3TRXA

High-resolution three-dimensional structure of reduced recombinant human thioredoxin in solution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCTPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title High-resolution three-dimensional structure of reduced recombinant human thioredoxin in solution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 20
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1990-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3trxA00
4L5OA 3VK9A 3NOFA 4ML6A 3LFLA 14GSA 2EIQA 4IELA 5CRHA 2N5BA 2R2JA 4XIHA 5CAXA 3KMOA 1GSDA 4FH8A 3I43A 4RI7A 3UVTA 1O6JA 2WDUA 4ZBBA 2YV9A 3RHBA 1PD21 4NAXA 1A2LA 4BWQA 1SK1A 2WULA 5IOWA 3ME8A 2DLXA 3CSHA 3TKPA 1SK2A 1HNBA 1TOFA 4XCSA 3FW2A 4FYBA 3GKXA 2WZ9A 4HDEA 1K3LA 4Q5QA 2MMAA 4MJEA 2X64A 4J56E 3EYTA 4F2IA 4ZL9A 1XW9A 4NPBA 1XXUA 2PVQA 1H75A 3F0IA 5KN1A 1X5EA 4GXZA 4MZWA 17GSA 5DQSA 1WRYA 5CREA 1A2JA 5B6MA 1AQVA 2RM6A 3CTGA 1PRXA 3A3TA 3BD2A 3GL3A 5DALA 3CMIA 1G7EA 1DBYA 2C3TA 1NHOA 3O3TA 1TDIA 2B5YA 8GSSA 2LNTA 2K9FA 3HVSA 1F2EA 3BJ5A 3GKNA 1F3BA 5HR3A 4MK3A 1VF3A 4N0VA 2I1UA 1OKDA 2HRFA 1AQWA 3HJOA 2LRCA 2PERA 4HS1A 1O73A 2XC2A 3WGXA 1XWCA 2HZFA 1PQNA 3ZIJA 2B5XA 2GQMA 4MJAA 4AGSA 5J9BA 3LGCA 2H71A 1B4QA 3RDWA 4KGIA 2H1DA 5ELGA 5DJLA 4I5QA 5EVOA 2G2QA 1UVZA 4WR5A 2A2SA 1F3AA 2X8CA 4KCAA 5J41A 2HRNA 2ZUPA 4OFTA 2FWGA 4LLRA 3WGEA 1GSSA 4HU7A 4KDXA 2PBJA 1GTUA 1YEPA 5CP1A 4ECJA 20GSA 1E6BA 1JZOA 2YZUA 3ZVJD 1K0OA 4DVCA 1B4PA 4PXOA 3CSIA 1GWCA 2PUKC 1SKRB 2GT5A 5EPFA 4NV5A 1XCCA 1ERTA 3LORA 1KNGA 4IVFA 5J3RA 4HZ2A 2KP2A 4G2EA 2C0EA 1M2BA 1A0RP 3QAWA 2R37A 2DJ0A 3FZ9A 1ST9A 5G1LA 2YWMA 2I3YA 4WXTA 2HE3A 5D8IA 3TRXA 2GQKA 2FCHA 3ZVJA 3M9KA 3QAGA 1ON4A 2AV4A 1MDJA 2MMZA 4MZBA 2B1KA 2H0HA 1A23A 1SU9A 2CVKA 4ZBDA 22GSA 4EL1A 3ED3A 1ZYEA 3L9VA 3US3A 3M1GA 3GL5A 3A2XA 1I9DA 4EF0A 1QMVA 3WGDA 5DALB 3GHAA 5H5SA 3M9JA 3DD3A 3CRTA 3WYWA 3HZ4A 2H74A 2VL3A 1B48A 3CSJA 3GSSA 3KXOA 1GTAA 3D21A 1MD4A 3WT2A 4HJMA 3IHQA 1N2AA 5ECIB 1NW2A 5HR1A 2H6XA 5ECOB 1TJDA 2FLSA 3ERGA 2LRTA 2V6OA 2B7JA 1MEKA 1OAZA 2L4CA 1RW1A 2L6DA 12GSA 1EV9A 1KBNA 3KGKA 1YKCA 3LXZA 2LRNA 3W8SA 3CYNA 3VFIA 4ZIJA 4O92A 1GTBA 1T1VA 2K8SA 1YQ1A 5IMAA 2O8VB 1SD8A 3D5JA 3GV1A 2I4AA 10GSA 3I6AA 1Y6EA 2FY6A 5A4UA 3DVXA 1TI1A 3BOAA 4PUAA 1EEJA 5CNWA 2MBSA 4JR4A 4ZBAA 2DJ2A 1GSYA 3FYGA 4KCEA 3EMXA 4WBJA 4E8EA 3IRAA 5B7CA 1XWBA 2GS3A 18GSA 2R6KA 3L78A 1URMA 4WF4A 3VI7A 1BEDA 3ZFBA 4QQ7A 1XFLA 4NXIA 4TVEA 1NSWA 1Z7PA 2OADA 2IFQA 1X9WB 1EEMA 1R5PA 3W8JA 1I5GA 3UOMA 3MSZA 1JHBA 3FR3A 1FW1A 1F37A 2H72A 3EVIA 3K8NA 3DGQA 3J7Yk 1Q4JA 3Q18A 4LMVA 3ISOA 13GSA 2WJUA 4MH3A 5B8BA 2GSSA 3LYKA 4K9ZA 1N8JA 1ML6A 4K0GA 5FHIA 2ES7A 1YKAA 3M3MA 4EC0A 4WKWA 1O81A 1PN9A 2IIYA 2YNXA 4OO4A 3TCOA 4IW9A 2DBCA 2DIZA 3OR5A 3S9FA 2I9HA 2QKEA 1WWJA 3L0HA 4L0WA 3WT1A 1IYIA 4EDZA 4IS0A 2V2GA 4L5LA 1HYUA 2FGXA 2GTUA 1UN2A 2CZ3A 2QSIA 5D96A 1LJRA 4DSQA 2E0QA 2YN1A 1S3AA 3ERFA 2R5GA 1ILOA 5GSSA 4TOPA 3ZREA 2LNSA 1NM3A 1GUMA 5LD0A 1AXDA 1T4YA 1SL0B 1R7HA 4TW5A 2VLVA 4E8HA 2IMDA 5CRDA 3V1WA 2KP1A 5DCHA 1AC1A 2HT9A 1M9BA 1OKTA 2LV3A 3G7YA 4IQAA 1WPIA 2FHEA 3VLNA 2VO4A 4JE1A 2CA8A 2V1MA 1SL2B 4EE0A 1USBA 1XIYA 3IXRA 4FO5A 2VD0A 5G5FA 2IMEA 4XS4A 1HD2A 3TKQA 3UIWA 2XHFA 3MNGA 2JL4A 4PQIA 2BTOT 4TN8A 3ZTLA 2C8UA 2L6CA 3L9UA 5IMFA 5GZZB 2I81A 3UMAA 5HQPA 3HZ8A 1J9BA 1G0TA 3HA9A 4TKYA 1X5DA 2O89A 2H1BA 3N9JA 5IOXA 1Z5YE 1PSQA 4NWYA 1KEBA 2M80A 4NV2A 2FD3A 4ECCA 1BAYA 4BWSA 2IJYA 2IFQB 3KP9A 4HEA2 1SL1B 4CDOA 2H8LA 3A5WA 1LBKA 1M0UA 1EP7A 4IKHA 4MPGA 2H1GA 3GFKA 1DE1A 4MF7A 1OE8A 1THXA 3P2AA 4AJ7A 1SJZA 2NBSA 2GT6A 5B6NA 4TR3A 5G5EA 4I8BA 4JR6A 1MDKA 3RPPA 3Q19A 3APOA 2PU9C 3F4RA 2X8GA 3VWUA 3UEMA 6GSVA 5G1KA 1PKZA 1JZWA 2HYXA 4IGJA 2GGTA 3H79A 3KTLA 4LL4B 5JWQB 5F06A 1QXHA 4F0BA 5KN0A 3BCKA 3WD6A 2HXKA 4JU5A 5D9XA 1QUWA 3I9V2 1M99A 3GH9A 4WBRD 5GAPD 1X0RA 2J23A 4XRAA 4N10A 4YAPA 3PR8A 1C72A 4WETA 3TJBA 3EU3A 2ON5A 2OACA 4ECBA 1LU4A 1V2AA 1E2YA 2LJKA 2P31A 2HSYA 1YF1A 2F3MA 5G30A 2YCDA 3SWLA 2VLUA 4ML1A 1VGLA 2CV4A 4IJIA 2IPAA 4KA0A 2XPEA 1V98A 3QR6A 4XS4B 2GSTA 5IPHA 1SJIA 5H5QA 4K6XA 1FVJA 1Q98A 4ZB8A 2C3NA 1QGVA 2YWIA 4TR1A 1EV4A 3FRCA 3FY7A 2DJKA 2LUSA 3GKKA 4G19A 3IE3A 3LWAA 2ZNMA 5GAND 4OO5A 3DKSA 3F8UA 3SBCA 2DMLA 2JZRA 4PUFC 5ECHB 1ZZYA 3KMNA 1TK0B 5CYYA 2XBIA 6GSSA 1SYXA 3GX8A 3D0ZA 5JCWA 1AW9A 1ZL9A 1S3DA 5ECPB 1M7TA 2F51A 3C71A 3IA1A 3H93A 4PGTA 4TR0A 4HQZA 1T4ZA 3P7XA 5F07A 2YJHA 2EIOA 3GSTA 3E9JB 4ZB9A 3IR4A 5ECKB 2H19A 2R4VA 5ID2A 2PGTA 4MH2A 1A2MA 1HNAA 2JSYA 2QGVA 1FAAA 4ILFA 3ZMKA 3ME7A 1XWGA 3DMLA 2H66A 3F4SA 5AGYA 4V1Ap 1BX9A 4GSTA 4K8MA 2Z9SA 4DSSA 3F6FA 5ECNB 3GNJA 3GRXA 3TKSA 4TXOA 2B3SA 2VL2C 1SJ6A 2CZ2A 2CX4A 3U5RE 3GURA 4P3YB 3EWLA 5DBQA 3KCMA 4Q5RA 2RLIA 1OYJA 4KX4A 1FHEA 2VAFA 1R5AA 2LSTA 1EOGA 3GTUA 1XOBA 3G7JA 4AJ8A 3ZIVA 4N30A 4XTSA 4KE3A 2WCIA 4HQSA 2P0GA 1JZRA 2O87A 2H1AA 2N5AA 1OC9A 1XBSA 3FR9A 3QMXA 4D73A 2RM5A 1K0AA 3EMPA 2B6MA 3QFBC 2MMOA 2VUPA 4GQFA 2G0FA 3KP8A 3TB2A 4ZL7A 2X99A 4TR1B 1B8XA 2YPMA 4EVMA 5COHA 5FWGA 1EGRA 4MJCA 6GSWA 2N5FA 1QFNA 2H30A 2C80A 3FK8A 2H0GA 2FA8A 5L71A 2HZEA 4Z7XA 3N5OA 5AIXA 2IMIA 3C8EA 5IMZA 3J7Yb 4MF6A 3FZ4A 3FZ5A 3F9UA 4IQ1A 5KN3A 2L59A 5A5KA 1WOUA 1TK8B 3GUSA 4PQHA 5J5NA 2LKUA 1R4WA 4I2TA 4Q5FA 4TR4A 1ABAA 2ZCTA 5DVBA 1PKWA 3A2VA 5C00A 2DJJA 2QC7A 4OCEA 5F05A 5HFIA 2RUEA 4ECIA 3IDVA 3TKSE 3QD9A 3VWVA 4MABA 1U3IA 5ID2B 1T3BA 1H4OA 3ZFLA 2JACA 5ELAA 4MDCA 1GP1A 1EP8A 1EZKA 2OE3A 11GSA 4FYCA 4KNDA 2LQQA 3QPMA 2PVOC 2LS5A 4ZXGA 3UBKA 4DSSB 2O7KA 3JCML 1Y25A 3U6VA 2GQLA 4IP1A 1AQXA 4TXOB 3F4TA 2FWFA 3H1NA 1TI3A 2WB9A 6GSTA 1B9YC 1FOVA 3TRQA 2OJLA 5CO3A 19GSA 1SYRA 1YF0A 1ZOFA 5GSTA 3GTUB 2RIIA 2YP6A 5E4WA 5A4VA 1PMTA 4MZCA 3DXBA 2OBIA 3TRPA 4G10A 1OC9B 4MA9A 3VPQA 4D73B 3FZAA 3GA4A 2MMNA 4GCIA 1TTZA 5AISA 3DVWA 4WR4A 2C0FA 3UL3A 1THOA 3IBHA 5HR0A 1W4VA 1TKDB 2AUVA 5IM9A 1J08A 5D73A 2EC4A 1F9MA 1WP0A 3HVXA 3LQ7A 2E2MA 4ZILA 4O5RA 3IK7A 1IYHA 4CW9A 3TJKA 4MLYA 3HY2A 3RPNA 1TK5B 3KD0A 6GSXA 2HZEB 3RHCA 4NHWA 1ZGNA 1KTEA 2C0GA 3HKRA 2TRXA 4HJ2A 1BG5A 4FYUA 1T8EB 2VM2A 1GUKA 4XS1A 2TIRA 4YQUA 3EU4A 1ZYQB 4OD7A 2VCTA 2YWOA 4YQMA 5CRGA 1V40A 1HNCA 2TRCP 4L0UA 4GSSA 1J0FA 4PNFA 4POLA 4DEJA 4KH7A 1TRSA 1VF2A 4RI6A 2VM1A 1XVQA 3Q74A 3DYRA 4KSOA 5FT3A 3LXTA 2JZTA 4I2UA 5DQYA 2XPDA 1GLPA 1ERWA 4V2LA 2E2GA 4PURA 4KAEA 3RBTA 1XWKA 3TDGA 3D4MA 5ECMB 3IC4A 3GMFA 1K0CA 1ERVA 5JCGA 2H73A 4HOJA 4AJ6A 5ECQB 7GSSA 2KLXA 4KSMA 2C3QA 2DJ3A 2C4JA 2M46A 4ACSA 4X43A 3VWXA 3QAVA 2VCQA 4CHSA 4LMWA 5DDLA 5D93A 1Z6MA 1QK8A 2B7KA 3VI5A 3TGZA 1K0NA 4POBA 2GZPA 6GSYA 3GH6A 1TU7A 3M0FA 1DUGA 1A8LA 1UA5A 2DIYA 3IV4A 3F3RA 4JRRA 2LEGA 4F03A 2FNOA 1GSUA 1JFUA 2F9SA 4RQXA 2HSHA 5AIVA 3Q6OA 1XPVA 1WIKA 9GSSA 3GIXA 2AB6A 2VL9A 1TP9A 1G6YA 2AJQB 2P5RA 2YOIA 4PQ1A 2KOKA 3E0UA 2JU5A 2FWHA 3LEFA 1K0BA 4ZB6A 4BVYA 3W6GA 3TUEA 1RQMA 2HNLA 2GDRA 2OKAA 1XWAA 5G31A 1T7PB 2CX3A 1U6TA 1BJXA 1GUHA 2JZSA 3CXGA 4LL1B 2VCWA 1PGTA 2GVPA 4IP6A 3UJ1A 4IN0A 1OVNA 1JLVA 3ZLPA 3HJMA 3M8NA 1GLQA 1AIUA 2GSQA 3P90A 5DCGA 3MAKA 4QL7A 1XZOA 4TRXA 2PWJA 1X5CA 2H6YA 4OWYA 2CVBA 2OE0A 5E59A 3PH9A 4EUYA 1GNWA 1WJKA 4K1FA 1PX6A 2H75A 2VD1A 4RUVA 1AUCA 2AHEA 3FEUA 2H70A 2AAWA 3D4TA 3C1SA 3KH9A 2WRTA 3F6DA 2A2RA 1YEXA 4X0XA 4OMVA 2H6ZA 2H01A 4POKA 1PL2A 2YV7A 5C04A 2VCVA 3EC3A 2P5QA 2BMXA 5F8BA 1GSQA 2YJ7A 3FKFA 4GRFA 4OFMA 2L4QA 2WFCA 3F63A 1DSBA 4BL7A 3HCZA 3ZL5A 3KJYA 4O32A 3VWWA 4F82A 1TRUA 5DAKA 1K0MA 2H0IA 4V2MA 4NHZA 1CQHA 1O85A 1GRXA 3KH7A 2WS2A 2IMKA 1CQGA 5DJMA 1TRWA 4Q5NA 4K2DA 4IHUA 3TKRA 2YWNA 2MYGA 2VIMA 2WGRA 1W89A 4I97A 5IIZA 3TJJA 1G6WA 3D22A 3VPTA 1FG4A 5IO0A 3UBLA 3EURA 2LJRA 5ENUA 2L57A 1GULA 4V1Ag 4HZ4A 1Z6NA 3MWHA 5ECLB 3LJRA 5KEJA 2AYTA 2F8AA 2NDOA 1PL1A 4BVXA 4HI7A 3TOTA 1F6MC 1TXXA 2CT6A 4EDYA 4RQRA 4ID0A 5IO2A 3FHKA 1BQ7A 1JLWA 2H76A 2LQOA 2GLRA 5INYA 2IN3A 1PA3A 2DSAA 1A0FA 2KUCA 4KW6A 5G2ZA 2LJAA 4OCFA 3DRNA 4FIWA 2EIRA 4XS6A 1B9XC 1VF4A 2LTKA 2FA4A 4KB3A 1U87A 3CTFA 4IBPA 4N11A 4GLTA 5D9VA 2D2ZA 1K3YA 2VOCA 1AAZA 1MD3A 1M2DA 1ACVA 2A4VA 1EOHA 1ZCPA 1FB6A 4IJ3A 4BPYA 1FO5A 5LCZA 4HU9A 3O6TA 4DSRA 5IMCA 3D6IA 3O76A 2HI7A 3IAM2 5JCUA 1K0DA 3QFAC 4MF5A 4GQCA 2VLTA 4MPFA 1QQ2A 1XW6A 1SENA 2CAQA 1SD9A 2PMTA 2MBTA 1M9AA 3APSA 4YAVA 4MCUA 1SKWB 2NPBA 1ERUA 3EINA 3QOUA 2VCXA 4LA1A 4PNGA 1JZDA 6GSUA 1EGOA 1U3AA 3G9BA 4MMMA 3HHVA 2RUFA 3HXSA 1MTCA 2OA7A 2R3XA 2MZCA 2JSZA 1VF1A 5H5RA 3ZRDA 5DAKB 2DC5A 3GX0A 4KUNA 3DIEA 3KIJA 3HD5A 3KZQA 3UVHA 1YY7A 5IPGA 5B8AA 4K7OA 3BCIA 2FWEA 4OFNA 2GSRA 3P8WA 3G7IA 4GWRA 2XBQA 1V57A 2KHPA 3NZNA 4F0CA 1TU8A 1DE2A 2NTOA 5D9WA 5JWOB 2O85A 3UAPA 4XHMA 2REMA 3C1RA 3DWVA 1S3CA 2B5EA 3C7MA 4ISDA 3UARA 3H4KA 2L5LA 4K7NA 4GTUA 4K7IA 3LSZA 1OC8A 4QL9A 2NVLA 3IPZA 1R26A 3H8QA 5IMDA 1A24A 4F9ZA 3HDCA 3IOSA 4YH2A 1V9WA 3IAS2 1EWXA 5KN2A 1BYEA 1OC3A 3F3QA 4GF0A 5ECRB 1TRVA 4POMA 4HUAA 1X9SB 3QCPA 3KM6A 1YJ6A 3EE2A 3HVVA 4PX1A 5EY6A 2IMFA 3CBUA 2OBKA 2IWTA 2DJ1A 1Z9HA 2YANA 3GYKA 4NMUA 2C1YA 5HFKA 3C73A 4KDUA 2V32A 2YZHA 2DMMA 3GKMA 3KEBA 1TW9A 5IQYA 2E7PA 3E3EA 4YQVA 3TKSC 4MP4A 2J9HA 1FVKA 2OE1A 4MJBA 1YZXA 3L9SA 4EXJA 3HYPA 2GZZA 2PN8A 5J4UA 16GSA 4G9HA 4WF5A 5D9TA 2L5OA 1NHYA 2CQ9A 4JBBA 5F0GA 1XW5A 3ZZXA 1O8WA 1Z3EA 1A8YA 5EL8A 4I6XA 3MDKA 1XOAA 3ZMLA 5JWRB 3APQA 5ECSA 4XRDA 3PGTA 3DEXA 4BA7A 1GSFA 3HJPA 1RK4A 4AF2A 1Z7RA 4X1UA 1GTIA 2K8VA 1K3OA 1GL8A 2F8FA 2K6VA 1YDKA 1HQOA 4JZQA 4ZL8A 5ABRA 5LNKe 3R2QA 5HFGA 1OE7A 3ZITA 2FUG2 2HFDA 5CRWA 3ZYWA 3IK9A 1GSEA 1VRSD 2VCZA 3NIVA 4GSNA 1WE0A 3A2WA 2X8HA 1M2AA 1FB0A 5A4WA 3ERWA 4N0ZA 3L4NA 2GZYA 3CRUA 3QDNA 4H86A 3BBYA 2K18A 1U88A 4EO3A 1GH2A 1SK0A 3TOUA 4JEDA 2B1LA 4EKZA 2JADA 4ULXA 5AN1A 2M72A 1G7OA 2ON7A 2BJXA 3KTBA 4O7HA 4K0NA 3I69A 5J9CA 1X9MB 4V2NA 2V41A 2VL2A 1UC7A 3PINA 3GN3A 2HLSA 1MDIA 4L8EA 3LG6A 1GNEA 2C0DA 3LYPA 5HR2A 2V6KA 1XVWA 3TJGA 1ZMAA 4WEYA 3AY8A 2PPTA 3VURA 1O8XA 3TJFA 4J2FA 2ALBA 1SKSB 3RAZA 2IL3A 4KDYA 1O7UA 4TXVA 1WMJA 4J57E 5IMVA 3FR6A 2CAIA 1V58A 1PX7A 1T00A 2CVDA
chains in the Genus database with same CATH superfamily
4L5OA 3VK9A 3NOFA 4ML6A 3LFLA 4EIQA 14GSA 2EIQA 4IELA 5CRHA 2N5BA 2R2JA 4XIHA 5CAXA 3KMOA 1GSDA 4FH8A 3I43A 4RI7A 3UVTA 1O6JA 2WDUA 4ZBBA 2YV9A 5BMUA 3RHBA 1PD21 4NAXA 1A2LA 4BWQA 1SK1A 2WULA 5IOWA 3ME8A 2DLXA 3CSHA 3TKPA 1SK2A 1HNBA 1TOFA 4XCSA 3FW2A 4FYBA 3GKXA 2WZ9A 4HDEA 1K3LA 4Q5QA 2MMAA 4MJEA 4CY6A 2X64A 4J56E 3EYTA 4F2IA 4ZL9A 1XW9A 4NPBA 1XXUA 2PVQA 1H75A 3F0IA 4FQUA 5KN1A 1X5EA 4GXZA 4MZWA 17GSA 5DQSA 1WRYA 5CREA 1A2JA 5B6MA 1AQVA 2HSMA 2RM6A 3CTGA 1PRXA 3A3TA 3BD2A 3GL3A 5DALA 3CMIA 1G7EA 1DBYA 2C3TA 1NHOA 3O3TA 1TDIA 2B5YA 8GSSA 2LNTA 2K9FA 4K2XA 3HVSA 1F2EA 3BJ5A 3GKNA 1F3BA 5HR3A 4MK3A 1VF3A 4N0VA 2I1UA 1OKDA 2HRFA 1AQWA 3MIXA 3HJOA 2LRCA 2PERA 4HS1A 1O73A 2XC2A 3WGXA 1XWCA 2HZFA 1PQNA 3ZIJA 2B5XA 2GQMA 4MJAA 4AGSA 5J9BA 3LGCA 2H71A 1B4QA 3RDWA 4KGIA 2H1DA 5ELGA 5DJLA 4I5QA 5EVOA 2G2QA 2A4HA 1UVZA 4WR5A 2A2SA 1F3AA 2X8CA 4KCAA 5J41A 2HRNA 2ZUPA 4Z2TA 4OFTA 2FWGA 4LLRA 3WGEA 1GSSA 4HU7A 4KDXA 2PBJA 1GTUA 1YEPA 5CP1A 4ECJA 20GSA 1E6BA 1JZOA 2YZUA 3ZVJD 1K0OA 4DVCA 1B4PA 4PXOA 3CSIA 1GWCA 2PUKC 1SKRB 2GT5A 5EPFA 4NV5A 1XCCA 1ERTA 3LORA 1KNGA 4IVFA 5J3RA 4HZ2A 2KP2A 4G2EA 2C0EA 1M2BA 1A0RP 3QAWA 2R37A 2DJ0A 3FZ9A 1ST9A 5G1LA 2YWMA 2I3YA 4WXTA 2HE3A 5D8IA 3TRXA 2GQKA 2FCHA 3ZVJA 3M9KA 3QAGA 1ON4A 2AV4A 1MDJA 2MMZA 4MZBA 2B1KA 2HRAA 2H0HA 1A23A 1SU9A 2CVKA 4ZBDA 22GSA 4K5SA 4EL1A 3ED3A 1ZYEA 3L9VA 3US3A 3M1GA 3GL5A 3A2XA 1I9DA 4EF0A 1QMVA 3WGDA 5DALB 3GHAA 5H5SA 3M9JA 4ICYA 3DD3A 3CRTA 3WYWA 3HZ4A 2H74A 2VL3A 1B48A 3CSJA 3GSSA 3KXOA 1GTAA 3D21A 1MD4A 3WT2A 4HJMA 3IHQA 1N2AA 5ECIB 1NW2A 5HR1A 2H6XA 5ECOB 1TJDA 2FLSA 3ERGA 2LRTA 2V6OA 2B7JA 1MEKA 1OAZA 2L4CA 1RW1A 2L6DA 12GSA 1EV9A 1KBNA 3KGKA 1YKCA 3LXZA 2LRNA 3W8SA 3CYNA 3VFIA 4ZIJA 4O92A 1GTBA 1T1VA 2K8SA 1YQ1A 5IMAA 2O8VB 1SD8A 3D5JA 1M3IA 3GV1A 2QA2A 2I4AA 10GSA 3I6AA 1Y6EA 2FY6A 5A4UA 3DVXA 1TI1A 3BOAA 4PUAA 1EEJA 5CNWA 2MBSA 4JR4A 4ZBAA 2DJ2A 1GSYA 3FYGA 4KCEA 3EMXA 4WBJA 4E8EA 3IRAA 5B7CA 1XWBA 2GS3A 18GSA 2R6KA 3L78A 1URMA 4WF4A 3VI7A 1BEDA 3ZFBA 4QQ7A 1XFLA 4NXIA 4TVEA 1NSWA 1Z7PA 2OADA 2IFQA 1X9WB 1EEMA 1R5PA 3W8JA 1I5GA 3UOMA 3MSZA 1JHBA 3FR3A 1FW1A 1F37A 2H72A 3EVIA 3K8NA 3DGQA 3J7Yk 1Q4JA 3Q18A 4LMVA 3ISOA 13GSA 2WJUA 4MH3A 5B8BA 2GSSA 3LYKA 4K9ZA 1N8JA 1ML6A 4K0GA 5FHIA 4MNNA 2ES7A 1YKAA 3M3MA 4EC0A 4WKWA 1O81A 1PN9A 2IIYA 2YNXA 4OO4A 5KOXA 3TCOA 4IW9A 2DBCA 2DIZA 3OR5A 3S9FA 2I9HA 2QKEA 1WWJA 3L0HA 4L0WA 3WT1A 1IYIA 4EDZA 4IS0A 2V2GA 4L5LA 1HYUA 2FGXA 2GTUA 1UN2A 2CZ3A 2QSIA 5D96A 1LJRA 4DSQA 2E0QA 2YN1A 1S3AA 3ERFA 2R5GA 1ILOA 5GSSA 4TOPA 3ZREA 2LNSA 1NM3A 1GUMA 5LD0A 1AXDA 1T4YA 1SL0B 1R7HA 4TW5A 2VLVA 4E8HA 2IMDA 5CRDA 3V1WA 2KP1A 5DCHA 1AC1A 2HT9A 1M9BA 1OKTA 2LV3A 3G7YA 4IQAA 1WPIA 2FHEA 3VLNA 2VO4A 4JE1A 2CA8A 2V1MA 1SL2B 4EE0A 1USBA 1XIYA 3IXRA 4FO5A 2VD0A 5G5FA 4USSA 2IMEA 4XS4A 1HD2A 3TKQA 3UIWA 1FOHA 2XHFA 3MNGA 2JL4A 4PQIA 2BTOT 4TN8A 3ZTLA 2C8UA 2L6CA 3L9UA 5IMFA 5GZZB 2I81A 3UMAA 5HQPA 3HZ8A 1J9BA 1G0TA 3HA9A 4TKYA 1X5DA 2O89A 2H1BA 3N9JA 1PN0A 5IOXA 1Z5YE 1PSQA 4NWYA 1KEBA 2M80A 4NV2A 2FD3A 4ECCA 1BAYA 4BWSA 2IJYA 2IFQB 3KP9A 4HEA2 5KOWA 1SL1B 4CDOA 2H8LA 3A5WA 1LBKA 1M0UA 1EP7A 4IKHA 4MPGA 2H1GA 3GFKA 1DE1A 4MF7A 1OE8A 1THXA 3P2AA 4AJ7A 1SJZA 2NBSA 2GT6A 5B6NA 4TR3A 2QA1A 5G5EA 4I8BA 4JR6A 1MDKA 3RPPA 3Q19A 3APOA 2PU9C 3F4RA 3MYDA 2X8GA 3VWUA 3UEMA 6GSVA 5G1KA 1PKZA 1JZWA 2HYXA 4IGJA 2GGTA 3H79A 3KTLA 4LL4B 5JWQB 5F06A 1QXHA 4F0BA 5KN0A 3BCKA 3WD6A 2HXKA 4JU5A 5D9XA 1QUWA 3I9V2 1M99A 3GH9A 4WBRD 5GAPD 1X0RA 2J23A 4XRAA 4N10A 4YAPA 3PR8A 1C72A 4WETA 3TJBA 3EU3A 2ON5A 2OACA 4ECBA 1LU4A 1V2AA 1E2YA 4O5QA 2LJKA 2P31A 2HSYA 1YF1A 2F3MA 5G30A 2YCDA 3SWLA 2VLUA 4ML1A 1VGLA 2CV4A 4IJIA 2IPAA 4KA0A 2XPEA 1V98A 3QR6A 4XS4B 2GSTA 5IPHA 1SJIA 5H5QA 4K6XA 1FVJA 1Q98A 4ZB8A 2C3NA 1QGVA 2YWIA 4TR1A 1EV4A 3FRCA 3FY7A 2DJKA 2LUSA 3GKKA 4G19A 3IE3A 3LWAA 2ZNMA 5GAND 4OO5A 3DKSA 3F8UA 3SBCA 2DMLA 2JZRA 4PUFC 1ZYNA 5ECHB 1ZZYA 3KMNA 1TK0B 5CYYA 2XBIA 6GSSA 1SYXA 3GX8A 3D0ZA 5JCWA 1AW9A 1ZL9A 1S3DA 5ECPB 1M7TA 2F51A 3C71A 3IA1A 3CQFA 3H93A 4PGTA 4TR0A 4HQZA 1T4ZA 3P7XA 4G0LA 5F07A 2YJHA 2EIOA 3GSTA 3E9JB 4ZB9A 3IR4A 5ECKB 3FMWA 2H19A 2R4VA 5ID2A 2PGTA 4MH2A 3IHGA 1A2MA 1HNAA 2JSYA 2QGVA 1FAAA 4ILFA 3ZMKA 3ME7A 1XWGA 3DMLA 2H66A 3F4SA 5AGYA 4V1Ap 1BX9A 4GSTA 4K8MA 2Z9SA 4CY8A 4DSSA 4O5UA 3F6FA 5ECNB 4BIKA 3GNJA 3GRXA 3TKSA 4TXOA 2B3SA 2VL2C 1SJ6A 2CZ2A 2CX4A 3U5RE 3GURA 4P3YB 3EWLA 5DBQA 3KCMA 4Q5RA 2RLIA 1OYJA 4KX4A 1FHEA 2VAFA 1R5AA 2LSTA 1EOGA 3GTUA 1XOBA 3G7JA 4AJ8A 2DKIA 3ZIVA 4N30A 4XTSA 4KE3A 2WCIA 3IC8A 4HQSA 2P0GA 1JZRA 2HRKA 1M3JA 2O87A 2H1AA 2N5AA 1OC9A 1XBSA 3FR9A 3QMXA 4D73A 2RM5A 1K0AA 3EMPA 2B6MA 3QFBC 2R0GA 2MMOA 2VUPA 4GQFA 2G0FA 3KP8A 3TB2A 4ZL7A 2X99A 4TR1B 1B8XA 2YPMA 4EVMA 5COHA 5FWGA 1EGRA 4PTSA 4MJCA 6GSWA 2N5FA 1QFNA 2H30A 2C80A 3FK8A 2H0GA 2FA8A 5L71A 2HZEA 4Z7XA 3N5OA 5AIXA 2IMIA 3C8EA 5IMZA 3J7Yb 4MF6A 3FZ4A 3FZ5A 3F9UA 4IQ1A 5KN3A 2L59A 5A5KA 1WOUA 1TK8B 3GUSA 4PQHA 5J5NA 2LKUA 1R4WA 4I2TA 4Q5FA 4TR4A 1ABAA 2ZCTA 5DVBA 1PKWA 3A2VA 5C00A 2DJJA 2QC7A 4OCEA 5F05A 5HFIA 2RUEA 4ECIA 3IDVA 3TKSE 3QD9A 3VWVA 4MABA 1U3IA 5ID2B 3PPUA 1T3BA 1H4OA 3ZFLA 2JACA 5ELAA 4MDCA 1GP1A 1EP8A 1EZKA 2OE3A 11GSA 4FYCA 4KNDA 2LQQA 3QPMA 2PVOC 2LS5A 4ZXGA 3UBKA 4DSSB 2O7KA 3JCML 4HSCX 1Y25A 3U6VA 2GQLA 4IP1A 1AQXA 4TXOB 3F4TA 2FWFA 3H1NA 1TI3A 2WB9A 6GSTA 1B9YC 1FOVA 4EIPA 3TRQA 2OJLA 5CO3A 19GSA 1SYRA 1YF0A 1ZOFA 5GSTA 3GTUB 2RIIA 2YP6A 5E4WA 5A4VA 1PMTA 4MZCA 3DXBA 2OBIA 3TRPA 4G10A 1OC9B 4MA9A 3VPQA 4D73B 3FZAA 3GA4A 2MMNA 4GCIA 1TTZA 5AISA 5BRTA 3DVWA 4WR4A 2C0FA 3UL3A 1THOA 3IBHA 5HR0A 1W4VA 1TKDB 2AUVA 5IM9A 1J08A 5D73A 2EC4A 1F9MA 1WP0A 3HVXA 3LQ7A 2E2MA 4ZILA 4O5RA 3IK7A 1IYHA 4CW9A 3TJKA 4MLYA 3HY2A 3RPNA 1TK5B 3KD0A 6GSXA 2HZEB 3RHCA 4NHWA 1ZGNA 1KTEA 2C0GA 3HKRA 2TRXA 4HJ2A 1BG5A 4FYUA 1T8EB 2VM2A 1GUKA 4XS1A 2TIRA 4YQUA 3EU4A 1ZYQB 4OD7A 2VCTA 2YWOA 4YQMA 5CRGA 1V40A 1HNCA 2TRCP 4L0UA 4GSSA 1J0FA 4PNFA 4POLA 4DEJA 4KH7A 1TRSA 1VF2A 4RI6A 2VM1A 4A5PA 2X49A 1XVQA 2R0CA 3Q74A 3DYRA 4KSOA 5FT3A 3LXTA 2JZTA 4I2UA 5DQYA 2XPDA 1GLPA 1ERWA 4V2LA 2E2GA 4PURA 4KAEA 3RBTA 1XWKA 3TDGA 3D4MA 5ECMB 3IC4A 3GMFA 1K0CA 3EPTA 1ERVA 5JCGA 2H73A 4HOJA 4AJ6A 5ECQB 7GSSA 2KLXA 4KSMA 2C3QA 2DJ3A 2C4JA 2M46A 4ACSA 4X43A 3VWXA 3QAVA 4YKFA 2VCQA 4CHSA 4KF9A 4LMWA 2A2PA 5DDLA 5D93A 1Z6MA 1QK8A 2B7KA 3VI5A 3TGZA 1K0NA 4POBA 2GZPA 6GSYA 3GH6A 1TU7A 3M0FA 1DUGA 1A8LA 1UA5A 2DIYA 3IV4A 3F3RA 4JRRA 2LEGA 4F03A 2R0PA 2FNOA 1GSUA 1JFUA 2F9SA 4RQXA 2HSHA 5AIVA 3Q6OA 1XPVA 1WIKA 9GSSA 3GIXA 1ZYPA 2AB6A 2VL9A 1TP9A 1G6YA 2AJQB 2P5RA 2YOIA 4PQ1A 2KOKA 3E0UA 2JU5A 2FWHA 3LEFA 1K0BA 4ZB6A 4BVYA 3W6GA 3TUEA 1RQMA 2HNLA 2GDRA 2OKAA 1XWAA 5G31A 1T7PB 2X4AA 2CX3A 1U6TA 1BJXA 2UZ8A 1GUHA 2JZSA 3CXGA 4LL1B 2VCWA 1PGTA 2GVPA 4IP6A 3UJ1A 4IN0A 1OVNA 1JLVA 3ZLPA 1PFOA 3HJMA 3M8NA 1GLQA 1AIUA 2GSQA 3P90A 5DCGA 3MAKA 4QL7A 1XZOA 4TRXA 2PWJA 1X5CA 2H6YA 4OWYA 2CVBA 2OE0A 5E59A 3PH9A 4EUYA 1GNWA 1WJKA 3LW9A 4K1FA 1PX6A 2H75A 2VD1A 4RUVA 1AUCA 2AHEA 3FEUA 2H70A 2AAWA 3D4TA 3C1SA 3KH9A 2WRTA 3F6DA 2A2RA 1YEXA 4X0XA 4OMVA 2H6ZA 2H01A 4POKA 1PL2A 2YV7A 5C04A 2VCVA 3EC3A 2P5QA 2BMXA 5F8BA 1GSQA 2YJ7A 3FKFA 4GRFA 4OFMA 2L4QA 2WFCA 3F63A 1DSBA 4BL7A 3HCZA 3ZL5A 3KJYA 4O32A 3VWWA 4F82A 1TRUA 5DAKA 1K0MA 2H0IA 4V2MA 4NHZA 1CQHA 1O85A 1GRXA 3KH7A 2WS2A 2IMKA 1CQGA 5DJMA 1TRWA 4Q5NA 4K2DA 4IHUA 3TKRA 2YWNA 2MYGA 2VIMA 2WGRA 1W89A 4I97A 5IIZA 3TJJA 1G6WA 3D22A 3VPTA 1FG4A 5IO0A 3UBLA 3EURA 2LJRA 5ENUA 2L57A 1GULA 4V1Ag 4HZ4A 1Z6NA 3MWHA 5ECLB 3LJRA 5KEJA 2AYTA 2F8AA 2NDOA 1PL1A 4BVXA 4HI7A 3TOTA 1F6MC 1TXXA 2CT6A 4EDYA 4RQRA 4ID0A 5IO2A 3FHKA 4BVYB 1BQ7A 1JLWA 2H76A 2LQOA 2GLRA 5INYA 2IN3A 1PA3A 2DSAA 1A0FA 2KUCA 4KW6A 5G2ZA 2LJAA 4OCFA 3DRNA 4FIWA 2EIRA 4XS6A 1B9XC 1VF4A 2LTKA 2FA4A 4KB3A 1U87A 3CTFA 4IBPA 4N11A 4GLTA 5D9VA 2D2ZA 1K3YA 2VOCA 1AAZA 1MD3A 1M2DA 1ACVA 2A4VA 1EOHA 1ZCPA 1FB6A 4IJ3A 4BPYA 1FO5A 5LCZA 4HU9A 3O6TA 4DSRA 5IMCA 3D6IA 3O76A 2HI7A 3IAM2 5JCUA 1K0DA 3QFAC 4MF5A 4GQCA 2VLTA 4MPFA 1QQ2A 1XW6A 1SENA 2CAQA 1SD9A 2PMTA 2MBTA 1M9AA 3APSA 4YAVA 4MCUA 1SKWB 2NPBA 1ERUA 3EINA 3QOUA 2VCXA 4LA1A 4PNGA 1JZDA 6GSUA 1EGOA 1U3AA 3R3EA 3G9BA 4MMMA 3HHVA 2RUFA 3HXSA 1MTCA 4BL7B 2OA7A 2R3XA 2MZCA 2JSZA 1VF1A 5H5RA 3ZRDA 5DAKB 2DC5A 3GX0A 4KUNA 3DIEA 3KIJA 3HD5A 3KZQA 3UVHA 1YY7A 5IPGA 5B8AA 4K7OA 3BCIA 4X4JA 2FWEA 4OFNA 2GSRA 3P8WA 3G7IA 1S3RA 4GWRA 2XBQA 1V57A 2KHPA 3NZNA 4F0CA 1TU8A 1DE2A 2NTOA 5D9WA 5JWOB 4YKGA 2O85A 3UAPA 4XHMA 2REMA 3C1RA 4BVXB 3DWVA 1S3CA 2B5EA 3C7MA 4ISDA 3UARA 2DKHA 3H4KA 2L5LA 4K7NA 4GTUA 4K7IA 3LSZA 1OC8A 4QL9A 2NVLA 3IPZA 1R26A 3H8QA 5IMDA 1A24A 4F9ZA 3HDCA 3IOSA 4YH2A 1V9WA 3IAS2 3HVNA 1EWXA 5KN2A 1BYEA 1OC3A 3F3QA 4GF0A 5ECRB 1TRVA 4POMA 4HUAA 1X9SB 3QCPA 3KM6A 1YJ6A 3EE2A 3HVVA 4PX1A 5EY6A 2IMFA 3CBUA 2OBKA 2IWTA 2DJ1A 1Z9HA 2YANA 3GYKA 4NMUA 2C1YA 5HFKA 3C73A 4KDUA 4G0IA 2V32A 2YZHA 4Z2RA 2DMMA 3GKMA 3KEBA 1TW9A 5IQYA 2E7PA 3E3EA 4YQVA 3TKSC 4MP4A 2J9HA 1FVKA 2OE1A 4MJBA 1YZXA 3L9SA 4EXJA 3HYPA 2GZZA 2PN8A 5J4UA 16GSA 4G9HA 4WF5A 5D9TA 2L5OA 1NHYA 4Z2UA 2CQ9A 4JBBA 5F0GA 1XW5A 3ZZXA 1O8WA 1Z3EA 1A8YA 5EL8A 4I6XA 3MDKA 1XOAA 3ZMLA 5JWRB 3APQA 4XRDA 5ECSA 3PGTA 3DEXA 4BA7A 1GSFA 3HJPA 1RK4A 4AF2A 4X1UA 1Z7RA 1GTIA 4K5RA 2K8VA 1K3OA 1GL8A 2F8FA 2K6VA 1YDKA 1HQOA 4JZQA 4ZL8A 5ABRA 5LNKe 3R2QA 5HFGA 1OE7A 3ZITA 2FUG2 2HFDA 5CRWA 3ZYWA 3IK9A 1GSEA 1VRSD 2VCZA 3NIVA 4GSNA 1WE0A 3A2WA 2X8HA 4G0KA 1M2AA 1FB0A 5A4WA 3ERWA 4N0ZA 3L4NA 2GZYA 3CRUA 3QDNA 4H86A 3BBYA 2K18A 1U88A 4EO3A 1GH2A 1SK0A 3TOUA 4JEDA 2B1LA 4EKZA 2JADA 4ULXA 5AN1A 3A5IA 2M72A 1G7OA 2ON7A 2BJXA 3KTBA 4O7HA 4K0NA 3I69A 5J9CA 1X9MB 4V2NA 2V41A 2VL2A 1UC7A 1XG8A 3PINA 3GN3A 2HLSA 1MDIA 4L8EA 3LG6A 1GNEA 2C0DA 3LYPA 5HR2A 2V6KA 1XVWA 3TJGA 1ZMAA 4WEYA 3AY8A 2PPTA 3VURA 1O8XA 3TJFA 4J2FA 2ALBA 1SKSB 3RAZA 2IL3A 4KDYA 1O7UA 4TXVA 1WMJA 4J57E 5IMVA 3FR6A 2CAIA 1V58A 1PX7A 1T00A 2CVDA
chains in the Genus database with same CATH topology
4L5OA 3VK9A 3NOFA 4ML6A 3LFLA 4EIQA 14GSA 2EIQA 4IELA 5CRHA 2N5BA 2R2JA 4XIHA 5CAXA 3KMOA 1GSDA 4FH8A 3I43A 4RI7A 3UVTA 1O6JA 2WDUA 4ZBBA 2YV9A 5BMUA 3RHBA 1PD21 4NAXA 1A2LA 4BWQA 1SK1A 2WULA 5IOWA 3ME8A 2DLXA 3CSHA 3TKPA 1SK2A 1HNBA 1TOFA 4XCSA 3FW2A 4FYBA 3GKXA 2WZ9A 4HDEA 1K3LA 4Q5QA 2MMAA 4MJEA 4CY6A 2X64A 4J56E 3EYTA 4F2IA 4ZL9A 1XW9A 4NPBA 1XXUA 2PVQA 1H75A 3F0IA 4FQUA 5KN1A 1X5EA 4GXZA 4MZWA 17GSA 5DQSA 1WRYA 5CREA 1A2JA 5B6MA 1AQVA 2HSMA 2RM6A 3CTGA 1PRXA 3A3TA 3BD2A 3GL3A 5DALA 3CMIA 1G7EA 1DBYA 2C3TA 1NHOA 3O3TA 1TDIA 2B5YA 8GSSA 2LNTA 2K9FA 4K2XA 3HVSA 1F2EA 3BJ5A 3GKNA 1F3BA 5HR3A 4MK3A 1VF3A 4N0VA 2I1UA 1OKDA 2HRFA 1AQWA 3MIXA 3HJOA 2LRCA 2PERA 4HS1A 1O73A 2XC2A 3WGXA 1XWCA 2HZFA 1PQNA 3ZIJA 2B5XA 2GQMA 4MJAA 4AGSA 5J9BA 3LGCA 2H71A 1B4QA 3RDWA 4KGIA 2H1DA 5ELGA 5DJLA 4I5QA 5EVOA 2G2QA 2A4HA 1UVZA 4WR5A 2A2SA 1F3AA 2X8CA 4KCAA 5J41A 2HRNA 2ZUPA 4Z2TA 4OFTA 2FWGA 4LLRA 3WGEA 1GSSA 4HU7A 4KDXA 2PBJA 1GTUA 1YEPA 5CP1A 4ECJA 20GSA 1E6BA 1JZOA 2YZUA 3ZVJD 1K0OA 4DVCA 1B4PA 4PXOA 3CSIA 1GWCA 2PUKC 1SKRB 2GT5A 5EPFA 4NV5A 1XCCA 1ERTA 3LORA 1KNGA 4IVFA 5J3RA 4HZ2A 2KP2A 4G2EA 2C0EA 1M2BA 1A0RP 3QAWA 2R37A 2DJ0A 3FZ9A 1ST9A 5G1LA 2YWMA 2I3YA 4WXTA 2HE3A 5D8IA 3TRXA 2GQKA 2FCHA 3ZVJA 3M9KA 3QAGA 1ON4A 2AV4A 1MDJA 2MMZA 4MZBA 2B1KA 2HRAA 2H0HA 1A23A 1SU9A 2CVKA 4ZBDA 22GSA 4K5SA 4EL1A 3ED3A 1ZYEA 3L9VA 3US3A 3M1GA 3GL5A 3A2XA 1I9DA 4EF0A 1QMVA 3WGDA 5DALB 3GHAA 5H5SA 3M9JA 4ICYA 3DD3A 3CRTA 3WYWA 3HZ4A 2H74A 2VL3A 1B48A 3CSJA 3GSSA 3KXOA 1GTAA 3D21A 1MD4A 3WT2A 4HJMA 3IHQA 1N2AA 5ECIB 1NW2A 5HR1A 2H6XA 5ECOB 1TJDA 2FLSA 3ERGA 2LRTA 2V6OA 2B7JA 1MEKA 1OAZA 2L4CA 1RW1A 2L6DA 12GSA 1EV9A 1KBNA 3KGKA 1YKCA 3LXZA 2LRNA 3W8SA 3CYNA 3VFIA 4ZIJA 4O92A 1GTBA 1T1VA 2K8SA 1YQ1A 5IMAA 2O8VB 1SD8A 3D5JA 3GV1A 2QA2A 2I4AA 10GSA 3I6AA 1Y6EA 2FY6A 5A4UA 3DVXA 1TI1A 3BOAA 4PUAA 1EEJA 5CNWA 2MBSA 4JR4A 4ZBAA 2DJ2A 1GSYA 3FYGA 4KCEA 3EMXA 4WBJA 4E8EA 3IRAA 5B7CA 1XWBA 2GS3A 18GSA 2R6KA 3L78A 1URMA 4WF4A 3VI7A 1BEDA 3ZFBA 4QQ7A 1XFLA 4NXIA 4TVEA 1NSWA 1Z7PA 2OADA 2IFQA 1X9WB 1EEMA 1R5PA 3W8JA 1I5GA 3UOMA 3MSZA 1JHBA 3FR3A 1FW1A 1F37A 2H72A 3EVIA 3K8NA 3DGQA 3J7Yk 1Q4JA 3Q18A 4LMVA 3ISOA 13GSA 2WJUA 4MH3A 5B8BA 2GSSA 3LYKA 4K9ZA 1N8JA 1ML6A 4K0GA 5FHIA 4MNNA 2ES7A 1YKAA 3M3MA 4EC0A 4WKWA 1O81A 1PN9A 2IIYA 2YNXA 4OO4A 5KOXA 3TCOA 4IW9A 2DBCA 2DIZA 3OR5A 3S9FA 2I9HA 2QKEA 1WWJA 3L0HA 4L0WA 3WT1A 1IYIA 4EDZA 4IS0A 2V2GA 4L5LA 1HYUA 2FGXA 2GTUA 1UN2A 2CZ3A 2QSIA 5D96A 1LJRA 4DSQA 2E0QA 2YN1A 1S3AA 3ERFA 2R5GA 1ILOA 5GSSA 4TOPA 3ZREA 2LNSA 1NM3A 1GUMA 5LD0A 1AXDA 1T4YA 1SL0B 1R7HA 4TW5A 2VLVA 4E8HA 2IMDA 5CRDA 3V1WA 2KP1A 5DCHA 1AC1A 2HT9A 1M9BA 1OKTA 2LV3A 3G7YA 4IQAA 1WPIA 2FHEA 3VLNA 2VO4A 4JE1A 2CA8A 2V1MA 1SL2B 4EE0A 1USBA 1XIYA 3IXRA 4FO5A 2VD0A 5G5FA 4USSA 2IMEA 4XS4A 1HD2A 3TKQA 3UIWA 1FOHA 2XHFA 3MNGA 2JL4A 4PQIA 2BTOT 4TN8A 3ZTLA 2C8UA 2L6CA 3L9UA 5IMFA 5GZZB 2I81A 3UMAA 5HQPA 3HZ8A 1J9BA 1G0TA 3HA9A 4TKYA 1X5DA 2O89A 2H1BA 3N9JA 1PN0A 5IOXA 1Z5YE 1PSQA 4NWYA 1KEBA 2M80A 4NV2A 2FD3A 4ECCA 1BAYA 4BWSA 2IJYA 2IFQB 3KP9A 4HEA2 5KOWA 1SL1B 4CDOA 2H8LA 3A5WA 1LBKA 1M0UA 1EP7A 4IKHA 4MPGA 2H1GA 3GFKA 1DE1A 4MF7A 1OE8A 1THXA 3P2AA 4AJ7A 1SJZA 2NBSA 2GT6A 5B6NA 4TR3A 2QA1A 5G5EA 4I8BA 4JR6A 1MDKA 3RPPA 3Q19A 3APOA 2PU9C 3F4RA 3MYDA 2X8GA 3VWUA 3UEMA 6GSVA 5G1KA 1PKZA 1JZWA 2HYXA 4IGJA 2GGTA 3H79A 3KTLA 4LL4B 5JWQB 5F06A 1QXHA 4F0BA 5KN0A 3BCKA 3WD6A 2HXKA 4JU5A 5D9XA 1QUWA 3I9V2 1M99A 3GH9A 4WBRD 5GAPD 1X0RA 2J23A 4XRAA 4N10A 4YAPA 3PR8A 1C72A 4WETA 3TJBA 3EU3A 2ON5A 2OACA 4ECBA 1LU4A 1V2AA 1E2YA 4O5QA 2LJKA 2P31A 2HSYA 1YF1A 2F3MA 5G30A 2YCDA 3SWLA 2VLUA 4ML1A 1VGLA 2CV4A 4IJIA 2IPAA 4KA0A 2XPEA 1V98A 3QR6A 4XS4B 2GSTA 5IPHA 1SJIA 5H5QA 4K6XA 1FVJA 1Q98A 4ZB8A 2C3NA 1QGVA 2YWIA 4TR1A 1EV4A 3FRCA 3FY7A 2DJKA 2LUSA 3GKKA 4G19A 3IE3A 3LWAA 2ZNMA 5GAND 4OO5A 3DKSA 3F8UA 3SBCA 2DMLA 2JZRA 4PUFC 1ZYNA 5ECHB 1ZZYA 3KMNA 1TK0B 5CYYA 2XBIA 6GSSA 1SYXA 3GX8A 3D0ZA 5JCWA 1AW9A 1ZL9A 1S3DA 5ECPB 1M7TA 2F51A 3C71A 3IA1A 3H93A 4PGTA 4TR0A 4HQZA 1T4ZA 3P7XA 4G0LA 5F07A 2YJHA 2EIOA 3GSTA 3E9JB 4ZB9A 3IR4A 5ECKB 3FMWA 2H19A 2R4VA 5ID2A 2PGTA 4MH2A 3IHGA 1A2MA 1HNAA 2JSYA 2QGVA 1FAAA 4ILFA 3ZMKA 3ME7A 1XWGA 3DMLA 2H66A 3F4SA 5AGYA 4V1Ap 1BX9A 4GSTA 4K8MA 2Z9SA 4CY8A 4DSSA 4O5UA 3F6FA 5ECNB 3GNJA 3GRXA 3TKSA 4TXOA 2B3SA 2VL2C 1SJ6A 2CZ2A 2CX4A 3U5RE 3GURA 4P3YB 3EWLA 5DBQA 3KCMA 4Q5RA 2RLIA 1OYJA 4KX4A 1FHEA 2VAFA 1R5AA 2LSTA 1EOGA 3GTUA 1XOBA 3G7JA 4AJ8A 2DKIA 3ZIVA 4N30A 4XTSA 4KE3A 2WCIA 3IC8A 4HQSA 2P0GA 1JZRA 2HRKA 2O87A 2H1AA 2N5AA 1OC9A 1XBSA 3FR9A 3QMXA 4D73A 2RM5A 1K0AA 3EMPA 2B6MA 3QFBC 2R0GA 2MMOA 2VUPA 4GQFA 2G0FA 3KP8A 3TB2A 4ZL7A 2X99A 4TR1B 1B8XA 2YPMA 4EVMA 5COHA 5FWGA 1EGRA 4PTSA 4MJCA 6GSWA 2N5FA 1QFNA 2H30A 2C80A 3FK8A 2H0GA 2FA8A 5L71A 2HZEA 4Z7XA 3N5OA 5AIXA 2IMIA 3C8EA 5IMZA 3J7Yb 4MF6A 3FZ4A 3FZ5A 3F9UA 4IQ1A 5KN3A 2L59A 5A5KA 1WOUA 1TK8B 3GUSA 4PQHA 5J5NA 2LKUA 1R4WA 4I2TA 4Q5FA 4TR4A 1ABAA 2ZCTA 5DVBA 1PKWA 3A2VA 5C00A 2DJJA 2QC7A 4OCEA 5F05A 5HFIA 2RUEA 4ECIA 3IDVA 3TKSE 3QD9A 3VWVA 4MABA 1U3IA 5ID2B 3PPUA 1T3BA 1H4OA 3ZFLA 2JACA 5ELAA 4MDCA 1GP1A 1EP8A 1EZKA 2OE3A 11GSA 4FYCA 4KNDA 2LQQA 3QPMA 2PVOC 2LS5A 4ZXGA 3UBKA 4DSSB 2O7KA 3JCML 1Y25A 3U6VA 2GQLA 4IP1A 1AQXA 4TXOB 3F4TA 2FWFA 3H1NA 1TI3A 2WB9A 6GSTA 1B9YC 1FOVA 4EIPA 3TRQA 2OJLA 5CO3A 19GSA 1SYRA 1YF0A 1ZOFA 5GSTA 3GTUB 2RIIA 2YP6A 5E4WA 5A4VA 1PMTA 4MZCA 3DXBA 2OBIA 3TRPA 4G10A 1OC9B 4MA9A 3VPQA 4D73B 3FZAA 3GA4A 2MMNA 4GCIA 1TTZA 5AISA 5BRTA 3DVWA 4WR4A 2C0FA 3UL3A 1THOA 3IBHA 5HR0A 1W4VA 1TKDB 2AUVA 5IM9A 1J08A 5D73A 2EC4A 1F9MA 1WP0A 3HVXA 3LQ7A 2E2MA 4ZILA 4O5RA 3IK7A 1IYHA 4CW9A 3TJKA 4MLYA 3HY2A 3RPNA 1TK5B 3KD0A 6GSXA 2HZEB 3RHCA 4NHWA 1ZGNA 1KTEA 2C0GA 3HKRA 2TRXA 4HJ2A 1BG5A 4FYUA 1T8EB 2VM2A 1GUKA 4XS1A 2TIRA 4YQUA 3EU4A 1ZYQB 4OD7A 2VCTA 2YWOA 4YQMA 5CRGA 1V40A 1HNCA 2TRCP 4L0UA 4GSSA 1J0FA 4PNFA 4POLA 4DEJA 4KH7A 1TRSA 1VF2A 4RI6A 2VM1A 4A5PA 2X49A 1XVQA 2R0CA 3Q74A 3DYRA 4KSOA 5FT3A 3LXTA 2JZTA 4I2UA 5DQYA 2XPDA 1GLPA 1ERWA 4V2LA 2E2GA 4PURA 4KAEA 3RBTA 1XWKA 3TDGA 3D4MA 5ECMB 3IC4A 3GMFA 1K0CA 3EPTA 1ERVA 5JCGA 2H73A 4HOJA 4AJ6A 5ECQB 7GSSA 2KLXA 4KSMA 2C3QA 2DJ3A 2C4JA 2M46A 4ACSA 4X43A 3VWXA 3QAVA 4YKFA 2VCQA 4CHSA 4KF9A 4LMWA 2A2PA 5DDLA 5D93A 1Z6MA 1QK8A 2B7KA 3VI5A 3TGZA 1K0NA 4POBA 2GZPA 6GSYA 3GH6A 1TU7A 3M0FA 1DUGA 1A8LA 1UA5A 2DIYA 3IV4A 3F3RA 4JRRA 2LEGA 4F03A 2R0PA 2FNOA 1GSUA 1JFUA 2F9SA 4RQXA 2HSHA 5AIVA 3Q6OA 1XPVA 1WIKA 9GSSA 3GIXA 1ZYPA 2AB6A 2VL9A 1TP9A 1G6YA 2AJQB 2P5RA 2YOIA 4PQ1A 2KOKA 3E0UA 2JU5A 2FWHA 3LEFA 1K0BA 4ZB6A 4BVYA 3W6GA 3TUEA 1RQMA 2HNLA 2GDRA 2OKAA 1XWAA 5G31A 1T7PB 2X4AA 2CX3A 1U6TA 1BJXA 2UZ8A 1GUHA 2JZSA 3CXGA 4LL1B 2VCWA 1PGTA 2GVPA 4IP6A 3UJ1A 4IN0A 1OVNA 1JLVA 3ZLPA 3HJMA 3M8NA 1GLQA 1AIUA 2GSQA 3P90A 5DCGA 3MAKA 4QL7A 1XZOA 4TRXA 2PWJA 1X5CA 2H6YA 4OWYA 2CVBA 2OE0A 5E59A 3PH9A 4EUYA 1GNWA 1WJKA 3LW9A 4K1FA 1PX6A 2H75A 2VD1A 4RUVA 1AUCA 2AHEA 3FEUA 2H70A 2AAWA 3D4TA 3C1SA 3KH9A 2WRTA 3F6DA 2A2RA 1YEXA 4X0XA 4OMVA 2H6ZA 2H01A 4POKA 1PL2A 2YV7A 5C04A 2VCVA 3EC3A 2P5QA 2BMXA 5F8BA 1GSQA 2YJ7A 3FKFA 4GRFA 4OFMA 2L4QA 2WFCA 3F63A 1DSBA 4BL7A 3HCZA 3ZL5A 3KJYA 4O32A 3VWWA 4F82A 1TRUA 5DAKA 1K0MA 2H0IA 4V2MA 4NHZA 1CQHA 1O85A 1GRXA 3KH7A 2WS2A 2IMKA 1CQGA 5DJMA 1TRWA 4Q5NA 4K2DA 4IHUA 3TKRA 2YWNA 2MYGA 2VIMA 2WGRA 1W89A 4I97A 5IIZA 3TJJA 1G6WA 3D22A 3VPTA 1FG4A 5IO0A 3UBLA 3EURA 2LJRA 5ENUA 2L57A 1GULA 4V1Ag 4HZ4A 1Z6NA 3MWHA 5ECLB 3LJRA 5KEJA 2AYTA 2F8AA 2NDOA 1PL1A 4BVXA 4HI7A 3TOTA 1F6MC 1TXXA 2CT6A 4EDYA 4RQRA 4ID0A 5IO2A 3FHKA 4BVYB 1BQ7A 1JLWA 2H76A 2LQOA 2GLRA 5INYA 2IN3A 1PA3A 2DSAA 1A0FA 2KUCA 4KW6A 5G2ZA 2LJAA 4OCFA 3DRNA 4FIWA 2EIRA 4XS6A 1B9XC 1VF4A 2LTKA 2FA4A 4KB3A 1U87A 3CTFA 4IBPA 4N11A 4GLTA 5D9VA 2D2ZA 1K3YA 2VOCA 1AAZA 1MD3A 1M2DA 1ACVA 2A4VA 1EOHA 1ZCPA 1FB6A 4IJ3A 4BPYA 1FO5A 5LCZA 4HU9A 3O6TA 4DSRA 5IMCA 3D6IA 3O76A 2HI7A 3IAM2 5JCUA 1K0DA 3QFAC 4MF5A 4GQCA 2VLTA 4MPFA 1QQ2A 1XW6A 1SENA 2CAQA 1SD9A 2PMTA 2MBTA 1M9AA 3APSA 4YAVA 4MCUA 1SKWB 2NPBA 1ERUA 3EINA 3QOUA 2VCXA 4LA1A 4PNGA 1JZDA 6GSUA 1EGOA 1U3AA 3R3EA 3G9BA 4MMMA 3HHVA 2RUFA 3HXSA 1MTCA 4BL7B 2OA7A 2R3XA 2MZCA 2JSZA 1VF1A 5H5RA 3ZRDA 5DAKB 2DC5A 3GX0A 4KUNA 3DIEA 3KIJA 3HD5A 3KZQA 3UVHA 1YY7A 5IPGA 5B8AA 4K7OA 3BCIA 4X4JA 2FWEA 4OFNA 2GSRA 3P8WA 3G7IA 4GWRA 2XBQA 1V57A 2KHPA 3NZNA 4F0CA 1TU8A 1DE2A 2NTOA 5D9WA 5JWOB 4YKGA 2O85A 3UAPA 4XHMA 2REMA 3C1RA 4BVXB 3DWVA 1S3CA 2B5EA 3C7MA 4ISDA 3UARA 2DKHA 3H4KA 2L5LA 4K7NA 4GTUA 4K7IA 3LSZA 1OC8A 4QL9A 2NVLA 3IPZA 1R26A 3H8QA 5IMDA 1A24A 4F9ZA 3HDCA 3IOSA 4YH2A 1V9WA 3IAS2 1EWXA 5KN2A 1BYEA 1OC3A 3F3QA 4GF0A 5ECRB 1TRVA 4POMA 4HUAA 1X9SB 3QCPA 3KM6A 1YJ6A 3EE2A 3HVVA 4PX1A 5EY6A 2IMFA 3CBUA 2OBKA 2IWTA 2DJ1A 1Z9HA 2YANA 3GYKA 4NMUA 2C1YA 5HFKA 3C73A 4KDUA 4G0IA 2V32A 2YZHA 4Z2RA 2DMMA 3GKMA 3KEBA 1TW9A 5IQYA 2E7PA 3E3EA 4YQVA 3TKSC 4MP4A 2J9HA 1FVKA 2OE1A 4MJBA 1YZXA 3L9SA 4EXJA 3HYPA 2GZZA 2PN8A 5J4UA 16GSA 4G9HA 4WF5A 5D9TA 2L5OA 1NHYA 4Z2UA 2CQ9A 4JBBA 5F0GA 1XW5A 3ZZXA 1O8WA 1Z3EA 1A8YA 5EL8A 4I6XA 3MDKA 1XOAA 3ZMLA 5JWRB 3APQA 4XRDA 5ECSA 3PGTA 3DEXA 4BA7A 1GSFA 3HJPA 1RK4A 4AF2A 4X1UA 1Z7RA 1GTIA 4K5RA 2K8VA 1K3OA 1GL8A 2F8FA 2K6VA 1YDKA 1HQOA 4JZQA 4ZL8A 5ABRA 5LNKe 3R2QA 5HFGA 1OE7A 3ZITA 2FUG2 2HFDA 5CRWA 3ZYWA 3IK9A 1GSEA 1VRSD 2VCZA 3NIVA 4GSNA 1WE0A 3A2WA 2X8HA 4G0KA 1M2AA 1FB0A 5A4WA 3ERWA 4N0ZA 3L4NA 2GZYA 3CRUA 3QDNA 4H86A 3BBYA 2K18A 1U88A 4EO3A 1GH2A 1SK0A 3TOUA 4JEDA 2B1LA 4EKZA 2JADA 4ULXA 5AN1A 3A5IA 2M72A 1G7OA 2ON7A 2BJXA 3KTBA 4O7HA 4K0NA 3I69A 5J9CA 1X9MB 4V2NA 2V41A 2VL2A 1UC7A 3PINA 3GN3A 2HLSA 1MDIA 4L8EA 3LG6A 1GNEA 2C0DA 3LYPA 5HR2A 2V6KA 1XVWA 3TJGA 1ZMAA 4WEYA 3AY8A 2PPTA 3VURA 1O8XA 3TJFA 4J2FA 2ALBA 1SKSB 3RAZA 2IL3A 4KDYA 1O7UA 4TXVA 1WMJA 4J57E 5IMVA 3FR6A 2CAIA 1V58A 1PX7A 1T00A 2CVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L5O A;  3VK9 A;  3NOF A;  4ML6 A;  3LFL A;  14GS A;  2EIQ A;  4IEL A;  5CRH A;  2N5B A;  2R2J A;  4XIH A;  5CAX A;  3KMO A;  1GSD A;  4FH8 A;  3I43 A;  4RI7 A;  3UVT A;  1O6J A;  2WDU A;  4ZBB A;  2YV9 A;  3RHB A;  1PD2 1;  4NAX A;  1A2L A;  4BWQ A;  1SK1 A;  2WUL A;  5IOW A;  3ME8 A;  2DLX A;  3CSH A;  3TKP A;  1SK2 A;  1HNB A;  1TOF A;  4XCS A;  3FW2 A;  4FYB A;  3GKX A;  2WZ9 A;  4HDE A;  1K3L A;  4Q5Q A;  2MMA A;  4MJE A;  2X64 A;  4J56 E;  3EYT A;  4F2I A;  4ZL9 A;  1XW9 A;  4NPB A;  1XXU A;  2PVQ A;  1H75 A;  3F0I A;  5KN1 A;  1X5E A;  4GXZ A;  4MZW A;  17GS A;  5DQS A;  1WRY A;  5CRE A;  1A2J A;  5B6M A;  1AQV A;  2RM6 A;  3CTG A;  1PRX A;  3A3T A;  3BD2 A;  3GL3 A;  5DAL A;  3CMI A;  1G7E A;  1DBY A;  2C3T A;  1NHO A;  3O3T A;  1TDI A;  2B5Y A;  8GSS A;  2LNT A;  2K9F A;  3HVS A;  1F2E A;  3BJ5 A;  3GKN A;  1F3B A;  5HR3 A;  4MK3 A;  1VF3 A;  4N0V A;  2I1U A;  1OKD A;  2HRF A;  1AQW A;  3HJO A;  2LRC A;  2PER A;  4HS1 A;  1O73 A;  2XC2 A;  3WGX A;  1XWC A;  2HZF A;  1PQN A;  3ZIJ A;  2B5X A;  2GQM A;  4MJA A;  4AGS A;  5J9B A;  3LGC A;  2H71 A;  1B4Q A;  3RDW A;  4KGI A;  2H1D A;  5ELG A;  5DJL A;  4I5Q A;  5EVO A;  2G2Q A;  1UVZ A;  4WR5 A;  2A2S A;  1F3A A;  2X8C A;  4KCA A;  5J41 A;  2HRN A;  2ZUP A;  4OFT A;  2FWG A;  4LLR A;  3WGE A;  1GSS A;  4HU7 A;  4KDX A;  2PBJ A;  1GTU A;  1YEP A;  5CP1 A;  4ECJ A;  20GS A;  1E6B A;  1JZO A;  2YZU A;  3ZVJ D;  1K0O A;  4DVC A;  1B4P A;  4PXO A;  3CSI A;  1GWC A;  2PUK C;  1SKR B;  2GT5 A;  5EPF A;  4NV5 A;  1XCC A;  1ERT A;  3LOR A;  1KNG A;  4IVF A;  5J3R A;  4HZ2 A;  2KP2 A;  4G2E A;  2C0E A;  1M2B A;  1A0R P;  3QAW A;  2R37 A;  2DJ0 A;  3FZ9 A;  1ST9 A;  5G1L A;  2YWM A;  2I3Y A;  4WXT A;  2HE3 A;  5D8I A;  3TRX A;  2GQK A;  2FCH A;  3ZVJ A;  3M9K A;  3QAG A;  1ON4 A;  2AV4 A;  1MDJ A;  2MMZ A;  4MZB A;  2B1K A;  2H0H A;  1A23 A;  1SU9 A;  2CVK A;  4ZBD A;  22GS A;  4EL1 A;  3ED3 A;  1ZYE A;  3L9V A;  3US3 A;  3M1G A;  3GL5 A;  3A2X A;  1I9D A;  4EF0 A;  1QMV A;  3WGD A;  5DAL B;  3GHA A;  5H5S A;  3M9J A;  3DD3 A;  3CRT A;  3WYW A;  3HZ4 A;  2H74 A;  2VL3 A;  1B48 A;  3CSJ A;  3GSS A;  3KXO A;  1GTA A;  3D21 A;  1MD4 A;  3WT2 A;  4HJM A;  3IHQ A;  1N2A A;  5ECI B;  1NW2 A;  5HR1 A;  2H6X A;  5ECO B;  1TJD A;  2FLS A;  3ERG A;  2LRT A;  2V6O A;  2B7J A;  1MEK A;  1OAZ A;  2L4C A;  1RW1 A;  2L6D A;  12GS A;  1EV9 A;  1KBN A;  3KGK A;  1YKC A;  3LXZ A;  2LRN A;  3W8S A;  3CYN A;  3VFI A;  4ZIJ A;  4O92 A;  1GTB A;  1T1V A;  2K8S A;  1YQ1 A;  5IMA A;  2O8V B;  1SD8 A;  3D5J A;  3GV1 A;  2I4A A;  10GS A;  3I6A A;  1Y6E A;  2FY6 A;  5A4U A;  3DVX A;  1TI1 A;  3BOA A;  4PUA A;  1EEJ A;  5CNW A;  2MBS A;  4JR4 A;  4ZBA A;  2DJ2 A;  1GSY A;  3FYG A;  4KCE A;  3EMX A;  4WBJ A;  4E8E A;  3IRA A;  5B7C A;  1XWB A;  2GS3 A;  18GS A;  2R6K A;  3L78 A;  1URM A;  4WF4 A;  3VI7 A;  1BED A;  3ZFB A;  4QQ7 A;  1XFL A;  4NXI A;  4TVE A;  1NSW A;  1Z7P A;  2OAD A;  2IFQ A;  1X9W B;  1EEM A;  1R5P A;  3W8J A;  1I5G A;  3UOM A;  3MSZ A;  1JHB A;  3FR3 A;  1FW1 A;  1F37 A;  2H72 A;  3EVI A;  3K8N A;  3DGQ A;  3J7Y k;  1Q4J A;  3Q18 A;  4LMV A;  3ISO A;  13GS A;  2WJU A;  4MH3 A;  5B8B A;  2GSS A;  3LYK A;  4K9Z A;  1N8J A;  1ML6 A;  4K0G A;  5FHI A;  2ES7 A;  1YKA A;  3M3M A;  4EC0 A;  4WKW A;  1O81 A;  1PN9 A;  2IIY A;  2YNX A;  4OO4 A;  3TCO A;  4IW9 A;  2DBC A;  2DIZ A;  3OR5 A;  3S9F A;  2I9H A;  2QKE A;  1WWJ A;  3L0H A;  4L0W A;  3WT1 A;  1IYI A;  4EDZ A;  4IS0 A;  2V2G A;  4L5L A;  1HYU A;  2FGX A;  2GTU A;  1UN2 A;  2CZ3 A;  2QSI A;  5D96 A;  1LJR A;  4DSQ A;  2E0Q A;  2YN1 A;  1S3A A;  3ERF A;  2R5G A;  1ILO A;  5GSS A;  4TOP A;  3ZRE A;  2LNS A;  1NM3 A;  1GUM A;  5LD0 A;  1AXD A;  1T4Y A;  1SL0 B;  1R7H A;  4TW5 A;  2VLV A;  4E8H A;  2IMD A;  5CRD A;  3V1W A;  2KP1 A;  5DCH A;  1AC1 A;  2HT9 A;  1M9B A;  1OKT A;  2LV3 A;  3G7Y A;  4IQA A;  1WPI A;  2FHE A;  3VLN A;  2VO4 A;  4JE1 A;  2CA8 A;  2V1M A;  1SL2 B;  4EE0 A;  1USB A;  1XIY A;  3IXR A;  4FO5 A;  2VD0 A;  5G5F A;  2IME A;  4XS4 A;  1HD2 A;  3TKQ A;  3UIW A;  2XHF A;  3MNG A;  2JL4 A;  4PQI A;  2BTO T;  4TN8 A;  3ZTL A;  2C8U A;  2L6C A;  3L9U A;  5IMF A;  5GZZ B;  2I81 A;  3UMA A;  5HQP A;  3HZ8 A;  1J9B A;  1G0T A;  3HA9 A;  4TKY A;  1X5D A;  2O89 A;  2H1B A;  3N9J A;  5IOX A;  1Z5Y E;  1PSQ A;  4NWY A;  1KEB A;  2M80 A;  4NV2 A;  2FD3 A;  4ECC A;  1BAY A;  4BWS A;  2IJY A;  2IFQ B;  3KP9 A;  4HEA 2;  1SL1 B;  4CDO A;  2H8L A;  3A5W A;  1LBK A;  1M0U A;  1EP7 A;  4IKH A;  4MPG A;  2H1G A;  3GFK A;  1DE1 A;  4MF7 A;  1OE8 A;  1THX A;  3P2A A;  4AJ7 A;  1SJZ A;  2NBS A;  2GT6 A;  5B6N A;  4TR3 A;  5G5E A;  4I8B A;  4JR6 A;  1MDK A;  3RPP A;  3Q19 A;  3APO A;  2PU9 C;  3F4R A;  2X8G A;  3VWU A;  3UEM A;  6GSV A;  5G1K A;  1PKZ A;  1JZW A;  2HYX A;  4IGJ A;  2GGT A;  3H79 A;  3KTL A;  4LL4 B;  5JWQ B;  5F06 A;  1QXH A;  4F0B A;  5KN0 A;  3BCK A;  3WD6 A;  2HXK A;  4JU5 A;  5D9X A;  1QUW A;  3I9V 2;  1M99 A;  3GH9 A;  4WBR D;  5GAP D;  1X0R A;  2J23 A;  4XRA A;  4N10 A;  4YAP A;  3PR8 A;  1C72 A;  4WET A;  3TJB A;  3EU3 A;  2ON5 A;  2OAC A;  4ECB A;  1LU4 A;  1V2A A;  1E2Y A;  2LJK A;  2P31 A;  2HSY A;  1YF1 A;  2F3M A;  5G30 A;  2YCD A;  3SWL A;  2VLU A;  4ML1 A;  1VGL A;  2CV4 A;  4IJI A;  2IPA A;  4KA0 A;  2XPE A;  1V98 A;  3QR6 A;  4XS4 B;  2GST A;  5IPH A;  1SJI A;  5H5Q A;  4K6X A;  1FVJ A;  1Q98 A;  4ZB8 A;  2C3N A;  1QGV A;  2YWI A;  4TR1 A;  1EV4 A;  3FRC A;  3FY7 A;  2DJK A;  2LUS A;  3GKK A;  4G19 A;  3IE3 A;  3LWA A;  2ZNM A;  5GAN D;  4OO5 A;  3DKS A;  3F8U A;  3SBC A;  2DML A;  2JZR A;  4PUF C;  5ECH B;  1ZZY A;  3KMN A;  1TK0 B;  5CYY A;  2XBI A;  6GSS A;  1SYX A;  3GX8 A;  3D0Z A;  5JCW A;  1AW9 A;  1ZL9 A;  1S3D A;  5ECP B;  1M7T A;  2F51 A;  3C71 A;  3IA1 A;  3H93 A;  4PGT A;  4TR0 A;  4HQZ A;  1T4Z A;  3P7X A;  5F07 A;  2YJH A;  2EIO A;  3GST A;  3E9J B;  4ZB9 A;  3IR4 A;  5ECK B;  2H19 A;  2R4V A;  5ID2 A;  2PGT A;  4MH2 A;  1A2M A;  1HNA A;  2JSY A;  2QGV A;  1FAA A;  4ILF A;  3ZMK A;  3ME7 A;  1XWG A;  3DML A;  2H66 A;  3F4S A;  5AGY A;  4V1A p;  1BX9 A;  4GST A;  4K8M A;  2Z9S A;  4DSS A;  3F6F A;  5ECN B;  3GNJ A;  3GRX A;  3TKS A;  4TXO A;  2B3S A;  2VL2 C;  1SJ6 A;  2CZ2 A;  2CX4 A;  3U5R E;  3GUR A;  4P3Y B;  3EWL A;  5DBQ A;  3KCM A;  4Q5R A;  2RLI A;  1OYJ A;  4KX4 A;  1FHE A;  2VAF A;  1R5A A;  2LST A;  1EOG A;  3GTU A;  1XOB A;  3G7J A;  4AJ8 A;  3ZIV A;  4N30 A;  4XTS A;  4KE3 A;  2WCI A;  4HQS A;  2P0G A;  1JZR A;  2O87 A;  2H1A A;  2N5A A;  1OC9 A;  1XBS A;  3FR9 A;  3QMX A;  4D73 A;  2RM5 A;  1K0A A;  3EMP A;  2B6M A;  3QFB C;  2MMO A;  2VUP A;  4GQF A;  2G0F A;  3KP8 A;  3TB2 A;  4ZL7 A;  2X99 A;  4TR1 B;  1B8X A;  2YPM A;  4EVM A;  5COH A;  5FWG A;  1EGR A;  4MJC A;  6GSW A;  2N5F A;  1QFN A;  2H30 A;  2C80 A;  3FK8 A;  2H0G A;  2FA8 A;  5L71 A;  2HZE A;  4Z7X A;  3N5O A;  5AIX A;  2IMI A;  3C8E A;  5IMZ A;  3J7Y b;  4MF6 A;  3FZ4 A;  3FZ5 A;  3F9U A;  4IQ1 A;  5KN3 A;  2L59 A;  5A5K A;  1WOU A;  1TK8 B;  3GUS A;  4PQH A;  5J5N A;  2LKU A;  1R4W A;  4I2T A;  4Q5F A;  4TR4 A;  1ABA A;  2ZCT A;  5DVB A;  1PKW A;  3A2V A;  5C00 A;  2DJJ A;  2QC7 A;  4OCE A;  5F05 A;  5HFI A;  2RUE A;  4ECI A;  3IDV A;  3TKS E;  3QD9 A;  3VWV A;  4MAB A;  1U3I A;  5ID2 B;  1T3B A;  1H4O A;  3ZFL A;  2JAC A;  5ELA A;  4MDC A;  1GP1 A;  1EP8 A;  1EZK A;  2OE3 A;  11GS A;  4FYC A;  4KND A;  2LQQ A;  3QPM A;  2PVO C;  2LS5 A;  4ZXG A;  3UBK A;  4DSS B;  2O7K A;  3JCM L;  1Y25 A;  3U6V A;  2GQL A;  4IP1 A;  1AQX A;  4TXO B;  3F4T A;  2FWF A;  3H1N A;  1TI3 A;  2WB9 A;  6GST A;  1B9Y C;  1FOV A;  3TRQ A;  2OJL A;  5CO3 A;  19GS A;  1SYR A;  1YF0 A;  1ZOF A;  5GST A;  3GTU B;  2RII A;  2YP6 A;  5E4W A;  5A4V A;  1PMT A;  4MZC A;  3DXB A;  2OBI A;  3TRP A;  4G10 A;  1OC9 B;  4MA9 A;  3VPQ A;  4D73 B;  3FZA A;  3GA4 A;  2MMN A;  4GCI A;  1TTZ A;  5AIS A;  3DVW A;  4WR4 A;  2C0F A;  3UL3 A;  1THO A;  3IBH A;  5HR0 A;  1W4V A;  1TKD B;  2AUV A;  5IM9 A;  1J08 A;  5D73 A;  2EC4 A;  1F9M A;  1WP0 A;  3HVX A;  3LQ7 A;  2E2M A;  4ZIL A;  4O5R A;  3IK7 A;  1IYH A;  4CW9 A;  3TJK A;  4MLY A;  3HY2 A;  3RPN A;  1TK5 B;  3KD0 A;  6GSX A;  2HZE B;  3RHC A;  4NHW A;  1ZGN A;  1KTE A;  2C0G A;  3HKR A;  2TRX A;  4HJ2 A;  1BG5 A;  4FYU A;  1T8E B;  2VM2 A;  1GUK A;  4XS1 A;  2TIR A;  4YQU A;  3EU4 A;  1ZYQ B;  4OD7 A;  2VCT A;  2YWO A;  4YQM A;  5CRG A;  1V40 A;  1HNC A;  2TRC P;  4L0U A;  4GSS A;  1J0F A;  4PNF A;  4POL A;  4DEJ A;  4KH7 A;  1TRS A;  1VF2 A;  4RI6 A;  2VM1 A;  1XVQ A;  3Q74 A;  3DYR A;  4KSO A;  5FT3 A;  3LXT A;  2JZT A;  4I2U A;  5DQY A;  2XPD A;  1GLP A;  1ERW A;  4V2L A;  2E2G A;  4PUR A;  4KAE A;  3RBT A;  1XWK A;  3TDG A;  3D4M A;  5ECM B;  3IC4 A;  3GMF A;  1K0C A;  1ERV A;  5JCG A;  2H73 A;  4HOJ A;  4AJ6 A;  5ECQ B;  7GSS A;  2KLX A;  4KSM A;  2C3Q A;  2DJ3 A;  2C4J A;  2M46 A;  4ACS A;  4X43 A;  3VWX A;  3QAV A;  2VCQ A;  4CHS A;  4LMW A;  5DDL A;  5D93 A;  1Z6M A;  1QK8 A;  2B7K A;  3VI5 A;  3TGZ A;  1K0N A;  4POB A;  2GZP A;  6GSY A;  3GH6 A;  1TU7 A;  3M0F A;  1DUG A;  1A8L A;  1UA5 A;  2DIY A;  3IV4 A;  3F3R A;  4JRR A;  2LEG A;  4F03 A;  2FNO A;  1GSU A;  1JFU A;  2F9S A;  4RQX A;  2HSH A;  5AIV A;  3Q6O A;  1XPV A;  1WIK A;  9GSS A;  3GIX A;  2AB6 A;  2VL9 A;  1TP9 A;  1G6Y A;  2AJQ B;  2P5R A;  2YOI A;  4PQ1 A;  2KOK A;  3E0U A;  2JU5 A;  2FWH A;  3LEF A;  1K0B A;  4ZB6 A;  4BVY A;  3W6G A;  3TUE A;  1RQM A;  2HNL A;  2GDR A;  2OKA A;  1XWA A;  5G31 A;  1T7P B;  2CX3 A;  1U6T A;  1BJX A;  1GUH A;  2JZS A;  3CXG A;  4LL1 B;  2VCW A;  1PGT A;  2GVP A;  4IP6 A;  3UJ1 A;  4IN0 A;  1OVN A;  1JLV A;  3ZLP A;  3HJM A;  3M8N A;  1GLQ A;  1AIU A;  2GSQ A;  3P90 A;  5DCG A;  3MAK A;  4QL7 A;  1XZO A;  4TRX A;  2PWJ A;  1X5C A;  2H6Y A;  4OWY A;  2CVB A;  2OE0 A;  5E59 A;  3PH9 A;  4EUY A;  1GNW A;  1WJK A;  4K1F A;  1PX6 A;  2H75 A;  2VD1 A;  4RUV A;  1AUC A;  2AHE A;  3FEU A;  2H70 A;  2AAW A;  3D4T A;  3C1S A;  3KH9 A;  2WRT A;  3F6D A;  2A2R A;  1YEX A;  4X0X A;  4OMV A;  2H6Z A;  2H01 A;  4POK A;  1PL2 A;  2YV7 A;  5C04 A;  2VCV A;  3EC3 A;  2P5Q A;  2BMX A;  5F8B A;  1GSQ A;  2YJ7 A;  3FKF A;  4GRF A;  4OFM A;  2L4Q A;  2WFC A;  3F63 A;  1DSB A;  4BL7 A;  3HCZ A;  3ZL5 A;  3KJY A;  4O32 A;  3VWW A;  4F82 A;  1TRU A;  5DAK A;  1K0M A;  2H0I A;  4V2M A;  4NHZ A;  1CQH A;  1O85 A;  1GRX A;  3KH7 A;  2WS2 A;  2IMK A;  1CQG A;  5DJM A;  1TRW A;  4Q5N A;  4K2D A;  4IHU A;  3TKR A;  2YWN A;  2MYG A;  2VIM A;  2WGR A;  1W89 A;  4I97 A;  5IIZ A;  3TJJ A;  1G6W A;  3D22 A;  3VPT A;  1FG4 A;  5IO0 A;  3UBL A;  3EUR A;  2LJR A;  5ENU A;  2L57 A;  1GUL A;  4V1A g;  4HZ4 A;  1Z6N A;  3MWH A;  5ECL B;  3LJR A;  5KEJ A;  2AYT A;  2F8A A;  2NDO A;  1PL1 A;  4BVX A;  4HI7 A;  3TOT A;  1F6M C;  1TXX A;  2CT6 A;  4EDY A;  4RQR A;  4ID0 A;  5IO2 A;  3FHK A;  1BQ7 A;  1JLW A;  2H76 A;  2LQO A;  2GLR A;  5INY A;  2IN3 A;  1PA3 A;  2DSA A;  1A0F A;  2KUC A;  4KW6 A;  5G2Z A;  2LJA A;  4OCF A;  3DRN A;  4FIW A;  2EIR A;  4XS6 A;  1B9X C;  1VF4 A;  2LTK A;  2FA4 A;  4KB3 A;  1U87 A;  3CTF A;  4IBP A;  4N11 A;  4GLT A;  5D9V A;  2D2Z A;  1K3Y A;  2VOC A;  1AAZ A;  1MD3 A;  1M2D A;  1ACV A;  2A4V A;  1EOH A;  1ZCP A;  1FB6 A;  4IJ3 A;  4BPY A;  1FO5 A;  5LCZ A;  4HU9 A;  3O6T A;  4DSR A;  5IMC A;  3D6I A;  3O76 A;  2HI7 A;  3IAM 2;  5JCU A;  1K0D A;  3QFA C;  4MF5 A;  4GQC A;  2VLT A;  4MPF A;  1QQ2 A;  1XW6 A;  1SEN A;  2CAQ A;  1SD9 A;  2PMT A;  2MBT A;  1M9A A;  3APS A;  4YAV A;  4MCU A;  1SKW B;  2NPB A;  1ERU A;  3EIN A;  3QOU A;  2VCX A;  4LA1 A;  4PNG A;  1JZD A;  6GSU A;  1EGO A;  1U3A A;  3G9B A;  4MMM A;  3HHV A;  2RUF A;  3HXS A;  1MTC A;  2OA7 A;  2R3X A;  2MZC A;  2JSZ A;  1VF1 A;  5H5R A;  3ZRD A;  5DAK B;  2DC5 A;  3GX0 A;  4KUN A;  3DIE A;  3KIJ A;  3HD5 A;  3KZQ A;  3UVH A;  1YY7 A;  5IPG A;  5B8A A;  4K7O A;  3BCI A;  2FWE A;  4OFN A;  2GSR A;  3P8W A;  3G7I A;  4GWR A;  2XBQ A;  1V57 A;  2KHP A;  3NZN A;  4F0C A;  1TU8 A;  1DE2 A;  2NTO A;  5D9W A;  5JWO B;  2O85 A;  3UAP A;  4XHM A;  2REM A;  3C1R A;  3DWV A;  1S3C A;  2B5E A;  3C7M A;  4ISD A;  3UAR A;  3H4K A;  2L5L A;  4K7N A;  4GTU A;  4K7I A;  3LSZ A;  1OC8 A;  4QL9 A;  2NVL A;  3IPZ A;  1R26 A;  3H8Q A;  5IMD A;  1A24 A;  4F9Z A;  3HDC A;  3IOS A;  4YH2 A;  1V9W A;  3IAS 2;  1EWX A;  5KN2 A;  1BYE A;  1OC3 A;  3F3Q A;  4GF0 A;  5ECR B;  1TRV A;  4POM A;  4HUA A;  1X9S B;  3QCP A;  3KM6 A;  1YJ6 A;  3EE2 A;  3HVV A;  4PX1 A;  5EY6 A;  2IMF A;  3CBU A;  2OBK A;  2IWT A;  2DJ1 A;  1Z9H A;  2YAN A;  3GYK A;  4NMU A;  2C1Y A;  5HFK A;  3C73 A;  4KDU A;  2V32 A;  2YZH A;  2DMM A;  3GKM A;  3KEB A;  1TW9 A;  5IQY A;  2E7P A;  3E3E A;  4YQV A;  3TKS C;  4MP4 A;  2J9H A;  1FVK A;  2OE1 A;  4MJB A;  1YZX A;  3L9S A;  4EXJ A;  3HYP A;  2GZZ A;  2PN8 A;  5J4U A;  16GS A;  4G9H A;  4WF5 A;  5D9T A;  2L5O A;  1NHY A;  2CQ9 A;  4JBB A;  5F0G A;  1XW5 A;  3ZZX A;  1O8W A;  1Z3E A;  1A8Y A;  5EL8 A;  4I6X A;  3MDK A;  1XOA A;  3ZML A;  5JWR B;  3APQ A;  5ECS A;  4XRD A;  3PGT A;  3DEX A;  4BA7 A;  1GSF A;  3HJP A;  1RK4 A;  4AF2 A;  1Z7R A;  4X1U A;  1GTI A;  2K8V A;  1K3O A;  1GL8 A;  2F8F A;  2K6V A;  1YDK A;  1HQO A;  4JZQ A;  4ZL8 A;  5ABR A;  5LNK e;  3R2Q A;  5HFG A;  1OE7 A;  3ZIT A;  2FUG 2;  2HFD A;  5CRW A;  3ZYW A;  3IK9 A;  1GSE A;  1VRS D;  2VCZ A;  3NIV A;  4GSN A;  1WE0 A;  3A2W A;  2X8H A;  1M2A A;  1FB0 A;  5A4W A;  3ERW A;  4N0Z A;  3L4N A;  2GZY A;  3CRU A;  3QDN A;  4H86 A;  3BBY A;  2K18 A;  1U88 A;  4EO3 A;  1GH2 A;  1SK0 A;  3TOU A;  4JED A;  2B1L A;  4EKZ A;  2JAD A;  4ULX A;  5AN1 A;  2M72 A;  1G7O A;  2ON7 A;  2BJX A;  3KTB A;  4O7H A;  4K0N A;  3I69 A;  5J9C A;  1X9M B;  4V2N A;  2V41 A;  2VL2 A;  1UC7 A;  3PIN A;  3GN3 A;  2HLS A;  1MDI A;  4L8E A;  3LG6 A;  1GNE A;  2C0D A;  3LYP A;  5HR2 A;  2V6K A;  1XVW A;  3TJG A;  1ZMA A;  4WEY A;  3AY8 A;  2PPT A;  3VUR A;  1O8X A;  3TJF A;  4J2F A;  2ALB A;  1SKS B;  3RAZ A;  2IL3 A;  4KDY A;  1O7U A;  4TXV A;  1WMJ A;  4J57 E;  5IMV A;  3FR6 A;  2CAI A;  1V58 A;  1PX7 A;  1T00 A;  2CVD A; 
#chains in the Genus database with same CATH topology
 4L5O A;  3VK9 A;  3NOF A;  4ML6 A;  3LFL A;  4EIQ A;  14GS A;  2EIQ A;  4IEL A;  5CRH A;  2N5B A;  2R2J A;  4XIH A;  5CAX A;  3KMO A;  1GSD A;  4FH8 A;  3I43 A;  4RI7 A;  3UVT A;  1O6J A;  2WDU A;  4ZBB A;  2YV9 A;  5BMU A;  3RHB A;  1PD2 1;  4NAX A;  1A2L A;  4BWQ A;  1SK1 A;  2WUL A;  5IOW A;  3ME8 A;  2DLX A;  3CSH A;  3TKP A;  1SK2 A;  1HNB A;  1TOF A;  4XCS A;  3FW2 A;  4FYB A;  3GKX A;  2WZ9 A;  4HDE A;  1K3L A;  4Q5Q A;  2MMA A;  4MJE A;  4CY6 A;  2X64 A;  4J56 E;  3EYT A;  4F2I A;  4ZL9 A;  1XW9 A;  4NPB A;  1XXU A;  2PVQ A;  1H75 A;  3F0I A;  4FQU A;  5KN1 A;  1X5E A;  4GXZ A;  4MZW A;  17GS A;  5DQS A;  1WRY A;  5CRE A;  1A2J A;  5B6M A;  1AQV A;  2HSM A;  2RM6 A;  3CTG A;  1PRX A;  3A3T A;  3BD2 A;  3GL3 A;  5DAL A;  3CMI A;  1G7E A;  1DBY A;  2C3T A;  1NHO A;  3O3T A;  1TDI A;  2B5Y A;  8GSS A;  2LNT A;  2K9F A;  4K2X A;  3HVS A;  1F2E A;  3BJ5 A;  3GKN A;  1F3B A;  5HR3 A;  4MK3 A;  1VF3 A;  4N0V A;  2I1U A;  1OKD A;  2HRF A;  1AQW A;  3MIX A;  3HJO A;  2LRC A;  2PER A;  4HS1 A;  1O73 A;  2XC2 A;  3WGX A;  1XWC A;  2HZF A;  1PQN A;  3ZIJ A;  2B5X A;  2GQM A;  4MJA A;  4AGS A;  5J9B A;  3LGC A;  2H71 A;  1B4Q A;  3RDW A;  4KGI A;  2H1D A;  5ELG A;  5DJL A;  4I5Q A;  5EVO A;  2G2Q A;  2A4H A;  1UVZ A;  4WR5 A;  2A2S A;  1F3A A;  2X8C A;  4KCA A;  5J41 A;  2HRN A;  2ZUP A;  4Z2T A;  4OFT A;  2FWG A;  4LLR A;  3WGE A;  1GSS A;  4HU7 A;  4KDX A;  2PBJ A;  1GTU A;  1YEP A;  5CP1 A;  4ECJ A;  20GS A;  1E6B A;  1JZO A;  2YZU A;  3ZVJ D;  1K0O A;  4DVC A;  1B4P A;  4PXO A;  3CSI A;  1GWC A;  2PUK C;  1SKR B;  2GT5 A;  5EPF A;  4NV5 A;  1XCC A;  1ERT A;  3LOR A;  1KNG A;  4IVF A;  5J3R A;  4HZ2 A;  2KP2 A;  4G2E A;  2C0E A;  1M2B A;  1A0R P;  3QAW A;  2R37 A;  2DJ0 A;  3FZ9 A;  1ST9 A;  5G1L A;  2YWM A;  2I3Y A;  4WXT A;  2HE3 A;  5D8I A;  3TRX A;  2GQK A;  2FCH A;  3ZVJ A;  3M9K A;  3QAG A;  1ON4 A;  2AV4 A;  1MDJ A;  2MMZ A;  4MZB A;  2B1K A;  2HRA A;  2H0H A;  1A23 A;  1SU9 A;  2CVK A;  4ZBD A;  22GS A;  4K5S A;  4EL1 A;  3ED3 A;  1ZYE A;  3L9V A;  3US3 A;  3M1G A;  3GL5 A;  3A2X A;  1I9D A;  4EF0 A;  1QMV A;  3WGD A;  5DAL B;  3GHA A;  5H5S A;  3M9J A;  4ICY A;  3DD3 A;  3CRT A;  3WYW A;  3HZ4 A;  2H74 A;  2VL3 A;  1B48 A;  3CSJ A;  3GSS A;  3KXO A;  1GTA A;  3D21 A;  1MD4 A;  3WT2 A;  4HJM A;  3IHQ A;  1N2A A;  5ECI B;  1NW2 A;  5HR1 A;  2H6X A;  5ECO B;  1TJD A;  2FLS A;  3ERG A;  2LRT A;  2V6O A;  2B7J A;  1MEK A;  1OAZ A;  2L4C A;  1RW1 A;  2L6D A;  12GS A;  1EV9 A;  1KBN A;  3KGK A;  1YKC A;  3LXZ A;  2LRN A;  3W8S A;  3CYN A;  3VFI A;  4ZIJ A;  4O92 A;  1GTB A;  1T1V A;  2K8S A;  1YQ1 A;  5IMA A;  2O8V B;  1SD8 A;  3D5J A;  1M3I A;  3GV1 A;  2QA2 A;  2I4A A;  10GS A;  3I6A A;  1Y6E A;  2FY6 A;  5A4U A;  3DVX A;  1TI1 A;  3BOA A;  4PUA A;  1EEJ A;  5CNW A;  2MBS A;  4JR4 A;  4ZBA A;  2DJ2 A;  1GSY A;  3FYG A;  4KCE A;  3EMX A;  4WBJ A;  4E8E A;  3IRA A;  5B7C A;  1XWB A;  2GS3 A;  18GS A;  2R6K A;  3L78 A;  1URM A;  4WF4 A;  3VI7 A;  1BED A;  3ZFB A;  4QQ7 A;  1XFL A;  4NXI A;  4TVE A;  1NSW A;  1Z7P A;  2OAD A;  2IFQ A;  1X9W B;  1EEM A;  1R5P A;  3W8J A;  1I5G A;  3UOM A;  3MSZ A;  1JHB A;  3FR3 A;  1FW1 A;  1F37 A;  2H72 A;  3EVI A;  3K8N A;  3DGQ A;  3J7Y k;  1Q4J A;  3Q18 A;  4LMV A;  3ISO A;  13GS A;  2WJU A;  4MH3 A;  5B8B A;  2GSS A;  3LYK A;  4K9Z A;  1N8J A;  1ML6 A;  4K0G A;  5FHI A;  4MNN A;  2ES7 A;  1YKA A;  3M3M A;  4EC0 A;  4WKW A;  1O81 A;  1PN9 A;  2IIY A;  2YNX A;  4OO4 A;  5KOX A;  3TCO A;  4IW9 A;  2DBC A;  2DIZ A;  3OR5 A;  3S9F A;  2I9H A;  2QKE A;  1WWJ A;  3L0H A;  4L0W A;  3WT1 A;  1IYI A;  4EDZ A;  4IS0 A;  2V2G A;  4L5L A;  1HYU A;  2FGX A;  2GTU A;  1UN2 A;  2CZ3 A;  2QSI A;  5D96 A;  1LJR A;  4DSQ A;  2E0Q A;  2YN1 A;  1S3A A;  3ERF A;  2R5G A;  1ILO A;  5GSS A;  4TOP A;  3ZRE A;  2LNS A;  1NM3 A;  1GUM A;  5LD0 A;  1AXD A;  1T4Y A;  1SL0 B;  1R7H A;  4TW5 A;  2VLV A;  4E8H A;  2IMD A;  5CRD A;  3V1W A;  2KP1 A;  5DCH A;  1AC1 A;  2HT9 A;  1M9B A;  1OKT A;  2LV3 A;  3G7Y A;  4IQA A;  1WPI A;  2FHE A;  3VLN A;  2VO4 A;  4JE1 A;  2CA8 A;  2V1M A;  1SL2 B;  4EE0 A;  1USB A;  1XIY A;  3IXR A;  4FO5 A;  2VD0 A;  5G5F A;  4USS A;  2IME A;  4XS4 A;  1HD2 A;  3TKQ A;  3UIW A;  1FOH A;  2XHF A;  3MNG A;  2JL4 A;  4PQI A;  2BTO T;  4TN8 A;  3ZTL A;  2C8U A;  2L6C A;  3L9U A;  5IMF A;  5GZZ B;  2I81 A;  3UMA A;  5HQP A;  3HZ8 A;  1J9B A;  1G0T A;  3HA9 A;  4TKY A;  1X5D A;  2O89 A;  2H1B A;  3N9J A;  1PN0 A;  5IOX A;  1Z5Y E;  1PSQ A;  4NWY A;  1KEB A;  2M80 A;  4NV2 A;  2FD3 A;  4ECC A;  1BAY A;  4BWS A;  2IJY A;  2IFQ B;  3KP9 A;  4HEA 2;  5KOW A;  1SL1 B;  4CDO A;  2H8L A;  3A5W A;  1LBK A;  1M0U A;  1EP7 A;  4IKH A;  4MPG A;  2H1G A;  3GFK A;  1DE1 A;  4MF7 A;  1OE8 A;  1THX A;  3P2A A;  4AJ7 A;  1SJZ A;  2NBS A;  2GT6 A;  5B6N A;  4TR3 A;  2QA1 A;  5G5E A;  4I8B A;  4JR6 A;  1MDK A;  3RPP A;  3Q19 A;  3APO A;  2PU9 C;  3F4R A;  3MYD A;  2X8G A;  3VWU A;  3UEM A;  6GSV A;  5G1K A;  1PKZ A;  1JZW A;  2HYX A;  4IGJ A;  2GGT A;  3H79 A;  3KTL A;  4LL4 B;  5JWQ B;  5F06 A;  1QXH A;  4F0B A;  5KN0 A;  3BCK A;  3WD6 A;  2HXK A;  4JU5 A;  5D9X A;  1QUW A;  3I9V 2;  1M99 A;  3GH9 A;  4WBR D;  5GAP D;  1X0R A;  2J23 A;  4XRA A;  4N10 A;  4YAP A;  3PR8 A;  1C72 A;  4WET A;  3TJB A;  3EU3 A;  2ON5 A;  2OAC A;  4ECB A;  1LU4 A;  1V2A A;  1E2Y A;  4O5Q A;  2LJK A;  2P31 A;  2HSY A;  1YF1 A;  2F3M A;  5G30 A;  2YCD A;  3SWL A;  2VLU A;  4ML1 A;  1VGL A;  2CV4 A;  4IJI A;  2IPA A;  4KA0 A;  2XPE A;  1V98 A;  3QR6 A;  4XS4 B;  2GST A;  5IPH A;  1SJI A;  5H5Q A;  4K6X A;  1FVJ A;  1Q98 A;  4ZB8 A;  2C3N A;  1QGV A;  2YWI A;  4TR1 A;  1EV4 A;  3FRC A;  3FY7 A;  2DJK A;  2LUS A;  3GKK A;  4G19 A;  3IE3 A;  3LWA A;  2ZNM A;  5GAN D;  4OO5 A;  3DKS A;  3F8U A;  3SBC A;  2DML A;  2JZR A;  4PUF C;  1ZYN A;  5ECH B;  1ZZY A;  3KMN A;  1TK0 B;  5CYY A;  2XBI A;  6GSS A;  1SYX A;  3GX8 A;  3D0Z A;  5JCW A;  1AW9 A;  1ZL9 A;  1S3D A;  5ECP B;  1M7T A;  2F51 A;  3C71 A;  3IA1 A;  3CQF A;  3H93 A;  4PGT A;  4TR0 A;  4HQZ A;  1T4Z A;  3P7X A;  4G0L A;  5F07 A;  2YJH A;  2EIO A;  3GST A;  3E9J B;  4ZB9 A;  3IR4 A;  5ECK B;  3FMW A;  2H19 A;  2R4V A;  5ID2 A;  2PGT A;  4MH2 A;  3IHG A;  1A2M A;  1HNA A;  2JSY A;  2QGV A;  1FAA A;  4ILF A;  3ZMK A;  3ME7 A;  1XWG A;  3DML A;  2H66 A;  3F4S A;  5AGY A;  4V1A p;  1BX9 A;  4GST A;  4K8M A;  2Z9S A;  4CY8 A;  4DSS A;  4O5U A;  3F6F A;  5ECN B;  4BIK A;  3GNJ A;  3GRX A;  3TKS A;  4TXO A;  2B3S A;  2VL2 C;  1SJ6 A;  2CZ2 A;  2CX4 A;  3U5R E;  3GUR A;  4P3Y B;  3EWL A;  5DBQ A;  3KCM A;  4Q5R A;  2RLI A;  1OYJ A;  4KX4 A;  1FHE A;  2VAF A;  1R5A A;  2LST A;  1EOG A;  3GTU A;  1XOB A;  3G7J A;  4AJ8 A;  2DKI A;  3ZIV A;  4N30 A;  4XTS A;  4KE3 A;  2WCI A;  3IC8 A;  4HQS A;  2P0G A;  1JZR A;  2HRK A;  1M3J A;  2O87 A;  2H1A A;  2N5A A;  1OC9 A;  1XBS A;  3FR9 A;  3QMX A;  4D73 A;  2RM5 A;  1K0A A;  3EMP A;  2B6M A;  3QFB C;  2R0G A;  2MMO A;  2VUP A;  4GQF A;  2G0F A;  3KP8 A;  3TB2 A;  4ZL7 A;  2X99 A;  4TR1 B;  1B8X A;  2YPM A;  4EVM A;  5COH A;  5FWG A;  1EGR A;  4PTS A;  4MJC A;  6GSW A;  2N5F A;  1QFN A;  2H30 A;  2C80 A;  3FK8 A;  2H0G A;  2FA8 A;  5L71 A;  2HZE A;  4Z7X A;  3N5O A;  5AIX A;  2IMI A;  3C8E A;  5IMZ A;  3J7Y b;  4MF6 A;  3FZ4 A;  3FZ5 A;  3F9U A;  4IQ1 A;  5KN3 A;  2L59 A;  5A5K A;  1WOU A;  1TK8 B;  3GUS A;  4PQH A;  5J5N A;  2LKU A;  1R4W A;  4I2T A;  4Q5F A;  4TR4 A;  1ABA A;  2ZCT A;  5DVB A;  1PKW A;  3A2V A;  5C00 A;  2DJJ A;  2QC7 A;  4OCE A;  5F05 A;  5HFI A;  2RUE A;  4ECI A;  3IDV A;  3TKS E;  3QD9 A;  3VWV A;  4MAB A;  1U3I A;  5ID2 B;  3PPU A;  1T3B A;  1H4O A;  3ZFL A;  2JAC A;  5ELA A;  4MDC A;  1GP1 A;  1EP8 A;  1EZK A;  2OE3 A;  11GS A;  4FYC A;  4KND A;  2LQQ A;  3QPM A;  2PVO C;  2LS5 A;  4ZXG A;  3UBK A;  4DSS B;  2O7K A;  3JCM L;  4HSC X;  1Y25 A;  3U6V A;  2GQL A;  4IP1 A;  1AQX A;  4TXO B;  3F4T A;  2FWF A;  3H1N A;  1TI3 A;  2WB9 A;  6GST A;  1B9Y C;  1FOV A;  4EIP A;  3TRQ A;  2OJL A;  5CO3 A;  19GS A;  1SYR A;  1YF0 A;  1ZOF A;  5GST A;  3GTU B;  2RII A;  2YP6 A;  5E4W A;  5A4V A;  1PMT A;  4MZC A;  3DXB A;  2OBI A;  3TRP A;  4G10 A;  1OC9 B;  4MA9 A;  3VPQ A;  4D73 B;  3FZA A;  3GA4 A;  2MMN A;  4GCI A;  1TTZ A;  5AIS A;  5BRT A;  3DVW A;  4WR4 A;  2C0F A;  3UL3 A;  1THO A;  3IBH A;  5HR0 A;  1W4V A;  1TKD B;  2AUV A;  5IM9 A;  1J08 A;  5D73 A;  2EC4 A;  1F9M A;  1WP0 A;  3HVX A;  3LQ7 A;  2E2M A;  4ZIL A;  4O5R A;  3IK7 A;  1IYH A;  4CW9 A;  3TJK A;  4MLY A;  3HY2 A;  3RPN A;  1TK5 B;  3KD0 A;  6GSX A;  2HZE B;  3RHC A;  4NHW A;  1ZGN A;  1KTE A;  2C0G A;  3HKR A;  2TRX A;  4HJ2 A;  1BG5 A;  4FYU A;  1T8E B;  2VM2 A;  1GUK A;  4XS1 A;  2TIR A;  4YQU A;  3EU4 A;  1ZYQ B;  4OD7 A;  2VCT A;  2YWO A;  4YQM A;  5CRG A;  1V40 A;  1HNC A;  2TRC P;  4L0U A;  4GSS A;  1J0F A;  4PNF A;  4POL A;  4DEJ A;  4KH7 A;  1TRS A;  1VF2 A;  4RI6 A;  2VM1 A;  4A5P A;  2X49 A;  1XVQ A;  2R0C A;  3Q74 A;  3DYR A;  4KSO A;  5FT3 A;  3LXT A;  2JZT A;  4I2U A;  5DQY A;  2XPD A;  1GLP A;  1ERW A;  4V2L A;  2E2G A;  4PUR A;  4KAE A;  3RBT A;  1XWK A;  3TDG A;  3D4M A;  5ECM B;  3IC4 A;  3GMF A;  1K0C A;  3EPT A;  1ERV A;  5JCG A;  2H73 A;  4HOJ A;  4AJ6 A;  5ECQ B;  7GSS A;  2KLX A;  4KSM A;  2C3Q A;  2DJ3 A;  2C4J A;  2M46 A;  4ACS A;  4X43 A;  3VWX A;  3QAV A;  4YKF A;  2VCQ A;  4CHS A;  4KF9 A;  4LMW A;  2A2P A;  5DDL A;  5D93 A;  1Z6M A;  1QK8 A;  2B7K A;  3VI5 A;  3TGZ A;  1K0N A;  4POB A;  2GZP A;  6GSY A;  3GH6 A;  1TU7 A;  3M0F A;  1DUG A;  1A8L A;  1UA5 A;  2DIY A;  3IV4 A;  3F3R A;  4JRR A;  2LEG A;  4F03 A;  2R0P A;  2FNO A;  1GSU A;  1JFU A;  2F9S A;  4RQX A;  2HSH A;  5AIV A;  3Q6O A;  1XPV A;  1WIK A;  9GSS A;  3GIX A;  1ZYP A;  2AB6 A;  2VL9 A;  1TP9 A;  1G6Y A;  2AJQ B;  2P5R A;  2YOI A;  4PQ1 A;  2KOK A;  3E0U A;  2JU5 A;  2FWH A;  3LEF A;  1K0B A;  4ZB6 A;  4BVY A;  3W6G A;  3TUE A;  1RQM A;  2HNL A;  2GDR A;  2OKA A;  1XWA A;  5G31 A;  1T7P B;  2X4A A;  2CX3 A;  1U6T A;  1BJX A;  2UZ8 A;  1GUH A;  2JZS A;  3CXG A;  4LL1 B;  2VCW A;  1PGT A;  2GVP A;  4IP6 A;  3UJ1 A;  4IN0 A;  1OVN A;  1JLV A;  3ZLP A;  1PFO A;  3HJM A;  3M8N A;  1GLQ A;  1AIU A;  2GSQ A;  3P90 A;  5DCG A;  3MAK A;  4QL7 A;  1XZO A;  4TRX A;  2PWJ A;  1X5C A;  2H6Y A;  4OWY A;  2CVB A;  2OE0 A;  5E59 A;  3PH9 A;  4EUY A;  1GNW A;  1WJK A;  3LW9 A;  4K1F A;  1PX6 A;  2H75 A;  2VD1 A;  4RUV A;  1AUC A;  2AHE A;  3FEU A;  2H70 A;  2AAW A;  3D4T A;  3C1S A;  3KH9 A;  2WRT A;  3F6D A;  2A2R A;  1YEX A;  4X0X A;  4OMV A;  2H6Z A;  2H01 A;  4POK A;  1PL2 A;  2YV7 A;  5C04 A;  2VCV A;  3EC3 A;  2P5Q A;  2BMX A;  5F8B A;  1GSQ A;  2YJ7 A;  3FKF A;  4GRF A;  4OFM A;  2L4Q A;  2WFC A;  3F63 A;  1DSB A;  4BL7 A;  3HCZ A;  3ZL5 A;  3KJY A;  4O32 A;  3VWW A;  4F82 A;  1TRU A;  5DAK A;  1K0M A;  2H0I A;  4V2M A;  4NHZ A;  1CQH A;  1O85 A;  1GRX A;  3KH7 A;  2WS2 A;  2IMK A;  1CQG A;  5DJM A;  1TRW A;  4Q5N A;  4K2D A;  4IHU A;  3TKR A;  2YWN A;  2MYG A;  2VIM A;  2WGR A;  1W89 A;  4I97 A;  5IIZ A;  3TJJ A;  1G6W A;  3D22 A;  3VPT A;  1FG4 A;  5IO0 A;  3UBL A;  3EUR A;  2LJR A;  5ENU A;  2L57 A;  1GUL A;  4V1A g;  4HZ4 A;  1Z6N A;  3MWH A;  5ECL B;  3LJR A;  5KEJ A;  2AYT A;  2F8A A;  2NDO A;  1PL1 A;  4BVX A;  4HI7 A;  3TOT A;  1F6M C;  1TXX A;  2CT6 A;  4EDY A;  4RQR A;  4ID0 A;  5IO2 A;  3FHK A;  4BVY B;  1BQ7 A;  1JLW A;  2H76 A;  2LQO A;  2GLR A;  5INY A;  2IN3 A;  1PA3 A;  2DSA A;  1A0F A;  2KUC A;  4KW6 A;  5G2Z A;  2LJA A;  4OCF A;  3DRN A;  4FIW A;  2EIR A;  4XS6 A;  1B9X C;  1VF4 A;  2LTK A;  2FA4 A;  4KB3 A;  1U87 A;  3CTF A;  4IBP A;  4N11 A;  4GLT A;  5D9V A;  2D2Z A;  1K3Y A;  2VOC A;  1AAZ A;  1MD3 A;  1M2D A;  1ACV A;  2A4V A;  1EOH A;  1ZCP A;  1FB6 A;  4IJ3 A;  4BPY A;  1FO5 A;  5LCZ A;  4HU9 A;  3O6T A;  4DSR A;  5IMC A;  3D6I A;  3O76 A;  2HI7 A;  3IAM 2;  5JCU A;  1K0D A;  3QFA C;  4MF5 A;  4GQC A;  2VLT A;  4MPF A;  1QQ2 A;  1XW6 A;  1SEN A;  2CAQ A;  1SD9 A;  2PMT A;  2MBT A;  1M9A A;  3APS A;  4YAV A;  4MCU A;  1SKW B;  2NPB A;  1ERU A;  3EIN A;  3QOU A;  2VCX A;  4LA1 A;  4PNG A;  1JZD A;  6GSU A;  1EGO A;  1U3A A;  3R3E A;  3G9B A;  4MMM A;  3HHV A;  2RUF A;  3HXS A;  1MTC A;  4BL7 B;  2OA7 A;  2R3X A;  2MZC A;  2JSZ A;  1VF1 A;  5H5R A;  3ZRD A;  5DAK B;  2DC5 A;  3GX0 A;  4KUN A;  3DIE A;  3KIJ A;  3HD5 A;  3KZQ A;  3UVH A;  1YY7 A;  5IPG A;  5B8A A;  4K7O A;  3BCI A;  4X4J A;  2FWE A;  4OFN A;  2GSR A;  3P8W A;  3G7I A;  1S3R A;  4GWR A;  2XBQ A;  1V57 A;  2KHP A;  3NZN A;  4F0C A;  1TU8 A;  1DE2 A;  2NTO A;  5D9W A;  5JWO B;  4YKG A;  2O85 A;  3UAP A;  4XHM A;  2REM A;  3C1R A;  4BVX B;  3DWV A;  1S3C A;  2B5E A;  3C7M A;  4ISD A;  3UAR A;  2DKH A;  3H4K A;  2L5L A;  4K7N A;  4GTU A;  4K7I A;  3LSZ A;  1OC8 A;  4QL9 A;  2NVL A;  3IPZ A;  1R26 A;  3H8Q A;  5IMD A;  1A24 A;  4F9Z A;  3HDC A;  3IOS A;  4YH2 A;  1V9W A;  3IAS 2;  3HVN A;  1EWX A;  5KN2 A;  1BYE A;  1OC3 A;  3F3Q A;  4GF0 A;  5ECR B;  1TRV A;  4POM A;  4HUA A;  1X9S B;  3QCP A;  3KM6 A;  1YJ6 A;  3EE2 A;  3HVV A;  4PX1 A;  5EY6 A;  2IMF A;  3CBU A;  2OBK A;  2IWT A;  2DJ1 A;  1Z9H A;  2YAN A;  3GYK A;  4NMU A;  2C1Y A;  5HFK A;  3C73 A;  4KDU A;  4G0I A;  2V32 A;  2YZH A;  4Z2R A;  2DMM A;  3GKM A;  3KEB A;  1TW9 A;  5IQY A;  2E7P A;  3E3E A;  4YQV A;  3TKS C;  4MP4 A;  2J9H A;  1FVK A;  2OE1 A;  4MJB A;  1YZX A;  3L9S A;  4EXJ A;  3HYP A;  2GZZ A;  2PN8 A;  5J4U A;  16GS A;  4G9H A;  4WF5 A;  5D9T A;  2L5O A;  1NHY A;  4Z2U A;  2CQ9 A;  4JBB A;  5F0G A;  1XW5 A;  3ZZX A;  1O8W A;  1Z3E A;  1A8Y A;  5EL8 A;  4I6X A;  3MDK A;  1XOA A;  3ZML A;  5JWR B;  3APQ A;  4XRD A;  5ECS A;  3PGT A;  3DEX A;  4BA7 A;  1GSF A;  3HJP A;  1RK4 A;  4AF2 A;  4X1U A;  1Z7R A;  1GTI A;  4K5R A;  2K8V A;  1K3O A;  1GL8 A;  2F8F A;  2K6V A;  1YDK A;  1HQO A;  4JZQ A;  4ZL8 A;  5ABR A;  5LNK e;  3R2Q A;  5HFG A;  1OE7 A;  3ZIT A;  2FUG 2;  2HFD A;  5CRW A;  3ZYW A;  3IK9 A;  1GSE A;  1VRS D;  2VCZ A;  3NIV A;  4GSN A;  1WE0 A;  3A2W A;  2X8H A;  4G0K A;  1M2A A;  1FB0 A;  5A4W A;  3ERW A;  4N0Z A;  3L4N A;  2GZY A;  3CRU A;  3QDN A;  4H86 A;  3BBY A;  2K18 A;  1U88 A;  4EO3 A;  1GH2 A;  1SK0 A;  3TOU A;  4JED A;  2B1L A;  4EKZ A;  2JAD A;  4ULX A;  5AN1 A;  3A5I A;  2M72 A;  1G7O A;  2ON7 A;  2BJX A;  3KTB A;  4O7H A;  4K0N A;  3I69 A;  5J9C A;  1X9M B;  4V2N A;  2V41 A;  2VL2 A;  1UC7 A;  1XG8 A;  3PIN A;  3GN3 A;  2HLS A;  1MDI A;  4L8E A;  3LG6 A;  1GNE A;  2C0D A;  3LYP A;  5HR2 A;  2V6K A;  1XVW A;  3TJG A;  1ZMA A;  4WEY A;  3AY8 A;  2PPT A;  3VUR A;  1O8X A;  3TJF A;  4J2F A;  2ALB A;  1SKS B;  3RAZ A;  2IL3 A;  4KDY A;  1O7U A;  4TXV A;  1WMJ A;  4J57 E;  5IMV A;  3FR6 A;  2CAI A;  1V58 A;  1PX7 A;  1T00 A;  2CVD A; 
#chains in the Genus database with same CATH homology
 4L5O A;  3VK9 A;  3NOF A;  4ML6 A;  3LFL A;  4EIQ A;  14GS A;  2EIQ A;  4IEL A;  5CRH A;  2N5B A;  2R2J A;  4XIH A;  5CAX A;  3KMO A;  1GSD A;  4FH8 A;  3I43 A;  4RI7 A;  3UVT A;  1O6J A;  2WDU A;  4ZBB A;  2YV9 A;  5BMU A;  3RHB A;  1PD2 1;  4NAX A;  1A2L A;  4BWQ A;  1SK1 A;  2WUL A;  5IOW A;  3ME8 A;  2DLX A;  3CSH A;  3TKP A;  1SK2 A;  1HNB A;  1TOF A;  4XCS A;  3FW2 A;  4FYB A;  3GKX A;  2WZ9 A;  4HDE A;  1K3L A;  4Q5Q A;  2MMA A;  4MJE A;  4CY6 A;  2X64 A;  4J56 E;  3EYT A;  4F2I A;  4ZL9 A;  1XW9 A;  4NPB A;  1XXU A;  2PVQ A;  1H75 A;  3F0I A;  4FQU A;  5KN1 A;  1X5E A;  4GXZ A;  4MZW A;  17GS A;  5DQS A;  1WRY A;  5CRE A;  1A2J A;  5B6M A;  1AQV A;  2HSM A;  2RM6 A;  3CTG A;  1PRX A;  3A3T A;  3BD2 A;  3GL3 A;  5DAL A;  3CMI A;  1G7E A;  1DBY A;  2C3T A;  1NHO A;  3O3T A;  1TDI A;  2B5Y A;  8GSS A;  2LNT A;  2K9F A;  4K2X A;  3HVS A;  1F2E A;  3BJ5 A;  3GKN A;  1F3B A;  5HR3 A;  4MK3 A;  1VF3 A;  4N0V A;  2I1U A;  1OKD A;  2HRF A;  1AQW A;  3MIX A;  3HJO A;  2LRC A;  2PER A;  4HS1 A;  1O73 A;  2XC2 A;  3WGX A;  1XWC A;  2HZF A;  1PQN A;  3ZIJ A;  2B5X A;  2GQM A;  4MJA A;  4AGS A;  5J9B A;  3LGC A;  2H71 A;  1B4Q A;  3RDW A;  4KGI A;  2H1D A;  5ELG A;  5DJL A;  4I5Q A;  5EVO A;  2G2Q A;  2A4H A;  1UVZ A;  4WR5 A;  2A2S A;  1F3A A;  2X8C A;  4KCA A;  5J41 A;  2HRN A;  2ZUP A;  4Z2T A;  4OFT A;  2FWG A;  4LLR A;  3WGE A;  1GSS A;  4HU7 A;  4KDX A;  2PBJ A;  1GTU A;  1YEP A;  5CP1 A;  4ECJ A;  20GS A;  1E6B A;  1JZO A;  2YZU A;  3ZVJ D;  1K0O A;  4DVC A;  1B4P A;  4PXO A;  3CSI A;  1GWC A;  2PUK C;  1SKR B;  2GT5 A;  5EPF A;  4NV5 A;  1XCC A;  1ERT A;  3LOR A;  1KNG A;  4IVF A;  5J3R A;  4HZ2 A;  2KP2 A;  4G2E A;  2C0E A;  1M2B A;  1A0R P;  3QAW A;  2R37 A;  2DJ0 A;  3FZ9 A;  1ST9 A;  5G1L A;  2YWM A;  2I3Y A;  4WXT A;  2HE3 A;  5D8I A;  3TRX A;  2GQK A;  2FCH A;  3ZVJ A;  3M9K A;  3QAG A;  1ON4 A;  2AV4 A;  1MDJ A;  2MMZ A;  4MZB A;  2B1K A;  2HRA A;  2H0H A;  1A23 A;  1SU9 A;  2CVK A;  4ZBD A;  22GS A;  4K5S A;  4EL1 A;  3ED3 A;  1ZYE A;  3L9V A;  3US3 A;  3M1G A;  3GL5 A;  3A2X A;  1I9D A;  4EF0 A;  1QMV A;  3WGD A;  5DAL B;  3GHA A;  5H5S A;  3M9J A;  4ICY A;  3DD3 A;  3CRT A;  3WYW A;  3HZ4 A;  2H74 A;  2VL3 A;  1B48 A;  3CSJ A;  3GSS A;  3KXO A;  1GTA A;  3D21 A;  1MD4 A;  3WT2 A;  4HJM A;  3IHQ A;  1N2A A;  5ECI B;  1NW2 A;  5HR1 A;  2H6X A;  5ECO B;  1TJD A;  2FLS A;  3ERG A;  2LRT A;  2V6O A;  2B7J A;  1MEK A;  1OAZ A;  2L4C A;  1RW1 A;  2L6D A;  12GS A;  1EV9 A;  1KBN A;  3KGK A;  1YKC A;  3LXZ A;  2LRN A;  3W8S A;  3CYN A;  3VFI A;  4ZIJ A;  4O92 A;  1GTB A;  1T1V A;  2K8S A;  1YQ1 A;  5IMA A;  2O8V B;  1SD8 A;  3D5J A;  3GV1 A;  2QA2 A;  2I4A A;  10GS A;  3I6A A;  1Y6E A;  2FY6 A;  5A4U A;  3DVX A;  1TI1 A;  3BOA A;  4PUA A;  1EEJ A;  5CNW A;  2MBS A;  4JR4 A;  4ZBA A;  2DJ2 A;  1GSY A;  3FYG A;  4KCE A;  3EMX A;  4WBJ A;  4E8E A;  3IRA A;  5B7C A;  1XWB A;  2GS3 A;  18GS A;  2R6K A;  3L78 A;  1URM A;  4WF4 A;  3VI7 A;  1BED A;  3ZFB A;  4QQ7 A;  1XFL A;  4NXI A;  4TVE A;  1NSW A;  1Z7P A;  2OAD A;  2IFQ A;  1X9W B;  1EEM A;  1R5P A;  3W8J A;  1I5G A;  3UOM A;  3MSZ A;  1JHB A;  3FR3 A;  1FW1 A;  1F37 A;  2H72 A;  3EVI A;  3K8N A;  3DGQ A;  3J7Y k;  1Q4J A;  3Q18 A;  4LMV A;  3ISO A;  13GS A;  2WJU A;  4MH3 A;  5B8B A;  2GSS A;  3LYK A;  4K9Z A;  1N8J A;  1ML6 A;  4K0G A;  5FHI A;  4MNN A;  2ES7 A;  1YKA A;  3M3M A;  4EC0 A;  4WKW A;  1O81 A;  1PN9 A;  2IIY A;  2YNX A;  4OO4 A;  5KOX A;  3TCO A;  4IW9 A;  2DBC A;  2DIZ A;  3OR5 A;  3S9F A;  2I9H A;  2QKE A;  1WWJ A;  3L0H A;  4L0W A;  3WT1 A;  1IYI A;  4EDZ A;  4IS0 A;  2V2G A;  4L5L A;  1HYU A;  2FGX A;  2GTU A;  1UN2 A;  2CZ3 A;  2QSI A;  5D96 A;  1LJR A;  4DSQ A;  2E0Q A;  2YN1 A;  1S3A A;  3ERF A;  2R5G A;  1ILO A;  5GSS A;  4TOP A;  3ZRE A;  2LNS A;  1NM3 A;  1GUM A;  5LD0 A;  1AXD A;  1T4Y A;  1SL0 B;  1R7H A;  4TW5 A;  2VLV A;  4E8H A;  2IMD A;  5CRD A;  3V1W A;  2KP1 A;  5DCH A;  1AC1 A;  2HT9 A;  1M9B A;  1OKT A;  2LV3 A;  3G7Y A;  4IQA A;  1WPI A;  2FHE A;  3VLN A;  2VO4 A;  4JE1 A;  2CA8 A;  2V1M A;  1SL2 B;  4EE0 A;  1USB A;  1XIY A;  3IXR A;  4FO5 A;  2VD0 A;  5G5F A;  4USS A;  2IME A;  4XS4 A;  1HD2 A;  3TKQ A;  3UIW A;  1FOH A;  2XHF A;  3MNG A;  2JL4 A;  4PQI A;  2BTO T;  4TN8 A;  3ZTL A;  2C8U A;  2L6C A;  3L9U A;  5IMF A;  5GZZ B;  2I81 A;  3UMA A;  5HQP A;  3HZ8 A;  1J9B A;  1G0T A;  3HA9 A;  4TKY A;  1X5D A;  2O89 A;  2H1B A;  3N9J A;  1PN0 A;  5IOX A;  1Z5Y E;  1PSQ A;  4NWY A;  1KEB A;  2M80 A;  4NV2 A;  2FD3 A;  4ECC A;  1BAY A;  4BWS A;  2IJY A;  2IFQ B;  3KP9 A;  4HEA 2;  5KOW A;  1SL1 B;  4CDO A;  2H8L A;  3A5W A;  1LBK A;  1M0U A;  1EP7 A;  4IKH A;  4MPG A;  2H1G A;  3GFK A;  1DE1 A;  4MF7 A;  1OE8 A;  1THX A;  3P2A A;  4AJ7 A;  1SJZ A;  2NBS A;  2GT6 A;  5B6N A;  4TR3 A;  2QA1 A;  5G5E A;  4I8B A;  4JR6 A;  1MDK A;  3RPP A;  3Q19 A;  3APO A;  2PU9 C;  3F4R A;  3MYD A;  2X8G A;  3VWU A;  3UEM A;  6GSV A;  5G1K A;  1PKZ A;  1JZW A;  2HYX A;  4IGJ A;  2GGT A;  3H79 A;  3KTL A;  4LL4 B;  5JWQ B;  5F06 A;  1QXH A;  4F0B A;  5KN0 A;  3BCK A;  3WD6 A;  2HXK A;  4JU5 A;  5D9X A;  1QUW A;  3I9V 2;  1M99 A;  3GH9 A;  4WBR D;  5GAP D;  1X0R A;  2J23 A;  4XRA A;  4N10 A;  4YAP A;  3PR8 A;  1C72 A;  4WET A;  3TJB A;  3EU3 A;  2ON5 A;  2OAC A;  4ECB A;  1LU4 A;  1V2A A;  1E2Y A;  4O5Q A;  2LJK A;  2P31 A;  2HSY A;  1YF1 A;  2F3M A;  5G30 A;  2YCD A;  3SWL A;  2VLU A;  4ML1 A;  1VGL A;  2CV4 A;  4IJI A;  2IPA A;  4KA0 A;  2XPE A;  1V98 A;  3QR6 A;  4XS4 B;  2GST A;  5IPH A;  1SJI A;  5H5Q A;  4K6X A;  1FVJ A;  1Q98 A;  4ZB8 A;  2C3N A;  1QGV A;  2YWI A;  4TR1 A;  1EV4 A;  3FRC A;  3FY7 A;  2DJK A;  2LUS A;  3GKK A;  4G19 A;  3IE3 A;  3LWA A;  2ZNM A;  5GAN D;  4OO5 A;  3DKS A;  3F8U A;  3SBC A;  2DML A;  2JZR A;  4PUF C;  1ZYN A;  5ECH B;  1ZZY A;  3KMN A;  1TK0 B;  5CYY A;  2XBI A;  6GSS A;  1SYX A;  3GX8 A;  3D0Z A;  5JCW A;  1AW9 A;  1ZL9 A;  1S3D A;  5ECP B;  1M7T A;  2F51 A;  3C71 A;  3IA1 A;  3H93 A;  4PGT A;  4TR0 A;  4HQZ A;  1T4Z A;  3P7X A;  4G0L A;  5F07 A;  2YJH A;  2EIO A;  3GST A;  3E9J B;  4ZB9 A;  3IR4 A;  5ECK B;  3FMW A;  2H19 A;  2R4V A;  5ID2 A;  2PGT A;  4MH2 A;  3IHG A;  1A2M A;  1HNA A;  2JSY A;  2QGV A;  1FAA A;  4ILF A;  3ZMK A;  3ME7 A;  1XWG A;  3DML A;  2H66 A;  3F4S A;  5AGY A;  4V1A p;  1BX9 A;  4GST A;  4K8M A;  2Z9S A;  4CY8 A;  4DSS A;  4O5U A;  3F6F A;  5ECN B;  3GNJ A;  3GRX A;  3TKS A;  4TXO A;  2B3S A;  2VL2 C;  1SJ6 A;  2CZ2 A;  2CX4 A;  3U5R E;  3GUR A;  4P3Y B;  3EWL A;  5DBQ A;  3KCM A;  4Q5R A;  2RLI A;  1OYJ A;  4KX4 A;  1FHE A;  2VAF A;  1R5A A;  2LST A;  1EOG A;  3GTU A;  1XOB A;  3G7J A;  4AJ8 A;  2DKI A;  3ZIV A;  4N30 A;  4XTS A;  4KE3 A;  2WCI A;  3IC8 A;  4HQS A;  2P0G A;  1JZR A;  2HRK A;  2O87 A;  2H1A A;  2N5A A;  1OC9 A;  1XBS A;  3FR9 A;  3QMX A;  4D73 A;  2RM5 A;  1K0A A;  3EMP A;  2B6M A;  3QFB C;  2R0G A;  2MMO A;  2VUP A;  4GQF A;  2G0F A;  3KP8 A;  3TB2 A;  4ZL7 A;  2X99 A;  4TR1 B;  1B8X A;  2YPM A;  4EVM A;  5COH A;  5FWG A;  1EGR A;  4PTS A;  4MJC A;  6GSW A;  2N5F A;  1QFN A;  2H30 A;  2C80 A;  3FK8 A;  2H0G A;  2FA8 A;  5L71 A;  2HZE A;  4Z7X A;  3N5O A;  5AIX A;  2IMI A;  3C8E A;  5IMZ A;  3J7Y b;  4MF6 A;  3FZ4 A;  3FZ5 A;  3F9U A;  4IQ1 A;  5KN3 A;  2L59 A;  5A5K A;  1WOU A;  1TK8 B;  3GUS A;  4PQH A;  5J5N A;  2LKU A;  1R4W A;  4I2T A;  4Q5F A;  4TR4 A;  1ABA A;  2ZCT A;  5DVB A;  1PKW A;  3A2V A;  5C00 A;  2DJJ A;  2QC7 A;  4OCE A;  5F05 A;  5HFI A;  2RUE A;  4ECI A;  3IDV A;  3TKS E;  3QD9 A;  3VWV A;  4MAB A;  1U3I A;  5ID2 B;  3PPU A;  1T3B A;  1H4O A;  3ZFL A;  2JAC A;  5ELA A;  4MDC A;  1GP1 A;  1EP8 A;  1EZK A;  2OE3 A;  11GS A;  4FYC A;  4KND A;  2LQQ A;  3QPM A;  2PVO C;  2LS5 A;  4ZXG A;  3UBK A;  4DSS B;  2O7K A;  3JCM L;  1Y25 A;  3U6V A;  2GQL A;  4IP1 A;  1AQX A;  4TXO B;  3F4T A;  2FWF A;  3H1N A;  1TI3 A;  2WB9 A;  6GST A;  1B9Y C;  1FOV A;  4EIP A;  3TRQ A;  2OJL A;  5CO3 A;  19GS A;  1SYR A;  1YF0 A;  1ZOF A;  5GST A;  3GTU B;  2RII A;  2YP6 A;  5E4W A;  5A4V A;  1PMT A;  4MZC A;  3DXB A;  2OBI A;  3TRP A;  4G10 A;  1OC9 B;  4MA9 A;  3VPQ A;  4D73 B;  3FZA A;  3GA4 A;  2MMN A;  4GCI A;  1TTZ A;  5AIS A;  5BRT A;  3DVW A;  4WR4 A;  2C0F A;  3UL3 A;  1THO A;  3IBH A;  5HR0 A;  1W4V A;  1TKD B;  2AUV A;  5IM9 A;  1J08 A;  5D73 A;  2EC4 A;  1F9M A;  1WP0 A;  3HVX A;  3LQ7 A;  2E2M A;  4ZIL A;  4O5R A;  3IK7 A;  1IYH A;  4CW9 A;  3TJK A;  4MLY A;  3HY2 A;  3RPN A;  1TK5 B;  3KD0 A;  6GSX A;  2HZE B;  3RHC A;  4NHW A;  1ZGN A;  1KTE A;  2C0G A;  3HKR A;  2TRX A;  4HJ2 A;  1BG5 A;  4FYU A;  1T8E B;  2VM2 A;  1GUK A;  4XS1 A;  2TIR A;  4YQU A;  3EU4 A;  1ZYQ B;  4OD7 A;  2VCT A;  2YWO A;  4YQM A;  5CRG A;  1V40 A;  1HNC A;  2TRC P;  4L0U A;  4GSS A;  1J0F A;  4PNF A;  4POL A;  4DEJ A;  4KH7 A;  1TRS A;  1VF2 A;  4RI6 A;  2VM1 A;  4A5P A;  2X49 A;  1XVQ A;  2R0C A;  3Q74 A;  3DYR A;  4KSO A;  5FT3 A;  3LXT A;  2JZT A;  4I2U A;  5DQY A;  2XPD A;  1GLP A;  1ERW A;  4V2L A;  2E2G A;  4PUR A;  4KAE A;  3RBT A;  1XWK A;  3TDG A;  3D4M A;  5ECM B;  3IC4 A;  3GMF A;  1K0C A;  3EPT A;  1ERV A;  5JCG A;  2H73 A;  4HOJ A;  4AJ6 A;  5ECQ B;  7GSS A;  2KLX A;  4KSM A;  2C3Q A;  2DJ3 A;  2C4J A;  2M46 A;  4ACS A;  4X43 A;  3VWX A;  3QAV A;  4YKF A;  2VCQ A;  4CHS A;  4KF9 A;  4LMW A;  2A2P A;  5DDL A;  5D93 A;  1Z6M A;  1QK8 A;  2B7K A;  3VI5 A;  3TGZ A;  1K0N A;  4POB A;  2GZP A;  6GSY A;  3GH6 A;  1TU7 A;  3M0F A;  1DUG A;  1A8L A;  1UA5 A;  2DIY A;  3IV4 A;  3F3R A;  4JRR A;  2LEG A;  4F03 A;  2R0P A;  2FNO A;  1GSU A;  1JFU A;  2F9S A;  4RQX A;  2HSH A;  5AIV A;  3Q6O A;  1XPV A;  1WIK A;  9GSS A;  3GIX A;  1ZYP A;  2AB6 A;  2VL9 A;  1TP9 A;  1G6Y A;  2AJQ B;  2P5R A;  2YOI A;  4PQ1 A;  2KOK A;  3E0U A;  2JU5 A;  2FWH A;  3LEF A;  1K0B A;  4ZB6 A;  4BVY A;  3W6G A;  3TUE A;  1RQM A;  2HNL A;  2GDR A;  2OKA A;  1XWA A;  5G31 A;  1T7P B;  2X4A A;  2CX3 A;  1U6T A;  1BJX A;  2UZ8 A;  1GUH A;  2JZS A;  3CXG A;  4LL1 B;  2VCW A;  1PGT A;  2GVP A;  4IP6 A;  3UJ1 A;  4IN0 A;  1OVN A;  1JLV A;  3ZLP A;  3HJM A;  3M8N A;  1GLQ A;  1AIU A;  2GSQ A;  3P90 A;  5DCG A;  3MAK A;  4QL7 A;  1XZO A;  4TRX A;  2PWJ A;  1X5C A;  2H6Y A;  4OWY A;  2CVB A;  2OE0 A;  5E59 A;  3PH9 A;  4EUY A;  1GNW A;  1WJK A;  3LW9 A;  4K1F A;  1PX6 A;  2H75 A;  2VD1 A;  4RUV A;  1AUC A;  2AHE A;  3FEU A;  2H70 A;  2AAW A;  3D4T A;  3C1S A;  3KH9 A;  2WRT A;  3F6D A;  2A2R A;  1YEX A;  4X0X A;  4OMV A;  2H6Z A;  2H01 A;  4POK A;  1PL2 A;  2YV7 A;  5C04 A;  2VCV A;  3EC3 A;  2P5Q A;  2BMX A;  5F8B A;  1GSQ A;  2YJ7 A;  3FKF A;  4GRF A;  4OFM A;  2L4Q A;  2WFC A;  3F63 A;  1DSB A;  4BL7 A;  3HCZ A;  3ZL5 A;  3KJY A;  4O32 A;  3VWW A;  4F82 A;  1TRU A;  5DAK A;  1K0M A;  2H0I A;  4V2M A;  4NHZ A;  1CQH A;  1O85 A;  1GRX A;  3KH7 A;  2WS2 A;  2IMK A;  1CQG A;  5DJM A;  1TRW A;  4Q5N A;  4K2D A;  4IHU A;  3TKR A;  2YWN A;  2MYG A;  2VIM A;  2WGR A;  1W89 A;  4I97 A;  5IIZ A;  3TJJ A;  1G6W A;  3D22 A;  3VPT A;  1FG4 A;  5IO0 A;  3UBL A;  3EUR A;  2LJR A;  5ENU A;  2L57 A;  1GUL A;  4V1A g;  4HZ4 A;  1Z6N A;  3MWH A;  5ECL B;  3LJR A;  5KEJ A;  2AYT A;  2F8A A;  2NDO A;  1PL1 A;  4BVX A;  4HI7 A;  3TOT A;  1F6M C;  1TXX A;  2CT6 A;  4EDY A;  4RQR A;  4ID0 A;  5IO2 A;  3FHK A;  4BVY B;  1BQ7 A;  1JLW A;  2H76 A;  2LQO A;  2GLR A;  5INY A;  2IN3 A;  1PA3 A;  2DSA A;  1A0F A;  2KUC A;  4KW6 A;  5G2Z A;  2LJA A;  4OCF A;  3DRN A;  4FIW A;  2EIR A;  4XS6 A;  1B9X C;  1VF4 A;  2LTK A;  2FA4 A;  4KB3 A;  1U87 A;  3CTF A;  4IBP A;  4N11 A;  4GLT A;  5D9V A;  2D2Z A;  1K3Y A;  2VOC A;  1AAZ A;  1MD3 A;  1M2D A;  1ACV A;  2A4V A;  1EOH A;  1ZCP A;  1FB6 A;  4IJ3 A;  4BPY A;  1FO5 A;  5LCZ A;  4HU9 A;  3O6T A;  4DSR A;  5IMC A;  3D6I A;  3O76 A;  2HI7 A;  3IAM 2;  5JCU A;  1K0D A;  3QFA C;  4MF5 A;  4GQC A;  2VLT A;  4MPF A;  1QQ2 A;  1XW6 A;  1SEN A;  2CAQ A;  1SD9 A;  2PMT A;  2MBT A;  1M9A A;  3APS A;  4YAV A;  4MCU A;  1SKW B;  2NPB A;  1ERU A;  3EIN A;  3QOU A;  2VCX A;  4LA1 A;  4PNG A;  1JZD A;  6GSU A;  1EGO A;  1U3A A;  3R3E A;  3G9B A;  4MMM A;  3HHV A;  2RUF A;  3HXS A;  1MTC A;  4BL7 B;  2OA7 A;  2R3X A;  2MZC A;  2JSZ A;  1VF1 A;  5H5R A;  3ZRD A;  5DAK B;  2DC5 A;  3GX0 A;  4KUN A;  3DIE A;  3KIJ A;  3HD5 A;  3KZQ A;  3UVH A;  1YY7 A;  5IPG A;  5B8A A;  4K7O A;  3BCI A;  4X4J A;  2FWE A;  4OFN A;  2GSR A;  3P8W A;  3G7I A;  4GWR A;  2XBQ A;  1V57 A;  2KHP A;  3NZN A;  4F0C A;  1TU8 A;  1DE2 A;  2NTO A;  5D9W A;  5JWO B;  4YKG A;  2O85 A;  3UAP A;  4XHM A;  2REM A;  3C1R A;  4BVX B;  3DWV A;  1S3C A;  2B5E A;  3C7M A;  4ISD A;  3UAR A;  2DKH A;  3H4K A;  2L5L A;  4K7N A;  4GTU A;  4K7I A;  3LSZ A;  1OC8 A;  4QL9 A;  2NVL A;  3IPZ A;  1R26 A;  3H8Q A;  5IMD A;  1A24 A;  4F9Z A;  3HDC A;  3IOS A;  4YH2 A;  1V9W A;  3IAS 2;  1EWX A;  5KN2 A;  1BYE A;  1OC3 A;  3F3Q A;  4GF0 A;  5ECR B;  1TRV A;  4POM A;  4HUA A;  1X9S B;  3QCP A;  3KM6 A;  1YJ6 A;  3EE2 A;  3HVV A;  4PX1 A;  5EY6 A;  2IMF A;  3CBU A;  2OBK A;  2IWT A;  2DJ1 A;  1Z9H A;  2YAN A;  3GYK A;  4NMU A;  2C1Y A;  5HFK A;  3C73 A;  4KDU A;  4G0I A;  2V32 A;  2YZH A;  4Z2R A;  2DMM A;  3GKM A;  3KEB A;  1TW9 A;  5IQY A;  2E7P A;  3E3E A;  4YQV A;  3TKS C;  4MP4 A;  2J9H A;  1FVK A;  2OE1 A;  4MJB A;  1YZX A;  3L9S A;  4EXJ A;  3HYP A;  2GZZ A;  2PN8 A;  5J4U A;  16GS A;  4G9H A;  4WF5 A;  5D9T A;  2L5O A;  1NHY A;  4Z2U A;  2CQ9 A;  4JBB A;  5F0G A;  1XW5 A;  3ZZX A;  1O8W A;  1Z3E A;  1A8Y A;  5EL8 A;  4I6X A;  3MDK A;  1XOA A;  3ZML A;  5JWR B;  3APQ A;  4XRD A;  5ECS A;  3PGT A;  3DEX A;  4BA7 A;  1GSF A;  3HJP A;  1RK4 A;  4AF2 A;  4X1U A;  1Z7R A;  1GTI A;  4K5R A;  2K8V A;  1K3O A;  1GL8 A;  2F8F A;  2K6V A;  1YDK A;  1HQO A;  4JZQ A;  4ZL8 A;  5ABR A;  5LNK e;  3R2Q A;  5HFG A;  1OE7 A;  3ZIT A;  2FUG 2;  2HFD A;  5CRW A;  3ZYW A;  3IK9 A;  1GSE A;  1VRS D;  2VCZ A;  3NIV A;  4GSN A;  1WE0 A;  3A2W A;  2X8H A;  4G0K A;  1M2A A;  1FB0 A;  5A4W A;  3ERW A;  4N0Z A;  3L4N A;  2GZY A;  3CRU A;  3QDN A;  4H86 A;  3BBY A;  2K18 A;  1U88 A;  4EO3 A;  1GH2 A;  1SK0 A;  3TOU A;  4JED A;  2B1L A;  4EKZ A;  2JAD A;  4ULX A;  5AN1 A;  3A5I A;  2M72 A;  1G7O A;  2ON7 A;  2BJX A;  3KTB A;  4O7H A;  4K0N A;  3I69 A;  5J9C A;  1X9M B;  4V2N A;  2V41 A;  2VL2 A;  1UC7 A;  3PIN A;  3GN3 A;  2HLS A;  1MDI A;  4L8E A;  3LG6 A;  1GNE A;  2C0D A;  3LYP A;  5HR2 A;  2V6K A;  1XVW A;  3TJG A;  1ZMA A;  4WEY A;  3AY8 A;  2PPT A;  3VUR A;  1O8X A;  3TJF A;  4J2F A;  2ALB A;  1SKS B;  3RAZ A;  2IL3 A;  4KDY A;  1O7U A;  4TXV A;  1WMJ A;  4J57 E;  5IMV A;  3FR6 A;  2CAI A;  1V58 A;  1PX7 A;  1T00 A;  2CVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...