2XPDA

Reduced thiol peroxidase (tpx) from yersinia pseudotuberculosis
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
166
structure length
166
Chain Sequence
TQTVHFQGNPVSVAGKLPQIGDKAKDFTLVAKDLSDVALSSFAGKRKVLNIFPSIDTGVCAASVRKFNQLAGELENTVVLCISSDLPFAQSRFCGAEGLSNVITLSTLRGADFKQAYGVAITEGPLAGLTARAVVVLDGQDNVIYSELVNEITTEPNYDAALAALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL PEROXIDASE
publication title Structural Characterisation of Tpx from Yersinia Pseudotuberculosis Reveals Insights Into the Binding of Salicylidene Acylhydrazide Compounds.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Oxidoreductase
total genus 56
structure length 166
sequence length 166
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2xpdA00
2PVQA 6GSSA 3H93A 3QD9A 1CQHA 3GNJA 2H0IA 1XZOA 1QK8A 3F4TA 4DSRA 4POMA 5J41A 2KP2A 2H71A 1WMJA 3GHAA 1MD4A 3KEBA 1EGOA 1HNBA 2H1DA 4IJ3A 1F3AA 1UA5A 3IXRA 2LEGA 3FK8A 2NDOA 3IAS2 3HA9A 2K8VA 4EUYA 3PR8A 1YEPA 2V1MA 2MMAA 3QFBC 3ZYWA 4F9ZA 2CVKA 1M2BA 4K8MA 5CRWA 3L4NA 1ABAA 3KP9A 3GN3A 1PRXA 2BTOT 1ON4A 2YWIA 3HZ8A 4GSTA 2RIIA 3IA1A 1QUWA 8GSSA 2YJ7A 3C71A 3ME8A 2FLSA 3FR6A 4EO3A 1A23A 3DRNA 2LRTA 1TI3A 1FVKA 3P7XA 6GSVA 5LD0A 5HR1A 1HNAA 4V1Ap 2DMMA 4TW5A 3WGDA 2WGRA 1JZRA 3MSZA 2I1UA 3WD6A 3R2QA 3C1RA 2CA8A 4GTUA 2PPTA 5D93A 3ZFBA 3D6IA 2GSSA 4IELA 3RBTA 5AIXA 3LYPA 3FZ9A 3LEFA 4HQZA 1FVJA 4TR1B 5G30A 2PGTA 16GSA 3O6TA 3IPZA 1PGTA 3H1NA 2YWOA 2I3YA 5B6MA 3A2WA 3V1WA 5IMFA 4KSOA 4LLRA 4ZBBA 2YWNA 4IGJA 3DEXA 3DYRA 4PNGA 1GSQA 5EVOA 5LNKe 3SWLA 4ECIA 4WR5A 1VGLA 3F0IA 5DDLA 4EE0A 17GSA 4ZIJA 1LBKA 5IM9A 1XBSA 1PA3A 1S3DA 1O73A 3ZRDA 2C3TA 4WKWA 2HSHA 1WOUA 3CSJA 4HI7A 5DALA 5FHIA 2VOCA 4LMWA 1U87A 2PN8A 5ABRA 2OKAA 1Z7PA 4P3YB 2Z9SA 3UARA 2V6KA 4GF0A 1PD21 3ERWA 1M9AA 2HT9A 3CTFA 2PERA 2GT6A 2AV4A 3NZNA 3KMOA 1QQ2A 5ECNB 2WDUA 2B6MA 5IMZA 3WT1A 3KZQA 1U88A 1OAZA 2GTUA 3GSTA 1HYUA 4PUAA 3Q74A 4TR0A 2OBIA 2X99A 4OCFA 4LL4B 1GTBA 3GKMA 2IL3A 2TIRA 4L8EA 20GSA 3TKSC 2O7KA 2LRCA 4DSSB 5HR2A 2J9HA 2KP1A 2B3SA 2JADA 2B1LA 3GYKA 3GH6A 1J9BA 3TDGA 3UMAA 4TR3A 1F2EA 2XHFA 3TJJA 2CX3A 4GXZA 4KX4A 1TDIA 2JZTA 2H1GA 2G0FA 4N30A 4F82A 5IMAA 5IQYA 1E2YA 5A4UA 1KNGA 2E0QA 4KCEA 1BJXA 1YY7A 1V2AA 1WPIA 1EOHA 1GL8A 2C3NA 2VCWA 2XC2A 2GSQA 1ERUA 1B9XC 5KN3A 3F6DA 1MEKA 1BYEA 1A24A 1N2AA 3CRUA 5GAND 1NM3A 1FAAA 2GQLA 5J3RA 2YV9A 1IYHA 4TXOA 2VCVA 3U5RE 3ISOA 1Z5YE 3UBKA 4F2IA 1AAZA 2I81A 22GSA 1O81A 2G2QA 5FWGA 3L78A 1EEMA 2OACA 4GLTA 1XCCA 1EWXA 1XOAA 3A3TA 4IW9A 2OJLA 4YAVA 2H8LA 3FW2A 3HY2A 5ECIB 4IP1A 5AGYA 5A4VA 1YQ1A 2B7JA 1RQMA 5D96A 2VD0A 3TKPA 2B5XA 2E2GA 5GSSA 4HZ2A 1ZCPA 4HUAA 4ML1A 3M0FA 4I2TA 1VF3A 1WWJA 2OBKA 2AJQB 2DIZA 2O87A 3BCKA 3KM6A 5EY6A 2X8CA 5GZZB 1FOVA 3GL3A 1TK5B 3ZVJA 3EMPA 3GX8A 5DCGA 5ECQB 1THOA 4K1FA 4TN8A 2FWGA 2DJJA 3PH9A 1Y6EA 3IC4A 4IBPA 2OE3A 2LJAA 2BJXA 19GSA 2HE3A 3FR3A 1F37A 1G6WA 1G0TA 1K3YA 1ZZYA 2VL3A 2F9SA 1XWKA 4OFTA 2VAFA 4OFNA 4OWYA 4ZILA 3F4SA 2P5QA 2K9FA 1Q4JA 4TR1A 2VCXA 3J7Yk 4EDYA 1AW9A 4I2UA 2RUEA 4HU9A 2VIMA 4KNDA 4RI7A 4WBJA 2YV7A 2YNXA 1GH2A 5HQPA 2H74A 1HQOA 4K7OA 3A2VA 4N0ZA 1K0OA 3VPQA 1AUCA 5KEJA 3EU3A 1V98A 4WF4A 4Q5FA 1A2MA 1ZYEA 3VURA 2H75A 3I6AA 4HS1A 2I9HA 3F6FA 1GNWA 1OKTA 1WE0A 3E9JB 1TRUA 2LTKA 1ILOA 4LL1B 4I8BA 4ULXA 4ZB8A 5ECOB 1M7TA 4NV5A 1TK0B 5HFGA 3HYPA 2IN3A 4ISDA 5D9WA 3GL5A 2P31A 1DBYA 2ALBA 4K2DA 2VM1A 4AJ7A 3PGTA 5E4WA 3UL3A 2GS3A 2LS5A 2N5FA 3W6GA 1I9DA 2PBJA 3HCZA 5D9XA 4XRDA 3Q18A 2H1AA 1JFUA 1MTCA 1PL1A 2R4VA 3KTBA 5D73A 2WS2A 6GSUA 2HSYA 2R5GA 3DKSA 1XPVA 3FKFA 2FGXA 4OD7A 4IQ1A 5ENUA 5GSTA 2RM6A 3EYTA 1S3AA 1K0AA 2IMDA 5IIZA 3HVSA 5AISA 5F0GA 3KD0A 2HRNA 1SKSB 4DSSA 1TXXA 3IOSA 5J5NA 3W8JA 1A0FA 4WXTA 1GLPA 3MAKA 12GSA 2ZUPA 4WR4A 1X5EA 5JWOB 3QPMA 3TGZA 1Z6NA 4HU7A 2WB9A 1JZDA 3VWVA 3VPTA 1X5CA 1XVQA 1GSEA 4ZL7A 1EOGA 3VI5A 3LXTA 1AIUA 1GUMA 2H0GA 3ED3A 4ZB9A 1THXA 1YEXA 3LJRA 1G7OA 2K8SA 1TK8B 2XBIA 3GKXA 3A2XA 1YDKA 4XCSA 2X64A 4GQCA 3KP8A 4KUNA 4YAPA 4MMMA 2KHPA 1A8LA 1W4VA 5AIVA 3N5OA 1ACVA 2DJKA 4RQRA 2B5EA 1EZKA 4NWYA 4XS4B 4OFMA 4KAEA 2A2SA 1ERTA 4GWRA 4V1Ag 3ZMLA 4JR4A 3ZMKA 1U3IA 4NHWA 4IP6A 4G2EA 2PUKC 1AQXA 1SU9A 1LJRA 2NPBA 4PGTA 1PN9A 3TRPA 1B9YC 4TVEA 3PINA 3TKQA 4D73B 1GSDA 3DWVA 4K0NA 4DEJA 3KH9A 2EC4A 2HRFA 5CAXA 3DGQA 3U6VA 1SYXA 3P90A 3EINA 5G31A 3VWWA 4PQ1A 1DUGA 1MDJA 1T7PB 3HD5A 1EV4A 2FY6A 4MJBA 1M2AA 5DJLA 2M46A 2HNLA 4NPBA 2WCIA 3CRTA 4ID0A 7GSSA 5KN0A 2DMLA 3HJOA 5ECHB 3TJBA 4EVMA 1DE1A 4NHZA 3DXBA 3EWLA 2YWMA 4N11A 1G6YA 3F63A 2IIYA 3QMXA 2I4AA 2DJ0A 2C1YA 5E59A 1UN2A 4MF5A 4YQUA 4LA1A 5A5KA 2LNSA 5L71A 3CTGA 2L5LA 1YJ6A 2E7PA 5B8AA 1FG4A 5F05A 4X43A 2AYTA 4FH8A 3LFLA 4KDXA 2ZNMA 1T3BA 1PX7A 3WYWA 1T8EB 3GH9A 3KGKA 2VL2A 2EIOA 1F6MC 3MWHA 1OC3A 1KTEA 5ECMB 2MZCA 2OADA 4XIHA 2JL4A 1K0BA 2L4QA 3KJYA 2L6CA 1A0RP 4CW9A 2N5BA 3IRAA 4ECBA 1SYRA 2IFQB 4YQVA 4MF7A 3TOUA 1T00A 3TUEA 2H76A 4F0BA 2GLRA 4V2LA 3MNGA 3Q19A 2VD1A 4MH3A 1M0UA 1YF1A 4KCAA 4XS1A 3ZITA 2MBTA 4X1UA 1BQ7A 4ZBAA 3C73A 5COHA 3UOMA 3VK9A 3VWUA 4PNFA 4JRRA 1TJDA 3L0HA 5ELAA 5KN1A 4YQMA 2JACA 2MMOA 4X0XA 3Q6OA 1YKAA 5G1LA 2H01A 4MZBA 5B7CA 2LRNA 4TKYA 5HR3A 2FA8A 3HJMA 2CVBA 3US3A 1WRYA 1M2DA 4AGSA 3D21A 2WJUA 4G9HA 3BD2A 2H6ZA 4TRXA 1QFNA 5JWRB 3DIEA 3IV4A 1OVNA 2YOIA 2V32A 2R3XA 3H8QA 1CQGA 4K7NA 1TOFA 4K9ZA 2B5YA 4K7IA 5ID2B 2GVPA 2X8HA 1R7HA 1XIYA 2AAWA 4I97A 1Z6MA 1XW9A 1I5GA 1V57A 1M9BA 1QXHA 3UAPA 5B6NA 1ZYQB 3AY8A 3P2AA 4GRFA 3UEMA 2NVLA 3KMNA 2R6KA 1K0MA 4O7HA 1EP8A 4N0VA 1E6BA 4J57E 4RUVA 11GSA 4I6XA 3GRXA 2GZZA 3QAGA 1TU8A 4DSQA 1ST9A 1BEDA 3E0UA 3TRQA 1SENA 1A2LA 1SKWB 5DAKB 2LV3A 2H70A 4E8HA 2NTOA 4L5OA 2R2JA 3WGEA 1NSWA 2C0DA 4MZCA 4HOJA 2GSRA 3EE2A 1B4QA 1PX6A 3FHKA 5IMCA 3ME7A 3GSSA 3F4RA 4HJ2A 2F3MA 5J9CA 4MK3A 4XS4A 2DSAA 1AQWA 5GAPD 5DVBA 4PX1A 1GTAA 2F8FA 3I43A 3DMLA 3F8UA 2O8VB 1A2JA 1SJZA 4MDCA 3CSIA 3GTUB 3HDCA 4POLA 4BVYA 2WFCA 3ZL5A 1NW2A 4E8EA 1GSFA 1JZWA 3J7Yb 3WT2A 1R5AA 1XWGA 1KEBA 1JLVA 2QC7A 1V9WA 4TXVA 4EF0A 2CVDA 4XTSA 1AXDA 2GSTA 3CSHA 2PMTA 4OMVA 3F3QA 3GUSA 3QOUA 2HYXA 1SK2A 4PQHA 2DIYA 2GQKA 1FHEA 2C0GA 4POKA 2FCHA 1FW1A 4PXOA 4O32A 2YZHA 4QL7A 4N10A 3D4TA 3ZTLA 2JZSA 3APSA 3IE3A 2YCDA 5CO3A 2ES7A 5ECSA 1F3BA 4JE1A 1SJIA 5HFKA 3H79A 1Z7RA 3G7JA 2TRXA 2H66A 1O6JA 1U3AA 1Z9HA 4ZB6A 2GZYA 4G19A 1H75A 2L6DA 2LNTA 1F9MA 2L57A 2PU9C 2NBSA 3A5WA 2H1BA 5C00A 3CYNA 1B8XA 2XPEA 1PKZA 1YZXA 2JU5A 5HFIA 4GQFA 3TJFA 4CDOA 2R37A 3WGXA 3P8WA 2X8GA 4F03A 3D22A 2IFQA 2KLXA 4CHSA 3EC3A 1TTZA 4MLYA 1SK1A 1R4WA 5IMDA 3L9VA 1VRSD 5INYA 3APOA 1ZOFA 1ML6A 3DVXA 1X9SB 5F06A 4ZXGA 2CZ3A 1URMA 1ERVA 3IK7A 2ON5A 4JR6A 4OCEA 2QKEA 4MH2A 1OKDA 1ZL9A 1K0NA 3LG6A 5B8BA 2DJ2A 3IK9A 5G2ZA 4NMUA 2VM2A 4MJCA 1N8JA 4V2MA 3W8SA 2GQMA 1PMTA 1X0RA 2VUPA 4XS6A 4ILFA 3GMFA 4IN0A 9GSSA 1YF0A 2H6XA 1M99A 5KN2A 5JCGA 1FB6A 3M9KA 2CV4A 1A8YA 4XRAA 13GSA 3C1SA 4TR4A 1C72A 2IPAA 2L4CA 5H5SA 4HQSA 1V58A 2VCTA 3CMIA 5IO0A 1GULA 1X9MB 4AJ6A 1B4PA 1K0CA 3GIXA 4JBBA 4HJMA 1PSQA 4WETA 3F9UA 1W89A 2KOKA 3GX0A 2CQ9A 5ID2A 1XWAA 4ML6A 2WZ9A 5IOXA 1XW6A 2YN1A 2LSTA 4ZL8A 1G7EA 2REMA 3KH7A 3QAWA 4QL9A 4BA7A 1WJKA 2PVOC 3E3EA 1GSSA 2RLIA 1T4ZA 3TKSA 5CP1A 4ACSA 1TRSA 2C4JA 1LU4A 4I5QA 1RK4A 3TKRA 5ECRB 1XFLA 4KB3A 1HD2A 2OE0A 2VCZA 5DAKA 4MZWA 2MMZA 1PKWA 2LUSA 3IAM2 2GGTA 2YPMA 2B1KA 5HR0A 5H5RA 1MDIA 2PWJA 2A2RA 2QGVA 1WP0A 6GSYA 1O8WA 4LMVA 3HVVA 2AUVA 3G9BA 3F3RA 3UVTA 4RQXA 1SL0B 1T1VA 2ZCTA 2XBQA 5C04A 4Q5NA 2FUG2 4QQ7A 2JSYA 3IDVA 3M8NA 1TKDB 3HJPA 2YP6A 2DJ3A 2CAIA 2C0FA 3GTUA 3VFIA 1SKRB 2H72A 1XW5A 1Z3EA 5CRHA 5CRDA 4GSNA 2V6OA 2CX4A 5EPFA 3HXSA 2CAQA 1K3LA 3FZ5A 4TOPA 4IJIA 1PQNA 1JHBA 6GSTA 1V40A 3HHVA 1EEJA 2MBSA 2YZUA 4FYCA 6GSWA 2LQOA 4JZQA 1EP7A 3QDNA 2LQQA 3EURA 1OE8A 4MJEA 2LJRA 3I9V2 4Q5QA 5DBQA 4G10A 3VI7A 2IJYA 3RDWA 3FEUA 3CBUA 2JSZA 2KUCA 3LQ7A 5CREA 2FWFA 3D0ZA 4KA0A 2CZ2A 2HZFA 4V2NA 4KH7A 1XWCA 2HZEB 1OC8A 3GKKA 1UC7A 1BX9A 1GLQA 2N5AA 2K18A 2MMNA 4MPFA 3NIVA 5J9BA 3TOTA 3VWXA 4IVFA 2O85A 3TJGA 2RUFA 3HVXA 1VF1A 3BCIA 3QAVA 1TI1A 2EIRA 1GSUA 4HEA2 3LWAA 4FIWA 3D5JA 1BG5A 2DC5A 4O5RA 4MCUA 5AN1A 5ECKB 1JLWA 2M72A 4ECJA 5JCUA 2K6VA 1USBA 2FD3A 2H30A 4Z7XA 2FA4A 3C8EA 1GUHA 4KW6A 3FZ4A 3ZZXA 2OE1A 4FYBA 2BMXA 2V2GA 2L59A 2C0EA 4YH2A 2M80A 3KCMA 2F51A 1R26A 4NXIA 6GSXA 5G5FA 1UVZA 1GSYA 2V41A 1OC9B 5H5QA 1JZOA 4KGIA 3HZ4A 3FZAA 3EU4A 5IPGA 4FO5A 2FNOA 3HKRA 1SD9A 3KTLA 1K3OA 4JU5A 1TU7A 4IQAA 4MF6A 4WF5A 4OO4A 2DLXA 5F07A 2YJHA 1DE2A 3TRXA 4KDUA 2DJ1A 3LGCA 1TW9A 1TP9A 5IO2A 5LCZA 5CRGA 1AQVA 3OR5A 4L0UA 5IMVA 1HNCA 3RPPA 4F0CA 3FRCA 3S9FA 2WULA 4MABA 1FO5A 1TRWA 5DJMA 1VF4A 1X5DA 3GURA 2VLUA 3L9UA 3IBHA 2HXKA 3C7MA 3LSZA 2GDRA 4WEYA 3QR6A 2P5RA 1GNEA 1VF2A 3RHBA 4J56E 2P0GA 2VL9A 5DQSA 1MDKA 1QMVA 1XWBA 1PL2A 2L5OA 3DVWA 5JWQB 5ECPB 3D4MA 3G7IA 1J08A 5D9VA 4O92A 4GCIA 2D2ZA 3RHCA 1YKCA 5J4UA 2VCQA 3KIJA 18GSA 2E2MA 3I69A 2LKUA 5CNWA 3O76A 4ZBDA 3NOFA 4JEDA 10GSA 2YANA 1Q98A 2IMIA 2AHEA 1XXUA 5FT3A 4KSMA 1SL1B 3BBYA 3GKNA 3EVIA 3BOAA 1XVWA 4IHUA 3IHQA 5G1KA 4PUFC 3RAZA 2IMFA 4D73A 4MA9A 3QFAC 3APQA 1K0DA 3L9SA 4WBRD 3IR4A 2CT6A 1OYJA 3N9JA 1SL2B 3GFKA 1EGRA 2VL2C 3QCPA 3EMXA 3M3MA 4L0WA 1GTIA 4GSSA 1MD3A 4NV2A 3ERGA 1GWCA 4IS0A 1T4YA 5EL8A 2J23A 2AB6A 2HFDA 4MJAA 1FB0A 2FHEA 3CXGA 1O7UA 4RI6A 3RPNA 2OA7A 4EKZA 3MDKA 2IMKA 1WIKA 4BPYA 1SD8A 2A4VA 5DCHA 2H73A 2QSIA 3KXOA 4OO5A 5D8IA 4EXJA 4EDZA 2VLTA 2VLVA 3UBLA 4AJ8A 4POBA 2HZEA 5ECLB 1DSBA 1ZGNA 4EC0A 3GV1A 2FWEA 1ERWA 1NHYA 3ZREA 4PURA 3K8NA 3VLNA 1H4OA 1TRVA 1GUKA 4NAXA 4HDEA 5DALB 4HZ4A 1O85A 3BJ5A 1R5PA 5G5EA 2TRCP 1SJ6A 3H4KA 1KBNA 1GTUA 1GP1A 2B7KA 1AC1A 1XOBA 2C80A 4BVXA 1Y25A 4J2FA 1OE7A 5IPHA 3ZVJD 4FYUA 4XHMA 4H86A 3G7YA 2MYGA 1B48A 2HI7A 4BWSA 3TKSE 3UIWA 2VO4A 2H0HA 2HLSA 4EL1A 2ON7A 4PQIA 2EIQA 5CYYA 5A4WA 3DD3A 5DQYA 3LYKA 4Q5RA 2FWHA 4K0GA 4BL7A 4ZL9A 4MP4A 4MPGA 4L5LA 1OC9A 4BWQA 1IYIA 3UJ1A 1EV9A 14GSA 2O89A 4IKHA 1RW1A 2H19A 1NHOA 4ECCA 2F8AA 3LXZA 5F8BA 4K6XA 3TB2A 3ZIVA 3UVHA 1U6TA 3FY7A 1ZMAA 3M9JA 1BAYA 2WRTA 3LORA 3M1GA 4AF2A 1O8XA 3SBCA 1X9WB 2RM5A 2DBCA 4KE3A 3GA4A 5ELGA 2LJKA 2C8UA 2C3QA 4KDYA 3JCML 3FYGA 1SK0A 5D9TA 3FR9A 2IWTA 1S3CA 2GT5A 5IOWA 2IMEA 1QGVA 2H6YA 3TCOA 4DVCA 2XPDA 5JCWA 1J0FA 2JZRA 3ERFA 2GZPA 4TXOB 3ZIJA 1GRXA 3ZFLA 3ZLPA 3O3TA 3TJKA
chains in the Genus database with same CATH superfamily
2PVQA 6GSSA 3H93A 1S3RA 3QD9A 1CQHA 3GNJA 2H0IA 1XZOA 1QK8A 3F4TA 4DSRA 4POMA 5J41A 2KP2A 2H71A 1WMJA 3GHAA 1MD4A 3KEBA 1EGOA 1HNBA 2H1DA 4IJ3A 1F3AA 1UA5A 3IXRA 2LEGA 3FK8A 2NDOA 3IAS2 3HA9A 2K8VA 4EUYA 3PR8A 1YEPA 2V1MA 2MMAA 3QFBC 3ZYWA 4F9ZA 2CVKA 1M2BA 4K8MA 5CRWA 3L4NA 1ABAA 3KP9A 3A5IA 3GN3A 2DKHA 1PRXA 2BTOT 1ON4A 2YWIA 3HZ8A 4GSTA 2RIIA 3IA1A 1QUWA 2QA2A 8GSSA 2YJ7A 3C71A 3ME8A 2FLSA 3FR6A 4EO3A 1A23A 3DRNA 2LRTA 1TI3A 1FVKA 3P7XA 6GSVA 5LD0A 5HR1A 1HNAA 4V1Ap 2DMMA 4TW5A 3WGDA 2WGRA 1JZRA 3MSZA 2I1UA 4YKGA 3WD6A 2A2PA 3R2QA 3C1RA 2CA8A 4GTUA 2PPTA 5D93A 3ZFBA 3D6IA 2GSSA 4IELA 3RBTA 5AIXA 3LYPA 3FZ9A 3LEFA 4HQZA 1FVJA 4TR1B 5G30A 2PGTA 16GSA 3O6TA 3IPZA 1PGTA 3H1NA 2YWOA 2I3YA 5B6MA 3A2WA 3V1WA 5IMFA 4KSOA 4LLRA 4ZBBA 2YWNA 4IGJA 3DEXA 3DYRA 4PNGA 1GSQA 5EVOA 5LNKe 3SWLA 4ECIA 4WR5A 1VGLA 3F0IA 5DDLA 4EE0A 17GSA 3FMWA 4ZIJA 1LBKA 5IM9A 1XBSA 1PA3A 1S3DA 1O73A 3ZRDA 2C3TA 4WKWA 2HSHA 1WOUA 3CSJA 4HI7A 5DALA 5FHIA 2VOCA 4LMWA 1U87A 2PN8A 5ABRA 2OKAA 1Z7PA 4P3YB 2Z9SA 3UARA 2V6KA 4GF0A 1PD21 3ERWA 1M9AA 2HT9A 3CTFA 2PERA 2GT6A 2AV4A 3NZNA 3KMOA 1QQ2A 5ECNB 2WDUA 2B6MA 5IMZA 3WT1A 3KZQA 1U88A 1OAZA 2GTUA 3GSTA 1HYUA 5BMUA 4PUAA 3Q74A 4TR0A 2OBIA 2X99A 4OCFA 4LL4B 1GTBA 3GKMA 2IL3A 2TIRA 4L8EA 20GSA 3TKSC 2O7KA 2LRCA 4DSSB 5HR2A 2J9HA 2KP1A 2B3SA 2JADA 2B1LA 3GYKA 3GH6A 1J9BA 3TDGA 3UMAA 4KF9A 4TR3A 1F2EA 2XHFA 3TJJA 2CX3A 4GXZA 4KX4A 4O5UA 1TDIA 2JZTA 2H1GA 2G0FA 4N30A 4F82A 5IMAA 5IQYA 1E2YA 5A4UA 1KNGA 2E0QA 4KCEA 1BJXA 1YY7A 1V2AA 1WPIA 1EOHA 1ZYNA 1GL8A 2C3NA 2VCWA 2XC2A 2GSQA 1ERUA 1B9XC 5KN3A 3F6DA 1MEKA 1BYEA 1A24A 1N2AA 3CRUA 5GAND 1NM3A 1FAAA 2GQLA 5J3RA 2YV9A 1IYHA 4TXOA 2VCVA 3U5RE 3ISOA 1Z5YE 3UBKA 4F2IA 1AAZA 2I81A 22GSA 1O81A 2G2QA 5FWGA 3L78A 1EEMA 4FQUA 2OACA 4GLTA 1XCCA 1EWXA 1XOAA 3A3TA 4IW9A 2OJLA 4YAVA 2H8LA 3FW2A 3HY2A 5ECIB 4IP1A 5AGYA 5A4VA 1YQ1A 2B7JA 1RQMA 5D96A 2VD0A 3TKPA 2B5XA 2E2GA 5GSSA 4HZ2A 1ZCPA 4HUAA 4ML1A 3M0FA 4I2TA 1VF3A 1WWJA 2OBKA 2AJQB 2DIZA 2O87A 3BCKA 3KM6A 5EY6A 2X8CA 5GZZB 1FOVA 3GL3A 1TK5B 3ZVJA 3EMPA 3GX8A 5DCGA 1THOA 4K1FA 4TN8A 5ECQB 2FWGA 2DJJA 3PH9A 1Y6EA 3IC4A 4IBPA 2OE3A 2LJAA 1M3IA 2BJXA 19GSA 2HE3A 3FR3A 1F37A 1G6WA 2R0GA 1G0TA 1K3YA 1ZZYA 2VL3A 2F9SA 1XWKA 4OFTA 2VAFA 4OFNA 4OWYA 4ZILA 3F4SA 2P5QA 2K9FA 1Q4JA 4TR1A 2VCXA 3J7Yk 4EDYA 1AW9A 4I2UA 2RUEA 4HU9A 2VIMA 4KNDA 4RI7A 4WBJA 2YV7A 2YNXA 4YKFA 1GH2A 5HQPA 2H74A 1HQOA 4K7OA 3A2VA 4N0ZA 1K0OA 3VPQA 1AUCA 5KEJA 3EU3A 1V98A 4WF4A 4Q5FA 1A2MA 1ZYEA 3VURA 2H75A 3I6AA 4HS1A 2I9HA 3F6FA 1GNWA 1OKTA 1WE0A 3E9JB 1TRUA 2LTKA 1ILOA 4LL1B 4I8BA 4ULXA 4ZB8A 5ECOB 1M7TA 4NV5A 1TK0B 5HFGA 3HYPA 2IN3A 4ISDA 5D9WA 3GL5A 2P31A 1DBYA 2ALBA 4K2DA 2VM1A 4AJ7A 3PGTA 5E4WA 3UL3A 2GS3A 2LS5A 2N5FA 3W6GA 1I9DA 2PBJA 3HCZA 5D9XA 4XRDA 3Q18A 2H1AA 1JFUA 1MTCA 1PL1A 4BIKA 2R4VA 3KTBA 5D73A 2WS2A 6GSUA 2HSYA 2R5GA 3DKSA 1XPVA 3FKFA 2FGXA 4OD7A 4IQ1A 5ENUA 5GSTA 2RM6A 3EYTA 1S3AA 1K0AA 2IMDA 5IIZA 3HVSA 5AISA 5F0GA 3KD0A 2HRNA 1SKSB 2HSMA 4DSSA 1TXXA 3IOSA 5J5NA 3W8JA 1A0FA 4WXTA 1GLPA 3MAKA 12GSA 2ZUPA 4WR4A 1X5EA 5JWOB 3QPMA 3TGZA 1Z6NA 4HU7A 2WB9A 1JZDA 3VWVA 3VPTA 1X5CA 1XVQA 1GSEA 4ZL7A 1EOGA 3VI5A 2R0PA 3LXTA 1AIUA 1GUMA 2H0GA 3ED3A 4ZB9A 1THXA 1YEXA 3LJRA 1G7OA 2K8SA 1TK8B 2XBIA 3GKXA 3A2XA 1YDKA 4XCSA 1PN0A 2X64A 4GQCA 3IHGA 3KP8A 4KUNA 4YAPA 4MMMA 2KHPA 4K5RA 1A8LA 1W4VA 5AIVA 3N5OA 1ACVA 2DJKA 4RQRA 2B5EA 1EZKA 4NWYA 4XS4B 4OFMA 4KAEA 2A2SA 1ERTA 4GWRA 4V1Ag 3ZMLA 4JR4A 3ZMKA 1U3IA 4NHWA 3LW9A 4IP6A 4G2EA 2PUKC 1AQXA 1SU9A 1LJRA 2NPBA 4PGTA 1PN9A 3TRPA 1B9YC 4BVYB 4TVEA 3PINA 3TKQA 4D73B 1GSDA 3DWVA 4K0NA 4DEJA 3KH9A 2EC4A 2HRFA 5CAXA 3DGQA 3U6VA 1SYXA 3P90A 3EINA 5G31A 3VWWA 4PQ1A 1DUGA 1MDJA 1T7PB 3HD5A 1EV4A 2FY6A 4MJBA 4A5PA 1M2AA 5DJLA 2M46A 2HNLA 4NPBA 2WCIA 3CRTA 4ID0A 7GSSA 5KN0A 2DMLA 3HJOA 5ECHB 3TJBA 4EVMA 1DE1A 4NHZA 3DXBA 3EWLA 2YWMA 4N11A 1G6YA 3F63A 2IIYA 3QMXA 2I4AA 2DJ0A 2C1YA 5E59A 1UN2A 4MF5A 4YQUA 4LA1A 5A5KA 2LNSA 5L71A 3CTGA 2L5LA 1YJ6A 2E7PA 5B8AA 1FG4A 5F05A 4X43A 2AYTA 4FH8A 3LFLA 4KDXA 2ZNMA 1T3BA 1PX7A 3WYWA 1T8EB 3GH9A 3KGKA 2VL2A 2EIOA 4X4JA 1F6MC 3MWHA 1OC3A 1KTEA 5ECMB 2MZCA 2OADA 4XIHA 2JL4A 1K0BA 2L4QA 3KJYA 2L6CA 1A0RP 4CW9A 2N5BA 3IRAA 4ECBA 1SYRA 2IFQB 4YQVA 4MF7A 3TOUA 1T00A 2HRKA 3TUEA 2H76A 4F0BA 2GLRA 4V2LA 3MNGA 3Q19A 2VD1A 4MH3A 1M0UA 1YF1A 4KCAA 4XS1A 3ZITA 2MBTA 4X1UA 1BQ7A 4HSCX 4ZBAA 4G0LA 3C73A 5COHA 3UOMA 3VK9A 3VWUA 4PNFA 4JRRA 1TJDA 3L0HA 5ELAA 5KN1A 3PPUA 4YQMA 2JACA 2MMOA 2UZ8A 4X0XA 3Q6OA 1YKAA 5G1LA 2H01A 4MZBA 5B7CA 2LRNA 4TKYA 5HR3A 5KOXA 2FA8A 3HJMA 2CVBA 3US3A 1WRYA 1M2DA 4AGSA 3D21A 2WJUA 4G9HA 3BD2A 2H6ZA 4TRXA 1QFNA 5JWRB 3DIEA 3IV4A 1OVNA 2YOIA 2V32A 2R3XA 3H8QA 1CQGA 4K7NA 1TOFA 4K9ZA 2B5YA 4K7IA 5ID2B 2GVPA 2X8HA 1R7HA 1XIYA 2AAWA 4I97A 1Z6MA 1XW9A 1I5GA 1V57A 1M9BA 1QXHA 3UAPA 5B6NA 1ZYQB 3AY8A 3P2AA 4GRFA 3UEMA 2NVLA 3KMNA 2R6KA 1K0MA 4O7HA 1EP8A 4N0VA 1E6BA 4J57E 4RUVA 11GSA 4I6XA 3GRXA 2GZZA 3QAGA 4K5SA 1TU8A 2A4HA 4DSQA 1ST9A 1BEDA 3E0UA 4Z2TA 3TRQA 4Z2UA 1SENA 1A2LA 1SKWB 5DAKB 2LV3A 2H70A 4E8HA 2NTOA 4L5OA 2R2JA 3WGEA 1NSWA 2C0DA 4MZCA 4HOJA 4CY8A 2GSRA 3EE2A 1B4QA 1PX6A 3FHKA 2DKIA 5IMCA 3ME7A 3GSSA 3F4RA 4HJ2A 2F3MA 5J9CA 4MK3A 4XS4A 2DSAA 1AQWA 5GAPD 5DVBA 4PX1A 1GTAA 2F8FA 3I43A 3DMLA 3F8UA 2O8VB 1A2JA 1SJZA 4MDCA 3CSIA 3GTUB 3HDCA 4POLA 4BVYA 2WFCA 4EIPA 3ZL5A 1NW2A 4E8EA 3R3EA 1GSFA 5KOWA 1JZWA 3J7Yb 3WT2A 1R5AA 1XWGA 1KEBA 1JLVA 2QC7A 1V9WA 4TXVA 4EF0A 2CVDA 4XTSA 1AXDA 2GSTA 3CSHA 2PMTA 4OMVA 3F3QA 1PFOA 3GUSA 3QOUA 2HYXA 1SK2A 4PQHA 2DIYA 2GQKA 1FHEA 2C0GA 4POKA 2FCHA 1FW1A 4PXOA 4O32A 2YZHA 4QL7A 4N10A 3D4TA 3ZTLA 2JZSA 3APSA 3IE3A 2YCDA 5CO3A 2ES7A 5ECSA 1F3BA 4JE1A 1SJIA 5HFKA 3H79A 1Z7RA 3G7JA 2TRXA 2H66A 1O6JA 1U3AA 1Z9HA 4ZB6A 2GZYA 4G19A 1H75A 2L6DA 2LNTA 1F9MA 2L57A 1M3JA 2PU9C 2NBSA 3A5WA 2H1BA 5C00A 3CYNA 1B8XA 2XPEA 1PKZA 4PTSA 1YZXA 2JU5A 5HFIA 4GQFA 3TJFA 4CDOA 2R37A 3WGXA 3P8WA 2X8GA 4F03A 3D22A 2IFQA 2KLXA 4CHSA 3EC3A 1TTZA 4MLYA 1SK1A 1R4WA 5IMDA 3L9VA 1VRSD 3MYDA 5INYA 3APOA 1ZOFA 1ML6A 3DVXA 1X9SB 5F06A 4ZXGA 2CZ3A 1URMA 1ERVA 3IK7A 2ON5A 4JR6A 4OCEA 2QKEA 4MH2A 1OKDA 1ZL9A 1K0NA 3LG6A 5B8BA 2DJ2A 3IK9A 5G2ZA 4NMUA 2VM2A 4MJCA 1N8JA 4V2MA 3W8SA 2GQMA 1PMTA 1X0RA 2VUPA 4XS6A 4ILFA 3GMFA 4IN0A 9GSSA 1YF0A 2H6XA 1M99A 5KN2A 1ZYPA 5JCGA 1FB6A 3M9KA 2CV4A 1A8YA 4XRAA 13GSA 3C1SA 4TR4A 1C72A 2IPAA 2L4CA 5H5SA 4HQSA 1V58A 2VCTA 3CMIA 5IO0A 1GULA 1X9MB 4AJ6A 1B4PA 1K0CA 3GIXA 4JBBA 4HJMA 1PSQA 4WETA 3F9UA 1W89A 2KOKA 3GX0A 2X4AA 2CQ9A 5ID2A 1XWAA 4ML6A 2WZ9A 5IOXA 1XW6A 2YN1A 2LSTA 4ZL8A 1G7EA 2REMA 3KH7A 3QAWA 4QL9A 4BA7A 1WJKA 2PVOC 4O5QA 3E3EA 1GSSA 2RLIA 1T4ZA 3TKSA 5CP1A 4ACSA 1TRSA 2C4JA 1LU4A 4I5QA 1RK4A 3TKRA 5ECRB 1XFLA 4KB3A 1HD2A 2OE0A 2VCZA 5DAKA 4MZWA 2MMZA 1PKWA 2LUSA 3IAM2 2GGTA 2YPMA 2B1KA 4MNNA 5HR0A 5H5RA 1MDIA 2PWJA 2A2RA 2QGVA 1WP0A 6GSYA 1O8WA 4LMVA 3HVVA 2AUVA 3G9BA 3F3RA 3UVTA 4RQXA 1SL0B 1T1VA 2ZCTA 2XBQA 5C04A 4Q5NA 2FUG2 4QQ7A 2JSYA 3IDVA 3M8NA 1TKDB 3HJPA 2YP6A 2DJ3A 2CAIA 2C0FA 3GTUA 3VFIA 1SKRB 2H72A 1XW5A 1Z3EA 5CRHA 5CRDA 4GSNA 2V6OA 2CX4A 5EPFA 3HXSA 2CAQA 1K3LA 3FZ5A 4TOPA 4IJIA 1PQNA 1JHBA 6GSTA 1V40A 3HHVA 1EEJA 2MBSA 2YZUA 4FYCA 6GSWA 2LQOA 4JZQA 1EP7A 1XG8A 3QDNA 2LQQA 3EURA 4ICYA 1OE8A 4MJEA 2LJRA 3I9V2 4Q5QA 5DBQA 4G10A 3VI7A 2IJYA 3RDWA 3FEUA 3CBUA 2JSZA 2KUCA 3LQ7A 5CREA 2FWFA 3D0ZA 4KA0A 2CZ2A 2HZFA 4V2NA 4KH7A 1XWCA 2HZEB 1OC8A 3GKKA 1UC7A 1BX9A 1GLQA 2N5AA 2K18A 2MMNA 4MPFA 4CY6A 3NIVA 5J9BA 3TOTA 3VWXA 4IVFA 2O85A 3TJGA 2RUFA 3HVXA 1VF1A 3BCIA 3QAVA 1TI1A 2EIRA 1GSUA 4HEA2 3HVNA 3LWAA 4BVXB 4FIWA 3D5JA 1BG5A 2DC5A 4O5RA 4MCUA 5AN1A 5ECKB 1JLWA 2M72A 4ECJA 5JCUA 2K6VA 1USBA 2FD3A 2H30A 4Z7XA 2FA4A 3C8EA 1GUHA 4KW6A 3FZ4A 3ZZXA 2OE1A 4FYBA 2BMXA 2V2GA 2L59A 3CQFA 2R0CA 2HRAA 2C0EA 4YH2A 2M80A 3KCMA 2F51A 1R26A 4NXIA 6GSXA 5G5FA 1UVZA 3EPTA 4BL7B 4K2XA 1GSYA 2V41A 1OC9B 5H5QA 1JZOA 4KGIA 3HZ4A 3FZAA 3EU4A 5IPGA 4FO5A 2FNOA 3HKRA 1SD9A 3KTLA 1K3OA 4JU5A 1TU7A 4IQAA 4MF6A 4WF5A 4OO4A 2DLXA 5F07A 2YJHA 1DE2A 3TRXA 4KDUA 2DJ1A 3LGCA 1TW9A 1TP9A 5IO2A 5LCZA 5CRGA 1AQVA 3OR5A 1FOHA 4L0UA 5IMVA 1HNCA 3RPPA 4F0CA 3FRCA 3S9FA 2WULA 4MABA 1FO5A 1TRWA 5DJMA 1VF4A 1X5DA 3GURA 2VLUA 3L9UA 3IBHA 2HXKA 3C7MA 3LSZA 2GDRA 4WEYA 3QR6A 2P5RA 1GNEA 1VF2A 3RHBA 4J56E 2P0GA 2VL9A 5DQSA 1MDKA 1QMVA 1XWBA 1PL2A 2L5OA 3DVWA 5JWQB 5ECPB 3D4MA 3G7IA 1J08A 3IC8A 5D9VA 4O92A 4GCIA 2D2ZA 3RHCA 1YKCA 5J4UA 2VCQA 3KIJA 18GSA 2E2MA 3I69A 2LKUA 2QA1A 5CNWA 3O76A 4ZBDA 3NOFA 4JEDA 10GSA 2YANA 1Q98A 2IMIA 2AHEA 1XXUA 5FT3A 4KSMA 1SL1B 3BBYA 3GKNA 3EVIA 3BOAA 1XVWA 4IHUA 3IHQA 5G1KA 4PUFC 3RAZA 2IMFA 4D73A 4MA9A 3QFAC 3APQA 3MIXA 1K0DA 3L9SA 4WBRD 3IR4A 2CT6A 4G0IA 1OYJA 3N9JA 1SL2B 5BRTA 3GFKA 1EGRA 2VL2C 3QCPA 3EMXA 2X49A 3M3MA 4L0WA 1GTIA 4GSSA 1MD3A 4NV2A 3ERGA 1GWCA 4IS0A 1T4YA 5EL8A 2J23A 2AB6A 2HFDA 4MJAA 1FB0A 4EIQA 2FHEA 3CXGA 1O7UA 4RI6A 3RPNA 2OA7A 4EKZA 3MDKA 4USSA 2IMKA 1WIKA 4BPYA 1SD8A 2A4VA 5DCHA 2H73A 2QSIA 3KXOA 4OO5A 5D8IA 4EXJA 4EDZA 2VLTA 2VLVA 3UBLA 4AJ8A 4POBA 2HZEA 5ECLB 1DSBA 1ZGNA 4EC0A 3GV1A 2FWEA 1ERWA 1NHYA 3ZREA 4PURA 3K8NA 3VLNA 1H4OA 1TRVA 1GUKA 4NAXA 4HDEA 5DALB 4HZ4A 1O85A 3BJ5A 1R5PA 5G5EA 2TRCP 1SJ6A 3H4KA 1KBNA 1GTUA 1GP1A 2B7KA 1AC1A 1XOBA 2C80A 4BVXA 1Y25A 4J2FA 1OE7A 5IPHA 3ZVJD 4FYUA 4XHMA 4H86A 3G7YA 2MYGA 1B48A 2HI7A 4BWSA 3TKSE 3UIWA 4G0KA 2VO4A 2H0HA 2HLSA 4EL1A 2ON7A 4PQIA 2EIQA 5CYYA 5A4WA 3DD3A 5DQYA 3LYKA 4Q5RA 2FWHA 4K0GA 4BL7A 4ZL9A 4MP4A 4MPGA 4L5LA 1OC9A 4BWQA 1IYIA 3UJ1A 1EV9A 14GSA 2O89A 4IKHA 1RW1A 2H19A 1NHOA 4ECCA 2F8AA 3LXZA 4Z2RA 5F8BA 4K6XA 3TB2A 3ZIVA 3UVHA 1U6TA 3FY7A 1ZMAA 3M9JA 1BAYA 2WRTA 3LORA 3M1GA 4AF2A 1O8XA 3SBCA 1X9WB 2RM5A 2DBCA 4KE3A 3GA4A 5ELGA 2LJKA 2C8UA 2C3QA 4KDYA 3JCML 3FYGA 1SK0A 5D9TA 3FR9A 2IWTA 1S3CA 2GT5A 5IOWA 2IMEA 1QGVA 2H6YA 3TCOA 4DVCA 2XPDA 5JCWA 1J0FA 2JZRA 3ERFA 2GZPA 4TXOB 3ZIJA 1GRXA 3ZFLA 3ZLPA 3O3TA 3TJKA
chains in the Genus database with same CATH topology
2PVQA 6GSSA 3H93A 3QD9A 1CQHA 3GNJA 2H0IA 1XZOA 1QK8A 3F4TA 4DSRA 4POMA 5J41A 2KP2A 2H71A 1WMJA 3GHAA 1MD4A 3KEBA 1EGOA 1HNBA 2H1DA 4IJ3A 1F3AA 1UA5A 3IXRA 2LEGA 3FK8A 2NDOA 3IAS2 3HA9A 2K8VA 4EUYA 3PR8A 1YEPA 2V1MA 2MMAA 3QFBC 3ZYWA 4F9ZA 2CVKA 1M2BA 4K8MA 5CRWA 3L4NA 1ABAA 3KP9A 3A5IA 3GN3A 2DKHA 1PRXA 2BTOT 1ON4A 2YWIA 3HZ8A 4GSTA 2RIIA 3IA1A 1QUWA 2QA2A 8GSSA 2YJ7A 3C71A 3ME8A 2FLSA 3FR6A 4EO3A 1A23A 3DRNA 2LRTA 1TI3A 1FVKA 3P7XA 6GSVA 5LD0A 5HR1A 1HNAA 4V1Ap 2DMMA 4TW5A 3WGDA 2WGRA 1JZRA 3MSZA 2I1UA 4YKGA 3WD6A 2A2PA 3R2QA 3C1RA 2CA8A 4GTUA 2PPTA 5D93A 3ZFBA 3D6IA 2GSSA 4IELA 3RBTA 5AIXA 3LYPA 3FZ9A 3LEFA 4HQZA 1FVJA 4TR1B 5G30A 2PGTA 16GSA 3O6TA 3IPZA 1PGTA 3H1NA 2YWOA 2I3YA 5B6MA 3A2WA 3V1WA 5IMFA 4KSOA 4LLRA 4ZBBA 2YWNA 4IGJA 3DEXA 3DYRA 4PNGA 1GSQA 5EVOA 5LNKe 3SWLA 4ECIA 4WR5A 1VGLA 3F0IA 5DDLA 4EE0A 17GSA 3FMWA 4ZIJA 1LBKA 5IM9A 1XBSA 1PA3A 1S3DA 1O73A 3ZRDA 2C3TA 4WKWA 2HSHA 1WOUA 3CSJA 4HI7A 5DALA 5FHIA 2VOCA 4LMWA 1U87A 2PN8A 5ABRA 2OKAA 1Z7PA 4P3YB 2Z9SA 3UARA 2V6KA 4GF0A 1PD21 3ERWA 1M9AA 2HT9A 3CTFA 2PERA 2GT6A 2AV4A 3NZNA 3KMOA 1QQ2A 5ECNB 2WDUA 2B6MA 5IMZA 3WT1A 3KZQA 1U88A 1OAZA 2GTUA 3GSTA 1HYUA 5BMUA 4PUAA 3Q74A 4TR0A 2OBIA 2X99A 4OCFA 4LL4B 1GTBA 3GKMA 2IL3A 2TIRA 4L8EA 20GSA 3TKSC 2O7KA 2LRCA 4DSSB 5HR2A 2J9HA 2KP1A 2B3SA 2JADA 2B1LA 3GYKA 3GH6A 1J9BA 3TDGA 3UMAA 4KF9A 4TR3A 1F2EA 2XHFA 3TJJA 2CX3A 4GXZA 4KX4A 4O5UA 1TDIA 2JZTA 2H1GA 2G0FA 4N30A 4F82A 5IMAA 5IQYA 1E2YA 5A4UA 1KNGA 2E0QA 4KCEA 1BJXA 1YY7A 1V2AA 1WPIA 1EOHA 1ZYNA 1GL8A 2C3NA 2VCWA 2XC2A 2GSQA 1ERUA 1B9XC 5KN3A 3F6DA 1MEKA 1BYEA 1A24A 1N2AA 3CRUA 5GAND 1NM3A 1FAAA 2GQLA 5J3RA 2YV9A 1IYHA 4TXOA 2VCVA 3U5RE 3ISOA 1Z5YE 3UBKA 4F2IA 1AAZA 2I81A 22GSA 1O81A 2G2QA 5FWGA 3L78A 1EEMA 4FQUA 2OACA 4GLTA 1XCCA 1EWXA 1XOAA 3A3TA 4IW9A 2OJLA 4YAVA 2H8LA 3FW2A 3HY2A 5ECIB 4IP1A 5AGYA 5A4VA 1YQ1A 2B7JA 1RQMA 5D96A 2VD0A 3TKPA 2B5XA 2E2GA 5GSSA 4HZ2A 1ZCPA 4HUAA 4ML1A 3M0FA 4I2TA 1VF3A 1WWJA 2OBKA 2AJQB 2DIZA 2O87A 3BCKA 3KM6A 5EY6A 2X8CA 5GZZB 1FOVA 3GL3A 1TK5B 3ZVJA 3EMPA 3GX8A 5DCGA 1THOA 4K1FA 4TN8A 5ECQB 2FWGA 2DJJA 3PH9A 1Y6EA 3IC4A 4IBPA 2OE3A 2LJAA 2BJXA 19GSA 2HE3A 3FR3A 1F37A 1G6WA 2R0GA 1G0TA 1K3YA 1ZZYA 2VL3A 2F9SA 1XWKA 4OFTA 2VAFA 4OFNA 4OWYA 4ZILA 3F4SA 2P5QA 2K9FA 1Q4JA 4TR1A 2VCXA 3J7Yk 4EDYA 1AW9A 4I2UA 2RUEA 4HU9A 2VIMA 4KNDA 4RI7A 4WBJA 2YV7A 2YNXA 4YKFA 1GH2A 5HQPA 2H74A 1HQOA 4K7OA 3A2VA 4N0ZA 1K0OA 3VPQA 1AUCA 5KEJA 3EU3A 1V98A 4WF4A 4Q5FA 1A2MA 1ZYEA 3VURA 2H75A 3I6AA 4HS1A 2I9HA 3F6FA 1GNWA 1OKTA 1WE0A 3E9JB 1TRUA 2LTKA 1ILOA 4LL1B 4I8BA 4ULXA 4ZB8A 5ECOB 1M7TA 4NV5A 1TK0B 5HFGA 3HYPA 2IN3A 4ISDA 5D9WA 3GL5A 2P31A 1DBYA 2ALBA 4K2DA 2VM1A 4AJ7A 3PGTA 5E4WA 3UL3A 2GS3A 2LS5A 2N5FA 3W6GA 1I9DA 2PBJA 3HCZA 5D9XA 4XRDA 3Q18A 2H1AA 1JFUA 1MTCA 1PL1A 2R4VA 3KTBA 5D73A 2WS2A 6GSUA 2HSYA 2R5GA 3DKSA 1XPVA 3FKFA 2FGXA 4OD7A 4IQ1A 5ENUA 5GSTA 2RM6A 3EYTA 1S3AA 1K0AA 2IMDA 5IIZA 3HVSA 5AISA 5F0GA 3KD0A 2HRNA 1SKSB 2HSMA 4DSSA 1TXXA 3IOSA 5J5NA 3W8JA 1A0FA 4WXTA 1GLPA 3MAKA 12GSA 2ZUPA 4WR4A 1X5EA 5JWOB 3QPMA 3TGZA 1Z6NA 4HU7A 2WB9A 1JZDA 3VWVA 3VPTA 1X5CA 1XVQA 1GSEA 4ZL7A 1EOGA 3VI5A 2R0PA 3LXTA 1AIUA 1GUMA 2H0GA 3ED3A 4ZB9A 1THXA 1YEXA 3LJRA 1G7OA 2K8SA 1TK8B 2XBIA 3GKXA 3A2XA 1YDKA 4XCSA 1PN0A 2X64A 4GQCA 3IHGA 3KP8A 4KUNA 4YAPA 4MMMA 2KHPA 4K5RA 1A8LA 1W4VA 5AIVA 3N5OA 1ACVA 2DJKA 4RQRA 2B5EA 1EZKA 4NWYA 4XS4B 4OFMA 4KAEA 2A2SA 1ERTA 4GWRA 4V1Ag 3ZMLA 4JR4A 3ZMKA 1U3IA 4NHWA 3LW9A 4IP6A 4G2EA 2PUKC 1AQXA 1SU9A 1LJRA 2NPBA 4PGTA 1PN9A 3TRPA 1B9YC 4BVYB 4TVEA 3PINA 3TKQA 4D73B 1GSDA 3DWVA 4K0NA 4DEJA 3KH9A 2EC4A 2HRFA 5CAXA 3DGQA 3U6VA 1SYXA 3P90A 3EINA 5G31A 3VWWA 4PQ1A 1DUGA 1MDJA 1T7PB 3HD5A 1EV4A 2FY6A 4MJBA 4A5PA 1M2AA 5DJLA 2M46A 2HNLA 4NPBA 2WCIA 3CRTA 4ID0A 7GSSA 5KN0A 2DMLA 3HJOA 5ECHB 3TJBA 4EVMA 1DE1A 4NHZA 3DXBA 3EWLA 2YWMA 4N11A 1G6YA 3F63A 2IIYA 3QMXA 2I4AA 2DJ0A 2C1YA 5E59A 1UN2A 4MF5A 4YQUA 4LA1A 5A5KA 2LNSA 5L71A 3CTGA 2L5LA 1YJ6A 2E7PA 5B8AA 1FG4A 5F05A 4X43A 2AYTA 4FH8A 3LFLA 4KDXA 2ZNMA 1T3BA 1PX7A 3WYWA 1T8EB 3GH9A 3KGKA 2VL2A 2EIOA 4X4JA 1F6MC 3MWHA 1OC3A 1KTEA 5ECMB 2MZCA 2OADA 4XIHA 2JL4A 1K0BA 2L4QA 3KJYA 2L6CA 1A0RP 4CW9A 2N5BA 3IRAA 4ECBA 1SYRA 2IFQB 4YQVA 4MF7A 3TOUA 1T00A 2HRKA 3TUEA 2H76A 4F0BA 2GLRA 4V2LA 3MNGA 3Q19A 2VD1A 4MH3A 1M0UA 1YF1A 4KCAA 4XS1A 3ZITA 2MBTA 4X1UA 1BQ7A 4ZBAA 4G0LA 3C73A 5COHA 3UOMA 3VK9A 3VWUA 4PNFA 4JRRA 1TJDA 3L0HA 5ELAA 5KN1A 3PPUA 4YQMA 2JACA 2MMOA 2UZ8A 4X0XA 3Q6OA 1YKAA 5G1LA 2H01A 4MZBA 5B7CA 2LRNA 4TKYA 5HR3A 5KOXA 2FA8A 3HJMA 2CVBA 3US3A 1WRYA 1M2DA 4AGSA 3D21A 2WJUA 4G9HA 3BD2A 2H6ZA 4TRXA 1QFNA 5JWRB 3DIEA 3IV4A 1OVNA 2YOIA 2V32A 2R3XA 3H8QA 1CQGA 4K7NA 1TOFA 4K9ZA 2B5YA 4K7IA 5ID2B 2GVPA 2X8HA 1R7HA 1XIYA 2AAWA 4I97A 1Z6MA 1XW9A 1I5GA 1V57A 1M9BA 1QXHA 3UAPA 5B6NA 1ZYQB 3AY8A 3P2AA 4GRFA 3UEMA 2NVLA 3KMNA 2R6KA 1K0MA 4O7HA 1EP8A 4N0VA 1E6BA 4J57E 4RUVA 11GSA 4I6XA 3GRXA 2GZZA 3QAGA 4K5SA 1TU8A 2A4HA 4DSQA 1ST9A 1BEDA 3E0UA 4Z2TA 3TRQA 4Z2UA 1SENA 1A2LA 1SKWB 5DAKB 2LV3A 2H70A 4E8HA 2NTOA 4L5OA 2R2JA 3WGEA 1NSWA 2C0DA 4MZCA 4HOJA 4CY8A 2GSRA 3EE2A 1B4QA 1PX6A 3FHKA 2DKIA 5IMCA 3ME7A 3GSSA 3F4RA 4HJ2A 2F3MA 5J9CA 4MK3A 4XS4A 2DSAA 1AQWA 5GAPD 5DVBA 4PX1A 1GTAA 2F8FA 3I43A 3DMLA 3F8UA 2O8VB 1A2JA 1SJZA 4MDCA 3CSIA 3GTUB 3HDCA 4POLA 4BVYA 2WFCA 4EIPA 3ZL5A 1NW2A 4E8EA 3R3EA 1GSFA 5KOWA 1JZWA 3J7Yb 3WT2A 1R5AA 1XWGA 1KEBA 1JLVA 2QC7A 1V9WA 4TXVA 4EF0A 2CVDA 4XTSA 1AXDA 2GSTA 3CSHA 2PMTA 4OMVA 3F3QA 3GUSA 3QOUA 2HYXA 1SK2A 4PQHA 2DIYA 2GQKA 1FHEA 2C0GA 4POKA 2FCHA 1FW1A 4PXOA 4O32A 2YZHA 4QL7A 4N10A 3D4TA 3ZTLA 2JZSA 3APSA 3IE3A 2YCDA 5CO3A 2ES7A 5ECSA 1F3BA 4JE1A 1SJIA 5HFKA 3H79A 1Z7RA 3G7JA 2TRXA 2H66A 1O6JA 1U3AA 1Z9HA 4ZB6A 2GZYA 4G19A 1H75A 2L6DA 2LNTA 1F9MA 2L57A 2PU9C 2NBSA 3A5WA 2H1BA 5C00A 3CYNA 1B8XA 2XPEA 1PKZA 4PTSA 1YZXA 2JU5A 5HFIA 4GQFA 3TJFA 4CDOA 2R37A 3WGXA 3P8WA 2X8GA 4F03A 3D22A 2IFQA 2KLXA 4CHSA 3EC3A 1TTZA 4MLYA 1SK1A 1R4WA 5IMDA 3L9VA 1VRSD 3MYDA 5INYA 3APOA 1ZOFA 1ML6A 3DVXA 1X9SB 5F06A 4ZXGA 2CZ3A 1URMA 1ERVA 3IK7A 2ON5A 4JR6A 4OCEA 2QKEA 4MH2A 1OKDA 1ZL9A 1K0NA 3LG6A 5B8BA 2DJ2A 3IK9A 5G2ZA 4NMUA 2VM2A 4MJCA 1N8JA 4V2MA 3W8SA 2GQMA 1PMTA 1X0RA 2VUPA 4XS6A 4ILFA 3GMFA 4IN0A 9GSSA 1YF0A 2H6XA 1M99A 5KN2A 1ZYPA 5JCGA 1FB6A 3M9KA 2CV4A 1A8YA 4XRAA 13GSA 3C1SA 4TR4A 1C72A 2IPAA 2L4CA 5H5SA 4HQSA 1V58A 2VCTA 3CMIA 5IO0A 1GULA 1X9MB 4AJ6A 1B4PA 1K0CA 3GIXA 4JBBA 4HJMA 1PSQA 4WETA 3F9UA 1W89A 2KOKA 3GX0A 2X4AA 2CQ9A 5ID2A 1XWAA 4ML6A 2WZ9A 5IOXA 1XW6A 2YN1A 2LSTA 4ZL8A 1G7EA 2REMA 3KH7A 3QAWA 4QL9A 4BA7A 1WJKA 2PVOC 4O5QA 3E3EA 1GSSA 2RLIA 1T4ZA 3TKSA 5CP1A 4ACSA 1TRSA 2C4JA 1LU4A 4I5QA 1RK4A 3TKRA 5ECRB 1XFLA 4KB3A 1HD2A 2OE0A 2VCZA 5DAKA 4MZWA 2MMZA 1PKWA 2LUSA 3IAM2 2GGTA 2YPMA 2B1KA 4MNNA 5HR0A 5H5RA 1MDIA 2PWJA 2A2RA 2QGVA 1WP0A 6GSYA 1O8WA 4LMVA 3HVVA 2AUVA 3G9BA 3F3RA 3UVTA 4RQXA 1SL0B 1T1VA 2ZCTA 2XBQA 5C04A 4Q5NA 2FUG2 4QQ7A 2JSYA 3IDVA 3M8NA 1TKDB 3HJPA 2YP6A 2DJ3A 2CAIA 2C0FA 3GTUA 3VFIA 1SKRB 2H72A 1XW5A 1Z3EA 5CRHA 5CRDA 4GSNA 2V6OA 2CX4A 5EPFA 3HXSA 2CAQA 1K3LA 3FZ5A 4TOPA 4IJIA 1PQNA 1JHBA 6GSTA 1V40A 3HHVA 1EEJA 2MBSA 2YZUA 4FYCA 6GSWA 2LQOA 4JZQA 1EP7A 3QDNA 2LQQA 3EURA 4ICYA 1OE8A 4MJEA 2LJRA 3I9V2 4Q5QA 5DBQA 4G10A 3VI7A 2IJYA 3RDWA 3FEUA 3CBUA 2JSZA 2KUCA 3LQ7A 5CREA 2FWFA 3D0ZA 4KA0A 2CZ2A 2HZFA 4V2NA 4KH7A 1XWCA 2HZEB 1OC8A 3GKKA 1UC7A 1BX9A 1GLQA 2N5AA 2K18A 2MMNA 4MPFA 4CY6A 3NIVA 5J9BA 3TOTA 3VWXA 4IVFA 2O85A 3TJGA 2RUFA 3HVXA 1VF1A 3BCIA 3QAVA 1TI1A 2EIRA 1GSUA 4HEA2 3LWAA 4BVXB 4FIWA 3D5JA 1BG5A 2DC5A 4O5RA 4MCUA 5AN1A 5ECKB 1JLWA 2M72A 4ECJA 5JCUA 2K6VA 1USBA 2FD3A 2H30A 4Z7XA 2FA4A 3C8EA 1GUHA 4KW6A 3FZ4A 3ZZXA 2OE1A 4FYBA 2BMXA 2V2GA 2L59A 2R0CA 2HRAA 2C0EA 4YH2A 2M80A 3KCMA 2F51A 1R26A 4NXIA 6GSXA 5G5FA 1UVZA 3EPTA 4BL7B 4K2XA 1GSYA 2V41A 1OC9B 5H5QA 1JZOA 4KGIA 3HZ4A 3FZAA 3EU4A 5IPGA 4FO5A 2FNOA 3HKRA 1SD9A 3KTLA 1K3OA 4JU5A 1TU7A 4IQAA 4MF6A 4WF5A 4OO4A 2DLXA 5F07A 2YJHA 1DE2A 3TRXA 4KDUA 2DJ1A 3LGCA 1TW9A 1TP9A 5IO2A 5LCZA 5CRGA 1AQVA 3OR5A 1FOHA 4L0UA 5IMVA 1HNCA 3RPPA 4F0CA 3FRCA 3S9FA 2WULA 4MABA 1FO5A 1TRWA 5DJMA 1VF4A 1X5DA 3GURA 2VLUA 3L9UA 3IBHA 2HXKA 3C7MA 3LSZA 2GDRA 4WEYA 3QR6A 2P5RA 1GNEA 1VF2A 3RHBA 4J56E 2P0GA 2VL9A 5DQSA 1MDKA 1QMVA 1XWBA 1PL2A 2L5OA 3DVWA 5JWQB 5ECPB 3D4MA 3G7IA 1J08A 3IC8A 5D9VA 4O92A 4GCIA 2D2ZA 3RHCA 1YKCA 5J4UA 2VCQA 3KIJA 18GSA 2E2MA 3I69A 2LKUA 2QA1A 5CNWA 3O76A 4ZBDA 3NOFA 4JEDA 10GSA 2YANA 1Q98A 2IMIA 2AHEA 1XXUA 5FT3A 4KSMA 1SL1B 3BBYA 3GKNA 3EVIA 3BOAA 1XVWA 4IHUA 3IHQA 5G1KA 4PUFC 3RAZA 2IMFA 4D73A 4MA9A 3QFAC 3APQA 3MIXA 1K0DA 3L9SA 4WBRD 3IR4A 2CT6A 4G0IA 1OYJA 3N9JA 1SL2B 5BRTA 3GFKA 1EGRA 2VL2C 3QCPA 3EMXA 2X49A 3M3MA 4L0WA 1GTIA 4GSSA 1MD3A 4NV2A 3ERGA 1GWCA 4IS0A 1T4YA 5EL8A 2J23A 2AB6A 2HFDA 4MJAA 1FB0A 4EIQA 2FHEA 3CXGA 1O7UA 4RI6A 3RPNA 2OA7A 4EKZA 3MDKA 4USSA 2IMKA 1WIKA 4BPYA 1SD8A 2A4VA 5DCHA 2H73A 2QSIA 3KXOA 4OO5A 5D8IA 4EXJA 4EDZA 2VLTA 2VLVA 3UBLA 4AJ8A 4POBA 2HZEA 5ECLB 1DSBA 1ZGNA 4EC0A 3GV1A 2FWEA 1ERWA 1NHYA 3ZREA 4PURA 3K8NA 3VLNA 1H4OA 1TRVA 1GUKA 4NAXA 4HDEA 5DALB 4HZ4A 1O85A 3BJ5A 1R5PA 5G5EA 2TRCP 1SJ6A 3H4KA 1KBNA 1GTUA 1GP1A 2B7KA 1AC1A 1XOBA 2C80A 4BVXA 1Y25A 4J2FA 1OE7A 5IPHA 3ZVJD 4FYUA 4XHMA 4H86A 3G7YA 2MYGA 1B48A 2HI7A 4BWSA 3TKSE 3UIWA 4G0KA 2VO4A 2H0HA 2HLSA 4EL1A 2ON7A 4PQIA 2EIQA 5CYYA 5A4WA 3DD3A 5DQYA 3LYKA 4Q5RA 2FWHA 4K0GA 4BL7A 4ZL9A 4MP4A 4MPGA 4L5LA 1OC9A 4BWQA 1IYIA 3UJ1A 1EV9A 14GSA 2O89A 4IKHA 1RW1A 2H19A 1NHOA 4ECCA 2F8AA 3LXZA 4Z2RA 5F8BA 4K6XA 3TB2A 3ZIVA 3UVHA 1U6TA 3FY7A 1ZMAA 3M9JA 1BAYA 2WRTA 3LORA 3M1GA 4AF2A 1O8XA 3SBCA 1X9WB 2RM5A 2DBCA 4KE3A 3GA4A 5ELGA 2LJKA 2C8UA 2C3QA 4KDYA 3JCML 3FYGA 1SK0A 5D9TA 3FR9A 2IWTA 1S3CA 2GT5A 5IOWA 2IMEA 1QGVA 2H6YA 3TCOA 4DVCA 2XPDA 5JCWA 1J0FA 2JZRA 3ERFA 2GZPA 4TXOB 3ZIJA 1GRXA 3ZFLA 3ZLPA 3O3TA 3TJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVQ A;  6GSS A;  3H93 A;  3QD9 A;  1CQH A;  3GNJ A;  2H0I A;  1XZO A;  1QK8 A;  3F4T A;  4DSR A;  4POM A;  5J41 A;  2KP2 A;  2H71 A;  1WMJ A;  3GHA A;  1MD4 A;  3KEB A;  1EGO A;  1HNB A;  2H1D A;  4IJ3 A;  1F3A A;  1UA5 A;  3IXR A;  2LEG A;  3FK8 A;  2NDO A;  3IAS 2;  3HA9 A;  2K8V A;  4EUY A;  3PR8 A;  1YEP A;  2V1M A;  2MMA A;  3QFB C;  3ZYW A;  4F9Z A;  2CVK A;  1M2B A;  4K8M A;  5CRW A;  3L4N A;  1ABA A;  3KP9 A;  3GN3 A;  1PRX A;  2BTO T;  1ON4 A;  2YWI A;  3HZ8 A;  4GST A;  2RII A;  3IA1 A;  1QUW A;  8GSS A;  2YJ7 A;  3C71 A;  3ME8 A;  2FLS A;  3FR6 A;  4EO3 A;  1A23 A;  3DRN A;  2LRT A;  1TI3 A;  1FVK A;  3P7X A;  6GSV A;  5LD0 A;  5HR1 A;  1HNA A;  4V1A p;  2DMM A;  4TW5 A;  3WGD A;  2WGR A;  1JZR A;  3MSZ A;  2I1U A;  3WD6 A;  3R2Q A;  3C1R A;  2CA8 A;  4GTU A;  2PPT A;  5D93 A;  3ZFB A;  3D6I A;  2GSS A;  4IEL A;  3RBT A;  5AIX A;  3LYP A;  3FZ9 A;  3LEF A;  4HQZ A;  1FVJ A;  4TR1 B;  5G30 A;  2PGT A;  16GS A;  3O6T A;  3IPZ A;  1PGT A;  3H1N A;  2YWO A;  2I3Y A;  5B6M A;  3A2W A;  3V1W A;  5IMF A;  4KSO A;  4LLR A;  4ZBB A;  2YWN A;  4IGJ A;  3DEX A;  3DYR A;  4PNG A;  1GSQ A;  5EVO A;  5LNK e;  3SWL A;  4ECI A;  4WR5 A;  1VGL A;  3F0I A;  5DDL A;  4EE0 A;  17GS A;  4ZIJ A;  1LBK A;  5IM9 A;  1XBS A;  1PA3 A;  1S3D A;  1O73 A;  3ZRD A;  2C3T A;  4WKW A;  2HSH A;  1WOU A;  3CSJ A;  4HI7 A;  5DAL A;  5FHI A;  2VOC A;  4LMW A;  1U87 A;  2PN8 A;  5ABR A;  2OKA A;  1Z7P A;  4P3Y B;  2Z9S A;  3UAR A;  2V6K A;  4GF0 A;  1PD2 1;  3ERW A;  1M9A A;  2HT9 A;  3CTF A;  2PER A;  2GT6 A;  2AV4 A;  3NZN A;  3KMO A;  1QQ2 A;  5ECN B;  2WDU A;  2B6M A;  5IMZ A;  3WT1 A;  3KZQ A;  1U88 A;  1OAZ A;  2GTU A;  3GST A;  1HYU A;  4PUA A;  3Q74 A;  4TR0 A;  2OBI A;  2X99 A;  4OCF A;  4LL4 B;  1GTB A;  3GKM A;  2IL3 A;  2TIR A;  4L8E A;  20GS A;  3TKS C;  2O7K A;  2LRC A;  4DSS B;  5HR2 A;  2J9H A;  2KP1 A;  2B3S A;  2JAD A;  2B1L A;  3GYK A;  3GH6 A;  1J9B A;  3TDG A;  3UMA A;  4TR3 A;  1F2E A;  2XHF A;  3TJJ A;  2CX3 A;  4GXZ A;  4KX4 A;  1TDI A;  2JZT A;  2H1G A;  2G0F A;  4N30 A;  4F82 A;  5IMA A;  5IQY A;  1E2Y A;  5A4U A;  1KNG A;  2E0Q A;  4KCE A;  1BJX A;  1YY7 A;  1V2A A;  1WPI A;  1EOH A;  1GL8 A;  2C3N A;  2VCW A;  2XC2 A;  2GSQ A;  1ERU A;  1B9X C;  5KN3 A;  3F6D A;  1MEK A;  1BYE A;  1A24 A;  1N2A A;  3CRU A;  5GAN D;  1NM3 A;  1FAA A;  2GQL A;  5J3R A;  2YV9 A;  1IYH A;  4TXO A;  2VCV A;  3U5R E;  3ISO A;  1Z5Y E;  3UBK A;  4F2I A;  1AAZ A;  2I81 A;  22GS A;  1O81 A;  2G2Q A;  5FWG A;  3L78 A;  1EEM A;  2OAC A;  4GLT A;  1XCC A;  1EWX A;  1XOA A;  3A3T A;  4IW9 A;  2OJL A;  4YAV A;  2H8L A;  3FW2 A;  3HY2 A;  5ECI B;  4IP1 A;  5AGY A;  5A4V A;  1YQ1 A;  2B7J A;  1RQM A;  5D96 A;  2VD0 A;  3TKP A;  2B5X A;  2E2G A;  5GSS A;  4HZ2 A;  1ZCP A;  4HUA A;  4ML1 A;  3M0F A;  4I2T A;  1VF3 A;  1WWJ A;  2OBK A;  2AJQ B;  2DIZ A;  2O87 A;  3BCK A;  3KM6 A;  5EY6 A;  2X8C A;  5GZZ B;  1FOV A;  3GL3 A;  1TK5 B;  3ZVJ A;  3EMP A;  3GX8 A;  5DCG A;  5ECQ B;  1THO A;  4K1F A;  4TN8 A;  2FWG A;  2DJJ A;  3PH9 A;  1Y6E A;  3IC4 A;  4IBP A;  2OE3 A;  2LJA A;  2BJX A;  19GS A;  2HE3 A;  3FR3 A;  1F37 A;  1G6W A;  1G0T A;  1K3Y A;  1ZZY A;  2VL3 A;  2F9S A;  1XWK A;  4OFT A;  2VAF A;  4OFN A;  4OWY A;  4ZIL A;  3F4S A;  2P5Q A;  2K9F A;  1Q4J A;  4TR1 A;  2VCX A;  3J7Y k;  4EDY A;  1AW9 A;  4I2U A;  2RUE A;  4HU9 A;  2VIM A;  4KND A;  4RI7 A;  4WBJ A;  2YV7 A;  2YNX A;  1GH2 A;  5HQP A;  2H74 A;  1HQO A;  4K7O A;  3A2V A;  4N0Z A;  1K0O A;  3VPQ A;  1AUC A;  5KEJ A;  3EU3 A;  1V98 A;  4WF4 A;  4Q5F A;  1A2M A;  1ZYE A;  3VUR A;  2H75 A;  3I6A A;  4HS1 A;  2I9H A;  3F6F A;  1GNW A;  1OKT A;  1WE0 A;  3E9J B;  1TRU A;  2LTK A;  1ILO A;  4LL1 B;  4I8B A;  4ULX A;  4ZB8 A;  5ECO B;  1M7T A;  4NV5 A;  1TK0 B;  5HFG A;  3HYP A;  2IN3 A;  4ISD A;  5D9W A;  3GL5 A;  2P31 A;  1DBY A;  2ALB A;  4K2D A;  2VM1 A;  4AJ7 A;  3PGT A;  5E4W A;  3UL3 A;  2GS3 A;  2LS5 A;  2N5F A;  3W6G A;  1I9D A;  2PBJ A;  3HCZ A;  5D9X A;  4XRD A;  3Q18 A;  2H1A A;  1JFU A;  1MTC A;  1PL1 A;  2R4V A;  3KTB A;  5D73 A;  2WS2 A;  6GSU A;  2HSY A;  2R5G A;  3DKS A;  1XPV A;  3FKF A;  2FGX A;  4OD7 A;  4IQ1 A;  5ENU A;  5GST A;  2RM6 A;  3EYT A;  1S3A A;  1K0A A;  2IMD A;  5IIZ A;  3HVS A;  5AIS A;  5F0G A;  3KD0 A;  2HRN A;  1SKS B;  4DSS A;  1TXX A;  3IOS A;  5J5N A;  3W8J A;  1A0F A;  4WXT A;  1GLP A;  3MAK A;  12GS A;  2ZUP A;  4WR4 A;  1X5E A;  5JWO B;  3QPM A;  3TGZ A;  1Z6N A;  4HU7 A;  2WB9 A;  1JZD A;  3VWV A;  3VPT A;  1X5C A;  1XVQ A;  1GSE A;  4ZL7 A;  1EOG A;  3VI5 A;  3LXT A;  1AIU A;  1GUM A;  2H0G A;  3ED3 A;  4ZB9 A;  1THX A;  1YEX A;  3LJR A;  1G7O A;  2K8S A;  1TK8 B;  2XBI A;  3GKX A;  3A2X A;  1YDK A;  4XCS A;  2X64 A;  4GQC A;  3KP8 A;  4KUN A;  4YAP A;  4MMM A;  2KHP A;  1A8L A;  1W4V A;  5AIV A;  3N5O A;  1ACV A;  2DJK A;  4RQR A;  2B5E A;  1EZK A;  4NWY A;  4XS4 B;  4OFM A;  4KAE A;  2A2S A;  1ERT A;  4GWR A;  4V1A g;  3ZML A;  4JR4 A;  3ZMK A;  1U3I A;  4NHW A;  4IP6 A;  4G2E A;  2PUK C;  1AQX A;  1SU9 A;  1LJR A;  2NPB A;  4PGT A;  1PN9 A;  3TRP A;  1B9Y C;  4TVE A;  3PIN A;  3TKQ A;  4D73 B;  1GSD A;  3DWV A;  4K0N A;  4DEJ A;  3KH9 A;  2EC4 A;  2HRF A;  5CAX A;  3DGQ A;  3U6V A;  1SYX A;  3P90 A;  3EIN A;  5G31 A;  3VWW A;  4PQ1 A;  1DUG A;  1MDJ A;  1T7P B;  3HD5 A;  1EV4 A;  2FY6 A;  4MJB A;  1M2A A;  5DJL A;  2M46 A;  2HNL A;  4NPB A;  2WCI A;  3CRT A;  4ID0 A;  7GSS A;  5KN0 A;  2DML A;  3HJO A;  5ECH B;  3TJB A;  4EVM A;  1DE1 A;  4NHZ A;  3DXB A;  3EWL A;  2YWM A;  4N11 A;  1G6Y A;  3F63 A;  2IIY A;  3QMX A;  2I4A A;  2DJ0 A;  2C1Y A;  5E59 A;  1UN2 A;  4MF5 A;  4YQU A;  4LA1 A;  5A5K A;  2LNS A;  5L71 A;  3CTG A;  2L5L A;  1YJ6 A;  2E7P A;  5B8A A;  1FG4 A;  5F05 A;  4X43 A;  2AYT A;  4FH8 A;  3LFL A;  4KDX A;  2ZNM A;  1T3B A;  1PX7 A;  3WYW A;  1T8E B;  3GH9 A;  3KGK A;  2VL2 A;  2EIO A;  1F6M C;  3MWH A;  1OC3 A;  1KTE A;  5ECM B;  2MZC A;  2OAD A;  4XIH A;  2JL4 A;  1K0B A;  2L4Q A;  3KJY A;  2L6C A;  1A0R P;  4CW9 A;  2N5B A;  3IRA A;  4ECB A;  1SYR A;  2IFQ B;  4YQV A;  4MF7 A;  3TOU A;  1T00 A;  3TUE A;  2H76 A;  4F0B A;  2GLR A;  4V2L A;  3MNG A;  3Q19 A;  2VD1 A;  4MH3 A;  1M0U A;  1YF1 A;  4KCA A;  4XS1 A;  3ZIT A;  2MBT A;  4X1U A;  1BQ7 A;  4ZBA A;  3C73 A;  5COH A;  3UOM A;  3VK9 A;  3VWU A;  4PNF A;  4JRR A;  1TJD A;  3L0H A;  5ELA A;  5KN1 A;  4YQM A;  2JAC A;  2MMO A;  4X0X A;  3Q6O A;  1YKA A;  5G1L A;  2H01 A;  4MZB A;  5B7C A;  2LRN A;  4TKY A;  5HR3 A;  2FA8 A;  3HJM A;  2CVB A;  3US3 A;  1WRY A;  1M2D A;  4AGS A;  3D21 A;  2WJU A;  4G9H A;  3BD2 A;  2H6Z A;  4TRX A;  1QFN A;  5JWR B;  3DIE A;  3IV4 A;  1OVN A;  2YOI A;  2V32 A;  2R3X A;  3H8Q A;  1CQG A;  4K7N A;  1TOF A;  4K9Z A;  2B5Y A;  4K7I A;  5ID2 B;  2GVP A;  2X8H A;  1R7H A;  1XIY A;  2AAW A;  4I97 A;  1Z6M A;  1XW9 A;  1I5G A;  1V57 A;  1M9B A;  1QXH A;  3UAP A;  5B6N A;  1ZYQ B;  3AY8 A;  3P2A A;  4GRF A;  3UEM A;  2NVL A;  3KMN A;  2R6K A;  1K0M A;  4O7H A;  1EP8 A;  4N0V A;  1E6B A;  4J57 E;  4RUV A;  11GS A;  4I6X A;  3GRX A;  2GZZ A;  3QAG A;  1TU8 A;  4DSQ A;  1ST9 A;  1BED A;  3E0U A;  3TRQ A;  1SEN A;  1A2L A;  1SKW B;  5DAK B;  2LV3 A;  2H70 A;  4E8H A;  2NTO A;  4L5O A;  2R2J A;  3WGE A;  1NSW A;  2C0D A;  4MZC A;  4HOJ A;  2GSR A;  3EE2 A;  1B4Q A;  1PX6 A;  3FHK A;  5IMC A;  3ME7 A;  3GSS A;  3F4R A;  4HJ2 A;  2F3M A;  5J9C A;  4MK3 A;  4XS4 A;  2DSA A;  1AQW A;  5GAP D;  5DVB A;  4PX1 A;  1GTA A;  2F8F A;  3I43 A;  3DML A;  3F8U A;  2O8V B;  1A2J A;  1SJZ A;  4MDC A;  3CSI A;  3GTU B;  3HDC A;  4POL A;  4BVY A;  2WFC A;  3ZL5 A;  1NW2 A;  4E8E A;  1GSF A;  1JZW A;  3J7Y b;  3WT2 A;  1R5A A;  1XWG A;  1KEB A;  1JLV A;  2QC7 A;  1V9W A;  4TXV A;  4EF0 A;  2CVD A;  4XTS A;  1AXD A;  2GST A;  3CSH A;  2PMT A;  4OMV A;  3F3Q A;  3GUS A;  3QOU A;  2HYX A;  1SK2 A;  4PQH A;  2DIY A;  2GQK A;  1FHE A;  2C0G A;  4POK A;  2FCH A;  1FW1 A;  4PXO A;  4O32 A;  2YZH A;  4QL7 A;  4N10 A;  3D4T A;  3ZTL A;  2JZS A;  3APS A;  3IE3 A;  2YCD A;  5CO3 A;  2ES7 A;  5ECS A;  1F3B A;  4JE1 A;  1SJI A;  5HFK A;  3H79 A;  1Z7R A;  3G7J A;  2TRX A;  2H66 A;  1O6J A;  1U3A A;  1Z9H A;  4ZB6 A;  2GZY A;  4G19 A;  1H75 A;  2L6D A;  2LNT A;  1F9M A;  2L57 A;  2PU9 C;  2NBS A;  3A5W A;  2H1B A;  5C00 A;  3CYN A;  1B8X A;  2XPE A;  1PKZ A;  1YZX A;  2JU5 A;  5HFI A;  4GQF A;  3TJF A;  4CDO A;  2R37 A;  3WGX A;  3P8W A;  2X8G A;  4F03 A;  3D22 A;  2IFQ A;  2KLX A;  4CHS A;  3EC3 A;  1TTZ A;  4MLY A;  1SK1 A;  1R4W A;  5IMD A;  3L9V A;  1VRS D;  5INY A;  3APO A;  1ZOF A;  1ML6 A;  3DVX A;  1X9S B;  5F06 A;  4ZXG A;  2CZ3 A;  1URM A;  1ERV A;  3IK7 A;  2ON5 A;  4JR6 A;  4OCE A;  2QKE A;  4MH2 A;  1OKD A;  1ZL9 A;  1K0N A;  3LG6 A;  5B8B A;  2DJ2 A;  3IK9 A;  5G2Z A;  4NMU A;  2VM2 A;  4MJC A;  1N8J A;  4V2M A;  3W8S A;  2GQM A;  1PMT A;  1X0R A;  2VUP A;  4XS6 A;  4ILF A;  3GMF A;  4IN0 A;  9GSS A;  1YF0 A;  2H6X A;  1M99 A;  5KN2 A;  5JCG A;  1FB6 A;  3M9K A;  2CV4 A;  1A8Y A;  4XRA A;  13GS A;  3C1S A;  4TR4 A;  1C72 A;  2IPA A;  2L4C A;  5H5S A;  4HQS A;  1V58 A;  2VCT A;  3CMI A;  5IO0 A;  1GUL A;  1X9M B;  4AJ6 A;  1B4P A;  1K0C A;  3GIX A;  4JBB A;  4HJM A;  1PSQ A;  4WET A;  3F9U A;  1W89 A;  2KOK A;  3GX0 A;  2CQ9 A;  5ID2 A;  1XWA A;  4ML6 A;  2WZ9 A;  5IOX A;  1XW6 A;  2YN1 A;  2LST A;  4ZL8 A;  1G7E A;  2REM A;  3KH7 A;  3QAW A;  4QL9 A;  4BA7 A;  1WJK A;  2PVO C;  3E3E A;  1GSS A;  2RLI A;  1T4Z A;  3TKS A;  5CP1 A;  4ACS A;  1TRS A;  2C4J A;  1LU4 A;  4I5Q A;  1RK4 A;  3TKR A;  5ECR B;  1XFL A;  4KB3 A;  1HD2 A;  2OE0 A;  2VCZ A;  5DAK A;  4MZW A;  2MMZ A;  1PKW A;  2LUS A;  3IAM 2;  2GGT A;  2YPM A;  2B1K A;  5HR0 A;  5H5R A;  1MDI A;  2PWJ A;  2A2R A;  2QGV A;  1WP0 A;  6GSY A;  1O8W A;  4LMV A;  3HVV A;  2AUV A;  3G9B A;  3F3R A;  3UVT A;  4RQX A;  1SL0 B;  1T1V A;  2ZCT A;  2XBQ A;  5C04 A;  4Q5N A;  2FUG 2;  4QQ7 A;  2JSY A;  3IDV A;  3M8N A;  1TKD B;  3HJP A;  2YP6 A;  2DJ3 A;  2CAI A;  2C0F A;  3GTU A;  3VFI A;  1SKR B;  2H72 A;  1XW5 A;  1Z3E A;  5CRH A;  5CRD A;  4GSN A;  2V6O A;  2CX4 A;  5EPF A;  3HXS A;  2CAQ A;  1K3L A;  3FZ5 A;  4TOP A;  4IJI A;  1PQN A;  1JHB A;  6GST A;  1V40 A;  3HHV A;  1EEJ A;  2MBS A;  2YZU A;  4FYC A;  6GSW A;  2LQO A;  4JZQ A;  1EP7 A;  3QDN A;  2LQQ A;  3EUR A;  1OE8 A;  4MJE A;  2LJR A;  3I9V 2;  4Q5Q A;  5DBQ A;  4G10 A;  3VI7 A;  2IJY A;  3RDW A;  3FEU A;  3CBU A;  2JSZ A;  2KUC A;  3LQ7 A;  5CRE A;  2FWF A;  3D0Z A;  4KA0 A;  2CZ2 A;  2HZF A;  4V2N A;  4KH7 A;  1XWC A;  2HZE B;  1OC8 A;  3GKK A;  1UC7 A;  1BX9 A;  1GLQ A;  2N5A A;  2K18 A;  2MMN A;  4MPF A;  3NIV A;  5J9B A;  3TOT A;  3VWX A;  4IVF A;  2O85 A;  3TJG A;  2RUF A;  3HVX A;  1VF1 A;  3BCI A;  3QAV A;  1TI1 A;  2EIR A;  1GSU A;  4HEA 2;  3LWA A;  4FIW A;  3D5J A;  1BG5 A;  2DC5 A;  4O5R A;  4MCU A;  5AN1 A;  5ECK B;  1JLW A;  2M72 A;  4ECJ A;  5JCU A;  2K6V A;  1USB A;  2FD3 A;  2H30 A;  4Z7X A;  2FA4 A;  3C8E A;  1GUH A;  4KW6 A;  3FZ4 A;  3ZZX A;  2OE1 A;  4FYB A;  2BMX A;  2V2G A;  2L59 A;  2C0E A;  4YH2 A;  2M80 A;  3KCM A;  2F51 A;  1R26 A;  4NXI A;  6GSX A;  5G5F A;  1UVZ A;  1GSY A;  2V41 A;  1OC9 B;  5H5Q A;  1JZO A;  4KGI A;  3HZ4 A;  3FZA A;  3EU4 A;  5IPG A;  4FO5 A;  2FNO A;  3HKR A;  1SD9 A;  3KTL A;  1K3O A;  4JU5 A;  1TU7 A;  4IQA A;  4MF6 A;  4WF5 A;  4OO4 A;  2DLX A;  5F07 A;  2YJH A;  1DE2 A;  3TRX A;  4KDU A;  2DJ1 A;  3LGC A;  1TW9 A;  1TP9 A;  5IO2 A;  5LCZ A;  5CRG A;  1AQV A;  3OR5 A;  4L0U A;  5IMV A;  1HNC A;  3RPP A;  4F0C A;  3FRC A;  3S9F A;  2WUL A;  4MAB A;  1FO5 A;  1TRW A;  5DJM A;  1VF4 A;  1X5D A;  3GUR A;  2VLU A;  3L9U A;  3IBH A;  2HXK A;  3C7M A;  3LSZ A;  2GDR A;  4WEY A;  3QR6 A;  2P5R A;  1GNE A;  1VF2 A;  3RHB A;  4J56 E;  2P0G A;  2VL9 A;  5DQS A;  1MDK A;  1QMV A;  1XWB A;  1PL2 A;  2L5O A;  3DVW A;  5JWQ B;  5ECP B;  3D4M A;  3G7I A;  1J08 A;  5D9V A;  4O92 A;  4GCI A;  2D2Z A;  3RHC A;  1YKC A;  5J4U A;  2VCQ A;  3KIJ A;  18GS A;  2E2M A;  3I69 A;  2LKU A;  5CNW A;  3O76 A;  4ZBD A;  3NOF A;  4JED A;  10GS A;  2YAN A;  1Q98 A;  2IMI A;  2AHE A;  1XXU A;  5FT3 A;  4KSM A;  1SL1 B;  3BBY A;  3GKN A;  3EVI A;  3BOA A;  1XVW A;  4IHU A;  3IHQ A;  5G1K A;  4PUF C;  3RAZ A;  2IMF A;  4D73 A;  4MA9 A;  3QFA C;  3APQ A;  1K0D A;  3L9S A;  4WBR D;  3IR4 A;  2CT6 A;  1OYJ A;  3N9J A;  1SL2 B;  3GFK A;  1EGR A;  2VL2 C;  3QCP A;  3EMX A;  3M3M A;  4L0W A;  1GTI A;  4GSS A;  1MD3 A;  4NV2 A;  3ERG A;  1GWC A;  4IS0 A;  1T4Y A;  5EL8 A;  2J23 A;  2AB6 A;  2HFD A;  4MJA A;  1FB0 A;  2FHE A;  3CXG A;  1O7U A;  4RI6 A;  3RPN A;  2OA7 A;  4EKZ A;  3MDK A;  2IMK A;  1WIK A;  4BPY A;  1SD8 A;  2A4V A;  5DCH A;  2H73 A;  2QSI A;  3KXO A;  4OO5 A;  5D8I A;  4EXJ A;  4EDZ A;  2VLT A;  2VLV A;  3UBL A;  4AJ8 A;  4POB A;  2HZE A;  5ECL B;  1DSB A;  1ZGN A;  4EC0 A;  3GV1 A;  2FWE A;  1ERW A;  1NHY A;  3ZRE A;  4PUR A;  3K8N A;  3VLN A;  1H4O A;  1TRV A;  1GUK A;  4NAX A;  4HDE A;  5DAL B;  4HZ4 A;  1O85 A;  3BJ5 A;  1R5P A;  5G5E A;  2TRC P;  1SJ6 A;  3H4K A;  1KBN A;  1GTU A;  1GP1 A;  2B7K A;  1AC1 A;  1XOB A;  2C80 A;  4BVX A;  1Y25 A;  4J2F A;  1OE7 A;  5IPH A;  3ZVJ D;  4FYU A;  4XHM A;  4H86 A;  3G7Y A;  2MYG A;  1B48 A;  2HI7 A;  4BWS A;  3TKS E;  3UIW A;  2VO4 A;  2H0H A;  2HLS A;  4EL1 A;  2ON7 A;  4PQI A;  2EIQ A;  5CYY A;  5A4W A;  3DD3 A;  5DQY A;  3LYK A;  4Q5R A;  2FWH A;  4K0G A;  4BL7 A;  4ZL9 A;  4MP4 A;  4MPG A;  4L5L A;  1OC9 A;  4BWQ A;  1IYI A;  3UJ1 A;  1EV9 A;  14GS A;  2O89 A;  4IKH A;  1RW1 A;  2H19 A;  1NHO A;  4ECC A;  2F8A A;  3LXZ A;  5F8B A;  4K6X A;  3TB2 A;  3ZIV A;  3UVH A;  1U6T A;  3FY7 A;  1ZMA A;  3M9J A;  1BAY A;  2WRT A;  3LOR A;  3M1G A;  4AF2 A;  1O8X A;  3SBC A;  1X9W B;  2RM5 A;  2DBC A;  4KE3 A;  3GA4 A;  5ELG A;  2LJK A;  2C8U A;  2C3Q A;  4KDY A;  3JCM L;  3FYG A;  1SK0 A;  5D9T A;  3FR9 A;  2IWT A;  1S3C A;  2GT5 A;  5IOW A;  2IME A;  1QGV A;  2H6Y A;  3TCO A;  4DVC A;  2XPD A;  5JCW A;  1J0F A;  2JZR A;  3ERF A;  2GZP A;  4TXO B;  3ZIJ A;  1GRX A;  3ZFL A;  3ZLP A;  3O3T A;  3TJK A; 
#chains in the Genus database with same CATH topology
 2PVQ A;  6GSS A;  3H93 A;  1S3R A;  3QD9 A;  1CQH A;  3GNJ A;  2H0I A;  1XZO A;  1QK8 A;  3F4T A;  4DSR A;  4POM A;  5J41 A;  2KP2 A;  2H71 A;  1WMJ A;  3GHA A;  1MD4 A;  3KEB A;  1EGO A;  1HNB A;  2H1D A;  4IJ3 A;  1F3A A;  1UA5 A;  3IXR A;  2LEG A;  3FK8 A;  2NDO A;  3IAS 2;  3HA9 A;  2K8V A;  4EUY A;  3PR8 A;  1YEP A;  2V1M A;  2MMA A;  3QFB C;  3ZYW A;  4F9Z A;  2CVK A;  1M2B A;  4K8M A;  5CRW A;  3L4N A;  1ABA A;  3KP9 A;  3A5I A;  3GN3 A;  2DKH A;  1PRX A;  2BTO T;  1ON4 A;  2YWI A;  3HZ8 A;  4GST A;  2RII A;  3IA1 A;  1QUW A;  2QA2 A;  8GSS A;  2YJ7 A;  3C71 A;  3ME8 A;  2FLS A;  3FR6 A;  4EO3 A;  1A23 A;  3DRN A;  2LRT A;  1TI3 A;  1FVK A;  3P7X A;  6GSV A;  5LD0 A;  5HR1 A;  1HNA A;  4V1A p;  2DMM A;  4TW5 A;  3WGD A;  2WGR A;  1JZR A;  3MSZ A;  2I1U A;  4YKG A;  3WD6 A;  2A2P A;  3R2Q A;  3C1R A;  2CA8 A;  4GTU A;  2PPT A;  5D93 A;  3ZFB A;  3D6I A;  2GSS A;  4IEL A;  3RBT A;  5AIX A;  3LYP A;  3FZ9 A;  3LEF A;  4HQZ A;  1FVJ A;  4TR1 B;  5G30 A;  2PGT A;  16GS A;  3O6T A;  3IPZ A;  1PGT A;  3H1N A;  2YWO A;  2I3Y A;  5B6M A;  3A2W A;  3V1W A;  5IMF A;  4KSO A;  4LLR A;  4ZBB A;  2YWN A;  4IGJ A;  3DEX A;  3DYR A;  4PNG A;  1GSQ A;  5EVO A;  5LNK e;  3SWL A;  4ECI A;  4WR5 A;  1VGL A;  3F0I A;  5DDL A;  4EE0 A;  17GS A;  3FMW A;  4ZIJ A;  1LBK A;  5IM9 A;  1XBS A;  1PA3 A;  1S3D A;  1O73 A;  3ZRD A;  2C3T A;  4WKW A;  2HSH A;  1WOU A;  3CSJ A;  4HI7 A;  5DAL A;  5FHI A;  2VOC A;  4LMW A;  1U87 A;  2PN8 A;  5ABR A;  2OKA A;  1Z7P A;  4P3Y B;  2Z9S A;  3UAR A;  2V6K A;  4GF0 A;  1PD2 1;  3ERW A;  1M9A A;  2HT9 A;  3CTF A;  2PER A;  2GT6 A;  2AV4 A;  3NZN A;  3KMO A;  1QQ2 A;  5ECN B;  2WDU A;  2B6M A;  5IMZ A;  3WT1 A;  3KZQ A;  1U88 A;  1OAZ A;  2GTU A;  3GST A;  1HYU A;  5BMU A;  4PUA A;  3Q74 A;  4TR0 A;  2OBI A;  2X99 A;  4OCF A;  4LL4 B;  1GTB A;  3GKM A;  2IL3 A;  2TIR A;  4L8E A;  20GS A;  3TKS C;  2O7K A;  2LRC A;  4DSS B;  5HR2 A;  2J9H A;  2KP1 A;  2B3S A;  2JAD A;  2B1L A;  3GYK A;  3GH6 A;  1J9B A;  3TDG A;  3UMA A;  4KF9 A;  4TR3 A;  1F2E A;  2XHF A;  3TJJ A;  2CX3 A;  4GXZ A;  4KX4 A;  4O5U A;  1TDI A;  2JZT A;  2H1G A;  2G0F A;  4N30 A;  4F82 A;  5IMA A;  5IQY A;  1E2Y A;  5A4U A;  1KNG A;  2E0Q A;  4KCE A;  1BJX A;  1YY7 A;  1V2A A;  1WPI A;  1EOH A;  1ZYN A;  1GL8 A;  2C3N A;  2VCW A;  2XC2 A;  2GSQ A;  1ERU A;  1B9X C;  5KN3 A;  3F6D A;  1MEK A;  1BYE A;  1A24 A;  1N2A A;  3CRU A;  5GAN D;  1NM3 A;  1FAA A;  2GQL A;  5J3R A;  2YV9 A;  1IYH A;  4TXO A;  2VCV A;  3U5R E;  3ISO A;  1Z5Y E;  3UBK A;  4F2I A;  1AAZ A;  2I81 A;  22GS A;  1O81 A;  2G2Q A;  5FWG A;  3L78 A;  1EEM A;  4FQU A;  2OAC A;  4GLT A;  1XCC A;  1EWX A;  1XOA A;  3A3T A;  4IW9 A;  2OJL A;  4YAV A;  2H8L A;  3FW2 A;  3HY2 A;  5ECI B;  4IP1 A;  5AGY A;  5A4V A;  1YQ1 A;  2B7J A;  1RQM A;  5D96 A;  2VD0 A;  3TKP A;  2B5X A;  2E2G A;  5GSS A;  4HZ2 A;  1ZCP A;  4HUA A;  4ML1 A;  3M0F A;  4I2T A;  1VF3 A;  1WWJ A;  2OBK A;  2AJQ B;  2DIZ A;  2O87 A;  3BCK A;  3KM6 A;  5EY6 A;  2X8C A;  5GZZ B;  1FOV A;  3GL3 A;  1TK5 B;  3ZVJ A;  3EMP A;  3GX8 A;  5DCG A;  1THO A;  4K1F A;  4TN8 A;  5ECQ B;  2FWG A;  2DJJ A;  3PH9 A;  1Y6E A;  3IC4 A;  4IBP A;  2OE3 A;  2LJA A;  1M3I A;  2BJX A;  19GS A;  2HE3 A;  3FR3 A;  1F37 A;  1G6W A;  2R0G A;  1G0T A;  1K3Y A;  1ZZY A;  2VL3 A;  2F9S A;  1XWK A;  4OFT A;  2VAF A;  4OFN A;  4OWY A;  4ZIL A;  3F4S A;  2P5Q A;  2K9F A;  1Q4J A;  4TR1 A;  2VCX A;  3J7Y k;  4EDY A;  1AW9 A;  4I2U A;  2RUE A;  4HU9 A;  2VIM A;  4KND A;  4RI7 A;  4WBJ A;  2YV7 A;  2YNX A;  4YKF A;  1GH2 A;  5HQP A;  2H74 A;  1HQO A;  4K7O A;  3A2V A;  4N0Z A;  1K0O A;  3VPQ A;  1AUC A;  5KEJ A;  3EU3 A;  1V98 A;  4WF4 A;  4Q5F A;  1A2M A;  1ZYE A;  3VUR A;  2H75 A;  3I6A A;  4HS1 A;  2I9H A;  3F6F A;  1GNW A;  1OKT A;  1WE0 A;  3E9J B;  1TRU A;  2LTK A;  1ILO A;  4LL1 B;  4I8B A;  4ULX A;  4ZB8 A;  5ECO B;  1M7T A;  4NV5 A;  1TK0 B;  5HFG A;  3HYP A;  2IN3 A;  4ISD A;  5D9W A;  3GL5 A;  2P31 A;  1DBY A;  2ALB A;  4K2D A;  2VM1 A;  4AJ7 A;  3PGT A;  5E4W A;  3UL3 A;  2GS3 A;  2LS5 A;  2N5F A;  3W6G A;  1I9D A;  2PBJ A;  3HCZ A;  5D9X A;  4XRD A;  3Q18 A;  2H1A A;  1JFU A;  1MTC A;  1PL1 A;  4BIK A;  2R4V A;  3KTB A;  5D73 A;  2WS2 A;  6GSU A;  2HSY A;  2R5G A;  3DKS A;  1XPV A;  3FKF A;  2FGX A;  4OD7 A;  4IQ1 A;  5ENU A;  5GST A;  2RM6 A;  3EYT A;  1S3A A;  1K0A A;  2IMD A;  5IIZ A;  3HVS A;  5AIS A;  5F0G A;  3KD0 A;  2HRN A;  1SKS B;  2HSM A;  4DSS A;  1TXX A;  3IOS A;  5J5N A;  3W8J A;  1A0F A;  4WXT A;  1GLP A;  3MAK A;  12GS A;  2ZUP A;  4WR4 A;  1X5E A;  5JWO B;  3QPM A;  3TGZ A;  1Z6N A;  4HU7 A;  2WB9 A;  1JZD A;  3VWV A;  3VPT A;  1X5C A;  1XVQ A;  1GSE A;  4ZL7 A;  1EOG A;  3VI5 A;  2R0P A;  3LXT A;  1AIU A;  1GUM A;  2H0G A;  3ED3 A;  4ZB9 A;  1THX A;  1YEX A;  3LJR A;  1G7O A;  2K8S A;  1TK8 B;  2XBI A;  3GKX A;  3A2X A;  1YDK A;  4XCS A;  1PN0 A;  2X64 A;  4GQC A;  3IHG A;  3KP8 A;  4KUN A;  4YAP A;  4MMM A;  2KHP A;  4K5R A;  1A8L A;  1W4V A;  5AIV A;  3N5O A;  1ACV A;  2DJK A;  4RQR A;  2B5E A;  1EZK A;  4NWY A;  4XS4 B;  4OFM A;  4KAE A;  2A2S A;  1ERT A;  4GWR A;  4V1A g;  3ZML A;  4JR4 A;  3ZMK A;  1U3I A;  4NHW A;  3LW9 A;  4IP6 A;  4G2E A;  2PUK C;  1AQX A;  1SU9 A;  1LJR A;  2NPB A;  4PGT A;  1PN9 A;  3TRP A;  1B9Y C;  4BVY B;  4TVE A;  3PIN A;  3TKQ A;  4D73 B;  1GSD A;  3DWV A;  4K0N A;  4DEJ A;  3KH9 A;  2EC4 A;  2HRF A;  5CAX A;  3DGQ A;  3U6V A;  1SYX A;  3P90 A;  3EIN A;  5G31 A;  3VWW A;  4PQ1 A;  1DUG A;  1MDJ A;  1T7P B;  3HD5 A;  1EV4 A;  2FY6 A;  4MJB A;  4A5P A;  1M2A A;  5DJL A;  2M46 A;  2HNL A;  4NPB A;  2WCI A;  3CRT A;  4ID0 A;  7GSS A;  5KN0 A;  2DML A;  3HJO A;  5ECH B;  3TJB A;  4EVM A;  1DE1 A;  4NHZ A;  3DXB A;  3EWL A;  2YWM A;  4N11 A;  1G6Y A;  3F63 A;  2IIY A;  3QMX A;  2I4A A;  2DJ0 A;  2C1Y A;  5E59 A;  1UN2 A;  4MF5 A;  4YQU A;  4LA1 A;  5A5K A;  2LNS A;  5L71 A;  3CTG A;  2L5L A;  1YJ6 A;  2E7P A;  5B8A A;  1FG4 A;  5F05 A;  4X43 A;  2AYT A;  4FH8 A;  3LFL A;  4KDX A;  2ZNM A;  1T3B A;  1PX7 A;  3WYW A;  1T8E B;  3GH9 A;  3KGK A;  2VL2 A;  2EIO A;  4X4J A;  1F6M C;  3MWH A;  1OC3 A;  1KTE A;  5ECM B;  2MZC A;  2OAD A;  4XIH A;  2JL4 A;  1K0B A;  2L4Q A;  3KJY A;  2L6C A;  1A0R P;  4CW9 A;  2N5B A;  3IRA A;  4ECB A;  1SYR A;  2IFQ B;  4YQV A;  4MF7 A;  3TOU A;  1T00 A;  2HRK A;  3TUE A;  2H76 A;  4F0B A;  2GLR A;  4V2L A;  3MNG A;  3Q19 A;  2VD1 A;  4MH3 A;  1M0U A;  1YF1 A;  4KCA A;  4XS1 A;  3ZIT A;  2MBT A;  4X1U A;  1BQ7 A;  4HSC X;  4ZBA A;  4G0L A;  3C73 A;  5COH A;  3UOM A;  3VK9 A;  3VWU A;  4PNF A;  4JRR A;  1TJD A;  3L0H A;  5ELA A;  5KN1 A;  3PPU A;  4YQM A;  2JAC A;  2MMO A;  2UZ8 A;  4X0X A;  3Q6O A;  1YKA A;  5G1L A;  2H01 A;  4MZB A;  5B7C A;  2LRN A;  4TKY A;  5HR3 A;  5KOX A;  2FA8 A;  3HJM A;  2CVB A;  3US3 A;  1WRY A;  1M2D A;  4AGS A;  3D21 A;  2WJU A;  4G9H A;  3BD2 A;  2H6Z A;  4TRX A;  1QFN A;  5JWR B;  3DIE A;  3IV4 A;  1OVN A;  2YOI A;  2V32 A;  2R3X A;  3H8Q A;  1CQG A;  4K7N A;  1TOF A;  4K9Z A;  2B5Y A;  4K7I A;  5ID2 B;  2GVP A;  2X8H A;  1R7H A;  1XIY A;  2AAW A;  4I97 A;  1Z6M A;  1XW9 A;  1I5G A;  1V57 A;  1M9B A;  1QXH A;  3UAP A;  5B6N A;  1ZYQ B;  3AY8 A;  3P2A A;  4GRF A;  3UEM A;  2NVL A;  3KMN A;  2R6K A;  1K0M A;  4O7H A;  1EP8 A;  4N0V A;  1E6B A;  4J57 E;  4RUV A;  11GS A;  4I6X A;  3GRX A;  2GZZ A;  3QAG A;  4K5S A;  1TU8 A;  2A4H A;  4DSQ A;  1ST9 A;  1BED A;  3E0U A;  4Z2T A;  3TRQ A;  4Z2U A;  1SEN A;  1A2L A;  1SKW B;  5DAK B;  2LV3 A;  2H70 A;  4E8H A;  2NTO A;  4L5O A;  2R2J A;  3WGE A;  1NSW A;  2C0D A;  4MZC A;  4HOJ A;  4CY8 A;  2GSR A;  3EE2 A;  1B4Q A;  1PX6 A;  3FHK A;  2DKI A;  5IMC A;  3ME7 A;  3GSS A;  3F4R A;  4HJ2 A;  2F3M A;  5J9C A;  4MK3 A;  4XS4 A;  2DSA A;  1AQW A;  5GAP D;  5DVB A;  4PX1 A;  1GTA A;  2F8F A;  3I43 A;  3DML A;  3F8U A;  2O8V B;  1A2J A;  1SJZ A;  4MDC A;  3CSI A;  3GTU B;  3HDC A;  4POL A;  4BVY A;  2WFC A;  4EIP A;  3ZL5 A;  1NW2 A;  4E8E A;  3R3E A;  1GSF A;  5KOW A;  1JZW A;  3J7Y b;  3WT2 A;  1R5A A;  1XWG A;  1KEB A;  1JLV A;  2QC7 A;  1V9W A;  4TXV A;  4EF0 A;  2CVD A;  4XTS A;  1AXD A;  2GST A;  3CSH A;  2PMT A;  4OMV A;  3F3Q A;  1PFO A;  3GUS A;  3QOU A;  2HYX A;  1SK2 A;  4PQH A;  2DIY A;  2GQK A;  1FHE A;  2C0G A;  4POK A;  2FCH A;  1FW1 A;  4PXO A;  4O32 A;  2YZH A;  4QL7 A;  4N10 A;  3D4T A;  3ZTL A;  2JZS A;  3APS A;  3IE3 A;  2YCD A;  5CO3 A;  2ES7 A;  5ECS A;  1F3B A;  4JE1 A;  1SJI A;  5HFK A;  3H79 A;  1Z7R A;  3G7J A;  2TRX A;  2H66 A;  1O6J A;  1U3A A;  1Z9H A;  4ZB6 A;  2GZY A;  4G19 A;  1H75 A;  2L6D A;  2LNT A;  1F9M A;  2L57 A;  1M3J A;  2PU9 C;  2NBS A;  3A5W A;  2H1B A;  5C00 A;  3CYN A;  1B8X A;  2XPE A;  1PKZ A;  4PTS A;  1YZX A;  2JU5 A;  5HFI A;  4GQF A;  3TJF A;  4CDO A;  2R37 A;  3WGX A;  3P8W A;  2X8G A;  4F03 A;  3D22 A;  2IFQ A;  2KLX A;  4CHS A;  3EC3 A;  1TTZ A;  4MLY A;  1SK1 A;  1R4W A;  5IMD A;  3L9V A;  1VRS D;  3MYD A;  5INY A;  3APO A;  1ZOF A;  1ML6 A;  3DVX A;  1X9S B;  5F06 A;  4ZXG A;  2CZ3 A;  1URM A;  1ERV A;  3IK7 A;  2ON5 A;  4JR6 A;  4OCE A;  2QKE A;  4MH2 A;  1OKD A;  1ZL9 A;  1K0N A;  3LG6 A;  5B8B A;  2DJ2 A;  3IK9 A;  5G2Z A;  4NMU A;  2VM2 A;  4MJC A;  1N8J A;  4V2M A;  3W8S A;  2GQM A;  1PMT A;  1X0R A;  2VUP A;  4XS6 A;  4ILF A;  3GMF A;  4IN0 A;  9GSS A;  1YF0 A;  2H6X A;  1M99 A;  5KN2 A;  1ZYP A;  5JCG A;  1FB6 A;  3M9K A;  2CV4 A;  1A8Y A;  4XRA A;  13GS A;  3C1S A;  4TR4 A;  1C72 A;  2IPA A;  2L4C A;  5H5S A;  4HQS A;  1V58 A;  2VCT A;  3CMI A;  5IO0 A;  1GUL A;  1X9M B;  4AJ6 A;  1B4P A;  1K0C A;  3GIX A;  4JBB A;  4HJM A;  1PSQ A;  4WET A;  3F9U A;  1W89 A;  2KOK A;  3GX0 A;  2X4A A;  2CQ9 A;  5ID2 A;  1XWA A;  4ML6 A;  2WZ9 A;  5IOX A;  1XW6 A;  2YN1 A;  2LST A;  4ZL8 A;  1G7E A;  2REM A;  3KH7 A;  3QAW A;  4QL9 A;  4BA7 A;  1WJK A;  2PVO C;  4O5Q A;  3E3E A;  1GSS A;  2RLI A;  1T4Z A;  3TKS A;  5CP1 A;  4ACS A;  1TRS A;  2C4J A;  1LU4 A;  4I5Q A;  1RK4 A;  3TKR A;  5ECR B;  1XFL A;  4KB3 A;  1HD2 A;  2OE0 A;  2VCZ A;  5DAK A;  4MZW A;  2MMZ A;  1PKW A;  2LUS A;  3IAM 2;  2GGT A;  2YPM A;  2B1K A;  4MNN A;  5HR0 A;  5H5R A;  1MDI A;  2PWJ A;  2A2R A;  2QGV A;  1WP0 A;  6GSY A;  1O8W A;  4LMV A;  3HVV A;  2AUV A;  3G9B A;  3F3R A;  3UVT A;  4RQX A;  1SL0 B;  1T1V A;  2ZCT A;  2XBQ A;  5C04 A;  4Q5N A;  2FUG 2;  4QQ7 A;  2JSY A;  3IDV A;  3M8N A;  1TKD B;  3HJP A;  2YP6 A;  2DJ3 A;  2CAI A;  2C0F A;  3GTU A;  3VFI A;  1SKR B;  2H72 A;  1XW5 A;  1Z3E A;  5CRH A;  5CRD A;  4GSN A;  2V6O A;  2CX4 A;  5EPF A;  3HXS A;  2CAQ A;  1K3L A;  3FZ5 A;  4TOP A;  4IJI A;  1PQN A;  1JHB A;  6GST A;  1V40 A;  3HHV A;  1EEJ A;  2MBS A;  2YZU A;  4FYC A;  6GSW A;  2LQO A;  4JZQ A;  1EP7 A;  1XG8 A;  3QDN A;  2LQQ A;  3EUR A;  4ICY A;  1OE8 A;  4MJE A;  2LJR A;  3I9V 2;  4Q5Q A;  5DBQ A;  4G10 A;  3VI7 A;  2IJY A;  3RDW A;  3FEU A;  3CBU A;  2JSZ A;  2KUC A;  3LQ7 A;  5CRE A;  2FWF A;  3D0Z A;  4KA0 A;  2CZ2 A;  2HZF A;  4V2N A;  4KH7 A;  1XWC A;  2HZE B;  1OC8 A;  3GKK A;  1UC7 A;  1BX9 A;  1GLQ A;  2N5A A;  2K18 A;  2MMN A;  4MPF A;  4CY6 A;  3NIV A;  5J9B A;  3TOT A;  3VWX A;  4IVF A;  2O85 A;  3TJG A;  2RUF A;  3HVX A;  1VF1 A;  3BCI A;  3QAV A;  1TI1 A;  2EIR A;  1GSU A;  4HEA 2;  3HVN A;  3LWA A;  4BVX B;  4FIW A;  3D5J A;  1BG5 A;  2DC5 A;  4O5R A;  4MCU A;  5AN1 A;  5ECK B;  1JLW A;  2M72 A;  4ECJ A;  5JCU A;  2K6V A;  1USB A;  2FD3 A;  2H30 A;  4Z7X A;  2FA4 A;  3C8E A;  1GUH A;  4KW6 A;  3FZ4 A;  3ZZX A;  2OE1 A;  4FYB A;  2BMX A;  2V2G A;  2L59 A;  3CQF A;  2R0C A;  2HRA A;  2C0E A;  4YH2 A;  2M80 A;  3KCM A;  2F51 A;  1R26 A;  4NXI A;  6GSX A;  5G5F A;  1UVZ A;  3EPT A;  4BL7 B;  4K2X A;  1GSY A;  2V41 A;  1OC9 B;  5H5Q A;  1JZO A;  4KGI A;  3HZ4 A;  3FZA A;  3EU4 A;  5IPG A;  4FO5 A;  2FNO A;  3HKR A;  1SD9 A;  3KTL A;  1K3O A;  4JU5 A;  1TU7 A;  4IQA A;  4MF6 A;  4WF5 A;  4OO4 A;  2DLX A;  5F07 A;  2YJH A;  1DE2 A;  3TRX A;  4KDU A;  2DJ1 A;  3LGC A;  1TW9 A;  1TP9 A;  5IO2 A;  5LCZ A;  5CRG A;  1AQV A;  3OR5 A;  1FOH A;  4L0U A;  5IMV A;  1HNC A;  3RPP A;  4F0C A;  3FRC A;  3S9F A;  2WUL A;  4MAB A;  1FO5 A;  1TRW A;  5DJM A;  1VF4 A;  1X5D A;  3GUR A;  2VLU A;  3L9U A;  3IBH A;  2HXK A;  3C7M A;  3LSZ A;  2GDR A;  4WEY A;  3QR6 A;  2P5R A;  1GNE A;  1VF2 A;  3RHB A;  4J56 E;  2P0G A;  2VL9 A;  5DQS A;  1MDK A;  1QMV A;  1XWB A;  1PL2 A;  2L5O A;  3DVW A;  5JWQ B;  5ECP B;  3D4M A;  3G7I A;  1J08 A;  3IC8 A;  5D9V A;  4O92 A;  4GCI A;  2D2Z A;  3RHC A;  1YKC A;  5J4U A;  2VCQ A;  3KIJ A;  18GS A;  2E2M A;  3I69 A;  2LKU A;  2QA1 A;  5CNW A;  3O76 A;  4ZBD A;  3NOF A;  4JED A;  10GS A;  2YAN A;  1Q98 A;  2IMI A;  2AHE A;  1XXU A;  5FT3 A;  4KSM A;  1SL1 B;  3BBY A;  3GKN A;  3EVI A;  3BOA A;  1XVW A;  4IHU A;  3IHQ A;  5G1K A;  4PUF C;  3RAZ A;  2IMF A;  4D73 A;  4MA9 A;  3QFA C;  3APQ A;  3MIX A;  1K0D A;  3L9S A;  4WBR D;  3IR4 A;  2CT6 A;  4G0I A;  1OYJ A;  3N9J A;  1SL2 B;  5BRT A;  3GFK A;  1EGR A;  2VL2 C;  3QCP A;  3EMX A;  2X49 A;  3M3M A;  4L0W A;  1GTI A;  4GSS A;  1MD3 A;  4NV2 A;  3ERG A;  1GWC A;  4IS0 A;  1T4Y A;  5EL8 A;  2J23 A;  2AB6 A;  2HFD A;  4MJA A;  1FB0 A;  4EIQ A;  2FHE A;  3CXG A;  1O7U A;  4RI6 A;  3RPN A;  2OA7 A;  4EKZ A;  3MDK A;  4USS A;  2IMK A;  1WIK A;  4BPY A;  1SD8 A;  2A4V A;  5DCH A;  2H73 A;  2QSI A;  3KXO A;  4OO5 A;  5D8I A;  4EXJ A;  4EDZ A;  2VLT A;  2VLV A;  3UBL A;  4AJ8 A;  4POB A;  2HZE A;  5ECL B;  1DSB A;  1ZGN A;  4EC0 A;  3GV1 A;  2FWE A;  1ERW A;  1NHY A;  3ZRE A;  4PUR A;  3K8N A;  3VLN A;  1H4O A;  1TRV A;  1GUK A;  4NAX A;  4HDE A;  5DAL B;  4HZ4 A;  1O85 A;  3BJ5 A;  1R5P A;  5G5E A;  2TRC P;  1SJ6 A;  3H4K A;  1KBN A;  1GTU A;  1GP1 A;  2B7K A;  1AC1 A;  1XOB A;  2C80 A;  4BVX A;  1Y25 A;  4J2F A;  1OE7 A;  5IPH A;  3ZVJ D;  4FYU A;  4XHM A;  4H86 A;  3G7Y A;  2MYG A;  1B48 A;  2HI7 A;  4BWS A;  3TKS E;  3UIW A;  4G0K A;  2VO4 A;  2H0H A;  2HLS A;  4EL1 A;  2ON7 A;  4PQI A;  2EIQ A;  5CYY A;  5A4W A;  3DD3 A;  5DQY A;  3LYK A;  4Q5R A;  2FWH A;  4K0G A;  4BL7 A;  4ZL9 A;  4MP4 A;  4MPG A;  4L5L A;  1OC9 A;  4BWQ A;  1IYI A;  3UJ1 A;  1EV9 A;  14GS A;  2O89 A;  4IKH A;  1RW1 A;  2H19 A;  1NHO A;  4ECC A;  2F8A A;  3LXZ A;  4Z2R A;  5F8B A;  4K6X A;  3TB2 A;  3ZIV A;  3UVH A;  1U6T A;  3FY7 A;  1ZMA A;  3M9J A;  1BAY A;  2WRT A;  3LOR A;  3M1G A;  4AF2 A;  1O8X A;  3SBC A;  1X9W B;  2RM5 A;  2DBC A;  4KE3 A;  3GA4 A;  5ELG A;  2LJK A;  2C8U A;  2C3Q A;  4KDY A;  3JCM L;  3FYG A;  1SK0 A;  5D9T A;  3FR9 A;  2IWT A;  1S3C A;  2GT5 A;  5IOW A;  2IME A;  1QGV A;  2H6Y A;  3TCO A;  4DVC A;  2XPD A;  5JCW A;  1J0F A;  2JZR A;  3ERF A;  2GZP A;  4TXO B;  3ZIJ A;  1GRX A;  3ZFL A;  3ZLP A;  3O3T A;  3TJK A; 
#chains in the Genus database with same CATH homology
 2PVQ A;  6GSS A;  3H93 A;  3QD9 A;  1CQH A;  3GNJ A;  2H0I A;  1XZO A;  1QK8 A;  3F4T A;  4DSR A;  4POM A;  5J41 A;  2KP2 A;  2H71 A;  1WMJ A;  3GHA A;  1MD4 A;  3KEB A;  1EGO A;  1HNB A;  2H1D A;  4IJ3 A;  1F3A A;  1UA5 A;  3IXR A;  2LEG A;  3FK8 A;  2NDO A;  3IAS 2;  3HA9 A;  2K8V A;  4EUY A;  3PR8 A;  1YEP A;  2V1M A;  2MMA A;  3QFB C;  3ZYW A;  4F9Z A;  2CVK A;  1M2B A;  4K8M A;  5CRW A;  3L4N A;  1ABA A;  3KP9 A;  3A5I A;  3GN3 A;  2DKH A;  1PRX A;  2BTO T;  1ON4 A;  2YWI A;  3HZ8 A;  4GST A;  2RII A;  3IA1 A;  1QUW A;  2QA2 A;  8GSS A;  2YJ7 A;  3C71 A;  3ME8 A;  2FLS A;  3FR6 A;  4EO3 A;  1A23 A;  3DRN A;  2LRT A;  1TI3 A;  1FVK A;  3P7X A;  6GSV A;  5LD0 A;  5HR1 A;  1HNA A;  4V1A p;  2DMM A;  4TW5 A;  3WGD A;  2WGR A;  1JZR A;  3MSZ A;  2I1U A;  4YKG A;  3WD6 A;  2A2P A;  3R2Q A;  3C1R A;  2CA8 A;  4GTU A;  2PPT A;  5D93 A;  3ZFB A;  3D6I A;  2GSS A;  4IEL A;  3RBT A;  5AIX A;  3LYP A;  3FZ9 A;  3LEF A;  4HQZ A;  1FVJ A;  4TR1 B;  5G30 A;  2PGT A;  16GS A;  3O6T A;  3IPZ A;  1PGT A;  3H1N A;  2YWO A;  2I3Y A;  5B6M A;  3A2W A;  3V1W A;  5IMF A;  4KSO A;  4LLR A;  4ZBB A;  2YWN A;  4IGJ A;  3DEX A;  3DYR A;  4PNG A;  1GSQ A;  5EVO A;  5LNK e;  3SWL A;  4ECI A;  4WR5 A;  1VGL A;  3F0I A;  5DDL A;  4EE0 A;  17GS A;  3FMW A;  4ZIJ A;  1LBK A;  5IM9 A;  1XBS A;  1PA3 A;  1S3D A;  1O73 A;  3ZRD A;  2C3T A;  4WKW A;  2HSH A;  1WOU A;  3CSJ A;  4HI7 A;  5DAL A;  5FHI A;  2VOC A;  4LMW A;  1U87 A;  2PN8 A;  5ABR A;  2OKA A;  1Z7P A;  4P3Y B;  2Z9S A;  3UAR A;  2V6K A;  4GF0 A;  1PD2 1;  3ERW A;  1M9A A;  2HT9 A;  3CTF A;  2PER A;  2GT6 A;  2AV4 A;  3NZN A;  3KMO A;  1QQ2 A;  5ECN B;  2WDU A;  2B6M A;  5IMZ A;  3WT1 A;  3KZQ A;  1U88 A;  1OAZ A;  2GTU A;  3GST A;  1HYU A;  5BMU A;  4PUA A;  3Q74 A;  4TR0 A;  2OBI A;  2X99 A;  4OCF A;  4LL4 B;  1GTB A;  3GKM A;  2IL3 A;  2TIR A;  4L8E A;  20GS A;  3TKS C;  2O7K A;  2LRC A;  4DSS B;  5HR2 A;  2J9H A;  2KP1 A;  2B3S A;  2JAD A;  2B1L A;  3GYK A;  3GH6 A;  1J9B A;  3TDG A;  3UMA A;  4KF9 A;  4TR3 A;  1F2E A;  2XHF A;  3TJJ A;  2CX3 A;  4GXZ A;  4KX4 A;  4O5U A;  1TDI A;  2JZT A;  2H1G A;  2G0F A;  4N30 A;  4F82 A;  5IMA A;  5IQY A;  1E2Y A;  5A4U A;  1KNG A;  2E0Q A;  4KCE A;  1BJX A;  1YY7 A;  1V2A A;  1WPI A;  1EOH A;  1ZYN A;  1GL8 A;  2C3N A;  2VCW A;  2XC2 A;  2GSQ A;  1ERU A;  1B9X C;  5KN3 A;  3F6D A;  1MEK A;  1BYE A;  1A24 A;  1N2A A;  3CRU A;  5GAN D;  1NM3 A;  1FAA A;  2GQL A;  5J3R A;  2YV9 A;  1IYH A;  4TXO A;  2VCV A;  3U5R E;  3ISO A;  1Z5Y E;  3UBK A;  4F2I A;  1AAZ A;  2I81 A;  22GS A;  1O81 A;  2G2Q A;  5FWG A;  3L78 A;  1EEM A;  4FQU A;  2OAC A;  4GLT A;  1XCC A;  1EWX A;  1XOA A;  3A3T A;  4IW9 A;  2OJL A;  4YAV A;  2H8L A;  3FW2 A;  3HY2 A;  5ECI B;  4IP1 A;  5AGY A;  5A4V A;  1YQ1 A;  2B7J A;  1RQM A;  5D96 A;  2VD0 A;  3TKP A;  2B5X A;  2E2G A;  5GSS A;  4HZ2 A;  1ZCP A;  4HUA A;  4ML1 A;  3M0F A;  4I2T A;  1VF3 A;  1WWJ A;  2OBK A;  2AJQ B;  2DIZ A;  2O87 A;  3BCK A;  3KM6 A;  5EY6 A;  2X8C A;  5GZZ B;  1FOV A;  3GL3 A;  1TK5 B;  3ZVJ A;  3EMP A;  3GX8 A;  5DCG A;  1THO A;  4K1F A;  4TN8 A;  5ECQ B;  2FWG A;  2DJJ A;  3PH9 A;  1Y6E A;  3IC4 A;  4IBP A;  2OE3 A;  2LJA A;  2BJX A;  19GS A;  2HE3 A;  3FR3 A;  1F37 A;  1G6W A;  2R0G A;  1G0T A;  1K3Y A;  1ZZY A;  2VL3 A;  2F9S A;  1XWK A;  4OFT A;  2VAF A;  4OFN A;  4OWY A;  4ZIL A;  3F4S A;  2P5Q A;  2K9F A;  1Q4J A;  4TR1 A;  2VCX A;  3J7Y k;  4EDY A;  1AW9 A;  4I2U A;  2RUE A;  4HU9 A;  2VIM A;  4KND A;  4RI7 A;  4WBJ A;  2YV7 A;  2YNX A;  4YKF A;  1GH2 A;  5HQP A;  2H74 A;  1HQO A;  4K7O A;  3A2V A;  4N0Z A;  1K0O A;  3VPQ A;  1AUC A;  5KEJ A;  3EU3 A;  1V98 A;  4WF4 A;  4Q5F A;  1A2M A;  1ZYE A;  3VUR A;  2H75 A;  3I6A A;  4HS1 A;  2I9H A;  3F6F A;  1GNW A;  1OKT A;  1WE0 A;  3E9J B;  1TRU A;  2LTK A;  1ILO A;  4LL1 B;  4I8B A;  4ULX A;  4ZB8 A;  5ECO B;  1M7T A;  4NV5 A;  1TK0 B;  5HFG A;  3HYP A;  2IN3 A;  4ISD A;  5D9W A;  3GL5 A;  2P31 A;  1DBY A;  2ALB A;  4K2D A;  2VM1 A;  4AJ7 A;  3PGT A;  5E4W A;  3UL3 A;  2GS3 A;  2LS5 A;  2N5F A;  3W6G A;  1I9D A;  2PBJ A;  3HCZ A;  5D9X A;  4XRD A;  3Q18 A;  2H1A A;  1JFU A;  1MTC A;  1PL1 A;  2R4V A;  3KTB A;  5D73 A;  2WS2 A;  6GSU A;  2HSY A;  2R5G A;  3DKS A;  1XPV A;  3FKF A;  2FGX A;  4OD7 A;  4IQ1 A;  5ENU A;  5GST A;  2RM6 A;  3EYT A;  1S3A A;  1K0A A;  2IMD A;  5IIZ A;  3HVS A;  5AIS A;  5F0G A;  3KD0 A;  2HRN A;  1SKS B;  2HSM A;  4DSS A;  1TXX A;  3IOS A;  5J5N A;  3W8J A;  1A0F A;  4WXT A;  1GLP A;  3MAK A;  12GS A;  2ZUP A;  4WR4 A;  1X5E A;  5JWO B;  3QPM A;  3TGZ A;  1Z6N A;  4HU7 A;  2WB9 A;  1JZD A;  3VWV A;  3VPT A;  1X5C A;  1XVQ A;  1GSE A;  4ZL7 A;  1EOG A;  3VI5 A;  2R0P A;  3LXT A;  1AIU A;  1GUM A;  2H0G A;  3ED3 A;  4ZB9 A;  1THX A;  1YEX A;  3LJR A;  1G7O A;  2K8S A;  1TK8 B;  2XBI A;  3GKX A;  3A2X A;  1YDK A;  4XCS A;  1PN0 A;  2X64 A;  4GQC A;  3IHG A;  3KP8 A;  4KUN A;  4YAP A;  4MMM A;  2KHP A;  4K5R A;  1A8L A;  1W4V A;  5AIV A;  3N5O A;  1ACV A;  2DJK A;  4RQR A;  2B5E A;  1EZK A;  4NWY A;  4XS4 B;  4OFM A;  4KAE A;  2A2S A;  1ERT A;  4GWR A;  4V1A g;  3ZML A;  4JR4 A;  3ZMK A;  1U3I A;  4NHW A;  3LW9 A;  4IP6 A;  4G2E A;  2PUK C;  1AQX A;  1SU9 A;  1LJR A;  2NPB A;  4PGT A;  1PN9 A;  3TRP A;  1B9Y C;  4BVY B;  4TVE A;  3PIN A;  3TKQ A;  4D73 B;  1GSD A;  3DWV A;  4K0N A;  4DEJ A;  3KH9 A;  2EC4 A;  2HRF A;  5CAX A;  3DGQ A;  3U6V A;  1SYX A;  3P90 A;  3EIN A;  5G31 A;  3VWW A;  4PQ1 A;  1DUG A;  1MDJ A;  1T7P B;  3HD5 A;  1EV4 A;  2FY6 A;  4MJB A;  4A5P A;  1M2A A;  5DJL A;  2M46 A;  2HNL A;  4NPB A;  2WCI A;  3CRT A;  4ID0 A;  7GSS A;  5KN0 A;  2DML A;  3HJO A;  5ECH B;  3TJB A;  4EVM A;  1DE1 A;  4NHZ A;  3DXB A;  3EWL A;  2YWM A;  4N11 A;  1G6Y A;  3F63 A;  2IIY A;  3QMX A;  2I4A A;  2DJ0 A;  2C1Y A;  5E59 A;  1UN2 A;  4MF5 A;  4YQU A;  4LA1 A;  5A5K A;  2LNS A;  5L71 A;  3CTG A;  2L5L A;  1YJ6 A;  2E7P A;  5B8A A;  1FG4 A;  5F05 A;  4X43 A;  2AYT A;  4FH8 A;  3LFL A;  4KDX A;  2ZNM A;  1T3B A;  1PX7 A;  3WYW A;  1T8E B;  3GH9 A;  3KGK A;  2VL2 A;  2EIO A;  4X4J A;  1F6M C;  3MWH A;  1OC3 A;  1KTE A;  5ECM B;  2MZC A;  2OAD A;  4XIH A;  2JL4 A;  1K0B A;  2L4Q A;  3KJY A;  2L6C A;  1A0R P;  4CW9 A;  2N5B A;  3IRA A;  4ECB A;  1SYR A;  2IFQ B;  4YQV A;  4MF7 A;  3TOU A;  1T00 A;  2HRK A;  3TUE A;  2H76 A;  4F0B A;  2GLR A;  4V2L A;  3MNG A;  3Q19 A;  2VD1 A;  4MH3 A;  1M0U A;  1YF1 A;  4KCA A;  4XS1 A;  3ZIT A;  2MBT A;  4X1U A;  1BQ7 A;  4ZBA A;  4G0L A;  3C73 A;  5COH A;  3UOM A;  3VK9 A;  3VWU A;  4PNF A;  4JRR A;  1TJD A;  3L0H A;  5ELA A;  5KN1 A;  3PPU A;  4YQM A;  2JAC A;  2MMO A;  2UZ8 A;  4X0X A;  3Q6O A;  1YKA A;  5G1L A;  2H01 A;  4MZB A;  5B7C A;  2LRN A;  4TKY A;  5HR3 A;  5KOX A;  2FA8 A;  3HJM A;  2CVB A;  3US3 A;  1WRY A;  1M2D A;  4AGS A;  3D21 A;  2WJU A;  4G9H A;  3BD2 A;  2H6Z A;  4TRX A;  1QFN A;  5JWR B;  3DIE A;  3IV4 A;  1OVN A;  2YOI A;  2V32 A;  2R3X A;  3H8Q A;  1CQG A;  4K7N A;  1TOF A;  4K9Z A;  2B5Y A;  4K7I A;  5ID2 B;  2GVP A;  2X8H A;  1R7H A;  1XIY A;  2AAW A;  4I97 A;  1Z6M A;  1XW9 A;  1I5G A;  1V57 A;  1M9B A;  1QXH A;  3UAP A;  5B6N A;  1ZYQ B;  3AY8 A;  3P2A A;  4GRF A;  3UEM A;  2NVL A;  3KMN A;  2R6K A;  1K0M A;  4O7H A;  1EP8 A;  4N0V A;  1E6B A;  4J57 E;  4RUV A;  11GS A;  4I6X A;  3GRX A;  2GZZ A;  3QAG A;  4K5S A;  1TU8 A;  2A4H A;  4DSQ A;  1ST9 A;  1BED A;  3E0U A;  4Z2T A;  3TRQ A;  4Z2U A;  1SEN A;  1A2L A;  1SKW B;  5DAK B;  2LV3 A;  2H70 A;  4E8H A;  2NTO A;  4L5O A;  2R2J A;  3WGE A;  1NSW A;  2C0D A;  4MZC A;  4HOJ A;  4CY8 A;  2GSR A;  3EE2 A;  1B4Q A;  1PX6 A;  3FHK A;  2DKI A;  5IMC A;  3ME7 A;  3GSS A;  3F4R A;  4HJ2 A;  2F3M A;  5J9C A;  4MK3 A;  4XS4 A;  2DSA A;  1AQW A;  5GAP D;  5DVB A;  4PX1 A;  1GTA A;  2F8F A;  3I43 A;  3DML A;  3F8U A;  2O8V B;  1A2J A;  1SJZ A;  4MDC A;  3CSI A;  3GTU B;  3HDC A;  4POL A;  4BVY A;  2WFC A;  4EIP A;  3ZL5 A;  1NW2 A;  4E8E A;  3R3E A;  1GSF A;  5KOW A;  1JZW A;  3J7Y b;  3WT2 A;  1R5A A;  1XWG A;  1KEB A;  1JLV A;  2QC7 A;  1V9W A;  4TXV A;  4EF0 A;  2CVD A;  4XTS A;  1AXD A;  2GST A;  3CSH A;  2PMT A;  4OMV A;  3F3Q A;  3GUS A;  3QOU A;  2HYX A;  1SK2 A;  4PQH A;  2DIY A;  2GQK A;  1FHE A;  2C0G A;  4POK A;  2FCH A;  1FW1 A;  4PXO A;  4O32 A;  2YZH A;  4QL7 A;  4N10 A;  3D4T A;  3ZTL A;  2JZS A;  3APS A;  3IE3 A;  2YCD A;  5CO3 A;  2ES7 A;  5ECS A;  1F3B A;  4JE1 A;  1SJI A;  5HFK A;  3H79 A;  1Z7R A;  3G7J A;  2TRX A;  2H66 A;  1O6J A;  1U3A A;  1Z9H A;  4ZB6 A;  2GZY A;  4G19 A;  1H75 A;  2L6D A;  2LNT A;  1F9M A;  2L57 A;  2PU9 C;  2NBS A;  3A5W A;  2H1B A;  5C00 A;  3CYN A;  1B8X A;  2XPE A;  1PKZ A;  4PTS A;  1YZX A;  2JU5 A;  5HFI A;  4GQF A;  3TJF A;  4CDO A;  2R37 A;  3WGX A;  3P8W A;  2X8G A;  4F03 A;  3D22 A;  2IFQ A;  2KLX A;  4CHS A;  3EC3 A;  1TTZ A;  4MLY A;  1SK1 A;  1R4W A;  5IMD A;  3L9V A;  1VRS D;  3MYD A;  5INY A;  3APO A;  1ZOF A;  1ML6 A;  3DVX A;  1X9S B;  5F06 A;  4ZXG A;  2CZ3 A;  1URM A;  1ERV A;  3IK7 A;  2ON5 A;  4JR6 A;  4OCE A;  2QKE A;  4MH2 A;  1OKD A;  1ZL9 A;  1K0N A;  3LG6 A;  5B8B A;  2DJ2 A;  3IK9 A;  5G2Z A;  4NMU A;  2VM2 A;  4MJC A;  1N8J A;  4V2M A;  3W8S A;  2GQM A;  1PMT A;  1X0R A;  2VUP A;  4XS6 A;  4ILF A;  3GMF A;  4IN0 A;  9GSS A;  1YF0 A;  2H6X A;  1M99 A;  5KN2 A;  1ZYP A;  5JCG A;  1FB6 A;  3M9K A;  2CV4 A;  1A8Y A;  4XRA A;  13GS A;  3C1S A;  4TR4 A;  1C72 A;  2IPA A;  2L4C A;  5H5S A;  4HQS A;  1V58 A;  2VCT A;  3CMI A;  5IO0 A;  1GUL A;  1X9M B;  4AJ6 A;  1B4P A;  1K0C A;  3GIX A;  4JBB A;  4HJM A;  1PSQ A;  4WET A;  3F9U A;  1W89 A;  2KOK A;  3GX0 A;  2X4A A;  2CQ9 A;  5ID2 A;  1XWA A;  4ML6 A;  2WZ9 A;  5IOX A;  1XW6 A;  2YN1 A;  2LST A;  4ZL8 A;  1G7E A;  2REM A;  3KH7 A;  3QAW A;  4QL9 A;  4BA7 A;  1WJK A;  2PVO C;  4O5Q A;  3E3E A;  1GSS A;  2RLI A;  1T4Z A;  3TKS A;  5CP1 A;  4ACS A;  1TRS A;  2C4J A;  1LU4 A;  4I5Q A;  1RK4 A;  3TKR A;  5ECR B;  1XFL A;  4KB3 A;  1HD2 A;  2OE0 A;  2VCZ A;  5DAK A;  4MZW A;  2MMZ A;  1PKW A;  2LUS A;  3IAM 2;  2GGT A;  2YPM A;  2B1K A;  4MNN A;  5HR0 A;  5H5R A;  1MDI A;  2PWJ A;  2A2R A;  2QGV A;  1WP0 A;  6GSY A;  1O8W A;  4LMV A;  3HVV A;  2AUV A;  3G9B A;  3F3R A;  3UVT A;  4RQX A;  1SL0 B;  1T1V A;  2ZCT A;  2XBQ A;  5C04 A;  4Q5N A;  2FUG 2;  4QQ7 A;  2JSY A;  3IDV A;  3M8N A;  1TKD B;  3HJP A;  2YP6 A;  2DJ3 A;  2CAI A;  2C0F A;  3GTU A;  3VFI A;  1SKR B;  2H72 A;  1XW5 A;  1Z3E A;  5CRH A;  5CRD A;  4GSN A;  2V6O A;  2CX4 A;  5EPF A;  3HXS A;  2CAQ A;  1K3L A;  3FZ5 A;  4TOP A;  4IJI A;  1PQN A;  1JHB A;  6GST A;  1V40 A;  3HHV A;  1EEJ A;  2MBS A;  2YZU A;  4FYC A;  6GSW A;  2LQO A;  4JZQ A;  1EP7 A;  3QDN A;  2LQQ A;  3EUR A;  4ICY A;  1OE8 A;  4MJE A;  2LJR A;  3I9V 2;  4Q5Q A;  5DBQ A;  4G10 A;  3VI7 A;  2IJY A;  3RDW A;  3FEU A;  3CBU A;  2JSZ A;  2KUC A;  3LQ7 A;  5CRE A;  2FWF A;  3D0Z A;  4KA0 A;  2CZ2 A;  2HZF A;  4V2N A;  4KH7 A;  1XWC A;  2HZE B;  1OC8 A;  3GKK A;  1UC7 A;  1BX9 A;  1GLQ A;  2N5A A;  2K18 A;  2MMN A;  4MPF A;  4CY6 A;  3NIV A;  5J9B A;  3TOT A;  3VWX A;  4IVF A;  2O85 A;  3TJG A;  2RUF A;  3HVX A;  1VF1 A;  3BCI A;  3QAV A;  1TI1 A;  2EIR A;  1GSU A;  4HEA 2;  3LWA A;  4BVX B;  4FIW A;  3D5J A;  1BG5 A;  2DC5 A;  4O5R A;  4MCU A;  5AN1 A;  5ECK B;  1JLW A;  2M72 A;  4ECJ A;  5JCU A;  2K6V A;  1USB A;  2FD3 A;  2H30 A;  4Z7X A;  2FA4 A;  3C8E A;  1GUH A;  4KW6 A;  3FZ4 A;  3ZZX A;  2OE1 A;  4FYB A;  2BMX A;  2V2G A;  2L59 A;  2R0C A;  2HRA A;  2C0E A;  4YH2 A;  2M80 A;  3KCM A;  2F51 A;  1R26 A;  4NXI A;  6GSX A;  5G5F A;  1UVZ A;  3EPT A;  4BL7 B;  4K2X A;  1GSY A;  2V41 A;  1OC9 B;  5H5Q A;  1JZO A;  4KGI A;  3HZ4 A;  3FZA A;  3EU4 A;  5IPG A;  4FO5 A;  2FNO A;  3HKR A;  1SD9 A;  3KTL A;  1K3O A;  4JU5 A;  1TU7 A;  4IQA A;  4MF6 A;  4WF5 A;  4OO4 A;  2DLX A;  5F07 A;  2YJH A;  1DE2 A;  3TRX A;  4KDU A;  2DJ1 A;  3LGC A;  1TW9 A;  1TP9 A;  5IO2 A;  5LCZ A;  5CRG A;  1AQV A;  3OR5 A;  1FOH A;  4L0U A;  5IMV A;  1HNC A;  3RPP A;  4F0C A;  3FRC A;  3S9F A;  2WUL A;  4MAB A;  1FO5 A;  1TRW A;  5DJM A;  1VF4 A;  1X5D A;  3GUR A;  2VLU A;  3L9U A;  3IBH A;  2HXK A;  3C7M A;  3LSZ A;  2GDR A;  4WEY A;  3QR6 A;  2P5R A;  1GNE A;  1VF2 A;  3RHB A;  4J56 E;  2P0G A;  2VL9 A;  5DQS A;  1MDK A;  1QMV A;  1XWB A;  1PL2 A;  2L5O A;  3DVW A;  5JWQ B;  5ECP B;  3D4M A;  3G7I A;  1J08 A;  3IC8 A;  5D9V A;  4O92 A;  4GCI A;  2D2Z A;  3RHC A;  1YKC A;  5J4U A;  2VCQ A;  3KIJ A;  18GS A;  2E2M A;  3I69 A;  2LKU A;  2QA1 A;  5CNW A;  3O76 A;  4ZBD A;  3NOF A;  4JED A;  10GS A;  2YAN A;  1Q98 A;  2IMI A;  2AHE A;  1XXU A;  5FT3 A;  4KSM A;  1SL1 B;  3BBY A;  3GKN A;  3EVI A;  3BOA A;  1XVW A;  4IHU A;  3IHQ A;  5G1K A;  4PUF C;  3RAZ A;  2IMF A;  4D73 A;  4MA9 A;  3QFA C;  3APQ A;  3MIX A;  1K0D A;  3L9S A;  4WBR D;  3IR4 A;  2CT6 A;  4G0I A;  1OYJ A;  3N9J A;  1SL2 B;  5BRT A;  3GFK A;  1EGR A;  2VL2 C;  3QCP A;  3EMX A;  2X49 A;  3M3M A;  4L0W A;  1GTI A;  4GSS A;  1MD3 A;  4NV2 A;  3ERG A;  1GWC A;  4IS0 A;  1T4Y A;  5EL8 A;  2J23 A;  2AB6 A;  2HFD A;  4MJA A;  1FB0 A;  4EIQ A;  2FHE A;  3CXG A;  1O7U A;  4RI6 A;  3RPN A;  2OA7 A;  4EKZ A;  3MDK A;  4USS A;  2IMK A;  1WIK A;  4BPY A;  1SD8 A;  2A4V A;  5DCH A;  2H73 A;  2QSI A;  3KXO A;  4OO5 A;  5D8I A;  4EXJ A;  4EDZ A;  2VLT A;  2VLV A;  3UBL A;  4AJ8 A;  4POB A;  2HZE A;  5ECL B;  1DSB A;  1ZGN A;  4EC0 A;  3GV1 A;  2FWE A;  1ERW A;  1NHY A;  3ZRE A;  4PUR A;  3K8N A;  3VLN A;  1H4O A;  1TRV A;  1GUK A;  4NAX A;  4HDE A;  5DAL B;  4HZ4 A;  1O85 A;  3BJ5 A;  1R5P A;  5G5E A;  2TRC P;  1SJ6 A;  3H4K A;  1KBN A;  1GTU A;  1GP1 A;  2B7K A;  1AC1 A;  1XOB A;  2C80 A;  4BVX A;  1Y25 A;  4J2F A;  1OE7 A;  5IPH A;  3ZVJ D;  4FYU A;  4XHM A;  4H86 A;  3G7Y A;  2MYG A;  1B48 A;  2HI7 A;  4BWS A;  3TKS E;  3UIW A;  4G0K A;  2VO4 A;  2H0H A;  2HLS A;  4EL1 A;  2ON7 A;  4PQI A;  2EIQ A;  5CYY A;  5A4W A;  3DD3 A;  5DQY A;  3LYK A;  4Q5R A;  2FWH A;  4K0G A;  4BL7 A;  4ZL9 A;  4MP4 A;  4MPG A;  4L5L A;  1OC9 A;  4BWQ A;  1IYI A;  3UJ1 A;  1EV9 A;  14GS A;  2O89 A;  4IKH A;  1RW1 A;  2H19 A;  1NHO A;  4ECC A;  2F8A A;  3LXZ A;  4Z2R A;  5F8B A;  4K6X A;  3TB2 A;  3ZIV A;  3UVH A;  1U6T A;  3FY7 A;  1ZMA A;  3M9J A;  1BAY A;  2WRT A;  3LOR A;  3M1G A;  4AF2 A;  1O8X A;  3SBC A;  1X9W B;  2RM5 A;  2DBC A;  4KE3 A;  3GA4 A;  5ELG A;  2LJK A;  2C8U A;  2C3Q A;  4KDY A;  3JCM L;  3FYG A;  1SK0 A;  5D9T A;  3FR9 A;  2IWT A;  1S3C A;  2GT5 A;  5IOW A;  2IME A;  1QGV A;  2H6Y A;  3TCO A;  4DVC A;  2XPD A;  5JCW A;  1J0F A;  2JZR A;  3ERF A;  2GZP A;  4TXO B;  3ZIJ A;  1GRX A;  3ZFL A;  3ZLP A;  3O3T A;  3TJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...