2XPDA

Reduced thiol peroxidase (tpx) from yersinia pseudotuberculosis
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
166
structure length
166
Chain Sequence
b'TQTVHFQGNPVSVAGKLPQIGDKAKDFTLVAKDLSDVALSSFAGKRKVLNIFPSIDTGVCAASVRKFNQLAGELENTVVLCISSDLPFAQSRFCGAEGLSNVITLSTLRGADFKQAYGVAITEGPLAGLTARAVVVLDGQDNVIYSELVNEITTEPNYDAALAALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL PEROXIDASE
publication title Structural Characterisation of Tpx from Yersinia Pseudotuberculosis Reveals Insights Into the Binding of Salicylidene Acylhydrazide Compounds.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Oxidoreductase
total genus 56
structure length 166
sequence length 166
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2xpdA00
2PVQA 3FYGA 5D9TA 4G2EA 1TU8A 1EWXA 4GF0A 2OJLA 2YZHA 5AISA 2F8AA 4TR0A 3IHQA 1M99A 1R4WA 3F4RA 4KA0A 2IWTA 4IJ3A 6GSYA 4MZBA 1G7OA 4I2UA 3W6GA 2CX4A 2GDRA 3A2WA 3WT2A 2VM1A 1AAZA 4HOJA 1PX7A 3OR5A 3RHCA 4ISDA 1ILOA 2FWFA 2YZUA 1UA5A 5B6NA 4V2MA 4DVCA 2QSIA 5H5SA 14GSA 3E9JB 1V58A 1Z5YE 3EVIA 1VF1A 3LXTA 4K8MA 2XHFA 2R4VA 3G7JA 1YZXA 1XVQA 3GUSA 3QAWA 5ECPB 1Z9HA 2X99A 12GSA 2GGTA 2AUVA 1DE1A 2A4VA 2H75A 1MD3A 4ECJA 3H1NA 4OFNA 3GFKA 2AAWA 1WJKA 4IHUA 1XPVA 4EC0A 2K6VA 4IJIA 4POLA 1MEKA 3L78A 2C3NA 4MPFA 3UJ1A 3EU3A 2HYXA 1ON4A 3A3TA 3MDKA 1R26A 1E2YA 2EIOA 2ZNMA 4JBBA 4OCFA 2HRFA 1HNBA 4ECIA 3GKMA 2DC5A 2OACA 1EGOA 1GTAA 3C7MA 4LLRA 3UIWA 5GSSA 1GNEA 3C73A 2E7PA 3TKSC 1M7TA 4L5LA 1K3LA 2EIRA 2LKUA 5ECNB 4WEYA 3C1RA 1G0TA 3LYPA 2PBJA 4FYBA 2H66A 3CSJA 4KW6A 2HSHA 1EEMA 3F0IA 1SU9A 1YY7A 1GUKA 4J56E 2CVBA 5EVOA 3I9V2 2OKAA 3EINA 1FW1A 5CYYA 1RK4A 2LUSA 4RQXA 3LG6A 1A24A 2DJKA 2FCHA 3IRAA 4WF5A 5CNWA 3RPPA 2BMXA 2ZUPA 2YCDA 4L0UA 2CV4A 3HKRA 2GSSA 1O85A 3FK8A 4HUAA 3L9SA 4IQAA 2O8VB 2CA8A 3AY8A 3GL3A 3UVHA 4F03A 1GLQA 2VIMA 1NM3A 2IPAA 4NV5A 4AJ8A 4I2TA 3CXGA 2H01A 3GSSA 2J9HA 1LBKA 2PU9C 2H6XA 2KLXA 4GLTA 1C72A 4GSSA 18GSA 1YF0A 2H8LA 3IBHA 3IOSA 1AXDA 2PERA 4JE1A 3TRQA 5ECSA 3O6TA 3VWUA 2NPBA 4KSMA 1JLWA 3DIEA 2LTKA 5ECQB 4MZWA 1A0RP 2WDUA 3S9FA 4IGJA 2B1LA 4NMUA 3VPTA 2GS3A 6GSVA 1RW1A 1Y25A 2H0IA 1BQ7A 3LWAA 2GSTA 5LCZA 4XTSA 3F6DA 1XW6A 1J08A 2H0GA 3MAKA 3HYPA 1MDIA 2VLTA 1UVZA 1K0CA 1AQXA 1GTBA 3VURA 4XHMA 3H8QA 1TDIA 3KGKA 5IOWA 3IDVA 1X5EA 2VCWA 5E59A 1R7HA 3ED3A 4FIWA 1SK2A 3F4SA 1OC3A 1TK8B 2F8FA 2MZCA 3UOMA 1B8XA 3HVXA 2NVLA 4KAEA 2GT6A 1TI3A 3VI5A 1XOBA 1BYEA 5ECRB 4L5OA 2ON7A 3L0HA 1EP8A 1U87A 1XWKA 2R2JA 4MA9A 2H76A 1GWCA 4PNFA 2O87A 4OFMA 5KN2A 1OE8A 2ZCTA 2WFCA 4LL4B 4WKWA 3BD2A 1FB0A 1EGRA 4ZL9A 3BJ5A 1KTEA 4NHZA 3GN3A 1E6BA 1XIYA 1PA3A 1GULA 3TOUA 1USBA 1THOA 5GAND 2AB6A 4N0VA 3ERFA 5JCUA 1Z6NA 4HDEA 4GSNA 2NDOA 4GRFA 5CRHA 3TKPA 1ZCPA 1QFNA 5H5QA 1SD9A 4FYUA 1PSQA 5IMFA 2L6DA 2GQKA 1SJIA 3E3EA 3ZFLA 5IPGA 2BJXA 3LFLA 2KUCA 2RLIA 2OA7A 3F63A 1DSBA 5IO0A 3EE2A 2R6KA 3DWVA 1F9MA 1ZOFA 2GZZA 1TI1A 4ML1A 1TXXA 4OFTA 2LRNA 1X0RA 4QL7A 1O7UA 4WF4A 4KH7A 4K0NA 1A8LA 2FA8A 4JRRA 4K1FA 1GSDA 2VL2A 2GZYA 4I97A 2B5YA 3GYKA 4TXVA 2AHEA 4POKA 3D5JA 3ZVJA 1Z3EA 2R37A 2C0FA 1HD2A 1WOUA 1K0AA 4K7OA 1H75A 2L5OA 1K3YA 4ECBA 3VWWA 4O32A 5D9VA 1VF4A 1ERUA 2FD3A 3M8NA 4PGTA 2V2GA 4HQZA 1R5AA 3HJPA 3O76A 1FO5A 2H73A 2CZ3A 5D9XA 5CAXA 2MBTA 1PRXA 1S3DA 3UARA 1URMA 2IJYA 3KXOA 4G9HA 1GSQA 1WMJA 2JL4A 3FR9A 5HFGA 2HZEA 2JZRA 3FR6A 1THXA 1EEJA 5CRWA 1BX9A 2P31A 1OKDA 3GX0A 1PGTA 2ALBA 5F8BA 4MJCA 2DBCA 3GV1A 4TR1B 1AUCA 3LEFA 5IIZA 5INYA 4MJBA 5D96A 4XRDA 3TCOA 1V57A 3IE3A 1K0BA 5ID2A 4F82A 3FZ9A 4HZ2A 1QXHA 3D22A 2LEGA 2NBSA 3EU4A 2L6CA 2YV9A 4HU7A 1XCCA 5CO3A 2VAFA 1MDJA 4HU9A 3P2AA 4XCSA 2HE3A 1A2LA 2AV4A 4EVMA 3PR8A 3UMAA 1SK1A 4K2DA 4IBPA 1YDKA 3VFIA 1SKRB 1OYJA 2C0DA 3FY7A 2DJ3A 5DJLA 2C0EA 5D8IA 2XBQA 1ERTA 4KCAA 2QKEA 4FH8A 3CSHA 4XS4B 2WULA 4XS1A 2V1MA 5GZZB 3V1WA 4XS6A 2X8CA 4I6XA 1MDKA 3IV4A 3F9UA 1SENA 2E2GA 5IMCA 2K8VA 2MMNA 2JACA 2EC4A 3ZITA 5J9CA 4ZBAA 2KOKA 2WJUA 3QMXA 5B8AA 3L4NA 2CQ9A 3APSA 3HHVA 2LRTA 2C1YA 1OKTA 2FWHA 3NIVA 3LORA 5ECHB 5IOXA 1PD21 3GH6A 5ECIB 3TUEA 5DDLA 4POMA 1YEPA 2X64A 2DMLA 2MMOA 1SL2B 2FLSA 2L5LA 5G1KA 1OAZA 1J9BA 3GTUA 1AQVA 3HVSA 2H6YA 3IPZA 3ME8A 5GAPD 1TP9A 4TXOA 2IMDA 2LQOA 1TK0B 3L9UA 2WGRA 4MJEA 2QGVA 1X5CA 4MZCA 1JZWA 4HJMA 3WGEA 4RI6A 2FUG2 1SJ6A 3H79A 1M2AA 4X43A 4NV2A 3EURA 4JR4A 4G19A 2VUPA 3CBUA 4KCEA 4EO3A 3QFAC 1X9WB 1SKWB 3G7YA 5DQYA 2L59A 4WR4A 4ULXA 1VF3A 4TR4A 4F2IA 1F37A 3HZ8A 3M9JA 4LMWA 4F0CA 4YAVA 2F3MA 3ZL5A 2C3QA 1WWJA 3FRCA 4KDXA 1G7EA 3A2VA 4EE0A 2HFDA 4CHSA 2V6OA 4ZB9A 3US3A 2R5GA 4TN8A 3W8SA 3PINA 4TR1A 4KX4A 1YJ6A 1GSFA 4BPYA 1F6MC 2PPTA 4KB3A 5H5RA 2PN8A 1GP1A 1V98A 4ZL7A 3DGQA 1M2DA 3IA1A 5F06A 2G0FA 2K9FA 4GWRA 5J5NA 1VF2A 4QQ7A 1NW2A 1ZGNA 2ON5A 4KDYA 2D2ZA 2LQQA 3U5RE 2B6MA 3VI7A 3VK9A 4G10A 3J7Yb 4N11A 4EL1A 5DQSA 2KHPA 5KN0A 3QD9A 5F0GA 4IELA 1ACVA 2FHEA 4OO5A 4ID0A 13GSA 4Q5NA 1JZRA 3E0UA 5AGYA 2RUFA 3TJJA 1XWAA 1FG4A 2WS2A 4PURA 2L4QA 1SKSB 4CDOA 2YJHA 2TRXA 2H71A 2GVPA 2CZ2A 4K6XA 4JU5A 1F2EA 2IFQA 3IAS2 9GSSA 2XBIA 4N10A 5ECLB 4MABA 1PKWA 1FOVA 5G5EA 2O85A 1EV9A 3I69A 1Q98A 2HZFA 1XOAA 3VPQA 1LJRA 4GSTA 1XVWA 3GURA 1TRSA 4Q5FA 1WIKA 4MF7A 3KJYA 5A4UA 3GKXA 1ZMAA 3TKSA 2H1GA 3DD3A 4IP1A 4ZBDA 5AIXA 3QPMA 4IVFA 6GSUA 3EMXA 2DSAA 2V32A 1FVKA 5J41A 3P8WA 3KZQA 2YWOA 3GA4A 3EWLA 6GSXA 2OE0A 4D73B 3QCPA 3HJOA 2WZ9A 3ZRDA 3VLNA 3Q18A 3DKSA 2ES7A 2RM6A 3N9JA 1B48A 2K8SA 3CYNA 3F3QA 5IMAA 5IO2A 3BOAA 3DRNA 4DSRA 2OBIA 3G9BA 3RDWA 4K9ZA 5DALB 5L71A 1G6WA 4BWSA 5DVBA 5IPHA 2N5BA 4IQ1A 1XBSA 3HJMA 1CQHA 2XPEA 3UEMA 3WGXA 3TKQA 4NWYA 2VD1A 1SD8A 2M72A 3CRUA 2JADA 3GNJA 2VL3A 1HNAA 3GMFA 1XW9A 3VWVA 1SL1B 5DJMA 1GL8A 2QC7A 1H4OA 4DEJA 1T3BA 4HEA2 3BBYA 3DYRA 3F3RA 2RIIA 3TGZA 2H30A 3LJRA 2IL3A 1V2AA 1M9BA 1XWCA 2GSQA 1OC9B 3D4MA 2JU5A 1A23A 2JSZA 5G1LA 3FZ4A 2TIRA 3GRXA 2X8GA 2H1AA 3ISOA 2VCTA 1QUWA 2HI7A 2V41A 4EDZA 3CRTA 1GNWA 1GSSA 2GT5A 2DIZA 4Z7XA 3IAM2 1F3AA 5DAKB 1TRVA 1NSWA 3D0ZA 4YH2A 4ZL8A 1HQOA 2YWIA 5D73A 1HNCA 1JLVA 1JZOA 17GSA 1A2MA 4PX1A 1LU4A 2HNLA 5DCHA 5AIVA 1SYXA 1JFUA 4AGSA 1GTIA 2LNSA 2LV3A 1V9WA 1WE0A 2YV7A 4MH3A 4X0XA 5CRDA 3Q19A 3NOFA 1ST9A 5LD0A 1FHEA 3KMOA 3TJGA 3APQA 1FAAA 2OADA 2XPDA 3KP9A 4GCIA 1ABAA 1RQMA 2P0GA 2IMIA 4IW9A 3ZZXA 3J7Yk 4TW5A 2LJKA 4N0ZA 2VCVA 5DBQA 2NTOA 3D4TA 3W8JA 2B7JA 2H72A 4OO4A 4XIHA 1ERWA 1AW9A 2IN3A 1B4QA 4PQ1A 2B3SA 3G7IA 1BG5A 1XWGA 5HFIA 1T1VA 6GSSA 3GX8A 5J3RA 3I43A 5J4UA 3M3MA 2BTOT 2VLVA 1T4ZA 4MDCA 3KM6A 1KBNA 5LNKe 4IP6A 3DXBA 3MSZA 2LS5A 5JWOB 1NHOA 1UN2A 1YKCA 4MLYA 4HJ2A 3FEUA 1TOFA 4L0WA 3GH9A 1YKAA 3ERGA 3HDCA 2GTUA 4PUFC 3UL3A 2YJ7A 4DSSB 4PUAA 4RUVA 2LJAA 3UVTA 4WBRD 3KTLA 2JZSA 5FHIA 2GQMA 4PNGA 1N8JA 1Y6EA 5DCGA 2FGXA 2CX3A 4H86A 1SL0B 4K7NA 2A2SA 1JZDA 1T4YA 1ZL9A 2YPMA 3WD6A 2H1DA 1T00A 5GSTA 2HRNA 5HR1A 3HCZA 2C8UA 5EY6A 4IS0A 2AYTA 1T8EB 2DJJA 2DIYA 3HY2A 5G31A 5FWGA 3GKKA 2DJ2A 2GZPA 2LJRA 4AF2A 1GSYA 2H74A 4OD7A 1A0FA 3C1SA 2IMKA 4TR3A 1OVNA 4J57E 3RAZA 1X9MB 2H19A 5A4WA 2XC2A 4I5QA 10GSA 3UBLA 1MD4A 3ZMKA 1SK0A 3KP8A 1M2BA 3Q6OA 3DVXA 5DAKA 4OCEA 3KEBA 4OWYA 3LSZA 5FT3A 3ZYWA 3FR3A 3CSIA 4ZIJA 5AN1A 1TKDB 4Q5QA 5CREA 3WGDA 5HR3A 4NXIA 1U88A 4KE3A 5IMDA 3L9VA 2OE3A 3GHAA 4EUYA 3BCKA 3KMNA 1QK8A 2DMMA 2LRCA 2VCXA 1F3BA 3MWHA 3IK7A 4YQVA 1ZZYA 4BVYA 1GH2A 3GIXA 1ZYQB 2DJ0A 2O7KA 3P90A 3FKFA 2M80A 4KDUA 1XFLA 4K0GA 1X9SB 1Z7RA 4JR6A 4P3YB 2I1UA 22GSA 1GUMA 2PVOC 3N5OA 2LNTA 3JCML 3ERWA 2MMZA 4ZBBA 1K0OA 3HXSA 1WPIA 1GUHA 4LL1B 4EDYA 4BVXA 1TJDA 4L8EA 1U3IA 5EPFA 2C0GA 2I4AA 4IN0A 2KP1A 3DVWA 2WCIA 1EV4A 2RM5A 4KSOA 3FHKA 5JCGA 4PXOA 3TKSE 1X5DA 4YAPA 2FWEA 1AIUA 4DSSA 2FY6A 1BAYA 3RBTA 1DUGA 4GTUA 1O8XA 3R2QA 1A8YA 5G30A 4ILFA 3F4TA 3ZVJD 3LQ7A 3F8UA 4AJ6A 2N5AA 1DE2A 3TRPA 3UBKA 4I8BA 1OE7A 4WR5A 1PL2A 4F0BA 1BJXA 1B9XC 1QGVA 2VL9A 4XRAA 2I9HA 11GSA 1YEXA 5ABRA 1FVJA 1ZYEA 2EIQA 5JWRB 2J23A 1QQ2A 2K18A 1XW5A 4GQCA 4E8EA 3DEXA 4BWQA 3F6FA 1ML6A 3HVVA 2KP2A 1EOHA 2F51A 4FO5A 1PKZA 3IK9A 5HR0A 5HFKA 3IXRA 4MP4A 4XS4A 1GSEA 5G2ZA 2GQLA 3ZIVA 2L4CA 3QR6A 2HT9A 5F07A 1YQ1A 2YWNA 1WRYA 3EMPA 2VCQA 4MJAA 3GL5A 3ME7A 1DBYA 3C71A 4HS1A 2C4JA 1J0FA 1GRXA 1MTCA 3WYWA 1PN9A 20GSA 3Q74A 5D93A 1ERVA 1K0DA 4ML6A 4O7HA 3K8NA 3ZLPA 5IMZA 4OMVA 4V2NA 3KCMA 3TOTA 2B5XA 2FA4A 1UC7A 3H4KA 3IC4A 2MYGA 1QMVA 4NPBA 4GXZA 2YOIA 4N30A 4GQFA 1O8WA 2R3XA 3TJFA 5C00A 2A2RA 1IYHA 4MPGA 3C8EA 2CT6A 2YWMA 4HI7A 1TW9A 1GTUA 1O73A 1A2JA 4ZXGA 2HSYA 2PGTA 1EP7A 1HYUA 5ELGA 3VWXA 1TRUA 3D6IA 3RPNA 2AJQB 2VLUA 3LXZA 4JEDA 4DSQA 5IM9A 4AJ7A 3APOA 4NHWA 2HLSA 2E0QA 4ZB8A 5ECKB 2JZTA 3PH9A 1O6JA 5CRGA 4MK3A 2IMFA 5IMVA 2VM2A 4LMVA 3UAPA 3EYTA 5KN3A 2HZEB 1S3AA 6GSTA 5ECMB 5JWQB 4QL9A 4RQRA 4ZB6A 2N5FA 4PQHA 3LYKA 3FZ5A 5EL8A 1TTZA 5ELAA 3P7XA 1JHBA 4O92A 4JZQA 4BL7A 5ECOB 4ACSA 3CTGA 2VD0A 4WXTA 2GLRA 1KNGA 1K0MA 3IR4A 5ID2B 2GSRA 4PQIA 5ENUA 3M9KA 3EC3A 3I6AA 1I9DA 3M1GA 3QDNA 2FNOA 4KNDA 4MF6A 4EF0A 1XZOA 2PUKC 2YNXA 2VO4A 2F9SA 2CAIA 3A2XA 1V40A 1GSUA 3TRXA 1M9AA 1OC8A 2FWGA 6GSWA 4ZILA 1VGLA 4V2LA 4HZ4A 2JSYA 4POBA 8GSSA 1TU7A 2CVKA 3FW2A 1WP0A 2RUEA 2WB9A 1YF1A 4HQSA 2IIYA 3LGCA 2H6ZA 3KD0A 1EOGA 3M0FA 3TJKA 2LSTA 2VL2C 2H0HA 2VOCA 3NZNA 2I81A 4MMMA 1BEDA 2P5QA 2YP6A 2O89A 2B1KA 5G5FA 4YQUA 1XWBA 3QAVA 2WRTA 5HQPA 1B9YC 4Q5RA 1W4VA 5B7CA 2P5RA 5A5KA 1PMTA 5J9BA 3ZFBA 4WETA 4MH2A 4O5RA 4E8HA 1T7PB 2VCZA 2PMTA 1FB6A 4MCUA 1CQGA 4K7IA 2OE1A 3WT1A 2C80A 3TDGA 2L57A 4CW9A 1XXUA 2PWJA 3ZREA 2HXKA 4TOPA 3GTUB 4V1Ap 3TKRA 2CAQA 2H70A 1SYRA 1S3CA 3ZMLA 1W89A 1M0UA 5F05A 3KH9A 2OBKA 1AC1A 4TXOB 4EXJA 4TVEA 3HA9A 3HD5A 1K0NA 2C3TA 5A4VA 3U6VA 4FYCA 3ZTLA 4D73A 4J2FA 3MNGA 4YQMA 1TRWA 1PL1A 19GSA 4TRXA 1PQNA 1NHYA 3GKNA 3H93A 7GSSA 5IQYA 4ECCA 2DJ1A 2X8HA 2B5EA 5DALA 4IKHA 2MBSA 3BCIA 5B8BA 1O81A 5CP1A 1K3OA 3HZ4A 3KH7A 3SBCA 3GSTA 1SJZA 3QAGA 3O3TA 5C04A 1EZKA 5B6MA 2V6KA 3DMLA 3PGTA 2I3YA 4F9ZA 1Q4JA 5HR2A 4EKZA 2B7KA 2E2MA 3TJBA 4KUNA 5KEJA 3SWLA 3D21A 4WBJA 3TB2A 3FZAA 1Z6MA 2MMAA 1G6YA 1Z7PA 3KIJA 16GSA 5D9WA 2M46A 4KGIA 1AQWA 1B4PA 1OC9A 2YN1A 3QFBC 2DLXA 1R5PA 4X1UA 2H1BA 4NAXA 5JCWA 1I5GA 3CMIA 4V1Ag 4RI7A 3ZIJA 3CTFA 1VRSD 1KEBA 3RHBA 2YANA 2CVDA 1IYIA 4TKYA 2TRCP 2G2QA 5COHA 1U6TA 5KN1A 3KTBA 4LA1A 3A5WA 1U3AA 1N2AA 2REMA 1TK5B 2Z9SA 3QOUA 4BA7A 1GLPA 2IFQB 4MF5A 2IMEA 5E4WA 1PX6A
chains in the Genus database with same CATH superfamily
2PVQA 3FYGA 5D9TA 4G0IA 4G2EA 1TU8A 1EWXA 4GF0A 2OJLA 2YZHA 5AISA 2F8AA 4TR0A 3IHQA 1M99A 1R4WA 4K5SA 3F4RA 2HRAA 4KA0A 1FOHA 2IWTA 4IJ3A 6GSYA 4MZBA 1G7OA 4I2UA 3W6GA 2CX4A 2GDRA 3A2WA 3WT2A 2VM1A 1AAZA 4HOJA 1PX7A 3OR5A 3RHCA 4ISDA 1ILOA 2FWFA 2YZUA 1UA5A 5B6NA 4V2MA 4DVCA 2QSIA 5H5SA 14GSA 3E9JB 1V58A 1Z5YE 3EVIA 1VF1A 3LXTA 4K8MA 2XHFA 2R4VA 3G7JA 1YZXA 1XVQA 3GUSA 3QAWA 5ECPB 1Z9HA 2X99A 12GSA 2GGTA 2AUVA 1DE1A 4O5UA 2A4VA 2H75A 1MD3A 4ECJA 3H1NA 4OFNA 4X4JA 3MIXA 3GFKA 2AAWA 1WJKA 4IHUA 1XPVA 4EC0A 2K6VA 4IJIA 4POLA 1MEKA 3L78A 2C3NA 4MPFA 3UJ1A 3EU3A 2HYXA 1ON4A 3A3TA 3MDKA 1R26A 1E2YA 2EIOA 2ZNMA 4JBBA 4OCFA 2HRFA 1HNBA 4ECIA 3GKMA 2DC5A 2OACA 1EGOA 1GTAA 1M3IA 3C7MA 4LLRA 1ZYPA 3UIWA 5GSSA 1GNEA 3C73A 2E7PA 3TKSC 1M7TA 4L5LA 1K3LA 2EIRA 2LKUA 5ECNB 4WEYA 3C1RA 4BIKA 1G0TA 3LYPA 2PBJA 4FYBA 2H66A 3CSJA 4KW6A 2HSHA 1EEMA 3F0IA 1SU9A 1YY7A 1GUKA 4J56E 2CVBA 5EVOA 3I9V2 2OKAA 3EINA 1FW1A 5CYYA 1RK4A 2LUSA 4RQXA 3LG6A 1A24A 2DJKA 2A4HA 2FCHA 3IRAA 4WF5A 5CNWA 3RPPA 2BMXA 2ZUPA 2YCDA 4L0UA 2CV4A 3HKRA 2GSSA 1O85A 3FK8A 4HUAA 3L9SA 4IQAA 2O8VB 2CA8A 3AY8A 3GL3A 3UVHA 4F03A 1GLQA 2VIMA 1NM3A 2IPAA 4NV5A 4AJ8A 4I2TA 3CXGA 2H01A 3GSSA 2J9HA 1LBKA 2PU9C 2H6XA 2KLXA 4GLTA 1C72A 4GSSA 18GSA 1YF0A 2H8LA 3IBHA 3IOSA 1AXDA 2PERA 4JE1A 3TRQA 5ECSA 3O6TA 3VWUA 2NPBA 4KSMA 1JLWA 3DIEA 2LTKA 5ECQB 4MZWA 1A0RP 2WDUA 3S9FA 4IGJA 2B1LA 4NMUA 3VPTA 2GS3A 6GSVA 1RW1A 1Y25A 2H0IA 1BQ7A 1XG8A 3LWAA 4Z2UA 2GSTA 5LCZA 4XTSA 3F6DA 1XW6A 1J08A 4KF9A 2H0GA 3MAKA 3HYPA 1MDIA 2VLTA 1UVZA 1K0CA 1AQXA 1GTBA 3VURA 4XHMA 3H8QA 1TDIA 3KGKA 5IOWA 3IDVA 1X5EA 2VCWA 5E59A 5BMUA 1R7HA 3ED3A 4FIWA 1SK2A 3F4SA 1OC3A 1TK8B 2F8FA 2MZCA 3UOMA 1B8XA 3HVXA 2NVLA 4KAEA 2GT6A 1TI3A 3VI5A 1XOBA 1BYEA 5ECRB 4L5OA 2ON7A 3L0HA 1EP8A 1U87A 1XWKA 2R2JA 4MA9A 2H76A 1GWCA 4PNFA 2O87A 4OFMA 5KN2A 4G0LA 1OE8A 2ZCTA 1PFOA 2WFCA 4LL4B 4WKWA 3BD2A 1FB0A 1EGRA 4ZL9A 3BJ5A 1KTEA 4NHZA 3GN3A 1E6BA 1XIYA 1PA3A 1GULA 3TOUA 1USBA 1THOA 5GAND 2AB6A 4EIQA 4MNNA 4N0VA 3ERFA 5JCUA 1Z6NA 4HDEA 4GSNA 2NDOA 4GRFA 5CRHA 3TKPA 1ZCPA 1QFNA 5H5QA 1SD9A 4FYUA 1PSQA 5IMFA 2L6DA 2GQKA 1SJIA 3E3EA 3ZFLA 5IPGA 2BJXA 3LFLA 2KUCA 2RLIA 2OA7A 4BVYB 3F63A 1DSBA 5IO0A 3EE2A 2R6KA 3DWVA 1F9MA 1ZOFA 2GZZA 1TI1A 4ML1A 1TXXA 4OFTA 2LRNA 1X0RA 4QL7A 1O7UA 4WF4A 4KH7A 4K0NA 1A8LA 2FA8A 4JRRA 4K1FA 1GSDA 2VL2A 2GZYA 4I97A 2B5YA 3GYKA 4TXVA 2AHEA 4POKA 3D5JA 3A5IA 3ZVJA 1Z3EA 2R37A 2C0FA 1HD2A 1WOUA 1K0AA 4K7OA 1H75A 2L5OA 1K3YA 4ECBA 3VWWA 4O32A 5D9VA 1VF4A 1ERUA 2FD3A 3M8NA 4PGTA 2V2GA 4BVXB 4HQZA 1R5AA 3HJPA 3O76A 1FO5A 2H73A 2CZ3A 5D9XA 4YKFA 5CAXA 2MBTA 1PRXA 1S3DA 3UARA 1URMA 2IJYA 3KXOA 4G9HA 1GSQA 2R0GA 1WMJA 2JL4A 3FR9A 5HFGA 2HZEA 2JZRA 3FR6A 1THXA 1EEJA 5CRWA 1BX9A 2P31A 1OKDA 3GX0A 1PGTA 2ALBA 5F8BA 4MJCA 2DBCA 3GV1A 1PN0A 4TR1B 1AUCA 3LEFA 5IIZA 5INYA 4MJBA 5D96A 4XRDA 3TCOA 1V57A 3IE3A 1K0BA 5ID2A 4F82A 3FZ9A 4HZ2A 1QXHA 3D22A 2LEGA 2NBSA 3EU4A 2L6CA 2YV9A 4HU7A 1XCCA 5CO3A 2VAFA 1MDJA 4HU9A 3P2AA 4XCSA 2HE3A 1A2LA 2AV4A 4EVMA 3PR8A 3UMAA 1SK1A 4K2DA 4IBPA 1YDKA 3VFIA 1SKRB 1OYJA 2C0DA 3FY7A 2DJ3A 5DJLA 2C0EA 5D8IA 2XBQA 1ERTA 4KCAA 2QKEA 4FH8A 3CSHA 4XS4B 2WULA 4XS1A 2V1MA 5GZZB 3V1WA 4XS6A 2X8CA 4I6XA 1MDKA 3IV4A 3F9UA 1SENA 2E2GA 5IMCA 3IC8A 2K8VA 2MMNA 2JACA 2EC4A 3ZITA 5J9CA 4ZBAA 2KOKA 2WJUA 3QMXA 5B8AA 3L4NA 2CQ9A 3APSA 3HHVA 2LRTA 2C1YA 1OKTA 2FWHA 3NIVA 3LORA 5ECHB 2A2PA 5IOXA 1PD21 3GH6A 5ECIB 3TUEA 5DDLA 4POMA 1YEPA 2X64A 2DMLA 2MMOA 1SL2B 2FLSA 2L5LA 5G1KA 1OAZA 1J9BA 3GTUA 1AQVA 3HVSA 2H6YA 3IPZA 3ME8A 5GAPD 1TP9A 4TXOA 2IMDA 2LQOA 1TK0B 3L9UA 2WGRA 4MJEA 2QGVA 1X5CA 4MZCA 1JZWA 4HJMA 3WGEA 4RI6A 2FUG2 1SJ6A 3H79A 1M2AA 4X43A 4NV2A 3EURA 4JR4A 4G19A 2VUPA 3CBUA 4KCEA 4Z2RA 4EO3A 3QFAC 1X9WB 1SKWB 3G7YA 5DQYA 2L59A 4WR4A 4ULXA 1VF3A 4TR4A 4F2IA 1F37A 3HZ8A 3M9JA 4LMWA 4F0CA 4YAVA 2F3MA 3ZL5A 2C3QA 1WWJA 3FRCA 4KDXA 1G7EA 3A2VA 4EE0A 2HFDA 4CHSA 4BL7B 2V6OA 4ZB9A 3US3A 2R5GA 4TN8A 3W8SA 3PINA 4TR1A 4KX4A 1YJ6A 1GSFA 4BPYA 1F6MC 2PPTA 4KB3A 5H5RA 2PN8A 1GP1A 1V98A 4ZL7A 3DGQA 4CY8A 1M2DA 3IA1A 5F06A 2G0FA 2K9FA 4GWRA 5J5NA 1ZYNA 1VF2A 4QQ7A 1NW2A 1ZGNA 2ON5A 4KDYA 2D2ZA 2LQQA 4K5RA 3U5RE 2B6MA 3VI7A 3VK9A 4G10A 3J7Yb 4N11A 4EL1A 5DQSA 2KHPA 5KN0A 3QD9A 5F0GA 4IELA 1ACVA 2FHEA 4OO5A 4ID0A 13GSA 4Q5NA 1JZRA 3E0UA 5AGYA 2RUFA 3TJJA 1XWAA 1FG4A 2WS2A 4PURA 2L4QA 1SKSB 4CDOA 2YJHA 2TRXA 2H71A 2GVPA 2CZ2A 4K6XA 4JU5A 1F2EA 2IFQA 3IAS2 9GSSA 2XBIA 4N10A 5ECLB 4MABA 4K2XA 1PKWA 1FOVA 5G5EA 2O85A 1EV9A 3I69A 1Q98A 2HZFA 1XOAA 3VPQA 1LJRA 4GSTA 1XVWA 3GURA 1TRSA 4Q5FA 1WIKA 3MYDA 4MF7A 3KJYA 5A4UA 3GKXA 1ZMAA 3TKSA 2H1GA 3DD3A 1M3JA 4IP1A 4ZBDA 5AIXA 3QPMA 4IVFA 4FQUA 6GSUA 3EMXA 2DSAA 2V32A 1FVKA 5J41A 3P8WA 3KZQA 2YWOA 3GA4A 3EWLA 6GSXA 2OE0A 4D73B 3QCPA 3HJOA 2WZ9A 3ZRDA 3VLNA 3Q18A 3DKSA 2ES7A 2RM6A 3N9JA 1B48A 2K8SA 3CYNA 3F3QA 5IMAA 5IO2A 3BOAA 3DRNA 4DSRA 2OBIA 3G9BA 3RDWA 4K9ZA 5DALB 5L71A 1G6WA 4BWSA 5DVBA 5IPHA 2N5BA 4IQ1A 1XBSA 3HJMA 1CQHA 2XPEA 3UEMA 3WGXA 3TKQA 4NWYA 2VD1A 1SD8A 2M72A 3CRUA 2JADA 3GNJA 2VL3A 1HNAA 3GMFA 1XW9A 3VWVA 1SL1B 5DJMA 1GL8A 2QC7A 2QA2A 1H4OA 4DEJA 1T3BA 4HEA2 3BBYA 4CY6A 3DYRA 3F3RA 2RIIA 3TGZA 5KOXA 2H30A 3LJRA 2IL3A 1V2AA 1M9BA 1XWCA 2GSQA 1OC9B 3D4MA 2JU5A 1A23A 2JSZA 5G1LA 3FZ4A 2DKIA 2TIRA 3GRXA 2X8GA 2H1AA 3ISOA 2VCTA 1QUWA 2HI7A 2V41A 4EDZA 3CRTA 1GNWA 1GSSA 2GT5A 2DIZA 4Z7XA 2QA1A 3IAM2 1F3AA 5DAKB 1TRVA 1NSWA 3D0ZA 4YH2A 4ZL8A 1HQOA 2YWIA 5D73A 1HNCA 1JLVA 1JZOA 17GSA 1A2MA 4PX1A 1LU4A 2HNLA 5DCHA 5AIVA 1SYXA 1JFUA 4AGSA 1GTIA 2LNSA 2LV3A 1V9WA 1WE0A 2YV7A 4MH3A 4X0XA 5CRDA 3Q19A 3NOFA 1ST9A 5LD0A 1FHEA 3KMOA 3TJGA 3APQA 1FAAA 2OADA 2XPDA 3KP9A 4GCIA 1ABAA 1RQMA 2DKHA 2P0GA 2IMIA 4IW9A 3ZZXA 3J7Yk 4TW5A 2LJKA 4N0ZA 2VCVA 5DBQA 2NTOA 3D4TA 3W8JA 2B7JA 2H72A 4OO4A 4XIHA 1ERWA 1AW9A 2IN3A 1B4QA 4A5PA 4PQ1A 2B3SA 3G7IA 1BG5A 1XWGA 4O5QA 5HFIA 1T1VA 6GSSA 3GX8A 5J3RA 3I43A 5J4UA 3M3MA 2BTOT 2VLVA 1T4ZA 4MDCA 3KM6A 1KBNA 5LNKe 4IP6A 4USSA 3DXBA 3MSZA 2LS5A 5JWOB 1NHOA 1UN2A 1YKCA 4MLYA 4HJ2A 3FEUA 1TOFA 4L0WA 3GH9A 1YKAA 3ERGA 3HDCA 2GTUA 4PUFC 3UL3A 2YJ7A 4DSSB 4PUAA 4RUVA 2LJAA 3UVTA 4WBRD 3KTLA 2JZSA 5FHIA 2GQMA 4PNGA 1N8JA 1Y6EA 5DCGA 2FGXA 2CX3A 4H86A 1SL0B 4K7NA 2A2SA 1JZDA 3LW9A 1T4YA 1ZL9A 2YPMA 3WD6A 2H1DA 1T00A 5GSTA 2HRNA 5HR1A 3HCZA 2C8UA 5EY6A 4IS0A 2AYTA 1T8EB 2DJJA 2DIYA 3HY2A 5G31A 5FWGA 3GKKA 2DJ2A 2R0PA 2GZPA 2LJRA 4AF2A 2X49A 1GSYA 2H74A 4OD7A 1A0FA 3C1SA 2IMKA 4TR3A 1OVNA 4J57E 3RAZA 1X9MB 2H19A 5A4WA 2XC2A 4I5QA 10GSA 3UBLA 1MD4A 3ZMKA 1SK0A 3KP8A 1M2BA 3Q6OA 3DVXA 5DAKA 4OCEA 3KEBA 4OWYA 3LSZA 5FT3A 3ZYWA 3FR3A 3CSIA 4ZIJA 5AN1A 1TKDB 4Q5QA 5CREA 3WGDA 5HR3A 4NXIA 1U88A 4KE3A 5IMDA 3L9VA 2OE3A 3GHAA 4EUYA 3BCKA 3KMNA 1QK8A 2DMMA 2LRCA 2VCXA 1F3BA 3MWHA 3IK7A 4YQVA 1ZZYA 4BVYA 1GH2A 3GIXA 1ZYQB 2DJ0A 2O7KA 3P90A 3FKFA 2M80A 4KDUA 1XFLA 4K0GA 1X9SB 1Z7RA 4JR6A 4P3YB 2I1UA 22GSA 1GUMA 2PVOC 3N5OA 2LNTA 3JCML 5BRTA 3ERWA 2MMZA 4ZBBA 1K0OA 3HXSA 1WPIA 1GUHA 4LL1B 4EDYA 4BVXA 1TJDA 4L8EA 1U3IA 5EPFA 2C0GA 2I4AA 4IN0A 2KP1A 3DVWA 2WCIA 1EV4A 2RM5A 4KSOA 3FHKA 5JCGA 4PXOA 3TKSE 3IHGA 1X5DA 4YAPA 2FWEA 3HVNA 1AIUA 4DSSA 2FY6A 1BAYA 3RBTA 1DUGA 4GTUA 1O8XA 3R2QA 1S3RA 1A8YA 2X4AA 5G30A 4ILFA 3F4TA 3ZVJD 3LQ7A 3F8UA 4AJ6A 2N5AA 1DE2A 3TRPA 3UBKA 4I8BA 1OE7A 4WR5A 1PL2A 4F0BA 1BJXA 1B9XC 1QGVA 2VL9A 4XRAA 2I9HA 11GSA 1YEXA 5ABRA 1FVJA 1ZYEA 2EIQA 5JWRB 2J23A 1QQ2A 2K18A 1XW5A 4GQCA 4E8EA 3DEXA 4BWQA 3F6FA 1ML6A 3HVVA 2KP2A 4Z2TA 1EOHA 2F51A 4FO5A 1PKZA 3IK9A 5HR0A 5HFKA 3IXRA 4MP4A 4XS4A 1GSEA 5G2ZA 2GQLA 3ZIVA 2L4CA 3QR6A 2HT9A 5F07A 1YQ1A 2YWNA 1WRYA 2R0CA 3EMPA 2VCQA 4MJAA 3GL5A 3ME7A 1DBYA 3C71A 4HS1A 2C4JA 1J0FA 1GRXA 1MTCA 3WYWA 1PN9A 20GSA 3Q74A 5D93A 1ERVA 1K0DA 4ML6A 4O7HA 3K8NA 3ZLPA 5IMZA 4OMVA 4V2NA 3KCMA 3TOTA 2B5XA 2FA4A 1UC7A 3H4KA 3IC4A 2MYGA 1QMVA 4NPBA 4GXZA 2YOIA 3R3EA 4GQFA 1O8WA 4N30A 2R3XA 3TJFA 5C00A 2A2RA 1IYHA 4MPGA 3C8EA 2CT6A 2YWMA 4HI7A 1TW9A 1GTUA 1O73A 1A2JA 4ZXGA 2HSYA 2PGTA 1EP7A 1HYUA 5ELGA 3VWXA 1TRUA 2UZ8A 4EIPA 3D6IA 3RPNA 2AJQB 2VLUA 3LXZA 4JEDA 4DSQA 5IM9A 4AJ7A 3APOA 4NHWA 2HLSA 2E0QA 4ZB8A 5ECKB 4G0KA 2JZTA 3PH9A 1O6JA 5CRGA 4MK3A 2IMFA 5IMVA 2VM2A 4LMVA 3UAPA 3EYTA 5KN3A 2HZEB 1S3AA 4ICYA 6GSTA 5ECMB 5JWQB 4QL9A 4RQRA 4ZB6A 2N5FA 4PQHA 3LYKA 3FZ5A 5EL8A 1TTZA 5ELAA 3P7XA 1JHBA 4O92A 4JZQA 4BL7A 5ECOB 4ACSA 3CTGA 2VD0A 4WXTA 2GLRA 1KNGA 1K0MA 2HRKA 3IR4A 5ID2B 2GSRA 4PQIA 5ENUA 3M9KA 3EC3A 3I6AA 1I9DA 3M1GA 3QDNA 2FNOA 4KNDA 4MF6A 4EF0A 1XZOA 2PUKC 2YNXA 2VO4A 2F9SA 2CAIA 3A2XA 1V40A 1GSUA 3TRXA 1M9AA 1OC8A 2FWGA 6GSWA 4ZILA 1VGLA 4V2LA 4HZ4A 5KOWA 2JSYA 4POBA 8GSSA 1TU7A 2CVKA 3FW2A 1WP0A 2RUEA 2WB9A 1YF1A 4HQSA 2IIYA 3LGCA 3CQFA 2H6ZA 3KD0A 1EOGA 3M0FA 3TJKA 2LSTA 2VL2C 2H0HA 2VOCA 3NZNA 2I81A 4MMMA 1BEDA 2P5QA 2YP6A 2O89A 2B1KA 5G5FA 4YQUA 1XWBA 3QAVA 2WRTA 5HQPA 1B9YC 4Q5RA 1W4VA 5B7CA 2P5RA 5A5KA 1PMTA 5J9BA 3ZFBA 4WETA 4MH2A 4O5RA 4E8HA 1T7PB 2VCZA 2PMTA 1FB6A 4MCUA 1CQGA 4K7IA 2OE1A 3WT1A 2C80A 3PPUA 3TDGA 2L57A 4CW9A 1XXUA 2PWJA 3ZREA 2HXKA 4TOPA 3GTUB 2HSMA 4V1Ap 3TKRA 2CAQA 2H70A 1SYRA 1S3CA 3ZMLA 1W89A 1M0UA 5F05A 3KH9A 2OBKA 1AC1A 3EPTA 4TXOB 4EXJA 4TVEA 3HA9A 3HD5A 1K0NA 2C3TA 5A4VA 3U6VA 4FYCA 3ZTLA 4D73A 4J2FA 3MNGA 4YQMA 1TRWA 1PL1A 19GSA 4TRXA 1PQNA 1NHYA 3GKNA 3H93A 7GSSA 5IQYA 4HSCX 4ECCA 2DJ1A 2X8HA 2B5EA 5DALA 4IKHA 2MBSA 3BCIA 5B8BA 1O81A 5CP1A 1K3OA 3HZ4A 3KH7A 3SBCA 3GSTA 1SJZA 3QAGA 3O3TA 5C04A 1EZKA 5B6MA 2V6KA 3DMLA 3PGTA 2I3YA 4F9ZA 1Q4JA 5HR2A 4EKZA 2B7KA 2E2MA 3TJBA 4KUNA 5KEJA 3SWLA 3D21A 4WBJA 3TB2A 3FZAA 1Z6MA 2MMAA 1G6YA 1Z7PA 3KIJA 16GSA 5D9WA 2M46A 4KGIA 1AQWA 1B4PA 1OC9A 2YN1A 3QFBC 2DLXA 1R5PA 4X1UA 2H1BA 4NAXA 5JCWA 1I5GA 3CMIA 4V1Ag 4RI7A 3ZIJA 3CTFA 3FMWA 1VRSD 1KEBA 3RHBA 2YANA 2CVDA 1IYIA 4TKYA 2TRCP 2G2QA 5COHA 4YKGA 1U6TA 5KN1A 3KTBA 4LA1A 3A5WA 1U3AA 1N2AA 2REMA 4PTSA 1TK5B 2Z9SA 3QOUA 4BA7A 1GLPA 2IFQB 4MF5A 2IMEA 5E4WA 1PX6A
chains in the Genus database with same CATH topology
2PVQA 3FYGA 5D9TA 4G0IA 4G2EA 1TU8A 1EWXA 4GF0A 2OJLA 2YZHA 5AISA 2F8AA 4TR0A 3IHQA 1M99A 1R4WA 4K5SA 3F4RA 2HRAA 4KA0A 1FOHA 2IWTA 4IJ3A 6GSYA 4MZBA 1G7OA 4I2UA 3W6GA 2CX4A 2GDRA 3A2WA 3WT2A 2VM1A 1AAZA 4HOJA 1PX7A 3OR5A 3RHCA 4ISDA 1ILOA 2FWFA 2YZUA 1UA5A 5B6NA 4V2MA 4DVCA 2QSIA 5H5SA 14GSA 3E9JB 1V58A 1Z5YE 3EVIA 1VF1A 3LXTA 4K8MA 2XHFA 2R4VA 3G7JA 1YZXA 1XVQA 3GUSA 3QAWA 5ECPB 1Z9HA 2X99A 12GSA 2GGTA 2AUVA 1DE1A 4O5UA 2A4VA 2H75A 1MD3A 4ECJA 3H1NA 4OFNA 4X4JA 3MIXA 3GFKA 2AAWA 1WJKA 4IHUA 1XPVA 4EC0A 2K6VA 4IJIA 4POLA 1MEKA 3L78A 2C3NA 4MPFA 3UJ1A 3EU3A 2HYXA 1ON4A 3A3TA 3MDKA 1R26A 1E2YA 2EIOA 2ZNMA 4JBBA 4OCFA 2HRFA 1HNBA 4ECIA 3GKMA 2DC5A 2OACA 1EGOA 1GTAA 3C7MA 4LLRA 1ZYPA 3UIWA 5GSSA 1GNEA 3C73A 2E7PA 3TKSC 1M7TA 4L5LA 1K3LA 2EIRA 2LKUA 5ECNB 4WEYA 3C1RA 1G0TA 3LYPA 2PBJA 4FYBA 2H66A 3CSJA 4KW6A 2HSHA 1EEMA 3F0IA 1SU9A 1YY7A 1GUKA 4J56E 2CVBA 5EVOA 3I9V2 2OKAA 3EINA 1FW1A 5CYYA 1RK4A 2LUSA 4RQXA 3LG6A 1A24A 2DJKA 2A4HA 2FCHA 3IRAA 4WF5A 5CNWA 3RPPA 2BMXA 2ZUPA 2YCDA 4L0UA 2CV4A 3HKRA 2GSSA 1O85A 3FK8A 4HUAA 3L9SA 4IQAA 2O8VB 2CA8A 3AY8A 3GL3A 3UVHA 4F03A 1GLQA 2VIMA 1NM3A 2IPAA 4NV5A 4AJ8A 4I2TA 3CXGA 2H01A 3GSSA 2J9HA 1LBKA 2PU9C 2H6XA 2KLXA 4GLTA 1C72A 4GSSA 18GSA 1YF0A 2H8LA 3IBHA 3IOSA 1AXDA 2PERA 4JE1A 3TRQA 5ECSA 3O6TA 3VWUA 2NPBA 4KSMA 1JLWA 3DIEA 2LTKA 5ECQB 4MZWA 1A0RP 2WDUA 3S9FA 4IGJA 2B1LA 4NMUA 3VPTA 2GS3A 6GSVA 1RW1A 1Y25A 2H0IA 1BQ7A 3LWAA 4Z2UA 2GSTA 5LCZA 4XTSA 3F6DA 1XW6A 1J08A 4KF9A 2H0GA 3MAKA 3HYPA 1MDIA 2VLTA 1UVZA 1K0CA 1AQXA 1GTBA 3VURA 4XHMA 3H8QA 1TDIA 3KGKA 5IOWA 3IDVA 1X5EA 2VCWA 5E59A 5BMUA 1R7HA 3ED3A 4FIWA 1SK2A 3F4SA 1OC3A 1TK8B 2F8FA 2MZCA 3UOMA 1B8XA 3HVXA 2NVLA 4KAEA 2GT6A 1TI3A 3VI5A 1XOBA 1BYEA 5ECRB 4L5OA 2ON7A 3L0HA 1EP8A 1U87A 1XWKA 2R2JA 4MA9A 2H76A 1GWCA 4PNFA 2O87A 4OFMA 5KN2A 4G0LA 1OE8A 2ZCTA 2WFCA 4LL4B 4WKWA 3BD2A 1FB0A 1EGRA 4ZL9A 3BJ5A 1KTEA 4NHZA 3GN3A 1E6BA 1XIYA 1PA3A 1GULA 3TOUA 1USBA 1THOA 5GAND 2AB6A 4EIQA 4MNNA 4N0VA 3ERFA 5JCUA 1Z6NA 4HDEA 4GSNA 2NDOA 4GRFA 5CRHA 3TKPA 1ZCPA 1QFNA 5H5QA 1SD9A 4FYUA 1PSQA 5IMFA 2L6DA 2GQKA 1SJIA 3E3EA 3ZFLA 5IPGA 2BJXA 3LFLA 2KUCA 2RLIA 2OA7A 4BVYB 3F63A 1DSBA 5IO0A 3EE2A 2R6KA 3DWVA 1F9MA 1ZOFA 2GZZA 1TI1A 4ML1A 1TXXA 4OFTA 2LRNA 1X0RA 4QL7A 1O7UA 4WF4A 4KH7A 4K0NA 1A8LA 2FA8A 4JRRA 4K1FA 1GSDA 2VL2A 2GZYA 4I97A 2B5YA 3GYKA 4TXVA 2AHEA 4POKA 3D5JA 3A5IA 3ZVJA 1Z3EA 2R37A 2C0FA 1HD2A 1WOUA 1K0AA 4K7OA 1H75A 2L5OA 1K3YA 4ECBA 3VWWA 4O32A 5D9VA 1VF4A 1ERUA 2FD3A 3M8NA 4PGTA 2V2GA 4BVXB 4HQZA 1R5AA 3HJPA 3O76A 1FO5A 2H73A 2CZ3A 5D9XA 4YKFA 5CAXA 2MBTA 1PRXA 1S3DA 3UARA 1URMA 2IJYA 3KXOA 4G9HA 1GSQA 2R0GA 1WMJA 2JL4A 3FR9A 5HFGA 2HZEA 2JZRA 3FR6A 1THXA 1EEJA 5CRWA 1BX9A 2P31A 1OKDA 3GX0A 1PGTA 2ALBA 5F8BA 4MJCA 2DBCA 3GV1A 1PN0A 4TR1B 1AUCA 3LEFA 5IIZA 5INYA 4MJBA 5D96A 4XRDA 3TCOA 1V57A 3IE3A 1K0BA 5ID2A 4F82A 3FZ9A 4HZ2A 1QXHA 3D22A 2LEGA 2NBSA 3EU4A 2L6CA 2YV9A 4HU7A 1XCCA 5CO3A 2VAFA 1MDJA 4HU9A 3P2AA 4XCSA 2HE3A 1A2LA 2AV4A 4EVMA 3PR8A 3UMAA 1SK1A 4K2DA 4IBPA 1YDKA 3VFIA 1SKRB 1OYJA 2C0DA 3FY7A 2DJ3A 5DJLA 2C0EA 5D8IA 2XBQA 1ERTA 4KCAA 2QKEA 4FH8A 3CSHA 4XS4B 2WULA 4XS1A 2V1MA 5GZZB 3V1WA 4XS6A 2X8CA 4I6XA 1MDKA 3IV4A 3F9UA 1SENA 2E2GA 5IMCA 3IC8A 2K8VA 2MMNA 2JACA 2EC4A 3ZITA 5J9CA 4ZBAA 2KOKA 2WJUA 3QMXA 5B8AA 3L4NA 2CQ9A 3APSA 3HHVA 2LRTA 2C1YA 1OKTA 2FWHA 3NIVA 3LORA 5ECHB 2A2PA 5IOXA 1PD21 3GH6A 5ECIB 3TUEA 5DDLA 4POMA 1YEPA 2X64A 2DMLA 2MMOA 1SL2B 2FLSA 2L5LA 5G1KA 1OAZA 1J9BA 3GTUA 1AQVA 3HVSA 2H6YA 3IPZA 3ME8A 5GAPD 1TP9A 4TXOA 2IMDA 2LQOA 1TK0B 3L9UA 2WGRA 4MJEA 2QGVA 1X5CA 4MZCA 1JZWA 4HJMA 3WGEA 4RI6A 2FUG2 1SJ6A 3H79A 1M2AA 4X43A 4NV2A 3EURA 4JR4A 4G19A 2VUPA 3CBUA 4KCEA 4Z2RA 4EO3A 3QFAC 1X9WB 1SKWB 3G7YA 5DQYA 2L59A 4WR4A 4ULXA 1VF3A 4TR4A 4F2IA 1F37A 3HZ8A 3M9JA 4LMWA 4F0CA 4YAVA 2F3MA 3ZL5A 2C3QA 1WWJA 3FRCA 4KDXA 1G7EA 3A2VA 4EE0A 2HFDA 4CHSA 4BL7B 2V6OA 4ZB9A 3US3A 2R5GA 4TN8A 3W8SA 3PINA 4TR1A 4KX4A 1YJ6A 1GSFA 4BPYA 1F6MC 2PPTA 4KB3A 5H5RA 2PN8A 1GP1A 1V98A 4ZL7A 3DGQA 4CY8A 1M2DA 3IA1A 5F06A 2G0FA 2K9FA 4GWRA 5J5NA 1ZYNA 1VF2A 4QQ7A 1NW2A 1ZGNA 2ON5A 4KDYA 2D2ZA 2LQQA 4K5RA 3U5RE 2B6MA 3VI7A 3VK9A 4G10A 3J7Yb 4N11A 4EL1A 5DQSA 2KHPA 5KN0A 3QD9A 5F0GA 4IELA 1ACVA 2FHEA 4OO5A 4ID0A 13GSA 4Q5NA 1JZRA 3E0UA 5AGYA 2RUFA 3TJJA 1XWAA 1FG4A 2WS2A 4PURA 2L4QA 1SKSB 4CDOA 2YJHA 2TRXA 2H71A 2GVPA 2CZ2A 4K6XA 4JU5A 1F2EA 2IFQA 3IAS2 9GSSA 2XBIA 4N10A 5ECLB 4MABA 4K2XA 1PKWA 1FOVA 5G5EA 2O85A 1EV9A 3I69A 1Q98A 2HZFA 1XOAA 3VPQA 1LJRA 4GSTA 1XVWA 3GURA 1TRSA 4Q5FA 1WIKA 3MYDA 4MF7A 3KJYA 5A4UA 3GKXA 1ZMAA 3TKSA 2H1GA 3DD3A 4IP1A 4ZBDA 5AIXA 3QPMA 4IVFA 4FQUA 6GSUA 3EMXA 2DSAA 2V32A 1FVKA 5J41A 3P8WA 3KZQA 2YWOA 3GA4A 3EWLA 6GSXA 2OE0A 4D73B 3QCPA 3HJOA 2WZ9A 3ZRDA 3VLNA 3Q18A 3DKSA 2ES7A 2RM6A 3N9JA 1B48A 2K8SA 3CYNA 3F3QA 5IMAA 5IO2A 3BOAA 3DRNA 4DSRA 2OBIA 3G9BA 3RDWA 4K9ZA 5DALB 5L71A 1G6WA 4BWSA 5DVBA 5IPHA 2N5BA 4IQ1A 1XBSA 3HJMA 1CQHA 2XPEA 3UEMA 3WGXA 3TKQA 4NWYA 2VD1A 1SD8A 2M72A 3CRUA 2JADA 3GNJA 2VL3A 1HNAA 3GMFA 1XW9A 3VWVA 1SL1B 5DJMA 1GL8A 2QC7A 2QA2A 1H4OA 4DEJA 1T3BA 4HEA2 3BBYA 4CY6A 3DYRA 3F3RA 2RIIA 3TGZA 5KOXA 2H30A 3LJRA 2IL3A 1V2AA 1M9BA 1XWCA 2GSQA 1OC9B 3D4MA 2JU5A 1A23A 2JSZA 5G1LA 3FZ4A 2DKIA 2TIRA 3GRXA 2X8GA 2H1AA 3ISOA 2VCTA 1QUWA 2HI7A 2V41A 4EDZA 3CRTA 1GNWA 1GSSA 2GT5A 2DIZA 4Z7XA 2QA1A 3IAM2 1F3AA 5DAKB 1TRVA 1NSWA 3D0ZA 4YH2A 4ZL8A 1HQOA 2YWIA 5D73A 1HNCA 1JLVA 1JZOA 17GSA 1A2MA 4PX1A 1LU4A 2HNLA 5DCHA 5AIVA 1SYXA 1JFUA 4AGSA 1GTIA 2LNSA 2LV3A 1V9WA 1WE0A 2YV7A 4MH3A 4X0XA 5CRDA 3Q19A 3NOFA 1ST9A 5LD0A 1FHEA 3KMOA 3TJGA 3APQA 1FAAA 2OADA 2XPDA 3KP9A 4GCIA 1ABAA 1RQMA 2DKHA 2P0GA 2IMIA 4IW9A 3ZZXA 3J7Yk 4TW5A 2LJKA 4N0ZA 2VCVA 5DBQA 2NTOA 3D4TA 3W8JA 2B7JA 2H72A 4OO4A 4XIHA 1ERWA 1AW9A 2IN3A 1B4QA 4A5PA 4PQ1A 2B3SA 3G7IA 1BG5A 1XWGA 4O5QA 5HFIA 1T1VA 6GSSA 3GX8A 5J3RA 3I43A 5J4UA 3M3MA 2BTOT 2VLVA 1T4ZA 4MDCA 3KM6A 1KBNA 5LNKe 4IP6A 4USSA 3DXBA 3MSZA 2LS5A 5JWOB 1NHOA 1UN2A 1YKCA 4MLYA 4HJ2A 3FEUA 1TOFA 4L0WA 3GH9A 1YKAA 3ERGA 3HDCA 2GTUA 4PUFC 3UL3A 2YJ7A 4DSSB 4PUAA 4RUVA 2LJAA 3UVTA 4WBRD 3KTLA 2JZSA 5FHIA 2GQMA 4PNGA 1N8JA 1Y6EA 5DCGA 2FGXA 2CX3A 4H86A 1SL0B 4K7NA 2A2SA 1JZDA 3LW9A 1T4YA 1ZL9A 2YPMA 3WD6A 2H1DA 1T00A 5GSTA 2HRNA 5HR1A 3HCZA 2C8UA 5EY6A 4IS0A 2AYTA 1T8EB 2DJJA 2DIYA 3HY2A 5G31A 5FWGA 3GKKA 2DJ2A 2R0PA 2GZPA 2LJRA 4AF2A 2X49A 1GSYA 2H74A 4OD7A 1A0FA 3C1SA 2IMKA 4TR3A 1OVNA 4J57E 3RAZA 1X9MB 2H19A 5A4WA 2XC2A 4I5QA 10GSA 3UBLA 1MD4A 3ZMKA 1SK0A 3KP8A 1M2BA 3Q6OA 3DVXA 5DAKA 4OCEA 3KEBA 4OWYA 3LSZA 5FT3A 3ZYWA 3FR3A 3CSIA 4ZIJA 5AN1A 1TKDB 4Q5QA 5CREA 3WGDA 5HR3A 4NXIA 1U88A 4KE3A 5IMDA 3L9VA 2OE3A 3GHAA 4EUYA 3BCKA 3KMNA 1QK8A 2DMMA 2LRCA 2VCXA 1F3BA 3MWHA 3IK7A 4YQVA 1ZZYA 4BVYA 1GH2A 3GIXA 1ZYQB 2DJ0A 2O7KA 3P90A 3FKFA 2M80A 4KDUA 1XFLA 4K0GA 1X9SB 1Z7RA 4JR6A 4P3YB 2I1UA 22GSA 1GUMA 2PVOC 3N5OA 2LNTA 3JCML 5BRTA 3ERWA 2MMZA 4ZBBA 1K0OA 3HXSA 1WPIA 1GUHA 4LL1B 4EDYA 4BVXA 1TJDA 4L8EA 1U3IA 5EPFA 2C0GA 2I4AA 4IN0A 2KP1A 3DVWA 2WCIA 1EV4A 2RM5A 4KSOA 3FHKA 5JCGA 4PXOA 3TKSE 3IHGA 1X5DA 4YAPA 2FWEA 1AIUA 4DSSA 2FY6A 1BAYA 3RBTA 1DUGA 4GTUA 1O8XA 3R2QA 1A8YA 2X4AA 5G30A 4ILFA 3F4TA 3ZVJD 3LQ7A 3F8UA 4AJ6A 2N5AA 1DE2A 3TRPA 3UBKA 4I8BA 1OE7A 4WR5A 1PL2A 4F0BA 1BJXA 1B9XC 1QGVA 2VL9A 4XRAA 2I9HA 11GSA 1YEXA 5ABRA 1FVJA 1ZYEA 2EIQA 5JWRB 2J23A 1QQ2A 2K18A 1XW5A 4GQCA 4E8EA 3DEXA 4BWQA 3F6FA 1ML6A 3HVVA 2KP2A 4Z2TA 1EOHA 2F51A 4FO5A 1PKZA 3IK9A 5HR0A 5HFKA 3IXRA 4MP4A 4XS4A 1GSEA 5G2ZA 2GQLA 3ZIVA 2L4CA 3QR6A 2HT9A 5F07A 1YQ1A 2YWNA 1WRYA 2R0CA 3EMPA 2VCQA 4MJAA 3GL5A 3ME7A 1DBYA 3C71A 4HS1A 2C4JA 1J0FA 1GRXA 1MTCA 3WYWA 1PN9A 20GSA 3Q74A 5D93A 1ERVA 1K0DA 4ML6A 4O7HA 3K8NA 3ZLPA 5IMZA 4OMVA 4V2NA 3KCMA 3TOTA 2B5XA 2FA4A 1UC7A 3H4KA 3IC4A 2MYGA 1QMVA 4NPBA 4GXZA 2YOIA 3R3EA 4GQFA 1O8WA 4N30A 2R3XA 3TJFA 5C00A 2A2RA 1IYHA 4MPGA 3C8EA 2CT6A 2YWMA 4HI7A 1TW9A 1GTUA 1O73A 1A2JA 4ZXGA 2HSYA 2PGTA 1EP7A 1HYUA 5ELGA 3VWXA 1TRUA 2UZ8A 4EIPA 3D6IA 3RPNA 2AJQB 2VLUA 3LXZA 4JEDA 4DSQA 5IM9A 4AJ7A 3APOA 4NHWA 2HLSA 2E0QA 4ZB8A 5ECKB 4G0KA 2JZTA 3PH9A 1O6JA 5CRGA 4MK3A 2IMFA 5IMVA 2VM2A 4LMVA 3UAPA 3EYTA 5KN3A 2HZEB 1S3AA 4ICYA 6GSTA 5ECMB 5JWQB 4QL9A 4RQRA 4ZB6A 2N5FA 4PQHA 3LYKA 3FZ5A 5EL8A 1TTZA 5ELAA 3P7XA 1JHBA 4O92A 4JZQA 4BL7A 5ECOB 4ACSA 3CTGA 2VD0A 4WXTA 2GLRA 1KNGA 1K0MA 2HRKA 3IR4A 5ID2B 2GSRA 4PQIA 5ENUA 3M9KA 3EC3A 3I6AA 1I9DA 3M1GA 3QDNA 2FNOA 4KNDA 4MF6A 4EF0A 1XZOA 2PUKC 2YNXA 2VO4A 2F9SA 2CAIA 3A2XA 1V40A 1GSUA 3TRXA 1M9AA 1OC8A 2FWGA 6GSWA 4ZILA 1VGLA 4V2LA 4HZ4A 5KOWA 2JSYA 4POBA 8GSSA 1TU7A 2CVKA 3FW2A 1WP0A 2RUEA 2WB9A 1YF1A 4HQSA 2IIYA 3LGCA 2H6ZA 3KD0A 1EOGA 3M0FA 3TJKA 2LSTA 2VL2C 2H0HA 2VOCA 3NZNA 2I81A 4MMMA 1BEDA 2P5QA 2YP6A 2O89A 2B1KA 5G5FA 4YQUA 1XWBA 3QAVA 2WRTA 5HQPA 1B9YC 4Q5RA 1W4VA 5B7CA 2P5RA 5A5KA 1PMTA 5J9BA 3ZFBA 4WETA 4MH2A 4O5RA 4E8HA 1T7PB 2VCZA 2PMTA 1FB6A 4MCUA 1CQGA 4K7IA 2OE1A 3WT1A 2C80A 3PPUA 3TDGA 2L57A 4CW9A 1XXUA 2PWJA 3ZREA 2HXKA 4TOPA 3GTUB 2HSMA 4V1Ap 3TKRA 2CAQA 2H70A 1SYRA 1S3CA 3ZMLA 1W89A 1M0UA 5F05A 3KH9A 2OBKA 1AC1A 3EPTA 4TXOB 4EXJA 4TVEA 3HA9A 3HD5A 1K0NA 2C3TA 5A4VA 3U6VA 4FYCA 3ZTLA 4D73A 4J2FA 3MNGA 4YQMA 1TRWA 1PL1A 19GSA 4TRXA 1PQNA 1NHYA 3GKNA 3H93A 7GSSA 5IQYA 4ECCA 2DJ1A 2X8HA 2B5EA 5DALA 4IKHA 2MBSA 3BCIA 5B8BA 1O81A 5CP1A 1K3OA 3HZ4A 3KH7A 3SBCA 3GSTA 1SJZA 3QAGA 3O3TA 5C04A 1EZKA 5B6MA 2V6KA 3DMLA 3PGTA 2I3YA 4F9ZA 1Q4JA 5HR2A 4EKZA 2B7KA 2E2MA 3TJBA 4KUNA 5KEJA 3SWLA 3D21A 4WBJA 3TB2A 3FZAA 1Z6MA 2MMAA 1G6YA 1Z7PA 3KIJA 16GSA 5D9WA 2M46A 4KGIA 1AQWA 1B4PA 1OC9A 2YN1A 3QFBC 2DLXA 1R5PA 4X1UA 2H1BA 4NAXA 5JCWA 1I5GA 3CMIA 4V1Ag 4RI7A 3ZIJA 3CTFA 3FMWA 1VRSD 1KEBA 3RHBA 2YANA 2CVDA 1IYIA 4TKYA 2TRCP 2G2QA 5COHA 4YKGA 1U6TA 5KN1A 3KTBA 4LA1A 3A5WA 1U3AA 1N2AA 2REMA 4PTSA 1TK5B 2Z9SA 3QOUA 4BA7A 1GLPA 2IFQB 4MF5A 2IMEA 5E4WA 1PX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVQ A;  3FYG A;  5D9T A;  4G2E A;  1TU8 A;  1EWX A;  4GF0 A;  2OJL A;  2YZH A;  5AIS A;  2F8A A;  4TR0 A;  3IHQ A;  1M99 A;  1R4W A;  3F4R A;  4KA0 A;  2IWT A;  4IJ3 A;  6GSY A;  4MZB A;  1G7O A;  4I2U A;  3W6G A;  2CX4 A;  2GDR A;  3A2W A;  3WT2 A;  2VM1 A;  1AAZ A;  4HOJ A;  1PX7 A;  3OR5 A;  3RHC A;  4ISD A;  1ILO A;  2FWF A;  2YZU A;  1UA5 A;  5B6N A;  4V2M A;  4DVC A;  2QSI A;  5H5S A;  14GS A;  3E9J B;  1V58 A;  1Z5Y E;  3EVI A;  1VF1 A;  3LXT A;  4K8M A;  2XHF A;  2R4V A;  3G7J A;  1YZX A;  1XVQ A;  3GUS A;  3QAW A;  5ECP B;  1Z9H A;  2X99 A;  12GS A;  2GGT A;  2AUV A;  1DE1 A;  2A4V A;  2H75 A;  1MD3 A;  4ECJ A;  3H1N A;  4OFN A;  3GFK A;  2AAW A;  1WJK A;  4IHU A;  1XPV A;  4EC0 A;  2K6V A;  4IJI A;  4POL A;  1MEK A;  3L78 A;  2C3N A;  4MPF A;  3UJ1 A;  3EU3 A;  2HYX A;  1ON4 A;  3A3T A;  3MDK A;  1R26 A;  1E2Y A;  2EIO A;  2ZNM A;  4JBB A;  4OCF A;  2HRF A;  1HNB A;  4ECI A;  3GKM A;  2DC5 A;  2OAC A;  1EGO A;  1GTA A;  3C7M A;  4LLR A;  3UIW A;  5GSS A;  1GNE A;  3C73 A;  2E7P A;  3TKS C;  1M7T A;  4L5L A;  1K3L A;  2EIR A;  2LKU A;  5ECN B;  4WEY A;  3C1R A;  1G0T A;  3LYP A;  2PBJ A;  4FYB A;  2H66 A;  3CSJ A;  4KW6 A;  2HSH A;  1EEM A;  3F0I A;  1SU9 A;  1YY7 A;  1GUK A;  4J56 E;  2CVB A;  5EVO A;  3I9V 2;  2OKA A;  3EIN A;  1FW1 A;  5CYY A;  1RK4 A;  2LUS A;  4RQX A;  3LG6 A;  1A24 A;  2DJK A;  2FCH A;  3IRA A;  4WF5 A;  5CNW A;  3RPP A;  2BMX A;  2ZUP A;  2YCD A;  4L0U A;  2CV4 A;  3HKR A;  2GSS A;  1O85 A;  3FK8 A;  4HUA A;  3L9S A;  4IQA A;  2O8V B;  2CA8 A;  3AY8 A;  3GL3 A;  3UVH A;  4F03 A;  1GLQ A;  2VIM A;  1NM3 A;  2IPA A;  4NV5 A;  4AJ8 A;  4I2T A;  3CXG A;  2H01 A;  3GSS A;  2J9H A;  1LBK A;  2PU9 C;  2H6X A;  2KLX A;  4GLT A;  1C72 A;  4GSS A;  18GS A;  1YF0 A;  2H8L A;  3IBH A;  3IOS A;  1AXD A;  2PER A;  4JE1 A;  3TRQ A;  5ECS A;  3O6T A;  3VWU A;  2NPB A;  4KSM A;  1JLW A;  3DIE A;  2LTK A;  5ECQ B;  4MZW A;  1A0R P;  2WDU A;  3S9F A;  4IGJ A;  2B1L A;  4NMU A;  3VPT A;  2GS3 A;  6GSV A;  1RW1 A;  1Y25 A;  2H0I A;  1BQ7 A;  3LWA A;  2GST A;  5LCZ A;  4XTS A;  3F6D A;  1XW6 A;  1J08 A;  2H0G A;  3MAK A;  3HYP A;  1MDI A;  2VLT A;  1UVZ A;  1K0C A;  1AQX A;  1GTB A;  3VUR A;  4XHM A;  3H8Q A;  1TDI A;  3KGK A;  5IOW A;  3IDV A;  1X5E A;  2VCW A;  5E59 A;  1R7H A;  3ED3 A;  4FIW A;  1SK2 A;  3F4S A;  1OC3 A;  1TK8 B;  2F8F A;  2MZC A;  3UOM A;  1B8X A;  3HVX A;  2NVL A;  4KAE A;  2GT6 A;  1TI3 A;  3VI5 A;  1XOB A;  1BYE A;  5ECR B;  4L5O A;  2ON7 A;  3L0H A;  1EP8 A;  1U87 A;  1XWK A;  2R2J A;  4MA9 A;  2H76 A;  1GWC A;  4PNF A;  2O87 A;  4OFM A;  5KN2 A;  1OE8 A;  2ZCT A;  2WFC A;  4LL4 B;  4WKW A;  3BD2 A;  1FB0 A;  1EGR A;  4ZL9 A;  3BJ5 A;  1KTE A;  4NHZ A;  3GN3 A;  1E6B A;  1XIY A;  1PA3 A;  1GUL A;  3TOU A;  1USB A;  1THO A;  5GAN D;  2AB6 A;  4N0V A;  3ERF A;  5JCU A;  1Z6N A;  4HDE A;  4GSN A;  2NDO A;  4GRF A;  5CRH A;  3TKP A;  1ZCP A;  1QFN A;  5H5Q A;  1SD9 A;  4FYU A;  1PSQ A;  5IMF A;  2L6D A;  2GQK A;  1SJI A;  3E3E A;  3ZFL A;  5IPG A;  2BJX A;  3LFL A;  2KUC A;  2RLI A;  2OA7 A;  3F63 A;  1DSB A;  5IO0 A;  3EE2 A;  2R6K A;  3DWV A;  1F9M A;  1ZOF A;  2GZZ A;  1TI1 A;  4ML1 A;  1TXX A;  4OFT A;  2LRN A;  1X0R A;  4QL7 A;  1O7U A;  4WF4 A;  4KH7 A;  4K0N A;  1A8L A;  2FA8 A;  4JRR A;  4K1F A;  1GSD A;  2VL2 A;  2GZY A;  4I97 A;  2B5Y A;  3GYK A;  4TXV A;  2AHE A;  4POK A;  3D5J A;  3ZVJ A;  1Z3E A;  2R37 A;  2C0F A;  1HD2 A;  1WOU A;  1K0A A;  4K7O A;  1H75 A;  2L5O A;  1K3Y A;  4ECB A;  3VWW A;  4O32 A;  5D9V A;  1VF4 A;  1ERU A;  2FD3 A;  3M8N A;  4PGT A;  2V2G A;  4HQZ A;  1R5A A;  3HJP A;  3O76 A;  1FO5 A;  2H73 A;  2CZ3 A;  5D9X A;  5CAX A;  2MBT A;  1PRX A;  1S3D A;  3UAR A;  1URM A;  2IJY A;  3KXO A;  4G9H A;  1GSQ A;  1WMJ A;  2JL4 A;  3FR9 A;  5HFG A;  2HZE A;  2JZR A;  3FR6 A;  1THX A;  1EEJ A;  5CRW A;  1BX9 A;  2P31 A;  1OKD A;  3GX0 A;  1PGT A;  2ALB A;  5F8B A;  4MJC A;  2DBC A;  3GV1 A;  4TR1 B;  1AUC A;  3LEF A;  5IIZ A;  5INY A;  4MJB A;  5D96 A;  4XRD A;  3TCO A;  1V57 A;  3IE3 A;  1K0B A;  5ID2 A;  4F82 A;  3FZ9 A;  4HZ2 A;  1QXH A;  3D22 A;  2LEG A;  2NBS A;  3EU4 A;  2L6C A;  2YV9 A;  4HU7 A;  1XCC A;  5CO3 A;  2VAF A;  1MDJ A;  4HU9 A;  3P2A A;  4XCS A;  2HE3 A;  1A2L A;  2AV4 A;  4EVM A;  3PR8 A;  3UMA A;  1SK1 A;  4K2D A;  4IBP A;  1YDK A;  3VFI A;  1SKR B;  1OYJ A;  2C0D A;  3FY7 A;  2DJ3 A;  5DJL A;  2C0E A;  5D8I A;  2XBQ A;  1ERT A;  4KCA A;  2QKE A;  4FH8 A;  3CSH A;  4XS4 B;  2WUL A;  4XS1 A;  2V1M A;  5GZZ B;  3V1W A;  4XS6 A;  2X8C A;  4I6X A;  1MDK A;  3IV4 A;  3F9U A;  1SEN A;  2E2G A;  5IMC A;  2K8V A;  2MMN A;  2JAC A;  2EC4 A;  3ZIT A;  5J9C A;  4ZBA A;  2KOK A;  2WJU A;  3QMX A;  5B8A A;  3L4N A;  2CQ9 A;  3APS A;  3HHV A;  2LRT A;  2C1Y A;  1OKT A;  2FWH A;  3NIV A;  3LOR A;  5ECH B;  5IOX A;  1PD2 1;  3GH6 A;  5ECI B;  3TUE A;  5DDL A;  4POM A;  1YEP A;  2X64 A;  2DML A;  2MMO A;  1SL2 B;  2FLS A;  2L5L A;  5G1K A;  1OAZ A;  1J9B A;  3GTU A;  1AQV A;  3HVS A;  2H6Y A;  3IPZ A;  3ME8 A;  5GAP D;  1TP9 A;  4TXO A;  2IMD A;  2LQO A;  1TK0 B;  3L9U A;  2WGR A;  4MJE A;  2QGV A;  1X5C A;  4MZC A;  1JZW A;  4HJM A;  3WGE A;  4RI6 A;  2FUG 2;  1SJ6 A;  3H79 A;  1M2A A;  4X43 A;  4NV2 A;  3EUR A;  4JR4 A;  4G19 A;  2VUP A;  3CBU A;  4KCE A;  4EO3 A;  3QFA C;  1X9W B;  1SKW B;  3G7Y A;  5DQY A;  2L59 A;  4WR4 A;  4ULX A;  1VF3 A;  4TR4 A;  4F2I A;  1F37 A;  3HZ8 A;  3M9J A;  4LMW A;  4F0C A;  4YAV A;  2F3M A;  3ZL5 A;  2C3Q A;  1WWJ A;  3FRC A;  4KDX A;  1G7E A;  3A2V A;  4EE0 A;  2HFD A;  4CHS A;  2V6O A;  4ZB9 A;  3US3 A;  2R5G A;  4TN8 A;  3W8S A;  3PIN A;  4TR1 A;  4KX4 A;  1YJ6 A;  1GSF A;  4BPY A;  1F6M C;  2PPT A;  4KB3 A;  5H5R A;  2PN8 A;  1GP1 A;  1V98 A;  4ZL7 A;  3DGQ A;  1M2D A;  3IA1 A;  5F06 A;  2G0F A;  2K9F A;  4GWR A;  5J5N A;  1VF2 A;  4QQ7 A;  1NW2 A;  1ZGN A;  2ON5 A;  4KDY A;  2D2Z A;  2LQQ A;  3U5R E;  2B6M A;  3VI7 A;  3VK9 A;  4G10 A;  3J7Y b;  4N11 A;  4EL1 A;  5DQS A;  2KHP A;  5KN0 A;  3QD9 A;  5F0G A;  4IEL A;  1ACV A;  2FHE A;  4OO5 A;  4ID0 A;  13GS A;  4Q5N A;  1JZR A;  3E0U A;  5AGY A;  2RUF A;  3TJJ A;  1XWA A;  1FG4 A;  2WS2 A;  4PUR A;  2L4Q A;  1SKS B;  4CDO A;  2YJH A;  2TRX A;  2H71 A;  2GVP A;  2CZ2 A;  4K6X A;  4JU5 A;  1F2E A;  2IFQ A;  3IAS 2;  9GSS A;  2XBI A;  4N10 A;  5ECL B;  4MAB A;  1PKW A;  1FOV A;  5G5E A;  2O85 A;  1EV9 A;  3I69 A;  1Q98 A;  2HZF A;  1XOA A;  3VPQ A;  1LJR A;  4GST A;  1XVW A;  3GUR A;  1TRS A;  4Q5F A;  1WIK A;  4MF7 A;  3KJY A;  5A4U A;  3GKX A;  1ZMA A;  3TKS A;  2H1G A;  3DD3 A;  4IP1 A;  4ZBD A;  5AIX A;  3QPM A;  4IVF A;  6GSU A;  3EMX A;  2DSA A;  2V32 A;  1FVK A;  5J41 A;  3P8W A;  3KZQ A;  2YWO A;  3GA4 A;  3EWL A;  6GSX A;  2OE0 A;  4D73 B;  3QCP A;  3HJO A;  2WZ9 A;  3ZRD A;  3VLN A;  3Q18 A;  3DKS A;  2ES7 A;  2RM6 A;  3N9J A;  1B48 A;  2K8S A;  3CYN A;  3F3Q A;  5IMA A;  5IO2 A;  3BOA A;  3DRN A;  4DSR A;  2OBI A;  3G9B A;  3RDW A;  4K9Z A;  5DAL B;  5L71 A;  1G6W A;  4BWS A;  5DVB A;  5IPH A;  2N5B A;  4IQ1 A;  1XBS A;  3HJM A;  1CQH A;  2XPE A;  3UEM A;  3WGX A;  3TKQ A;  4NWY A;  2VD1 A;  1SD8 A;  2M72 A;  3CRU A;  2JAD A;  3GNJ A;  2VL3 A;  1HNA A;  3GMF A;  1XW9 A;  3VWV A;  1SL1 B;  5DJM A;  1GL8 A;  2QC7 A;  1H4O A;  4DEJ A;  1T3B A;  4HEA 2;  3BBY A;  3DYR A;  3F3R A;  2RII A;  3TGZ A;  2H30 A;  3LJR A;  2IL3 A;  1V2A A;  1M9B A;  1XWC A;  2GSQ A;  1OC9 B;  3D4M A;  2JU5 A;  1A23 A;  2JSZ A;  5G1L A;  3FZ4 A;  2TIR A;  3GRX A;  2X8G A;  2H1A A;  3ISO A;  2VCT A;  1QUW A;  2HI7 A;  2V41 A;  4EDZ A;  3CRT A;  1GNW A;  1GSS A;  2GT5 A;  2DIZ A;  4Z7X A;  3IAM 2;  1F3A A;  5DAK B;  1TRV A;  1NSW A;  3D0Z A;  4YH2 A;  4ZL8 A;  1HQO A;  2YWI A;  5D73 A;  1HNC A;  1JLV A;  1JZO A;  17GS A;  1A2M A;  4PX1 A;  1LU4 A;  2HNL A;  5DCH A;  5AIV A;  1SYX A;  1JFU A;  4AGS A;  1GTI A;  2LNS A;  2LV3 A;  1V9W A;  1WE0 A;  2YV7 A;  4MH3 A;  4X0X A;  5CRD A;  3Q19 A;  3NOF A;  1ST9 A;  5LD0 A;  1FHE A;  3KMO A;  3TJG A;  3APQ A;  1FAA A;  2OAD A;  2XPD A;  3KP9 A;  4GCI A;  1ABA A;  1RQM A;  2P0G A;  2IMI A;  4IW9 A;  3ZZX A;  3J7Y k;  4TW5 A;  2LJK A;  4N0Z A;  2VCV A;  5DBQ A;  2NTO A;  3D4T A;  3W8J A;  2B7J A;  2H72 A;  4OO4 A;  4XIH A;  1ERW A;  1AW9 A;  2IN3 A;  1B4Q A;  4PQ1 A;  2B3S A;  3G7I A;  1BG5 A;  1XWG A;  5HFI A;  1T1V A;  6GSS A;  3GX8 A;  5J3R A;  3I43 A;  5J4U A;  3M3M A;  2BTO T;  2VLV A;  1T4Z A;  4MDC A;  3KM6 A;  1KBN A;  5LNK e;  4IP6 A;  3DXB A;  3MSZ A;  2LS5 A;  5JWO B;  1NHO A;  1UN2 A;  1YKC A;  4MLY A;  4HJ2 A;  3FEU A;  1TOF A;  4L0W A;  3GH9 A;  1YKA A;  3ERG A;  3HDC A;  2GTU A;  4PUF C;  3UL3 A;  2YJ7 A;  4DSS B;  4PUA A;  4RUV A;  2LJA A;  3UVT A;  4WBR D;  3KTL A;  2JZS A;  5FHI A;  2GQM A;  4PNG A;  1N8J A;  1Y6E A;  5DCG A;  2FGX A;  2CX3 A;  4H86 A;  1SL0 B;  4K7N A;  2A2S A;  1JZD A;  1T4Y A;  1ZL9 A;  2YPM A;  3WD6 A;  2H1D A;  1T00 A;  5GST A;  2HRN A;  5HR1 A;  3HCZ A;  2C8U A;  5EY6 A;  4IS0 A;  2AYT A;  1T8E B;  2DJJ A;  2DIY A;  3HY2 A;  5G31 A;  5FWG A;  3GKK A;  2DJ2 A;  2GZP A;  2LJR A;  4AF2 A;  1GSY A;  2H74 A;  4OD7 A;  1A0F A;  3C1S A;  2IMK A;  4TR3 A;  1OVN A;  4J57 E;  3RAZ A;  1X9M B;  2H19 A;  5A4W A;  2XC2 A;  4I5Q A;  10GS A;  3UBL A;  1MD4 A;  3ZMK A;  1SK0 A;  3KP8 A;  1M2B A;  3Q6O A;  3DVX A;  5DAK A;  4OCE A;  3KEB A;  4OWY A;  3LSZ A;  5FT3 A;  3ZYW A;  3FR3 A;  3CSI A;  4ZIJ A;  5AN1 A;  1TKD B;  4Q5Q A;  5CRE A;  3WGD A;  5HR3 A;  4NXI A;  1U88 A;  4KE3 A;  5IMD A;  3L9V A;  2OE3 A;  3GHA A;  4EUY A;  3BCK A;  3KMN A;  1QK8 A;  2DMM A;  2LRC A;  2VCX A;  1F3B A;  3MWH A;  3IK7 A;  4YQV A;  1ZZY A;  4BVY A;  1GH2 A;  3GIX A;  1ZYQ B;  2DJ0 A;  2O7K A;  3P90 A;  3FKF A;  2M80 A;  4KDU A;  1XFL A;  4K0G A;  1X9S B;  1Z7R A;  4JR6 A;  4P3Y B;  2I1U A;  22GS A;  1GUM A;  2PVO C;  3N5O A;  2LNT A;  3JCM L;  3ERW A;  2MMZ A;  4ZBB A;  1K0O A;  3HXS A;  1WPI A;  1GUH A;  4LL1 B;  4EDY A;  4BVX A;  1TJD A;  4L8E A;  1U3I A;  5EPF A;  2C0G A;  2I4A A;  4IN0 A;  2KP1 A;  3DVW A;  2WCI A;  1EV4 A;  2RM5 A;  4KSO A;  3FHK A;  5JCG A;  4PXO A;  3TKS E;  1X5D A;  4YAP A;  2FWE A;  1AIU A;  4DSS A;  2FY6 A;  1BAY A;  3RBT A;  1DUG A;  4GTU A;  1O8X A;  3R2Q A;  1A8Y A;  5G30 A;  4ILF A;  3F4T A;  3ZVJ D;  3LQ7 A;  3F8U A;  4AJ6 A;  2N5A A;  1DE2 A;  3TRP A;  3UBK A;  4I8B A;  1OE7 A;  4WR5 A;  1PL2 A;  4F0B A;  1BJX A;  1B9X C;  1QGV A;  2VL9 A;  4XRA A;  2I9H A;  11GS A;  1YEX A;  5ABR A;  1FVJ A;  1ZYE A;  2EIQ A;  5JWR B;  2J23 A;  1QQ2 A;  2K18 A;  1XW5 A;  4GQC A;  4E8E A;  3DEX A;  4BWQ A;  3F6F A;  1ML6 A;  3HVV A;  2KP2 A;  1EOH A;  2F51 A;  4FO5 A;  1PKZ A;  3IK9 A;  5HR0 A;  5HFK A;  3IXR A;  4MP4 A;  4XS4 A;  1GSE A;  5G2Z A;  2GQL A;  3ZIV A;  2L4C A;  3QR6 A;  2HT9 A;  5F07 A;  1YQ1 A;  2YWN A;  1WRY A;  3EMP A;  2VCQ A;  4MJA A;  3GL5 A;  3ME7 A;  1DBY A;  3C71 A;  4HS1 A;  2C4J A;  1J0F A;  1GRX A;  1MTC A;  3WYW A;  1PN9 A;  20GS A;  3Q74 A;  5D93 A;  1ERV A;  1K0D A;  4ML6 A;  4O7H A;  3K8N A;  3ZLP A;  5IMZ A;  4OMV A;  4V2N A;  3KCM A;  3TOT A;  2B5X A;  2FA4 A;  1UC7 A;  3H4K A;  3IC4 A;  2MYG A;  1QMV A;  4NPB A;  4GXZ A;  2YOI A;  4N30 A;  4GQF A;  1O8W A;  2R3X A;  3TJF A;  5C00 A;  2A2R A;  1IYH A;  4MPG A;  3C8E A;  2CT6 A;  2YWM A;  4HI7 A;  1TW9 A;  1GTU A;  1O73 A;  1A2J A;  4ZXG A;  2HSY A;  2PGT A;  1EP7 A;  1HYU A;  5ELG A;  3VWX A;  1TRU A;  3D6I A;  3RPN A;  2AJQ B;  2VLU A;  3LXZ A;  4JED A;  4DSQ A;  5IM9 A;  4AJ7 A;  3APO A;  4NHW A;  2HLS A;  2E0Q A;  4ZB8 A;  5ECK B;  2JZT A;  3PH9 A;  1O6J A;  5CRG A;  4MK3 A;  2IMF A;  5IMV A;  2VM2 A;  4LMV A;  3UAP A;  3EYT A;  5KN3 A;  2HZE B;  1S3A A;  6GST A;  5ECM B;  5JWQ B;  4QL9 A;  4RQR A;  4ZB6 A;  2N5F A;  4PQH A;  3LYK A;  3FZ5 A;  5EL8 A;  1TTZ A;  5ELA A;  3P7X A;  1JHB A;  4O92 A;  4JZQ A;  4BL7 A;  5ECO B;  4ACS A;  3CTG A;  2VD0 A;  4WXT A;  2GLR A;  1KNG A;  1K0M A;  3IR4 A;  5ID2 B;  2GSR A;  4PQI A;  5ENU A;  3M9K A;  3EC3 A;  3I6A A;  1I9D A;  3M1G A;  3QDN A;  2FNO A;  4KND A;  4MF6 A;  4EF0 A;  1XZO A;  2PUK C;  2YNX A;  2VO4 A;  2F9S A;  2CAI A;  3A2X A;  1V40 A;  1GSU A;  3TRX A;  1M9A A;  1OC8 A;  2FWG A;  6GSW A;  4ZIL A;  1VGL A;  4V2L A;  4HZ4 A;  2JSY A;  4POB A;  8GSS A;  1TU7 A;  2CVK A;  3FW2 A;  1WP0 A;  2RUE A;  2WB9 A;  1YF1 A;  4HQS A;  2IIY A;  3LGC A;  2H6Z A;  3KD0 A;  1EOG A;  3M0F A;  3TJK A;  2LST A;  2VL2 C;  2H0H A;  2VOC A;  3NZN A;  2I81 A;  4MMM A;  1BED A;  2P5Q A;  2YP6 A;  2O89 A;  2B1K A;  5G5F A;  4YQU A;  1XWB A;  3QAV A;  2WRT A;  5HQP A;  1B9Y C;  4Q5R A;  1W4V A;  5B7C A;  2P5R A;  5A5K A;  1PMT A;  5J9B A;  3ZFB A;  4WET A;  4MH2 A;  4O5R A;  4E8H A;  1T7P B;  2VCZ A;  2PMT A;  1FB6 A;  4MCU A;  1CQG A;  4K7I A;  2OE1 A;  3WT1 A;  2C80 A;  3TDG A;  2L57 A;  4CW9 A;  1XXU A;  2PWJ A;  3ZRE A;  2HXK A;  4TOP A;  3GTU B;  4V1A p;  3TKR A;  2CAQ A;  2H70 A;  1SYR A;  1S3C A;  3ZML A;  1W89 A;  1M0U A;  5F05 A;  3KH9 A;  2OBK A;  1AC1 A;  4TXO B;  4EXJ A;  4TVE A;  3HA9 A;  3HD5 A;  1K0N A;  2C3T A;  5A4V A;  3U6V A;  4FYC A;  3ZTL A;  4D73 A;  4J2F A;  3MNG A;  4YQM A;  1TRW A;  1PL1 A;  19GS A;  4TRX A;  1PQN A;  1NHY A;  3GKN A;  3H93 A;  7GSS A;  5IQY A;  4ECC A;  2DJ1 A;  2X8H A;  2B5E A;  5DAL A;  4IKH A;  2MBS A;  3BCI A;  5B8B A;  1O81 A;  5CP1 A;  1K3O A;  3HZ4 A;  3KH7 A;  3SBC A;  3GST A;  1SJZ A;  3QAG A;  3O3T A;  5C04 A;  1EZK A;  5B6M A;  2V6K A;  3DML A;  3PGT A;  2I3Y A;  4F9Z A;  1Q4J A;  5HR2 A;  4EKZ A;  2B7K A;  2E2M A;  3TJB A;  4KUN A;  5KEJ A;  3SWL A;  3D21 A;  4WBJ A;  3TB2 A;  3FZA A;  1Z6M A;  2MMA A;  1G6Y A;  1Z7P A;  3KIJ A;  16GS A;  5D9W A;  2M46 A;  4KGI A;  1AQW A;  1B4P A;  1OC9 A;  2YN1 A;  3QFB C;  2DLX A;  1R5P A;  4X1U A;  2H1B A;  4NAX A;  5JCW A;  1I5G A;  3CMI A;  4V1A g;  4RI7 A;  3ZIJ A;  3CTF A;  1VRS D;  1KEB A;  3RHB A;  2YAN A;  2CVD A;  1IYI A;  4TKY A;  2TRC P;  2G2Q A;  5COH A;  1U6T A;  5KN1 A;  3KTB A;  4LA1 A;  3A5W A;  1U3A A;  1N2A A;  2REM A;  1TK5 B;  2Z9S A;  3QOU A;  4BA7 A;  1GLP A;  2IFQ B;  4MF5 A;  2IME A;  5E4W A;  1PX6 A; 
#chains in the Genus database with same CATH topology
 2PVQ A;  3FYG A;  5D9T A;  4G0I A;  4G2E A;  1TU8 A;  1EWX A;  4GF0 A;  2OJL A;  2YZH A;  5AIS A;  2F8A A;  4TR0 A;  3IHQ A;  1M99 A;  1R4W A;  4K5S A;  3F4R A;  2HRA A;  4KA0 A;  1FOH A;  2IWT A;  4IJ3 A;  6GSY A;  4MZB A;  1G7O A;  4I2U A;  3W6G A;  2CX4 A;  2GDR A;  3A2W A;  3WT2 A;  2VM1 A;  1AAZ A;  4HOJ A;  1PX7 A;  3OR5 A;  3RHC A;  4ISD A;  1ILO A;  2FWF A;  2YZU A;  1UA5 A;  5B6N A;  4V2M A;  4DVC A;  2QSI A;  5H5S A;  14GS A;  3E9J B;  1V58 A;  1Z5Y E;  3EVI A;  1VF1 A;  3LXT A;  4K8M A;  2XHF A;  2R4V A;  3G7J A;  1YZX A;  1XVQ A;  3GUS A;  3QAW A;  5ECP B;  1Z9H A;  2X99 A;  12GS A;  2GGT A;  2AUV A;  1DE1 A;  4O5U A;  2A4V A;  2H75 A;  1MD3 A;  4ECJ A;  3H1N A;  4OFN A;  4X4J A;  3MIX A;  3GFK A;  2AAW A;  1WJK A;  4IHU A;  1XPV A;  4EC0 A;  2K6V A;  4IJI A;  4POL A;  1MEK A;  3L78 A;  2C3N A;  4MPF A;  3UJ1 A;  3EU3 A;  2HYX A;  1ON4 A;  3A3T A;  3MDK A;  1R26 A;  1E2Y A;  2EIO A;  2ZNM A;  4JBB A;  4OCF A;  2HRF A;  1HNB A;  4ECI A;  3GKM A;  2DC5 A;  2OAC A;  1EGO A;  1GTA A;  1M3I A;  3C7M A;  4LLR A;  1ZYP A;  3UIW A;  5GSS A;  1GNE A;  3C73 A;  2E7P A;  3TKS C;  1M7T A;  4L5L A;  1K3L A;  2EIR A;  2LKU A;  5ECN B;  4WEY A;  3C1R A;  4BIK A;  1G0T A;  3LYP A;  2PBJ A;  4FYB A;  2H66 A;  3CSJ A;  4KW6 A;  2HSH A;  1EEM A;  3F0I A;  1SU9 A;  1YY7 A;  1GUK A;  4J56 E;  2CVB A;  5EVO A;  3I9V 2;  2OKA A;  3EIN A;  1FW1 A;  5CYY A;  1RK4 A;  2LUS A;  4RQX A;  3LG6 A;  1A24 A;  2DJK A;  2A4H A;  2FCH A;  3IRA A;  4WF5 A;  5CNW A;  3RPP A;  2BMX A;  2ZUP A;  2YCD A;  4L0U A;  2CV4 A;  3HKR A;  2GSS A;  1O85 A;  3FK8 A;  4HUA A;  3L9S A;  4IQA A;  2O8V B;  2CA8 A;  3AY8 A;  3GL3 A;  3UVH A;  4F03 A;  1GLQ A;  2VIM A;  1NM3 A;  2IPA A;  4NV5 A;  4AJ8 A;  4I2T A;  3CXG A;  2H01 A;  3GSS A;  2J9H A;  1LBK A;  2PU9 C;  2H6X A;  2KLX A;  4GLT A;  1C72 A;  4GSS A;  18GS A;  1YF0 A;  2H8L A;  3IBH A;  3IOS A;  1AXD A;  2PER A;  4JE1 A;  3TRQ A;  5ECS A;  3O6T A;  3VWU A;  2NPB A;  4KSM A;  1JLW A;  3DIE A;  2LTK A;  5ECQ B;  4MZW A;  1A0R P;  2WDU A;  3S9F A;  4IGJ A;  2B1L A;  4NMU A;  3VPT A;  2GS3 A;  6GSV A;  1RW1 A;  1Y25 A;  2H0I A;  1BQ7 A;  1XG8 A;  3LWA A;  4Z2U A;  2GST A;  5LCZ A;  4XTS A;  3F6D A;  1XW6 A;  1J08 A;  4KF9 A;  2H0G A;  3MAK A;  3HYP A;  1MDI A;  2VLT A;  1UVZ A;  1K0C A;  1AQX A;  1GTB A;  3VUR A;  4XHM A;  3H8Q A;  1TDI A;  3KGK A;  5IOW A;  3IDV A;  1X5E A;  2VCW A;  5E59 A;  5BMU A;  1R7H A;  3ED3 A;  4FIW A;  1SK2 A;  3F4S A;  1OC3 A;  1TK8 B;  2F8F A;  2MZC A;  3UOM A;  1B8X A;  3HVX A;  2NVL A;  4KAE A;  2GT6 A;  1TI3 A;  3VI5 A;  1XOB A;  1BYE A;  5ECR B;  4L5O A;  2ON7 A;  3L0H A;  1EP8 A;  1U87 A;  1XWK A;  2R2J A;  4MA9 A;  2H76 A;  1GWC A;  4PNF A;  2O87 A;  4OFM A;  5KN2 A;  4G0L A;  1OE8 A;  2ZCT A;  1PFO A;  2WFC A;  4LL4 B;  4WKW A;  3BD2 A;  1FB0 A;  1EGR A;  4ZL9 A;  3BJ5 A;  1KTE A;  4NHZ A;  3GN3 A;  1E6B A;  1XIY A;  1PA3 A;  1GUL A;  3TOU A;  1USB A;  1THO A;  5GAN D;  2AB6 A;  4EIQ A;  4MNN A;  4N0V A;  3ERF A;  5JCU A;  1Z6N A;  4HDE A;  4GSN A;  2NDO A;  4GRF A;  5CRH A;  3TKP A;  1ZCP A;  1QFN A;  5H5Q A;  1SD9 A;  4FYU A;  1PSQ A;  5IMF A;  2L6D A;  2GQK A;  1SJI A;  3E3E A;  3ZFL A;  5IPG A;  2BJX A;  3LFL A;  2KUC A;  2RLI A;  2OA7 A;  4BVY B;  3F63 A;  1DSB A;  5IO0 A;  3EE2 A;  2R6K A;  3DWV A;  1F9M A;  1ZOF A;  2GZZ A;  1TI1 A;  4ML1 A;  1TXX A;  4OFT A;  2LRN A;  1X0R A;  4QL7 A;  1O7U A;  4WF4 A;  4KH7 A;  4K0N A;  1A8L A;  2FA8 A;  4JRR A;  4K1F A;  1GSD A;  2VL2 A;  2GZY A;  4I97 A;  2B5Y A;  3GYK A;  4TXV A;  2AHE A;  4POK A;  3D5J A;  3A5I A;  3ZVJ A;  1Z3E A;  2R37 A;  2C0F A;  1HD2 A;  1WOU A;  1K0A A;  4K7O A;  1H75 A;  2L5O A;  1K3Y A;  4ECB A;  3VWW A;  4O32 A;  5D9V A;  1VF4 A;  1ERU A;  2FD3 A;  3M8N A;  4PGT A;  2V2G A;  4BVX B;  4HQZ A;  1R5A A;  3HJP A;  3O76 A;  1FO5 A;  2H73 A;  2CZ3 A;  5D9X A;  4YKF A;  5CAX A;  2MBT A;  1PRX A;  1S3D A;  3UAR A;  1URM A;  2IJY A;  3KXO A;  4G9H A;  1GSQ A;  2R0G A;  1WMJ A;  2JL4 A;  3FR9 A;  5HFG A;  2HZE A;  2JZR A;  3FR6 A;  1THX A;  1EEJ A;  5CRW A;  1BX9 A;  2P31 A;  1OKD A;  3GX0 A;  1PGT A;  2ALB A;  5F8B A;  4MJC A;  2DBC A;  3GV1 A;  1PN0 A;  4TR1 B;  1AUC A;  3LEF A;  5IIZ A;  5INY A;  4MJB A;  5D96 A;  4XRD A;  3TCO A;  1V57 A;  3IE3 A;  1K0B A;  5ID2 A;  4F82 A;  3FZ9 A;  4HZ2 A;  1QXH A;  3D22 A;  2LEG A;  2NBS A;  3EU4 A;  2L6C A;  2YV9 A;  4HU7 A;  1XCC A;  5CO3 A;  2VAF A;  1MDJ A;  4HU9 A;  3P2A A;  4XCS A;  2HE3 A;  1A2L A;  2AV4 A;  4EVM A;  3PR8 A;  3UMA A;  1SK1 A;  4K2D A;  4IBP A;  1YDK A;  3VFI A;  1SKR B;  1OYJ A;  2C0D A;  3FY7 A;  2DJ3 A;  5DJL A;  2C0E A;  5D8I A;  2XBQ A;  1ERT A;  4KCA A;  2QKE A;  4FH8 A;  3CSH A;  4XS4 B;  2WUL A;  4XS1 A;  2V1M A;  5GZZ B;  3V1W A;  4XS6 A;  2X8C A;  4I6X A;  1MDK A;  3IV4 A;  3F9U A;  1SEN A;  2E2G A;  5IMC A;  3IC8 A;  2K8V A;  2MMN A;  2JAC A;  2EC4 A;  3ZIT A;  5J9C A;  4ZBA A;  2KOK A;  2WJU A;  3QMX A;  5B8A A;  3L4N A;  2CQ9 A;  3APS A;  3HHV A;  2LRT A;  2C1Y A;  1OKT A;  2FWH A;  3NIV A;  3LOR A;  5ECH B;  2A2P A;  5IOX A;  1PD2 1;  3GH6 A;  5ECI B;  3TUE A;  5DDL A;  4POM A;  1YEP A;  2X64 A;  2DML A;  2MMO A;  1SL2 B;  2FLS A;  2L5L A;  5G1K A;  1OAZ A;  1J9B A;  3GTU A;  1AQV A;  3HVS A;  2H6Y A;  3IPZ A;  3ME8 A;  5GAP D;  1TP9 A;  4TXO A;  2IMD A;  2LQO A;  1TK0 B;  3L9U A;  2WGR A;  4MJE A;  2QGV A;  1X5C A;  4MZC A;  1JZW A;  4HJM A;  3WGE A;  4RI6 A;  2FUG 2;  1SJ6 A;  3H79 A;  1M2A A;  4X43 A;  4NV2 A;  3EUR A;  4JR4 A;  4G19 A;  2VUP A;  3CBU A;  4KCE A;  4Z2R A;  4EO3 A;  3QFA C;  1X9W B;  1SKW B;  3G7Y A;  5DQY A;  2L59 A;  4WR4 A;  4ULX A;  1VF3 A;  4TR4 A;  4F2I A;  1F37 A;  3HZ8 A;  3M9J A;  4LMW A;  4F0C A;  4YAV A;  2F3M A;  3ZL5 A;  2C3Q A;  1WWJ A;  3FRC A;  4KDX A;  1G7E A;  3A2V A;  4EE0 A;  2HFD A;  4CHS A;  4BL7 B;  2V6O A;  4ZB9 A;  3US3 A;  2R5G A;  4TN8 A;  3W8S A;  3PIN A;  4TR1 A;  4KX4 A;  1YJ6 A;  1GSF A;  4BPY A;  1F6M C;  2PPT A;  4KB3 A;  5H5R A;  2PN8 A;  1GP1 A;  1V98 A;  4ZL7 A;  3DGQ A;  4CY8 A;  1M2D A;  3IA1 A;  5F06 A;  2G0F A;  2K9F A;  4GWR A;  5J5N A;  1ZYN A;  1VF2 A;  4QQ7 A;  1NW2 A;  1ZGN A;  2ON5 A;  4KDY A;  2D2Z A;  2LQQ A;  4K5R A;  3U5R E;  2B6M A;  3VI7 A;  3VK9 A;  4G10 A;  3J7Y b;  4N11 A;  4EL1 A;  5DQS A;  2KHP A;  5KN0 A;  3QD9 A;  5F0G A;  4IEL A;  1ACV A;  2FHE A;  4OO5 A;  4ID0 A;  13GS A;  4Q5N A;  1JZR A;  3E0U A;  5AGY A;  2RUF A;  3TJJ A;  1XWA A;  1FG4 A;  2WS2 A;  4PUR A;  2L4Q A;  1SKS B;  4CDO A;  2YJH A;  2TRX A;  2H71 A;  2GVP A;  2CZ2 A;  4K6X A;  4JU5 A;  1F2E A;  2IFQ A;  3IAS 2;  9GSS A;  2XBI A;  4N10 A;  5ECL B;  4MAB A;  4K2X A;  1PKW A;  1FOV A;  5G5E A;  2O85 A;  1EV9 A;  3I69 A;  1Q98 A;  2HZF A;  1XOA A;  3VPQ A;  1LJR A;  4GST A;  1XVW A;  3GUR A;  1TRS A;  4Q5F A;  1WIK A;  3MYD A;  4MF7 A;  3KJY A;  5A4U A;  3GKX A;  1ZMA A;  3TKS A;  2H1G A;  3DD3 A;  1M3J A;  4IP1 A;  4ZBD A;  5AIX A;  3QPM A;  4IVF A;  4FQU A;  6GSU A;  3EMX A;  2DSA A;  2V32 A;  1FVK A;  5J41 A;  3P8W A;  3KZQ A;  2YWO A;  3GA4 A;  3EWL A;  6GSX A;  2OE0 A;  4D73 B;  3QCP A;  3HJO A;  2WZ9 A;  3ZRD A;  3VLN A;  3Q18 A;  3DKS A;  2ES7 A;  2RM6 A;  3N9J A;  1B48 A;  2K8S A;  3CYN A;  3F3Q A;  5IMA A;  5IO2 A;  3BOA A;  3DRN A;  4DSR A;  2OBI A;  3G9B A;  3RDW A;  4K9Z A;  5DAL B;  5L71 A;  1G6W A;  4BWS A;  5DVB A;  5IPH A;  2N5B A;  4IQ1 A;  1XBS A;  3HJM A;  1CQH A;  2XPE A;  3UEM A;  3WGX A;  3TKQ A;  4NWY A;  2VD1 A;  1SD8 A;  2M72 A;  3CRU A;  2JAD A;  3GNJ A;  2VL3 A;  1HNA A;  3GMF A;  1XW9 A;  3VWV A;  1SL1 B;  5DJM A;  1GL8 A;  2QC7 A;  2QA2 A;  1H4O A;  4DEJ A;  1T3B A;  4HEA 2;  3BBY A;  4CY6 A;  3DYR A;  3F3R A;  2RII A;  3TGZ A;  5KOX A;  2H30 A;  3LJR A;  2IL3 A;  1V2A A;  1M9B A;  1XWC A;  2GSQ A;  1OC9 B;  3D4M A;  2JU5 A;  1A23 A;  2JSZ A;  5G1L A;  3FZ4 A;  2DKI A;  2TIR A;  3GRX A;  2X8G A;  2H1A A;  3ISO A;  2VCT A;  1QUW A;  2HI7 A;  2V41 A;  4EDZ A;  3CRT A;  1GNW A;  1GSS A;  2GT5 A;  2DIZ A;  4Z7X A;  2QA1 A;  3IAM 2;  1F3A A;  5DAK B;  1TRV A;  1NSW A;  3D0Z A;  4YH2 A;  4ZL8 A;  1HQO A;  2YWI A;  5D73 A;  1HNC A;  1JLV A;  1JZO A;  17GS A;  1A2M A;  4PX1 A;  1LU4 A;  2HNL A;  5DCH A;  5AIV A;  1SYX A;  1JFU A;  4AGS A;  1GTI A;  2LNS A;  2LV3 A;  1V9W A;  1WE0 A;  2YV7 A;  4MH3 A;  4X0X A;  5CRD A;  3Q19 A;  3NOF A;  1ST9 A;  5LD0 A;  1FHE A;  3KMO A;  3TJG A;  3APQ A;  1FAA A;  2OAD A;  2XPD A;  3KP9 A;  4GCI A;  1ABA A;  1RQM A;  2DKH A;  2P0G A;  2IMI A;  4IW9 A;  3ZZX A;  3J7Y k;  4TW5 A;  2LJK A;  4N0Z A;  2VCV A;  5DBQ A;  2NTO A;  3D4T A;  3W8J A;  2B7J A;  2H72 A;  4OO4 A;  4XIH A;  1ERW A;  1AW9 A;  2IN3 A;  1B4Q A;  4A5P A;  4PQ1 A;  2B3S A;  3G7I A;  1BG5 A;  1XWG A;  4O5Q A;  5HFI A;  1T1V A;  6GSS A;  3GX8 A;  5J3R A;  3I43 A;  5J4U A;  3M3M A;  2BTO T;  2VLV A;  1T4Z A;  4MDC A;  3KM6 A;  1KBN A;  5LNK e;  4IP6 A;  4USS A;  3DXB A;  3MSZ A;  2LS5 A;  5JWO B;  1NHO A;  1UN2 A;  1YKC A;  4MLY A;  4HJ2 A;  3FEU A;  1TOF A;  4L0W A;  3GH9 A;  1YKA A;  3ERG A;  3HDC A;  2GTU A;  4PUF C;  3UL3 A;  2YJ7 A;  4DSS B;  4PUA A;  4RUV A;  2LJA A;  3UVT A;  4WBR D;  3KTL A;  2JZS A;  5FHI A;  2GQM A;  4PNG A;  1N8J A;  1Y6E A;  5DCG A;  2FGX A;  2CX3 A;  4H86 A;  1SL0 B;  4K7N A;  2A2S A;  1JZD A;  3LW9 A;  1T4Y A;  1ZL9 A;  2YPM A;  3WD6 A;  2H1D A;  1T00 A;  5GST A;  2HRN A;  5HR1 A;  3HCZ A;  2C8U A;  5EY6 A;  4IS0 A;  2AYT A;  1T8E B;  2DJJ A;  2DIY A;  3HY2 A;  5G31 A;  5FWG A;  3GKK A;  2DJ2 A;  2R0P A;  2GZP A;  2LJR A;  4AF2 A;  2X49 A;  1GSY A;  2H74 A;  4OD7 A;  1A0F A;  3C1S A;  2IMK A;  4TR3 A;  1OVN A;  4J57 E;  3RAZ A;  1X9M B;  2H19 A;  5A4W A;  2XC2 A;  4I5Q A;  10GS A;  3UBL A;  1MD4 A;  3ZMK A;  1SK0 A;  3KP8 A;  1M2B A;  3Q6O A;  3DVX A;  5DAK A;  4OCE A;  3KEB A;  4OWY A;  3LSZ A;  5FT3 A;  3ZYW A;  3FR3 A;  3CSI A;  4ZIJ A;  5AN1 A;  1TKD B;  4Q5Q A;  5CRE A;  3WGD A;  5HR3 A;  4NXI A;  1U88 A;  4KE3 A;  5IMD A;  3L9V A;  2OE3 A;  3GHA A;  4EUY A;  3BCK A;  3KMN A;  1QK8 A;  2DMM A;  2LRC A;  2VCX A;  1F3B A;  3MWH A;  3IK7 A;  4YQV A;  1ZZY A;  4BVY A;  1GH2 A;  3GIX A;  1ZYQ B;  2DJ0 A;  2O7K A;  3P90 A;  3FKF A;  2M80 A;  4KDU A;  1XFL A;  4K0G A;  1X9S B;  1Z7R A;  4JR6 A;  4P3Y B;  2I1U A;  22GS A;  1GUM A;  2PVO C;  3N5O A;  2LNT A;  3JCM L;  5BRT A;  3ERW A;  2MMZ A;  4ZBB A;  1K0O A;  3HXS A;  1WPI A;  1GUH A;  4LL1 B;  4EDY A;  4BVX A;  1TJD A;  4L8E A;  1U3I A;  5EPF A;  2C0G A;  2I4A A;  4IN0 A;  2KP1 A;  3DVW A;  2WCI A;  1EV4 A;  2RM5 A;  4KSO A;  3FHK A;  5JCG A;  4PXO A;  3TKS E;  3IHG A;  1X5D A;  4YAP A;  2FWE A;  3HVN A;  1AIU A;  4DSS A;  2FY6 A;  1BAY A;  3RBT A;  1DUG A;  4GTU A;  1O8X A;  3R2Q A;  1S3R A;  1A8Y A;  2X4A A;  5G30 A;  4ILF A;  3F4T A;  3ZVJ D;  3LQ7 A;  3F8U A;  4AJ6 A;  2N5A A;  1DE2 A;  3TRP A;  3UBK A;  4I8B A;  1OE7 A;  4WR5 A;  1PL2 A;  4F0B A;  1BJX A;  1B9X C;  1QGV A;  2VL9 A;  4XRA A;  2I9H A;  11GS A;  1YEX A;  5ABR A;  1FVJ A;  1ZYE A;  2EIQ A;  5JWR B;  2J23 A;  1QQ2 A;  2K18 A;  1XW5 A;  4GQC A;  4E8E A;  3DEX A;  4BWQ A;  3F6F A;  1ML6 A;  3HVV A;  2KP2 A;  4Z2T A;  1EOH A;  2F51 A;  4FO5 A;  1PKZ A;  3IK9 A;  5HR0 A;  5HFK A;  3IXR A;  4MP4 A;  4XS4 A;  1GSE A;  5G2Z A;  2GQL A;  3ZIV A;  2L4C A;  3QR6 A;  2HT9 A;  5F07 A;  1YQ1 A;  2YWN A;  1WRY A;  2R0C A;  3EMP A;  2VCQ A;  4MJA A;  3GL5 A;  3ME7 A;  1DBY A;  3C71 A;  4HS1 A;  2C4J A;  1J0F A;  1GRX A;  1MTC A;  3WYW A;  1PN9 A;  20GS A;  3Q74 A;  5D93 A;  1ERV A;  1K0D A;  4ML6 A;  4O7H A;  3K8N A;  3ZLP A;  5IMZ A;  4OMV A;  4V2N A;  3KCM A;  3TOT A;  2B5X A;  2FA4 A;  1UC7 A;  3H4K A;  3IC4 A;  2MYG A;  1QMV A;  4NPB A;  4GXZ A;  2YOI A;  3R3E A;  4GQF A;  1O8W A;  4N30 A;  2R3X A;  3TJF A;  5C00 A;  2A2R A;  1IYH A;  4MPG A;  3C8E A;  2CT6 A;  2YWM A;  4HI7 A;  1TW9 A;  1GTU A;  1O73 A;  1A2J A;  4ZXG A;  2HSY A;  2PGT A;  1EP7 A;  1HYU A;  5ELG A;  3VWX A;  1TRU A;  2UZ8 A;  4EIP A;  3D6I A;  3RPN A;  2AJQ B;  2VLU A;  3LXZ A;  4JED A;  4DSQ A;  5IM9 A;  4AJ7 A;  3APO A;  4NHW A;  2HLS A;  2E0Q A;  4ZB8 A;  5ECK B;  4G0K A;  2JZT A;  3PH9 A;  1O6J A;  5CRG A;  4MK3 A;  2IMF A;  5IMV A;  2VM2 A;  4LMV A;  3UAP A;  3EYT A;  5KN3 A;  2HZE B;  1S3A A;  4ICY A;  6GST A;  5ECM B;  5JWQ B;  4QL9 A;  4RQR A;  4ZB6 A;  2N5F A;  4PQH A;  3LYK A;  3FZ5 A;  5EL8 A;  1TTZ A;  5ELA A;  3P7X A;  1JHB A;  4O92 A;  4JZQ A;  4BL7 A;  5ECO B;  4ACS A;  3CTG A;  2VD0 A;  4WXT A;  2GLR A;  1KNG A;  1K0M A;  2HRK A;  3IR4 A;  5ID2 B;  2GSR A;  4PQI A;  5ENU A;  3M9K A;  3EC3 A;  3I6A A;  1I9D A;  3M1G A;  3QDN A;  2FNO A;  4KND A;  4MF6 A;  4EF0 A;  1XZO A;  2PUK C;  2YNX A;  2VO4 A;  2F9S A;  2CAI A;  3A2X A;  1V40 A;  1GSU A;  3TRX A;  1M9A A;  1OC8 A;  2FWG A;  6GSW A;  4ZIL A;  1VGL A;  4V2L A;  4HZ4 A;  5KOW A;  2JSY A;  4POB A;  8GSS A;  1TU7 A;  2CVK A;  3FW2 A;  1WP0 A;  2RUE A;  2WB9 A;  1YF1 A;  4HQS A;  2IIY A;  3LGC A;  3CQF A;  2H6Z A;  3KD0 A;  1EOG A;  3M0F A;  3TJK A;  2LST A;  2VL2 C;  2H0H A;  2VOC A;  3NZN A;  2I81 A;  4MMM A;  1BED A;  2P5Q A;  2YP6 A;  2O89 A;  2B1K A;  5G5F A;  4YQU A;  1XWB A;  3QAV A;  2WRT A;  5HQP A;  1B9Y C;  4Q5R A;  1W4V A;  5B7C A;  2P5R A;  5A5K A;  1PMT A;  5J9B A;  3ZFB A;  4WET A;  4MH2 A;  4O5R A;  4E8H A;  1T7P B;  2VCZ A;  2PMT A;  1FB6 A;  4MCU A;  1CQG A;  4K7I A;  2OE1 A;  3WT1 A;  2C80 A;  3PPU A;  3TDG A;  2L57 A;  4CW9 A;  1XXU A;  2PWJ A;  3ZRE A;  2HXK A;  4TOP A;  3GTU B;  2HSM A;  4V1A p;  3TKR A;  2CAQ A;  2H70 A;  1SYR A;  1S3C A;  3ZML A;  1W89 A;  1M0U A;  5F05 A;  3KH9 A;  2OBK A;  1AC1 A;  3EPT A;  4TXO B;  4EXJ A;  4TVE A;  3HA9 A;  3HD5 A;  1K0N A;  2C3T A;  5A4V A;  3U6V A;  4FYC A;  3ZTL A;  4D73 A;  4J2F A;  3MNG A;  4YQM A;  1TRW A;  1PL1 A;  19GS A;  4TRX A;  1PQN A;  1NHY A;  3GKN A;  3H93 A;  7GSS A;  5IQY A;  4HSC X;  4ECC A;  2DJ1 A;  2X8H A;  2B5E A;  5DAL A;  4IKH A;  2MBS A;  3BCI A;  5B8B A;  1O81 A;  5CP1 A;  1K3O A;  3HZ4 A;  3KH7 A;  3SBC A;  3GST A;  1SJZ A;  3QAG A;  3O3T A;  5C04 A;  1EZK A;  5B6M A;  2V6K A;  3DML A;  3PGT A;  2I3Y A;  4F9Z A;  1Q4J A;  5HR2 A;  4EKZ A;  2B7K A;  2E2M A;  3TJB A;  4KUN A;  5KEJ A;  3SWL A;  3D21 A;  4WBJ A;  3TB2 A;  3FZA A;  1Z6M A;  2MMA A;  1G6Y A;  1Z7P A;  3KIJ A;  16GS A;  5D9W A;  2M46 A;  4KGI A;  1AQW A;  1B4P A;  1OC9 A;  2YN1 A;  3QFB C;  2DLX A;  1R5P A;  4X1U A;  2H1B A;  4NAX A;  5JCW A;  1I5G A;  3CMI A;  4V1A g;  4RI7 A;  3ZIJ A;  3CTF A;  3FMW A;  1VRS D;  1KEB A;  3RHB A;  2YAN A;  2CVD A;  1IYI A;  4TKY A;  2TRC P;  2G2Q A;  5COH A;  4YKG A;  1U6T A;  5KN1 A;  3KTB A;  4LA1 A;  3A5W A;  1U3A A;  1N2A A;  2REM A;  4PTS A;  1TK5 B;  2Z9S A;  3QOU A;  4BA7 A;  1GLP A;  2IFQ B;  4MF5 A;  2IME A;  5E4W A;  1PX6 A; 
#chains in the Genus database with same CATH homology
 2PVQ A;  3FYG A;  5D9T A;  4G0I A;  4G2E A;  1TU8 A;  1EWX A;  4GF0 A;  2OJL A;  2YZH A;  5AIS A;  2F8A A;  4TR0 A;  3IHQ A;  1M99 A;  1R4W A;  4K5S A;  3F4R A;  2HRA A;  4KA0 A;  1FOH A;  2IWT A;  4IJ3 A;  6GSY A;  4MZB A;  1G7O A;  4I2U A;  3W6G A;  2CX4 A;  2GDR A;  3A2W A;  3WT2 A;  2VM1 A;  1AAZ A;  4HOJ A;  1PX7 A;  3OR5 A;  3RHC A;  4ISD A;  1ILO A;  2FWF A;  2YZU A;  1UA5 A;  5B6N A;  4V2M A;  4DVC A;  2QSI A;  5H5S A;  14GS A;  3E9J B;  1V58 A;  1Z5Y E;  3EVI A;  1VF1 A;  3LXT A;  4K8M A;  2XHF A;  2R4V A;  3G7J A;  1YZX A;  1XVQ A;  3GUS A;  3QAW A;  5ECP B;  1Z9H A;  2X99 A;  12GS A;  2GGT A;  2AUV A;  1DE1 A;  4O5U A;  2A4V A;  2H75 A;  1MD3 A;  4ECJ A;  3H1N A;  4OFN A;  4X4J A;  3MIX A;  3GFK A;  2AAW A;  1WJK A;  4IHU A;  1XPV A;  4EC0 A;  2K6V A;  4IJI A;  4POL A;  1MEK A;  3L78 A;  2C3N A;  4MPF A;  3UJ1 A;  3EU3 A;  2HYX A;  1ON4 A;  3A3T A;  3MDK A;  1R26 A;  1E2Y A;  2EIO A;  2ZNM A;  4JBB A;  4OCF A;  2HRF A;  1HNB A;  4ECI A;  3GKM A;  2DC5 A;  2OAC A;  1EGO A;  1GTA A;  3C7M A;  4LLR A;  1ZYP A;  3UIW A;  5GSS A;  1GNE A;  3C73 A;  2E7P A;  3TKS C;  1M7T A;  4L5L A;  1K3L A;  2EIR A;  2LKU A;  5ECN B;  4WEY A;  3C1R A;  1G0T A;  3LYP A;  2PBJ A;  4FYB A;  2H66 A;  3CSJ A;  4KW6 A;  2HSH A;  1EEM A;  3F0I A;  1SU9 A;  1YY7 A;  1GUK A;  4J56 E;  2CVB A;  5EVO A;  3I9V 2;  2OKA A;  3EIN A;  1FW1 A;  5CYY A;  1RK4 A;  2LUS A;  4RQX A;  3LG6 A;  1A24 A;  2DJK A;  2A4H A;  2FCH A;  3IRA A;  4WF5 A;  5CNW A;  3RPP A;  2BMX A;  2ZUP A;  2YCD A;  4L0U A;  2CV4 A;  3HKR A;  2GSS A;  1O85 A;  3FK8 A;  4HUA A;  3L9S A;  4IQA A;  2O8V B;  2CA8 A;  3AY8 A;  3GL3 A;  3UVH A;  4F03 A;  1GLQ A;  2VIM A;  1NM3 A;  2IPA A;  4NV5 A;  4AJ8 A;  4I2T A;  3CXG A;  2H01 A;  3GSS A;  2J9H A;  1LBK A;  2PU9 C;  2H6X A;  2KLX A;  4GLT A;  1C72 A;  4GSS A;  18GS A;  1YF0 A;  2H8L A;  3IBH A;  3IOS A;  1AXD A;  2PER A;  4JE1 A;  3TRQ A;  5ECS A;  3O6T A;  3VWU A;  2NPB A;  4KSM A;  1JLW A;  3DIE A;  2LTK A;  5ECQ B;  4MZW A;  1A0R P;  2WDU A;  3S9F A;  4IGJ A;  2B1L A;  4NMU A;  3VPT A;  2GS3 A;  6GSV A;  1RW1 A;  1Y25 A;  2H0I A;  1BQ7 A;  3LWA A;  4Z2U A;  2GST A;  5LCZ A;  4XTS A;  3F6D A;  1XW6 A;  1J08 A;  4KF9 A;  2H0G A;  3MAK A;  3HYP A;  1MDI A;  2VLT A;  1UVZ A;  1K0C A;  1AQX A;  1GTB A;  3VUR A;  4XHM A;  3H8Q A;  1TDI A;  3KGK A;  5IOW A;  3IDV A;  1X5E A;  2VCW A;  5E59 A;  5BMU A;  1R7H A;  3ED3 A;  4FIW A;  1SK2 A;  3F4S A;  1OC3 A;  1TK8 B;  2F8F A;  2MZC A;  3UOM A;  1B8X A;  3HVX A;  2NVL A;  4KAE A;  2GT6 A;  1TI3 A;  3VI5 A;  1XOB A;  1BYE A;  5ECR B;  4L5O A;  2ON7 A;  3L0H A;  1EP8 A;  1U87 A;  1XWK A;  2R2J A;  4MA9 A;  2H76 A;  1GWC A;  4PNF A;  2O87 A;  4OFM A;  5KN2 A;  4G0L A;  1OE8 A;  2ZCT A;  2WFC A;  4LL4 B;  4WKW A;  3BD2 A;  1FB0 A;  1EGR A;  4ZL9 A;  3BJ5 A;  1KTE A;  4NHZ A;  3GN3 A;  1E6B A;  1XIY A;  1PA3 A;  1GUL A;  3TOU A;  1USB A;  1THO A;  5GAN D;  2AB6 A;  4EIQ A;  4MNN A;  4N0V A;  3ERF A;  5JCU A;  1Z6N A;  4HDE A;  4GSN A;  2NDO A;  4GRF A;  5CRH A;  3TKP A;  1ZCP A;  1QFN A;  5H5Q A;  1SD9 A;  4FYU A;  1PSQ A;  5IMF A;  2L6D A;  2GQK A;  1SJI A;  3E3E A;  3ZFL A;  5IPG A;  2BJX A;  3LFL A;  2KUC A;  2RLI A;  2OA7 A;  4BVY B;  3F63 A;  1DSB A;  5IO0 A;  3EE2 A;  2R6K A;  3DWV A;  1F9M A;  1ZOF A;  2GZZ A;  1TI1 A;  4ML1 A;  1TXX A;  4OFT A;  2LRN A;  1X0R A;  4QL7 A;  1O7U A;  4WF4 A;  4KH7 A;  4K0N A;  1A8L A;  2FA8 A;  4JRR A;  4K1F A;  1GSD A;  2VL2 A;  2GZY A;  4I97 A;  2B5Y A;  3GYK A;  4TXV A;  2AHE A;  4POK A;  3D5J A;  3A5I A;  3ZVJ A;  1Z3E A;  2R37 A;  2C0F A;  1HD2 A;  1WOU A;  1K0A A;  4K7O A;  1H75 A;  2L5O A;  1K3Y A;  4ECB A;  3VWW A;  4O32 A;  5D9V A;  1VF4 A;  1ERU A;  2FD3 A;  3M8N A;  4PGT A;  2V2G A;  4BVX B;  4HQZ A;  1R5A A;  3HJP A;  3O76 A;  1FO5 A;  2H73 A;  2CZ3 A;  5D9X A;  4YKF A;  5CAX A;  2MBT A;  1PRX A;  1S3D A;  3UAR A;  1URM A;  2IJY A;  3KXO A;  4G9H A;  1GSQ A;  2R0G A;  1WMJ A;  2JL4 A;  3FR9 A;  5HFG A;  2HZE A;  2JZR A;  3FR6 A;  1THX A;  1EEJ A;  5CRW A;  1BX9 A;  2P31 A;  1OKD A;  3GX0 A;  1PGT A;  2ALB A;  5F8B A;  4MJC A;  2DBC A;  3GV1 A;  1PN0 A;  4TR1 B;  1AUC A;  3LEF A;  5IIZ A;  5INY A;  4MJB A;  5D96 A;  4XRD A;  3TCO A;  1V57 A;  3IE3 A;  1K0B A;  5ID2 A;  4F82 A;  3FZ9 A;  4HZ2 A;  1QXH A;  3D22 A;  2LEG A;  2NBS A;  3EU4 A;  2L6C A;  2YV9 A;  4HU7 A;  1XCC A;  5CO3 A;  2VAF A;  1MDJ A;  4HU9 A;  3P2A A;  4XCS A;  2HE3 A;  1A2L A;  2AV4 A;  4EVM A;  3PR8 A;  3UMA A;  1SK1 A;  4K2D A;  4IBP A;  1YDK A;  3VFI A;  1SKR B;  1OYJ A;  2C0D A;  3FY7 A;  2DJ3 A;  5DJL A;  2C0E A;  5D8I A;  2XBQ A;  1ERT A;  4KCA A;  2QKE A;  4FH8 A;  3CSH A;  4XS4 B;  2WUL A;  4XS1 A;  2V1M A;  5GZZ B;  3V1W A;  4XS6 A;  2X8C A;  4I6X A;  1MDK A;  3IV4 A;  3F9U A;  1SEN A;  2E2G A;  5IMC A;  3IC8 A;  2K8V A;  2MMN A;  2JAC A;  2EC4 A;  3ZIT A;  5J9C A;  4ZBA A;  2KOK A;  2WJU A;  3QMX A;  5B8A A;  3L4N A;  2CQ9 A;  3APS A;  3HHV A;  2LRT A;  2C1Y A;  1OKT A;  2FWH A;  3NIV A;  3LOR A;  5ECH B;  2A2P A;  5IOX A;  1PD2 1;  3GH6 A;  5ECI B;  3TUE A;  5DDL A;  4POM A;  1YEP A;  2X64 A;  2DML A;  2MMO A;  1SL2 B;  2FLS A;  2L5L A;  5G1K A;  1OAZ A;  1J9B A;  3GTU A;  1AQV A;  3HVS A;  2H6Y A;  3IPZ A;  3ME8 A;  5GAP D;  1TP9 A;  4TXO A;  2IMD A;  2LQO A;  1TK0 B;  3L9U A;  2WGR A;  4MJE A;  2QGV A;  1X5C A;  4MZC A;  1JZW A;  4HJM A;  3WGE A;  4RI6 A;  2FUG 2;  1SJ6 A;  3H79 A;  1M2A A;  4X43 A;  4NV2 A;  3EUR A;  4JR4 A;  4G19 A;  2VUP A;  3CBU A;  4KCE A;  4Z2R A;  4EO3 A;  3QFA C;  1X9W B;  1SKW B;  3G7Y A;  5DQY A;  2L59 A;  4WR4 A;  4ULX A;  1VF3 A;  4TR4 A;  4F2I A;  1F37 A;  3HZ8 A;  3M9J A;  4LMW A;  4F0C A;  4YAV A;  2F3M A;  3ZL5 A;  2C3Q A;  1WWJ A;  3FRC A;  4KDX A;  1G7E A;  3A2V A;  4EE0 A;  2HFD A;  4CHS A;  4BL7 B;  2V6O A;  4ZB9 A;  3US3 A;  2R5G A;  4TN8 A;  3W8S A;  3PIN A;  4TR1 A;  4KX4 A;  1YJ6 A;  1GSF A;  4BPY A;  1F6M C;  2PPT A;  4KB3 A;  5H5R A;  2PN8 A;  1GP1 A;  1V98 A;  4ZL7 A;  3DGQ A;  4CY8 A;  1M2D A;  3IA1 A;  5F06 A;  2G0F A;  2K9F A;  4GWR A;  5J5N A;  1ZYN A;  1VF2 A;  4QQ7 A;  1NW2 A;  1ZGN A;  2ON5 A;  4KDY A;  2D2Z A;  2LQQ A;  4K5R A;  3U5R E;  2B6M A;  3VI7 A;  3VK9 A;  4G10 A;  3J7Y b;  4N11 A;  4EL1 A;  5DQS A;  2KHP A;  5KN0 A;  3QD9 A;  5F0G A;  4IEL A;  1ACV A;  2FHE A;  4OO5 A;  4ID0 A;  13GS A;  4Q5N A;  1JZR A;  3E0U A;  5AGY A;  2RUF A;  3TJJ A;  1XWA A;  1FG4 A;  2WS2 A;  4PUR A;  2L4Q A;  1SKS B;  4CDO A;  2YJH A;  2TRX A;  2H71 A;  2GVP A;  2CZ2 A;  4K6X A;  4JU5 A;  1F2E A;  2IFQ A;  3IAS 2;  9GSS A;  2XBI A;  4N10 A;  5ECL B;  4MAB A;  4K2X A;  1PKW A;  1FOV A;  5G5E A;  2O85 A;  1EV9 A;  3I69 A;  1Q98 A;  2HZF A;  1XOA A;  3VPQ A;  1LJR A;  4GST A;  1XVW A;  3GUR A;  1TRS A;  4Q5F A;  1WIK A;  3MYD A;  4MF7 A;  3KJY A;  5A4U A;  3GKX A;  1ZMA A;  3TKS A;  2H1G A;  3DD3 A;  4IP1 A;  4ZBD A;  5AIX A;  3QPM A;  4IVF A;  4FQU A;  6GSU A;  3EMX A;  2DSA A;  2V32 A;  1FVK A;  5J41 A;  3P8W A;  3KZQ A;  2YWO A;  3GA4 A;  3EWL A;  6GSX A;  2OE0 A;  4D73 B;  3QCP A;  3HJO A;  2WZ9 A;  3ZRD A;  3VLN A;  3Q18 A;  3DKS A;  2ES7 A;  2RM6 A;  3N9J A;  1B48 A;  2K8S A;  3CYN A;  3F3Q A;  5IMA A;  5IO2 A;  3BOA A;  3DRN A;  4DSR A;  2OBI A;  3G9B A;  3RDW A;  4K9Z A;  5DAL B;  5L71 A;  1G6W A;  4BWS A;  5DVB A;  5IPH A;  2N5B A;  4IQ1 A;  1XBS A;  3HJM A;  1CQH A;  2XPE A;  3UEM A;  3WGX A;  3TKQ A;  4NWY A;  2VD1 A;  1SD8 A;  2M72 A;  3CRU A;  2JAD A;  3GNJ A;  2VL3 A;  1HNA A;  3GMF A;  1XW9 A;  3VWV A;  1SL1 B;  5DJM A;  1GL8 A;  2QC7 A;  2QA2 A;  1H4O A;  4DEJ A;  1T3B A;  4HEA 2;  3BBY A;  4CY6 A;  3DYR A;  3F3R A;  2RII A;  3TGZ A;  5KOX A;  2H30 A;  3LJR A;  2IL3 A;  1V2A A;  1M9B A;  1XWC A;  2GSQ A;  1OC9 B;  3D4M A;  2JU5 A;  1A23 A;  2JSZ A;  5G1L A;  3FZ4 A;  2DKI A;  2TIR A;  3GRX A;  2X8G A;  2H1A A;  3ISO A;  2VCT A;  1QUW A;  2HI7 A;  2V41 A;  4EDZ A;  3CRT A;  1GNW A;  1GSS A;  2GT5 A;  2DIZ A;  4Z7X A;  2QA1 A;  3IAM 2;  1F3A A;  5DAK B;  1TRV A;  1NSW A;  3D0Z A;  4YH2 A;  4ZL8 A;  1HQO A;  2YWI A;  5D73 A;  1HNC A;  1JLV A;  1JZO A;  17GS A;  1A2M A;  4PX1 A;  1LU4 A;  2HNL A;  5DCH A;  5AIV A;  1SYX A;  1JFU A;  4AGS A;  1GTI A;  2LNS A;  2LV3 A;  1V9W A;  1WE0 A;  2YV7 A;  4MH3 A;  4X0X A;  5CRD A;  3Q19 A;  3NOF A;  1ST9 A;  5LD0 A;  1FHE A;  3KMO A;  3TJG A;  3APQ A;  1FAA A;  2OAD A;  2XPD A;  3KP9 A;  4GCI A;  1ABA A;  1RQM A;  2DKH A;  2P0G A;  2IMI A;  4IW9 A;  3ZZX A;  3J7Y k;  4TW5 A;  2LJK A;  4N0Z A;  2VCV A;  5DBQ A;  2NTO A;  3D4T A;  3W8J A;  2B7J A;  2H72 A;  4OO4 A;  4XIH A;  1ERW A;  1AW9 A;  2IN3 A;  1B4Q A;  4A5P A;  4PQ1 A;  2B3S A;  3G7I A;  1BG5 A;  1XWG A;  4O5Q A;  5HFI A;  1T1V A;  6GSS A;  3GX8 A;  5J3R A;  3I43 A;  5J4U A;  3M3M A;  2BTO T;  2VLV A;  1T4Z A;  4MDC A;  3KM6 A;  1KBN A;  5LNK e;  4IP6 A;  4USS A;  3DXB A;  3MSZ A;  2LS5 A;  5JWO B;  1NHO A;  1UN2 A;  1YKC A;  4MLY A;  4HJ2 A;  3FEU A;  1TOF A;  4L0W A;  3GH9 A;  1YKA A;  3ERG A;  3HDC A;  2GTU A;  4PUF C;  3UL3 A;  2YJ7 A;  4DSS B;  4PUA A;  4RUV A;  2LJA A;  3UVT A;  4WBR D;  3KTL A;  2JZS A;  5FHI A;  2GQM A;  4PNG A;  1N8J A;  1Y6E A;  5DCG A;  2FGX A;  2CX3 A;  4H86 A;  1SL0 B;  4K7N A;  2A2S A;  1JZD A;  3LW9 A;  1T4Y A;  1ZL9 A;  2YPM A;  3WD6 A;  2H1D A;  1T00 A;  5GST A;  2HRN A;  5HR1 A;  3HCZ A;  2C8U A;  5EY6 A;  4IS0 A;  2AYT A;  1T8E B;  2DJJ A;  2DIY A;  3HY2 A;  5G31 A;  5FWG A;  3GKK A;  2DJ2 A;  2R0P A;  2GZP A;  2LJR A;  4AF2 A;  2X49 A;  1GSY A;  2H74 A;  4OD7 A;  1A0F A;  3C1S A;  2IMK A;  4TR3 A;  1OVN A;  4J57 E;  3RAZ A;  1X9M B;  2H19 A;  5A4W A;  2XC2 A;  4I5Q A;  10GS A;  3UBL A;  1MD4 A;  3ZMK A;  1SK0 A;  3KP8 A;  1M2B A;  3Q6O A;  3DVX A;  5DAK A;  4OCE A;  3KEB A;  4OWY A;  3LSZ A;  5FT3 A;  3ZYW A;  3FR3 A;  3CSI A;  4ZIJ A;  5AN1 A;  1TKD B;  4Q5Q A;  5CRE A;  3WGD A;  5HR3 A;  4NXI A;  1U88 A;  4KE3 A;  5IMD A;  3L9V A;  2OE3 A;  3GHA A;  4EUY A;  3BCK A;  3KMN A;  1QK8 A;  2DMM A;  2LRC A;  2VCX A;  1F3B A;  3MWH A;  3IK7 A;  4YQV A;  1ZZY A;  4BVY A;  1GH2 A;  3GIX A;  1ZYQ B;  2DJ0 A;  2O7K A;  3P90 A;  3FKF A;  2M80 A;  4KDU A;  1XFL A;  4K0G A;  1X9S B;  1Z7R A;  4JR6 A;  4P3Y B;  2I1U A;  22GS A;  1GUM A;  2PVO C;  3N5O A;  2LNT A;  3JCM L;  5BRT A;  3ERW A;  2MMZ A;  4ZBB A;  1K0O A;  3HXS A;  1WPI A;  1GUH A;  4LL1 B;  4EDY A;  4BVX A;  1TJD A;  4L8E A;  1U3I A;  5EPF A;  2C0G A;  2I4A A;  4IN0 A;  2KP1 A;  3DVW A;  2WCI A;  1EV4 A;  2RM5 A;  4KSO A;  3FHK A;  5JCG A;  4PXO A;  3TKS E;  3IHG A;  1X5D A;  4YAP A;  2FWE A;  1AIU A;  4DSS A;  2FY6 A;  1BAY A;  3RBT A;  1DUG A;  4GTU A;  1O8X A;  3R2Q A;  1A8Y A;  2X4A A;  5G30 A;  4ILF A;  3F4T A;  3ZVJ D;  3LQ7 A;  3F8U A;  4AJ6 A;  2N5A A;  1DE2 A;  3TRP A;  3UBK A;  4I8B A;  1OE7 A;  4WR5 A;  1PL2 A;  4F0B A;  1BJX A;  1B9X C;  1QGV A;  2VL9 A;  4XRA A;  2I9H A;  11GS A;  1YEX A;  5ABR A;  1FVJ A;  1ZYE A;  2EIQ A;  5JWR B;  2J23 A;  1QQ2 A;  2K18 A;  1XW5 A;  4GQC A;  4E8E A;  3DEX A;  4BWQ A;  3F6F A;  1ML6 A;  3HVV A;  2KP2 A;  4Z2T A;  1EOH A;  2F51 A;  4FO5 A;  1PKZ A;  3IK9 A;  5HR0 A;  5HFK A;  3IXR A;  4MP4 A;  4XS4 A;  1GSE A;  5G2Z A;  2GQL A;  3ZIV A;  2L4C A;  3QR6 A;  2HT9 A;  5F07 A;  1YQ1 A;  2YWN A;  1WRY A;  2R0C A;  3EMP A;  2VCQ A;  4MJA A;  3GL5 A;  3ME7 A;  1DBY A;  3C71 A;  4HS1 A;  2C4J A;  1J0F A;  1GRX A;  1MTC A;  3WYW A;  1PN9 A;  20GS A;  3Q74 A;  5D93 A;  1ERV A;  1K0D A;  4ML6 A;  4O7H A;  3K8N A;  3ZLP A;  5IMZ A;  4OMV A;  4V2N A;  3KCM A;  3TOT A;  2B5X A;  2FA4 A;  1UC7 A;  3H4K A;  3IC4 A;  2MYG A;  1QMV A;  4NPB A;  4GXZ A;  2YOI A;  3R3E A;  4GQF A;  1O8W A;  4N30 A;  2R3X A;  3TJF A;  5C00 A;  2A2R A;  1IYH A;  4MPG A;  3C8E A;  2CT6 A;  2YWM A;  4HI7 A;  1TW9 A;  1GTU A;  1O73 A;  1A2J A;  4ZXG A;  2HSY A;  2PGT A;  1EP7 A;  1HYU A;  5ELG A;  3VWX A;  1TRU A;  2UZ8 A;  4EIP A;  3D6I A;  3RPN A;  2AJQ B;  2VLU A;  3LXZ A;  4JED A;  4DSQ A;  5IM9 A;  4AJ7 A;  3APO A;  4NHW A;  2HLS A;  2E0Q A;  4ZB8 A;  5ECK B;  4G0K A;  2JZT A;  3PH9 A;  1O6J A;  5CRG A;  4MK3 A;  2IMF A;  5IMV A;  2VM2 A;  4LMV A;  3UAP A;  3EYT A;  5KN3 A;  2HZE B;  1S3A A;  4ICY A;  6GST A;  5ECM B;  5JWQ B;  4QL9 A;  4RQR A;  4ZB6 A;  2N5F A;  4PQH A;  3LYK A;  3FZ5 A;  5EL8 A;  1TTZ A;  5ELA A;  3P7X A;  1JHB A;  4O92 A;  4JZQ A;  4BL7 A;  5ECO B;  4ACS A;  3CTG A;  2VD0 A;  4WXT A;  2GLR A;  1KNG A;  1K0M A;  2HRK A;  3IR4 A;  5ID2 B;  2GSR A;  4PQI A;  5ENU A;  3M9K A;  3EC3 A;  3I6A A;  1I9D A;  3M1G A;  3QDN A;  2FNO A;  4KND A;  4MF6 A;  4EF0 A;  1XZO A;  2PUK C;  2YNX A;  2VO4 A;  2F9S A;  2CAI A;  3A2X A;  1V40 A;  1GSU A;  3TRX A;  1M9A A;  1OC8 A;  2FWG A;  6GSW A;  4ZIL A;  1VGL A;  4V2L A;  4HZ4 A;  5KOW A;  2JSY A;  4POB A;  8GSS A;  1TU7 A;  2CVK A;  3FW2 A;  1WP0 A;  2RUE A;  2WB9 A;  1YF1 A;  4HQS A;  2IIY A;  3LGC A;  2H6Z A;  3KD0 A;  1EOG A;  3M0F A;  3TJK A;  2LST A;  2VL2 C;  2H0H A;  2VOC A;  3NZN A;  2I81 A;  4MMM A;  1BED A;  2P5Q A;  2YP6 A;  2O89 A;  2B1K A;  5G5F A;  4YQU A;  1XWB A;  3QAV A;  2WRT A;  5HQP A;  1B9Y C;  4Q5R A;  1W4V A;  5B7C A;  2P5R A;  5A5K A;  1PMT A;  5J9B A;  3ZFB A;  4WET A;  4MH2 A;  4O5R A;  4E8H A;  1T7P B;  2VCZ A;  2PMT A;  1FB6 A;  4MCU A;  1CQG A;  4K7I A;  2OE1 A;  3WT1 A;  2C80 A;  3PPU A;  3TDG A;  2L57 A;  4CW9 A;  1XXU A;  2PWJ A;  3ZRE A;  2HXK A;  4TOP A;  3GTU B;  2HSM A;  4V1A p;  3TKR A;  2CAQ A;  2H70 A;  1SYR A;  1S3C A;  3ZML A;  1W89 A;  1M0U A;  5F05 A;  3KH9 A;  2OBK A;  1AC1 A;  3EPT A;  4TXO B;  4EXJ A;  4TVE A;  3HA9 A;  3HD5 A;  1K0N A;  2C3T A;  5A4V A;  3U6V A;  4FYC A;  3ZTL A;  4D73 A;  4J2F A;  3MNG A;  4YQM A;  1TRW A;  1PL1 A;  19GS A;  4TRX A;  1PQN A;  1NHY A;  3GKN A;  3H93 A;  7GSS A;  5IQY A;  4ECC A;  2DJ1 A;  2X8H A;  2B5E A;  5DAL A;  4IKH A;  2MBS A;  3BCI A;  5B8B A;  1O81 A;  5CP1 A;  1K3O A;  3HZ4 A;  3KH7 A;  3SBC A;  3GST A;  1SJZ A;  3QAG A;  3O3T A;  5C04 A;  1EZK A;  5B6M A;  2V6K A;  3DML A;  3PGT A;  2I3Y A;  4F9Z A;  1Q4J A;  5HR2 A;  4EKZ A;  2B7K A;  2E2M A;  3TJB A;  4KUN A;  5KEJ A;  3SWL A;  3D21 A;  4WBJ A;  3TB2 A;  3FZA A;  1Z6M A;  2MMA A;  1G6Y A;  1Z7P A;  3KIJ A;  16GS A;  5D9W A;  2M46 A;  4KGI A;  1AQW A;  1B4P A;  1OC9 A;  2YN1 A;  3QFB C;  2DLX A;  1R5P A;  4X1U A;  2H1B A;  4NAX A;  5JCW A;  1I5G A;  3CMI A;  4V1A g;  4RI7 A;  3ZIJ A;  3CTF A;  3FMW A;  1VRS D;  1KEB A;  3RHB A;  2YAN A;  2CVD A;  1IYI A;  4TKY A;  2TRC P;  2G2Q A;  5COH A;  4YKG A;  1U6T A;  5KN1 A;  3KTB A;  4LA1 A;  3A5W A;  1U3A A;  1N2A A;  2REM A;  4PTS A;  1TK5 B;  2Z9S A;  3QOU A;  4BA7 A;  1GLP A;  2IFQ B;  4MF5 A;  2IME A;  5E4W A;  1PX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...