZMLA 5H5QA 3TJGA 4ML6A 1XWCA 2DMMA 4HQZA 1XWAA 3DYRA 3A5IA 1PD21 1AXDA 4IP6A 4LA1A 1OYJA 2YV7A 1XFLA 1FB0A 4PQIA 2WULA 3TRPA 2LJAA 3GRXA 3IRAA 2RM6A 3LYKA 4XS4B 4HI7A 1ML6A 2JZRA 2CZ3A 2L5LA 5HFIA 1TP9A 5B7CA 2HSYA 4OFMA 1ZCPA 2VLVA 5D9WA 1HNBA 4MJBA 6GSTA 2GSRA 2H6XA 4FYCA 4KDYA 1GSUA 2IJYA 5A4VA 3S9FA 3EC3A 2KUCA 5G1LA 3EVIA 4MP4A 4XRDA 2GSQA 3VK9A 1GH2A 13GSA 4MA9A 3O76A 4K7IA 5DBQA 4HJ2A 3NZNA 2EIOA 3K8NA 4OCEA 2R6KA 2B5XA 1EP8A 2V32A 3HJMA 4MK3A 5KN3A 1V98A 5CREA 5LNKe 2H1BA 5J9BA 2H6YA 4JR4A 1TRSA 3CYNA 3H8QA 4EXJA 3Q6OA 5C04A 3C1SA 4EKZA 1XCCA 4RUVA 2I1UA 1Z6NA 3DRNA 2CX3A 3FK8A 2WFCA 1OC9A 4EDZA 4ZILA 3KP8A 2M72A 4Q5RA 5IO2A 4BL7B 5KOXA 3GTUB 2J9HA 1T4ZA 2NTOA 4Z2TA 2H01A 4GF0A 1YJ6A 2CVKA 3CXGA 4GSTA 4QL7A 2I3YA 1XPVA 5ABRA 1FAAA 3DMLA 3HVVA 3TRXA 1HD2A 4MF6A 3FYGA 5AISA 5EPFA 1O8WA 1UVZA 2O7KA 4BVXA 4D73A 5J9CA 1E6BA 2GQMA 3GHAA 3HKRA 2QC7A 4J2FA 2MBTA 3WT2A 4TXVA 1N8JA 3ME7A 1F37A 1B4PA 3TJBA 12GSA 4TR1A 5E59A 3VWXA 1ERVA 2VD1A 3D21A 1YZXA 2YN1A 2FWHA 4TR4A 1AQXA 4AJ6A 3UBLA 11GSA 3KH9A 1FHEA 4KE3A 1BJXA 3QCPA 5LCZA 2X49A 4F0CA 1A24A 2MYGA 5DJMA 3EWLA 4Z2UA 3GIXA 2FWFA 3CSHA 3FMWA 5HR1A 1XXUA 3TJFA 4KDXA 2H72A 3D4TA 3HD5A 4Q5FA 1S3DA 3G7IA 2WZ9A 3CTFA 1GRXA 2LTKA 2YV9A 2V6OA 3WGEA 2LJKA 4YQMA 4N10A 1SD9A 5CAXA 3ERWA 3Q74A 5J3RA 3QMXA 4IBPA 3KD0A 2H0HA 1GTAA 2C8UA 1JZOA 1NW2A 3NOFA 1XWBA 5IMZA 2L57A 4NV5A 1EGOA 5GSTA 4P3YB 3FR9A 4Z2RA 1A2MA 1V9WA 4WF5A 4WF4A 3VWWA 1GL8A 5IQYA 1I9DA 2DJKA 1XOAA 1TRUA 2E0QA 5H5SA 1F3BA 2X4AA 3WT1A 3GX8A 2DJ1A 1TK8B 2DKIA 3DEXA 1X9WB 5G5EA 1M2DA 4OO5A 1MDIA 2HZEA 1TK0B 1U3IA 3IDVA 2IMFA 4L5LA 4WETA 1PL1A 5FHIA 5ECNB 1SYRA 1R5PA 1VF2A 3EU4A 4HDEA 1B9YC 3VWUA 1O7UA 6GSUA 2ZUPA 1ACVA 1Q98A 2IFQA 3LWAA 5IIZA 3IK7A 2DC5A 1OC9B 4G2EA 5JWOB 1WE0A 1GSEA 1K0OA 1GTIA 1YKAA 2AUVA 4O92A 4GXZA 4F82A 2WJUA 2HRKA 3QR6A 1PSQA 2B1LA 4J57E 2R0PA 4MCUA 4EDYA 4DSRA 3TDGA 3KJYA 1OVNA 4ILFA 3ZFLA 5EVOA 3QDNA 4POLA 4OCFA 4BVXB 4D73B 2P5RA 4DEJA 2WRTA 1FOHA 4L0WA 2H1GA 2HT9A 2LUSA 4AJ7A 2V41A 3M0FA 4I5QA 4CY8A 2GS3A 1G0TA 1NHOA 3W8JA 4CW9A 3HJOA 2PGTA 4TR1B 1JZRA 2Z9SA 1O8XA 2PN8A 2MZCA 2EIQA 2H1DA 4IJ3A 1TJDA 2XHFA 2CVBA 7GSSA 4HZ4A 3TKSC 1ERWA 1BAYA 1FG4A 3F4TA 2YWMA 4ZB9A 2G2QA 3FEUA 4NHWA 3GYKA 2YOIA 3UBKA 2A2SA 4MABA 5HFKA 2VCXA 17GSA 3UL3A 5G31A 1GUHA 5ELAA 3L78A 1GSQA 2C3NA 4PTSA 1QXHA 1SJIA 2CQ9A 2K8VA 1VF3A 3HYPA 1TU8A 2YNXA 4G9HA 1F2EA 4V2LA 1GSYA 3CSJA 3ZREA 1HNCA 2B5YA 4E8EA 2H30A 2HFDA 2PVQA 4E8HA 1Z3EA 2FWEA 3E9JB 1EGRA 2C1YA 4POMA 4PURA 1TK5B 1WOUA 1OKTA 1YF0A 4JRRA 4NWYA 2G0FA 3F4RA 2GSTA 2IL3A 4GWRA 4J56E 4KCAA 5D8IA 1Z9HA 3W6GA 4NMUA 3W8SA 4Q5QA 3TB2A 2WDUA 1M9AA 1PKZA 4G19A 4GSNA 4IKHA 5IM9A 4JU5A 5E4WA 3MAKA 4WR4A 1K0MA 1K3YA 3M8NA 1G7EA 4GLTA 3HZ8A 2M46A 2H73A 3FZ9A 1MEKA 2DJ0A 2FGXA 2K18A 1ILOA 1HQOA 4XTSA 2GQLA 4ZB6A 4K9ZA 4TVEA 1M0UA 2HZEB 4MZCA 1GNWA 3GURA 5B6MA 5GAPD 4IS0A 2YJ7A 3VPTA 4KAEA 4X0XA 3Q19A 1MD3A 3A3TA 2HRNA 2CAQA 5F8BA 1XVQA 2B7JA 3LQ7A 2IFQB 2XPEA 3A2WA 1WWJA 3BOAA 2ON7A 3L4NA 1C72A 3D6IA 4MMMA 1X0RA 2LEGA 1ZL9A 1JLWA 5CNWA 2XBIA 3ERFA 1IYIA 2OBKA 3EMXA 2E2GA 4CY6A 5F07A 4XHMA 1KEBA 5CRDA 3KMNA 2R4VA 1A8YA 2GT6A 4IJIA 1RW1A 5D9XA 2ZCTA 4XIHA 3H1NA 3SWLA 3UMAA 2K9FA 2C80A 2V2GA 5CRGA 4N11A 4QQ7A 1MDJA 1EOHA 1K0NA 3ZMKA 4ECJA 5DDLA 3IAS2 2L59A 2HI7A 4LLRA 4TN8A 3ZTLA 2REMA 2RUFA 4FIWA 3MDKA 3LEFA 3FZ5A 2LRNA 4RQRA 2IMKA 1R26A 5EY6A 1FW1A 4LMWA 2OADA 5IMDA 1CQHA 1TW9A 1ON4A 5DCGA 4OMVA 3L9VA 3EURA 2V1MA 2KOKA 2AYTA 4AF2A 2BMXA 4G0KA 2B5EA 2JADA 1QMVA 2IPAA 2ES7A 2AJQB 5JCUA 4IP1A 3M9JA 3BD2A 5ECMB 2XBQA 5JCGA 3QAGA 3MSZA 4HS1A 2WGRA 2VL2A 4OO4A 3ZZXA 3ZVJA 1DUGA 2TRXA 1PMTA 3VI7A 1RQMA 4WKWA 1BYEA 1O6JA 3BCKA 1T4YA 5ECIB 3LGCA 2H1AA 3HXSA 4MF5A 2XC2A 5HR3A 3F4SA 1XOBA 1M7TA 2LNSA 1OE8A 2DIZA 2MMAA 3CBUA 1GWCA 1JHBA 3F3RA 5F0GA 5AN1A 3RAZA 3KTBA 1XW5A 4HUAA 5F05A 1TU7A 1IYHA 1LBKA 2B1KA 2FUG2 3EINA 4XRAA 1CQGA 3FR6A 2C0EA 1YKCA 4FYBA 2WB9A 4JR6A 3MNGA 2PERA 3VLNA 1A2JA 2F3MA 3GSTA 4V1Ap 1T7PB 4I2UA 3GL3A 2P31A 1XVWA 4FQUA 3IC8A 5DALA 2GTUA 1PX7A 4DSSA 4QL9A 1J0FA 3D22A 3C1RA 3GSSA 1GSDA 4MZBA 2F9SA 3LXTA 1QQ2A 4YQUA 1Y6EA 1V57A 4EO3A 3ZRDA 1TKDB 2L6DA 1X5EA 3QAWA 4N0VA 1YDKA 5B6NA 3UOMA 1H75A 4O5UA 1ERTA 4KSMA 4YAVA 3F9UA 1GULA 2H0IA 3H79A 3KM6A 3LORA 3HDCA 1SL1B 4PXOA 2R37A 5ECPB 4USSA 2H75A 2XPDA 1WJKA 1BG5A 2DLXA 1ZOFA 4HOJA 9GSSA 4L8EA 3JCML 4G0IA 2GGTA 1AC1A 3MIXA 1F6MC 4POBA 1DSBA 2QKEA 2L5OA 4CHSA 4ZL8A 2IMEA 5D73A 5DAKB 1FO5A 4I6XA 3PGTA 3N5OA 2IMIA 4LMVA 4HU9A 2VL2C 4ZBAA 5DQYA 2F8FA 4K0GA 5IO0A 4KCEA 1R7HA 2H6ZA 5FT3A 4OWYA 2YZUA 2GZZA 5ECHB 2RM5A 5COHA 4HJMA 1A23A 3TKSA 1NSWA 2VUPA 3WYWA 1PQNA 1M99A 1GSFA 1Z7RA 4K5RA 1FB6A 2R0CA 4MH2A 5A5KA 3O3TA 2ZNMA 1HNAA 1ST9A 4JBBA 2DIYA 4IQ1A 3V1WA 4EE0A 4KNDA 5KN1A 1ZYPA 2LKUA 1X9MB 1XZOA 3U5RE 5ECRB 3TKPA 1X5CA 3ZIJA 1SD8A 4PQHA 1URMA 1KNGA 1XIYA 2YCDA 2JZSA 2MMOA 1FVKA 5GZZB 2PBJA 1M2AA 4EC0A 2H70A 3P2AA 2PVOC 2RIIA 2FHEA 1EEMA 4TW5A 3GL5A 2P0GA 4WEYA 4IVFA 2HE3A 3P8WA 3TCOA 2DMLA 3RBTA 1A0FA 10GSA 4MJEA 2DBCA 4NAXA 5CRHA 5J4UA 3DXBA 3IHQA 2FWGA 1ZGNA 3TJJA 20GSA 4PUAA 4GTUA 1G7OA 1USBA 4Z7XA 1KBNA 2VCTA 1JFUA 2FY6A 3EMPA 3TUEA 2QSIA 2VCZA 4KSOA 4EF0A 5IOWA 2B3SA 1VF1A 1SYXA 2M80A 4JZQA 3UEMA 5IMVA 4K7NA 5DALB 4V1Ag 1GSSA 3US3A 4DSSB 3BBYA 3C73A 3F6DA 1XWKA 2AAWA 1S3CA 1SJZA 4NHZA 4ISDA 1PKWA 2CT6A 3GKKA 4PX1A 4OD7A 3U6VA 3D5JA 2HZFA 22GSA 1WIKA 3GMFA 3WGXA 2I9HA 2OACA 1TRVA 2B7KA 1SJ6A 2PU9C 4K1FA 5GAND 6GSSA 1KTEA 1AQWA 3VFIA 1SENA 5JCWA 1AQVA 2VM1A 3KZQA 2CZ2A 1M9BA 2IWTA 1OE7A 2AHEA 5LD0A 4F9ZA 1FVJA 1V2AA 2ALBA 4EUYA 3IHGA 1XWGA 3EPTA 3KXOA 1MTCA 1W89A 5KOWA 4EL1A 2C3TA 5IMCA 3F0IA 3TKRA 1WPIA 5KEJA 4DSQA 3FRCA 3BJ5A 3ZL5A 3BCIA 4F03A 2A4HA 2KHPA 1K0CA 3GN3A 4IN0A 5KN2A 1A2LA 3RPPA 3F63A 2QGVA 3PINA 4TXOA 5ECKB 1U6TA 4IQAA 4XS6A 5HQPA 1X5DA 4O5RA 5L71A 2PUKC 3WGDA 3NIVA 2YJHA 4A5PA 4N30A 2GLRA 1BX9A 4BA7A 3M1GA 2MBSA 2NDOA 4ML1A 4Q5NA 4ZIJA 4K7OA 2FA4A 3C7MA 2KP2A 2CX4A 2EC4A 2R2JA 4KB3A 4ECCA 3FY7A 2VCWA 1K0DA 4MPFA 2JSZA 1I5GA 2FA8A 2N5BA 4L5OA 4PUFC 4KF9A 3F8UA 1R4WA 4GQCA 5ECOB 4H86A 3VURA 3PR8A 2K8SA 3J7Yb 3KMOA 1TI1A 2LJRA 4MJAA 1QGVA 1AW9A 1O81A 3F6FA 4RI6A 4BVYA 3A5WA 4FYUA 4BL7A 2LRTA 4O32A 1R5AA 2HNLA 5J41A 18GSA 4OFNA 5IMFA 4K2XA 2IN3A 3HZ4A 2C0GA 1T00A 2GZYA 3CMIA 3FR3A 3GNJA 4DVCA 3LSZA 3O6TA 8GSSA 4ULXA 3FZAA 4HU7A 3I43A 3CRUA 2A4VA 3DD3A 3IA1A 5A4UA 1V40A 1T8EB 3RHCA 2EIRA 2FD3A 4GSSA 1LJRA 1THXA 3MYDA 3UJ1A 3PH9A 3FW2A 4V2MA 5CP1A 1GNEA 3ZLPA 2LV3A 3L0HA 3ZITA 1PX6A 2WS2A 4PNFA 3VI5A 1WRYA 1BEDA 1THOA 3G7YA 5JWQB 1PRXA 4K6XA 1OC8A 1PA3A 4YKGA 2JSYA 1ZYNA 2BJXA 4TKYA 1A8LA 3I69A 4YKFA 3ZVJD 1K0BA 4ICYA 5KN0A 4ZBDA 2O89A 2HRFA 1UN2A 3ME8A 2GZPA 4RQXA 3GUSA 2I4AA 3KH7A 4G10A 3I6AA 1T3BA 1GTUA 3QOUA 5B8AA 4TXOB 2I81A 1VGLA 2GSSA 3OR5A 3EYTA 3RPNA 4I97A 2JACA 2C0FA 4ECIA 2VLUA 1QK8A 4G0LA 1YEPA 2O87A 3TKQA 1WP0A 5CO3A 3IAM2 5DQSA 1ERUA 3IOSA 3D4MA 2FNOA 1AIUA 4BWQA 1Q4JA 5EL8A 1DE1A 1PL2A 1G6YA 2MMNA 2X8GA 1K0AA 2NPBA 1SKSB 2JU5A 3TOTA 2BTOT 2X8HA 3KGKA 3H4KA 3M3MA 1SK1A 2DJ3A 5G5FA 2UZ8A 5DJLA 4MZWA 1DE2A 2OE3A 4KH7A 1U88A 3KEBA 4NXIA 3APSA 4ECBA 3H93A 1GLPA 2ON5A 3Q18A 1Y25A 3N9JA 3ISOA 4BVYB 2YZHA 4IHUA 2OA7A 4K8MA 5AIXA 3TOUA 4POKA 3R3EA 2CA8A 5AIVA 3LFLA 1TDIA 19GSA 2VL9A 3GH9A 1NHYA 4MH3A 3FHKA 1Z5YE 1YF1A 3DGQA 2B6MA 1W4VA 4XCSA 4MF7A 1SK2A 3ZFBA 4HZ2A 4XS1A 2CV4A 3FZ4A 5G2ZA 3UAPA 4EIPA 3KTLA 1MD4A 5ECLB 2H76A 1PN0A 2N5FA 3RHBA 2LQQA 4RI7A 1AAZA 1VRSD 4JEDA 4F0BA 1RK4A 5D96A 4X4JA 2QA1A 5C00A 4NPBA 2RUEA 1X9SB 2VCVA 3QAVA 14GSA 3GA4A 4L0UA 2KP1A 2HYXA 2OBIA 5IPGA 1OKDA 2RLIA 1ZZYA 1H4OA 3TGZA 2C3QA 1O73A 1EOGA 3CSIA 2HLSA 4BWSA 4IGJA 3L9SA 5H5RA 4YAPA 3IXRA 2YWNA 3CTGA 2N5AA 4LL4B 2KLXA 1ZYEA 3LW9A 2GQKA 2K6VA 3MWHA 2JZTA 2YPMA 1J08A 5HFGA 2PMTA 3HVXA 1UA5A 2E2MA 3IR4A 3EE2A 5A4WA 2LS5A 3G9BA 5ELGA 1OAZA 2L4CA 5BMUA 3G7JA 5FWGA 2H19A 3M9KA 3A2VA 2A2PA 1YQ1A 3UVHA 1QUWA 4ZL9A 4TR3A 3HVSA 3DVWA 3LJRA 5IOXA 4ZL7A 4F2IA 2VM2A 5ECSA 4O7HA 2CAIA 2H8LA 1B8XA 5ID2A 4MDCA 4LL1B 3VWVA 3HHVA 2YWIA 2R5GA 4MPGA 4EVMA 2IIYA 5ENUA 4AJ8A 4PNGA 1UC7A 4EIQA 4GQFA 3IV4A 3GH6A 1YY7A 2C0DA 6GSXA 5IPHA 2QA2A 4IELA 2DKHA 3SBCA 1LU4A 1V58A 2DJ2A 1TTZA 1SU9A 4ID0A 1SL2B 2C4JA 2R3XA 2AB6A 4O5QA 3IK9A 3TRQA 3GKXA 2X64A 3GV1A 3ZIVA 2VLTA 2PPTA 2MMZA 2GVPA 2X8CA 3IC4A 1K3LA 3LYPA 4K0NA 4TOPA 3DWVA 3DVXA 4WBJA 2AV4A 3I9V2 3QFAC 4KDUA 4ZBBA 3TJKA 5J5NA 4JE1A 4MJCA 2VL3A 2HRAA 2OE0A 6GSVA 1EEJA 4X43A 3LG6A 1A0RP 2YANA 4PGTA 1B9XC 1T1VA 2FCHA 3QFBC 2JL4A 3VPQA 1WMJA 2E7PA 1TRWA 1U3AA 5CYYA 4ZB8A 3ZYWA 2IMDA 2VOCA 4KW6A 1GLQA 3ED3A 3KCMA 3P90A 2OKAA 1Z6MA 3J7Yk 1GTBA 1HYUA 2WCIA 3DKSA 1M2BA 2O8VB 1OC3A 2DSAA 1K3OA 3QD9A 2VD0A 4HQSA 5JWRB 4K2DA 2TRCP 1U87A 1B4QA 2FLSA 2H66A 5GSSA 1SK0A 2OJLA 4YQVA 2F8AA 2R0GA 3IPZA 4HEA2 5HR2A 5DCHA 1XW9A 2L4QA 1ZMAA 4OFTA 4V2NA 2VAFA 4XS4A 1Z7PA 1TXXA 4N0ZA 3AY8A 1BQ7A 4TRXA 3R2QA 4KA0A 4ACSA 1B48A 3A2XA 2X99A 1ZYQB 1EV9A 4I8BA 1MDKA 4GRFA 1SKWB 3L9UA 2LSTA 1AUCA 1EP7A 2OE1A 4AGSA 2H71A 3TKSE 1EZKA 3CRTA 3GX0A 1GUKA 1XW6A 5BRTA 3GKMA 3C8EA 2NVLA 1S3AA 1PN9A 4MLYA 1GP1A 5G1KA 1SKRB 3HA9A 4YH2A 3UIWA 2HSMA 1SL0B 6GSYA 4NV2A 2V6KA 3APOA 2VIMA 5D9VA 3LXZA 4TR0A 16GSA 2F51A 5ID2B 2GDRA 6GSWA 1JZWA 1QFNA 3UVTA 4KX4A 4FO5A 2CVDA 2DJJA 4GCIA 3QPMA 3PPUA 2GT5A 4WR5A 3KIJA 3GTUA 1NM3A 2HXKA 2YP6A 2LQOA 2HSHA 2TIRA 1EV4A 3E0UA 3FKFA 3WD6A 3UARA 1N2AA 1GUMA 2J23A 4WXTA 5DVBA 4BPYA 3IE3A 1EWXA 1FOVA 5HR0A 5D93A 1TI3A 2YWOA 2PWJA 1F9MA 4KGIA 1YEXA 3GFKA 4I2TA 2LRCA 2LNTA 3EU3A 5AGYA 2P5QA 1XBSA 2VO4A 1TOFA 4KUNA 4CDOA 3HCZA 5ECQB 5CRWA 1JZDA 3ERGA 3KP9A 4FH8A 2H74A 4K5SA 3HY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJP A;  3DIE A;  1DBY A;  5G30 A;  1ABA A;  3E3E A;  4IW9 A;  1JLV A;  3GKN A;  3IBH A;  2L6C A;  4PQ1 A;  1VF4 A;  1J9B A;  3D0Z A;  2D2Z A;  1O85 A;  2VCQ A;  2A2R A;  2O85 A;  1E2Y A;  2NBS A;  5F06 A;  2H0G A;  5DAK A;  1G6W A;  1PGT A;  3APQ A;  3C71 A;  3P7X A;  5B8B A;  4ZXG A;  3F3Q A;  5IMA A;  4WBR D;  1F3A A;  4X1U A;  5INY A;  3RDW A;  5D9T A;  3ZML A;  5H5Q A;  3TJG A;  4ML6 A;  1XWC A;  2DMM A;  4HQZ A;  1XWA A;  3DYR A;  1PD2 1;  1AXD A;  4IP6 A;  4LA1 A;  1OYJ A;  2YV7 A;  1XFL A;  1FB0 A;  4PQI A;  2WUL A;  3TRP A;  2LJA A;  3GRX A;  3IRA A;  2RM6 A;  3LYK A;  4XS4 B;  4HI7 A;  1ML6 A;  2JZR A;  2CZ3 A;  2L5L A;  5HFI A;  1TP9 A;  5B7C A;  2HSY A;  4OFM A;  1ZCP A;  2VLV A;  5D9W A;  1HNB A;  4MJB A;  6GST A;  2GSR A;  2H6X A;  4FYC A;  4KDY A;  1GSU A;  2IJY A;  5A4V A;  3S9F A;  3EC3 A;  2KUC A;  5G1L A;  3EVI A;  4MP4 A;  4XRD A;  2GSQ A;  3VK9 A;  1GH2 A;  13GS A;  4MA9 A;  3O76 A;  4K7I A;  5DBQ A;  4HJ2 A;  3NZN A;  2EIO A;  3K8N A;  4OCE A;  2R6K A;  2B5X A;  1EP8 A;  2V32 A;  3HJM A;  4MK3 A;  5KN3 A;  1V98 A;  5CRE A;  5LNK e;  2H1B A;  5J9B A;  2H6Y A;  4JR4 A;  1TRS A;  3CYN A;  3H8Q A;  4EXJ A;  3Q6O A;  5C04 A;  3C1S A;  4EKZ A;  1XCC A;  4RUV A;  2I1U A;  1Z6N A;  3DRN A;  2CX3 A;  3FK8 A;  2WFC A;  1OC9 A;  4EDZ A;  4ZIL A;  3KP8 A;  2M72 A;  4Q5R A;  5IO2 A;  3GTU B;  2J9H A;  1T4Z A;  2NTO A;  2H01 A;  4GF0 A;  1YJ6 A;  2CVK A;  3CXG A;  4GST A;  4QL7 A;  2I3Y A;  1XPV A;  5ABR A;  1FAA A;  3DML A;  3HVV A;  3TRX A;  1HD2 A;  4MF6 A;  3FYG A;  5AIS A;  5EPF A;  1O8W A;  1UVZ A;  2O7K A;  4BVX A;  4D73 A;  5J9C A;  1E6B A;  2GQM A;  3GHA A;  3HKR A;  2QC7 A;  4J2F A;  2MBT A;  3WT2 A;  4TXV A;  1N8J A;  3ME7 A;  1F37 A;  1B4P A;  3TJB A;  12GS A;  4TR1 A;  5E59 A;  3VWX A;  1ERV A;  2VD1 A;  3D21 A;  1YZX A;  2YN1 A;  2FWH A;  4TR4 A;  1AQX A;  4AJ6 A;  3UBL A;  11GS A;  3KH9 A;  1FHE A;  4KE3 A;  1BJX A;  3QCP A;  5LCZ A;  4F0C A;  1A24 A;  2MYG A;  5DJM A;  3EWL A;  3GIX A;  2FWF A;  3CSH A;  5HR1 A;  1XXU A;  3TJF A;  4KDX A;  2H72 A;  3D4T A;  3HD5 A;  4Q5F A;  1S3D A;  3G7I A;  2WZ9 A;  3CTF A;  1GRX A;  2LTK A;  2YV9 A;  2V6O A;  3WGE A;  2LJK A;  4YQM A;  4N10 A;  1SD9 A;  5CAX A;  3ERW A;  3Q74 A;  5J3R A;  3QMX A;  4IBP A;  3KD0 A;  2H0H A;  1GTA A;  2C8U A;  1JZO A;  1NW2 A;  3NOF A;  1XWB A;  5IMZ A;  2L57 A;  4NV5 A;  1EGO A;  5GST A;  4P3Y B;  3FR9 A;  1A2M A;  1V9W A;  4WF5 A;  4WF4 A;  3VWW A;  1GL8 A;  5IQY A;  1I9D A;  2DJK A;  1XOA A;  1TRU A;  2E0Q A;  5H5S A;  1F3B A;  3WT1 A;  3GX8 A;  2DJ1 A;  1TK8 B;  3DEX A;  1X9W B;  5G5E A;  1M2D A;  4OO5 A;  1MDI A;  2HZE A;  1TK0 B;  1U3I A;  3IDV A;  2IMF A;  4L5L A;  4WET A;  1PL1 A;  5FHI A;  5ECN B;  1SYR A;  1R5P A;  1VF2 A;  3EU4 A;  4HDE A;  1B9Y C;  3VWU A;  1O7U A;  6GSU A;  2ZUP A;  1ACV A;  1Q98 A;  2IFQ A;  3LWA A;  5IIZ A;  3IK7 A;  2DC5 A;  1OC9 B;  4G2E A;  5JWO B;  1WE0 A;  1GSE A;  1K0O A;  1GTI A;  1YKA A;  2AUV A;  4O92 A;  4GXZ A;  4F82 A;  2WJU A;  3QR6 A;  1PSQ A;  2B1L A;  4J57 E;  4MCU A;  4EDY A;  4DSR A;  3TDG A;  3KJY A;  1OVN A;  4ILF A;  3ZFL A;  5EVO A;  3QDN A;  4POL A;  4OCF A;  4D73 B;  2P5R A;  4DEJ A;  2WRT A;  4L0W A;  2H1G A;  2HT9 A;  2LUS A;  4AJ7 A;  2V41 A;  3M0F A;  4I5Q A;  2GS3 A;  1G0T A;  1NHO A;  3W8J A;  4CW9 A;  3HJO A;  2PGT A;  4TR1 B;  1JZR A;  2Z9S A;  1O8X A;  2PN8 A;  2MZC A;  2EIQ A;  2H1D A;  4IJ3 A;  1TJD A;  2XHF A;  2CVB A;  7GSS A;  4HZ4 A;  3TKS C;  1ERW A;  1BAY A;  1FG4 A;  3F4T A;  2YWM A;  4ZB9 A;  2G2Q A;  3FEU A;  4NHW A;  3GYK A;  2YOI A;  3UBK A;  2A2S A;  4MAB A;  5HFK A;  2VCX A;  17GS A;  3UL3 A;  5G31 A;  1GUH A;  5ELA A;  3L78 A;  1GSQ A;  2C3N A;  1QXH A;  1SJI A;  2CQ9 A;  2K8V A;  1VF3 A;  3HYP A;  1TU8 A;  2YNX A;  4G9H A;  1F2E A;  4V2L A;  1GSY A;  3CSJ A;  3ZRE A;  1HNC A;  2B5Y A;  4E8E A;  2H30 A;  2HFD A;  2PVQ A;  4E8H A;  1Z3E A;  2FWE A;  3E9J B;  1EGR A;  2C1Y A;  4POM A;  4PUR A;  1TK5 B;  1WOU A;  1OKT A;  1YF0 A;  4JRR A;  4NWY A;  2G0F A;  3F4R A;  2GST A;  2IL3 A;  4GWR A;  4J56 E;  4KCA A;  5D8I A;  1Z9H A;  3W6G A;  4NMU A;  3W8S A;  4Q5Q A;  3TB2 A;  2WDU A;  1M9A A;  1PKZ A;  4G19 A;  4GSN A;  4IKH A;  5IM9 A;  4JU5 A;  5E4W A;  3MAK A;  4WR4 A;  1K0M A;  1K3Y A;  3M8N A;  1G7E A;  4GLT A;  3HZ8 A;  2M46 A;  2H73 A;  3FZ9 A;  1MEK A;  2DJ0 A;  2FGX A;  2K18 A;  1ILO A;  1HQO A;  4XTS A;  2GQL A;  4ZB6 A;  4K9Z A;  4TVE A;  1M0U A;  2HZE B;  4MZC A;  1GNW A;  3GUR A;  5B6M A;  5GAP D;  4IS0 A;  2YJ7 A;  3VPT A;  4KAE A;  4X0X A;  3Q19 A;  1MD3 A;  3A3T A;  2HRN A;  2CAQ A;  5F8B A;  1XVQ A;  2B7J A;  3LQ7 A;  2IFQ B;  2XPE A;  3A2W A;  1WWJ A;  3BOA A;  2ON7 A;  3L4N A;  1C72 A;  3D6I A;  4MMM A;  1X0R A;  2LEG A;  1ZL9 A;  1JLW A;  2XBI A;  3ERF A;  5CNW A;  1IYI A;  2OBK A;  3EMX A;  2E2G A;  5F07 A;  4XHM A;  1KEB A;  5CRD A;  3KMN A;  2R4V A;  1A8Y A;  2GT6 A;  4IJI A;  1RW1 A;  5D9X A;  2ZCT A;  4XIH A;  3H1N A;  3SWL A;  3UMA A;  2K9F A;  2C80 A;  2V2G A;  5CRG A;  4N11 A;  4QQ7 A;  1MDJ A;  1EOH A;  1K0N A;  3ZMK A;  4ECJ A;  5DDL A;  3IAS 2;  2L59 A;  2HI7 A;  4LLR A;  4TN8 A;  3ZTL A;  2REM A;  2RUF A;  4FIW A;  3MDK A;  3LEF A;  3FZ5 A;  2LRN A;  4RQR A;  2IMK A;  1R26 A;  5EY6 A;  1FW1 A;  4LMW A;  2OAD A;  5IMD A;  1CQH A;  1TW9 A;  1ON4 A;  5DCG A;  4OMV A;  3L9V A;  3EUR A;  2V1M A;  2KOK A;  2AYT A;  4AF2 A;  2BMX A;  2B5E A;  2JAD A;  1QMV A;  2IPA A;  2ES7 A;  2AJQ B;  5JCU A;  4IP1 A;  3M9J A;  3BD2 A;  5ECM B;  2XBQ A;  5JCG A;  3QAG A;  3MSZ A;  4HS1 A;  2WGR A;  2VL2 A;  4OO4 A;  3ZZX A;  3ZVJ A;  1DUG A;  2TRX A;  1PMT A;  3VI7 A;  1RQM A;  4WKW A;  1BYE A;  1O6J A;  3BCK A;  1T4Y A;  5ECI B;  3LGC A;  2H1A A;  3HXS A;  4MF5 A;  2XC2 A;  5HR3 A;  3F4S A;  1XOB A;  1M7T A;  2LNS A;  1OE8 A;  2DIZ A;  2MMA A;  3CBU A;  1GWC A;  1JHB A;  3F3R A;  5F0G A;  5AN1 A;  3RAZ A;  3KTB A;  1XW5 A;  4HUA A;  5F05 A;  1TU7 A;  1IYH A;  1LBK A;  2B1K A;  2FUG 2;  3EIN A;  4XRA A;  1CQG A;  3FR6 A;  2C0E A;  1YKC A;  4FYB A;  2WB9 A;  4JR6 A;  3MNG A;  2PER A;  3VLN A;  1A2J A;  2F3M A;  3GST A;  4V1A p;  1T7P B;  4I2U A;  3GL3 A;  2P31 A;  1XVW A;  5DAL A;  2GTU A;  1PX7 A;  4DSS A;  4QL9 A;  1J0F A;  3D22 A;  3C1R A;  3GSS A;  1GSD A;  4MZB A;  2F9S A;  3LXT A;  1QQ2 A;  4YQU A;  1Y6E A;  1V57 A;  4EO3 A;  3ZRD A;  1TKD B;  2L6D A;  1X5E A;  3QAW A;  4N0V A;  1YDK A;  5B6N A;  3UOM A;  1H75 A;  1ERT A;  4KSM A;  4YAV A;  3F9U A;  1GUL A;  2H0I A;  3H79 A;  3KM6 A;  3LOR A;  3HDC A;  1SL1 B;  4PXO A;  2R37 A;  5ECP B;  2H75 A;  2XPD A;  1WJK A;  1BG5 A;  2DLX A;  1ZOF A;  4HOJ A;  9GSS A;  4L8E A;  3JCM L;  2GGT A;  1AC1 A;  1F6M C;  4POB A;  1DSB A;  2QKE A;  2L5O A;  4CHS A;  4ZL8 A;  2IME A;  5D73 A;  5DAK B;  1FO5 A;  4I6X A;  3PGT A;  3N5O A;  2IMI A;  4LMV A;  4HU9 A;  2VL2 C;  4ZBA A;  5DQY A;  2F8F A;  4K0G A;  5IO0 A;  4KCE A;  1R7H A;  2H6Z A;  5FT3 A;  4OWY A;  2YZU A;  2GZZ A;  5ECH B;  2RM5 A;  5COH A;  4HJM A;  1A23 A;  3TKS A;  1NSW A;  2VUP A;  3WYW A;  1PQN A;  1M99 A;  1GSF A;  1Z7R A;  1FB6 A;  4MH2 A;  5A5K A;  3O3T A;  2ZNM A;  1HNA A;  1ST9 A;  4JBB A;  2DIY A;  4IQ1 A;  3V1W A;  4EE0 A;  4KND A;  5KN1 A;  2LKU A;  1X9M B;  1XZO A;  3U5R E;  5ECR B;  3TKP A;  1X5C A;  3ZIJ A;  1SD8 A;  4PQH A;  1URM A;  1KNG A;  1XIY A;  2YCD A;  2JZS A;  2MMO A;  1FVK A;  5GZZ B;  2PBJ A;  1M2A A;  4EC0 A;  2H70 A;  3P2A A;  2PVO C;  2RII A;  2FHE A;  1EEM A;  4TW5 A;  3GL5 A;  2P0G A;  4WEY A;  4IVF A;  2HE3 A;  3P8W A;  3TCO A;  2DML A;  3RBT A;  1A0F A;  10GS A;  4MJE A;  2DBC A;  4NAX A;  5CRH A;  5J4U A;  3DXB A;  3IHQ A;  2FWG A;  1ZGN A;  3TJJ A;  20GS A;  4PUA A;  4GTU A;  1G7O A;  1USB A;  4Z7X A;  1KBN A;  2VCT A;  1JFU A;  2FY6 A;  3EMP A;  3TUE A;  2QSI A;  2VCZ A;  4KSO A;  4EF0 A;  5IOW A;  2B3S A;  1VF1 A;  1SYX A;  2M80 A;  4JZQ A;  3UEM A;  5IMV A;  4K7N A;  5DAL B;  4V1A g;  1GSS A;  3US3 A;  4DSS B;  3BBY A;  3C73 A;  3F6D A;  1XWK A;  2AAW A;  1S3C A;  1SJZ A;  4NHZ A;  4ISD A;  1PKW A;  2CT6 A;  3GKK A;  4PX1 A;  4OD7 A;  3U6V A;  3D5J A;  2HZF A;  22GS A;  1WIK A;  3GMF A;  3WGX A;  2I9H A;  2OAC A;  1TRV A;  2B7K A;  1SJ6 A;  2PU9 C;  4K1F A;  5GAN D;  6GSS A;  1KTE A;  1AQW A;  3VFI A;  1SEN A;  5JCW A;  1AQV A;  2VM1 A;  3KZQ A;  2CZ2 A;  1M9B A;  2IWT A;  1OE7 A;  2AHE A;  5LD0 A;  4F9Z A;  1FVJ A;  1V2A A;  2ALB A;  4EUY A;  1XWG A;  3KXO A;  1MTC A;  1W89 A;  4EL1 A;  2C3T A;  5IMC A;  3F0I A;  3TKR A;  1WPI A;  5KEJ A;  4DSQ A;  3FRC A;  3BJ5 A;  3ZL5 A;  3BCI A;  4F03 A;  2KHP A;  1K0C A;  3GN3 A;  4IN0 A;  5KN2 A;  1A2L A;  3RPP A;  3F63 A;  2QGV A;  3PIN A;  4TXO A;  5ECK B;  1U6T A;  4IQA A;  4XS6 A;  5HQP A;  1X5D A;  4O5R A;  5L71 A;  2PUK C;  3WGD A;  3NIV A;  2YJH A;  4N30 A;  2GLR A;  1BX9 A;  4BA7 A;  3M1G A;  2MBS A;  2NDO A;  4ML1 A;  4Q5N A;  4ZIJ A;  4K7O A;  2FA4 A;  3C7M A;  2KP2 A;  2CX4 A;  2EC4 A;  2R2J A;  4KB3 A;  4ECC A;  3FY7 A;  2VCW A;  1K0D A;  4MPF A;  2JSZ A;  1I5G A;  2FA8 A;  2N5B A;  4L5O A;  4PUF C;  3F8U A;  1R4W A;  4GQC A;  5ECO B;  4H86 A;  3VUR A;  3PR8 A;  2K8S A;  3J7Y b;  3KMO A;  1TI1 A;  2LJR A;  4MJA A;  1QGV A;  1AW9 A;  1O81 A;  3F6F A;  4RI6 A;  4BVY A;  3A5W A;  4FYU A;  4BL7 A;  2LRT A;  4O32 A;  1R5A A;  2HNL A;  5J41 A;  18GS A;  4OFN A;  5IMF A;  2IN3 A;  3HZ4 A;  2C0G A;  1T00 A;  2GZY A;  3CMI A;  3FR3 A;  3GNJ A;  4DVC A;  3LSZ A;  3O6T A;  8GSS A;  4ULX A;  3FZA A;  4HU7 A;  3I43 A;  3CRU A;  2A4V A;  3DD3 A;  3IA1 A;  5A4U A;  1V40 A;  1T8E B;  3RHC A;  2EIR A;  2FD3 A;  4GSS A;  1LJR A;  1THX A;  3UJ1 A;  3PH9 A;  3FW2 A;  4V2M A;  5CP1 A;  1GNE A;  3ZLP A;  2LV3 A;  3L0H A;  3ZIT A;  1PX6 A;  2WS2 A;  4PNF A;  3VI5 A;  1WRY A;  1BED A;  1THO A;  3G7Y A;  5JWQ B;  1PRX A;  4K6X A;  1OC8 A;  1PA3 A;  2JSY A;  2BJX A;  4TKY A;  1A8L A;  3I69 A;  3ZVJ D;  1K0B A;  5KN0 A;  4ZBD A;  2O89 A;  2HRF A;  1UN2 A;  3ME8 A;  2GZP A;  4RQX A;  3GUS A;  2I4A A;  3KH7 A;  4G10 A;  3I6A A;  1T3B A;  1GTU A;  3QOU A;  5B8A A;  4TXO B;  2I81 A;  1VGL A;  2GSS A;  3OR5 A;  3EYT A;  3RPN A;  4I97 A;  2JAC A;  2C0F A;  4ECI A;  2VLU A;  1QK8 A;  1YEP A;  2O87 A;  3TKQ A;  1WP0 A;  5CO3 A;  3IAM 2;  5DQS A;  1ERU A;  3IOS A;  3D4M A;  2FNO A;  1AIU A;  4BWQ A;  1Q4J A;  5EL8 A;  1DE1 A;  1PL2 A;  1G6Y A;  2MMN A;  2X8G A;  1K0A A;  2NPB A;  1SKS B;  2JU5 A;  3TOT A;  2BTO T;  2X8H A;  3KGK A;  3H4K A;  3M3M A;  1SK1 A;  2DJ3 A;  5G5F A;  5DJL A;  4MZW A;  1DE2 A;  2OE3 A;  4KH7 A;  1U88 A;  3KEB A;  4NXI A;  3APS A;  4ECB A;  3H93 A;  1GLP A;  2ON5 A;  3Q18 A;  1Y25 A;  3N9J A;  3ISO A;  2YZH A;  4IHU A;  2OA7 A;  4K8M A;  5AIX A;  3TOU A;  4POK A;  2CA8 A;  5AIV A;  3LFL A;  1TDI A;  19GS A;  2VL9 A;  3GH9 A;  1NHY A;  4MH3 A;  3FHK A;  1Z5Y E;  1YF1 A;  3DGQ A;  2B6M A;  1W4V A;  4XCS A;  4MF7 A;  1SK2 A;  3ZFB A;  4HZ2 A;  4XS1 A;  2CV4 A;  3FZ4 A;  5G2Z A;  3UAP A;  3KTL A;  1MD4 A;  5ECL B;  2H76 A;  2N5F A;  3RHB A;  2LQQ A;  4RI7 A;  1AAZ A;  1VRS D;  4JED A;  4F0B A;  1RK4 A;  5D96 A;  5C00 A;  4NPB A;  2RUE A;  1X9S B;  2VCV A;  3QAV A;  14GS A;  3GA4 A;  4L0U A;  2KP1 A;  2HYX A;  2OBI A;  5IPG A;  1OKD A;  2RLI A;  1ZZY A;  1H4O A;  3TGZ A;  2C3Q A;  1O73 A;  1EOG A;  3CSI A;  2HLS A;  4BWS A;  4IGJ A;  3L9S A;  5H5R A;  4YAP A;  3IXR A;  2YWN A;  3CTG A;  2N5A A;  4LL4 B;  2KLX A;  1ZYE A;  2GQK A;  2K6V A;  3MWH A;  2JZT A;  2YPM A;  1J08 A;  5HFG A;  2PMT A;  3HVX A;  1UA5 A;  2E2M A;  3IR4 A;  3EE2 A;  5A4W A;  2LS5 A;  3G9B A;  5ELG A;  1OAZ A;  2L4C A;  3G7J A;  5FWG A;  2H19 A;  3M9K A;  3A2V A;  1YQ1 A;  3UVH A;  1QUW A;  4ZL9 A;  4TR3 A;  3HVS A;  3DVW A;  3LJR A;  5IOX A;  4ZL7 A;  4F2I A;  2VM2 A;  5ECS A;  4O7H A;  2CAI A;  2H8L A;  1B8X A;  5ID2 A;  4MDC A;  4LL1 B;  3VWV A;  3HHV A;  2YWI A;  2R5G A;  4MPG A;  4EVM A;  2IIY A;  5ENU A;  4AJ8 A;  4PNG A;  1UC7 A;  4GQF A;  3IV4 A;  3GH6 A;  1YY7 A;  2C0D A;  6GSX A;  5IPH A;  4IEL A;  3SBC A;  1LU4 A;  1V58 A;  2DJ2 A;  1TTZ A;  1SU9 A;  4ID0 A;  1SL2 B;  2C4J A;  2R3X A;  2AB6 A;  3IK9 A;  3TRQ A;  3GKX A;  2X64 A;  3GV1 A;  3ZIV A;  2VLT A;  2PPT A;  2MMZ A;  2GVP A;  2X8C A;  3IC4 A;  1K3L A;  3LYP A;  4K0N A;  4TOP A;  3DWV A;  3DVX A;  4WBJ A;  2AV4 A;  3I9V 2;  3QFA C;  4KDU A;  4ZBB A;  3TJK A;  5J5N A;  4JE1 A;  4MJC A;  2VL3 A;  2OE0 A;  6GSV A;  1EEJ A;  4X43 A;  3LG6 A;  1A0R P;  2YAN A;  4PGT A;  1B9X C;  1T1V A;  2FCH A;  3QFB C;  2JL4 A;  3VPQ A;  1WMJ A;  2E7P A;  1TRW A;  1U3A A;  5CYY A;  4ZB8 A;  3ZYW A;  2IMD A;  2VOC A;  4KW6 A;  1GLQ A;  3ED3 A;  3KCM A;  3P90 A;  2OKA A;  1Z6M A;  3J7Y k;  1GTB A;  1HYU A;  2WCI A;  3DKS A;  1M2B A;  2O8V B;  1OC3 A;  2DSA A;  1K3O A;  3QD9 A;  2VD0 A;  4HQS A;  5JWR B;  4K2D A;  2TRC P;  1U87 A;  1B4Q A;  2FLS A;  2H66 A;  5GSS A;  1SK0 A;  2OJL A;  4YQV A;  2F8A A;  3IPZ A;  4HEA 2;  5HR2 A;  5DCH A;  1XW9 A;  2L4Q A;  1ZMA A;  4OFT A;  4V2N A;  2VAF A;  4XS4 A;  1Z7P A;  1TXX A;  4N0Z A;  3AY8 A;  1BQ7 A;  4TRX A;  3R2Q A;  4KA0 A;  4ACS A;  1B48 A;  3A2X A;  2X99 A;  1ZYQ B;  1EV9 A;  4I8B A;  1MDK A;  4GRF A;  1SKW B;  3L9U A;  2LST A;  1AUC A;  1EP7 A;  2OE1 A;  4AGS A;  2H71 A;  3TKS E;  1EZK A;  3CRT A;  3GX0 A;  1GUK A;  1XW6 A;  3GKM A;  3C8E A;  2NVL A;  1S3A A;  1PN9 A;  4MLY A;  1GP1 A;  5G1K A;  1SKR B;  3HA9 A;  4YH2 A;  3UIW A;  1SL0 B;  6GSY A;  4NV2 A;  2V6K A;  3APO A;  2VIM A;  5D9V A;  3LXZ A;  4TR0 A;  16GS A;  2F51 A;  5ID2 B;  2GDR A;  6GSW A;  1JZW A;  1QFN A;  3UVT A;  4KX4 A;  4FO5 A;  2CVD A;  2DJJ A;  4GCI A;  3QPM A;  2GT5 A;  4WR5 A;  3KIJ A;  3GTU A;  1NM3 A;  2HXK A;  2YP6 A;  2LQO A;  2HSH A;  2TIR A;  1EV4 A;  3E0U A;  3FKF A;  3WD6 A;  3UAR A;  1N2A A;  1GUM A;  2J23 A;  4WXT A;  5DVB A;  4BPY A;  3IE3 A;  1EWX A;  1FOV A;  5HR0 A;  5D93 A;  1TI3 A;  2YWO A;  2PWJ A;  1F9M A;  4KGI A;  1YEX A;  3GFK A;  4I2T A;  2LRC A;  2LNT A;  3EU3 A;  5AGY A;  2P5Q A;  1XBS A;  2VO4 A;  1TOF A;  4KUN A;  4CDO A;  3HCZ A;  5ECQ B;  5CRW A;  1JZD A;  3ERG A;  3KP9 A;  4FH8 A;  2H74 A;  3HY2 A; 
#chains in the Genus database with same CATH topology
 3HJP A;  3DIE A;  1DBY A;  5G30 A;  1ABA A;  3E3E A;  4IW9 A;  1JLV A;  3GKN A;  3IBH A;  2L6C A;  4PQ1 A;  1VF4 A;  1J9B A;  3D0Z A;  2D2Z A;  1O85 A;  2VCQ A;  2A2R A;  2O85 A;  1E2Y A;  2NBS A;  5F06 A;  2H0G A;  5DAK A;  1G6W A;  1PGT A;  3APQ A;  3C71 A;  3P7X A;  5B8B A;  4ZXG A;  3F3Q A;  5IMA A;  4MNN A;  4WBR D;  1F3A A;  4X1U A;  5INY A;  3RDW A;  5D9T A;  3ZML A;  5H5Q A;  3TJG A;  4ML6 A;  1XWC A;  2DMM A;  4HQZ A;  1XWA A;  3DYR A;  3A5I A;  1PD2 1;  1AXD A;  4IP6 A;  4LA1 A;  1OYJ A;  2YV7 A;  1XFL A;  1FB0 A;  4PQI A;  2WUL A;  3TRP A;  2LJA A;  3GRX A;  3IRA A;  2RM6 A;  3LYK A;  4XS4 B;  4HI7 A;  1ML6 A;  2JZR A;  2CZ3 A;  2L5L A;  5HFI A;  1TP9 A;  5B7C A;  2HSY A;  4OFM A;  1ZCP A;  2VLV A;  5D9W A;  1HNB A;  4MJB A;  6GST A;  2GSR A;  2H6X A;  4FYC A;  4KDY A;  1GSU A;  2IJY A;  5A4V A;  3S9F A;  3EC3 A;  2KUC A;  5G1L A;  3EVI A;  4MP4 A;  4XRD A;  2GSQ A;  3VK9 A;  1GH2 A;  13GS A;  4MA9 A;  3O76 A;  4K7I A;  5DBQ A;  1M3J A;  4HJ2 A;  3NZN A;  2EIO A;  3K8N A;  4OCE A;  2R6K A;  2B5X A;  1EP8 A;  2V32 A;  3HJM A;  4MK3 A;  5KN3 A;  1V98 A;  5CRE A;  5LNK e;  2H1B A;  5J9B A;  2H6Y A;  4JR4 A;  1TRS A;  3CYN A;  3H8Q A;  4EXJ A;  3Q6O A;  5C04 A;  3C1S A;  4EKZ A;  1XCC A;  4RUV A;  2I1U A;  1Z6N A;  3DRN A;  2CX3 A;  3FK8 A;  2WFC A;  1OC9 A;  4EDZ A;  4ZIL A;  3KP8 A;  2M72 A;  4Q5R A;  5IO2 A;  4BL7 B;  5KOX A;  3GTU B;  2J9H A;  1T4Z A;  2NTO A;  4Z2T A;  2H01 A;  4GF0 A;  1YJ6 A;  2CVK A;  3CXG A;  4GST A;  4QL7 A;  2I3Y A;  1XPV A;  5ABR A;  1FAA A;  3DML A;  3HVV A;  3TRX A;  1HD2 A;  4MF6 A;  3FYG A;  5AIS A;  3CQF A;  5EPF A;  1O8W A;  1UVZ A;  2O7K A;  4BVX A;  4D73 A;  5J9C A;  1E6B A;  2GQM A;  3GHA A;  3HKR A;  2QC7 A;  4J2F A;  2MBT A;  3WT2 A;  4TXV A;  1N8J A;  3ME7 A;  1F37 A;  1B4P A;  3TJB A;  12GS A;  4TR1 A;  5E59 A;  3VWX A;  1ERV A;  2VD1 A;  3D21 A;  1YZX A;  2YN1 A;  2FWH A;  4TR4 A;  1AQX A;  4AJ6 A;  3UBL A;  11GS A;  3KH9 A;  1FHE A;  4KE3 A;  1BJX A;  3QCP A;  5LCZ A;  2X49 A;  4F0C A;  1A24 A;  2MYG A;  5DJM A;  3EWL A;  4Z2U A;  3GIX A;  2FWF A;  3CSH A;  3FMW A;  5HR1 A;  1XXU A;  3TJF A;  4KDX A;  2H72 A;  3D4T A;  3HD5 A;  4Q5F A;  1S3D A;  3G7I A;  2WZ9 A;  3CTF A;  1GRX A;  2LTK A;  2YV9 A;  2V6O A;  3WGE A;  2LJK A;  4YQM A;  4N10 A;  1SD9 A;  5CAX A;  3ERW A;  3Q74 A;  5J3R A;  3QMX A;  4IBP A;  3KD0 A;  2H0H A;  1GTA A;  2C8U A;  1JZO A;  1NW2 A;  3NOF A;  1XWB A;  5IMZ A;  2L57 A;  4NV5 A;  1EGO A;  5GST A;  4P3Y B;  3FR9 A;  4Z2R A;  1A2M A;  1V9W A;  4WF5 A;  4WF4 A;  3VWW A;  1GL8 A;  5IQY A;  1I9D A;  2DJK A;  1XOA A;  1TRU A;  2E0Q A;  5H5S A;  1F3B A;  2X4A A;  3WT1 A;  3GX8 A;  2DJ1 A;  1TK8 B;  2DKI A;  3DEX A;  1X9W B;  5G5E A;  1M2D A;  4OO5 A;  1MDI A;  2HZE A;  1TK0 B;  1U3I A;  3IDV A;  2IMF A;  4L5L A;  4WET A;  1PL1 A;  5FHI A;  5ECN B;  1SYR A;  1R5P A;  1VF2 A;  3EU4 A;  4HDE A;  1B9Y C;  3VWU A;  1O7U A;  6GSU A;  2ZUP A;  1ACV A;  1Q98 A;  2IFQ A;  3LWA A;  5IIZ A;  3IK7 A;  2DC5 A;  1OC9 B;  4G2E A;  5JWO B;  1WE0 A;  1GSE A;  1K0O A;  1GTI A;  1YKA A;  2AUV A;  3HVN A;  4O92 A;  4GXZ A;  4F82 A;  2WJU A;  2HRK A;  3QR6 A;  1PSQ A;  2B1L A;  4J57 E;  2R0P A;  4MCU A;  4EDY A;  4DSR A;  3TDG A;  3KJY A;  1OVN A;  4ILF A;  3ZFL A;  5EVO A;  3QDN A;  4POL A;  4OCF A;  4BVX B;  4D73 B;  2P5R A;  4DEJ A;  2WRT A;  1FOH A;  4L0W A;  2H1G A;  2HT9 A;  2LUS A;  4AJ7 A;  2V41 A;  3M0F A;  4I5Q A;  4CY8 A;  2GS3 A;  1G0T A;  1NHO A;  3W8J A;  4CW9 A;  3HJO A;  2PGT A;  4TR1 B;  1JZR A;  2Z9S A;  1O8X A;  2PN8 A;  2MZC A;  2EIQ A;  2H1D A;  4IJ3 A;  1TJD A;  2XHF A;  2CVB A;  7GSS A;  4HZ4 A;  3TKS C;  1ERW A;  1BAY A;  1FG4 A;  3F4T A;  2YWM A;  4ZB9 A;  2G2Q A;  3FEU A;  4NHW A;  3GYK A;  2YOI A;  3UBK A;  2A2S A;  4MAB A;  5HFK A;  2VCX A;  17GS A;  3UL3 A;  5G31 A;  1GUH A;  5ELA A;  3L78 A;  1GSQ A;  2C3N A;  4PTS A;  1QXH A;  1SJI A;  2CQ9 A;  2K8V A;  1VF3 A;  3HYP A;  1TU8 A;  2YNX A;  4G9H A;  1F2E A;  4V2L A;  1GSY A;  3CSJ A;  3ZRE A;  1HNC A;  2B5Y A;  4E8E A;  2H30 A;  2HFD A;  2PVQ A;  4E8H A;  1Z3E A;  2FWE A;  3E9J B;  1EGR A;  2C1Y A;  4POM A;  4PUR A;  1TK5 B;  1WOU A;  1OKT A;  1YF0 A;  4JRR A;  4NWY A;  2G0F A;  3F4R A;  2GST A;  2IL3 A;  4GWR A;  4J56 E;  4KCA A;  5D8I A;  1Z9H A;  3W6G A;  4NMU A;  3W8S A;  4Q5Q A;  3TB2 A;  2WDU A;  1M9A A;  1PKZ A;  1PFO A;  4G19 A;  4GSN A;  4IKH A;  5IM9 A;  4JU5 A;  5E4W A;  3MAK A;  4WR4 A;  1K0M A;  1K3Y A;  3M8N A;  1G7E A;  4GLT A;  3HZ8 A;  2M46 A;  2H73 A;  3FZ9 A;  1MEK A;  2DJ0 A;  2FGX A;  2K18 A;  1ILO A;  1HQO A;  4XTS A;  2GQL A;  4ZB6 A;  4K9Z A;  4TVE A;  1M0U A;  2HZE B;  4MZC A;  1GNW A;  3GUR A;  5B6M A;  5GAP D;  4IS0 A;  2YJ7 A;  3VPT A;  4KAE A;  4X0X A;  3Q19 A;  1MD3 A;  3A3T A;  2HRN A;  2CAQ A;  5F8B A;  1XVQ A;  2B7J A;  3LQ7 A;  2IFQ B;  2XPE A;  3A2W A;  1WWJ A;  3BOA A;  2ON7 A;  3L4N A;  1C72 A;  3D6I A;  4MMM A;  1X0R A;  2LEG A;  1ZL9 A;  1JLW A;  5CNW A;  2XBI A;  3ERF A;  1IYI A;  2OBK A;  3EMX A;  2E2G A;  4CY6 A;  5F07 A;  4XHM A;  1KEB A;  5CRD A;  3KMN A;  2R4V A;  1A8Y A;  2GT6 A;  4IJI A;  1RW1 A;  5D9X A;  2ZCT A;  4XIH A;  3H1N A;  3SWL A;  3UMA A;  2K9F A;  2C80 A;  2V2G A;  5CRG A;  4N11 A;  4QQ7 A;  1MDJ A;  1EOH A;  1K0N A;  3ZMK A;  4ECJ A;  5DDL A;  3IAS 2;  2L59 A;  2HI7 A;  4LLR A;  4TN8 A;  3ZTL A;  2REM A;  2RUF A;  4FIW A;  3MDK A;  3LEF A;  3FZ5 A;  2LRN A;  4RQR A;  2IMK A;  1R26 A;  5EY6 A;  1FW1 A;  4LMW A;  2OAD A;  5IMD A;  1CQH A;  1TW9 A;  1ON4 A;  5DCG A;  4OMV A;  3L9V A;  3EUR A;  2V1M A;  2KOK A;  2AYT A;  4AF2 A;  2BMX A;  4G0K A;  2B5E A;  2JAD A;  1QMV A;  2IPA A;  2ES7 A;  2AJQ B;  5JCU A;  4IP1 A;  3M9J A;  3BD2 A;  5ECM B;  2XBQ A;  5JCG A;  3QAG A;  3MSZ A;  4HS1 A;  2WGR A;  2VL2 A;  4OO4 A;  3ZZX A;  3ZVJ A;  1DUG A;  2TRX A;  1PMT A;  3VI7 A;  1RQM A;  4WKW A;  1BYE A;  1O6J A;  3BCK A;  1T4Y A;  5ECI B;  3LGC A;  2H1A A;  3HXS A;  4MF5 A;  2XC2 A;  5HR3 A;  3F4S A;  1XOB A;  1M7T A;  2LNS A;  1OE8 A;  2DIZ A;  2MMA A;  3CBU A;  1GWC A;  1JHB A;  3F3R A;  5F0G A;  5AN1 A;  3RAZ A;  3KTB A;  1XW5 A;  4HUA A;  5F05 A;  1TU7 A;  1IYH A;  1S3R A;  1LBK A;  2B1K A;  2FUG 2;  3EIN A;  4XRA A;  1CQG A;  3FR6 A;  1M3I A;  2C0E A;  1YKC A;  4FYB A;  2WB9 A;  4JR6 A;  3MNG A;  2PER A;  3VLN A;  1A2J A;  2F3M A;  3GST A;  4V1A p;  1T7P B;  4I2U A;  3GL3 A;  2P31 A;  1XVW A;  4FQU A;  3IC8 A;  5DAL A;  2GTU A;  1PX7 A;  4DSS A;  4QL9 A;  1J0F A;  3D22 A;  3C1R A;  3GSS A;  1GSD A;  4MZB A;  2F9S A;  3LXT A;  1QQ2 A;  4YQU A;  1Y6E A;  1V57 A;  4EO3 A;  3ZRD A;  1TKD B;  2L6D A;  1X5E A;  3QAW A;  4N0V A;  1YDK A;  5B6N A;  3UOM A;  1H75 A;  4O5U A;  1ERT A;  4KSM A;  4YAV A;  3F9U A;  1GUL A;  2H0I A;  3H79 A;  3KM6 A;  3LOR A;  3HDC A;  1SL1 B;  4PXO A;  2R37 A;  5ECP B;  4USS A;  2H75 A;  2XPD A;  1WJK A;  1BG5 A;  2DLX A;  1ZOF A;  4HOJ A;  9GSS A;  4L8E A;  3JCM L;  4G0I A;  2GGT A;  1AC1 A;  3MIX A;  1F6M C;  4POB A;  1DSB A;  2QKE A;  2L5O A;  4CHS A;  4ZL8 A;  2IME A;  5D73 A;  5DAK B;  1FO5 A;  4I6X A;  3PGT A;  3N5O A;  2IMI A;  4LMV A;  4HU9 A;  2VL2 C;  4ZBA A;  5DQY A;  2F8F A;  4K0G A;  5IO0 A;  4KCE A;  1R7H A;  2H6Z A;  5FT3 A;  4OWY A;  2YZU A;  2GZZ A;  5ECH B;  2RM5 A;  5COH A;  4HJM A;  1A23 A;  3TKS A;  1NSW A;  2VUP A;  3WYW A;  1PQN A;  1M99 A;  1GSF A;  1Z7R A;  4K5R A;  1FB6 A;  2R0C A;  4MH2 A;  5A5K A;  3O3T A;  2ZNM A;  1HNA A;  1ST9 A;  4JBB A;  2DIY A;  4IQ1 A;  3V1W A;  4EE0 A;  4KND A;  5KN1 A;  1ZYP A;  2LKU A;  1X9M B;  1XZO A;  3U5R E;  5ECR B;  3TKP A;  1X5C A;  3ZIJ A;  1SD8 A;  4PQH A;  1URM A;  1KNG A;  1XIY A;  2YCD A;  2JZS A;  2MMO A;  1FVK A;  5GZZ B;  2PBJ A;  1M2A A;  4EC0 A;  2H70 A;  3P2A A;  2PVO C;  2RII A;  2FHE A;  1EEM A;  4TW5 A;  3GL5 A;  2P0G A;  4WEY A;  4IVF A;  2HE3 A;  3P8W A;  3TCO A;  2DML A;  3RBT A;  1A0F A;  10GS A;  4MJE A;  2DBC A;  4NAX A;  5CRH A;  5J4U A;  3DXB A;  3IHQ A;  2FWG A;  1ZGN A;  3TJJ A;  20GS A;  4PUA A;  4GTU A;  1G7O A;  1USB A;  4Z7X A;  1KBN A;  2VCT A;  1JFU A;  2FY6 A;  3EMP A;  3TUE A;  2QSI A;  2VCZ A;  4KSO A;  4EF0 A;  5IOW A;  2B3S A;  1VF1 A;  1SYX A;  2M80 A;  4JZQ A;  3UEM A;  5IMV A;  4K7N A;  5DAL B;  4V1A g;  1GSS A;  3US3 A;  4DSS B;  3BBY A;  3C73 A;  3F6D A;  1XWK A;  2AAW A;  1S3C A;  1SJZ A;  4NHZ A;  4ISD A;  1PKW A;  2CT6 A;  3GKK A;  4PX1 A;  4OD7 A;  3U6V A;  3D5J A;  2HZF A;  22GS A;  1WIK A;  3GMF A;  3WGX A;  2I9H A;  2OAC A;  1TRV A;  2B7K A;  1SJ6 A;  2PU9 C;  4K1F A;  5GAN D;  6GSS A;  1KTE A;  1AQW A;  3VFI A;  1SEN A;  5JCW A;  1AQV A;  2VM1 A;  3KZQ A;  2CZ2 A;  1M9B A;  2IWT A;  1OE7 A;  2AHE A;  5LD0 A;  4F9Z A;  1FVJ A;  1V2A A;  2ALB A;  4EUY A;  3IHG A;  1XWG A;  3EPT A;  3KXO A;  1MTC A;  1W89 A;  5KOW A;  4EL1 A;  2C3T A;  5IMC A;  3F0I A;  3TKR A;  1WPI A;  5KEJ A;  4DSQ A;  3FRC A;  3BJ5 A;  3ZL5 A;  3BCI A;  4F03 A;  2A4H A;  2KHP A;  1K0C A;  3GN3 A;  4IN0 A;  5KN2 A;  1A2L A;  3RPP A;  3F63 A;  2QGV A;  3PIN A;  4TXO A;  5ECK B;  1U6T A;  4IQA A;  4XS6 A;  5HQP A;  1X5D A;  4O5R A;  5L71 A;  2PUK C;  3WGD A;  3NIV A;  2YJH A;  4A5P A;  4N30 A;  2GLR A;  1BX9 A;  4BA7 A;  3M1G A;  2MBS A;  2NDO A;  4ML1 A;  4Q5N A;  4ZIJ A;  4K7O A;  2FA4 A;  3C7M A;  2KP2 A;  2CX4 A;  2EC4 A;  2R2J A;  4KB3 A;  4ECC A;  3FY7 A;  2VCW A;  1K0D A;  4MPF A;  2JSZ A;  1I5G A;  2FA8 A;  2N5B A;  4L5O A;  4PUF C;  4KF9 A;  3F8U A;  1R4W A;  4GQC A;  5ECO B;  4H86 A;  3VUR A;  3PR8 A;  2K8S A;  3J7Y b;  3KMO A;  1TI1 A;  2LJR A;  4MJA A;  1QGV A;  1AW9 A;  1O81 A;  3F6F A;  4RI6 A;  4BVY A;  3A5W A;  4FYU A;  4BL7 A;  2LRT A;  4O32 A;  1R5A A;  2HNL A;  5J41 A;  18GS A;  4OFN A;  5IMF A;  4K2X A;  2IN3 A;  3HZ4 A;  2C0G A;  1T00 A;  2GZY A;  3CMI A;  3FR3 A;  3GNJ A;  4DVC A;  3LSZ A;  3O6T A;  8GSS A;  4ULX A;  3FZA A;  4HU7 A;  3I43 A;  3CRU A;  2A4V A;  3DD3 A;  3IA1 A;  5A4U A;  1V40 A;  1T8E B;  3RHC A;  2EIR A;  2FD3 A;  4GSS A;  1LJR A;  1THX A;  3MYD A;  3UJ1 A;  4HSC X;  3PH9 A;  3FW2 A;  4V2M A;  5CP1 A;  1GNE A;  3ZLP A;  2LV3 A;  3L0H A;  3ZIT A;  1PX6 A;  2WS2 A;  4PNF A;  3VI5 A;  1WRY A;  1BED A;  1THO A;  3G7Y A;  5JWQ B;  1PRX A;  4K6X A;  1OC8 A;  1PA3 A;  4YKG A;  2JSY A;  1ZYN A;  2BJX A;  4TKY A;  1A8L A;  3I69 A;  4YKF A;  3ZVJ D;  1K0B A;  4ICY A;  5KN0 A;  4ZBD A;  2O89 A;  2HRF A;  1UN2 A;  3ME8 A;  2GZP A;  4RQX A;  3GUS A;  2I4A A;  3KH7 A;  4G10 A;  3I6A A;  1T3B A;  1GTU A;  3QOU A;  5B8A A;  4TXO B;  2I81 A;  1VGL A;  2GSS A;  3OR5 A;  3EYT A;  3RPN A;  4I97 A;  2JAC A;  2C0F A;  4ECI A;  2VLU A;  1QK8 A;  4G0L A;  1YEP A;  2O87 A;  3TKQ A;  1WP0 A;  5CO3 A;  3IAM 2;  5DQS A;  1ERU A;  3IOS A;  3D4M A;  2FNO A;  1AIU A;  4BWQ A;  1Q4J A;  5EL8 A;  1DE1 A;  1PL2 A;  1G6Y A;  2MMN A;  2X8G A;  1K0A A;  2NPB A;  1SKS B;  2JU5 A;  3TOT A;  2BTO T;  2X8H A;  3KGK A;  3H4K A;  3M3M A;  1SK1 A;  4BIK A;  2DJ3 A;  5G5F A;  2UZ8 A;  5DJL A;  4MZW A;  1DE2 A;  2OE3 A;  4KH7 A;  1U88 A;  3KEB A;  4NXI A;  3APS A;  4ECB A;  3H93 A;  1GLP A;  2ON5 A;  3Q18 A;  1Y25 A;  3N9J A;  3ISO A;  4BVY B;  2YZH A;  4IHU A;  2OA7 A;  4K8M A;  5AIX A;  3TOU A;  4POK A;  3R3E A;  2CA8 A;  5AIV A;  3LFL A;  1TDI A;  19GS A;  2VL9 A;  3GH9 A;  1NHY A;  4MH3 A;  3FHK A;  1Z5Y E;  1YF1 A;  3DGQ A;  2B6M A;  1W4V A;  4XCS A;  4MF7 A;  1SK2 A;  3ZFB A;  4HZ2 A;  4XS1 A;  2CV4 A;  3FZ4 A;  5G2Z A;  3UAP A;  4EIP A;  3KTL A;  1MD4 A;  5ECL B;  2H76 A;  1PN0 A;  2N5F A;  3RHB A;  2LQQ A;  4RI7 A;  1AAZ A;  1VRS D;  4JED A;  4F0B A;  1RK4 A;  5D96 A;  4X4J A;  2QA1 A;  1XG8 A;  5C00 A;  4NPB A;  2RUE A;  1X9S B;  2VCV A;  3QAV A;  14GS A;  3GA4 A;  4L0U A;  2KP1 A;  2HYX A;  2OBI A;  5IPG A;  1OKD A;  2RLI A;  1ZZY A;  1H4O A;  3TGZ A;  2C3Q A;  1O73 A;  1EOG A;  3CSI A;  2HLS A;  4BWS A;  4IGJ A;  3L9S A;  5H5R A;  4YAP A;  3IXR A;  2YWN A;  3CTG A;  2N5A A;  4LL4 B;  2KLX A;  1ZYE A;  3LW9 A;  2GQK A;  2K6V A;  3MWH A;  2JZT A;  2YPM A;  1J08 A;  5HFG A;  2PMT A;  3HVX A;  1UA5 A;  2E2M A;  3IR4 A;  3EE2 A;  5A4W A;  2LS5 A;  3G9B A;  5ELG A;  1OAZ A;  2L4C A;  5BMU A;  3G7J A;  5FWG A;  2H19 A;  3M9K A;  3A2V A;  2A2P A;  1YQ1 A;  3UVH A;  1QUW A;  4ZL9 A;  4TR3 A;  3HVS A;  3DVW A;  3LJR A;  5IOX A;  4ZL7 A;  4F2I A;  2VM2 A;  5ECS A;  4O7H A;  2CAI A;  2H8L A;  1B8X A;  5ID2 A;  4MDC A;  4LL1 B;  3VWV A;  3HHV A;  2YWI A;  2R5G A;  4MPG A;  4EVM A;  2IIY A;  5ENU A;  4AJ8 A;  4PNG A;  1UC7 A;  4EIQ A;  4GQF A;  3IV4 A;  3GH6 A;  1YY7 A;  2C0D A;  6GSX A;  5IPH A;  2QA2 A;  4IEL A;  2DKH A;  3SBC A;  1LU4 A;  1V58 A;  2DJ2 A;  1TTZ A;  1SU9 A;  4ID0 A;  1SL2 B;  2C4J A;  2R3X A;  2AB6 A;  4O5Q A;  3IK9 A;  3TRQ A;  3GKX A;  2X64 A;  3GV1 A;  3ZIV A;  2VLT A;  2PPT A;  2MMZ A;  2GVP A;  2X8C A;  3IC4 A;  1K3L A;  3LYP A;  4K0N A;  4TOP A;  3DWV A;  3DVX A;  4WBJ A;  2AV4 A;  3I9V 2;  3QFA C;  4KDU A;  4ZBB A;  3TJK A;  5J5N A;  4JE1 A;  4MJC A;  2VL3 A;  2HRA A;  2OE0 A;  6GSV A;  1EEJ A;  4X43 A;  3LG6 A;  1A0R P;  2YAN A;  4PGT A;  1B9X C;  1T1V A;  2FCH A;  3QFB C;  2JL4 A;  3VPQ A;  1WMJ A;  2E7P A;  1TRW A;  1U3A A;  5CYY A;  4ZB8 A;  3ZYW A;  2IMD A;  2VOC A;  4KW6 A;  1GLQ A;  3ED3 A;  3KCM A;  3P90 A;  2OKA A;  1Z6M A;  3J7Y k;  1GTB A;  1HYU A;  2WCI A;  3DKS A;  1M2B A;  2O8V B;  1OC3 A;  2DSA A;  1K3O A;  3QD9 A;  2VD0 A;  4HQS A;  5JWR B;  4K2D A;  2TRC P;  1U87 A;  1B4Q A;  2FLS A;  2H66 A;  5GSS A;  1SK0 A;  2OJL A;  4YQV A;  2F8A A;  2R0G A;  3IPZ A;  4HEA 2;  5HR2 A;  5DCH A;  1XW9 A;  2L4Q A;  1ZMA A;  4OFT A;  4V2N A;  2VAF A;  4XS4 A;  1Z7P A;  1TXX A;  4N0Z A;  3AY8 A;  1BQ7 A;  4TRX A;  3R2Q A;  4KA0 A;  4ACS A;  1B48 A;  3A2X A;  2X99 A;  1ZYQ B;  1EV9 A;  4I8B A;  1MDK A;  4GRF A;  1SKW B;  3L9U A;  2LST A;  1AUC A;  1EP7 A;  2OE1 A;  4AGS A;  2H71 A;  3TKS E;  1EZK A;  3CRT A;  3GX0 A;  1GUK A;  1XW6 A;  5BRT A;  3GKM A;  3C8E A;  2NVL A;  1S3A A;  1PN9 A;  4MLY A;  1GP1 A;  5G1K A;  1SKR B;  3HA9 A;  4YH2 A;  3UIW A;  2HSM A;  1SL0 B;  6GSY A;  4NV2 A;  2V6K A;  3APO A;  2VIM A;  5D9V A;  3LXZ A;  4TR0 A;  16GS A;  2F51 A;  5ID2 B;  2GDR A;  6GSW A;  1JZW A;  1QFN A;  3UVT A;  4KX4 A;  4FO5 A;  2CVD A;  2DJJ A;  4GCI A;  3QPM A;  3PPU A;  2GT5 A;  4WR5 A;  3KIJ A;  3GTU A;  1NM3 A;  2HXK A;  2YP6 A;  2LQO A;  2HSH A;  2TIR A;  1EV4 A;  3E0U A;  3FKF A;  3WD6 A;  3UAR A;  1N2A A;  1GUM A;  2J23 A;  4WXT A;  5DVB A;  4BPY A;  3IE3 A;  1EWX A;  1FOV A;  5HR0 A;  5D93 A;  1TI3 A;  2YWO A;  2PWJ A;  1F9M A;  4KGI A;  1YEX A;  3GFK A;  4I2T A;  2LRC A;  2LNT A;  3EU3 A;  5AGY A;  2P5Q A;  1XBS A;  2VO4 A;  1TOF A;  4KUN A;  4CDO A;  3HCZ A;  5ECQ B;  5CRW A;  1JZD A;  3ERG A;  3KP9 A;  4FH8 A;  2H74 A;  4K5S A;  3HY2 A; 
#chains in the Genus database with same CATH homology
 3HJP A;  3DIE A;  1DBY A;  5G30 A;  1ABA A;  3E3E A;  4IW9 A;  1JLV A;  3GKN A;  3IBH A;  2L6C A;  4PQ1 A;  1VF4 A;  1J9B A;  3D0Z A;  2D2Z A;  1O85 A;  2VCQ A;  2A2R A;  2O85 A;  1E2Y A;  2NBS A;  5F06 A;  2H0G A;  5DAK A;  1G6W A;  1PGT A;  3APQ A;  3C71 A;  3P7X A;  5B8B A;  4ZXG A;  3F3Q A;  5IMA A;  4MNN A;  4WBR D;  1F3A A;  4X1U A;  5INY A;  3RDW A;  5D9T A;  3ZML A;  5H5Q A;  3TJG A;  4ML6 A;  1XWC A;  2DMM A;  4HQZ A;  1XWA A;  3DYR A;  3A5I A;  1PD2 1;  1AXD A;  4IP6 A;  4LA1 A;  1OYJ A;  2YV7 A;  1XFL A;  1FB0 A;  4PQI A;  2WUL A;  3TRP A;  2LJA A;  3GRX A;  3IRA A;  2RM6 A;  3LYK A;  4XS4 B;  4HI7 A;  1ML6 A;  2JZR A;  2CZ3 A;  2L5L A;  5HFI A;  1TP9 A;  5B7C A;  2HSY A;  4OFM A;  1ZCP A;  2VLV A;  5D9W A;  1HNB A;  4MJB A;  6GST A;  2GSR A;  2H6X A;  4FYC A;  4KDY A;  1GSU A;  2IJY A;  5A4V A;  3S9F A;  3EC3 A;  2KUC A;  5G1L A;  3EVI A;  4MP4 A;  4XRD A;  2GSQ A;  3VK9 A;  1GH2 A;  13GS A;  4MA9 A;  3O76 A;  4K7I A;  5DBQ A;  4HJ2 A;  3NZN A;  2EIO A;  3K8N A;  4OCE A;  2R6K A;  2B5X A;  1EP8 A;  2V32 A;  3HJM A;  4MK3 A;  5KN3 A;  1V98 A;  5CRE A;  5LNK e;  2H1B A;  5J9B A;  2H6Y A;  4JR4 A;  1TRS A;  3CYN A;  3H8Q A;  4EXJ A;  3Q6O A;  5C04 A;  3C1S A;  4EKZ A;  1XCC A;  4RUV A;  2I1U A;  1Z6N A;  3DRN A;  2CX3 A;  3FK8 A;  2WFC A;  1OC9 A;  4EDZ A;  4ZIL A;  3KP8 A;  2M72 A;  4Q5R A;  5IO2 A;  4BL7 B;  5KOX A;  3GTU B;  2J9H A;  1T4Z A;  2NTO A;  4Z2T A;  2H01 A;  4GF0 A;  1YJ6 A;  2CVK A;  3CXG A;  4GST A;  4QL7 A;  2I3Y A;  1XPV A;  5ABR A;  1FAA A;  3DML A;  3HVV A;  3TRX A;  1HD2 A;  4MF6 A;  3FYG A;  5AIS A;  5EPF A;  1O8W A;  1UVZ A;  2O7K A;  4BVX A;  4D73 A;  5J9C A;  1E6B A;  2GQM A;  3GHA A;  3HKR A;  2QC7 A;  4J2F A;  2MBT A;  3WT2 A;  4TXV A;  1N8J A;  3ME7 A;  1F37 A;  1B4P A;  3TJB A;  12GS A;  4TR1 A;  5E59 A;  3VWX A;  1ERV A;  2VD1 A;  3D21 A;  1YZX A;  2YN1 A;  2FWH A;  4TR4 A;  1AQX A;  4AJ6 A;  3UBL A;  11GS A;  3KH9 A;  1FHE A;  4KE3 A;  1BJX A;  3QCP A;  5LCZ A;  2X49 A;  4F0C A;  1A24 A;  2MYG A;  5DJM A;  3EWL A;  4Z2U A;  3GIX A;  2FWF A;  3CSH A;  3FMW A;  5HR1 A;  1XXU A;  3TJF A;  4KDX A;  2H72 A;  3D4T A;  3HD5 A;  4Q5F A;  1S3D A;  3G7I A;  2WZ9 A;  3CTF A;  1GRX A;  2LTK A;  2YV9 A;  2V6O A;  3WGE A;  2LJK A;  4YQM A;  4N10 A;  1SD9 A;  5CAX A;  3ERW A;  3Q74 A;  5J3R A;  3QMX A;  4IBP A;  3KD0 A;  2H0H A;  1GTA A;  2C8U A;  1JZO A;  1NW2 A;  3NOF A;  1XWB A;  5IMZ A;  2L57 A;  4NV5 A;  1EGO A;  5GST A;  4P3Y B;  3FR9 A;  4Z2R A;  1A2M A;  1V9W A;  4WF5 A;  4WF4 A;  3VWW A;  1GL8 A;  5IQY A;  1I9D A;  2DJK A;  1XOA A;  1TRU A;  2E0Q A;  5H5S A;  1F3B A;  2X4A A;  3WT1 A;  3GX8 A;  2DJ1 A;  1TK8 B;  2DKI A;  3DEX A;  1X9W B;  5G5E A;  1M2D A;  4OO5 A;  1MDI A;  2HZE A;  1TK0 B;  1U3I A;  3IDV A;  2IMF A;  4L5L A;  4WET A;  1PL1 A;  5FHI A;  5ECN B;  1SYR A;  1R5P A;  1VF2 A;  3EU4 A;  4HDE A;  1B9Y C;  3VWU A;  1O7U A;  6GSU A;  2ZUP A;  1ACV A;  1Q98 A;  2IFQ A;  3LWA A;  5IIZ A;  3IK7 A;  2DC5 A;  1OC9 B;  4G2E A;  5JWO B;  1WE0 A;  1GSE A;  1K0O A;  1GTI A;  1YKA A;  2AUV A;  4O92 A;  4GXZ A;  4F82 A;  2WJU A;  2HRK A;  3QR6 A;  1PSQ A;  2B1L A;  4J57 E;  2R0P A;  4MCU A;  4EDY A;  4DSR A;  3TDG A;  3KJY A;  1OVN A;  4ILF A;  3ZFL A;  5EVO A;  3QDN A;  4POL A;  4OCF A;  4BVX B;  4D73 B;  2P5R A;  4DEJ A;  2WRT A;  1FOH A;  4L0W A;  2H1G A;  2HT9 A;  2LUS A;  4AJ7 A;  2V41 A;  3M0F A;  4I5Q A;  4CY8 A;  2GS3 A;  1G0T A;  1NHO A;  3W8J A;  4CW9 A;  3HJO A;  2PGT A;  4TR1 B;  1JZR A;  2Z9S A;  1O8X A;  2PN8 A;  2MZC A;  2EIQ A;  2H1D A;  4IJ3 A;  1TJD A;  2XHF A;  2CVB A;  7GSS A;  4HZ4 A;  3TKS C;  1ERW A;  1BAY A;  1FG4 A;  3F4T A;  2YWM A;  4ZB9 A;  2G2Q A;  3FEU A;  4NHW A;  3GYK A;  2YOI A;  3UBK A;  2A2S A;  4MAB A;  5HFK A;  2VCX A;  17GS A;  3UL3 A;  5G31 A;  1GUH A;  5ELA A;  3L78 A;  1GSQ A;  2C3N A;  4PTS A;  1QXH A;  1SJI A;  2CQ9 A;  2K8V A;  1VF3 A;  3HYP A;  1TU8 A;  2YNX A;  4G9H A;  1F2E A;  4V2L A;  1GSY A;  3CSJ A;  3ZRE A;  1HNC A;  2B5Y A;  4E8E A;  2H30 A;  2HFD A;  2PVQ A;  4E8H A;  1Z3E A;  2FWE A;  3E9J B;  1EGR A;  2C1Y A;  4POM A;  4PUR A;  1TK5 B;  1WOU A;  1OKT A;  1YF0 A;  4JRR A;  4NWY A;  2G0F A;  3F4R A;  2GST A;  2IL3 A;  4GWR A;  4J56 E;  4KCA A;  5D8I A;  1Z9H A;  3W6G A;  4NMU A;  3W8S A;  4Q5Q A;  3TB2 A;  2WDU A;  1M9A A;  1PKZ A;  4G19 A;  4GSN A;  4IKH A;  5IM9 A;  4JU5 A;  5E4W A;  3MAK A;  4WR4 A;  1K0M A;  1K3Y A;  3M8N A;  1G7E A;  4GLT A;  3HZ8 A;  2M46 A;  2H73 A;  3FZ9 A;  1MEK A;  2DJ0 A;  2FGX A;  2K18 A;  1ILO A;  1HQO A;  4XTS A;  2GQL A;  4ZB6 A;  4K9Z A;  4TVE A;  1M0U A;  2HZE B;  4MZC A;  1GNW A;  3GUR A;  5B6M A;  5GAP D;  4IS0 A;  2YJ7 A;  3VPT A;  4KAE A;  4X0X A;  3Q19 A;  1MD3 A;  3A3T A;  2HRN A;  2CAQ A;  5F8B A;  1XVQ A;  2B7J A;  3LQ7 A;  2IFQ B;  2XPE A;  3A2W A;  1WWJ A;  3BOA A;  2ON7 A;  3L4N A;  1C72 A;  3D6I A;  4MMM A;  1X0R A;  2LEG A;  1ZL9 A;  1JLW A;  5CNW A;  2XBI A;  3ERF A;  1IYI A;  2OBK A;  3EMX A;  2E2G A;  4CY6 A;  5F07 A;  4XHM A;  1KEB A;  5CRD A;  3KMN A;  2R4V A;  1A8Y A;  2GT6 A;  4IJI A;  1RW1 A;  5D9X A;  2ZCT A;  4XIH A;  3H1N A;  3SWL A;  3UMA A;  2K9F A;  2C80 A;  2V2G A;  5CRG A;  4N11 A;  4QQ7 A;  1MDJ A;  1EOH A;  1K0N A;  3ZMK A;  4ECJ A;  5DDL A;  3IAS 2;  2L59 A;  2HI7 A;  4LLR A;  4TN8 A;  3ZTL A;  2REM A;  2RUF A;  4FIW A;  3MDK A;  3LEF A;  3FZ5 A;  2LRN A;  4RQR A;  2IMK A;  1R26 A;  5EY6 A;  1FW1 A;  4LMW A;  2OAD A;  5IMD A;  1CQH A;  1TW9 A;  1ON4 A;  5DCG A;  4OMV A;  3L9V A;  3EUR A;  2V1M A;  2KOK A;  2AYT A;  4AF2 A;  2BMX A;  4G0K A;  2B5E A;  2JAD A;  1QMV A;  2IPA A;  2ES7 A;  2AJQ B;  5JCU A;  4IP1 A;  3M9J A;  3BD2 A;  5ECM B;  2XBQ A;  5JCG A;  3QAG A;  3MSZ A;  4HS1 A;  2WGR A;  2VL2 A;  4OO4 A;  3ZZX A;  3ZVJ A;  1DUG A;  2TRX A;  1PMT A;  3VI7 A;  1RQM A;  4WKW A;  1BYE A;  1O6J A;  3BCK A;  1T4Y A;  5ECI B;  3LGC A;  2H1A A;  3HXS A;  4MF5 A;  2XC2 A;  5HR3 A;  3F4S A;  1XOB A;  1M7T A;  2LNS A;  1OE8 A;  2DIZ A;  2MMA A;  3CBU A;  1GWC A;  1JHB A;  3F3R A;  5F0G A;  5AN1 A;  3RAZ A;  3KTB A;  1XW5 A;  4HUA A;  5F05 A;  1TU7 A;  1IYH A;  1LBK A;  2B1K A;  2FUG 2;  3EIN A;  4XRA A;  1CQG A;  3FR6 A;  2C0E A;  1YKC A;  4FYB A;  2WB9 A;  4JR6 A;  3MNG A;  2PER A;  3VLN A;  1A2J A;  2F3M A;  3GST A;  4V1A p;  1T7P B;  4I2U A;  3GL3 A;  2P31 A;  1XVW A;  4FQU A;  3IC8 A;  5DAL A;  2GTU A;  1PX7 A;  4DSS A;  4QL9 A;  1J0F A;  3D22 A;  3C1R A;  3GSS A;  1GSD A;  4MZB A;  2F9S A;  3LXT A;  1QQ2 A;  4YQU A;  1Y6E A;  1V57 A;  4EO3 A;  3ZRD A;  1TKD B;  2L6D A;  1X5E A;  3QAW A;  4N0V A;  1YDK A;  5B6N A;  3UOM A;  1H75 A;  4O5U A;  1ERT A;  4KSM A;  4YAV A;  3F9U A;  1GUL A;  2H0I A;  3H79 A;  3KM6 A;  3LOR A;  3HDC A;  1SL1 B;  4PXO A;  2R37 A;  5ECP B;  4USS A;  2H75 A;  2XPD A;  1WJK A;  1BG5 A;  2DLX A;  1ZOF A;  4HOJ A;  9GSS A;  4L8E A;  3JCM L;  4G0I A;  2GGT A;  1AC1 A;  3MIX A;  1F6M C;  4POB A;  1DSB A;  2QKE A;  2L5O A;  4CHS A;  4ZL8 A;  2IME A;  5D73 A;  5DAK B;  1FO5 A;  4I6X A;  3PGT A;  3N5O A;  2IMI A;  4LMV A;  4HU9 A;  2VL2 C;  4ZBA A;  5DQY A;  2F8F A;  4K0G A;  5IO0 A;  4KCE A;  1R7H A;  2H6Z A;  5FT3 A;  4OWY A;  2YZU A;  2GZZ A;  5ECH B;  2RM5 A;  5COH A;  4HJM A;  1A23 A;  3TKS A;  1NSW A;  2VUP A;  3WYW A;  1PQN A;  1M99 A;  1GSF A;  1Z7R A;  4K5R A;  1FB6 A;  2R0C A;  4MH2 A;  5A5K A;  3O3T A;  2ZNM A;  1HNA A;  1ST9 A;  4JBB A;  2DIY A;  4IQ1 A;  3V1W A;  4EE0 A;  4KND A;  5KN1 A;  1ZYP A;  2LKU A;  1X9M B;  1XZO A;  3U5R E;  5ECR B;  3TKP A;  1X5C A;  3ZIJ A;  1SD8 A;  4PQH A;  1URM A;  1KNG A;  1XIY A;  2YCD A;  2JZS A;  2MMO A;  1FVK A;  5GZZ B;  2PBJ A;  1M2A A;  4EC0 A;  2H70 A;  3P2A A;  2PVO C;  2RII A;  2FHE A;  1EEM A;  4TW5 A;  3GL5 A;  2P0G A;  4WEY A;  4IVF A;  2HE3 A;  3P8W A;  3TCO A;  2DML A;  3RBT A;  1A0F A;  10GS A;  4MJE A;  2DBC A;  4NAX A;  5CRH A;  5J4U A;  3DXB A;  3IHQ A;  2FWG A;  1ZGN A;  3TJJ A;  20GS A;  4PUA A;  4GTU A;  1G7O A;  1USB A;  4Z7X A;  1KBN A;  2VCT A;  1JFU A;  2FY6 A;  3EMP A;  3TUE A;  2QSI A;  2VCZ A;  4KSO A;  4EF0 A;  5IOW A;  2B3S A;  1VF1 A;  1SYX A;  2M80 A;  4JZQ A;  3UEM A;  5IMV A;  4K7N A;  5DAL B;  4V1A g;  1GSS A;  3US3 A;  4DSS B;  3BBY A;  3C73 A;  3F6D A;  1XWK A;  2AAW A;  1S3C A;  1SJZ A;  4NHZ A;  4ISD A;  1PKW A;  2CT6 A;  3GKK A;  4PX1 A;  4OD7 A;  3U6V A;  3D5J A;  2HZF A;  22GS A;  1WIK A;  3GMF A;  3WGX A;  2I9H A;  2OAC A;  1TRV A;  2B7K A;  1SJ6 A;  2PU9 C;  4K1F A;  5GAN D;  6GSS A;  1KTE A;  1AQW A;  3VFI A;  1SEN A;  5JCW A;  1AQV A;  2VM1 A;  3KZQ A;  2CZ2 A;  1M9B A;  2IWT A;  1OE7 A;  2AHE A;  5LD0 A;  4F9Z A;  1FVJ A;  1V2A A;  2ALB A;  4EUY A;  3IHG A;  1XWG A;  3EPT A;  3KXO A;  1MTC A;  1W89 A;  5KOW A;  4EL1 A;  2C3T A;  5IMC A;  3F0I A;  3TKR A;  1WPI A;  5KEJ A;  4DSQ A;  3FRC A;  3BJ5 A;  3ZL5 A;  3BCI A;  4F03 A;  2A4H A;  2KHP A;  1K0C A;  3GN3 A;  4IN0 A;  5KN2 A;  1A2L A;  3RPP A;  3F63 A;  2QGV A;  3PIN A;  4TXO A;  5ECK B;  1U6T A;  4IQA A;  4XS6 A;  5HQP A;  1X5D A;  4O5R A;  5L71 A;  2PUK C;  3WGD A;  3NIV A;  2YJH A;  4A5P A;  4N30 A;  2GLR A;  1BX9 A;  4BA7 A;  3M1G A;  2MBS A;  2NDO A;  4ML1 A;  4Q5N A;  4ZIJ A;  4K7O A;  2FA4 A;  3C7M A;  2KP2 A;  2CX4 A;  2EC4 A;  2R2J A;  4KB3 A;  4ECC A;  3FY7 A;  2VCW A;  1K0D A;  4MPF A;  2JSZ A;  1I5G A;  2FA8 A;  2N5B A;  4L5O A;  4PUF C;  4KF9 A;  3F8U A;  1R4W A;  4GQC A;  5ECO B;  4H86 A;  3VUR A;  3PR8 A;  2K8S A;  3J7Y b;  3KMO A;  1TI1 A;  2LJR A;  4MJA A;  1QGV A;  1AW9 A;  1O81 A;  3F6F A;  4RI6 A;  4BVY A;  3A5W A;  4FYU A;  4BL7 A;  2LRT A;  4O32 A;  1R5A A;  2HNL A;  5J41 A;  18GS A;  4OFN A;  5IMF A;  4K2X A;  2IN3 A;  3HZ4 A;  2C0G A;  1T00 A;  2GZY A;  3CMI A;  3FR3 A;  3GNJ A;  4DVC A;  3LSZ A;  3O6T A;  8GSS A;  4ULX A;  3FZA A;  4HU7 A;  3I43 A;  3CRU A;  2A4V A;  3DD3 A;  3IA1 A;  5A4U A;  1V40 A;  1T8E B;  3RHC A;  2EIR A;  2FD3 A;  4GSS A;  1LJR A;  1THX A;  3MYD A;  3UJ1 A;  3PH9 A;  3FW2 A;  4V2M A;  5CP1 A;  1GNE A;  3ZLP A;  2LV3 A;  3L0H A;  3ZIT A;  1PX6 A;  2WS2 A;  4PNF A;  3VI5 A;  1WRY A;  1BED A;  1THO A;  3G7Y A;  5JWQ B;  1PRX A;  4K6X A;  1OC8 A;  1PA3 A;  4YKG A;  2JSY A;  1ZYN A;  2BJX A;  4TKY A;  1A8L A;  3I69 A;  4YKF A;  3ZVJ D;  1K0B A;  4ICY A;  5KN0 A;  4ZBD A;  2O89 A;  2HRF A;  1UN2 A;  3ME8 A;  2GZP A;  4RQX A;  3GUS A;  2I4A A;  3KH7 A;  4G10 A;  3I6A A;  1T3B A;  1GTU A;  3QOU A;  5B8A A;  4TXO B;  2I81 A;  1VGL A;  2GSS A;  3OR5 A;  3EYT A;  3RPN A;  4I97 A;  2JAC A;  2C0F A;  4ECI A;  2VLU A;  1QK8 A;  4G0L A;  1YEP A;  2O87 A;  3TKQ A;  1WP0 A;  5CO3 A;  3IAM 2;  5DQS A;  1ERU A;  3IOS A;  3D4M A;  2FNO A;  1AIU A;  4BWQ A;  1Q4J A;  5EL8 A;  1DE1 A;  1PL2 A;  1G6Y A;  2MMN A;  2X8G A;  1K0A A;  2NPB A;  1SKS B;  2JU5 A;  3TOT A;  2BTO T;  2X8H A;  3KGK A;  3H4K A;  3M3M A;  1SK1 A;  2DJ3 A;  5G5F A;  2UZ8 A;  5DJL A;  4MZW A;  1DE2 A;  2OE3 A;  4KH7 A;  1U88 A;  3KEB A;  4NXI A;  3APS A;  4ECB A;  3H93 A;  1GLP A;  2ON5 A;  3Q18 A;  1Y25 A;  3N9J A;  3ISO A;  4BVY B;  2YZH A;  4IHU A;  2OA7 A;  4K8M A;  5AIX A;  3TOU A;  4POK A;  3R3E A;  2CA8 A;  5AIV A;  3LFL A;  1TDI A;  19GS A;  2VL9 A;  3GH9 A;  1NHY A;  4MH3 A;  3FHK A;  1Z5Y E;  1YF1 A;  3DGQ A;  2B6M A;  1W4V A;  4XCS A;  4MF7 A;  1SK2 A;  3ZFB A;  4HZ2 A;  4XS1 A;  2CV4 A;  3FZ4 A;  5G2Z A;  3UAP A;  4EIP A;  3KTL A;  1MD4 A;  5ECL B;  2H76 A;  1PN0 A;  2N5F A;  3RHB A;  2LQQ A;  4RI7 A;  1AAZ A;  1VRS D;  4JED A;  4F0B A;  1RK4 A;  5D96 A;  4X4J A;  2QA1 A;  5C00 A;  4NPB A;  2RUE A;  1X9S B;  2VCV A;  3QAV A;  14GS A;  3GA4 A;  4L0U A;  2KP1 A;  2HYX A;  2OBI A;  5IPG A;  1OKD A;  2RLI A;  1ZZY A;  1H4O A;  3TGZ A;  2C3Q A;  1O73 A;  1EOG A;  3CSI A;  2HLS A;  4BWS A;  4IGJ A;  3L9S A;  5H5R A;  4YAP A;  3IXR A;  2YWN A;  3CTG A;  2N5A A;  4LL4 B;  2KLX A;  1ZYE A;  3LW9 A;  2GQK A;  2K6V A;  3MWH A;  2JZT A;  2YPM A;  1J08 A;  5HFG A;  2PMT A;  3HVX A;  1UA5 A;  2E2M A;  3IR4 A;  3EE2 A;  5A4W A;  2LS5 A;  3G9B A;  5ELG A;  1OAZ A;  2L4C A;  5BMU A;  3G7J A;  5FWG A;  2H19 A;  3M9K A;  3A2V A;  2A2P A;  1YQ1 A;  3UVH A;  1QUW A;  4ZL9 A;  4TR3 A;  3HVS A;  3DVW A;  3LJR A;  5IOX A;  4ZL7 A;  4F2I A;  2VM2 A;  5ECS A;  4O7H A;  2CAI A;  2H8L A;  1B8X A;  5ID2 A;  4MDC A;  4LL1 B;  3VWV A;  3HHV A;  2YWI A;  2R5G A;  4MPG A;  4EVM A;  2IIY A;  5ENU A;  4AJ8 A;  4PNG A;  1UC7 A;  4EIQ A;  4GQF A;  3IV4 A;  3GH6 A;  1YY7 A;  2C0D A;  6GSX A;  5IPH A;  2QA2 A;  4IEL A;  2DKH A;  3SBC A;  1LU4 A;  1V58 A;  2DJ2 A;  1TTZ A;  1SU9 A;  4ID0 A;  1SL2 B;  2C4J A;  2R3X A;  2AB6 A;  4O5Q A;  3IK9 A;  3TRQ A;  3GKX A;  2X64 A;  3GV1 A;  3ZIV A;  2VLT A;  2PPT A;  2MMZ A;  2GVP A;  2X8C A;  3IC4 A;  1K3L A;  3LYP A;  4K0N A;  4TOP A;  3DWV A;  3DVX A;  4WBJ A;  2AV4 A;  3I9V 2;  3QFA C;  4KDU A;  4ZBB A;  3TJK A;  5J5N A;  4JE1 A;  4MJC A;  2VL3 A;  2HRA A;  2OE0 A;  6GSV A;  1EEJ A;  4X43 A;  3LG6 A;  1A0R P;  2YAN A;  4PGT A;  1B9X C;  1T1V A;  2FCH A;  3QFB C;  2JL4 A;  3VPQ A;  1WMJ A;  2E7P A;  1TRW A;  1U3A A;  5CYY A;  4ZB8 A;  3ZYW A;  2IMD A;  2VOC A;  4KW6 A;  1GLQ A;  3ED3 A;  3KCM A;  3P90 A;  2OKA A;  1Z6M A;  3J7Y k;  1GTB A;  1HYU A;  2WCI A;  3DKS A;  1M2B A;  2O8V B;  1OC3 A;  2DSA A;  1K3O A;  3QD9 A;  2VD0 A;  4HQS A;  5JWR B;  4K2D A;  2TRC P;  1U87 A;  1B4Q A;  2FLS A;  2H66 A;  5GSS A;  1SK0 A;  2OJL A;  4YQV A;  2F8A A;  2R0G A;  3IPZ A;  4HEA 2;  5HR2 A;  5DCH A;  1XW9 A;  2L4Q A;  1ZMA A;  4OFT A;  4V2N A;  2VAF A;  4XS4 A;  1Z7P A;  1TXX A;  4N0Z A;  3AY8 A;  1BQ7 A;  4TRX A;  3R2Q A;  4KA0 A;  4ACS A;  1B48 A;  3A2X A;  2X99 A;  1ZYQ B;  1EV9 A;  4I8B A;  1MDK A;  4GRF A;  1SKW B;  3L9U A;  2LST A;  1AUC A;  1EP7 A;  2OE1 A;  4AGS A;  2H71 A;  3TKS E;  1EZK A;  3CRT A;  3GX0 A;  1GUK A;  1XW6 A;  5BRT A;  3GKM A;  3C8E A;  2NVL A;  1S3A A;  1PN9 A;  4MLY A;  1GP1 A;  5G1K A;  1SKR B;  3HA9 A;  4YH2 A;  3UIW A;  2HSM A;  1SL0 B;  6GSY A;  4NV2 A;  2V6K A;  3APO A;  2VIM A;  5D9V A;  3LXZ A;  4TR0 A;  16GS A;  2F51 A;  5ID2 B;  2GDR A;  6GSW A;  1JZW A;  1QFN A;  3UVT A;  4KX4 A;  4FO5 A;  2CVD A;  2DJJ A;  4GCI A;  3QPM A;  3PPU A;  2GT5 A;  4WR5 A;  3KIJ A;  3GTU A;  1NM3 A;  2HXK A;  2YP6 A;  2LQO A;  2HSH A;  2TIR A;  1EV4 A;  3E0U A;  3FKF A;  3WD6 A;  3UAR A;  1N2A A;  1GUM A;  2J23 A;  4WXT A;  5DVB A;  4BPY A;  3IE3 A;  1EWX A;  1FOV A;  5HR0 A;  5D93 A;  1TI3 A;  2YWO A;  2PWJ A;  1F9M A;  4KGI A;  1YEX A;  3GFK A;  4I2T A;  2LRC A;  2LNT A;  3EU3 A;  5AGY A;  2P5Q A;  1XBS A;  2VO4 A;  1TOF A;  4KUN A;  4CDO A;  3HCZ A;  5ECQ B;  5CRW A;  1JZD A;  3ERG A;  3KP9 A;  4FH8 A;  2H74 A;  4K5S A;  3HY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...