2XPDA

Reduced thiol peroxidase (tpx) from yersinia pseudotuberculosis
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
166
structure length
166
Chain Sequence
TQTVHFQGNPVSVAGKLPQIGDKAKDFTLVAKDLSDVALSSFAGKRKVLNIFPSIDTGVCAASVRKFNQLAGELENTVVLCISSDLPFAQSRFCGAEGLSNVITLSTLRGADFKQAYGVAITEGPLAGLTARAVVVLDGQDNVIYSELVNEITTEPNYDAALAALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL PEROXIDASE
publication title Structural Characterisation of Tpx from Yersinia Pseudotuberculosis Reveals Insights Into the Binding of Salicylidene Acylhydrazide Compounds.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Oxidoreductase
total genus 56
structure length 166
sequence length 166
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2xpdA00
4N0ZA 1VF4A 2G2QA 2WULA 4EDZA 3QDNA 5CRWA 2YN1A 2B5YA 2H72A 2L59A 4DSSA 1O8XA 1R4WA 1X5EA 3ERFA 3BJ5A 3M0FA 1PL2A 1FVJA 4TR0A 2ZUPA 3GTUB 1VRSD 2PWJA 4L5OA 2GT5A 5F0GA 4TW5A 1JZDA 1PL1A 4GXZA 3GKKA 2CVDA 2ALBA 4BPYA 4HJMA 5IOXA 1XWGA 3H4KA 2VD1A 1XWAA 5HFGA 4J2FA 1JFUA 1C72A 2K8VA 3HCZA 3F9UA 2IMEA 1PQNA 2X8GA 4XS1A 2YNXA 2EIQA 2PU9C 3FHKA 3GKNA 1PN9A 1WJKA 4YAPA 2ON5A 16GSA 3VPTA 1SD9A 3DWVA 3CRTA 5F07A 1EV4A 3BOAA 2WB9A 2DBCA 3ISOA 5D93A 9GSSA 3K8NA 5ID2B 1QGVA 3ME7A 1F3AA 1Q4JA 4YAVA 2OBKA 3D4MA 2IMDA 1VF3A 2VIMA 4CDOA 1FAAA 2R5GA 1T3BA 2X8CA 3DGQA 2IL3A 4ZIJA 3D6IA 4JEDA 3KTLA 4IN0A 4OFNA 5ELGA 2D2ZA 5EY6A 2HLSA 1AQXA 5DVBA 3TKSC 2O85A 5DBQA 3CSHA 3FK8A 5AISA 1E6BA 3KTBA 3DEXA 4DVCA 3SBCA 5J5NA 3HZ8A 3IRAA 2MMOA 2B1LA 3ERGA 2HZEA 2QSIA 1B8XA 4D73A 2IFQA 5HR1A 1ZYEA 2IMKA 4ZILA 3N5OA 5D9VA 1YDKA 2OBIA 4GLTA 2OE3A 4IP1A 3ZYWA 1T4YA 1URMA 2FWHA 4XTSA 2RLIA 1EEJA 3TOTA 3M1GA 3RBTA 1EOHA 1A8YA 2LJKA 3G7IA 3L9SA 4J56E 3LWAA 1A0RP 2BTOT 1YF0A 5AIVA 2OACA 1TU8A 2JZSA 1EV9A 1TTZA 2DLXA 2WS2A 3CBUA 2OKAA 4KX4A 4KGIA 3IHQA 2JZTA 1GUHA 5IMVA 1NM3A 4WBJA 4GSSA 2M72A 2R3XA 1BAYA 4EKZA 4DSRA 1WIKA 3TUEA 1YY7A 3TB2A 4RQXA 1AC1A 1O8WA 3CMIA 4HZ2A 5FWGA 1U3AA 3KXOA 3GYKA 3ZIJA 3EWLA 1TK5B 1V2AA 4KNDA 4XS4B 3GKMA 4MA9A 5CYYA 3FR6A 1GWCA 5ECLB 2VOCA 2AHEA 1HQOA 2E7PA 3LYPA 3C1SA 3TGZA 4MH2A 1SKSB 2DJ3A 1SL2B 2I81A 2OE1A 3VK9A 4ECCA 4H86A 4XCSA 5IMCA 1M0UA 4RUVA 2L4QA 4Q5NA 4YH2A 1WOUA 1GRXA 2QC7A 1FHEA 1GSYA 3E3EA 1EZKA 10GSA 1GH2A 5A4UA 2N5AA 3UIWA 4AGSA 3IOSA 2RIIA 1AIUA 3WD6A 2JZRA 5D9TA 6GSXA 3HJMA 4GQFA 1M9BA 1FOVA 3F0IA 5LD0A 4ZL8A 2C8UA 3UOMA 5DJMA 3TKSE 3VI7A 3LQ7A 3UBLA 6GSVA 5JCGA 3IE3A 5DQSA 3KM6A 1M2AA 3WT2A 3WGDA 2M80A 3H79A 3RHBA 3ZRDA 3KMNA 4EC0A 3TDGA 2AB6A 3F6DA 3APSA 3DRNA 5E4WA 1U6TA 3KGKA 1AUCA 5JWRB 3C73A 3CXGA 2YZHA 2C80A 4V1Ag 4KDUA 4EVMA 4EDYA 3GHAA 4JBBA 4K0NA 2CX3A 2L57A 2PBJA 4AF2A 3JCML 2OJLA 4ML6A 1XW5A 4KCEA 3Q18A 1EGRA 3QCPA 1R5AA 4XRDA 3TKPA 1GNEA 5G30A 1BYEA 1YKAA 2NPBA 3QMXA 4WKWA 3HDCA 1OC8A 1QXHA 4DSQA 1GNWA 2CAQA 5B6MA 4KA0A 2DC5A 3KMOA 5G1LA 4K6XA 1CQHA 3NOFA 2LS5A 1GSQA 1DBYA 3IDVA 4G9HA 5ELAA 1XOBA 1ZOFA 5G1KA 3LXZA 4KE3A 3GL3A 2E2GA 4PQIA 3GTUA 1FVKA 3TOUA 1TW9A 4PUAA 2HSHA 5J3RA 3UAPA 2M46A 1XVWA 1VF1A 4EE0A 2X99A 1I5GA 4F2IA 1XPVA 2VLVA 4MABA 3UMAA 4J57E 1J0FA 3WGEA 2PN8A 1M9AA 3IPZA 2C3TA 3P2AA 2EC4A 1A24A 4TXOB 2GDRA 3LSZA 2MMZA 1TI3A 2KLXA 3ZTLA 2R4VA 5CP1A 1XBSA 3DD3A 1BJXA 1XIYA 3DXBA 1Z5YE 1OE8A 3P8WA 2PVOC 3FR9A 4K7OA 1HNCA 3LJRA 3GRXA 2O89A 4BA7A 5ID2A 3PGTA 2TRXA 2FA8A 1SK2A 2MZCA 4FYBA 3F4RA 1OKDA 2GT6A 1FB0A 4ZBAA 1ILOA 4LMWA 1RQMA 2K9FA 2VLUA 4OCFA 4ZL7A 2LRNA 3IA1A 4O5RA 2F3MA 1XWKA 2AAWA 2DMMA 20GSA 3MWHA 4LMVA 1J08A 1QK8A 4IELA 2NTOA 3M8NA 4YQVA 4IQ1A 3L9VA 5ECRB 4EL1A 3VURA 2DIZA 1YQ1A 2DJJA 1EWXA 1EP8A 1O73A 2GZPA 3HVSA 2HT9A 2HZFA 2O87A 3M9JA 5CNWA 5B8BA 2K18A 3W8SA 1GTUA 3I6AA 4MJEA 1GSEA 4IHUA 3IBHA 3Q19A 1WRYA 2LSTA 3WYWA 4KW6A 4NHZA 3SWLA 4Q5RA 3H8QA 3MNGA 4OD7A 1G7EA 3L9UA 5IO0A 4WXTA 3I43A 4HI7A 4MJCA 4TR1B 1YZXA 3FRCA 1K0DA 2YWMA 3WT1A 3G9BA 2C0DA 3FZ9A 1G6WA 1W4VA 3HVVA 3ZFLA 3W8JA 2VL2A 2CX4A 3ZVJD 5KN3A 4RQRA 1GLQA 2V41A 1V98A 4K7NA 4NWYA 2ZCTA 1K3YA 3F63A 3HKRA 3VI5A 1GTBA 2F9SA 4GTUA 4IKHA 2HNLA 3GA4A 3F4TA 3QAGA 2B5EA 2MBSA 4IGJA 1TP9A 2R2JA 2JSZA 2FHEA 4ECBA 4KH7A 3D21A 2YWOA 2Z9SA 4PUFC 5IOWA 3HXSA 4POMA 2NDOA 2H1DA 3TRXA 1V58A 2VAFA 5HFKA 4JZQA 2B7JA 3RDWA 6GSWA 3GH6A 4XS4A 2XC2A 4HQSA 3ZZXA 4OO4A 3O6TA 5LCZA 1SK1A 4G2EA 2H30A 2V6OA 1Z3EA 4L0WA 4AJ8A 1TJDA 1J9BA 2DJKA 2V2GA 2JL4A 2K8SA 3LXTA 4P3YB 3ZVJA 1WPIA 2H76A 1THOA 4IQAA 6GSUA 1EEMA 1PKZA 2P0GA 3RPPA 3KIJA 1S3AA 1TU7A 2LKUA 4BVXA 2CVKA 5J4UA 2GZYA 2YJHA 4L0UA 1FB6A 2OE0A 1B48A 2LJRA 4RI6A 4WR4A 1QUWA 1EP7A 5D96A 4FYCA 3F3RA 1IYHA 1F6MC 4K8MA 4WBRD 1PSQA 2B7KA 4HS1A 1MDKA 3LG6A 2HE3A 1SJIA 5JWOB 3ERWA 4LL4B 3Q6OA 3EURA 4ISDA 5ECKB 5HR3A 3RHCA 6GSSA 1O85A 4X1UA 3APQA 1K0AA 4L5LA 3EC3A 1BQ7A 11GSA 1PKWA 2L6DA 3GV1A 1AQVA 3GIXA 3EU3A 3FY7A 4FO5A 5F06A 3TJBA 5KEJA 2J9HA 3O3TA 1X9SB 5D73A 3HHVA 3P90A 5E59A 4KB3A 1RK4A 3QPMA 2LNTA 4N30A 2CT6A 2J23A 1JZRA 3KP8A 3QR6A 4JRRA 1A0FA 1Z7RA 3FKFA 1WE0A 3TRPA 5A4VA 1R26A 3CTFA 3CRUA 3HD5A 5FHIA 1V40A 5HR0A 4KDXA 1KEBA 3TKRA 4GF0A 2ES7A 1SU9A 2IJYA 3FZAA 4WR5A 1LJRA 4IBPA 2GS3A 2TIRA 1E2YA 1TI1A 2LRTA 4JU5A 1VF2A 2P31A 3L78A 4ZXGA 4V2MA 3TJJA 4HOJA 3KD0A 3ZL5A 5KN0A 4NHWA 3DYRA 2A4VA 1IYIA 2C4JA 2TRCP 1U88A 3IV4A 1XOAA 4PNFA 3J7Yk 3A5WA 3CSJA 3W6GA 1GSSA 4MF5A 3ME8A 2H6YA 3HVXA 4TXOA 3O76A 3TJKA 4QL9A 2LQOA 3MAKA 4FIWA 5B7CA 4JR6A 2FUG2 1TRVA 1XW6A 3PINA 2DJ1A 3AY8A 5H5QA 3FEUA 2HRFA 2YCDA 4AJ7A 1Z7PA 2WRTA 1X5CA 4F9ZA 4MMMA 2IIYA 1F3BA 5CREA 2VL9A 3D22A 2B3SA 5J41A 3FZ4A 2EIOA 12GSA 5F8BA 3GURA 1Z6MA 4EO3A 3DVXA 1TDIA 3GMFA 2VL3A 2PPTA 3IC4A 1G7OA 2XPEA 5G5FA 1YJ6A 4ZBDA 2JADA 1A2JA 4ZL9A 4PX1A 3IAM2 5D8IA 1A2LA 3VFIA 4TXVA 2WJUA 4KSOA 4MZWA 2RUEA 1SD8A 4V2LA 3F8UA 5DJLA 5ECPB 4WF4A 3CTGA 1TRUA 4GWRA 5ECSA 1LBKA 3A3TA 1XZOA 5CRHA 4LL1B 1O6JA 3Q74A 1T7PB 3CSIA 1OAZA 3UVHA 1AXDA 2AV4A 2JSYA 2MBTA 3EINA 2GSTA 1MDJA 4KCAA 4HZ4A 1N2AA 4MF7A 1R5PA 3UL3A 4O92A 4TR1A 4WF5A 2R6KA 4XS6A 2XBIA 1W89A 4MDCA 5IPHA 2VUPA 5COHA 4PNGA 4Q5FA 4ECJA 3UVTA 2YOIA 4NV2A 4HU7A 2VCQA 5A5KA 4TN8A 1MDIA 2GSSA 1YEPA 1TKDB 1YF1A 3FZ5A 5H5RA 4KDYA 1U3IA 1USBA 4TKYA 1BX9A 1MD3A 6GSYA 4POLA 3QD9A 4I2UA 5EVOA 2L5OA 1SL0B 3EMXA 1YEXA 3C7MA 4NMUA 1SJZA 2C0FA 4HQZA 1UN2A 3BD2A 2I9HA 2YZUA 1ERTA 14GSA 1T1VA 2DJ0A 5HFIA 3ZMLA 4PQHA 1ZYQB 1H75A 3HJOA 4G10A 1ML6A 3D0ZA 2AJQB 3GUSA 1M2BA 5DAKB 1ERWA 5IO2A 3L0HA 1F2EA 5D9XA 2H71A 2O7KA 3M9KA 1M7TA 19GSA 3ZITA 4F03A 5IMFA 3J7Yb 1XFLA 4ECIA 2GQMA 1TK0B 2V1MA 3H1NA 4OO5A 1NHYA 1A23A 1GP1A 1NSWA 3US3A 4I6XA 2LEGA 2WFCA 2I4AA 2HXKA 4MF6A 1GLPA 2C0EA 1AQWA 4NAXA 3HY2A 1QMVA 4OMVA 3TJGA 2PVQA 3U6VA 3VWUA 1A2MA 1SL1B 2LRCA 1DUGA 1OKTA 3A2WA 2K6VA 3GN3A 1ON4A 1CQGA 2OA7A 4YQMA 2VL2C 3NZNA 4WEYA 4MCUA 4E8EA 2BJXA 4MZBA 1ABAA 3ZIVA 4OCEA 2YJ7A 4I2TA 1V9WA 1GSFA 5EL8A 1K0MA 3N9JA 3GL5A 1XVQA 3S9FA 4GCIA 2VLTA 2CZ3A 1K0NA 2H1GA 2X64A 1SENA 2GQKA 1U87A 4BVYA 2FY6A 2HRNA 2H0GA 5KN1A 2HYXA 5G31A 1UA5A 4EUYA 5DALB 4ML1A 2DSAA 5GSSA 1Z6NA 3C1RA 2H6XA 2I1UA 2IPAA 2YWIA 2KHPA 1AW9A 3UARA 5ECMB 5ECOB 2H01A 2FCHA 2RM5A 3G7JA 3GSTA 1H4OA 3IAS2 1QFNA 1OE7A 4LLRA 4MH3A 2DMLA 2WGRA 1ERVA 3ZFBA 1DE1A 1FO5A 3P7XA 2AYTA 6GSTA 2E2MA 1XXUA 3F6FA 2YV9A 4OWYA 2AUVA 3TJFA 2R37A 4Q5QA 3BBYA 1KTEA 1O81A 2FWGA 2H1BA 3KEBA 1I9DA 2B1KA 2QGVA 3R2QA 1B4PA 2GQLA 2YP6A 2O8VB 2WDUA 4ZB9A 3CYNA 3DIEA 1S3DA 2C0GA 1HNBA 3KJYA 4NXIA 1ERUA 2V32A 3I69A 5FT3A 5JWQB 4MJBA 3ZREA 5INYA 3DVWA 2F8FA 2C1YA 3VWVA 4NV5A 2L5LA 2H70A 4EF0A 2YANA 5C04A 5IM9A 4QQ7A 4Z7XA 2JU5A 2P5QA 4KUNA 4I8BA 4IP6A 1WWJA 1JLVA 1MTCA 1ZZYA 4KAEA 4CHSA 2H74A 2VCWA 1M99A 1PD21 1PMTA 2XHFA 2ON7A 3G7YA 5LNKe 4ULXA 4ZB6A 2PUKC 1GULA 2GVPA 3A2XA 4K9ZA 5IMDA 3HA9A 4OFMA 3FW2A 4ACSA 4X43A 1HD2A 2H75A 2YV7A 1QQ2A 1OYJA 1G6YA 2FD3A 1SYXA 1A8LA 1OC9B 2H1AA 3VWXA 1BEDA 1Y25A 2L6CA 4JR4A 4IS0A 1YKCA 3L4NA 1SKRB 3QAVA 1TRWA 2CZ2A 3M3MA 4O7HA 4POBA 1PX6A 2VD0A 1GTAA 5IQYA 1PGTA 4K2DA 1GL8A 4ILFA 5DCHA 3GFKA 2XPDA 1PA3A 1HYUA 2B5XA 1TRSA 2I3YA 3MDKA 5G2ZA 4MP4A 1UC7A 4GQCA 5JCUA 4GSTA 8GSSA 2PGTA 1UVZA 4V1Ap 5HR2A 3GH9A 7GSSA 1BG5A 4WETA 4PQ1A 3EU4A 5ENUA 2WCIA 5CO3A 3F3QA 3VPQA 3LYKA 1JHBA 1DSBA 3LORA 2H73A 3D4TA 4IJ3A 3ZMKA 4F82A 3HYPA 2GSRA 3TKSA 2KP2A 4I97A 5GAND 3GKXA 2LTKA 1X9WB 1XWBA 2H0HA 1B9YC 1XWCA 2LV3A 2PERA 4PGTA 5CAXA 2GGTA 2GZZA 3KP9A 3U5RE 3C8EA 5C00A 5IIZA 2PMTA 5D9WA 2DIYA 4XRAA 1FW1A 1K0BA 2H6ZA 4DSSB 1TXXA 4I5QA 2CVBA 3QFBC 2GLRA 3QAWA 3NIVA 4BWQA 2XBQA 5GZZB 5B8AA 4MLYA 5F05A 3IXRA 2C3NA 5AGYA 1WP0A 4TRXA 3H93A 4F0CA 4N10A 1JLWA 4PURA 1FG4A 3GX8A 3VLNA 2DJ2A 1GTIA 1GUKA 5JCWA 5DAKA 4TR4A 5KN2A 5DDLA 4BL7A 1DE2A 4MK3A 1TK8B 4N0VA 1X5DA 2GSQA 3QOUA 4K0GA 5H5SA 3IK7A 2H0IA 1GSDA 1ZMAA 3EVIA 2MMNA 4N11A 2CV4A 4F0BA 1HNAA 4HEA2 4HU9A 4MJAA 1K3LA 5HQPA 1Z9HA 3EYTA 1B4QA 3D5JA 5CRGA 2F51A 3WGXA 13GSA 3PR8A 5ECNB 2F8AA 4L8EA 1PRXA 2V6KA 2EIRA 1ZL9A 3MSZA 3TCOA 4IVFA 1X0RA 3UJ1A 2HFDA 1KNGA 1XCCA 3FYGA 5G5EA 1B9XC 1WMJA 1X9MB 3DKSA 5J9BA 2VCZA 2VCXA 1THXA 3E9JB 1MD4A 2GTUA 2ZNMA 2IMIA 2NVLA 2KP1A 1KBNA 2HZEB 5DALA 3BCKA 4TR3A 4D73B 2IMFA 1EOGA 2NBSA 4JE1A 2RM6A 2IFQB 1OC3A 1JZWA 1K0CA 4MZCA 2FWFA 4K7IA 3LFLA 1Y6EA 3VWWA 5ECHB 4O32A 1MEKA 2P5RA 1JZOA 1V57A 3OR5A 4CW9A 1GSUA 3A2VA 4QL7A 1EGOA 1K3OA 4OFTA 2YPMA 5AN1A 3F4SA 2E0QA 4MPFA 2YWNA 1S3CA 5B6NA 3TKQA 3LGCA 2IN3A 3APOA 2FLSA 3KCMA 3E0UA 1T8EB 1F37A 2VM2A 22GSA 3TRQA 4ZB8A 3PH9A 2FWEA 1K0OA 4TVEA 2L4CA 2HI7A 5DCGA 2KUCA 2MYGA 4X0XA 2CA8A 5IMAA 1AAZA 5AIXA 4HDEA 1F9MA 4ID0A 2H19A 4GRFA 5EPFA 1ZGNA 3BCIA 5GAPD 2KOKA 1N8JA 3KZQA 4NPBA 5IPGA 1GUMA 18GSA 3KH9A 5GSTA 1M2DA 2JACA 5ECIB 1SK0A 5CRDA 1SJ6A 2QKEA 2MMAA 2WZ9A 3RAZA 5DQYA 3HJPA 2N5BA 4FH8A 3IK9A 4EXJA 4XHMA 2G0FA 3QFAC 4AJ6A 17GSA 4TOPA 1ACVA 2A2RA 3V1WA 4HUAA 1OC9A 3EMPA 2H66A 1ST9A 3UEMA 3IR4A 1SYRA 2FA4A 3HZ4A 1G0TA 1SKWB 2X8HA 2VCTA 4LA1A 2OADA 1XW9A 3GSSA 2BMXA 2RUFA 4MPGA 2HSYA 3UBKA 2LQQA 3GNJA 1PX7A 1T00A 4K1FA 1LU4A 3I9V2 4FYUA 5IMZA 5ABRA 3ED3A 3ZLPA 3FR3A 4POKA 1R7HA 1VGLA 2LNSA 5J9CA 1ZCPA 2LJAA 2N5FA 4GSNA 5L71A 4IW9A 2H8LA 4RI7A 4KSMA 3EE2A 2FNOA 4G19A 3DMLA 2VM1A 3LEFA 2CAIA 4BWSA 1TOFA 4IJIA 2B6MA 4XIHA 2VO4A 3RPNA 3KH7A 4V2NA 1OVNA 3GX0A 2FGXA 4HJ2A 4DEJA 4PXOA 4ZBBA 5ECQB 2REMA 5A4WA 1NW2A 3C71A 2C3QA 2LUSA 1Q98A 2CQ9A 2IWTA 1O7UA 1NHOA 2VCVA 1RW1A 1T4ZA 4E8HA 4YQUA 2A2SA
chains in the Genus database with same CATH superfamily
4N0ZA 1VF4A 2G2QA 2WULA 4EDZA 3QDNA 5CRWA 2YN1A 2B5YA 2H72A 2L59A 4DSSA 1O8XA 1R4WA 1X5EA 3ERFA 3BJ5A 3M0FA 1PL2A 1FVJA 4TR0A 2ZUPA 4CY6A 3GTUB 1VRSD 2PWJA 5BMUA 4L5OA 2GT5A 5F0GA 4TW5A 1JZDA 1PL1A 4GXZA 3GKKA 2CVDA 2ALBA 4BPYA 4HJMA 5IOXA 1XWGA 3H4KA 2VD1A 1XWAA 5HFGA 4J2FA 1JFUA 1C72A 2K8VA 3HCZA 3F9UA 2IMEA 1PQNA 2X8GA 4XS1A 2YNXA 2EIQA 2PU9C 3MYDA 3FHKA 3GKNA 1PN9A 1WJKA 4YAPA 2ON5A 16GSA 3VPTA 1SD9A 3DWVA 4O5UA 3CRTA 5F07A 1EV4A 3BOAA 2WB9A 2DBCA 3ISOA 5D93A 9GSSA 3K8NA 5ID2B 1QGVA 3ME7A 1F3AA 1Q4JA 4YAVA 2OBKA 3D4MA 2IMDA 1VF3A 2VIMA 4CDOA 1FAAA 2R5GA 1T3BA 2X8CA 2QA2A 3DGQA 3R3EA 2IL3A 3EPTA 4ZIJA 3D6IA 4JEDA 3KTLA 2HSMA 2A2PA 4IN0A 4OFNA 5ELGA 2D2ZA 5EY6A 2HLSA 1AQXA 5DVBA 3TKSC 2O85A 5DBQA 3CSHA 3FK8A 5AISA 1E6BA 3KTBA 3DEXA 4YKFA 4DVCA 3SBCA 5J5NA 3HZ8A 1PN0A 3IRAA 2MMOA 2B1LA 3ERGA 2HZEA 2QSIA 1B8XA 4D73A 2IFQA 5HR1A 1ZYEA 2IMKA 4ZILA 3N5OA 4A5PA 5D9VA 1YDKA 2OBIA 4GLTA 2OE3A 4IP1A 3ZYWA 1T4YA 1URMA 2FWHA 4XTSA 2RLIA 3PPUA 1EEJA 3TOTA 3M1GA 3RBTA 1EOHA 1A8YA 2LJKA 3G7IA 3L9SA 4J56E 3LWAA 1A0RP 2BTOT 1YF0A 5AIVA 2OACA 1TU8A 2JZSA 1EV9A 1TTZA 2DLXA 2WS2A 3CBUA 2OKAA 4KX4A 4KGIA 3IHQA 2JZTA 1GUHA 5IMVA 1NM3A 4WBJA 4GSSA 2M72A 2R3XA 1BAYA 4EKZA 4DSRA 1WIKA 3TUEA 1YY7A 3TB2A 4RQXA 1AC1A 1O8WA 3CMIA 4HZ2A 5FWGA 1U3AA 3KXOA 3GYKA 3ZIJA 3EWLA 1TK5B 1V2AA 4KNDA 4XS4B 3GKMA 4MA9A 5CYYA 3FR6A 1GWCA 5ECLB 2VOCA 2AHEA 4FQUA 1HQOA 2E7PA 3LYPA 3C1SA 3TGZA 4MH2A 1SKSB 2DJ3A 1SL2B 2I81A 2OE1A 3VK9A 4ECCA 4H86A 4XCSA 5IMCA 1M0UA 4RUVA 2L4QA 4Q5NA 4YH2A 1WOUA 1GRXA 2QC7A 1FHEA 1GSYA 3E3EA 4X4JA 1EZKA 10GSA 1GH2A 5A4UA 2N5AA 3UIWA 4AGSA 3IOSA 4BVXB 2RIIA 1AIUA 3WD6A 2JZRA 5D9TA 6GSXA 3HJMA 4GQFA 1M9BA 1FOVA 3F0IA 5LD0A 4ZL8A 2C8UA 3UOMA 5DJMA 3TKSE 3VI7A 3LQ7A 3UBLA 6GSVA 5JCGA 1ZYPA 3IE3A 5DQSA 3KM6A 1M2AA 3WT2A 3WGDA 2M80A 3H79A 3RHBA 3ZRDA 3KMNA 4EC0A 3TDGA 2AB6A 3F6DA 3APSA 3DRNA 5E4WA 1U6TA 3KGKA 1AUCA 5JWRB 3C73A 3CXGA 2YZHA 2C80A 4V1Ag 4KDUA 4EVMA 4EDYA 3GHAA 4JBBA 4K0NA 2CX3A 2L57A 2PBJA 4AF2A 3JCML 2OJLA 4ML6A 4G0IA 1XW5A 4KCEA 3Q18A 1EGRA 3QCPA 1R5AA 4XRDA 3TKPA 1GNEA 5G30A 1BYEA 1YKAA 2NPBA 3QMXA 4WKWA 3HDCA 1OC8A 1QXHA 4DSQA 1GNWA 2CAQA 5B6MA 4KA0A 2DC5A 3KMOA 5G1LA 4HSCX 4K6XA 1CQHA 3NOFA 2LS5A 1GSQA 1DBYA 3IDVA 4G9HA 5ELAA 1XOBA 1ZOFA 5G1KA 1ZYNA 3LXZA 4K5RA 4KE3A 3GL3A 2E2GA 4PQIA 3GTUA 1FVKA 3TOUA 1TW9A 4PUAA 2HSHA 5J3RA 3UAPA 2M46A 1XVWA 1VF1A 4EE0A 2X99A 1I5GA 4F2IA 1XPVA 1M3JA 2VLVA 4MABA 3UMAA 4J57E 1J0FA 3WGEA 2PN8A 1M9AA 3IPZA 2C3TA 3P2AA 2EC4A 1A24A 4TXOB 2GDRA 3LSZA 2MMZA 1TI3A 2KLXA 3ZTLA 2R4VA 5CP1A 1XBSA 3DD3A 1BJXA 1XIYA 3DXBA 1Z5YE 1OE8A 3P8WA 2PVOC 3FR9A 4K7OA 1HNCA 3LJRA 3GRXA 2O89A 4BA7A 5ID2A 3PGTA 2TRXA 2FA8A 1SK2A 2MZCA 4FYBA 3F4RA 1OKDA 2GT6A 1FB0A 4ZBAA 1ILOA 2X4AA 4LMWA 1RQMA 2K9FA 2VLUA 4OCFA 4ZL7A 2LRNA 3IA1A 4O5RA 2F3MA 1XWKA 2AAWA 2DMMA 20GSA 3MWHA 4LMVA 3FMWA 1J08A 1QK8A 4IELA 2NTOA 3M8NA 4YQVA 1S3RA 4IQ1A 3L9VA 5ECRB 4EL1A 3VURA 2DIZA 5KOWA 1YQ1A 2DJJA 1EWXA 1EP8A 1O73A 2GZPA 3HVSA 2HT9A 2HZFA 2O87A 3M9JA 5CNWA 5B8BA 2K18A 3W8SA 1GTUA 3I6AA 4MJEA 1GSEA 4IHUA 3IBHA 3Q19A 1WRYA 2LSTA 3WYWA 4KW6A 4NHZA 3SWLA 4Q5RA 3H8QA 3MNGA 4OD7A 1G7EA 3L9UA 5IO0A 4WXTA 3I43A 4G0KA 4HI7A 4MJCA 4TR1B 1YZXA 3FRCA 1K0DA 2YWMA 3WT1A 3G9BA 2C0DA 3MIXA 3FZ9A 1G6WA 1W4VA 3HVVA 3ZFLA 3W8JA 2VL2A 2CX4A 3ZVJD 5KN3A 4RQRA 1GLQA 2V41A 1V98A 4K7NA 4NWYA 2ZCTA 1K3YA 3F63A 1FOHA 3HKRA 3VI5A 1GTBA 2F9SA 4GTUA 4IKHA 2HNLA 3GA4A 3F4TA 3QAGA 3IC8A 2B5EA 2MBSA 4IGJA 1TP9A 2R2JA 2JSZA 2FHEA 4ECBA 4KH7A 3D21A 5BRTA 2YWOA 2Z9SA 4PUFC 5IOWA 3HXSA 4POMA 4Z2TA 2NDOA 2H1DA 3TRXA 1V58A 2VAFA 5HFKA 4JZQA 2B7JA 3RDWA 6GSWA 3GH6A 4XS4A 2XC2A 4HQSA 3ZZXA 4OO4A 3O6TA 5LCZA 1SK1A 4G2EA 2H30A 2V6OA 1Z3EA 4L0WA 4AJ8A 1TJDA 1J9BA 2DJKA 2V2GA 2JL4A 2K8SA 3LXTA 4P3YB 3ZVJA 1WPIA 2H76A 1THOA 4IQAA 6GSUA 1EEMA 1PKZA 2P0GA 3RPPA 3KIJA 1S3AA 1TU7A 2LKUA 4BVXA 2CVKA 5J4UA 2GZYA 2YJHA 4L0UA 1FB6A 2OE0A 1B48A 2A4HA 2LJRA 4RI6A 4WR4A 1QUWA 1EP7A 5D96A 4FYCA 3F3RA 1IYHA 1F6MC 4K8MA 4WBRD 1PSQA 2B7KA 4HS1A 1MDKA 3LG6A 2HE3A 4YKGA 1SJIA 5JWOB 3ERWA 4LL4B 3Q6OA 3EURA 4ISDA 5ECKB 5HR3A 3RHCA 6GSSA 1O85A 4X1UA 3APQA 1K0AA 4L5LA 3EC3A 4BVYB 1BQ7A 11GSA 1PKWA 2L6DA 3GV1A 1AQVA 3GIXA 3EU3A 3FY7A 4FO5A 5F06A 3TJBA 5KEJA 2J9HA 3O3TA 1X9SB 5D73A 3HHVA 3P90A 5E59A 4KB3A 1RK4A 3QPMA 2LNTA 4N30A 4Z2RA 2CT6A 2J23A 1JZRA 3KP8A 3QR6A 4JRRA 1A0FA 1Z7RA 3FKFA 1WE0A 3TRPA 5A4VA 1R26A 3CTFA 3CRUA 3HD5A 5FHIA 1V40A 5HR0A 4KDXA 1KEBA 3TKRA 4GF0A 2ES7A 1SU9A 2IJYA 3FZAA 4WR5A 1LJRA 4IBPA 2GS3A 2TIRA 1E2YA 1TI1A 4EIQA 2LRTA 4JU5A 1VF2A 2P31A 3L78A 4ZXGA 4V2MA 3TJJA 4HOJA 3KD0A 3ZL5A 5KN0A 4NHWA 3DYRA 2A4VA 1IYIA 2C4JA 2TRCP 1U88A 3IV4A 1XOAA 4PNFA 3J7Yk 3A5WA 3CSJA 3W6GA 1GSSA 4MF5A 3ME8A 2H6YA 2HRKA 3HVXA 4TXOA 3O76A 3TJKA 4QL9A 2LQOA 3MAKA 4FIWA 5B7CA 4JR6A 2FUG2 1TRVA 1XW6A 3PINA 2DJ1A 3AY8A 4O5QA 5H5QA 3FEUA 2HRFA 2YCDA 4AJ7A 1Z7PA 2WRTA 1X5CA 4F9ZA 4MMMA 2IIYA 1F3BA 5CREA 2VL9A 2X49A 3D22A 2B3SA 5J41A 3FZ4A 2EIOA 12GSA 4USSA 5F8BA 3GURA 1Z6MA 4EO3A 3DVXA 1TDIA 2R0GA 3GMFA 2VL3A 2PPTA 3IC4A 1G7OA 2XPEA 5G5FA 1YJ6A 4ZBDA 2JADA 1A2JA 4ZL9A 4PX1A 3IAM2 5D8IA 1A2LA 3VFIA 4TXVA 2WJUA 4KSOA 4MZWA 2RUEA 1SD8A 4V2LA 3F8UA 5DJLA 5ECPB 4WF4A 4MNNA 3CTGA 1TRUA 4GWRA 5ECSA 1LBKA 3A3TA 1XZOA 5CRHA 4LL1B 1O6JA 2R0PA 3Q74A 1T7PB 3CSIA 1OAZA 4PTSA 3UVHA 1AXDA 2AV4A 2JSYA 2MBTA 3EINA 2GSTA 1MDJA 4KCAA 4HZ4A 1N2AA 4MF7A 1R5PA 3UL3A 4O92A 4TR1A 4WF5A 2R6KA 4XS6A 2XBIA 1W89A 4MDCA 5IPHA 2VUPA 5COHA 4PNGA 4Q5FA 4ECJA 3UVTA 2YOIA 4NV2A 4HU7A 2VCQA 5A5KA 4TN8A 1MDIA 2GSSA 1YEPA 1TKDB 4K5SA 1YF1A 3FZ5A 5H5RA 4KDYA 1U3IA 1USBA 4TKYA 1BX9A 1MD3A 6GSYA 4POLA 3QD9A 4I2UA 5EVOA 2L5OA 1SL0B 4KF9A 3EMXA 1YEXA 3C7MA 4NMUA 1SJZA 2C0FA 4HQZA 1UN2A 3BD2A 2I9HA 2YZUA 1ERTA 14GSA 1T1VA 2DJ0A 5HFIA 3ZMLA 4PQHA 1ZYQB 1H75A 3HJOA 4G10A 1ML6A 3D0ZA 2AJQB 3GUSA 1M2BA 3A5IA 5DAKB 1ERWA 5IO2A 3L0HA 1F2EA 5D9XA 4BL7B 2H71A 2O7KA 3M9KA 1M7TA 19GSA 3ZITA 4F03A 5IMFA 3J7Yb 1XFLA 4ECIA 2GQMA 1TK0B 2V1MA 3H1NA 4OO5A 1NHYA 1A23A 1GP1A 1NSWA 3US3A 4I6XA 2LEGA 2WFCA 2I4AA 2HXKA 4MF6A 1GLPA 2C0EA 1AQWA 4NAXA 3HY2A 1QMVA 4OMVA 3TJGA 2PVQA 3U6VA 3VWUA 1A2MA 1SL1B 2LRCA 1DUGA 1OKTA 3A2WA 2K6VA 3GN3A 1ON4A 1CQGA 2OA7A 2VL2C 4YQMA 3NZNA 4WEYA 4MCUA 4E8EA 2BJXA 4MZBA 1ABAA 3ZIVA 4OCEA 2YJ7A 3IHGA 4I2TA 1V9WA 1GSFA 5EL8A 1K0MA 3N9JA 3GL5A 1XVQA 3S9FA 4GCIA 2VLTA 2CZ3A 1K0NA 2H1GA 2X64A 1SENA 2GQKA 1U87A 4BVYA 2FY6A 2HRNA 2H0GA 5KN1A 2HYXA 5G31A 1UA5A 4EUYA 5DALB 4ML1A 2DSAA 5GSSA 1Z6NA 3C1RA 2H6XA 2I1UA 2IPAA 4G0LA 2YWIA 2KHPA 1AW9A 3UARA 5ECMB 5ECOB 2H01A 2FCHA 2RM5A 3G7JA 3GSTA 1H4OA 3IAS2 4Z2UA 1QFNA 1OE7A 4LLRA 4MH3A 2DMLA 2WGRA 1ERVA 3ZFBA 1DE1A 1FO5A 3P7XA 2AYTA 6GSTA 2E2MA 1XXUA 3F6FA 2YV9A 4OWYA 2AUVA 3TJFA 2UZ8A 2R37A 4Q5QA 3BBYA 1KTEA 2QA1A 1O81A 2FWGA 2H1BA 3KEBA 1I9DA 2B1KA 2QGVA 3R2QA 1B4PA 2GQLA 2YP6A 2O8VB 2WDUA 4ZB9A 2R0CA 3CYNA 3DIEA 1S3DA 2C0GA 1HNBA 3KJYA 4NXIA 1ERUA 2V32A 3I69A 5FT3A 5JWQB 4MJBA 3ZREA 5INYA 3DVWA 2F8FA 2C1YA 3VWVA 4NV5A 2L5LA 2H70A 4EF0A 2YANA 5C04A 1PFOA 5IM9A 4QQ7A 4Z7XA 2JU5A 2P5QA 4KUNA 4I8BA 4IP6A 1WWJA 1JLVA 1MTCA 1ZZYA 4KAEA 4CHSA 2H74A 2VCWA 1M99A 1PD21 1PMTA 3LW9A 2XHFA 2ON7A 3G7YA 5LNKe 4ULXA 4ZB6A 2PUKC 1GULA 2GVPA 3A2XA 4K9ZA 5IMDA 3HA9A 4OFMA 3FW2A 4ACSA 4X43A 1HD2A 2H75A 2YV7A 1QQ2A 1OYJA 1G6YA 2FD3A 1SYXA 1A8LA 1OC9B 2H1AA 3VWXA 1BEDA 1Y25A 2L6CA 4JR4A 4IS0A 1YKCA 2DKHA 3L4NA 1SKRB 3QAVA 1TRWA 2CZ2A 3M3MA 4O7HA 4POBA 1PX6A 5KOXA 2VD0A 1GTAA 5IQYA 1PGTA 4K2DA 1GL8A 4ILFA 5DCHA 3GFKA 2XPDA 1PA3A 1HYUA 2B5XA 1TRSA 2I3YA 3MDKA 5G2ZA 4MP4A 1UC7A 4GQCA 5JCUA 4GSTA 8GSSA 2PGTA 1UVZA 4V1Ap 5HR2A 3GH9A 7GSSA 1BG5A 4WETA 4PQ1A 3EU4A 5ENUA 2WCIA 5CO3A 3F3QA 3VPQA 3LYKA 1JHBA 1DSBA 3LORA 2H73A 3D4TA 4IJ3A 3ZMKA 4F82A 3HYPA 2GSRA 3TKSA 2KP2A 4I97A 5GAND 3GKXA 2LTKA 1X9WB 1XWBA 2H0HA 1B9YC 1XWCA 2LV3A 2PERA 4PGTA 5CAXA 2GGTA 2GZZA 3KP9A 3U5RE 3C8EA 5C00A 5IIZA 2PMTA 5D9WA 2DIYA 4XRAA 1FW1A 1K0BA 2H6ZA 4DSSB 1TXXA 4I5QA 2CVBA 3QFBC 2GLRA 3QAWA 3NIVA 4BWQA 2XBQA 5GZZB 5B8AA 4MLYA 5F05A 3IXRA 2C3NA 5AGYA 1WP0A 4TRXA 3H93A 4F0CA 3HVNA 4EIPA 4N10A 1JLWA 4PURA 1FG4A 3GX8A 3VLNA 2DJ2A 1GTIA 1GUKA 5JCWA 5DAKA 4TR4A 5KN2A 5DDLA 4BL7A 1DE2A 4MK3A 1TK8B 4N0VA 1X5DA 2GSQA 3QOUA 4K0GA 5H5SA 3IK7A 2H0IA 1GSDA 1ZMAA 3CQFA 3EVIA 2MMNA 4N11A 2CV4A 4F0BA 1HNAA 4HEA2 4HU9A 4MJAA 1K3LA 5HQPA 1Z9HA 3EYTA 1B4QA 3D5JA 5CRGA 2F51A 3WGXA 1M3IA 13GSA 3PR8A 5ECNB 2F8AA 4L8EA 1PRXA 2V6KA 2EIRA 1ZL9A 3MSZA 3TCOA 4IVFA 1X0RA 3UJ1A 2HFDA 1KNGA 1XCCA 3FYGA 5G5EA 1B9XC 1WMJA 1X9MB 3DKSA 5J9BA 2VCZA 2VCXA 1THXA 3E9JB 1MD4A 2GTUA 2ZNMA 2IMIA 2NVLA 2KP1A 1KBNA 2HZEB 5DALA 3BCKA 4TR3A 4D73B 2IMFA 1EOGA 2NBSA 4JE1A 2RM6A 2IFQB 1OC3A 1JZWA 1K0CA 4MZCA 2FWFA 4K7IA 3LFLA 1Y6EA 3VWWA 5ECHB 4O32A 1MEKA 2P5RA 1JZOA 1V57A 3OR5A 4CW9A 1GSUA 3A2VA 4QL7A 1EGOA 1K3OA 4OFTA 2YPMA 2HRAA 5AN1A 3F4SA 2E0QA 4MPFA 2YWNA 1S3CA 5B6NA 3TKQA 3LGCA 2IN3A 3APOA 4ICYA 2FLSA 4CY8A 3KCMA 3E0UA 1T8EB 1F37A 2VM2A 22GSA 3TRQA 4ZB8A 3PH9A 2FWEA 1K0OA 4TVEA 2L4CA 2HI7A 5DCGA 2KUCA 2MYGA 4X0XA 2CA8A 5IMAA 1AAZA 5AIXA 4HDEA 1F9MA 4ID0A 2H19A 4GRFA 5EPFA 1ZGNA 3BCIA 5GAPD 2KOKA 1N8JA 3KZQA 4NPBA 5IPGA 1GUMA 18GSA 1XG8A 3KH9A 5GSTA 1M2DA 2JACA 5ECIB 1SK0A 5CRDA 1SJ6A 2QKEA 2MMAA 2WZ9A 3RAZA 5DQYA 3HJPA 2N5BA 4FH8A 3IK9A 4BIKA 4EXJA 4XHMA 2G0FA 3QFAC 4AJ6A 17GSA 4TOPA 1ACVA 2A2RA 3V1WA 4HUAA 1OC9A 3EMPA 2H66A 1ST9A 3UEMA 3IR4A 1SYRA 2FA4A 3HZ4A 1G0TA 1SKWB 2X8HA 2VCTA 4LA1A 2OADA 1XW9A 3GSSA 2BMXA 2RUFA 4MPGA 2HSYA 3UBKA 2LQQA 3GNJA 1PX7A 1T00A 4K2XA 4K1FA 1LU4A 3I9V2 4FYUA 5IMZA 5ABRA 3ED3A 3ZLPA 3FR3A 4POKA 1R7HA 1VGLA 2LNSA 5J9CA 1ZCPA 2LJAA 2N5FA 4GSNA 5L71A 4IW9A 2H8LA 4RI7A 4KSMA 3EE2A 2FNOA 4G19A 3DMLA 2VM1A 3LEFA 2CAIA 4BWSA 1TOFA 4IJIA 2B6MA 2DKIA 4XIHA 2VO4A 3RPNA 3KH7A 4V2NA 1OVNA 3GX0A 2FGXA 4HJ2A 4DEJA 4PXOA 4ZBBA 5ECQB 2REMA 5A4WA 1NW2A 3C71A 2C3QA 2LUSA 1Q98A 2CQ9A 2IWTA 1O7UA 1NHOA 2VCVA 1RW1A 1T4ZA 4E8HA 4YQUA 2A2SA
chains in the Genus database with same CATH topology
4N0ZA 1VF4A 2G2QA 2WULA 4EDZA 3QDNA 5CRWA 2YN1A 2B5YA 2H72A 2L59A 4DSSA 1O8XA 1R4WA 1X5EA 3ERFA 3BJ5A 3M0FA 1PL2A 1FVJA 4TR0A 2ZUPA 4CY6A 3GTUB 1VRSD 2PWJA 5BMUA 4L5OA 2GT5A 5F0GA 4TW5A 1JZDA 1PL1A 4GXZA 3GKKA 2CVDA 2ALBA 4BPYA 4HJMA 5IOXA 1XWGA 3H4KA 2VD1A 1XWAA 5HFGA 4J2FA 1JFUA 1C72A 2K8VA 3HCZA 3F9UA 2IMEA 1PQNA 2X8GA 4XS1A 2YNXA 2EIQA 2PU9C 3MYDA 3FHKA 3GKNA 1PN9A 1WJKA 4YAPA 2ON5A 16GSA 3VPTA 1SD9A 3DWVA 4O5UA 3CRTA 5F07A 1EV4A 3BOAA 2WB9A 2DBCA 3ISOA 5D93A 9GSSA 3K8NA 5ID2B 1QGVA 3ME7A 1F3AA 1Q4JA 4YAVA 2OBKA 3D4MA 2IMDA 1VF3A 2VIMA 4CDOA 1FAAA 2R5GA 1T3BA 2X8CA 2QA2A 3DGQA 3R3EA 2IL3A 3EPTA 4ZIJA 3D6IA 4JEDA 3KTLA 2HSMA 2A2PA 4IN0A 4OFNA 5ELGA 2D2ZA 5EY6A 2HLSA 1AQXA 5DVBA 3TKSC 2O85A 5DBQA 3CSHA 3FK8A 5AISA 1E6BA 3KTBA 3DEXA 4YKFA 4DVCA 3SBCA 5J5NA 3HZ8A 1PN0A 3IRAA 2MMOA 2B1LA 3ERGA 2HZEA 2QSIA 1B8XA 4D73A 2IFQA 5HR1A 1ZYEA 2IMKA 4ZILA 3N5OA 4A5PA 5D9VA 1YDKA 2OBIA 4GLTA 2OE3A 4IP1A 3ZYWA 1T4YA 1URMA 2FWHA 4XTSA 2RLIA 3PPUA 1EEJA 3TOTA 3M1GA 3RBTA 1EOHA 1A8YA 2LJKA 3G7IA 3L9SA 4J56E 3LWAA 1A0RP 2BTOT 1YF0A 5AIVA 2OACA 1TU8A 2JZSA 1EV9A 1TTZA 2DLXA 2WS2A 3CBUA 2OKAA 4KX4A 4KGIA 3IHQA 2JZTA 1GUHA 5IMVA 1NM3A 4WBJA 4GSSA 2M72A 2R3XA 1BAYA 4EKZA 4DSRA 1WIKA 3TUEA 1YY7A 3TB2A 4RQXA 1AC1A 1O8WA 3CMIA 4HZ2A 5FWGA 1U3AA 3KXOA 3GYKA 3ZIJA 3EWLA 1TK5B 1V2AA 4KNDA 4XS4B 3GKMA 4MA9A 5CYYA 3FR6A 1GWCA 5ECLB 2VOCA 2AHEA 4FQUA 1HQOA 2E7PA 3LYPA 3C1SA 3TGZA 4MH2A 1SKSB 2DJ3A 1SL2B 2I81A 2OE1A 3VK9A 4ECCA 4H86A 4XCSA 5IMCA 1M0UA 4RUVA 2L4QA 4Q5NA 4YH2A 1WOUA 1GRXA 2QC7A 1FHEA 1GSYA 3E3EA 4X4JA 1EZKA 10GSA 1GH2A 5A4UA 2N5AA 3UIWA 4AGSA 3IOSA 4BVXB 2RIIA 1AIUA 3WD6A 2JZRA 5D9TA 6GSXA 3HJMA 4GQFA 1M9BA 1FOVA 3F0IA 5LD0A 4ZL8A 2C8UA 3UOMA 5DJMA 3TKSE 3VI7A 3LQ7A 3UBLA 6GSVA 5JCGA 1ZYPA 3IE3A 5DQSA 3KM6A 1M2AA 3WT2A 3WGDA 2M80A 3H79A 3RHBA 3ZRDA 3KMNA 4EC0A 3TDGA 2AB6A 3F6DA 3APSA 3DRNA 5E4WA 1U6TA 3KGKA 1AUCA 5JWRB 3C73A 3CXGA 2YZHA 2C80A 4V1Ag 4KDUA 4EVMA 4EDYA 3GHAA 4JBBA 4K0NA 2CX3A 2L57A 2PBJA 4AF2A 3JCML 2OJLA 4ML6A 4G0IA 1XW5A 4KCEA 3Q18A 1EGRA 3QCPA 1R5AA 4XRDA 3TKPA 1GNEA 5G30A 1BYEA 1YKAA 2NPBA 3QMXA 4WKWA 3HDCA 1OC8A 1QXHA 4DSQA 1GNWA 2CAQA 5B6MA 4KA0A 2DC5A 3KMOA 5G1LA 4K6XA 1CQHA 3NOFA 2LS5A 1GSQA 1DBYA 3IDVA 4G9HA 5ELAA 1XOBA 1ZOFA 5G1KA 1ZYNA 3LXZA 4K5RA 4KE3A 3GL3A 2E2GA 4PQIA 3GTUA 1FVKA 3TOUA 1TW9A 4PUAA 2HSHA 5J3RA 3UAPA 2M46A 1XVWA 1VF1A 4EE0A 2X99A 1I5GA 4F2IA 1XPVA 2VLVA 4MABA 3UMAA 4J57E 1J0FA 3WGEA 2PN8A 1M9AA 3IPZA 2C3TA 3P2AA 2EC4A 1A24A 4TXOB 2GDRA 3LSZA 2MMZA 1TI3A 2KLXA 3ZTLA 2R4VA 5CP1A 1XBSA 3DD3A 1BJXA 1XIYA 3DXBA 1Z5YE 1OE8A 3P8WA 2PVOC 3FR9A 4K7OA 1HNCA 3LJRA 3GRXA 2O89A 4BA7A 5ID2A 3PGTA 2TRXA 2FA8A 1SK2A 2MZCA 4FYBA 3F4RA 1OKDA 2GT6A 1FB0A 4ZBAA 1ILOA 2X4AA 4LMWA 1RQMA 2K9FA 2VLUA 4OCFA 4ZL7A 2LRNA 3IA1A 4O5RA 2F3MA 1XWKA 2AAWA 2DMMA 20GSA 3MWHA 4LMVA 3FMWA 1J08A 1QK8A 4IELA 2NTOA 3M8NA 4YQVA 4IQ1A 3L9VA 5ECRB 4EL1A 3VURA 2DIZA 5KOWA 1YQ1A 2DJJA 1EWXA 1EP8A 1O73A 2GZPA 3HVSA 2HT9A 2HZFA 2O87A 3M9JA 5CNWA 5B8BA 2K18A 3W8SA 1GTUA 3I6AA 4MJEA 1GSEA 4IHUA 3IBHA 3Q19A 1WRYA 2LSTA 3WYWA 4KW6A 4NHZA 3SWLA 4Q5RA 3H8QA 3MNGA 4OD7A 1G7EA 3L9UA 5IO0A 4WXTA 3I43A 4G0KA 4HI7A 4MJCA 4TR1B 1YZXA 3FRCA 1K0DA 2YWMA 3WT1A 3G9BA 2C0DA 3MIXA 3FZ9A 1G6WA 1W4VA 3HVVA 3ZFLA 3W8JA 2VL2A 2CX4A 3ZVJD 5KN3A 4RQRA 1GLQA 2V41A 1V98A 4K7NA 4NWYA 2ZCTA 1K3YA 3F63A 1FOHA 3HKRA 3VI5A 1GTBA 2F9SA 4GTUA 4IKHA 2HNLA 3GA4A 3F4TA 3QAGA 3IC8A 2B5EA 2MBSA 4IGJA 1TP9A 2R2JA 2JSZA 2FHEA 4ECBA 4KH7A 3D21A 5BRTA 2YWOA 2Z9SA 4PUFC 5IOWA 3HXSA 4POMA 4Z2TA 2NDOA 2H1DA 3TRXA 1V58A 2VAFA 5HFKA 4JZQA 2B7JA 3RDWA 6GSWA 3GH6A 4XS4A 2XC2A 4HQSA 3ZZXA 4OO4A 3O6TA 5LCZA 1SK1A 4G2EA 2H30A 2V6OA 1Z3EA 4L0WA 4AJ8A 1TJDA 1J9BA 2DJKA 2V2GA 2JL4A 2K8SA 3LXTA 4P3YB 3ZVJA 1WPIA 2H76A 1THOA 4IQAA 6GSUA 1EEMA 1PKZA 2P0GA 3RPPA 3KIJA 1S3AA 1TU7A 2LKUA 4BVXA 2CVKA 5J4UA 2GZYA 2YJHA 4L0UA 1FB6A 2OE0A 1B48A 2A4HA 2LJRA 4RI6A 4WR4A 1QUWA 1EP7A 5D96A 4FYCA 3F3RA 1IYHA 1F6MC 4K8MA 4WBRD 1PSQA 2B7KA 4HS1A 1MDKA 3LG6A 2HE3A 4YKGA 1SJIA 5JWOB 3ERWA 4LL4B 3Q6OA 3EURA 4ISDA 5ECKB 5HR3A 3RHCA 6GSSA 1O85A 4X1UA 3APQA 1K0AA 4L5LA 3EC3A 4BVYB 1BQ7A 11GSA 1PKWA 2L6DA 3GV1A 1AQVA 3GIXA 3EU3A 3FY7A 4FO5A 5F06A 3TJBA 5KEJA 2J9HA 3O3TA 1X9SB 5D73A 3HHVA 3P90A 5E59A 4KB3A 1RK4A 3QPMA 2LNTA 4N30A 4Z2RA 2CT6A 2J23A 1JZRA 3KP8A 3QR6A 4JRRA 1A0FA 1Z7RA 3FKFA 1WE0A 3TRPA 5A4VA 1R26A 3CTFA 3CRUA 3HD5A 5FHIA 1V40A 5HR0A 4KDXA 1KEBA 3TKRA 4GF0A 2ES7A 1SU9A 2IJYA 3FZAA 4WR5A 1LJRA 4IBPA 2GS3A 2TIRA 1E2YA 1TI1A 4EIQA 2LRTA 4JU5A 1VF2A 2P31A 3L78A 4ZXGA 4V2MA 3TJJA 4HOJA 3KD0A 3ZL5A 5KN0A 4NHWA 3DYRA 2A4VA 1IYIA 2C4JA 2TRCP 1U88A 3IV4A 1XOAA 4PNFA 3J7Yk 3A5WA 3CSJA 3W6GA 1GSSA 4MF5A 3ME8A 2H6YA 2HRKA 3HVXA 4TXOA 3O76A 3TJKA 4QL9A 2LQOA 3MAKA 4FIWA 5B7CA 4JR6A 2FUG2 1TRVA 1XW6A 3PINA 2DJ1A 3AY8A 4O5QA 5H5QA 3FEUA 2HRFA 2YCDA 4AJ7A 1Z7PA 2WRTA 1X5CA 4F9ZA 4MMMA 2IIYA 1F3BA 5CREA 2VL9A 2X49A 3D22A 2B3SA 5J41A 3FZ4A 2EIOA 12GSA 4USSA 5F8BA 3GURA 1Z6MA 4EO3A 3DVXA 1TDIA 2R0GA 3GMFA 2VL3A 2PPTA 3IC4A 1G7OA 2XPEA 5G5FA 1YJ6A 4ZBDA 2JADA 1A2JA 4ZL9A 4PX1A 3IAM2 5D8IA 1A2LA 3VFIA 4TXVA 2WJUA 4KSOA 4MZWA 2RUEA 1SD8A 4V2LA 3F8UA 5DJLA 5ECPB 4WF4A 4MNNA 3CTGA 1TRUA 4GWRA 5ECSA 1LBKA 3A3TA 1XZOA 5CRHA 4LL1B 1O6JA 2R0PA 3Q74A 1T7PB 3CSIA 1OAZA 4PTSA 3UVHA 1AXDA 2AV4A 2JSYA 2MBTA 3EINA 2GSTA 1MDJA 4KCAA 4HZ4A 1N2AA 4MF7A 1R5PA 3UL3A 4O92A 4TR1A 4WF5A 2R6KA 4XS6A 2XBIA 1W89A 4MDCA 5IPHA 2VUPA 5COHA 4PNGA 4Q5FA 4ECJA 3UVTA 2YOIA 4NV2A 4HU7A 2VCQA 5A5KA 4TN8A 1MDIA 2GSSA 1YEPA 1TKDB 4K5SA 1YF1A 3FZ5A 5H5RA 4KDYA 1U3IA 1USBA 4TKYA 1BX9A 1MD3A 6GSYA 4POLA 3QD9A 4I2UA 5EVOA 2L5OA 1SL0B 4KF9A 3EMXA 1YEXA 3C7MA 4NMUA 1SJZA 2C0FA 4HQZA 1UN2A 3BD2A 2I9HA 2YZUA 1ERTA 14GSA 1T1VA 2DJ0A 5HFIA 3ZMLA 4PQHA 1ZYQB 1H75A 3HJOA 4G10A 1ML6A 3D0ZA 2AJQB 3GUSA 1M2BA 3A5IA 5DAKB 1ERWA 5IO2A 3L0HA 1F2EA 5D9XA 4BL7B 2H71A 2O7KA 3M9KA 1M7TA 19GSA 3ZITA 4F03A 5IMFA 3J7Yb 1XFLA 4ECIA 2GQMA 1TK0B 2V1MA 3H1NA 4OO5A 1NHYA 1A23A 1GP1A 1NSWA 3US3A 4I6XA 2LEGA 2WFCA 2I4AA 2HXKA 4MF6A 1GLPA 2C0EA 1AQWA 4NAXA 3HY2A 1QMVA 4OMVA 3TJGA 2PVQA 3U6VA 3VWUA 1A2MA 1SL1B 2LRCA 1DUGA 1OKTA 3A2WA 2K6VA 3GN3A 1ON4A 1CQGA 2OA7A 4YQMA 2VL2C 3NZNA 4WEYA 4MCUA 4E8EA 2BJXA 4MZBA 1ABAA 3ZIVA 4OCEA 2YJ7A 3IHGA 4I2TA 1V9WA 1GSFA 5EL8A 1K0MA 3N9JA 3GL5A 1XVQA 3S9FA 4GCIA 2VLTA 2CZ3A 1K0NA 2H1GA 2X64A 1SENA 2GQKA 1U87A 4BVYA 2FY6A 2HRNA 2H0GA 5KN1A 2HYXA 5G31A 1UA5A 4EUYA 5DALB 4ML1A 2DSAA 5GSSA 1Z6NA 3C1RA 2H6XA 2I1UA 2IPAA 4G0LA 2YWIA 2KHPA 1AW9A 3UARA 5ECMB 5ECOB 2H01A 2FCHA 2RM5A 3G7JA 3GSTA 1H4OA 3IAS2 4Z2UA 1QFNA 1OE7A 4LLRA 4MH3A 2DMLA 2WGRA 1ERVA 3ZFBA 1DE1A 1FO5A 3P7XA 2AYTA 6GSTA 2E2MA 1XXUA 3F6FA 2YV9A 4OWYA 2AUVA 3TJFA 2UZ8A 2R37A 4Q5QA 3BBYA 1KTEA 2QA1A 1O81A 2FWGA 2H1BA 3KEBA 1I9DA 2B1KA 2QGVA 3R2QA 1B4PA 2GQLA 2YP6A 2O8VB 2WDUA 4ZB9A 2R0CA 3CYNA 3DIEA 1S3DA 2C0GA 1HNBA 3KJYA 4NXIA 1ERUA 2V32A 3I69A 5FT3A 5JWQB 4MJBA 3ZREA 5INYA 3DVWA 2F8FA 2C1YA 3VWVA 4NV5A 2L5LA 2H70A 4EF0A 2YANA 5C04A 5IM9A 4QQ7A 4Z7XA 2JU5A 2P5QA 4KUNA 4I8BA 4IP6A 1WWJA 1JLVA 1MTCA 1ZZYA 4KAEA 4CHSA 2H74A 2VCWA 1M99A 1PD21 1PMTA 3LW9A 2XHFA 2ON7A 3G7YA 5LNKe 4ULXA 4ZB6A 2PUKC 1GULA 2GVPA 3A2XA 4K9ZA 5IMDA 3HA9A 4OFMA 3FW2A 4ACSA 4X43A 1HD2A 2H75A 2YV7A 1QQ2A 1OYJA 1G6YA 2FD3A 1SYXA 1A8LA 1OC9B 2H1AA 3VWXA 1BEDA 1Y25A 2L6CA 4JR4A 4IS0A 1YKCA 2DKHA 3L4NA 1SKRB 3QAVA 1TRWA 2CZ2A 3M3MA 4O7HA 4POBA 1PX6A 5KOXA 2VD0A 1GTAA 5IQYA 1PGTA 4K2DA 1GL8A 4ILFA 5DCHA 3GFKA 2XPDA 1PA3A 1HYUA 2B5XA 1TRSA 2I3YA 3MDKA 5G2ZA 4MP4A 1UC7A 4GQCA 5JCUA 4GSTA 8GSSA 2PGTA 1UVZA 4V1Ap 5HR2A 3GH9A 7GSSA 1BG5A 4WETA 4PQ1A 3EU4A 5ENUA 2WCIA 5CO3A 3F3QA 3VPQA 3LYKA 1JHBA 1DSBA 3LORA 2H73A 3D4TA 4IJ3A 3ZMKA 4F82A 3HYPA 2GSRA 3TKSA 2KP2A 4I97A 5GAND 3GKXA 2LTKA 1X9WB 1XWBA 2H0HA 1B9YC 1XWCA 2LV3A 2PERA 4PGTA 5CAXA 2GGTA 2GZZA 3KP9A 3U5RE 3C8EA 5C00A 5IIZA 2PMTA 5D9WA 2DIYA 4XRAA 1FW1A 1K0BA 2H6ZA 4DSSB 1TXXA 4I5QA 2CVBA 3QFBC 2GLRA 3QAWA 3NIVA 4BWQA 2XBQA 5GZZB 5B8AA 4MLYA 5F05A 3IXRA 2C3NA 5AGYA 1WP0A 4TRXA 3H93A 4F0CA 4EIPA 4N10A 1JLWA 4PURA 1FG4A 3GX8A 3VLNA 2DJ2A 1GTIA 1GUKA 5JCWA 5DAKA 4TR4A 5KN2A 5DDLA 4BL7A 1DE2A 4MK3A 1TK8B 4N0VA 1X5DA 2GSQA 3QOUA 4K0GA 5H5SA 3IK7A 2H0IA 1GSDA 1ZMAA 3EVIA 2MMNA 4N11A 2CV4A 4F0BA 1HNAA 4HEA2 4HU9A 4MJAA 1K3LA 5HQPA 1Z9HA 3EYTA 1B4QA 3D5JA 5CRGA 2F51A 3WGXA 13GSA 3PR8A 5ECNB 2F8AA 4L8EA 1PRXA 2V6KA 2EIRA 1ZL9A 3MSZA 3TCOA 4IVFA 1X0RA 3UJ1A 2HFDA 1KNGA 1XCCA 3FYGA 5G5EA 1B9XC 1WMJA 1X9MB 3DKSA 5J9BA 2VCZA 2VCXA 1THXA 3E9JB 1MD4A 2GTUA 2ZNMA 2IMIA 2NVLA 2KP1A 1KBNA 2HZEB 5DALA 3BCKA 4TR3A 4D73B 2IMFA 1EOGA 2NBSA 4JE1A 2RM6A 2IFQB 1OC3A 1JZWA 1K0CA 4MZCA 2FWFA 4K7IA 3LFLA 1Y6EA 3VWWA 5ECHB 4O32A 1MEKA 2P5RA 1JZOA 1V57A 3OR5A 4CW9A 1GSUA 3A2VA 4QL7A 1EGOA 1K3OA 4OFTA 2YPMA 2HRAA 5AN1A 3F4SA 2E0QA 4MPFA 2YWNA 1S3CA 5B6NA 3TKQA 3LGCA 2IN3A 3APOA 4ICYA 2FLSA 4CY8A 3KCMA 3E0UA 1T8EB 1F37A 2VM2A 22GSA 3TRQA 4ZB8A 3PH9A 2FWEA 1K0OA 4TVEA 2L4CA 2HI7A 5DCGA 2KUCA 2MYGA 4X0XA 2CA8A 5IMAA 1AAZA 5AIXA 4HDEA 1F9MA 4ID0A 2H19A 4GRFA 5EPFA 1ZGNA 3BCIA 5GAPD 2KOKA 1N8JA 3KZQA 4NPBA 5IPGA 1GUMA 18GSA 3KH9A 5GSTA 1M2DA 2JACA 5ECIB 1SK0A 5CRDA 1SJ6A 2QKEA 2MMAA 2WZ9A 3RAZA 5DQYA 3HJPA 2N5BA 4FH8A 3IK9A 4EXJA 4XHMA 2G0FA 3QFAC 4AJ6A 17GSA 4TOPA 1ACVA 2A2RA 3V1WA 4HUAA 1OC9A 3EMPA 2H66A 1ST9A 3UEMA 3IR4A 1SYRA 2FA4A 3HZ4A 1G0TA 1SKWB 2X8HA 2VCTA 4LA1A 2OADA 1XW9A 3GSSA 2BMXA 2RUFA 4MPGA 2HSYA 3UBKA 2LQQA 3GNJA 1PX7A 1T00A 4K2XA 4K1FA 1LU4A 3I9V2 4FYUA 5IMZA 5ABRA 3ED3A 3ZLPA 3FR3A 4POKA 1R7HA 1VGLA 2LNSA 5J9CA 1ZCPA 2LJAA 2N5FA 4GSNA 5L71A 4IW9A 2H8LA 4RI7A 4KSMA 3EE2A 2FNOA 4G19A 3DMLA 2VM1A 3LEFA 2CAIA 4BWSA 1TOFA 4IJIA 2B6MA 2DKIA 4XIHA 2VO4A 3RPNA 3KH7A 4V2NA 1OVNA 3GX0A 2FGXA 4HJ2A 4DEJA 4PXOA 4ZBBA 5ECQB 2REMA 5A4WA 1NW2A 3C71A 2C3QA 2LUSA 1Q98A 2CQ9A 2IWTA 1O7UA 1NHOA 2VCVA 1RW1A 1T4ZA 4E8HA 4YQUA 2A2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N0Z A;  1VF4 A;  2G2Q A;  2WUL A;  4EDZ A;  3QDN A;  5CRW A;  2YN1 A;  2B5Y A;  2H72 A;  2L59 A;  4DSS A;  1O8X A;  1R4W A;  1X5E A;  3ERF A;  3BJ5 A;  3M0F A;  1PL2 A;  1FVJ A;  4TR0 A;  2ZUP A;  3GTU B;  1VRS D;  2PWJ A;  4L5O A;  2GT5 A;  5F0G A;  4TW5 A;  1JZD A;  1PL1 A;  4GXZ A;  3GKK A;  2CVD A;  2ALB A;  4BPY A;  4HJM A;  5IOX A;  1XWG A;  3H4K A;  2VD1 A;  1XWA A;  5HFG A;  4J2F A;  1JFU A;  1C72 A;  2K8V A;  3HCZ A;  3F9U A;  2IME A;  1PQN A;  2X8G A;  4XS1 A;  2YNX A;  2EIQ A;  2PU9 C;  3FHK A;  3GKN A;  1PN9 A;  1WJK A;  4YAP A;  2ON5 A;  16GS A;  3VPT A;  1SD9 A;  3DWV A;  3CRT A;  5F07 A;  1EV4 A;  3BOA A;  2WB9 A;  2DBC A;  3ISO A;  5D93 A;  9GSS A;  3K8N A;  5ID2 B;  1QGV A;  3ME7 A;  1F3A A;  1Q4J A;  4YAV A;  2OBK A;  3D4M A;  2IMD A;  1VF3 A;  2VIM A;  4CDO A;  1FAA A;  2R5G A;  1T3B A;  2X8C A;  3DGQ A;  2IL3 A;  4ZIJ A;  3D6I A;  4JED A;  3KTL A;  4IN0 A;  4OFN A;  5ELG A;  2D2Z A;  5EY6 A;  2HLS A;  1AQX A;  5DVB A;  3TKS C;  2O85 A;  5DBQ A;  3CSH A;  3FK8 A;  5AIS A;  1E6B A;  3KTB A;  3DEX A;  4DVC A;  3SBC A;  5J5N A;  3HZ8 A;  3IRA A;  2MMO A;  2B1L A;  3ERG A;  2HZE A;  2QSI A;  1B8X A;  4D73 A;  2IFQ A;  5HR1 A;  1ZYE A;  2IMK A;  4ZIL A;  3N5O A;  5D9V A;  1YDK A;  2OBI A;  4GLT A;  2OE3 A;  4IP1 A;  3ZYW A;  1T4Y A;  1URM A;  2FWH A;  4XTS A;  2RLI A;  1EEJ A;  3TOT A;  3M1G A;  3RBT A;  1EOH A;  1A8Y A;  2LJK A;  3G7I A;  3L9S A;  4J56 E;  3LWA A;  1A0R P;  2BTO T;  1YF0 A;  5AIV A;  2OAC A;  1TU8 A;  2JZS A;  1EV9 A;  1TTZ A;  2DLX A;  2WS2 A;  3CBU A;  2OKA A;  4KX4 A;  4KGI A;  3IHQ A;  2JZT A;  1GUH A;  5IMV A;  1NM3 A;  4WBJ A;  4GSS A;  2M72 A;  2R3X A;  1BAY A;  4EKZ A;  4DSR A;  1WIK A;  3TUE A;  1YY7 A;  3TB2 A;  4RQX A;  1AC1 A;  1O8W A;  3CMI A;  4HZ2 A;  5FWG A;  1U3A A;  3KXO A;  3GYK A;  3ZIJ A;  3EWL A;  1TK5 B;  1V2A A;  4KND A;  4XS4 B;  3GKM A;  4MA9 A;  5CYY A;  3FR6 A;  1GWC A;  5ECL B;  2VOC A;  2AHE A;  1HQO A;  2E7P A;  3LYP A;  3C1S A;  3TGZ A;  4MH2 A;  1SKS B;  2DJ3 A;  1SL2 B;  2I81 A;  2OE1 A;  3VK9 A;  4ECC A;  4H86 A;  4XCS A;  5IMC A;  1M0U A;  4RUV A;  2L4Q A;  4Q5N A;  4YH2 A;  1WOU A;  1GRX A;  2QC7 A;  1FHE A;  1GSY A;  3E3E A;  1EZK A;  10GS A;  1GH2 A;  5A4U A;  2N5A A;  3UIW A;  4AGS A;  3IOS A;  2RII A;  1AIU A;  3WD6 A;  2JZR A;  5D9T A;  6GSX A;  3HJM A;  4GQF A;  1M9B A;  1FOV A;  3F0I A;  5LD0 A;  4ZL8 A;  2C8U A;  3UOM A;  5DJM A;  3TKS E;  3VI7 A;  3LQ7 A;  3UBL A;  6GSV A;  5JCG A;  3IE3 A;  5DQS A;  3KM6 A;  1M2A A;  3WT2 A;  3WGD A;  2M80 A;  3H79 A;  3RHB A;  3ZRD A;  3KMN A;  4EC0 A;  3TDG A;  2AB6 A;  3F6D A;  3APS A;  3DRN A;  5E4W A;  1U6T A;  3KGK A;  1AUC A;  5JWR B;  3C73 A;  3CXG A;  2YZH A;  2C80 A;  4V1A g;  4KDU A;  4EVM A;  4EDY A;  3GHA A;  4JBB A;  4K0N A;  2CX3 A;  2L57 A;  2PBJ A;  4AF2 A;  3JCM L;  2OJL A;  4ML6 A;  1XW5 A;  4KCE A;  3Q18 A;  1EGR A;  3QCP A;  1R5A A;  4XRD A;  3TKP A;  1GNE A;  5G30 A;  1BYE A;  1YKA A;  2NPB A;  3QMX A;  4WKW A;  3HDC A;  1OC8 A;  1QXH A;  4DSQ A;  1GNW A;  2CAQ A;  5B6M A;  4KA0 A;  2DC5 A;  3KMO A;  5G1L A;  4K6X A;  1CQH A;  3NOF A;  2LS5 A;  1GSQ A;  1DBY A;  3IDV A;  4G9H A;  5ELA A;  1XOB A;  1ZOF A;  5G1K A;  3LXZ A;  4KE3 A;  3GL3 A;  2E2G A;  4PQI A;  3GTU A;  1FVK A;  3TOU A;  1TW9 A;  4PUA A;  2HSH A;  5J3R A;  3UAP A;  2M46 A;  1XVW A;  1VF1 A;  4EE0 A;  2X99 A;  1I5G A;  4F2I A;  1XPV A;  2VLV A;  4MAB A;  3UMA A;  4J57 E;  1J0F A;  3WGE A;  2PN8 A;  1M9A A;  3IPZ A;  2C3T A;  3P2A A;  2EC4 A;  1A24 A;  4TXO B;  2GDR A;  3LSZ A;  2MMZ A;  1TI3 A;  2KLX A;  3ZTL A;  2R4V A;  5CP1 A;  1XBS A;  3DD3 A;  1BJX A;  1XIY A;  3DXB A;  1Z5Y E;  1OE8 A;  3P8W A;  2PVO C;  3FR9 A;  4K7O A;  1HNC A;  3LJR A;  3GRX A;  2O89 A;  4BA7 A;  5ID2 A;  3PGT A;  2TRX A;  2FA8 A;  1SK2 A;  2MZC A;  4FYB A;  3F4R A;  1OKD A;  2GT6 A;  1FB0 A;  4ZBA A;  1ILO A;  4LMW A;  1RQM A;  2K9F A;  2VLU A;  4OCF A;  4ZL7 A;  2LRN A;  3IA1 A;  4O5R A;  2F3M A;  1XWK A;  2AAW A;  2DMM A;  20GS A;  3MWH A;  4LMV A;  1J08 A;  1QK8 A;  4IEL A;  2NTO A;  3M8N A;  4YQV A;  4IQ1 A;  3L9V A;  5ECR B;  4EL1 A;  3VUR A;  2DIZ A;  1YQ1 A;  2DJJ A;  1EWX A;  1EP8 A;  1O73 A;  2GZP A;  3HVS A;  2HT9 A;  2HZF A;  2O87 A;  3M9J A;  5CNW A;  5B8B A;  2K18 A;  3W8S A;  1GTU A;  3I6A A;  4MJE A;  1GSE A;  4IHU A;  3IBH A;  3Q19 A;  1WRY A;  2LST A;  3WYW A;  4KW6 A;  4NHZ A;  3SWL A;  4Q5R A;  3H8Q A;  3MNG A;  4OD7 A;  1G7E A;  3L9U A;  5IO0 A;  4WXT A;  3I43 A;  4HI7 A;  4MJC A;  4TR1 B;  1YZX A;  3FRC A;  1K0D A;  2YWM A;  3WT1 A;  3G9B A;  2C0D A;  3FZ9 A;  1G6W A;  1W4V A;  3HVV A;  3ZFL A;  3W8J A;  2VL2 A;  2CX4 A;  3ZVJ D;  5KN3 A;  4RQR A;  1GLQ A;  2V41 A;  1V98 A;  4K7N A;  4NWY A;  2ZCT A;  1K3Y A;  3F63 A;  3HKR A;  3VI5 A;  1GTB A;  2F9S A;  4GTU A;  4IKH A;  2HNL A;  3GA4 A;  3F4T A;  3QAG A;  2B5E A;  2MBS A;  4IGJ A;  1TP9 A;  2R2J A;  2JSZ A;  2FHE A;  4ECB A;  4KH7 A;  3D21 A;  2YWO A;  2Z9S A;  4PUF C;  5IOW A;  3HXS A;  4POM A;  2NDO A;  2H1D A;  3TRX A;  1V58 A;  2VAF A;  5HFK A;  4JZQ A;  2B7J A;  3RDW A;  6GSW A;  3GH6 A;  4XS4 A;  2XC2 A;  4HQS A;  3ZZX A;  4OO4 A;  3O6T A;  5LCZ A;  1SK1 A;  4G2E A;  2H30 A;  2V6O A;  1Z3E A;  4L0W A;  4AJ8 A;  1TJD A;  1J9B A;  2DJK A;  2V2G A;  2JL4 A;  2K8S A;  3LXT A;  4P3Y B;  3ZVJ A;  1WPI A;  2H76 A;  1THO A;  4IQA A;  6GSU A;  1EEM A;  1PKZ A;  2P0G A;  3RPP A;  3KIJ A;  1S3A A;  1TU7 A;  2LKU A;  4BVX A;  2CVK A;  5J4U A;  2GZY A;  2YJH A;  4L0U A;  1FB6 A;  2OE0 A;  1B48 A;  2LJR A;  4RI6 A;  4WR4 A;  1QUW A;  1EP7 A;  5D96 A;  4FYC A;  3F3R A;  1IYH A;  1F6M C;  4K8M A;  4WBR D;  1PSQ A;  2B7K A;  4HS1 A;  1MDK A;  3LG6 A;  2HE3 A;  1SJI A;  5JWO B;  3ERW A;  4LL4 B;  3Q6O A;  3EUR A;  4ISD A;  5ECK B;  5HR3 A;  3RHC A;  6GSS A;  1O85 A;  4X1U A;  3APQ A;  1K0A A;  4L5L A;  3EC3 A;  1BQ7 A;  11GS A;  1PKW A;  2L6D A;  3GV1 A;  1AQV A;  3GIX A;  3EU3 A;  3FY7 A;  4FO5 A;  5F06 A;  3TJB A;  5KEJ A;  2J9H A;  3O3T A;  1X9S B;  5D73 A;  3HHV A;  3P90 A;  5E59 A;  4KB3 A;  1RK4 A;  3QPM A;  2LNT A;  4N30 A;  2CT6 A;  2J23 A;  1JZR A;  3KP8 A;  3QR6 A;  4JRR A;  1A0F A;  1Z7R A;  3FKF A;  1WE0 A;  3TRP A;  5A4V A;  1R26 A;  3CTF A;  3CRU A;  3HD5 A;  5FHI A;  1V40 A;  5HR0 A;  4KDX A;  1KEB A;  3TKR A;  4GF0 A;  2ES7 A;  1SU9 A;  2IJY A;  3FZA A;  4WR5 A;  1LJR A;  4IBP A;  2GS3 A;  2TIR A;  1E2Y A;  1TI1 A;  2LRT A;  4JU5 A;  1VF2 A;  2P31 A;  3L78 A;  4ZXG A;  4V2M A;  3TJJ A;  4HOJ A;  3KD0 A;  3ZL5 A;  5KN0 A;  4NHW A;  3DYR A;  2A4V A;  1IYI A;  2C4J A;  2TRC P;  1U88 A;  3IV4 A;  1XOA A;  4PNF A;  3J7Y k;  3A5W A;  3CSJ A;  3W6G A;  1GSS A;  4MF5 A;  3ME8 A;  2H6Y A;  3HVX A;  4TXO A;  3O76 A;  3TJK A;  4QL9 A;  2LQO A;  3MAK A;  4FIW A;  5B7C A;  4JR6 A;  2FUG 2;  1TRV A;  1XW6 A;  3PIN A;  2DJ1 A;  3AY8 A;  5H5Q A;  3FEU A;  2HRF A;  2YCD A;  4AJ7 A;  1Z7P A;  2WRT A;  1X5C A;  4F9Z A;  4MMM A;  2IIY A;  1F3B A;  5CRE A;  2VL9 A;  3D22 A;  2B3S A;  5J41 A;  3FZ4 A;  2EIO A;  12GS A;  5F8B A;  3GUR A;  1Z6M A;  4EO3 A;  3DVX A;  1TDI A;  3GMF A;  2VL3 A;  2PPT A;  3IC4 A;  1G7O A;  2XPE A;  5G5F A;  1YJ6 A;  4ZBD A;  2JAD A;  1A2J A;  4ZL9 A;  4PX1 A;  3IAM 2;  5D8I A;  1A2L A;  3VFI A;  4TXV A;  2WJU A;  4KSO A;  4MZW A;  2RUE A;  1SD8 A;  4V2L A;  3F8U A;  5DJL A;  5ECP B;  4WF4 A;  3CTG A;  1TRU A;  4GWR A;  5ECS A;  1LBK A;  3A3T A;  1XZO A;  5CRH A;  4LL1 B;  1O6J A;  3Q74 A;  1T7P B;  3CSI A;  1OAZ A;  3UVH A;  1AXD A;  2AV4 A;  2JSY A;  2MBT A;  3EIN A;  2GST A;  1MDJ A;  4KCA A;  4HZ4 A;  1N2A A;  4MF7 A;  1R5P A;  3UL3 A;  4O92 A;  4TR1 A;  4WF5 A;  2R6K A;  4XS6 A;  2XBI A;  1W89 A;  4MDC A;  5IPH A;  2VUP A;  5COH A;  4PNG A;  4Q5F A;  4ECJ A;  3UVT A;  2YOI A;  4NV2 A;  4HU7 A;  2VCQ A;  5A5K A;  4TN8 A;  1MDI A;  2GSS A;  1YEP A;  1TKD B;  1YF1 A;  3FZ5 A;  5H5R A;  4KDY A;  1U3I A;  1USB A;  4TKY A;  1BX9 A;  1MD3 A;  6GSY A;  4POL A;  3QD9 A;  4I2U A;  5EVO A;  2L5O A;  1SL0 B;  3EMX A;  1YEX A;  3C7M A;  4NMU A;  1SJZ A;  2C0F A;  4HQZ A;  1UN2 A;  3BD2 A;  2I9H A;  2YZU A;  1ERT A;  14GS A;  1T1V A;  2DJ0 A;  5HFI A;  3ZML A;  4PQH A;  1ZYQ B;  1H75 A;  3HJO A;  4G10 A;  1ML6 A;  3D0Z A;  2AJQ B;  3GUS A;  1M2B A;  5DAK B;  1ERW A;  5IO2 A;  3L0H A;  1F2E A;  5D9X A;  2H71 A;  2O7K A;  3M9K A;  1M7T A;  19GS A;  3ZIT A;  4F03 A;  5IMF A;  3J7Y b;  1XFL A;  4ECI A;  2GQM A;  1TK0 B;  2V1M A;  3H1N A;  4OO5 A;  1NHY A;  1A23 A;  1GP1 A;  1NSW A;  3US3 A;  4I6X A;  2LEG A;  2WFC A;  2I4A A;  2HXK A;  4MF6 A;  1GLP A;  2C0E A;  1AQW A;  4NAX A;  3HY2 A;  1QMV A;  4OMV A;  3TJG A;  2PVQ A;  3U6V A;  3VWU A;  1A2M A;  1SL1 B;  2LRC A;  1DUG A;  1OKT A;  3A2W A;  2K6V A;  3GN3 A;  1ON4 A;  1CQG A;  2OA7 A;  4YQM A;  2VL2 C;  3NZN A;  4WEY A;  4MCU A;  4E8E A;  2BJX A;  4MZB A;  1ABA A;  3ZIV A;  4OCE A;  2YJ7 A;  4I2T A;  1V9W A;  1GSF A;  5EL8 A;  1K0M A;  3N9J A;  3GL5 A;  1XVQ A;  3S9F A;  4GCI A;  2VLT A;  2CZ3 A;  1K0N A;  2H1G A;  2X64 A;  1SEN A;  2GQK A;  1U87 A;  4BVY A;  2FY6 A;  2HRN A;  2H0G A;  5KN1 A;  2HYX A;  5G31 A;  1UA5 A;  4EUY A;  5DAL B;  4ML1 A;  2DSA A;  5GSS A;  1Z6N A;  3C1R A;  2H6X A;  2I1U A;  2IPA A;  2YWI A;  2KHP A;  1AW9 A;  3UAR A;  5ECM B;  5ECO B;  2H01 A;  2FCH A;  2RM5 A;  3G7J A;  3GST A;  1H4O A;  3IAS 2;  1QFN A;  1OE7 A;  4LLR A;  4MH3 A;  2DML A;  2WGR A;  1ERV A;  3ZFB A;  1DE1 A;  1FO5 A;  3P7X A;  2AYT A;  6GST A;  2E2M A;  1XXU A;  3F6F A;  2YV9 A;  4OWY A;  2AUV A;  3TJF A;  2R37 A;  4Q5Q A;  3BBY A;  1KTE A;  1O81 A;  2FWG A;  2H1B A;  3KEB A;  1I9D A;  2B1K A;  2QGV A;  3R2Q A;  1B4P A;  2GQL A;  2YP6 A;  2O8V B;  2WDU A;  4ZB9 A;  3CYN A;  3DIE A;  1S3D A;  2C0G A;  1HNB A;  3KJY A;  4NXI A;  1ERU A;  2V32 A;  3I69 A;  5FT3 A;  5JWQ B;  4MJB A;  3ZRE A;  5INY A;  3DVW A;  2F8F A;  2C1Y A;  3VWV A;  4NV5 A;  2L5L A;  2H70 A;  4EF0 A;  2YAN A;  5C04 A;  5IM9 A;  4QQ7 A;  4Z7X A;  2JU5 A;  2P5Q A;  4KUN A;  4I8B A;  4IP6 A;  1WWJ A;  1JLV A;  1MTC A;  1ZZY A;  4KAE A;  4CHS A;  2H74 A;  2VCW A;  1M99 A;  1PD2 1;  1PMT A;  2XHF A;  2ON7 A;  3G7Y A;  5LNK e;  4ULX A;  4ZB6 A;  2PUK C;  1GUL A;  2GVP A;  3A2X A;  4K9Z A;  5IMD A;  3HA9 A;  4OFM A;  3FW2 A;  4ACS A;  4X43 A;  1HD2 A;  2H75 A;  2YV7 A;  1QQ2 A;  1OYJ A;  1G6Y A;  2FD3 A;  1SYX A;  1A8L A;  1OC9 B;  2H1A A;  3VWX A;  1BED A;  1Y25 A;  2L6C A;  4JR4 A;  4IS0 A;  1YKC A;  3L4N A;  1SKR B;  3QAV A;  1TRW A;  2CZ2 A;  3M3M A;  4O7H A;  4POB A;  1PX6 A;  2VD0 A;  1GTA A;  5IQY A;  1PGT A;  4K2D A;  1GL8 A;  4ILF A;  5DCH A;  3GFK A;  2XPD A;  1PA3 A;  1HYU A;  2B5X A;  1TRS A;  2I3Y A;  3MDK A;  5G2Z A;  4MP4 A;  1UC7 A;  4GQC A;  5JCU A;  4GST A;  8GSS A;  2PGT A;  1UVZ A;  4V1A p;  5HR2 A;  3GH9 A;  7GSS A;  1BG5 A;  4WET A;  4PQ1 A;  3EU4 A;  5ENU A;  2WCI A;  5CO3 A;  3F3Q A;  3VPQ A;  3LYK A;  1JHB A;  1DSB A;  3LOR A;  2H73 A;  3D4T A;  4IJ3 A;  3ZMK A;  4F82 A;  3HYP A;  2GSR A;  3TKS A;  2KP2 A;  4I97 A;  5GAN D;  3GKX A;  2LTK A;  1X9W B;  1XWB A;  2H0H A;  1B9Y C;  1XWC A;  2LV3 A;  2PER A;  4PGT A;  5CAX A;  2GGT A;  2GZZ A;  3KP9 A;  3U5R E;  3C8E A;  5C00 A;  5IIZ A;  2PMT A;  5D9W A;  2DIY A;  4XRA A;  1FW1 A;  1K0B A;  2H6Z A;  4DSS B;  1TXX A;  4I5Q A;  2CVB A;  3QFB C;  2GLR A;  3QAW A;  3NIV A;  4BWQ A;  2XBQ A;  5GZZ B;  5B8A A;  4MLY A;  5F05 A;  3IXR A;  2C3N A;  5AGY A;  1WP0 A;  4TRX A;  3H93 A;  4F0C A;  4N10 A;  1JLW A;  4PUR A;  1FG4 A;  3GX8 A;  3VLN A;  2DJ2 A;  1GTI A;  1GUK A;  5JCW A;  5DAK A;  4TR4 A;  5KN2 A;  5DDL A;  4BL7 A;  1DE2 A;  4MK3 A;  1TK8 B;  4N0V A;  1X5D A;  2GSQ A;  3QOU A;  4K0G A;  5H5S A;  3IK7 A;  2H0I A;  1GSD A;  1ZMA A;  3EVI A;  2MMN A;  4N11 A;  2CV4 A;  4F0B A;  1HNA A;  4HEA 2;  4HU9 A;  4MJA A;  1K3L A;  5HQP A;  1Z9H A;  3EYT A;  1B4Q A;  3D5J A;  5CRG A;  2F51 A;  3WGX A;  13GS A;  3PR8 A;  5ECN B;  2F8A A;  4L8E A;  1PRX A;  2V6K A;  2EIR A;  1ZL9 A;  3MSZ A;  3TCO A;  4IVF A;  1X0R A;  3UJ1 A;  2HFD A;  1KNG A;  1XCC A;  3FYG A;  5G5E A;  1B9X C;  1WMJ A;  1X9M B;  3DKS A;  5J9B A;  2VCZ A;  2VCX A;  1THX A;  3E9J B;  1MD4 A;  2GTU A;  2ZNM A;  2IMI A;  2NVL A;  2KP1 A;  1KBN A;  2HZE B;  5DAL A;  3BCK A;  4TR3 A;  4D73 B;  2IMF A;  1EOG A;  2NBS A;  4JE1 A;  2RM6 A;  2IFQ B;  1OC3 A;  1JZW A;  1K0C A;  4MZC A;  2FWF A;  4K7I A;  3LFL A;  1Y6E A;  3VWW A;  5ECH B;  4O32 A;  1MEK A;  2P5R A;  1JZO A;  1V57 A;  3OR5 A;  4CW9 A;  1GSU A;  3A2V A;  4QL7 A;  1EGO A;  1K3O A;  4OFT A;  2YPM A;  5AN1 A;  3F4S A;  2E0Q A;  4MPF A;  2YWN A;  1S3C A;  5B6N A;  3TKQ A;  3LGC A;  2IN3 A;  3APO A;  2FLS A;  3KCM A;  3E0U A;  1T8E B;  1F37 A;  2VM2 A;  22GS A;  3TRQ A;  4ZB8 A;  3PH9 A;  2FWE A;  1K0O A;  4TVE A;  2L4C A;  2HI7 A;  5DCG A;  2KUC A;  2MYG A;  4X0X A;  2CA8 A;  5IMA A;  1AAZ A;  5AIX A;  4HDE A;  1F9M A;  4ID0 A;  2H19 A;  4GRF A;  5EPF A;  1ZGN A;  3BCI A;  5GAP D;  2KOK A;  1N8J A;  3KZQ A;  4NPB A;  5IPG A;  1GUM A;  18GS A;  3KH9 A;  5GST A;  1M2D A;  2JAC A;  5ECI B;  1SK0 A;  5CRD A;  1SJ6 A;  2QKE A;  2MMA A;  2WZ9 A;  3RAZ A;  5DQY A;  3HJP A;  2N5B A;  4FH8 A;  3IK9 A;  4EXJ A;  4XHM A;  2G0F A;  3QFA C;  4AJ6 A;  17GS A;  4TOP A;  1ACV A;  2A2R A;  3V1W A;  4HUA A;  1OC9 A;  3EMP A;  2H66 A;  1ST9 A;  3UEM A;  3IR4 A;  1SYR A;  2FA4 A;  3HZ4 A;  1G0T A;  1SKW B;  2X8H A;  2VCT A;  4LA1 A;  2OAD A;  1XW9 A;  3GSS A;  2BMX A;  2RUF A;  4MPG A;  2HSY A;  3UBK A;  2LQQ A;  3GNJ A;  1PX7 A;  1T00 A;  4K1F A;  1LU4 A;  3I9V 2;  4FYU A;  5IMZ A;  5ABR A;  3ED3 A;  3ZLP A;  3FR3 A;  4POK A;  1R7H A;  1VGL A;  2LNS A;  5J9C A;  1ZCP A;  2LJA A;  2N5F A;  4GSN A;  5L71 A;  4IW9 A;  2H8L A;  4RI7 A;  4KSM A;  3EE2 A;  2FNO A;  4G19 A;  3DML A;  2VM1 A;  3LEF A;  2CAI A;  4BWS A;  1TOF A;  4IJI A;  2B6M A;  4XIH A;  2VO4 A;  3RPN A;  3KH7 A;  4V2N A;  1OVN A;  3GX0 A;  2FGX A;  4HJ2 A;  4DEJ A;  4PXO A;  4ZBB A;  5ECQ B;  2REM A;  5A4W A;  1NW2 A;  3C71 A;  2C3Q A;  2LUS A;  1Q98 A;  2CQ9 A;  2IWT A;  1O7U A;  1NHO A;  2VCV A;  1RW1 A;  1T4Z A;  4E8H A;  4YQU A;  2A2S A; 
#chains in the Genus database with same CATH topology
 4N0Z A;  1VF4 A;  2G2Q A;  2WUL A;  4EDZ A;  3QDN A;  5CRW A;  2YN1 A;  2B5Y A;  2H72 A;  2L59 A;  4DSS A;  1O8X A;  1R4W A;  1X5E A;  3ERF A;  3BJ5 A;  3M0F A;  1PL2 A;  1FVJ A;  4TR0 A;  2ZUP A;  4CY6 A;  3GTU B;  1VRS D;  2PWJ A;  5BMU A;  4L5O A;  2GT5 A;  5F0G A;  4TW5 A;  1JZD A;  1PL1 A;  4GXZ A;  3GKK A;  2CVD A;  2ALB A;  4BPY A;  4HJM A;  5IOX A;  1XWG A;  3H4K A;  2VD1 A;  1XWA A;  5HFG A;  4J2F A;  1JFU A;  1C72 A;  2K8V A;  3HCZ A;  3F9U A;  2IME A;  1PQN A;  2X8G A;  4XS1 A;  2YNX A;  2EIQ A;  2PU9 C;  3MYD A;  3FHK A;  3GKN A;  1PN9 A;  1WJK A;  4YAP A;  2ON5 A;  16GS A;  3VPT A;  1SD9 A;  3DWV A;  4O5U A;  3CRT A;  5F07 A;  1EV4 A;  3BOA A;  2WB9 A;  2DBC A;  3ISO A;  5D93 A;  9GSS A;  3K8N A;  5ID2 B;  1QGV A;  3ME7 A;  1F3A A;  1Q4J A;  4YAV A;  2OBK A;  3D4M A;  2IMD A;  1VF3 A;  2VIM A;  4CDO A;  1FAA A;  2R5G A;  1T3B A;  2X8C A;  2QA2 A;  3DGQ A;  3R3E A;  2IL3 A;  3EPT A;  4ZIJ A;  3D6I A;  4JED A;  3KTL A;  2HSM A;  2A2P A;  4IN0 A;  4OFN A;  5ELG A;  2D2Z A;  5EY6 A;  2HLS A;  1AQX A;  5DVB A;  3TKS C;  2O85 A;  5DBQ A;  3CSH A;  3FK8 A;  5AIS A;  1E6B A;  3KTB A;  3DEX A;  4YKF A;  4DVC A;  3SBC A;  5J5N A;  3HZ8 A;  1PN0 A;  3IRA A;  2MMO A;  2B1L A;  3ERG A;  2HZE A;  2QSI A;  1B8X A;  4D73 A;  2IFQ A;  5HR1 A;  1ZYE A;  2IMK A;  4ZIL A;  3N5O A;  4A5P A;  5D9V A;  1YDK A;  2OBI A;  4GLT A;  2OE3 A;  4IP1 A;  3ZYW A;  1T4Y A;  1URM A;  2FWH A;  4XTS A;  2RLI A;  3PPU A;  1EEJ A;  3TOT A;  3M1G A;  3RBT A;  1EOH A;  1A8Y A;  2LJK A;  3G7I A;  3L9S A;  4J56 E;  3LWA A;  1A0R P;  2BTO T;  1YF0 A;  5AIV A;  2OAC A;  1TU8 A;  2JZS A;  1EV9 A;  1TTZ A;  2DLX A;  2WS2 A;  3CBU A;  2OKA A;  4KX4 A;  4KGI A;  3IHQ A;  2JZT A;  1GUH A;  5IMV A;  1NM3 A;  4WBJ A;  4GSS A;  2M72 A;  2R3X A;  1BAY A;  4EKZ A;  4DSR A;  1WIK A;  3TUE A;  1YY7 A;  3TB2 A;  4RQX A;  1AC1 A;  1O8W A;  3CMI A;  4HZ2 A;  5FWG A;  1U3A A;  3KXO A;  3GYK A;  3ZIJ A;  3EWL A;  1TK5 B;  1V2A A;  4KND A;  4XS4 B;  3GKM A;  4MA9 A;  5CYY A;  3FR6 A;  1GWC A;  5ECL B;  2VOC A;  2AHE A;  4FQU A;  1HQO A;  2E7P A;  3LYP A;  3C1S A;  3TGZ A;  4MH2 A;  1SKS B;  2DJ3 A;  1SL2 B;  2I81 A;  2OE1 A;  3VK9 A;  4ECC A;  4H86 A;  4XCS A;  5IMC A;  1M0U A;  4RUV A;  2L4Q A;  4Q5N A;  4YH2 A;  1WOU A;  1GRX A;  2QC7 A;  1FHE A;  1GSY A;  3E3E A;  4X4J A;  1EZK A;  10GS A;  1GH2 A;  5A4U A;  2N5A A;  3UIW A;  4AGS A;  3IOS A;  4BVX B;  2RII A;  1AIU A;  3WD6 A;  2JZR A;  5D9T A;  6GSX A;  3HJM A;  4GQF A;  1M9B A;  1FOV A;  3F0I A;  5LD0 A;  4ZL8 A;  2C8U A;  3UOM A;  5DJM A;  3TKS E;  3VI7 A;  3LQ7 A;  3UBL A;  6GSV A;  5JCG A;  1ZYP A;  3IE3 A;  5DQS A;  3KM6 A;  1M2A A;  3WT2 A;  3WGD A;  2M80 A;  3H79 A;  3RHB A;  3ZRD A;  3KMN A;  4EC0 A;  3TDG A;  2AB6 A;  3F6D A;  3APS A;  3DRN A;  5E4W A;  1U6T A;  3KGK A;  1AUC A;  5JWR B;  3C73 A;  3CXG A;  2YZH A;  2C80 A;  4V1A g;  4KDU A;  4EVM A;  4EDY A;  3GHA A;  4JBB A;  4K0N A;  2CX3 A;  2L57 A;  2PBJ A;  4AF2 A;  3JCM L;  2OJL A;  4ML6 A;  4G0I A;  1XW5 A;  4KCE A;  3Q18 A;  1EGR A;  3QCP A;  1R5A A;  4XRD A;  3TKP A;  1GNE A;  5G30 A;  1BYE A;  1YKA A;  2NPB A;  3QMX A;  4WKW A;  3HDC A;  1OC8 A;  1QXH A;  4DSQ A;  1GNW A;  2CAQ A;  5B6M A;  4KA0 A;  2DC5 A;  3KMO A;  5G1L A;  4HSC X;  4K6X A;  1CQH A;  3NOF A;  2LS5 A;  1GSQ A;  1DBY A;  3IDV A;  4G9H A;  5ELA A;  1XOB A;  1ZOF A;  5G1K A;  1ZYN A;  3LXZ A;  4K5R A;  4KE3 A;  3GL3 A;  2E2G A;  4PQI A;  3GTU A;  1FVK A;  3TOU A;  1TW9 A;  4PUA A;  2HSH A;  5J3R A;  3UAP A;  2M46 A;  1XVW A;  1VF1 A;  4EE0 A;  2X99 A;  1I5G A;  4F2I A;  1XPV A;  1M3J A;  2VLV A;  4MAB A;  3UMA A;  4J57 E;  1J0F A;  3WGE A;  2PN8 A;  1M9A A;  3IPZ A;  2C3T A;  3P2A A;  2EC4 A;  1A24 A;  4TXO B;  2GDR A;  3LSZ A;  2MMZ A;  1TI3 A;  2KLX A;  3ZTL A;  2R4V A;  5CP1 A;  1XBS A;  3DD3 A;  1BJX A;  1XIY A;  3DXB A;  1Z5Y E;  1OE8 A;  3P8W A;  2PVO C;  3FR9 A;  4K7O A;  1HNC A;  3LJR A;  3GRX A;  2O89 A;  4BA7 A;  5ID2 A;  3PGT A;  2TRX A;  2FA8 A;  1SK2 A;  2MZC A;  4FYB A;  3F4R A;  1OKD A;  2GT6 A;  1FB0 A;  4ZBA A;  1ILO A;  2X4A A;  4LMW A;  1RQM A;  2K9F A;  2VLU A;  4OCF A;  4ZL7 A;  2LRN A;  3IA1 A;  4O5R A;  2F3M A;  1XWK A;  2AAW A;  2DMM A;  20GS A;  3MWH A;  4LMV A;  3FMW A;  1J08 A;  1QK8 A;  4IEL A;  2NTO A;  3M8N A;  4YQV A;  1S3R A;  4IQ1 A;  3L9V A;  5ECR B;  4EL1 A;  3VUR A;  2DIZ A;  5KOW A;  1YQ1 A;  2DJJ A;  1EWX A;  1EP8 A;  1O73 A;  2GZP A;  3HVS A;  2HT9 A;  2HZF A;  2O87 A;  3M9J A;  5CNW A;  5B8B A;  2K18 A;  3W8S A;  1GTU A;  3I6A A;  4MJE A;  1GSE A;  4IHU A;  3IBH A;  3Q19 A;  1WRY A;  2LST A;  3WYW A;  4KW6 A;  4NHZ A;  3SWL A;  4Q5R A;  3H8Q A;  3MNG A;  4OD7 A;  1G7E A;  3L9U A;  5IO0 A;  4WXT A;  3I43 A;  4G0K A;  4HI7 A;  4MJC A;  4TR1 B;  1YZX A;  3FRC A;  1K0D A;  2YWM A;  3WT1 A;  3G9B A;  2C0D A;  3MIX A;  3FZ9 A;  1G6W A;  1W4V A;  3HVV A;  3ZFL A;  3W8J A;  2VL2 A;  2CX4 A;  3ZVJ D;  5KN3 A;  4RQR A;  1GLQ A;  2V41 A;  1V98 A;  4K7N A;  4NWY A;  2ZCT A;  1K3Y A;  3F63 A;  1FOH A;  3HKR A;  3VI5 A;  1GTB A;  2F9S A;  4GTU A;  4IKH A;  2HNL A;  3GA4 A;  3F4T A;  3QAG A;  3IC8 A;  2B5E A;  2MBS A;  4IGJ A;  1TP9 A;  2R2J A;  2JSZ A;  2FHE A;  4ECB A;  4KH7 A;  3D21 A;  5BRT A;  2YWO A;  2Z9S A;  4PUF C;  5IOW A;  3HXS A;  4POM A;  4Z2T A;  2NDO A;  2H1D A;  3TRX A;  1V58 A;  2VAF A;  5HFK A;  4JZQ A;  2B7J A;  3RDW A;  6GSW A;  3GH6 A;  4XS4 A;  2XC2 A;  4HQS A;  3ZZX A;  4OO4 A;  3O6T A;  5LCZ A;  1SK1 A;  4G2E A;  2H30 A;  2V6O A;  1Z3E A;  4L0W A;  4AJ8 A;  1TJD A;  1J9B A;  2DJK A;  2V2G A;  2JL4 A;  2K8S A;  3LXT A;  4P3Y B;  3ZVJ A;  1WPI A;  2H76 A;  1THO A;  4IQA A;  6GSU A;  1EEM A;  1PKZ A;  2P0G A;  3RPP A;  3KIJ A;  1S3A A;  1TU7 A;  2LKU A;  4BVX A;  2CVK A;  5J4U A;  2GZY A;  2YJH A;  4L0U A;  1FB6 A;  2OE0 A;  1B48 A;  2A4H A;  2LJR A;  4RI6 A;  4WR4 A;  1QUW A;  1EP7 A;  5D96 A;  4FYC A;  3F3R A;  1IYH A;  1F6M C;  4K8M A;  4WBR D;  1PSQ A;  2B7K A;  4HS1 A;  1MDK A;  3LG6 A;  2HE3 A;  4YKG A;  1SJI A;  5JWO B;  3ERW A;  4LL4 B;  3Q6O A;  3EUR A;  4ISD A;  5ECK B;  5HR3 A;  3RHC A;  6GSS A;  1O85 A;  4X1U A;  3APQ A;  1K0A A;  4L5L A;  3EC3 A;  4BVY B;  1BQ7 A;  11GS A;  1PKW A;  2L6D A;  3GV1 A;  1AQV A;  3GIX A;  3EU3 A;  3FY7 A;  4FO5 A;  5F06 A;  3TJB A;  5KEJ A;  2J9H A;  3O3T A;  1X9S B;  5D73 A;  3HHV A;  3P90 A;  5E59 A;  4KB3 A;  1RK4 A;  3QPM A;  2LNT A;  4N30 A;  4Z2R A;  2CT6 A;  2J23 A;  1JZR A;  3KP8 A;  3QR6 A;  4JRR A;  1A0F A;  1Z7R A;  3FKF A;  1WE0 A;  3TRP A;  5A4V A;  1R26 A;  3CTF A;  3CRU A;  3HD5 A;  5FHI A;  1V40 A;  5HR0 A;  4KDX A;  1KEB A;  3TKR A;  4GF0 A;  2ES7 A;  1SU9 A;  2IJY A;  3FZA A;  4WR5 A;  1LJR A;  4IBP A;  2GS3 A;  2TIR A;  1E2Y A;  1TI1 A;  4EIQ A;  2LRT A;  4JU5 A;  1VF2 A;  2P31 A;  3L78 A;  4ZXG A;  4V2M A;  3TJJ A;  4HOJ A;  3KD0 A;  3ZL5 A;  5KN0 A;  4NHW A;  3DYR A;  2A4V A;  1IYI A;  2C4J A;  2TRC P;  1U88 A;  3IV4 A;  1XOA A;  4PNF A;  3J7Y k;  3A5W A;  3CSJ A;  3W6G A;  1GSS A;  4MF5 A;  3ME8 A;  2H6Y A;  2HRK A;  3HVX A;  4TXO A;  3O76 A;  3TJK A;  4QL9 A;  2LQO A;  3MAK A;  4FIW A;  5B7C A;  4JR6 A;  2FUG 2;  1TRV A;  1XW6 A;  3PIN A;  2DJ1 A;  3AY8 A;  4O5Q A;  5H5Q A;  3FEU A;  2HRF A;  2YCD A;  4AJ7 A;  1Z7P A;  2WRT A;  1X5C A;  4F9Z A;  4MMM A;  2IIY A;  1F3B A;  5CRE A;  2VL9 A;  2X49 A;  3D22 A;  2B3S A;  5J41 A;  3FZ4 A;  2EIO A;  12GS A;  4USS A;  5F8B A;  3GUR A;  1Z6M A;  4EO3 A;  3DVX A;  1TDI A;  2R0G A;  3GMF A;  2VL3 A;  2PPT A;  3IC4 A;  1G7O A;  2XPE A;  5G5F A;  1YJ6 A;  4ZBD A;  2JAD A;  1A2J A;  4ZL9 A;  4PX1 A;  3IAM 2;  5D8I A;  1A2L A;  3VFI A;  4TXV A;  2WJU A;  4KSO A;  4MZW A;  2RUE A;  1SD8 A;  4V2L A;  3F8U A;  5DJL A;  5ECP B;  4WF4 A;  4MNN A;  3CTG A;  1TRU A;  4GWR A;  5ECS A;  1LBK A;  3A3T A;  1XZO A;  5CRH A;  4LL1 B;  1O6J A;  2R0P A;  3Q74 A;  1T7P B;  3CSI A;  1OAZ A;  4PTS A;  3UVH A;  1AXD A;  2AV4 A;  2JSY A;  2MBT A;  3EIN A;  2GST A;  1MDJ A;  4KCA A;  4HZ4 A;  1N2A A;  4MF7 A;  1R5P A;  3UL3 A;  4O92 A;  4TR1 A;  4WF5 A;  2R6K A;  4XS6 A;  2XBI A;  1W89 A;  4MDC A;  5IPH A;  2VUP A;  5COH A;  4PNG A;  4Q5F A;  4ECJ A;  3UVT A;  2YOI A;  4NV2 A;  4HU7 A;  2VCQ A;  5A5K A;  4TN8 A;  1MDI A;  2GSS A;  1YEP A;  1TKD B;  4K5S A;  1YF1 A;  3FZ5 A;  5H5R A;  4KDY A;  1U3I A;  1USB A;  4TKY A;  1BX9 A;  1MD3 A;  6GSY A;  4POL A;  3QD9 A;  4I2U A;  5EVO A;  2L5O A;  1SL0 B;  4KF9 A;  3EMX A;  1YEX A;  3C7M A;  4NMU A;  1SJZ A;  2C0F A;  4HQZ A;  1UN2 A;  3BD2 A;  2I9H A;  2YZU A;  1ERT A;  14GS A;  1T1V A;  2DJ0 A;  5HFI A;  3ZML A;  4PQH A;  1ZYQ B;  1H75 A;  3HJO A;  4G10 A;  1ML6 A;  3D0Z A;  2AJQ B;  3GUS A;  1M2B A;  3A5I A;  5DAK B;  1ERW A;  5IO2 A;  3L0H A;  1F2E A;  5D9X A;  4BL7 B;  2H71 A;  2O7K A;  3M9K A;  1M7T A;  19GS A;  3ZIT A;  4F03 A;  5IMF A;  3J7Y b;  1XFL A;  4ECI A;  2GQM A;  1TK0 B;  2V1M A;  3H1N A;  4OO5 A;  1NHY A;  1A23 A;  1GP1 A;  1NSW A;  3US3 A;  4I6X A;  2LEG A;  2WFC A;  2I4A A;  2HXK A;  4MF6 A;  1GLP A;  2C0E A;  1AQW A;  4NAX A;  3HY2 A;  1QMV A;  4OMV A;  3TJG A;  2PVQ A;  3U6V A;  3VWU A;  1A2M A;  1SL1 B;  2LRC A;  1DUG A;  1OKT A;  3A2W A;  2K6V A;  3GN3 A;  1ON4 A;  1CQG A;  2OA7 A;  2VL2 C;  4YQM A;  3NZN A;  4WEY A;  4MCU A;  4E8E A;  2BJX A;  4MZB A;  1ABA A;  3ZIV A;  4OCE A;  2YJ7 A;  3IHG A;  4I2T A;  1V9W A;  1GSF A;  5EL8 A;  1K0M A;  3N9J A;  3GL5 A;  1XVQ A;  3S9F A;  4GCI A;  2VLT A;  2CZ3 A;  1K0N A;  2H1G A;  2X64 A;  1SEN A;  2GQK A;  1U87 A;  4BVY A;  2FY6 A;  2HRN A;  2H0G A;  5KN1 A;  2HYX A;  5G31 A;  1UA5 A;  4EUY A;  5DAL B;  4ML1 A;  2DSA A;  5GSS A;  1Z6N A;  3C1R A;  2H6X A;  2I1U A;  2IPA A;  4G0L A;  2YWI A;  2KHP A;  1AW9 A;  3UAR A;  5ECM B;  5ECO B;  2H01 A;  2FCH A;  2RM5 A;  3G7J A;  3GST A;  1H4O A;  3IAS 2;  4Z2U A;  1QFN A;  1OE7 A;  4LLR A;  4MH3 A;  2DML A;  2WGR A;  1ERV A;  3ZFB A;  1DE1 A;  1FO5 A;  3P7X A;  2AYT A;  6GST A;  2E2M A;  1XXU A;  3F6F A;  2YV9 A;  4OWY A;  2AUV A;  3TJF A;  2UZ8 A;  2R37 A;  4Q5Q A;  3BBY A;  1KTE A;  2QA1 A;  1O81 A;  2FWG A;  2H1B A;  3KEB A;  1I9D A;  2B1K A;  2QGV A;  3R2Q A;  1B4P A;  2GQL A;  2YP6 A;  2O8V B;  2WDU A;  4ZB9 A;  2R0C A;  3CYN A;  3DIE A;  1S3D A;  2C0G A;  1HNB A;  3KJY A;  4NXI A;  1ERU A;  2V32 A;  3I69 A;  5FT3 A;  5JWQ B;  4MJB A;  3ZRE A;  5INY A;  3DVW A;  2F8F A;  2C1Y A;  3VWV A;  4NV5 A;  2L5L A;  2H70 A;  4EF0 A;  2YAN A;  5C04 A;  1PFO A;  5IM9 A;  4QQ7 A;  4Z7X A;  2JU5 A;  2P5Q A;  4KUN A;  4I8B A;  4IP6 A;  1WWJ A;  1JLV A;  1MTC A;  1ZZY A;  4KAE A;  4CHS A;  2H74 A;  2VCW A;  1M99 A;  1PD2 1;  1PMT A;  3LW9 A;  2XHF A;  2ON7 A;  3G7Y A;  5LNK e;  4ULX A;  4ZB6 A;  2PUK C;  1GUL A;  2GVP A;  3A2X A;  4K9Z A;  5IMD A;  3HA9 A;  4OFM A;  3FW2 A;  4ACS A;  4X43 A;  1HD2 A;  2H75 A;  2YV7 A;  1QQ2 A;  1OYJ A;  1G6Y A;  2FD3 A;  1SYX A;  1A8L A;  1OC9 B;  2H1A A;  3VWX A;  1BED A;  1Y25 A;  2L6C A;  4JR4 A;  4IS0 A;  1YKC A;  2DKH A;  3L4N A;  1SKR B;  3QAV A;  1TRW A;  2CZ2 A;  3M3M A;  4O7H A;  4POB A;  1PX6 A;  5KOX A;  2VD0 A;  1GTA A;  5IQY A;  1PGT A;  4K2D A;  1GL8 A;  4ILF A;  5DCH A;  3GFK A;  2XPD A;  1PA3 A;  1HYU A;  2B5X A;  1TRS A;  2I3Y A;  3MDK A;  5G2Z A;  4MP4 A;  1UC7 A;  4GQC A;  5JCU A;  4GST A;  8GSS A;  2PGT A;  1UVZ A;  4V1A p;  5HR2 A;  3GH9 A;  7GSS A;  1BG5 A;  4WET A;  4PQ1 A;  3EU4 A;  5ENU A;  2WCI A;  5CO3 A;  3F3Q A;  3VPQ A;  3LYK A;  1JHB A;  1DSB A;  3LOR A;  2H73 A;  3D4T A;  4IJ3 A;  3ZMK A;  4F82 A;  3HYP A;  2GSR A;  3TKS A;  2KP2 A;  4I97 A;  5GAN D;  3GKX A;  2LTK A;  1X9W B;  1XWB A;  2H0H A;  1B9Y C;  1XWC A;  2LV3 A;  2PER A;  4PGT A;  5CAX A;  2GGT A;  2GZZ A;  3KP9 A;  3U5R E;  3C8E A;  5C00 A;  5IIZ A;  2PMT A;  5D9W A;  2DIY A;  4XRA A;  1FW1 A;  1K0B A;  2H6Z A;  4DSS B;  1TXX A;  4I5Q A;  2CVB A;  3QFB C;  2GLR A;  3QAW A;  3NIV A;  4BWQ A;  2XBQ A;  5GZZ B;  5B8A A;  4MLY A;  5F05 A;  3IXR A;  2C3N A;  5AGY A;  1WP0 A;  4TRX A;  3H93 A;  4F0C A;  3HVN A;  4EIP A;  4N10 A;  1JLW A;  4PUR A;  1FG4 A;  3GX8 A;  3VLN A;  2DJ2 A;  1GTI A;  1GUK A;  5JCW A;  5DAK A;  4TR4 A;  5KN2 A;  5DDL A;  4BL7 A;  1DE2 A;  4MK3 A;  1TK8 B;  4N0V A;  1X5D A;  2GSQ A;  3QOU A;  4K0G A;  5H5S A;  3IK7 A;  2H0I A;  1GSD A;  1ZMA A;  3CQF A;  3EVI A;  2MMN A;  4N11 A;  2CV4 A;  4F0B A;  1HNA A;  4HEA 2;  4HU9 A;  4MJA A;  1K3L A;  5HQP A;  1Z9H A;  3EYT A;  1B4Q A;  3D5J A;  5CRG A;  2F51 A;  3WGX A;  1M3I A;  13GS A;  3PR8 A;  5ECN B;  2F8A A;  4L8E A;  1PRX A;  2V6K A;  2EIR A;  1ZL9 A;  3MSZ A;  3TCO A;  4IVF A;  1X0R A;  3UJ1 A;  2HFD A;  1KNG A;  1XCC A;  3FYG A;  5G5E A;  1B9X C;  1WMJ A;  1X9M B;  3DKS A;  5J9B A;  2VCZ A;  2VCX A;  1THX A;  3E9J B;  1MD4 A;  2GTU A;  2ZNM A;  2IMI A;  2NVL A;  2KP1 A;  1KBN A;  2HZE B;  5DAL A;  3BCK A;  4TR3 A;  4D73 B;  2IMF A;  1EOG A;  2NBS A;  4JE1 A;  2RM6 A;  2IFQ B;  1OC3 A;  1JZW A;  1K0C A;  4MZC A;  2FWF A;  4K7I A;  3LFL A;  1Y6E A;  3VWW A;  5ECH B;  4O32 A;  1MEK A;  2P5R A;  1JZO A;  1V57 A;  3OR5 A;  4CW9 A;  1GSU A;  3A2V A;  4QL7 A;  1EGO A;  1K3O A;  4OFT A;  2YPM A;  2HRA A;  5AN1 A;  3F4S A;  2E0Q A;  4MPF A;  2YWN A;  1S3C A;  5B6N A;  3TKQ A;  3LGC A;  2IN3 A;  3APO A;  4ICY A;  2FLS A;  4CY8 A;  3KCM A;  3E0U A;  1T8E B;  1F37 A;  2VM2 A;  22GS A;  3TRQ A;  4ZB8 A;  3PH9 A;  2FWE A;  1K0O A;  4TVE A;  2L4C A;  2HI7 A;  5DCG A;  2KUC A;  2MYG A;  4X0X A;  2CA8 A;  5IMA A;  1AAZ A;  5AIX A;  4HDE A;  1F9M A;  4ID0 A;  2H19 A;  4GRF A;  5EPF A;  1ZGN A;  3BCI A;  5GAP D;  2KOK A;  1N8J A;  3KZQ A;  4NPB A;  5IPG A;  1GUM A;  18GS A;  1XG8 A;  3KH9 A;  5GST A;  1M2D A;  2JAC A;  5ECI B;  1SK0 A;  5CRD A;  1SJ6 A;  2QKE A;  2MMA A;  2WZ9 A;  3RAZ A;  5DQY A;  3HJP A;  2N5B A;  4FH8 A;  3IK9 A;  4BIK A;  4EXJ A;  4XHM A;  2G0F A;  3QFA C;  4AJ6 A;  17GS A;  4TOP A;  1ACV A;  2A2R A;  3V1W A;  4HUA A;  1OC9 A;  3EMP A;  2H66 A;  1ST9 A;  3UEM A;  3IR4 A;  1SYR A;  2FA4 A;  3HZ4 A;  1G0T A;  1SKW B;  2X8H A;  2VCT A;  4LA1 A;  2OAD A;  1XW9 A;  3GSS A;  2BMX A;  2RUF A;  4MPG A;  2HSY A;  3UBK A;  2LQQ A;  3GNJ A;  1PX7 A;  1T00 A;  4K2X A;  4K1F A;  1LU4 A;  3I9V 2;  4FYU A;  5IMZ A;  5ABR A;  3ED3 A;  3ZLP A;  3FR3 A;  4POK A;  1R7H A;  1VGL A;  2LNS A;  5J9C A;  1ZCP A;  2LJA A;  2N5F A;  4GSN A;  5L71 A;  4IW9 A;  2H8L A;  4RI7 A;  4KSM A;  3EE2 A;  2FNO A;  4G19 A;  3DML A;  2VM1 A;  3LEF A;  2CAI A;  4BWS A;  1TOF A;  4IJI A;  2B6M A;  2DKI A;  4XIH A;  2VO4 A;  3RPN A;  3KH7 A;  4V2N A;  1OVN A;  3GX0 A;  2FGX A;  4HJ2 A;  4DEJ A;  4PXO A;  4ZBB A;  5ECQ B;  2REM A;  5A4W A;  1NW2 A;  3C71 A;  2C3Q A;  2LUS A;  1Q98 A;  2CQ9 A;  2IWT A;  1O7U A;  1NHO A;  2VCV A;  1RW1 A;  1T4Z A;  4E8H A;  4YQU A;  2A2S A; 
#chains in the Genus database with same CATH homology
 4N0Z A;  1VF4 A;  2G2Q A;  2WUL A;  4EDZ A;  3QDN A;  5CRW A;  2YN1 A;  2B5Y A;  2H72 A;  2L59 A;  4DSS A;  1O8X A;  1R4W A;  1X5E A;  3ERF A;  3BJ5 A;  3M0F A;  1PL2 A;  1FVJ A;  4TR0 A;  2ZUP A;  4CY6 A;  3GTU B;  1VRS D;  2PWJ A;  5BMU A;  4L5O A;  2GT5 A;  5F0G A;  4TW5 A;  1JZD A;  1PL1 A;  4GXZ A;  3GKK A;  2CVD A;  2ALB A;  4BPY A;  4HJM A;  5IOX A;  1XWG A;  3H4K A;  2VD1 A;  1XWA A;  5HFG A;  4J2F A;  1JFU A;  1C72 A;  2K8V A;  3HCZ A;  3F9U A;  2IME A;  1PQN A;  2X8G A;  4XS1 A;  2YNX A;  2EIQ A;  2PU9 C;  3MYD A;  3FHK A;  3GKN A;  1PN9 A;  1WJK A;  4YAP A;  2ON5 A;  16GS A;  3VPT A;  1SD9 A;  3DWV A;  4O5U A;  3CRT A;  5F07 A;  1EV4 A;  3BOA A;  2WB9 A;  2DBC A;  3ISO A;  5D93 A;  9GSS A;  3K8N A;  5ID2 B;  1QGV A;  3ME7 A;  1F3A A;  1Q4J A;  4YAV A;  2OBK A;  3D4M A;  2IMD A;  1VF3 A;  2VIM A;  4CDO A;  1FAA A;  2R5G A;  1T3B A;  2X8C A;  2QA2 A;  3DGQ A;  3R3E A;  2IL3 A;  3EPT A;  4ZIJ A;  3D6I A;  4JED A;  3KTL A;  2HSM A;  2A2P A;  4IN0 A;  4OFN A;  5ELG A;  2D2Z A;  5EY6 A;  2HLS A;  1AQX A;  5DVB A;  3TKS C;  2O85 A;  5DBQ A;  3CSH A;  3FK8 A;  5AIS A;  1E6B A;  3KTB A;  3DEX A;  4YKF A;  4DVC A;  3SBC A;  5J5N A;  3HZ8 A;  1PN0 A;  3IRA A;  2MMO A;  2B1L A;  3ERG A;  2HZE A;  2QSI A;  1B8X A;  4D73 A;  2IFQ A;  5HR1 A;  1ZYE A;  2IMK A;  4ZIL A;  3N5O A;  4A5P A;  5D9V A;  1YDK A;  2OBI A;  4GLT A;  2OE3 A;  4IP1 A;  3ZYW A;  1T4Y A;  1URM A;  2FWH A;  4XTS A;  2RLI A;  3PPU A;  1EEJ A;  3TOT A;  3M1G A;  3RBT A;  1EOH A;  1A8Y A;  2LJK A;  3G7I A;  3L9S A;  4J56 E;  3LWA A;  1A0R P;  2BTO T;  1YF0 A;  5AIV A;  2OAC A;  1TU8 A;  2JZS A;  1EV9 A;  1TTZ A;  2DLX A;  2WS2 A;  3CBU A;  2OKA A;  4KX4 A;  4KGI A;  3IHQ A;  2JZT A;  1GUH A;  5IMV A;  1NM3 A;  4WBJ A;  4GSS A;  2M72 A;  2R3X A;  1BAY A;  4EKZ A;  4DSR A;  1WIK A;  3TUE A;  1YY7 A;  3TB2 A;  4RQX A;  1AC1 A;  1O8W A;  3CMI A;  4HZ2 A;  5FWG A;  1U3A A;  3KXO A;  3GYK A;  3ZIJ A;  3EWL A;  1TK5 B;  1V2A A;  4KND A;  4XS4 B;  3GKM A;  4MA9 A;  5CYY A;  3FR6 A;  1GWC A;  5ECL B;  2VOC A;  2AHE A;  4FQU A;  1HQO A;  2E7P A;  3LYP A;  3C1S A;  3TGZ A;  4MH2 A;  1SKS B;  2DJ3 A;  1SL2 B;  2I81 A;  2OE1 A;  3VK9 A;  4ECC A;  4H86 A;  4XCS A;  5IMC A;  1M0U A;  4RUV A;  2L4Q A;  4Q5N A;  4YH2 A;  1WOU A;  1GRX A;  2QC7 A;  1FHE A;  1GSY A;  3E3E A;  4X4J A;  1EZK A;  10GS A;  1GH2 A;  5A4U A;  2N5A A;  3UIW A;  4AGS A;  3IOS A;  4BVX B;  2RII A;  1AIU A;  3WD6 A;  2JZR A;  5D9T A;  6GSX A;  3HJM A;  4GQF A;  1M9B A;  1FOV A;  3F0I A;  5LD0 A;  4ZL8 A;  2C8U A;  3UOM A;  5DJM A;  3TKS E;  3VI7 A;  3LQ7 A;  3UBL A;  6GSV A;  5JCG A;  1ZYP A;  3IE3 A;  5DQS A;  3KM6 A;  1M2A A;  3WT2 A;  3WGD A;  2M80 A;  3H79 A;  3RHB A;  3ZRD A;  3KMN A;  4EC0 A;  3TDG A;  2AB6 A;  3F6D A;  3APS A;  3DRN A;  5E4W A;  1U6T A;  3KGK A;  1AUC A;  5JWR B;  3C73 A;  3CXG A;  2YZH A;  2C80 A;  4V1A g;  4KDU A;  4EVM A;  4EDY A;  3GHA A;  4JBB A;  4K0N A;  2CX3 A;  2L57 A;  2PBJ A;  4AF2 A;  3JCM L;  2OJL A;  4ML6 A;  4G0I A;  1XW5 A;  4KCE A;  3Q18 A;  1EGR A;  3QCP A;  1R5A A;  4XRD A;  3TKP A;  1GNE A;  5G30 A;  1BYE A;  1YKA A;  2NPB A;  3QMX A;  4WKW A;  3HDC A;  1OC8 A;  1QXH A;  4DSQ A;  1GNW A;  2CAQ A;  5B6M A;  4KA0 A;  2DC5 A;  3KMO A;  5G1L A;  4K6X A;  1CQH A;  3NOF A;  2LS5 A;  1GSQ A;  1DBY A;  3IDV A;  4G9H A;  5ELA A;  1XOB A;  1ZOF A;  5G1K A;  1ZYN A;  3LXZ A;  4K5R A;  4KE3 A;  3GL3 A;  2E2G A;  4PQI A;  3GTU A;  1FVK A;  3TOU A;  1TW9 A;  4PUA A;  2HSH A;  5J3R A;  3UAP A;  2M46 A;  1XVW A;  1VF1 A;  4EE0 A;  2X99 A;  1I5G A;  4F2I A;  1XPV A;  2VLV A;  4MAB A;  3UMA A;  4J57 E;  1J0F A;  3WGE A;  2PN8 A;  1M9A A;  3IPZ A;  2C3T A;  3P2A A;  2EC4 A;  1A24 A;  4TXO B;  2GDR A;  3LSZ A;  2MMZ A;  1TI3 A;  2KLX A;  3ZTL A;  2R4V A;  5CP1 A;  1XBS A;  3DD3 A;  1BJX A;  1XIY A;  3DXB A;  1Z5Y E;  1OE8 A;  3P8W A;  2PVO C;  3FR9 A;  4K7O A;  1HNC A;  3LJR A;  3GRX A;  2O89 A;  4BA7 A;  5ID2 A;  3PGT A;  2TRX A;  2FA8 A;  1SK2 A;  2MZC A;  4FYB A;  3F4R A;  1OKD A;  2GT6 A;  1FB0 A;  4ZBA A;  1ILO A;  2X4A A;  4LMW A;  1RQM A;  2K9F A;  2VLU A;  4OCF A;  4ZL7 A;  2LRN A;  3IA1 A;  4O5R A;  2F3M A;  1XWK A;  2AAW A;  2DMM A;  20GS A;  3MWH A;  4LMV A;  3FMW A;  1J08 A;  1QK8 A;  4IEL A;  2NTO A;  3M8N A;  4YQV A;  4IQ1 A;  3L9V A;  5ECR B;  4EL1 A;  3VUR A;  2DIZ A;  5KOW A;  1YQ1 A;  2DJJ A;  1EWX A;  1EP8 A;  1O73 A;  2GZP A;  3HVS A;  2HT9 A;  2HZF A;  2O87 A;  3M9J A;  5CNW A;  5B8B A;  2K18 A;  3W8S A;  1GTU A;  3I6A A;  4MJE A;  1GSE A;  4IHU A;  3IBH A;  3Q19 A;  1WRY A;  2LST A;  3WYW A;  4KW6 A;  4NHZ A;  3SWL A;  4Q5R A;  3H8Q A;  3MNG A;  4OD7 A;  1G7E A;  3L9U A;  5IO0 A;  4WXT A;  3I43 A;  4G0K A;  4HI7 A;  4MJC A;  4TR1 B;  1YZX A;  3FRC A;  1K0D A;  2YWM A;  3WT1 A;  3G9B A;  2C0D A;  3MIX A;  3FZ9 A;  1G6W A;  1W4V A;  3HVV A;  3ZFL A;  3W8J A;  2VL2 A;  2CX4 A;  3ZVJ D;  5KN3 A;  4RQR A;  1GLQ A;  2V41 A;  1V98 A;  4K7N A;  4NWY A;  2ZCT A;  1K3Y A;  3F63 A;  1FOH A;  3HKR A;  3VI5 A;  1GTB A;  2F9S A;  4GTU A;  4IKH A;  2HNL A;  3GA4 A;  3F4T A;  3QAG A;  3IC8 A;  2B5E A;  2MBS A;  4IGJ A;  1TP9 A;  2R2J A;  2JSZ A;  2FHE A;  4ECB A;  4KH7 A;  3D21 A;  5BRT A;  2YWO A;  2Z9S A;  4PUF C;  5IOW A;  3HXS A;  4POM A;  4Z2T A;  2NDO A;  2H1D A;  3TRX A;  1V58 A;  2VAF A;  5HFK A;  4JZQ A;  2B7J A;  3RDW A;  6GSW A;  3GH6 A;  4XS4 A;  2XC2 A;  4HQS A;  3ZZX A;  4OO4 A;  3O6T A;  5LCZ A;  1SK1 A;  4G2E A;  2H30 A;  2V6O A;  1Z3E A;  4L0W A;  4AJ8 A;  1TJD A;  1J9B A;  2DJK A;  2V2G A;  2JL4 A;  2K8S A;  3LXT A;  4P3Y B;  3ZVJ A;  1WPI A;  2H76 A;  1THO A;  4IQA A;  6GSU A;  1EEM A;  1PKZ A;  2P0G A;  3RPP A;  3KIJ A;  1S3A A;  1TU7 A;  2LKU A;  4BVX A;  2CVK A;  5J4U A;  2GZY A;  2YJH A;  4L0U A;  1FB6 A;  2OE0 A;  1B48 A;  2A4H A;  2LJR A;  4RI6 A;  4WR4 A;  1QUW A;  1EP7 A;  5D96 A;  4FYC A;  3F3R A;  1IYH A;  1F6M C;  4K8M A;  4WBR D;  1PSQ A;  2B7K A;  4HS1 A;  1MDK A;  3LG6 A;  2HE3 A;  4YKG A;  1SJI A;  5JWO B;  3ERW A;  4LL4 B;  3Q6O A;  3EUR A;  4ISD A;  5ECK B;  5HR3 A;  3RHC A;  6GSS A;  1O85 A;  4X1U A;  3APQ A;  1K0A A;  4L5L A;  3EC3 A;  4BVY B;  1BQ7 A;  11GS A;  1PKW A;  2L6D A;  3GV1 A;  1AQV A;  3GIX A;  3EU3 A;  3FY7 A;  4FO5 A;  5F06 A;  3TJB A;  5KEJ A;  2J9H A;  3O3T A;  1X9S B;  5D73 A;  3HHV A;  3P90 A;  5E59 A;  4KB3 A;  1RK4 A;  3QPM A;  2LNT A;  4N30 A;  4Z2R A;  2CT6 A;  2J23 A;  1JZR A;  3KP8 A;  3QR6 A;  4JRR A;  1A0F A;  1Z7R A;  3FKF A;  1WE0 A;  3TRP A;  5A4V A;  1R26 A;  3CTF A;  3CRU A;  3HD5 A;  5FHI A;  1V40 A;  5HR0 A;  4KDX A;  1KEB A;  3TKR A;  4GF0 A;  2ES7 A;  1SU9 A;  2IJY A;  3FZA A;  4WR5 A;  1LJR A;  4IBP A;  2GS3 A;  2TIR A;  1E2Y A;  1TI1 A;  4EIQ A;  2LRT A;  4JU5 A;  1VF2 A;  2P31 A;  3L78 A;  4ZXG A;  4V2M A;  3TJJ A;  4HOJ A;  3KD0 A;  3ZL5 A;  5KN0 A;  4NHW A;  3DYR A;  2A4V A;  1IYI A;  2C4J A;  2TRC P;  1U88 A;  3IV4 A;  1XOA A;  4PNF A;  3J7Y k;  3A5W A;  3CSJ A;  3W6G A;  1GSS A;  4MF5 A;  3ME8 A;  2H6Y A;  2HRK A;  3HVX A;  4TXO A;  3O76 A;  3TJK A;  4QL9 A;  2LQO A;  3MAK A;  4FIW A;  5B7C A;  4JR6 A;  2FUG 2;  1TRV A;  1XW6 A;  3PIN A;  2DJ1 A;  3AY8 A;  4O5Q A;  5H5Q A;  3FEU A;  2HRF A;  2YCD A;  4AJ7 A;  1Z7P A;  2WRT A;  1X5C A;  4F9Z A;  4MMM A;  2IIY A;  1F3B A;  5CRE A;  2VL9 A;  2X49 A;  3D22 A;  2B3S A;  5J41 A;  3FZ4 A;  2EIO A;  12GS A;  4USS A;  5F8B A;  3GUR A;  1Z6M A;  4EO3 A;  3DVX A;  1TDI A;  2R0G A;  3GMF A;  2VL3 A;  2PPT A;  3IC4 A;  1G7O A;  2XPE A;  5G5F A;  1YJ6 A;  4ZBD A;  2JAD A;  1A2J A;  4ZL9 A;  4PX1 A;  3IAM 2;  5D8I A;  1A2L A;  3VFI A;  4TXV A;  2WJU A;  4KSO A;  4MZW A;  2RUE A;  1SD8 A;  4V2L A;  3F8U A;  5DJL A;  5ECP B;  4WF4 A;  4MNN A;  3CTG A;  1TRU A;  4GWR A;  5ECS A;  1LBK A;  3A3T A;  1XZO A;  5CRH A;  4LL1 B;  1O6J A;  2R0P A;  3Q74 A;  1T7P B;  3CSI A;  1OAZ A;  4PTS A;  3UVH A;  1AXD A;  2AV4 A;  2JSY A;  2MBT A;  3EIN A;  2GST A;  1MDJ A;  4KCA A;  4HZ4 A;  1N2A A;  4MF7 A;  1R5P A;  3UL3 A;  4O92 A;  4TR1 A;  4WF5 A;  2R6K A;  4XS6 A;  2XBI A;  1W89 A;  4MDC A;  5IPH A;  2VUP A;  5COH A;  4PNG A;  4Q5F A;  4ECJ A;  3UVT A;  2YOI A;  4NV2 A;  4HU7 A;  2VCQ A;  5A5K A;  4TN8 A;  1MDI A;  2GSS A;  1YEP A;  1TKD B;  4K5S A;  1YF1 A;  3FZ5 A;  5H5R A;  4KDY A;  1U3I A;  1USB A;  4TKY A;  1BX9 A;  1MD3 A;  6GSY A;  4POL A;  3QD9 A;  4I2U A;  5EVO A;  2L5O A;  1SL0 B;  4KF9 A;  3EMX A;  1YEX A;  3C7M A;  4NMU A;  1SJZ A;  2C0F A;  4HQZ A;  1UN2 A;  3BD2 A;  2I9H A;  2YZU A;  1ERT A;  14GS A;  1T1V A;  2DJ0 A;  5HFI A;  3ZML A;  4PQH A;  1ZYQ B;  1H75 A;  3HJO A;  4G10 A;  1ML6 A;  3D0Z A;  2AJQ B;  3GUS A;  1M2B A;  3A5I A;  5DAK B;  1ERW A;  5IO2 A;  3L0H A;  1F2E A;  5D9X A;  4BL7 B;  2H71 A;  2O7K A;  3M9K A;  1M7T A;  19GS A;  3ZIT A;  4F03 A;  5IMF A;  3J7Y b;  1XFL A;  4ECI A;  2GQM A;  1TK0 B;  2V1M A;  3H1N A;  4OO5 A;  1NHY A;  1A23 A;  1GP1 A;  1NSW A;  3US3 A;  4I6X A;  2LEG A;  2WFC A;  2I4A A;  2HXK A;  4MF6 A;  1GLP A;  2C0E A;  1AQW A;  4NAX A;  3HY2 A;  1QMV A;  4OMV A;  3TJG A;  2PVQ A;  3U6V A;  3VWU A;  1A2M A;  1SL1 B;  2LRC A;  1DUG A;  1OKT A;  3A2W A;  2K6V A;  3GN3 A;  1ON4 A;  1CQG A;  2OA7 A;  4YQM A;  2VL2 C;  3NZN A;  4WEY A;  4MCU A;  4E8E A;  2BJX A;  4MZB A;  1ABA A;  3ZIV A;  4OCE A;  2YJ7 A;  3IHG A;  4I2T A;  1V9W A;  1GSF A;  5EL8 A;  1K0M A;  3N9J A;  3GL5 A;  1XVQ A;  3S9F A;  4GCI A;  2VLT A;  2CZ3 A;  1K0N A;  2H1G A;  2X64 A;  1SEN A;  2GQK A;  1U87 A;  4BVY A;  2FY6 A;  2HRN A;  2H0G A;  5KN1 A;  2HYX A;  5G31 A;  1UA5 A;  4EUY A;  5DAL B;  4ML1 A;  2DSA A;  5GSS A;  1Z6N A;  3C1R A;  2H6X A;  2I1U A;  2IPA A;  4G0L A;  2YWI A;  2KHP A;  1AW9 A;  3UAR A;  5ECM B;  5ECO B;  2H01 A;  2FCH A;  2RM5 A;  3G7J A;  3GST A;  1H4O A;  3IAS 2;  4Z2U A;  1QFN A;  1OE7 A;  4LLR A;  4MH3 A;  2DML A;  2WGR A;  1ERV A;  3ZFB A;  1DE1 A;  1FO5 A;  3P7X A;  2AYT A;  6GST A;  2E2M A;  1XXU A;  3F6F A;  2YV9 A;  4OWY A;  2AUV A;  3TJF A;  2UZ8 A;  2R37 A;  4Q5Q A;  3BBY A;  1KTE A;  2QA1 A;  1O81 A;  2FWG A;  2H1B A;  3KEB A;  1I9D A;  2B1K A;  2QGV A;  3R2Q A;  1B4P A;  2GQL A;  2YP6 A;  2O8V B;  2WDU A;  4ZB9 A;  2R0C A;  3CYN A;  3DIE A;  1S3D A;  2C0G A;  1HNB A;  3KJY A;  4NXI A;  1ERU A;  2V32 A;  3I69 A;  5FT3 A;  5JWQ B;  4MJB A;  3ZRE A;  5INY A;  3DVW A;  2F8F A;  2C1Y A;  3VWV A;  4NV5 A;  2L5L A;  2H70 A;  4EF0 A;  2YAN A;  5C04 A;  5IM9 A;  4QQ7 A;  4Z7X A;  2JU5 A;  2P5Q A;  4KUN A;  4I8B A;  4IP6 A;  1WWJ A;  1JLV A;  1MTC A;  1ZZY A;  4KAE A;  4CHS A;  2H74 A;  2VCW A;  1M99 A;  1PD2 1;  1PMT A;  3LW9 A;  2XHF A;  2ON7 A;  3G7Y A;  5LNK e;  4ULX A;  4ZB6 A;  2PUK C;  1GUL A;  2GVP A;  3A2X A;  4K9Z A;  5IMD A;  3HA9 A;  4OFM A;  3FW2 A;  4ACS A;  4X43 A;  1HD2 A;  2H75 A;  2YV7 A;  1QQ2 A;  1OYJ A;  1G6Y A;  2FD3 A;  1SYX A;  1A8L A;  1OC9 B;  2H1A A;  3VWX A;  1BED A;  1Y25 A;  2L6C A;  4JR4 A;  4IS0 A;  1YKC A;  2DKH A;  3L4N A;  1SKR B;  3QAV A;  1TRW A;  2CZ2 A;  3M3M A;  4O7H A;  4POB A;  1PX6 A;  5KOX A;  2VD0 A;  1GTA A;  5IQY A;  1PGT A;  4K2D A;  1GL8 A;  4ILF A;  5DCH A;  3GFK A;  2XPD A;  1PA3 A;  1HYU A;  2B5X A;  1TRS A;  2I3Y A;  3MDK A;  5G2Z A;  4MP4 A;  1UC7 A;  4GQC A;  5JCU A;  4GST A;  8GSS A;  2PGT A;  1UVZ A;  4V1A p;  5HR2 A;  3GH9 A;  7GSS A;  1BG5 A;  4WET A;  4PQ1 A;  3EU4 A;  5ENU A;  2WCI A;  5CO3 A;  3F3Q A;  3VPQ A;  3LYK A;  1JHB A;  1DSB A;  3LOR A;  2H73 A;  3D4T A;  4IJ3 A;  3ZMK A;  4F82 A;  3HYP A;  2GSR A;  3TKS A;  2KP2 A;  4I97 A;  5GAN D;  3GKX A;  2LTK A;  1X9W B;  1XWB A;  2H0H A;  1B9Y C;  1XWC A;  2LV3 A;  2PER A;  4PGT A;  5CAX A;  2GGT A;  2GZZ A;  3KP9 A;  3U5R E;  3C8E A;  5C00 A;  5IIZ A;  2PMT A;  5D9W A;  2DIY A;  4XRA A;  1FW1 A;  1K0B A;  2H6Z A;  4DSS B;  1TXX A;  4I5Q A;  2CVB A;  3QFB C;  2GLR A;  3QAW A;  3NIV A;  4BWQ A;  2XBQ A;  5GZZ B;  5B8A A;  4MLY A;  5F05 A;  3IXR A;  2C3N A;  5AGY A;  1WP0 A;  4TRX A;  3H93 A;  4F0C A;  4EIP A;  4N10 A;  1JLW A;  4PUR A;  1FG4 A;  3GX8 A;  3VLN A;  2DJ2 A;  1GTI A;  1GUK A;  5JCW A;  5DAK A;  4TR4 A;  5KN2 A;  5DDL A;  4BL7 A;  1DE2 A;  4MK3 A;  1TK8 B;  4N0V A;  1X5D A;  2GSQ A;  3QOU A;  4K0G A;  5H5S A;  3IK7 A;  2H0I A;  1GSD A;  1ZMA A;  3EVI A;  2MMN A;  4N11 A;  2CV4 A;  4F0B A;  1HNA A;  4HEA 2;  4HU9 A;  4MJA A;  1K3L A;  5HQP A;  1Z9H A;  3EYT A;  1B4Q A;  3D5J A;  5CRG A;  2F51 A;  3WGX A;  13GS A;  3PR8 A;  5ECN B;  2F8A A;  4L8E A;  1PRX A;  2V6K A;  2EIR A;  1ZL9 A;  3MSZ A;  3TCO A;  4IVF A;  1X0R A;  3UJ1 A;  2HFD A;  1KNG A;  1XCC A;  3FYG A;  5G5E A;  1B9X C;  1WMJ A;  1X9M B;  3DKS A;  5J9B A;  2VCZ A;  2VCX A;  1THX A;  3E9J B;  1MD4 A;  2GTU A;  2ZNM A;  2IMI A;  2NVL A;  2KP1 A;  1KBN A;  2HZE B;  5DAL A;  3BCK A;  4TR3 A;  4D73 B;  2IMF A;  1EOG A;  2NBS A;  4JE1 A;  2RM6 A;  2IFQ B;  1OC3 A;  1JZW A;  1K0C A;  4MZC A;  2FWF A;  4K7I A;  3LFL A;  1Y6E A;  3VWW A;  5ECH B;  4O32 A;  1MEK A;  2P5R A;  1JZO A;  1V57 A;  3OR5 A;  4CW9 A;  1GSU A;  3A2V A;  4QL7 A;  1EGO A;  1K3O A;  4OFT A;  2YPM A;  2HRA A;  5AN1 A;  3F4S A;  2E0Q A;  4MPF A;  2YWN A;  1S3C A;  5B6N A;  3TKQ A;  3LGC A;  2IN3 A;  3APO A;  4ICY A;  2FLS A;  4CY8 A;  3KCM A;  3E0U A;  1T8E B;  1F37 A;  2VM2 A;  22GS A;  3TRQ A;  4ZB8 A;  3PH9 A;  2FWE A;  1K0O A;  4TVE A;  2L4C A;  2HI7 A;  5DCG A;  2KUC A;  2MYG A;  4X0X A;  2CA8 A;  5IMA A;  1AAZ A;  5AIX A;  4HDE A;  1F9M A;  4ID0 A;  2H19 A;  4GRF A;  5EPF A;  1ZGN A;  3BCI A;  5GAP D;  2KOK A;  1N8J A;  3KZQ A;  4NPB A;  5IPG A;  1GUM A;  18GS A;  3KH9 A;  5GST A;  1M2D A;  2JAC A;  5ECI B;  1SK0 A;  5CRD A;  1SJ6 A;  2QKE A;  2MMA A;  2WZ9 A;  3RAZ A;  5DQY A;  3HJP A;  2N5B A;  4FH8 A;  3IK9 A;  4EXJ A;  4XHM A;  2G0F A;  3QFA C;  4AJ6 A;  17GS A;  4TOP A;  1ACV A;  2A2R A;  3V1W A;  4HUA A;  1OC9 A;  3EMP A;  2H66 A;  1ST9 A;  3UEM A;  3IR4 A;  1SYR A;  2FA4 A;  3HZ4 A;  1G0T A;  1SKW B;  2X8H A;  2VCT A;  4LA1 A;  2OAD A;  1XW9 A;  3GSS A;  2BMX A;  2RUF A;  4MPG A;  2HSY A;  3UBK A;  2LQQ A;  3GNJ A;  1PX7 A;  1T00 A;  4K2X A;  4K1F A;  1LU4 A;  3I9V 2;  4FYU A;  5IMZ A;  5ABR A;  3ED3 A;  3ZLP A;  3FR3 A;  4POK A;  1R7H A;  1VGL A;  2LNS A;  5J9C A;  1ZCP A;  2LJA A;  2N5F A;  4GSN A;  5L71 A;  4IW9 A;  2H8L A;  4RI7 A;  4KSM A;  3EE2 A;  2FNO A;  4G19 A;  3DML A;  2VM1 A;  3LEF A;  2CAI A;  4BWS A;  1TOF A;  4IJI A;  2B6M A;  2DKI A;  4XIH A;  2VO4 A;  3RPN A;  3KH7 A;  4V2N A;  1OVN A;  3GX0 A;  2FGX A;  4HJ2 A;  4DEJ A;  4PXO A;  4ZBB A;  5ECQ B;  2REM A;  5A4W A;  1NW2 A;  3C71 A;  2C3Q A;  2LUS A;  1Q98 A;  2CQ9 A;  2IWT A;  1O7U A;  1NHO A;  2VCV A;  1RW1 A;  1T4Z A;  4E8H A;  4YQU A;  2A2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...