2XPDA

Reduced thiol peroxidase (tpx) from yersinia pseudotuberculosis
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
166
structure length
166
Chain Sequence
TQTVHFQGNPVSVAGKLPQIGDKAKDFTLVAKDLSDVALSSFAGKRKVLNIFPSIDTGVCAASVRKFNQLAGELENTVVLCISSDLPFAQSRFCGAEGLSNVITLSTLRGADFKQAYGVAITEGPLAGLTARAVVVLDGQDNVIYSELVNEITTEPNYDAALAALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOL PEROXIDASE
publication title Structural Characterisation of Tpx from Yersinia Pseudotuberculosis Reveals Insights Into the Binding of Salicylidene Acylhydrazide Compounds.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
total genus 56
structure length 166
sequence length 166
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2xpdA00
2FY6A 2E2GA 2G0FA 3O76A 3FY7A 1GP1A 1K3OA 1OYJA 1SYRA 3LYKA 4TR1B 2NPBA 1ERWA 3KGKA 2GT5A 3EE2A 4YH2A 1N8JA 4OD7A 1EGOA 4NPBA 2GTUA 4TKYA 2H66A 3TJGA 2V32A 3EU4A 5GAPD 2EC4A 2L4CA 3O6TA 2YP6A 4V1Ap 5G5EA 1Z5YE 3FYGA 1U88A 4MJEA 2GSQA 3HVSA 2H8LA 2F8AA 1QQ2A 3W8SA 3OR5A 4E8EA 2G2QA 1YDKA 2L5OA 5E59A 4Q5FA 1A0RP 3WGXA 3TJBA 1XWAA 3LGCA 4N11A 4BVXA 4ZL7A 4DSRA 3EMXA 4ISDA 3IV4A 5IIZA 4WF4A 4RQXA 1XW5A 11GSA 2MBTA 3BCIA 4X0XA 3HKRA 3HJPA 4WR5A 2A2SA 3UBKA 2CZ3A 1T8EB 4ZB6A 4NV5A 2I1UA 2H74A 2JSZA 5CNWA 5ECSA 2HRNA 1SJ6A 1ZL9A 5HR2A 4TR0A 2XHFA 2IMDA 3IC4A 1VRSD 2VOCA 4IJIA 1I9DA 1FOVA 2NVLA 2C0DA 1GUHA 3M1GA 4F0BA 1B9YC 1PD21 1V40A 1ON4A 2NDOA 2IWTA 5IMDA 1GTBA 1QK8A 1JFUA 5DBQA 1Z6MA 3VWWA 3L9VA 3KP8A 3L9SA 2KP2A 4LL1B 3M8NA 2ES7A 1TOFA 3HZ8A 1A8YA 4LMVA 4AF2A 4ZXGA 3ZMLA 2HZEB 1PMTA 2VD1A 1PGTA 4CDOA 4I8BA 1QFNA 2EIQA 5L71A 2PBJA 1BG5A 1S3AA 2WGRA 3G7IA 1QGVA 3GV1A 2NTOA 4KDUA 1AIUA 5JWRB 12GSA 4D73B 1C72A 4PGTA 3KMOA 1AQVA 1K0BA 4KGIA 3C7MA 1ERVA 1GULA 4ZBBA 8GSSA 3KTLA 3APQA 1MD3A 5ECHB 1Q4JA 2I81A 5CRWA 4KAEA 1PSQA 2QSIA 4H86A 3DKSA 1OC3A 4OO5A 1YQ1A 2IMIA 2L6DA 2DBCA 3CMIA 1K0NA 3QCPA 2AHEA 3RHBA 1G7EA 2FA4A 4HQZA 1IYHA 2MMOA 1NM3A 3GIXA 2E0QA 2MZCA 2PWJA 5ECOB 3KP9A 3F4SA 3U5RE 20GSA 5AISA 4KCAA 2L57A 3GSTA 5CAXA 3H93A 2WJUA 2CQ9A 1UA5A 2JL4A 3I6AA 3GL5A 4GQCA 4HUAA 2YOIA 3CTFA 5IMAA 2M72A 5IMVA 3BBYA 3ISOA 3GH9A 4BWQA 1TW9A 4L8EA 2VIMA 4MZBA 5IMZA 2CT6A 1B8XA 1VGLA 2K6VA 1ACVA 1Y6EA 1G7OA 5IPGA 4I97A 3A2WA 3LFLA 2P5QA 2H19A 4HU9A 3HXSA 1YEXA 2VCWA 3IDVA 2C0GA 3QD9A 1XWGA 1B4PA 4BWSA 1MDIA 3GKKA 1Z6NA 3IPZA 4MH2A 5LNKe 2EIRA 1LJRA 1HQOA 2GGTA 3GURA 1FVJA 2I9HA 2CVBA 2LTKA 1O8WA 2AUVA 1KBNA 3GX0A 1HYUA 5DAKB 1OKDA 5EY6A 1WIKA 2DJ3A 3H79A 5F07A 2FWHA 4PQHA 1UVZA 18GSA 1WE0A 2KP1A 3TJFA 3KEBA 3GRXA 4XRDA 4WF5A 1NHYA 4JRRA 5DJMA 2OE0A 3V1WA 1GSUA 2IFQB 4DSQA 1ZMAA 3TKRA 2LRTA 3L78A 2VCQA 4I2TA 2LJKA 1O81A 3FZ9A 4PQIA 2HLSA 1JZDA 5A5KA 3MNGA 3P8WA 4WR4A 2PGTA 1MEKA 4KX4A 1KTEA 2H71A 1K0DA 1X9WB 3HHVA 1XOBA 1U3IA 4LMWA 4GSNA 3ERFA 2BJXA 3KH9A 4WBRD 4YQMA 3WGEA 2L6CA 3FR3A 4Q5RA 4TN8A 3A2XA 4O7HA 5G1LA 3E0UA 3G7YA 2YWMA 2FUG2 1SK1A 4RI7A 4DEJA 5B7CA 4MF6A 5JCUA 1AQWA 2O85A 5H5QA 2J23A 5B6MA 1TK0B 3UARA 1GUKA 1EOGA 4ML1A 4PX1A 5D73A 2LKUA 2V1MA 2GSTA 1XZOA 4MJAA 1AQXA 4ZB9A 5GSSA 4BA7A 3F9UA 1V58A 2KUCA 1TU8A 1A8LA 1YY7A 2M80A 4POLA 1SL1B 2VD0A 4PNFA 2RM6A 1YF0A 3LJRA 4DSSA 1AW9A 4POMA 5CO3A 6GSUA 1O85A 5G30A 1F37A 1TI1A 4XS4B 4XHMA 2H6ZA 2PVOC 3FR9A 2ZNMA 4HOJA 4V2NA 1HNBA 2F9SA 4JR4A 1SKSB 3GTUB 5J4UA 4NV2A 4KH7A 5DJLA 1IYIA 1HNAA 2LJAA 2V6KA 3C8EA 2DJKA 3CYNA 3TKQA 1XIYA 6GSXA 3DVXA 3EWLA 5KN0A 3LXZA 3Q18A 2RIIA 1YKAA 3DYRA 4JZQA 3D4TA 4KW6A 4TR4A 4WBJA 4P3YB 1R5PA 1K0OA 2GZZA 2VM1A 3H8QA 1TRUA 5ELGA 2XBIA 6GSWA 2LQQA 2CVDA 4O5RA 3GX8A 1TTZA 4IGJA 2YN1A 5AN1A 2VL2C 1TK5B 3AY8A 2FWGA 2EIOA 2IL3A 5ECPB 3DIEA 2GT6A 2OADA 1YZXA 2H6XA 1O8XA 3QMXA 2PERA 5CRHA 1HNCA 5C04A 4AGSA 4IJ3A 4K6XA 3VWUA 3DXBA 1NSWA 4QL7A 1FO5A 4OFMA 5D93A 3UBLA 3RDWA 3CSHA 1DBYA 2F51A 2RUFA 1WP0A 1PKZA 5HQPA 4ULXA 2WCIA 5GAND 3M3MA 3GUSA 1PQNA 3M0FA 2DIZA 4MF7A 5G1KA 4BVYA 1K3LA 1SKWB 2E2MA 3ME7A 2OKAA 5ENUA 1JLWA 3F63A 4XCSA 1GLPA 3C1SA 3F6FA 1GSFA 2YV7A 3R2QA 1FB0A 4WXTA 1XFLA 1USBA 2VLUA 3TCOA 2GVPA 3TDGA 3TRXA 4ZBDA 2HZEA 3ZYWA 3J7Yb 2FWFA 2LUSA 1F2EA 3VPQA 3APSA 3O3TA 3PGTA 2GZYA 5D9XA 3MDKA 4EL1A 1OVNA 1GH2A 2I4AA 2NBSA 4IBPA 5INYA 1VF4A 3FHKA 2VM2A 3TKPA 3E9JB 2XPDA 4V2MA 2OBIA 2YPMA 1T4ZA 2WRTA 5ECIB 1BAYA 1AXDA 1WJKA 3BOAA 1X5DA 3IK9A 4KNDA 1T00A 2A4VA 5B8AA 4EC0A 3J7Yk 2N5AA 4KCEA 4XTSA 1XBSA 5ID2B 1SENA 4HJMA 1SKRB 2FGXA 2IJYA 1AC1A 1EV9A 3I69A 2DMMA 2Z9SA 5ECMB 1ERUA 3KJYA 4WKWA 3KD0A 4FYCA 4G2EA 5LD0A 1ERTA 1F3BA 3DWVA 3UIWA 3GMFA 5DCHA 3CTGA 3CBUA 1TJDA 3KCMA 2C0FA 2H76A 3GFKA 3WT1A 3KIJA 2CAIA 3IRAA 14GSA 1EEMA 5KEJA 1A2JA 1FVKA 3GNJA 4BL7A 3G9BA 4GF0A 2CVKA 1YEPA 4KB3A 1SD8A 4IN0A 5DQSA 1TK8B 3VURA 5DCGA 2X64A 1UC7A 2B7KA 2AV4A 3F8UA 1R4WA 5KN3A 4ID0A 5F0GA 3VK9A 4G9HA 3GA4A 1A0FA 4PURA 13GSA 4J2FA 3HJMA 2C8UA 2J9HA 3IHQA 4ECCA 2K8SA 1EZKA 2IPAA 3UOMA 3VI5A 1DSBA 3G7JA 4N10A 4RQRA 3U6VA 1A23A 2FNOA 3KXOA 3D4MA 2H6YA 4XS1A 5DAKA 2H1BA 3I9V2 4ML6A 2ALBA 1WWJA 3DEXA 1EP7A 2VL3A 5EL8A 1VF2A 5D9TA 1GSQA 2FD3A 4PUAA 3FK8A 5DALA 4HZ4A 3HYPA 4OO4A 4TXOB 2MMNA 2GS3A 1GTAA 3FZ4A 4N0VA 3CXGA 3S9FA 4Q5NA 3LQ7A 2CAQA 1OC9A 5J9BA 4HU7A 4F2IA 2C3TA 2F8FA 4O32A 4NMUA 4X1UA 1M9AA 4NHWA 2WFCA 1M99A 4BPYA 3UMAA 5J9CA 5G31A 3D0ZA 3UJ1A 3HY2A 2DC5A 1RQMA 2H0GA 3HD5A 1EWXA 4N0ZA 1NW2A 3US3A 1T7PB 3LG6A 2V6OA 3QPMA 1PX7A 1TRWA 1Z3EA 3RBTA 2LSTA 4FYUA 2ZUPA 2HFDA 1YJ6A 4XS6A 4I2UA 4F82A 1YKCA 3EVIA 4V2LA 1A2LA 4GRFA 1H4OA 4ZIJA 2RUEA 3TJJA 5G5FA 3A3TA 2C3NA 2K9FA 4HI7A 2QC7A 4OCEA 3FZ5A 4FO5A 4AJ6A 3EURA 4WEYA 4KDXA 3LYPA 2ON5A 2OBKA 2CX4A 1GSDA 5EPFA 1Z7RA 3W8JA 3TRPA 3IAS2 2VLTA 3K8NA 2DIYA 3GH6A 2VLVA 1EEJA 4YQVA 3HDCA 9GSSA 4G10A 2OE1A 3EU3A 4HEA2 1M0UA 1VF3A 1K0CA 2KLXA 3P7XA 3ZLPA 2B3SA 4ZL8A 3M9KA 4FIWA 4L5OA 2VCZA 1WMJA 3TGZA 4IQ1A 4ACSA 2IMFA 4MZCA 2ON7A 3KTBA 2PUKC 4WETA 5B6NA 1J0FA 1N2AA 2AYTA 3F4RA 2VO4A 3ZL5A 1VF1A 2C4JA 4GWRA 2LRNA 3TKSA 1R5AA 3ED3A 3NZNA 3IA1A 3ZITA 4EO3A 1OKTA 3RAZA 3GYKA 3IR4A 4LL4B 4YAVA 3ZRDA 3FZAA 3DVWA 2R4VA 2IIYA 2JSYA 3F4TA 6GSVA 4IELA 4GCIA 3RHCA 5IMFA 5DVBA 2HE3A 3C71A 2TIRA 5AGYA 1BQ7A 3F6DA 1RK4A 1ABAA 4PNGA 1E2YA 4K0NA 4LLRA 2YANA 5D9WA 4HZ2A 3FR6A 4F0CA 4HJ2A 2VCXA 3ZVJD 1E6BA 5COHA 1WRYA 4ECIA 1DE1A 4IHUA 2R5GA 1DUGA 2JZTA 4IP6A 2DSAA 1YF1A 1MDKA 5IPHA 3EINA 1PN9A 4Z7XA 5B8BA 2R37A 4MH3A 4TVEA 5HR3A 2HNLA 1JHBA 3F3RA 3DMLA 2YJ7A 5DDLA 4I5QA 1QMVA 4J56E 3FEUA 4TR3A 1AAZA 4PXOA 2I3YA 4K0GA 4MDCA 1LU4A 4NWYA 1V2AA 3HJOA 5IO2A 4MABA 2OACA 1O6JA 1MTCA 3IAM2 3A2VA 2FCHA 3KH7A 1J08A 3ERGA 1K0AA 5F05A 1U6TA 4TR1A 2PPTA 4EDYA 4EF0A 1SK0A 1S3DA 3PR8A 4ZB8A 2QGVA 1JZOA 1XOAA 4CW9A 1G0TA 2HRFA 3D21A 2YNXA 3QAWA 4IKHA 4EE0A 2FA8A 1FAAA 2GSRA 4OWYA 5DQYA 2JZSA 3TB2A 4PQ1A 4QL9A 5JCGA 1GUMA 5IMCA 1R26A 1M2AA 4EUYA 3D5JA 1SJZA 3TOTA 4MA9A 2LJRA 1JZWA 3MWHA 16GSA 4IW9A 4LA1A 2HZFA 1CQGA 1H75A 1I5GA 3KMNA 2AAWA 1HD2A 5HFKA 3RPPA 2DJ2A 1A2MA 5JWOB 2GSSA 2GZPA 1GLQA 3P90A 1PL1A 5J5NA 3SBCA 1M7TA 2L59A 1KNGA 1TU7A 4IQAA 2LEGA 3Q19A 3HVXA 2LNTA 1TRVA 4MP4A 3GKMA 2DLXA 1SYXA 2QKEA 5IQYA 2XC2A 2VCTA 2C80A 2WDUA 22GSA 5CREA 1FB6A 1F9MA 2HXKA 4L5LA 4Q5QA 2HYXA 1XW6A 5HFGA 2L5LA 1FHEA 1SU9A 3GSSA 5A4WA 2AJQB 1DE2A 1CQHA 1TRSA 2BMXA 3UL3A 4JE1A 5ELAA 1K3YA 1O7UA 5ABRA 2CV4A 1ZCPA 2JACA 2YV9A 3D6IA 4MMMA 3TOUA 5EVOA 2TRCP 3HVVA 1S3CA 3ZTLA 1SD9A 4EVMA 3D22A 5A4VA 1BX9A 2RM5A 4OCFA 7GSSA 1SK2A 2XPEA 2YWNA 2K8VA 4D73A 3C1RA 1WOUA 1BYEA 5IM9A 2C1YA 1G6YA 4EKZA 4HQSA 1GTUA 4K2DA 1MD4A 3H1NA 1PRXA 1TI3A 3IBHA 2PVQA 3VI7A 4GSTA 2HT9A 3W6GA 2AB6A 5H5RA 5D96A 4MLYA 4TXOA 5ECRB 2FWEA 4ZBAA 4TOPA 4POKA 2A2RA 3QAGA 4KE3A 1AUCA 1Z9HA 4MZWA 2PMTA 5JCWA 5D9VA 1XXUA 2B5XA 3FW2A 3CSIA 5ECNB 4GSSA 2HSHA 5C00A 2B7JA 5CP1A 3Q74A 2LQOA 2KOKA 2C3QA 3EMPA 2H73A 3QDNA 3KZQA 1QXHA 4KSOA 3DD3A 1J9BA 1UN2A 1V57A 4OFNA 5JWQB 4NAXA 1FW1A 4HS1A 3ZVJA 1ML6A 3ZFBA 5G2ZA 1B9XC 3VFIA 2CA8A 2OE3A 1GRXA 2VAFA 1K0MA 3QR6A 1TP9A 4K8MA 4J57E 1WPIA 4O92A 19GSA 4G19A 5J3RA 3QFAC 1G6WA 3N5OA 3VLNA 3GN3A 1F3AA 2H1GA 4MJBA 4L0WA 2H0HA 3EC3A 1SL0B 1GNWA 4EDZA 2C0EA 1BJXA 4JBBA 4JU5A 2X8HA 1GSEA 4IVFA 1URMA 1RW1A 4V1Ag 4ILFA 3N9JA 3ME8A 3MSZA 3WD6A 3UAPA 2B1LA 1PA3A 3CSJA 2LRCA 4N30A 3TJKA 3Q6OA 5J41A 2IMEA 2OJLA 4KDYA 3TKSE 5F8BA 2N5BA 1SL2B 2H01A 1XWKA 3HCZA 3F3QA 2IFQA 2WB9A 4MCUA 3CRTA 3LORA 5E4WA 1ZGNA 4IP1A 5KN1A 1W4VA 3M9JA 4PUFC 3F0IA 2MBSA 2B5EA 2O87A 2GQMA 3APOA 5ECKB 2TRXA 2E7PA 3QOUA 4X43A 3NIVA 1R7HA 2O8VB 1OE7A 4QQ7A 4IS0A 3BJ5A 4ZILA 4ZL9A 1KEBA 1V9WA 2YZUA 1W89A 2CZ2A 2MYGA 3ZMKA 2L4QA 4AJ7A 2HSYA 4E8HA 3RPNA 4K7NA 2VCVA 5IO0A 1TDIA 2YWIA 5FWGA 4POBA 3IOSA 2B5YA 4FH8A 1GSYA 2H1AA 2YCDA 5ECQB 5GSTA 1ZZYA 2H75A 2P31A 3DGQA 4L0UA 4F03A 5KN2A 3QAVA 2D2ZA 2M46A 2H72A 3PINA 2X8CA 4ECBA 2V41A 1Z7PA 4XS4A 2VL9A 2OA7A 3HZ4A 3I43A 4TXVA 1XW9A 4DVCA 3EYTA 3L4NA 5F06A 2IN3A 1X0RA 3PH9A 3GTUA 4XRAA 5CYYA 2JZRA 1ST9A 4MPGA 1XCCA 3IE3A 4K7IA 2H1DA 4MPFA 1ZYQB 2GDRA 5LCZA 1TXXA 5A4UA 1EGRA 1XVQA 5HR1A 1XVWA 4OFTA 1X5EA 4YAPA 1T3BA 3SWLA 5D8IA 2H70A 1XPVA 3ZIVA 3TKSC 2RLIA 2PN8A 4GQFA 5AIXA 1TKDB 1GL8A 5DALB 4AJ8A 4TRXA 3LEFA 4K1FA 1EV4A 2H0IA 17GSA 3UVTA 4EXJA 2FLSA 4TW5A 3UEMA 2VUPA 1OC9B 1BEDA 1O73A 1ZOFA 2GQKA 1PX6A 2H30A 3FKFA 3IK7A 1V98A 3GKXA 3P2AA 3UVHA 1X5CA 5IOWA 5AIVA 1GSSA 3GL3A 4YQUA 3CRUA 5FHIA 2N5FA 2X8GA 3HA9A 1OAZA 3H4KA 2MMAA 1EP8A 5IOXA 5HR0A 3JCML 1THXA 1THOA 1M2DA 2B6MA 3NOFA 1MDJA 2XBQA 2P0GA 1QUWA 3BCKA 1GWCA 4RI6A 5FT3A 1FG4A 1A24A 3ERWA 3ZZXA 5GZZB 6GSTA 4K7OA 5H5SA 3LXTA 1NHOA 1PL2A 4XIHA 2LV3A 3VWXA 3WGDA 2GLRA 1M9BA 4ECJA 4NXIA 10GSA 3LSZA 4KA0A 2V2GA 4KUNA 3IXRA 2HI7A 2BTOT 1U3AA 2DJJA 5CRGA 4RUVA 2ZCTA 1XWCA 2FHEA 1LBKA 1M2BA 1OE8A 4JR6A 2WZ9A 3MAKA 3A5WA 2DMLA 1X9SB 3TUEA 3ZREA 3QFBC 4NHZA 3C73A 1X9MB 3L0HA 1T1VA 2CX3A 2B1KA 3WYWA 2WS2A 6GSYA 1Q98A 1XWBA 2R3XA 4HDEA 1GTIA 1EOHA 1U87A 1T4YA 6GSSA 5CRDA 1JZRA 3L9UA 2VL2A 2MMZA 4KSMA 1OC8A 4MJCA 5ID2A 2DJ0A 3TRQA 3VWVA 3VPTA 5HFIA 4F9ZA 2R6KA 4I6XA 2LS5A 2GQLA 1JLVA 2KHPA 3FRCA 3GKNA 2O89A 3ZFLA 2WULA 2LNSA 2X99A 1B4QA 4CHSA 1SJIA 4GLTA 3E3EA 3KM6A 2DJ1A 3BD2A 3LWAA 4MF5A 2P5RA 2F3MA 2R2JA 2REMA 2IMKA 4JEDA 3DRNA 1F6MC 4OMVA 5ECLB 3WT2A 2YJHA 1ZYEA 2PU9C 1GNEA 3GHAA 2K18A 1Y25A 2YZHA 2JADA 1B48A 2O7KA 4K9ZA 4GXZA 2JU5A 4MK3A 4DSSB 3ZIJA 4GTUA 1PKWA 2YWOA 1ILOA 4FYBA
chains in the Genus database with same CATH superfamily
2FY6A 2E2GA 2G0FA 3O76A 3FY7A 1GP1A 4K5RA 1K3OA 1OYJA 3EPTA 1SYRA 3LYKA 4TR1B 2NPBA 2UZ8A 1ERWA 3KGKA 2GT5A 3EE2A 4YH2A 1N8JA 4OD7A 1EGOA 4NPBA 2GTUA 4TKYA 2H66A 3TJGA 2V32A 3EU4A 5GAPD 2EC4A 2L4CA 3O6TA 4G0IA 2YP6A 4V1Ap 5G5EA 1Z5YE 3FYGA 1U88A 4MJEA 4G0LA 2GSQA 3HVSA 2H8LA 2F8AA 1QQ2A 3W8SA 3OR5A 4E8EA 2G2QA 1YDKA 2L5OA 5E59A 4Q5FA 1A0RP 3WGXA 3TJBA 1XWAA 3LGCA 4N11A 4BVXA 4ZL7A 1XG8A 4DSRA 3EMXA 4ISDA 3IV4A 5IIZA 4WF4A 4RQXA 1XW5A 4YKFA 11GSA 2MBTA 3BCIA 4X0XA 3HKRA 3HJPA 4WR5A 2A2SA 3UBKA 2CZ3A 1T8EB 4ZB6A 4NV5A 2I1UA 2H74A 2JSZA 5CNWA 5ECSA 2HRNA 1SJ6A 1ZL9A 5HR2A 4TR0A 2XHFA 2IMDA 3IC4A 1VRSD 2VOCA 4HSCX 4IJIA 1I9DA 1ZYNA 1FOVA 2NVLA 2C0DA 1GUHA 3M1GA 4F0BA 1B9YC 1PD21 1V40A 1ON4A 2NDOA 2IWTA 5IMDA 1GTBA 1QK8A 1JFUA 5DBQA 1Z6MA 3VWWA 3L9VA 3KP8A 3L9SA 2KP2A 4LL1B 3M8NA 2ES7A 1TOFA 3HZ8A 4USSA 1A8YA 4LMVA 4AF2A 4ZXGA 3ZMLA 2HZEB 1PMTA 2VD1A 1PGTA 4CDOA 4I8BA 1QFNA 2EIQA 4K2XA 5L71A 2PBJA 1BG5A 3MYDA 1S3AA 2WGRA 3G7IA 1QGVA 3GV1A 2NTOA 4KDUA 3A5IA 1AIUA 5JWRB 12GSA 4D73B 1C72A 4PGTA 3KMOA 1AQVA 1K0BA 4KGIA 3C7MA 1ERVA 1GULA 4ZBBA 8GSSA 3KTLA 3APQA 1MD3A 2QA1A 5ECHB 1Q4JA 2I81A 5CRWA 4KAEA 1PSQA 2QSIA 4H86A 3DKSA 1OC3A 4OO5A 1YQ1A 2IMIA 4BIKA 2L6DA 2DBCA 3CMIA 1K0NA 3QCPA 2AHEA 3RHBA 1G7EA 2FA4A 4HQZA 1IYHA 2MMOA 1NM3A 3GIXA 2E0QA 2MZCA 2PWJA 5ECOB 3KP9A 5BMUA 3F4SA 3U5RE 20GSA 5AISA 4KCAA 2L57A 3GSTA 5CAXA 3H93A 2WJUA 2CQ9A 1UA5A 2JL4A 3I6AA 3GL5A 4GQCA 4HUAA 2YOIA 3CTFA 5IMAA 2M72A 4BL7B 5IMVA 3BBYA 3ISOA 3GH9A 4BWQA 1TW9A 4L8EA 2VIMA 4MZBA 5IMZA 2CT6A 1B8XA 1VGLA 2K6VA 1ACVA 1Y6EA 1G7OA 5IPGA 4I97A 3A2WA 3LFLA 2P5QA 2H19A 4HU9A 3HXSA 1YEXA 2VCWA 3IDVA 2C0GA 3QD9A 1XWGA 1B4PA 4BWSA 1MDIA 3GKKA 1Z6NA 3IPZA 4MH2A 5LNKe 2EIRA 1LJRA 1HQOA 2GGTA 3GURA 4Z2UA 1FVJA 2I9HA 2CVBA 2LTKA 1O8WA 2AUVA 1KBNA 3GX0A 1HYUA 5DAKB 1OKDA 5EY6A 1WIKA 2DJ3A 3H79A 5F07A 2FWHA 4PQHA 1UVZA 18GSA 1WE0A 2KP1A 3TJFA 3KEBA 3GRXA 4XRDA 4WF5A 1NHYA 4JRRA 5DJMA 2OE0A 3V1WA 1GSUA 2IFQB 4DSQA 1ZMAA 3TKRA 2LRTA 3L78A 2VCQA 4I2TA 2LJKA 1O81A 3FZ9A 4PQIA 2HLSA 1JZDA 5A5KA 3MNGA 3HVNA 3R3EA 3P8WA 4WR4A 2PGTA 1MEKA 4KX4A 1KTEA 2H71A 1K0DA 1X9WB 3HHVA 1XOBA 1U3IA 4LMWA 4GSNA 3ERFA 2BJXA 3KH9A 4WBRD 4YQMA 3WGEA 2L6CA 3FR3A 4Q5RA 4TN8A 3A2XA 4O7HA 5G1LA 3E0UA 3G7YA 2YWMA 3MIXA 2FUG2 1SK1A 4RI7A 4DEJA 5B7CA 4MF6A 5JCUA 1AQWA 2O85A 5H5QA 2J23A 5B6MA 1TK0B 3UARA 1GUKA 1EOGA 4ML1A 4PX1A 5D73A 2LKUA 2V1MA 2GSTA 1XZOA 4MJAA 1AQXA 4ZB9A 5GSSA 4BA7A 3F9UA 1V58A 2KUCA 1TU8A 1A8LA 1YY7A 2M80A 4POLA 1SL1B 2VD0A 4PNFA 2RM6A 1YF0A 3LJRA 4DSSA 1AW9A 4POMA 5CO3A 6GSUA 1O85A 5G30A 1F37A 1TI1A 4XS4B 4XHMA 2H6ZA 2PVOC 3FR9A 2ZNMA 4HOJA 4V2NA 1HNBA 2F9SA 4JR4A 1SKSB 3GTUB 5J4UA 4NV2A 4KH7A 5DJLA 1IYIA 1HNAA 2LJAA 2V6KA 3C8EA 2DJKA 3CYNA 3TKQA 1XIYA 6GSXA 3DVXA 3EWLA 5KN0A 4FQUA 3LXZA 3Q18A 2RIIA 1YKAA 3DYRA 4JZQA 3D4TA 4KW6A 4TR4A 4WBJA 4P3YB 1R5PA 1K0OA 2GZZA 2VM1A 3H8QA 1TRUA 5ELGA 2XBIA 6GSWA 2LQQA 2CVDA 4O5RA 3GX8A 1TTZA 4IGJA 2YN1A 5AN1A 2VL2C 1TK5B 3AY8A 2FWGA 2EIOA 2IL3A 5ECPB 3DIEA 4O5UA 2GT6A 2OADA 1YZXA 2H6XA 1O8XA 3QMXA 2PERA 5CRHA 1HNCA 5C04A 4AGSA 4IJ3A 4K6XA 3VWUA 3DXBA 1NSWA 4QL7A 1FO5A 4OFMA 5D93A 3UBLA 3RDWA 3CSHA 1DBYA 2F51A 2RUFA 1WP0A 1PKZA 5HQPA 4K5SA 4ULXA 2WCIA 5GAND 3M3MA 3GUSA 1PQNA 3M0FA 2DIZA 4MF7A 5G1KA 2DKHA 2X49A 4BVYA 1K3LA 1SKWB 2E2MA 3ME7A 2OKAA 5ENUA 1JLWA 3F63A 4XCSA 1GLPA 3C1SA 3F6FA 1GSFA 2YV7A 3R2QA 1FB0A 4WXTA 1XFLA 1USBA 2VLUA 3TCOA 2GVPA 3TDGA 3TRXA 4ZBDA 2HZEA 3ZYWA 3J7Yb 2FWFA 2LUSA 1F2EA 4KF9A 3VPQA 3APSA 3O3TA 3PGTA 2GZYA 1M3JA 5D9XA 3MDKA 4EL1A 1OVNA 1GH2A 2I4AA 2NBSA 4IBPA 5INYA 1VF4A 3FHKA 2VM2A 3TKPA 3E9JB 2XPDA 4V2MA 4MNNA 2OBIA 2YPMA 1T4ZA 2WRTA 5ECIB 1BAYA 1AXDA 1WJKA 3BOAA 1X5DA 3IK9A 4KNDA 1T00A 2A4VA 5B8AA 4EC0A 3J7Yk 2N5AA 4KCEA 4XTSA 1XBSA 5ID2B 1SENA 4CY8A 4HJMA 1SKRB 2FGXA 2IJYA 1AC1A 1EV9A 3I69A 2DMMA 2Z9SA 5ECMB 1ERUA 3KJYA 4WKWA 1FOHA 3KD0A 4FYCA 4G2EA 5LD0A 4PTSA 1ERTA 1F3BA 3DWVA 3UIWA 3GMFA 5DCHA 3CTGA 3CBUA 1TJDA 3KCMA 2C0FA 2H76A 3GFKA 3WT1A 3KIJA 2CAIA 3IRAA 14GSA 1EEMA 5KEJA 1A2JA 1FVKA 3GNJA 4BL7A 3G9BA 4GF0A 2CVKA 1YEPA 4KB3A 1SD8A 4IN0A 5DQSA 1TK8B 3VURA 5DCGA 2X64A 1UC7A 2B7KA 2AV4A 3PPUA 3F8UA 1R4WA 5KN3A 4ID0A 5F0GA 3VK9A 4G9HA 3GA4A 1A0FA 4PURA 13GSA 4J2FA 3HJMA 2C8UA 2J9HA 3IHQA 4ECCA 2K8SA 1EZKA 2IPAA 3UOMA 3VI5A 1DSBA 3G7JA 4N10A 4RQRA 3U6VA 1A23A 2FNOA 3KXOA 3D4MA 2H6YA 4XS1A 2QA2A 5DAKA 2H1BA 3I9V2 4ML6A 2ALBA 1WWJA 3DEXA 1EP7A 2VL3A 5EL8A 1VF2A 5D9TA 1GSQA 2FD3A 4PUAA 3FK8A 5DALA 4HZ4A 3HYPA 4OO4A 4TXOB 2MMNA 2GS3A 1GTAA 3FZ4A 4N0VA 3CXGA 3S9FA 4Q5NA 4BVXB 3LQ7A 2CAQA 1OC9A 5J9BA 4HU7A 4F2IA 2C3TA 2F8FA 4O32A 4NMUA 4X1UA 1M9AA 4NHWA 2WFCA 1M99A 4BPYA 3UMAA 5J9CA 5G31A 3D0ZA 3UJ1A 3HY2A 2DC5A 1RQMA 2H0GA 3HD5A 1EWXA 4N0ZA 1NW2A 3US3A 1T7PB 3LG6A 2V6OA 3QPMA 1PX7A 1TRWA 1Z3EA 3RBTA 2LSTA 4FYUA 2ZUPA 2HFDA 1YJ6A 4ICYA 4XS6A 4I2UA 4F82A 1YKCA 3EVIA 4V2LA 1A2LA 4GRFA 1H4OA 4ZIJA 2RUEA 3TJJA 5G5FA 3A3TA 2C3NA 2K9FA 4HI7A 2QC7A 4OCEA 3FZ5A 4FO5A 4AJ6A 3EURA 4WEYA 4KDXA 3LYPA 2ON5A 2OBKA 2CX4A 1GSDA 5EPFA 1Z7RA 3W8JA 3TRPA 3IAS2 2VLTA 3K8NA 2R0CA 2DIYA 3GH6A 2VLVA 1EEJA 4YQVA 3HDCA 9GSSA 4G10A 2OE1A 3EU3A 4HEA2 1M0UA 1VF3A 1K0CA 2KLXA 3P7XA 3ZLPA 2B3SA 4ZL8A 3M9KA 4FIWA 4L5OA 2VCZA 1WMJA 3TGZA 4IQ1A 4ACSA 4O5QA 2IMFA 4MZCA 2ON7A 3KTBA 2PUKC 4WETA 5B6NA 1J0FA 1N2AA 2AYTA 3F4RA 2VO4A 3ZL5A 1VF1A 2C4JA 4GWRA 2LRNA 3TKSA 4EIQA 1R5AA 3ED3A 3NZNA 3IA1A 3ZITA 4EO3A 1OKTA 3RAZA 3GYKA 3IR4A 4LL4B 4YAVA 3ZRDA 3FZAA 3DVWA 2R4VA 2IIYA 2JSYA 3F4TA 6GSVA 4IELA 4GCIA 3RHCA 5IMFA 5DVBA 2HE3A 3C71A 2TIRA 5AGYA 4Z2RA 1BQ7A 3F6DA 1RK4A 1ABAA 4PNGA 1E2YA 4K0NA 4LLRA 2YANA 5D9WA 1S3RA 4HZ2A 3FR6A 4F0CA 4HJ2A 2VCXA 3ZVJD 1E6BA 5COHA 1WRYA 4ECIA 1DE1A 4IHUA 2R5GA 1DUGA 2JZTA 4IP6A 2DSAA 1YF1A 1MDKA 5IPHA 3EINA 1PN9A 4Z7XA 5B8BA 2R37A 4MH3A 4TVEA 5HR3A 2HNLA 1JHBA 3F3RA 3DMLA 2YJ7A 5DDLA 4I5QA 1QMVA 4J56E 3FEUA 4TR3A 1AAZA 4PXOA 2I3YA 4K0GA 4MDCA 1LU4A 4NWYA 1V2AA 3HJOA 5IO2A 2R0PA 4MABA 2OACA 1O6JA 1MTCA 3IAM2 3A2VA 2FCHA 3KH7A 1J08A 3ERGA 1K0AA 5F05A 1U6TA 4TR1A 2PPTA 4EDYA 4EF0A 1SK0A 1S3DA 3PR8A 4ZB8A 2QGVA 1JZOA 4Z2TA 1XOAA 4CW9A 1G0TA 2HRFA 3D21A 2YNXA 3QAWA 4IKHA 4EE0A 2FA8A 1FAAA 2GSRA 4OWYA 5DQYA 2JZSA 3TB2A 4PQ1A 4QL9A 5JCGA 1GUMA 5IMCA 1R26A 1M2AA 4EUYA 3D5JA 1SJZA 3TOTA 4MA9A 2LJRA 1JZWA 3MWHA 16GSA 4IW9A 4LA1A 2HZFA 1ZYPA 5KOWA 1CQGA 1H75A 1I5GA 3KMNA 2AAWA 1HD2A 5HFKA 3RPPA 2DJ2A 1A2MA 5JWOB 2GSSA 2GZPA 3P90A 1GLQA 3CQFA 1PL1A 5J5NA 3SBCA 1M7TA 2L59A 1KNGA 1TU7A 4IQAA 2LEGA 3Q19A 3HVXA 2LNTA 1TRVA 4MP4A 3GKMA 2DLXA 1SYXA 2QKEA 5IQYA 2XC2A 2VCTA 2C80A 2WDUA 22GSA 5CREA 1FB6A 1F9MA 2HXKA 4L5LA 4Q5QA 2HYXA 1XW6A 5HFGA 5KOXA 2DKIA 2L5LA 1FHEA 1SU9A 3GSSA 5A4WA 2AJQB 1PFOA 1DE2A 1CQHA 1TRSA 2BMXA 3UL3A 4JE1A 5ELAA 1K3YA 1O7UA 5ABRA 2CV4A 1ZCPA 2JACA 2YV9A 3D6IA 4MMMA 3TOUA 5EVOA 2TRCP 3HVVA 1S3CA 3ZTLA 1SD9A 4EVMA 3D22A 5A4VA 1BX9A 4A5PA 2RM5A 4OCFA 7GSSA 1SK2A 2XPEA 2YWNA 2K8VA 4D73A 3C1RA 1WOUA 1BYEA 5IM9A 2C1YA 1G6YA 4EKZA 4HQSA 1GTUA 4K2DA 1MD4A 3H1NA 1PRXA 1TI3A 3IBHA 2PVQA 3VI7A 4GSTA 2HT9A 3W6GA 2AB6A 5H5RA 5D96A 4MLYA 4TXOA 5ECRB 2FWEA 4ZBAA 4TOPA 4POKA 2A2RA 2A4HA 3QAGA 4KE3A 1AUCA 1Z9HA 4MZWA 2PMTA 5JCWA 5D9VA 1XXUA 2B5XA 3FW2A 3CSIA 5ECNB 4GSSA 2HSHA 5C00A 2B7JA 5CP1A 3Q74A 2LQOA 2KOKA 2C3QA 3EMPA 2H73A 3QDNA 3KZQA 1QXHA 4KSOA 3DD3A 1J9BA 1UN2A 1V57A 4OFNA 5JWQB 4NAXA 1FW1A 4HS1A 2HSMA 3ZVJA 1ML6A 3ZFBA 5G2ZA 1B9XC 3VFIA 2CA8A 2OE3A 1GRXA 2VAFA 1K0MA 3QR6A 1TP9A 4K8MA 4J57E 4BVYB 1WPIA 4O92A 19GSA 4G19A 5J3RA 3QFAC 1G6WA 3N5OA 5BRTA 3VLNA 3GN3A 1F3AA 2H1GA 4MJBA 4L0WA 2H0HA 3EC3A 1SL0B 2X4AA 1GNWA 4EDZA 2C0EA 1BJXA 4JBBA 4JU5A 2X8HA 1GSEA 4IVFA 1URMA 1RW1A 4V1Ag 4ILFA 3N9JA 3ME8A 3MSZA 3WD6A 3UAPA 2B1LA 1PA3A 3CSJA 2LRCA 4N30A 3TJKA 3Q6OA 5J41A 2IMEA 2OJLA 4KDYA 3TKSE 5F8BA 2N5BA 1SL2B 2H01A 1XWKA 3HCZA 3F3QA 2IFQA 2WB9A 4MCUA 3CRTA 3LORA 5E4WA 1ZGNA 4IP1A 5KN1A 1W4VA 3M9JA 4PUFC 3F0IA 2MBSA 2B5EA 2O87A 2GQMA 3APOA 5ECKB 2TRXA 2E7PA 3QOUA 4X43A 3NIVA 1R7HA 2O8VB 1OE7A 4QQ7A 4IS0A 4CY6A 3BJ5A 4ZILA 4ZL9A 1KEBA 1V9WA 2YZUA 1W89A 2CZ2A 2MYGA 3ZMKA 2HRKA 2L4QA 4AJ7A 2HSYA 4E8HA 3RPNA 4K7NA 2A2PA 2VCVA 5IO0A 1TDIA 2YWIA 5FWGA 4POBA 3IOSA 2B5YA 4FH8A 1GSYA 4EIPA 2H1AA 2YCDA 5ECQB 5GSTA 4X4JA 1ZZYA 2H75A 2P31A 3DGQA 4L0UA 4F03A 5KN2A 3QAVA 3FMWA 2D2ZA 2M46A 2H72A 3PINA 2X8CA 4ECBA 2V41A 1Z7PA 4XS4A 2VL9A 2OA7A 3HZ4A 3I43A 4TXVA 1XW9A 4DVCA 3EYTA 3L4NA 5F06A 2IN3A 1X0RA 3PH9A 3GTUA 4XRAA 5CYYA 2JZRA 2R0GA 1ST9A 4MPGA 1XCCA 3IE3A 4K7IA 2H1DA 4MPFA 1ZYQB 2GDRA 5LCZA 1TXXA 5A4UA 1EGRA 1XVQA 5HR1A 1XVWA 4OFTA 1X5EA 4YAPA 1T3BA 3SWLA 5D8IA 2H70A 1XPVA 3ZIVA 3TKSC 2RLIA 2PN8A 4GQFA 5AIXA 1TKDB 1GL8A 5DALB 4AJ8A 4TRXA 3LEFA 4K1FA 1EV4A 2HRAA 2H0IA 17GSA 3UVTA 4EXJA 2FLSA 4TW5A 1PN0A 3UEMA 2VUPA 1OC9B 1BEDA 1O73A 1ZOFA 2GQKA 1PX6A 2H30A 3FKFA 3IK7A 1V98A 3GKXA 3LW9A 3P2AA 3UVHA 1X5CA 5IOWA 1GSSA 5AIVA 3GL3A 4YQUA 3CRUA 5FHIA 2N5FA 2X8GA 3HA9A 1OAZA 3H4KA 2MMAA 1EP8A 5IOXA 5HR0A 3JCML 1THXA 1THOA 1M2DA 2B6MA 3NOFA 1MDJA 2XBQA 2P0GA 1QUWA 3BCKA 1GWCA 4RI6A 5FT3A 1FG4A 1A24A 3ERWA 3ZZXA 5GZZB 6GSTA 4K7OA 5H5SA 3LXTA 4YKGA 1NHOA 1PL2A 4XIHA 2LV3A 3VWXA 3WGDA 2GLRA 1M9BA 4ECJA 4NXIA 10GSA 3LSZA 4KA0A 2V2GA 4KUNA 3IXRA 2HI7A 2BTOT 1U3AA 2DJJA 5CRGA 4RUVA 2ZCTA 1XWCA 2FHEA 1LBKA 1M2BA 1OE8A 4JR6A 2WZ9A 3MAKA 3A5WA 2DMLA 1X9SB 3TUEA 1M3IA 3ZREA 3QFBC 4NHZA 3C73A 1X9MB 3L0HA 1T1VA 2CX3A 2B1KA 3WYWA 2WS2A 6GSYA 1Q98A 1XWBA 2R3XA 4HDEA 1GTIA 1EOHA 4G0KA 1U87A 1T4YA 6GSSA 5CRDA 1JZRA 3L9UA 3IC8A 2VL2A 2MMZA 4KSMA 1OC8A 4MJCA 5ID2A 2DJ0A 3TRQA 3VWVA 3VPTA 5HFIA 4F9ZA 2R6KA 4I6XA 2LS5A 2GQLA 1JLVA 2KHPA 3FRCA 3GKNA 2O89A 3ZFLA 2WULA 2LNSA 2X99A 1B4QA 4CHSA 1SJIA 4GLTA 3E3EA 3KM6A 2DJ1A 3BD2A 3IHGA 3LWAA 4MF5A 2P5RA 2F3MA 2R2JA 2REMA 2IMKA 4JEDA 3DRNA 1F6MC 4OMVA 5ECLB 3WT2A 2YJHA 1ZYEA 2PU9C 1GNEA 3GHAA 2K18A 1Y25A 2YZHA 2JADA 1B48A 2O7KA 4K9ZA 4GXZA 2JU5A 4MK3A 4DSSB 3ZIJA 4GTUA 1PKWA 2YWOA 1ILOA 4FYBA
chains in the Genus database with same CATH topology
2FY6A 2E2GA 2G0FA 3O76A 3FY7A 1GP1A 4K5RA 1K3OA 1OYJA 3EPTA 1SYRA 3LYKA 4TR1B 2NPBA 2UZ8A 1ERWA 3KGKA 2GT5A 3EE2A 4YH2A 1N8JA 4OD7A 1EGOA 4NPBA 2GTUA 4TKYA 2H66A 3TJGA 2V32A 3EU4A 5GAPD 2EC4A 2L4CA 3O6TA 4G0IA 2YP6A 4V1Ap 5G5EA 1Z5YE 3FYGA 1U88A 4MJEA 4G0LA 2GSQA 3HVSA 2H8LA 2F8AA 1QQ2A 3W8SA 3OR5A 4E8EA 2G2QA 1YDKA 2L5OA 5E59A 4Q5FA 1A0RP 3WGXA 3TJBA 1XWAA 3LGCA 4N11A 4BVXA 4ZL7A 4DSRA 3EMXA 4ISDA 3IV4A 5IIZA 4WF4A 4RQXA 1XW5A 4YKFA 11GSA 2MBTA 3BCIA 4X0XA 3HKRA 3HJPA 4WR5A 2A2SA 3UBKA 2CZ3A 1T8EB 4ZB6A 4NV5A 2I1UA 2H74A 2JSZA 5CNWA 5ECSA 2HRNA 1SJ6A 1ZL9A 5HR2A 4TR0A 2XHFA 2IMDA 3IC4A 1VRSD 2VOCA 4IJIA 1I9DA 1ZYNA 1FOVA 2NVLA 2C0DA 1GUHA 3M1GA 4F0BA 1B9YC 1PD21 1V40A 1ON4A 2NDOA 2IWTA 5IMDA 1GTBA 1QK8A 1JFUA 5DBQA 1Z6MA 3VWWA 3L9VA 3KP8A 3L9SA 2KP2A 4LL1B 3M8NA 2ES7A 1TOFA 3HZ8A 4USSA 1A8YA 4LMVA 4AF2A 4ZXGA 3ZMLA 2HZEB 1PMTA 2VD1A 1PGTA 4CDOA 4I8BA 1QFNA 2EIQA 4K2XA 5L71A 2PBJA 1BG5A 3MYDA 1S3AA 2WGRA 3G7IA 1QGVA 3GV1A 2NTOA 4KDUA 3A5IA 1AIUA 5JWRB 12GSA 4D73B 1C72A 4PGTA 3KMOA 1AQVA 1K0BA 4KGIA 3C7MA 1ERVA 1GULA 4ZBBA 8GSSA 3KTLA 3APQA 1MD3A 2QA1A 5ECHB 1Q4JA 2I81A 5CRWA 4KAEA 1PSQA 2QSIA 4H86A 3DKSA 1OC3A 4OO5A 1YQ1A 2IMIA 2L6DA 2DBCA 3CMIA 1K0NA 3QCPA 2AHEA 3RHBA 1G7EA 2FA4A 4HQZA 1IYHA 2MMOA 1NM3A 3GIXA 2E0QA 2MZCA 2PWJA 5ECOB 3KP9A 5BMUA 3F4SA 3U5RE 20GSA 5AISA 4KCAA 2L57A 3GSTA 5CAXA 3H93A 2WJUA 2CQ9A 1UA5A 2JL4A 3I6AA 3GL5A 4GQCA 4HUAA 2YOIA 3CTFA 5IMAA 2M72A 4BL7B 5IMVA 3BBYA 3ISOA 3GH9A 4BWQA 1TW9A 4L8EA 2VIMA 4MZBA 5IMZA 2CT6A 1B8XA 1VGLA 2K6VA 1ACVA 1Y6EA 1G7OA 5IPGA 4I97A 3A2WA 3LFLA 2P5QA 2H19A 4HU9A 3HXSA 1YEXA 2VCWA 3IDVA 2C0GA 3QD9A 1XWGA 1B4PA 4BWSA 1MDIA 3GKKA 1Z6NA 3IPZA 4MH2A 5LNKe 2EIRA 1LJRA 1HQOA 2GGTA 3GURA 4Z2UA 1FVJA 2I9HA 2CVBA 2LTKA 1O8WA 2AUVA 1KBNA 3GX0A 1HYUA 5DAKB 1OKDA 5EY6A 1WIKA 2DJ3A 3H79A 5F07A 2FWHA 4PQHA 1UVZA 18GSA 1WE0A 2KP1A 3TJFA 3KEBA 3GRXA 4XRDA 4WF5A 1NHYA 4JRRA 5DJMA 2OE0A 3V1WA 1GSUA 2IFQB 4DSQA 1ZMAA 3TKRA 2LRTA 3L78A 2VCQA 4I2TA 2LJKA 1O81A 3FZ9A 4PQIA 2HLSA 1JZDA 5A5KA 3MNGA 3R3EA 3P8WA 4WR4A 2PGTA 1MEKA 4KX4A 1KTEA 2H71A 1K0DA 1X9WB 3HHVA 1XOBA 1U3IA 4LMWA 4GSNA 3ERFA 2BJXA 3KH9A 4WBRD 4YQMA 3WGEA 2L6CA 3FR3A 4Q5RA 4TN8A 3A2XA 4O7HA 5G1LA 3E0UA 3G7YA 2YWMA 3MIXA 2FUG2 1SK1A 4RI7A 4DEJA 5B7CA 4MF6A 5JCUA 1AQWA 2O85A 5H5QA 2J23A 5B6MA 1TK0B 3UARA 1GUKA 1EOGA 4ML1A 4PX1A 5D73A 2LKUA 2V1MA 2GSTA 1XZOA 4MJAA 1AQXA 4ZB9A 5GSSA 4BA7A 3F9UA 1V58A 2KUCA 1TU8A 1A8LA 1YY7A 2M80A 4POLA 1SL1B 2VD0A 4PNFA 2RM6A 1YF0A 3LJRA 4DSSA 1AW9A 4POMA 5CO3A 6GSUA 1O85A 5G30A 1F37A 1TI1A 4XS4B 4XHMA 2H6ZA 2PVOC 3FR9A 2ZNMA 4HOJA 4V2NA 1HNBA 2F9SA 4JR4A 1SKSB 3GTUB 5J4UA 4NV2A 4KH7A 5DJLA 1IYIA 1HNAA 2LJAA 2V6KA 3C8EA 2DJKA 3CYNA 3TKQA 1XIYA 6GSXA 3DVXA 3EWLA 5KN0A 4FQUA 3LXZA 3Q18A 2RIIA 1YKAA 3DYRA 4JZQA 3D4TA 4KW6A 4TR4A 4WBJA 4P3YB 1R5PA 1K0OA 2GZZA 2VM1A 3H8QA 1TRUA 5ELGA 2XBIA 6GSWA 2LQQA 2CVDA 4O5RA 3GX8A 1TTZA 4IGJA 2YN1A 5AN1A 2VL2C 1TK5B 3AY8A 2FWGA 2EIOA 2IL3A 5ECPB 3DIEA 4O5UA 2GT6A 2OADA 1YZXA 2H6XA 1O8XA 3QMXA 2PERA 5CRHA 1HNCA 5C04A 4AGSA 4IJ3A 4K6XA 3VWUA 3DXBA 1NSWA 4QL7A 1FO5A 4OFMA 5D93A 3UBLA 3RDWA 3CSHA 1DBYA 2F51A 2RUFA 1WP0A 1PKZA 5HQPA 4K5SA 4ULXA 2WCIA 5GAND 3M3MA 3GUSA 1PQNA 3M0FA 2DIZA 4MF7A 5G1KA 2DKHA 2X49A 4BVYA 1K3LA 1SKWB 2E2MA 3ME7A 2OKAA 5ENUA 1JLWA 3F63A 4XCSA 1GLPA 3C1SA 3F6FA 1GSFA 2YV7A 3R2QA 1FB0A 4WXTA 1XFLA 1USBA 2VLUA 3TCOA 2GVPA 3TDGA 3TRXA 4ZBDA 2HZEA 3ZYWA 3J7Yb 2FWFA 2LUSA 1F2EA 4KF9A 3VPQA 3APSA 3O3TA 3PGTA 2GZYA 5D9XA 3MDKA 4EL1A 1OVNA 1GH2A 2I4AA 2NBSA 4IBPA 5INYA 1VF4A 3FHKA 2VM2A 3TKPA 3E9JB 2XPDA 4V2MA 4MNNA 2OBIA 2YPMA 1T4ZA 2WRTA 5ECIB 1BAYA 1AXDA 1WJKA 3BOAA 1X5DA 3IK9A 4KNDA 1T00A 2A4VA 5B8AA 4EC0A 3J7Yk 2N5AA 4KCEA 4XTSA 1XBSA 5ID2B 1SENA 4CY8A 4HJMA 1SKRB 2FGXA 2IJYA 1AC1A 1EV9A 3I69A 2DMMA 2Z9SA 5ECMB 1ERUA 3KJYA 4WKWA 1FOHA 3KD0A 4FYCA 4G2EA 5LD0A 4PTSA 1ERTA 1F3BA 3DWVA 3UIWA 3GMFA 5DCHA 3CTGA 3CBUA 1TJDA 3KCMA 2C0FA 2H76A 3GFKA 3WT1A 3KIJA 2CAIA 3IRAA 14GSA 1EEMA 5KEJA 1A2JA 1FVKA 3GNJA 4BL7A 3G9BA 4GF0A 2CVKA 1YEPA 4KB3A 1SD8A 4IN0A 5DQSA 1TK8B 3VURA 5DCGA 2X64A 1UC7A 2B7KA 2AV4A 3PPUA 3F8UA 1R4WA 5KN3A 4ID0A 5F0GA 3VK9A 4G9HA 3GA4A 1A0FA 4PURA 13GSA 4J2FA 3HJMA 2C8UA 2J9HA 3IHQA 4ECCA 2K8SA 1EZKA 2IPAA 3UOMA 3VI5A 1DSBA 3G7JA 4N10A 4RQRA 3U6VA 1A23A 2FNOA 3KXOA 3D4MA 2H6YA 4XS1A 2QA2A 5DAKA 2H1BA 3I9V2 4ML6A 2ALBA 1WWJA 3DEXA 1EP7A 2VL3A 5EL8A 1VF2A 5D9TA 1GSQA 2FD3A 4PUAA 3FK8A 5DALA 4HZ4A 3HYPA 4OO4A 4TXOB 2MMNA 2GS3A 1GTAA 3FZ4A 4N0VA 3CXGA 3S9FA 4Q5NA 4BVXB 3LQ7A 2CAQA 1OC9A 5J9BA 4HU7A 4F2IA 2C3TA 2F8FA 4O32A 4NMUA 4X1UA 1M9AA 4NHWA 2WFCA 1M99A 4BPYA 3UMAA 5J9CA 5G31A 3D0ZA 3UJ1A 3HY2A 2DC5A 1RQMA 2H0GA 3HD5A 1EWXA 4N0ZA 1NW2A 3US3A 1T7PB 3LG6A 2V6OA 3QPMA 1PX7A 1TRWA 1Z3EA 3RBTA 2LSTA 4FYUA 2ZUPA 2HFDA 1YJ6A 4ICYA 4XS6A 4I2UA 4F82A 1YKCA 3EVIA 4V2LA 1A2LA 4GRFA 1H4OA 4ZIJA 2RUEA 3TJJA 5G5FA 3A3TA 2C3NA 2K9FA 4HI7A 2QC7A 4OCEA 3FZ5A 4FO5A 4AJ6A 3EURA 4WEYA 4KDXA 3LYPA 2ON5A 2OBKA 2CX4A 1GSDA 5EPFA 1Z7RA 3W8JA 3TRPA 3IAS2 2VLTA 3K8NA 2R0CA 2DIYA 3GH6A 2VLVA 1EEJA 4YQVA 3HDCA 9GSSA 4G10A 2OE1A 3EU3A 4HEA2 1M0UA 1VF3A 1K0CA 2KLXA 3P7XA 3ZLPA 2B3SA 4ZL8A 3M9KA 4FIWA 4L5OA 2VCZA 1WMJA 3TGZA 4IQ1A 4ACSA 4O5QA 2IMFA 4MZCA 2ON7A 3KTBA 2PUKC 4WETA 5B6NA 1J0FA 1N2AA 2AYTA 3F4RA 2VO4A 3ZL5A 1VF1A 2C4JA 4GWRA 2LRNA 3TKSA 4EIQA 1R5AA 3ED3A 3NZNA 3IA1A 3ZITA 4EO3A 1OKTA 3RAZA 3GYKA 3IR4A 4LL4B 4YAVA 3ZRDA 3FZAA 3DVWA 2R4VA 2IIYA 2JSYA 3F4TA 6GSVA 4IELA 4GCIA 3RHCA 5IMFA 5DVBA 2HE3A 3C71A 2TIRA 5AGYA 4Z2RA 1BQ7A 3F6DA 1RK4A 1ABAA 4PNGA 1E2YA 4K0NA 4LLRA 2YANA 5D9WA 4HZ2A 3FR6A 4F0CA 4HJ2A 2VCXA 3ZVJD 1E6BA 5COHA 1WRYA 4ECIA 1DE1A 4IHUA 2R5GA 1DUGA 2JZTA 4IP6A 2DSAA 1YF1A 1MDKA 5IPHA 3EINA 1PN9A 4Z7XA 5B8BA 2R37A 4MH3A 4TVEA 5HR3A 2HNLA 1JHBA 3F3RA 3DMLA 2YJ7A 5DDLA 4I5QA 1QMVA 4J56E 3FEUA 4TR3A 1AAZA 4PXOA 2I3YA 4K0GA 4MDCA 1LU4A 4NWYA 1V2AA 3HJOA 5IO2A 2R0PA 4MABA 2OACA 1O6JA 1MTCA 3IAM2 3A2VA 2FCHA 3KH7A 1J08A 3ERGA 1K0AA 5F05A 1U6TA 4TR1A 2PPTA 4EDYA 4EF0A 1SK0A 1S3DA 3PR8A 4ZB8A 2QGVA 1JZOA 4Z2TA 1XOAA 4CW9A 1G0TA 2HRFA 3D21A 2YNXA 3QAWA 4IKHA 4EE0A 2FA8A 1FAAA 2GSRA 4OWYA 5DQYA 2JZSA 3TB2A 4PQ1A 4QL9A 5JCGA 1GUMA 5IMCA 1R26A 1M2AA 4EUYA 3D5JA 1SJZA 3TOTA 4MA9A 2LJRA 1JZWA 3MWHA 16GSA 4IW9A 4LA1A 2HZFA 1ZYPA 5KOWA 1CQGA 1H75A 1I5GA 3KMNA 2AAWA 1HD2A 5HFKA 3RPPA 2DJ2A 1A2MA 5JWOB 2GSSA 2GZPA 1GLQA 3P90A 1PL1A 5J5NA 3SBCA 1M7TA 2L59A 1KNGA 1TU7A 4IQAA 2LEGA 3Q19A 3HVXA 2LNTA 1TRVA 4MP4A 3GKMA 2DLXA 1SYXA 2QKEA 5IQYA 2XC2A 2VCTA 2C80A 2WDUA 22GSA 5CREA 1FB6A 1F9MA 2HXKA 4L5LA 4Q5QA 2HYXA 1XW6A 5HFGA 5KOXA 2DKIA 2L5LA 1FHEA 1SU9A 3GSSA 5A4WA 2AJQB 1DE2A 1CQHA 1TRSA 2BMXA 3UL3A 4JE1A 5ELAA 1K3YA 1O7UA 5ABRA 2CV4A 1ZCPA 2JACA 2YV9A 3D6IA 4MMMA 3TOUA 5EVOA 2TRCP 3HVVA 1S3CA 3ZTLA 1SD9A 4EVMA 3D22A 5A4VA 1BX9A 4A5PA 2RM5A 4OCFA 7GSSA 1SK2A 2XPEA 2YWNA 2K8VA 4D73A 3C1RA 1WOUA 1BYEA 5IM9A 2C1YA 1G6YA 4EKZA 4HQSA 1GTUA 4K2DA 1MD4A 3H1NA 1PRXA 1TI3A 3IBHA 2PVQA 3VI7A 4GSTA 2HT9A 3W6GA 2AB6A 5H5RA 5D96A 4MLYA 4TXOA 5ECRB 2FWEA 4ZBAA 4TOPA 4POKA 2A2RA 2A4HA 3QAGA 4KE3A 1AUCA 1Z9HA 4MZWA 2PMTA 5JCWA 5D9VA 1XXUA 2B5XA 3FW2A 3CSIA 5ECNB 4GSSA 2HSHA 5C00A 2B7JA 5CP1A 3Q74A 2LQOA 2KOKA 2C3QA 3EMPA 2H73A 3QDNA 3KZQA 1QXHA 4KSOA 3DD3A 1J9BA 1UN2A 1V57A 4OFNA 5JWQB 4NAXA 1FW1A 4HS1A 2HSMA 3ZVJA 1ML6A 3ZFBA 5G2ZA 1B9XC 3VFIA 2CA8A 2OE3A 1GRXA 2VAFA 1K0MA 3QR6A 1TP9A 4K8MA 4J57E 4BVYB 1WPIA 4O92A 19GSA 4G19A 5J3RA 3QFAC 1G6WA 3N5OA 5BRTA 3VLNA 3GN3A 1F3AA 2H1GA 4MJBA 4L0WA 2H0HA 3EC3A 1SL0B 2X4AA 1GNWA 4EDZA 2C0EA 1BJXA 4JBBA 4JU5A 2X8HA 1GSEA 4IVFA 1URMA 1RW1A 4V1Ag 4ILFA 3N9JA 3ME8A 3MSZA 3WD6A 3UAPA 2B1LA 1PA3A 3CSJA 2LRCA 4N30A 3TJKA 3Q6OA 5J41A 2IMEA 2OJLA 4KDYA 3TKSE 5F8BA 2N5BA 1SL2B 2H01A 1XWKA 3HCZA 3F3QA 2IFQA 2WB9A 4MCUA 3CRTA 3LORA 5E4WA 1ZGNA 4IP1A 5KN1A 1W4VA 3M9JA 4PUFC 3F0IA 2MBSA 2B5EA 2O87A 2GQMA 3APOA 5ECKB 2TRXA 2E7PA 3QOUA 4X43A 3NIVA 1R7HA 2O8VB 1OE7A 4QQ7A 4IS0A 4CY6A 3BJ5A 4ZILA 4ZL9A 1KEBA 1V9WA 2YZUA 1W89A 2CZ2A 2MYGA 3ZMKA 2HRKA 2L4QA 4AJ7A 2HSYA 4E8HA 3RPNA 4K7NA 2A2PA 2VCVA 5IO0A 1TDIA 2YWIA 5FWGA 4POBA 3IOSA 2B5YA 4FH8A 1GSYA 4EIPA 2H1AA 2YCDA 5ECQB 5GSTA 4X4JA 1ZZYA 2H75A 2P31A 3DGQA 4L0UA 4F03A 5KN2A 3QAVA 3FMWA 2D2ZA 2M46A 2H72A 3PINA 2X8CA 4ECBA 2V41A 1Z7PA 4XS4A 2VL9A 2OA7A 3HZ4A 3I43A 4TXVA 1XW9A 4DVCA 3EYTA 3L4NA 5F06A 2IN3A 1X0RA 3PH9A 3GTUA 4XRAA 5CYYA 2JZRA 2R0GA 1ST9A 4MPGA 1XCCA 3IE3A 4K7IA 2H1DA 4MPFA 1ZYQB 2GDRA 5LCZA 1TXXA 5A4UA 1EGRA 1XVQA 5HR1A 1XVWA 4OFTA 1X5EA 4YAPA 1T3BA 3SWLA 5D8IA 2H70A 1XPVA 3ZIVA 3TKSC 2RLIA 2PN8A 4GQFA 5AIXA 1TKDB 1GL8A 5DALB 4AJ8A 4TRXA 3LEFA 4K1FA 1EV4A 2HRAA 2H0IA 17GSA 3UVTA 4EXJA 2FLSA 4TW5A 1PN0A 3UEMA 2VUPA 1OC9B 1BEDA 1O73A 1ZOFA 2GQKA 1PX6A 2H30A 3FKFA 3IK7A 1V98A 3GKXA 3LW9A 3P2AA 3UVHA 1X5CA 5IOWA 5AIVA 1GSSA 3GL3A 4YQUA 3CRUA 5FHIA 2N5FA 2X8GA 3HA9A 1OAZA 3H4KA 2MMAA 1EP8A 5IOXA 5HR0A 3JCML 1THXA 1THOA 1M2DA 2B6MA 3NOFA 1MDJA 2XBQA 2P0GA 1QUWA 3BCKA 1GWCA 4RI6A 5FT3A 1FG4A 1A24A 3ERWA 3ZZXA 5GZZB 6GSTA 4K7OA 5H5SA 3LXTA 4YKGA 1NHOA 1PL2A 4XIHA 2LV3A 3VWXA 3WGDA 2GLRA 1M9BA 4ECJA 4NXIA 10GSA 3LSZA 4KA0A 2V2GA 4KUNA 3IXRA 2HI7A 2BTOT 1U3AA 2DJJA 5CRGA 4RUVA 2ZCTA 1XWCA 2FHEA 1LBKA 1M2BA 1OE8A 4JR6A 2WZ9A 3MAKA 3A5WA 2DMLA 1X9SB 3TUEA 3ZREA 3QFBC 4NHZA 3C73A 1X9MB 3L0HA 1T1VA 2CX3A 2B1KA 3WYWA 2WS2A 6GSYA 1Q98A 1XWBA 2R3XA 4HDEA 1GTIA 1EOHA 4G0KA 1U87A 1T4YA 6GSSA 5CRDA 1JZRA 3L9UA 3IC8A 2VL2A 2MMZA 4KSMA 1OC8A 4MJCA 5ID2A 2DJ0A 3TRQA 3VWVA 3VPTA 5HFIA 4F9ZA 2R6KA 4I6XA 2LS5A 2GQLA 1JLVA 2KHPA 3FRCA 3GKNA 2O89A 3ZFLA 2WULA 2LNSA 2X99A 1B4QA 4CHSA 1SJIA 4GLTA 3E3EA 3KM6A 2DJ1A 3BD2A 3IHGA 3LWAA 4MF5A 2P5RA 2F3MA 2R2JA 2REMA 2IMKA 4JEDA 3DRNA 1F6MC 4OMVA 5ECLB 3WT2A 2YJHA 1ZYEA 2PU9C 1GNEA 3GHAA 2K18A 1Y25A 2YZHA 2JADA 1B48A 2O7KA 4K9ZA 4GXZA 2JU5A 4MK3A 4DSSB 3ZIJA 4GTUA 1PKWA 2YWOA 1ILOA 4FYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FY6 A;  2E2G A;  2G0F A;  3O76 A;  3FY7 A;  1GP1 A;  1K3O A;  1OYJ A;  1SYR A;  3LYK A;  4TR1 B;  2NPB A;  1ERW A;  3KGK A;  2GT5 A;  3EE2 A;  4YH2 A;  1N8J A;  4OD7 A;  1EGO A;  4NPB A;  2GTU A;  4TKY A;  2H66 A;  3TJG A;  2V32 A;  3EU4 A;  5GAP D;  2EC4 A;  2L4C A;  3O6T A;  2YP6 A;  4V1A p;  5G5E A;  1Z5Y E;  3FYG A;  1U88 A;  4MJE A;  2GSQ A;  3HVS A;  2H8L A;  2F8A A;  1QQ2 A;  3W8S A;  3OR5 A;  4E8E A;  2G2Q A;  1YDK A;  2L5O A;  5E59 A;  4Q5F A;  1A0R P;  3WGX A;  3TJB A;  1XWA A;  3LGC A;  4N11 A;  4BVX A;  4ZL7 A;  4DSR A;  3EMX A;  4ISD A;  3IV4 A;  5IIZ A;  4WF4 A;  4RQX A;  1XW5 A;  11GS A;  2MBT A;  3BCI A;  4X0X A;  3HKR A;  3HJP A;  4WR5 A;  2A2S A;  3UBK A;  2CZ3 A;  1T8E B;  4ZB6 A;  4NV5 A;  2I1U A;  2H74 A;  2JSZ A;  5CNW A;  5ECS A;  2HRN A;  1SJ6 A;  1ZL9 A;  5HR2 A;  4TR0 A;  2XHF A;  2IMD A;  3IC4 A;  1VRS D;  2VOC A;  4IJI A;  1I9D A;  1FOV A;  2NVL A;  2C0D A;  1GUH A;  3M1G A;  4F0B A;  1B9Y C;  1PD2 1;  1V40 A;  1ON4 A;  2NDO A;  2IWT A;  5IMD A;  1GTB A;  1QK8 A;  1JFU A;  5DBQ A;  1Z6M A;  3VWW A;  3L9V A;  3KP8 A;  3L9S A;  2KP2 A;  4LL1 B;  3M8N A;  2ES7 A;  1TOF A;  3HZ8 A;  1A8Y A;  4LMV A;  4AF2 A;  4ZXG A;  3ZML A;  2HZE B;  1PMT A;  2VD1 A;  1PGT A;  4CDO A;  4I8B A;  1QFN A;  2EIQ A;  5L71 A;  2PBJ A;  1BG5 A;  1S3A A;  2WGR A;  3G7I A;  1QGV A;  3GV1 A;  2NTO A;  4KDU A;  1AIU A;  5JWR B;  12GS A;  4D73 B;  1C72 A;  4PGT A;  3KMO A;  1AQV A;  1K0B A;  4KGI A;  3C7M A;  1ERV A;  1GUL A;  4ZBB A;  8GSS A;  3KTL A;  3APQ A;  1MD3 A;  5ECH B;  1Q4J A;  2I81 A;  5CRW A;  4KAE A;  1PSQ A;  2QSI A;  4H86 A;  3DKS A;  1OC3 A;  4OO5 A;  1YQ1 A;  2IMI A;  2L6D A;  2DBC A;  3CMI A;  1K0N A;  3QCP A;  2AHE A;  3RHB A;  1G7E A;  2FA4 A;  4HQZ A;  1IYH A;  2MMO A;  1NM3 A;  3GIX A;  2E0Q A;  2MZC A;  2PWJ A;  5ECO B;  3KP9 A;  3F4S A;  3U5R E;  20GS A;  5AIS A;  4KCA A;  2L57 A;  3GST A;  5CAX A;  3H93 A;  2WJU A;  2CQ9 A;  1UA5 A;  2JL4 A;  3I6A A;  3GL5 A;  4GQC A;  4HUA A;  2YOI A;  3CTF A;  5IMA A;  2M72 A;  5IMV A;  3BBY A;  3ISO A;  3GH9 A;  4BWQ A;  1TW9 A;  4L8E A;  2VIM A;  4MZB A;  5IMZ A;  2CT6 A;  1B8X A;  1VGL A;  2K6V A;  1ACV A;  1Y6E A;  1G7O A;  5IPG A;  4I97 A;  3A2W A;  3LFL A;  2P5Q A;  2H19 A;  4HU9 A;  3HXS A;  1YEX A;  2VCW A;  3IDV A;  2C0G A;  3QD9 A;  1XWG A;  1B4P A;  4BWS A;  1MDI A;  3GKK A;  1Z6N A;  3IPZ A;  4MH2 A;  5LNK e;  2EIR A;  1LJR A;  1HQO A;  2GGT A;  3GUR A;  1FVJ A;  2I9H A;  2CVB A;  2LTK A;  1O8W A;  2AUV A;  1KBN A;  3GX0 A;  1HYU A;  5DAK B;  1OKD A;  5EY6 A;  1WIK A;  2DJ3 A;  3H79 A;  5F07 A;  2FWH A;  4PQH A;  1UVZ A;  18GS A;  1WE0 A;  2KP1 A;  3TJF A;  3KEB A;  3GRX A;  4XRD A;  4WF5 A;  1NHY A;  4JRR A;  5DJM A;  2OE0 A;  3V1W A;  1GSU A;  2IFQ B;  4DSQ A;  1ZMA A;  3TKR A;  2LRT A;  3L78 A;  2VCQ A;  4I2T A;  2LJK A;  1O81 A;  3FZ9 A;  4PQI A;  2HLS A;  1JZD A;  5A5K A;  3MNG A;  3P8W A;  4WR4 A;  2PGT A;  1MEK A;  4KX4 A;  1KTE A;  2H71 A;  1K0D A;  1X9W B;  3HHV A;  1XOB A;  1U3I A;  4LMW A;  4GSN A;  3ERF A;  2BJX A;  3KH9 A;  4WBR D;  4YQM A;  3WGE A;  2L6C A;  3FR3 A;  4Q5R A;  4TN8 A;  3A2X A;  4O7H A;  5G1L A;  3E0U A;  3G7Y A;  2YWM A;  2FUG 2;  1SK1 A;  4RI7 A;  4DEJ A;  5B7C A;  4MF6 A;  5JCU A;  1AQW A;  2O85 A;  5H5Q A;  2J23 A;  5B6M A;  1TK0 B;  3UAR A;  1GUK A;  1EOG A;  4ML1 A;  4PX1 A;  5D73 A;  2LKU A;  2V1M A;  2GST A;  1XZO A;  4MJA A;  1AQX A;  4ZB9 A;  5GSS A;  4BA7 A;  3F9U A;  1V58 A;  2KUC A;  1TU8 A;  1A8L A;  1YY7 A;  2M80 A;  4POL A;  1SL1 B;  2VD0 A;  4PNF A;  2RM6 A;  1YF0 A;  3LJR A;  4DSS A;  1AW9 A;  4POM A;  5CO3 A;  6GSU A;  1O85 A;  5G30 A;  1F37 A;  1TI1 A;  4XS4 B;  4XHM A;  2H6Z A;  2PVO C;  3FR9 A;  2ZNM A;  4HOJ A;  4V2N A;  1HNB A;  2F9S A;  4JR4 A;  1SKS B;  3GTU B;  5J4U A;  4NV2 A;  4KH7 A;  5DJL A;  1IYI A;  1HNA A;  2LJA A;  2V6K A;  3C8E A;  2DJK A;  3CYN A;  3TKQ A;  1XIY A;  6GSX A;  3DVX A;  3EWL A;  5KN0 A;  3LXZ A;  3Q18 A;  2RII A;  1YKA A;  3DYR A;  4JZQ A;  3D4T A;  4KW6 A;  4TR4 A;  4WBJ A;  4P3Y B;  1R5P A;  1K0O A;  2GZZ A;  2VM1 A;  3H8Q A;  1TRU A;  5ELG A;  2XBI A;  6GSW A;  2LQQ A;  2CVD A;  4O5R A;  3GX8 A;  1TTZ A;  4IGJ A;  2YN1 A;  5AN1 A;  2VL2 C;  1TK5 B;  3AY8 A;  2FWG A;  2EIO A;  2IL3 A;  5ECP B;  3DIE A;  2GT6 A;  2OAD A;  1YZX A;  2H6X A;  1O8X A;  3QMX A;  2PER A;  5CRH A;  1HNC A;  5C04 A;  4AGS A;  4IJ3 A;  4K6X A;  3VWU A;  3DXB A;  1NSW A;  4QL7 A;  1FO5 A;  4OFM A;  5D93 A;  3UBL A;  3RDW A;  3CSH A;  1DBY A;  2F51 A;  2RUF A;  1WP0 A;  1PKZ A;  5HQP A;  4ULX A;  2WCI A;  5GAN D;  3M3M A;  3GUS A;  1PQN A;  3M0F A;  2DIZ A;  4MF7 A;  5G1K A;  4BVY A;  1K3L A;  1SKW B;  2E2M A;  3ME7 A;  2OKA A;  5ENU A;  1JLW A;  3F63 A;  4XCS A;  1GLP A;  3C1S A;  3F6F A;  1GSF A;  2YV7 A;  3R2Q A;  1FB0 A;  4WXT A;  1XFL A;  1USB A;  2VLU A;  3TCO A;  2GVP A;  3TDG A;  3TRX A;  4ZBD A;  2HZE A;  3ZYW A;  3J7Y b;  2FWF A;  2LUS A;  1F2E A;  3VPQ A;  3APS A;  3O3T A;  3PGT A;  2GZY A;  5D9X A;  3MDK A;  4EL1 A;  1OVN A;  1GH2 A;  2I4A A;  2NBS A;  4IBP A;  5INY A;  1VF4 A;  3FHK A;  2VM2 A;  3TKP A;  3E9J B;  2XPD A;  4V2M A;  2OBI A;  2YPM A;  1T4Z A;  2WRT A;  5ECI B;  1BAY A;  1AXD A;  1WJK A;  3BOA A;  1X5D A;  3IK9 A;  4KND A;  1T00 A;  2A4V A;  5B8A A;  4EC0 A;  3J7Y k;  2N5A A;  4KCE A;  4XTS A;  1XBS A;  5ID2 B;  1SEN A;  4HJM A;  1SKR B;  2FGX A;  2IJY A;  1AC1 A;  1EV9 A;  3I69 A;  2DMM A;  2Z9S A;  5ECM B;  1ERU A;  3KJY A;  4WKW A;  3KD0 A;  4FYC A;  4G2E A;  5LD0 A;  1ERT A;  1F3B A;  3DWV A;  3UIW A;  3GMF A;  5DCH A;  3CTG A;  3CBU A;  1TJD A;  3KCM A;  2C0F A;  2H76 A;  3GFK A;  3WT1 A;  3KIJ A;  2CAI A;  3IRA A;  14GS A;  1EEM A;  5KEJ A;  1A2J A;  1FVK A;  3GNJ A;  4BL7 A;  3G9B A;  4GF0 A;  2CVK A;  1YEP A;  4KB3 A;  1SD8 A;  4IN0 A;  5DQS A;  1TK8 B;  3VUR A;  5DCG A;  2X64 A;  1UC7 A;  2B7K A;  2AV4 A;  3F8U A;  1R4W A;  5KN3 A;  4ID0 A;  5F0G A;  3VK9 A;  4G9H A;  3GA4 A;  1A0F A;  4PUR A;  13GS A;  4J2F A;  3HJM A;  2C8U A;  2J9H A;  3IHQ A;  4ECC A;  2K8S A;  1EZK A;  2IPA A;  3UOM A;  3VI5 A;  1DSB A;  3G7J A;  4N10 A;  4RQR A;  3U6V A;  1A23 A;  2FNO A;  3KXO A;  3D4M A;  2H6Y A;  4XS1 A;  5DAK A;  2H1B A;  3I9V 2;  4ML6 A;  2ALB A;  1WWJ A;  3DEX A;  1EP7 A;  2VL3 A;  5EL8 A;  1VF2 A;  5D9T A;  1GSQ A;  2FD3 A;  4PUA A;  3FK8 A;  5DAL A;  4HZ4 A;  3HYP A;  4OO4 A;  4TXO B;  2MMN A;  2GS3 A;  1GTA A;  3FZ4 A;  4N0V A;  3CXG A;  3S9F A;  4Q5N A;  3LQ7 A;  2CAQ A;  1OC9 A;  5J9B A;  4HU7 A;  4F2I A;  2C3T A;  2F8F A;  4O32 A;  4NMU A;  4X1U A;  1M9A A;  4NHW A;  2WFC A;  1M99 A;  4BPY A;  3UMA A;  5J9C A;  5G31 A;  3D0Z A;  3UJ1 A;  3HY2 A;  2DC5 A;  1RQM A;  2H0G A;  3HD5 A;  1EWX A;  4N0Z A;  1NW2 A;  3US3 A;  1T7P B;  3LG6 A;  2V6O A;  3QPM A;  1PX7 A;  1TRW A;  1Z3E A;  3RBT A;  2LST A;  4FYU A;  2ZUP A;  2HFD A;  1YJ6 A;  4XS6 A;  4I2U A;  4F82 A;  1YKC A;  3EVI A;  4V2L A;  1A2L A;  4GRF A;  1H4O A;  4ZIJ A;  2RUE A;  3TJJ A;  5G5F A;  3A3T A;  2C3N A;  2K9F A;  4HI7 A;  2QC7 A;  4OCE A;  3FZ5 A;  4FO5 A;  4AJ6 A;  3EUR A;  4WEY A;  4KDX A;  3LYP A;  2ON5 A;  2OBK A;  2CX4 A;  1GSD A;  5EPF A;  1Z7R A;  3W8J A;  3TRP A;  3IAS 2;  2VLT A;  3K8N A;  2DIY A;  3GH6 A;  2VLV A;  1EEJ A;  4YQV A;  3HDC A;  9GSS A;  4G10 A;  2OE1 A;  3EU3 A;  4HEA 2;  1M0U A;  1VF3 A;  1K0C A;  2KLX A;  3P7X A;  3ZLP A;  2B3S A;  4ZL8 A;  3M9K A;  4FIW A;  4L5O A;  2VCZ A;  1WMJ A;  3TGZ A;  4IQ1 A;  4ACS A;  2IMF A;  4MZC A;  2ON7 A;  3KTB A;  2PUK C;  4WET A;  5B6N A;  1J0F A;  1N2A A;  2AYT A;  3F4R A;  2VO4 A;  3ZL5 A;  1VF1 A;  2C4J A;  4GWR A;  2LRN A;  3TKS A;  1R5A A;  3ED3 A;  3NZN A;  3IA1 A;  3ZIT A;  4EO3 A;  1OKT A;  3RAZ A;  3GYK A;  3IR4 A;  4LL4 B;  4YAV A;  3ZRD A;  3FZA A;  3DVW A;  2R4V A;  2IIY A;  2JSY A;  3F4T A;  6GSV A;  4IEL A;  4GCI A;  3RHC A;  5IMF A;  5DVB A;  2HE3 A;  3C71 A;  2TIR A;  5AGY A;  1BQ7 A;  3F6D A;  1RK4 A;  1ABA A;  4PNG A;  1E2Y A;  4K0N A;  4LLR A;  2YAN A;  5D9W A;  4HZ2 A;  3FR6 A;  4F0C A;  4HJ2 A;  2VCX A;  3ZVJ D;  1E6B A;  5COH A;  1WRY A;  4ECI A;  1DE1 A;  4IHU A;  2R5G A;  1DUG A;  2JZT A;  4IP6 A;  2DSA A;  1YF1 A;  1MDK A;  5IPH A;  3EIN A;  1PN9 A;  4Z7X A;  5B8B A;  2R37 A;  4MH3 A;  4TVE A;  5HR3 A;  2HNL A;  1JHB A;  3F3R A;  3DML A;  2YJ7 A;  5DDL A;  4I5Q A;  1QMV A;  4J56 E;  3FEU A;  4TR3 A;  1AAZ A;  4PXO A;  2I3Y A;  4K0G A;  4MDC A;  1LU4 A;  4NWY A;  1V2A A;  3HJO A;  5IO2 A;  4MAB A;  2OAC A;  1O6J A;  1MTC A;  3IAM 2;  3A2V A;  2FCH A;  3KH7 A;  1J08 A;  3ERG A;  1K0A A;  5F05 A;  1U6T A;  4TR1 A;  2PPT A;  4EDY A;  4EF0 A;  1SK0 A;  1S3D A;  3PR8 A;  4ZB8 A;  2QGV A;  1JZO A;  1XOA A;  4CW9 A;  1G0T A;  2HRF A;  3D21 A;  2YNX A;  3QAW A;  4IKH A;  4EE0 A;  2FA8 A;  1FAA A;  2GSR A;  4OWY A;  5DQY A;  2JZS A;  3TB2 A;  4PQ1 A;  4QL9 A;  5JCG A;  1GUM A;  5IMC A;  1R26 A;  1M2A A;  4EUY A;  3D5J A;  1SJZ A;  3TOT A;  4MA9 A;  2LJR A;  1JZW A;  3MWH A;  16GS A;  4IW9 A;  4LA1 A;  2HZF A;  1CQG A;  1H75 A;  1I5G A;  3KMN A;  2AAW A;  1HD2 A;  5HFK A;  3RPP A;  2DJ2 A;  1A2M A;  5JWO B;  2GSS A;  2GZP A;  1GLQ A;  3P90 A;  1PL1 A;  5J5N A;  3SBC A;  1M7T A;  2L59 A;  1KNG A;  1TU7 A;  4IQA A;  2LEG A;  3Q19 A;  3HVX A;  2LNT A;  1TRV A;  4MP4 A;  3GKM A;  2DLX A;  1SYX A;  2QKE A;  5IQY A;  2XC2 A;  2VCT A;  2C80 A;  2WDU A;  22GS A;  5CRE A;  1FB6 A;  1F9M A;  2HXK A;  4L5L A;  4Q5Q A;  2HYX A;  1XW6 A;  5HFG A;  2L5L A;  1FHE A;  1SU9 A;  3GSS A;  5A4W A;  2AJQ B;  1DE2 A;  1CQH A;  1TRS A;  2BMX A;  3UL3 A;  4JE1 A;  5ELA A;  1K3Y A;  1O7U A;  5ABR A;  2CV4 A;  1ZCP A;  2JAC A;  2YV9 A;  3D6I A;  4MMM A;  3TOU A;  5EVO A;  2TRC P;  3HVV A;  1S3C A;  3ZTL A;  1SD9 A;  4EVM A;  3D22 A;  5A4V A;  1BX9 A;  2RM5 A;  4OCF A;  7GSS A;  1SK2 A;  2XPE A;  2YWN A;  2K8V A;  4D73 A;  3C1R A;  1WOU A;  1BYE A;  5IM9 A;  2C1Y A;  1G6Y A;  4EKZ A;  4HQS A;  1GTU A;  4K2D A;  1MD4 A;  3H1N A;  1PRX A;  1TI3 A;  3IBH A;  2PVQ A;  3VI7 A;  4GST A;  2HT9 A;  3W6G A;  2AB6 A;  5H5R A;  5D96 A;  4MLY A;  4TXO A;  5ECR B;  2FWE A;  4ZBA A;  4TOP A;  4POK A;  2A2R A;  3QAG A;  4KE3 A;  1AUC A;  1Z9H A;  4MZW A;  2PMT A;  5JCW A;  5D9V A;  1XXU A;  2B5X A;  3FW2 A;  3CSI A;  5ECN B;  4GSS A;  2HSH A;  5C00 A;  2B7J A;  5CP1 A;  3Q74 A;  2LQO A;  2KOK A;  2C3Q A;  3EMP A;  2H73 A;  3QDN A;  3KZQ A;  1QXH A;  4KSO A;  3DD3 A;  1J9B A;  1UN2 A;  1V57 A;  4OFN A;  5JWQ B;  4NAX A;  1FW1 A;  4HS1 A;  3ZVJ A;  1ML6 A;  3ZFB A;  5G2Z A;  1B9X C;  3VFI A;  2CA8 A;  2OE3 A;  1GRX A;  2VAF A;  1K0M A;  3QR6 A;  1TP9 A;  4K8M A;  4J57 E;  1WPI A;  4O92 A;  19GS A;  4G19 A;  5J3R A;  3QFA C;  1G6W A;  3N5O A;  3VLN A;  3GN3 A;  1F3A A;  2H1G A;  4MJB A;  4L0W A;  2H0H A;  3EC3 A;  1SL0 B;  1GNW A;  4EDZ A;  2C0E A;  1BJX A;  4JBB A;  4JU5 A;  2X8H A;  1GSE A;  4IVF A;  1URM A;  1RW1 A;  4V1A g;  4ILF A;  3N9J A;  3ME8 A;  3MSZ A;  3WD6 A;  3UAP A;  2B1L A;  1PA3 A;  3CSJ A;  2LRC A;  4N30 A;  3TJK A;  3Q6O A;  5J41 A;  2IME A;  2OJL A;  4KDY A;  3TKS E;  5F8B A;  2N5B A;  1SL2 B;  2H01 A;  1XWK A;  3HCZ A;  3F3Q A;  2IFQ A;  2WB9 A;  4MCU A;  3CRT A;  3LOR A;  5E4W A;  1ZGN A;  4IP1 A;  5KN1 A;  1W4V A;  3M9J A;  4PUF C;  3F0I A;  2MBS A;  2B5E A;  2O87 A;  2GQM A;  3APO A;  5ECK B;  2TRX A;  2E7P A;  3QOU A;  4X43 A;  3NIV A;  1R7H A;  2O8V B;  1OE7 A;  4QQ7 A;  4IS0 A;  3BJ5 A;  4ZIL A;  4ZL9 A;  1KEB A;  1V9W A;  2YZU A;  1W89 A;  2CZ2 A;  2MYG A;  3ZMK A;  2L4Q A;  4AJ7 A;  2HSY A;  4E8H A;  3RPN A;  4K7N A;  2VCV A;  5IO0 A;  1TDI A;  2YWI A;  5FWG A;  4POB A;  3IOS A;  2B5Y A;  4FH8 A;  1GSY A;  2H1A A;  2YCD A;  5ECQ B;  5GST A;  1ZZY A;  2H75 A;  2P31 A;  3DGQ A;  4L0U A;  4F03 A;  5KN2 A;  3QAV A;  2D2Z A;  2M46 A;  2H72 A;  3PIN A;  2X8C A;  4ECB A;  2V41 A;  1Z7P A;  4XS4 A;  2VL9 A;  2OA7 A;  3HZ4 A;  3I43 A;  4TXV A;  1XW9 A;  4DVC A;  3EYT A;  3L4N A;  5F06 A;  2IN3 A;  1X0R A;  3PH9 A;  3GTU A;  4XRA A;  5CYY A;  2JZR A;  1ST9 A;  4MPG A;  1XCC A;  3IE3 A;  4K7I A;  2H1D A;  4MPF A;  1ZYQ B;  2GDR A;  5LCZ A;  1TXX A;  5A4U A;  1EGR A;  1XVQ A;  5HR1 A;  1XVW A;  4OFT A;  1X5E A;  4YAP A;  1T3B A;  3SWL A;  5D8I A;  2H70 A;  1XPV A;  3ZIV A;  3TKS C;  2RLI A;  2PN8 A;  4GQF A;  5AIX A;  1TKD B;  1GL8 A;  5DAL B;  4AJ8 A;  4TRX A;  3LEF A;  4K1F A;  1EV4 A;  2H0I A;  17GS A;  3UVT A;  4EXJ A;  2FLS A;  4TW5 A;  3UEM A;  2VUP A;  1OC9 B;  1BED A;  1O73 A;  1ZOF A;  2GQK A;  1PX6 A;  2H30 A;  3FKF A;  3IK7 A;  1V98 A;  3GKX A;  3P2A A;  3UVH A;  1X5C A;  5IOW A;  5AIV A;  1GSS A;  3GL3 A;  4YQU A;  3CRU A;  5FHI A;  2N5F A;  2X8G A;  3HA9 A;  1OAZ A;  3H4K A;  2MMA A;  1EP8 A;  5IOX A;  5HR0 A;  3JCM L;  1THX A;  1THO A;  1M2D A;  2B6M A;  3NOF A;  1MDJ A;  2XBQ A;  2P0G A;  1QUW A;  3BCK A;  1GWC A;  4RI6 A;  5FT3 A;  1FG4 A;  1A24 A;  3ERW A;  3ZZX A;  5GZZ B;  6GST A;  4K7O A;  5H5S A;  3LXT A;  1NHO A;  1PL2 A;  4XIH A;  2LV3 A;  3VWX A;  3WGD A;  2GLR A;  1M9B A;  4ECJ A;  4NXI A;  10GS A;  3LSZ A;  4KA0 A;  2V2G A;  4KUN A;  3IXR A;  2HI7 A;  2BTO T;  1U3A A;  2DJJ A;  5CRG A;  4RUV A;  2ZCT A;  1XWC A;  2FHE A;  1LBK A;  1M2B A;  1OE8 A;  4JR6 A;  2WZ9 A;  3MAK A;  3A5W A;  2DML A;  1X9S B;  3TUE A;  3ZRE A;  3QFB C;  4NHZ A;  3C73 A;  1X9M B;  3L0H A;  1T1V A;  2CX3 A;  2B1K A;  3WYW A;  2WS2 A;  6GSY A;  1Q98 A;  1XWB A;  2R3X A;  4HDE A;  1GTI A;  1EOH A;  1U87 A;  1T4Y A;  6GSS A;  5CRD A;  1JZR A;  3L9U A;  2VL2 A;  2MMZ A;  4KSM A;  1OC8 A;  4MJC A;  5ID2 A;  2DJ0 A;  3TRQ A;  3VWV A;  3VPT A;  5HFI A;  4F9Z A;  2R6K A;  4I6X A;  2LS5 A;  2GQL A;  1JLV A;  2KHP A;  3FRC A;  3GKN A;  2O89 A;  3ZFL A;  2WUL A;  2LNS A;  2X99 A;  1B4Q A;  4CHS A;  1SJI A;  4GLT A;  3E3E A;  3KM6 A;  2DJ1 A;  3BD2 A;  3LWA A;  4MF5 A;  2P5R A;  2F3M A;  2R2J A;  2REM A;  2IMK A;  4JED A;  3DRN A;  1F6M C;  4OMV A;  5ECL B;  3WT2 A;  2YJH A;  1ZYE A;  2PU9 C;  1GNE A;  3GHA A;  2K18 A;  1Y25 A;  2YZH A;  2JAD A;  1B48 A;  2O7K A;  4K9Z A;  4GXZ A;  2JU5 A;  4MK3 A;  4DSS B;  3ZIJ A;  4GTU A;  1PKW A;  2YWO A;  1ILO A;  4FYB A; 
#chains in the Genus database with same CATH topology
 2FY6 A;  2E2G A;  2G0F A;  3O76 A;  3FY7 A;  1GP1 A;  4K5R A;  1K3O A;  1OYJ A;  3EPT A;  1SYR A;  3LYK A;  4TR1 B;  2NPB A;  2UZ8 A;  1ERW A;  3KGK A;  2GT5 A;  3EE2 A;  4YH2 A;  1N8J A;  4OD7 A;  1EGO A;  4NPB A;  2GTU A;  4TKY A;  2H66 A;  3TJG A;  2V32 A;  3EU4 A;  5GAP D;  2EC4 A;  2L4C A;  3O6T A;  4G0I A;  2YP6 A;  4V1A p;  5G5E A;  1Z5Y E;  3FYG A;  1U88 A;  4MJE A;  4G0L A;  2GSQ A;  3HVS A;  2H8L A;  2F8A A;  1QQ2 A;  3W8S A;  3OR5 A;  4E8E A;  2G2Q A;  1YDK A;  2L5O A;  5E59 A;  4Q5F A;  1A0R P;  3WGX A;  3TJB A;  1XWA A;  3LGC A;  4N11 A;  4BVX A;  4ZL7 A;  1XG8 A;  4DSR A;  3EMX A;  4ISD A;  3IV4 A;  5IIZ A;  4WF4 A;  4RQX A;  1XW5 A;  4YKF A;  11GS A;  2MBT A;  3BCI A;  4X0X A;  3HKR A;  3HJP A;  4WR5 A;  2A2S A;  3UBK A;  2CZ3 A;  1T8E B;  4ZB6 A;  4NV5 A;  2I1U A;  2H74 A;  2JSZ A;  5CNW A;  5ECS A;  2HRN A;  1SJ6 A;  1ZL9 A;  5HR2 A;  4TR0 A;  2XHF A;  2IMD A;  3IC4 A;  1VRS D;  2VOC A;  4HSC X;  4IJI A;  1I9D A;  1ZYN A;  1FOV A;  2NVL A;  2C0D A;  1GUH A;  3M1G A;  4F0B A;  1B9Y C;  1PD2 1;  1V40 A;  1ON4 A;  2NDO A;  2IWT A;  5IMD A;  1GTB A;  1QK8 A;  1JFU A;  5DBQ A;  1Z6M A;  3VWW A;  3L9V A;  3KP8 A;  3L9S A;  2KP2 A;  4LL1 B;  3M8N A;  2ES7 A;  1TOF A;  3HZ8 A;  4USS A;  1A8Y A;  4LMV A;  4AF2 A;  4ZXG A;  3ZML A;  2HZE B;  1PMT A;  2VD1 A;  1PGT A;  4CDO A;  4I8B A;  1QFN A;  2EIQ A;  4K2X A;  5L71 A;  2PBJ A;  1BG5 A;  3MYD A;  1S3A A;  2WGR A;  3G7I A;  1QGV A;  3GV1 A;  2NTO A;  4KDU A;  3A5I A;  1AIU A;  5JWR B;  12GS A;  4D73 B;  1C72 A;  4PGT A;  3KMO A;  1AQV A;  1K0B A;  4KGI A;  3C7M A;  1ERV A;  1GUL A;  4ZBB A;  8GSS A;  3KTL A;  3APQ A;  1MD3 A;  2QA1 A;  5ECH B;  1Q4J A;  2I81 A;  5CRW A;  4KAE A;  1PSQ A;  2QSI A;  4H86 A;  3DKS A;  1OC3 A;  4OO5 A;  1YQ1 A;  2IMI A;  4BIK A;  2L6D A;  2DBC A;  3CMI A;  1K0N A;  3QCP A;  2AHE A;  3RHB A;  1G7E A;  2FA4 A;  4HQZ A;  1IYH A;  2MMO A;  1NM3 A;  3GIX A;  2E0Q A;  2MZC A;  2PWJ A;  5ECO B;  3KP9 A;  5BMU A;  3F4S A;  3U5R E;  20GS A;  5AIS A;  4KCA A;  2L57 A;  3GST A;  5CAX A;  3H93 A;  2WJU A;  2CQ9 A;  1UA5 A;  2JL4 A;  3I6A A;  3GL5 A;  4GQC A;  4HUA A;  2YOI A;  3CTF A;  5IMA A;  2M72 A;  4BL7 B;  5IMV A;  3BBY A;  3ISO A;  3GH9 A;  4BWQ A;  1TW9 A;  4L8E A;  2VIM A;  4MZB A;  5IMZ A;  2CT6 A;  1B8X A;  1VGL A;  2K6V A;  1ACV A;  1Y6E A;  1G7O A;  5IPG A;  4I97 A;  3A2W A;  3LFL A;  2P5Q A;  2H19 A;  4HU9 A;  3HXS A;  1YEX A;  2VCW A;  3IDV A;  2C0G A;  3QD9 A;  1XWG A;  1B4P A;  4BWS A;  1MDI A;  3GKK A;  1Z6N A;  3IPZ A;  4MH2 A;  5LNK e;  2EIR A;  1LJR A;  1HQO A;  2GGT A;  3GUR A;  4Z2U A;  1FVJ A;  2I9H A;  2CVB A;  2LTK A;  1O8W A;  2AUV A;  1KBN A;  3GX0 A;  1HYU A;  5DAK B;  1OKD A;  5EY6 A;  1WIK A;  2DJ3 A;  3H79 A;  5F07 A;  2FWH A;  4PQH A;  1UVZ A;  18GS A;  1WE0 A;  2KP1 A;  3TJF A;  3KEB A;  3GRX A;  4XRD A;  4WF5 A;  1NHY A;  4JRR A;  5DJM A;  2OE0 A;  3V1W A;  1GSU A;  2IFQ B;  4DSQ A;  1ZMA A;  3TKR A;  2LRT A;  3L78 A;  2VCQ A;  4I2T A;  2LJK A;  1O81 A;  3FZ9 A;  4PQI A;  2HLS A;  1JZD A;  5A5K A;  3MNG A;  3HVN A;  3R3E A;  3P8W A;  4WR4 A;  2PGT A;  1MEK A;  4KX4 A;  1KTE A;  2H71 A;  1K0D A;  1X9W B;  3HHV A;  1XOB A;  1U3I A;  4LMW A;  4GSN A;  3ERF A;  2BJX A;  3KH9 A;  4WBR D;  4YQM A;  3WGE A;  2L6C A;  3FR3 A;  4Q5R A;  4TN8 A;  3A2X A;  4O7H A;  5G1L A;  3E0U A;  3G7Y A;  2YWM A;  3MIX A;  2FUG 2;  1SK1 A;  4RI7 A;  4DEJ A;  5B7C A;  4MF6 A;  5JCU A;  1AQW A;  2O85 A;  5H5Q A;  2J23 A;  5B6M A;  1TK0 B;  3UAR A;  1GUK A;  1EOG A;  4ML1 A;  4PX1 A;  5D73 A;  2LKU A;  2V1M A;  2GST A;  1XZO A;  4MJA A;  1AQX A;  4ZB9 A;  5GSS A;  4BA7 A;  3F9U A;  1V58 A;  2KUC A;  1TU8 A;  1A8L A;  1YY7 A;  2M80 A;  4POL A;  1SL1 B;  2VD0 A;  4PNF A;  2RM6 A;  1YF0 A;  3LJR A;  4DSS A;  1AW9 A;  4POM A;  5CO3 A;  6GSU A;  1O85 A;  5G30 A;  1F37 A;  1TI1 A;  4XS4 B;  4XHM A;  2H6Z A;  2PVO C;  3FR9 A;  2ZNM A;  4HOJ A;  4V2N A;  1HNB A;  2F9S A;  4JR4 A;  1SKS B;  3GTU B;  5J4U A;  4NV2 A;  4KH7 A;  5DJL A;  1IYI A;  1HNA A;  2LJA A;  2V6K A;  3C8E A;  2DJK A;  3CYN A;  3TKQ A;  1XIY A;  6GSX A;  3DVX A;  3EWL A;  5KN0 A;  4FQU A;  3LXZ A;  3Q18 A;  2RII A;  1YKA A;  3DYR A;  4JZQ A;  3D4T A;  4KW6 A;  4TR4 A;  4WBJ A;  4P3Y B;  1R5P A;  1K0O A;  2GZZ A;  2VM1 A;  3H8Q A;  1TRU A;  5ELG A;  2XBI A;  6GSW A;  2LQQ A;  2CVD A;  4O5R A;  3GX8 A;  1TTZ A;  4IGJ A;  2YN1 A;  5AN1 A;  2VL2 C;  1TK5 B;  3AY8 A;  2FWG A;  2EIO A;  2IL3 A;  5ECP B;  3DIE A;  4O5U A;  2GT6 A;  2OAD A;  1YZX A;  2H6X A;  1O8X A;  3QMX A;  2PER A;  5CRH A;  1HNC A;  5C04 A;  4AGS A;  4IJ3 A;  4K6X A;  3VWU A;  3DXB A;  1NSW A;  4QL7 A;  1FO5 A;  4OFM A;  5D93 A;  3UBL A;  3RDW A;  3CSH A;  1DBY A;  2F51 A;  2RUF A;  1WP0 A;  1PKZ A;  5HQP A;  4K5S A;  4ULX A;  2WCI A;  5GAN D;  3M3M A;  3GUS A;  1PQN A;  3M0F A;  2DIZ A;  4MF7 A;  5G1K A;  2DKH A;  2X49 A;  4BVY A;  1K3L A;  1SKW B;  2E2M A;  3ME7 A;  2OKA A;  5ENU A;  1JLW A;  3F63 A;  4XCS A;  1GLP A;  3C1S A;  3F6F A;  1GSF A;  2YV7 A;  3R2Q A;  1FB0 A;  4WXT A;  1XFL A;  1USB A;  2VLU A;  3TCO A;  2GVP A;  3TDG A;  3TRX A;  4ZBD A;  2HZE A;  3ZYW A;  3J7Y b;  2FWF A;  2LUS A;  1F2E A;  4KF9 A;  3VPQ A;  3APS A;  3O3T A;  3PGT A;  2GZY A;  1M3J A;  5D9X A;  3MDK A;  4EL1 A;  1OVN A;  1GH2 A;  2I4A A;  2NBS A;  4IBP A;  5INY A;  1VF4 A;  3FHK A;  2VM2 A;  3TKP A;  3E9J B;  2XPD A;  4V2M A;  4MNN A;  2OBI A;  2YPM A;  1T4Z A;  2WRT A;  5ECI B;  1BAY A;  1AXD A;  1WJK A;  3BOA A;  1X5D A;  3IK9 A;  4KND A;  1T00 A;  2A4V A;  5B8A A;  4EC0 A;  3J7Y k;  2N5A A;  4KCE A;  4XTS A;  1XBS A;  5ID2 B;  1SEN A;  4CY8 A;  4HJM A;  1SKR B;  2FGX A;  2IJY A;  1AC1 A;  1EV9 A;  3I69 A;  2DMM A;  2Z9S A;  5ECM B;  1ERU A;  3KJY A;  4WKW A;  1FOH A;  3KD0 A;  4FYC A;  4G2E A;  5LD0 A;  4PTS A;  1ERT A;  1F3B A;  3DWV A;  3UIW A;  3GMF A;  5DCH A;  3CTG A;  3CBU A;  1TJD A;  3KCM A;  2C0F A;  2H76 A;  3GFK A;  3WT1 A;  3KIJ A;  2CAI A;  3IRA A;  14GS A;  1EEM A;  5KEJ A;  1A2J A;  1FVK A;  3GNJ A;  4BL7 A;  3G9B A;  4GF0 A;  2CVK A;  1YEP A;  4KB3 A;  1SD8 A;  4IN0 A;  5DQS A;  1TK8 B;  3VUR A;  5DCG A;  2X64 A;  1UC7 A;  2B7K A;  2AV4 A;  3PPU A;  3F8U A;  1R4W A;  5KN3 A;  4ID0 A;  5F0G A;  3VK9 A;  4G9H A;  3GA4 A;  1A0F A;  4PUR A;  13GS A;  4J2F A;  3HJM A;  2C8U A;  2J9H A;  3IHQ A;  4ECC A;  2K8S A;  1EZK A;  2IPA A;  3UOM A;  3VI5 A;  1DSB A;  3G7J A;  4N10 A;  4RQR A;  3U6V A;  1A23 A;  2FNO A;  3KXO A;  3D4M A;  2H6Y A;  4XS1 A;  2QA2 A;  5DAK A;  2H1B A;  3I9V 2;  4ML6 A;  2ALB A;  1WWJ A;  3DEX A;  1EP7 A;  2VL3 A;  5EL8 A;  1VF2 A;  5D9T A;  1GSQ A;  2FD3 A;  4PUA A;  3FK8 A;  5DAL A;  4HZ4 A;  3HYP A;  4OO4 A;  4TXO B;  2MMN A;  2GS3 A;  1GTA A;  3FZ4 A;  4N0V A;  3CXG A;  3S9F A;  4Q5N A;  4BVX B;  3LQ7 A;  2CAQ A;  1OC9 A;  5J9B A;  4HU7 A;  4F2I A;  2C3T A;  2F8F A;  4O32 A;  4NMU A;  4X1U A;  1M9A A;  4NHW A;  2WFC A;  1M99 A;  4BPY A;  3UMA A;  5J9C A;  5G31 A;  3D0Z A;  3UJ1 A;  3HY2 A;  2DC5 A;  1RQM A;  2H0G A;  3HD5 A;  1EWX A;  4N0Z A;  1NW2 A;  3US3 A;  1T7P B;  3LG6 A;  2V6O A;  3QPM A;  1PX7 A;  1TRW A;  1Z3E A;  3RBT A;  2LST A;  4FYU A;  2ZUP A;  2HFD A;  1YJ6 A;  4ICY A;  4XS6 A;  4I2U A;  4F82 A;  1YKC A;  3EVI A;  4V2L A;  1A2L A;  4GRF A;  1H4O A;  4ZIJ A;  2RUE A;  3TJJ A;  5G5F A;  3A3T A;  2C3N A;  2K9F A;  4HI7 A;  2QC7 A;  4OCE A;  3FZ5 A;  4FO5 A;  4AJ6 A;  3EUR A;  4WEY A;  4KDX A;  3LYP A;  2ON5 A;  2OBK A;  2CX4 A;  1GSD A;  5EPF A;  1Z7R A;  3W8J A;  3TRP A;  3IAS 2;  2VLT A;  3K8N A;  2R0C A;  2DIY A;  3GH6 A;  2VLV A;  1EEJ A;  4YQV A;  3HDC A;  9GSS A;  4G10 A;  2OE1 A;  3EU3 A;  4HEA 2;  1M0U A;  1VF3 A;  1K0C A;  2KLX A;  3P7X A;  3ZLP A;  2B3S A;  4ZL8 A;  3M9K A;  4FIW A;  4L5O A;  2VCZ A;  1WMJ A;  3TGZ A;  4IQ1 A;  4ACS A;  4O5Q A;  2IMF A;  4MZC A;  2ON7 A;  3KTB A;  2PUK C;  4WET A;  5B6N A;  1J0F A;  1N2A A;  2AYT A;  3F4R A;  2VO4 A;  3ZL5 A;  1VF1 A;  2C4J A;  4GWR A;  2LRN A;  3TKS A;  4EIQ A;  1R5A A;  3ED3 A;  3NZN A;  3IA1 A;  3ZIT A;  4EO3 A;  1OKT A;  3RAZ A;  3GYK A;  3IR4 A;  4LL4 B;  4YAV A;  3ZRD A;  3FZA A;  3DVW A;  2R4V A;  2IIY A;  2JSY A;  3F4T A;  6GSV A;  4IEL A;  4GCI A;  3RHC A;  5IMF A;  5DVB A;  2HE3 A;  3C71 A;  2TIR A;  5AGY A;  4Z2R A;  1BQ7 A;  3F6D A;  1RK4 A;  1ABA A;  4PNG A;  1E2Y A;  4K0N A;  4LLR A;  2YAN A;  5D9W A;  1S3R A;  4HZ2 A;  3FR6 A;  4F0C A;  4HJ2 A;  2VCX A;  3ZVJ D;  1E6B A;  5COH A;  1WRY A;  4ECI A;  1DE1 A;  4IHU A;  2R5G A;  1DUG A;  2JZT A;  4IP6 A;  2DSA A;  1YF1 A;  1MDK A;  5IPH A;  3EIN A;  1PN9 A;  4Z7X A;  5B8B A;  2R37 A;  4MH3 A;  4TVE A;  5HR3 A;  2HNL A;  1JHB A;  3F3R A;  3DML A;  2YJ7 A;  5DDL A;  4I5Q A;  1QMV A;  4J56 E;  3FEU A;  4TR3 A;  1AAZ A;  4PXO A;  2I3Y A;  4K0G A;  4MDC A;  1LU4 A;  4NWY A;  1V2A A;  3HJO A;  5IO2 A;  2R0P A;  4MAB A;  2OAC A;  1O6J A;  1MTC A;  3IAM 2;  3A2V A;  2FCH A;  3KH7 A;  1J08 A;  3ERG A;  1K0A A;  5F05 A;  1U6T A;  4TR1 A;  2PPT A;  4EDY A;  4EF0 A;  1SK0 A;  1S3D A;  3PR8 A;  4ZB8 A;  2QGV A;  1JZO A;  4Z2T A;  1XOA A;  4CW9 A;  1G0T A;  2HRF A;  3D21 A;  2YNX A;  3QAW A;  4IKH A;  4EE0 A;  2FA8 A;  1FAA A;  2GSR A;  4OWY A;  5DQY A;  2JZS A;  3TB2 A;  4PQ1 A;  4QL9 A;  5JCG A;  1GUM A;  5IMC A;  1R26 A;  1M2A A;  4EUY A;  3D5J A;  1SJZ A;  3TOT A;  4MA9 A;  2LJR A;  1JZW A;  3MWH A;  16GS A;  4IW9 A;  4LA1 A;  2HZF A;  1ZYP A;  5KOW A;  1CQG A;  1H75 A;  1I5G A;  3KMN A;  2AAW A;  1HD2 A;  5HFK A;  3RPP A;  2DJ2 A;  1A2M A;  5JWO B;  2GSS A;  2GZP A;  3P90 A;  1GLQ A;  3CQF A;  1PL1 A;  5J5N A;  3SBC A;  1M7T A;  2L59 A;  1KNG A;  1TU7 A;  4IQA A;  2LEG A;  3Q19 A;  3HVX A;  2LNT A;  1TRV A;  4MP4 A;  3GKM A;  2DLX A;  1SYX A;  2QKE A;  5IQY A;  2XC2 A;  2VCT A;  2C80 A;  2WDU A;  22GS A;  5CRE A;  1FB6 A;  1F9M A;  2HXK A;  4L5L A;  4Q5Q A;  2HYX A;  1XW6 A;  5HFG A;  5KOX A;  2DKI A;  2L5L A;  1FHE A;  1SU9 A;  3GSS A;  5A4W A;  2AJQ B;  1PFO A;  1DE2 A;  1CQH A;  1TRS A;  2BMX A;  3UL3 A;  4JE1 A;  5ELA A;  1K3Y A;  1O7U A;  5ABR A;  2CV4 A;  1ZCP A;  2JAC A;  2YV9 A;  3D6I A;  4MMM A;  3TOU A;  5EVO A;  2TRC P;  3HVV A;  1S3C A;  3ZTL A;  1SD9 A;  4EVM A;  3D22 A;  5A4V A;  1BX9 A;  4A5P A;  2RM5 A;  4OCF A;  7GSS A;  1SK2 A;  2XPE A;  2YWN A;  2K8V A;  4D73 A;  3C1R A;  1WOU A;  1BYE A;  5IM9 A;  2C1Y A;  1G6Y A;  4EKZ A;  4HQS A;  1GTU A;  4K2D A;  1MD4 A;  3H1N A;  1PRX A;  1TI3 A;  3IBH A;  2PVQ A;  3VI7 A;  4GST A;  2HT9 A;  3W6G A;  2AB6 A;  5H5R A;  5D96 A;  4MLY A;  4TXO A;  5ECR B;  2FWE A;  4ZBA A;  4TOP A;  4POK A;  2A2R A;  2A4H A;  3QAG A;  4KE3 A;  1AUC A;  1Z9H A;  4MZW A;  2PMT A;  5JCW A;  5D9V A;  1XXU A;  2B5X A;  3FW2 A;  3CSI A;  5ECN B;  4GSS A;  2HSH A;  5C00 A;  2B7J A;  5CP1 A;  3Q74 A;  2LQO A;  2KOK A;  2C3Q A;  3EMP A;  2H73 A;  3QDN A;  3KZQ A;  1QXH A;  4KSO A;  3DD3 A;  1J9B A;  1UN2 A;  1V57 A;  4OFN A;  5JWQ B;  4NAX A;  1FW1 A;  4HS1 A;  2HSM A;  3ZVJ A;  1ML6 A;  3ZFB A;  5G2Z A;  1B9X C;  3VFI A;  2CA8 A;  2OE3 A;  1GRX A;  2VAF A;  1K0M A;  3QR6 A;  1TP9 A;  4K8M A;  4J57 E;  4BVY B;  1WPI A;  4O92 A;  19GS A;  4G19 A;  5J3R A;  3QFA C;  1G6W A;  3N5O A;  5BRT A;  3VLN A;  3GN3 A;  1F3A A;  2H1G A;  4MJB A;  4L0W A;  2H0H A;  3EC3 A;  1SL0 B;  2X4A A;  1GNW A;  4EDZ A;  2C0E A;  1BJX A;  4JBB A;  4JU5 A;  2X8H A;  1GSE A;  4IVF A;  1URM A;  1RW1 A;  4V1A g;  4ILF A;  3N9J A;  3ME8 A;  3MSZ A;  3WD6 A;  3UAP A;  2B1L A;  1PA3 A;  3CSJ A;  2LRC A;  4N30 A;  3TJK A;  3Q6O A;  5J41 A;  2IME A;  2OJL A;  4KDY A;  3TKS E;  5F8B A;  2N5B A;  1SL2 B;  2H01 A;  1XWK A;  3HCZ A;  3F3Q A;  2IFQ A;  2WB9 A;  4MCU A;  3CRT A;  3LOR A;  5E4W A;  1ZGN A;  4IP1 A;  5KN1 A;  1W4V A;  3M9J A;  4PUF C;  3F0I A;  2MBS A;  2B5E A;  2O87 A;  2GQM A;  3APO A;  5ECK B;  2TRX A;  2E7P A;  3QOU A;  4X43 A;  3NIV A;  1R7H A;  2O8V B;  1OE7 A;  4QQ7 A;  4IS0 A;  4CY6 A;  3BJ5 A;  4ZIL A;  4ZL9 A;  1KEB A;  1V9W A;  2YZU A;  1W89 A;  2CZ2 A;  2MYG A;  3ZMK A;  2HRK A;  2L4Q A;  4AJ7 A;  2HSY A;  4E8H A;  3RPN A;  4K7N A;  2A2P A;  2VCV A;  5IO0 A;  1TDI A;  2YWI A;  5FWG A;  4POB A;  3IOS A;  2B5Y A;  4FH8 A;  1GSY A;  4EIP A;  2H1A A;  2YCD A;  5ECQ B;  5GST A;  4X4J A;  1ZZY A;  2H75 A;  2P31 A;  3DGQ A;  4L0U A;  4F03 A;  5KN2 A;  3QAV A;  3FMW A;  2D2Z A;  2M46 A;  2H72 A;  3PIN A;  2X8C A;  4ECB A;  2V41 A;  1Z7P A;  4XS4 A;  2VL9 A;  2OA7 A;  3HZ4 A;  3I43 A;  4TXV A;  1XW9 A;  4DVC A;  3EYT A;  3L4N A;  5F06 A;  2IN3 A;  1X0R A;  3PH9 A;  3GTU A;  4XRA A;  5CYY A;  2JZR A;  2R0G A;  1ST9 A;  4MPG A;  1XCC A;  3IE3 A;  4K7I A;  2H1D A;  4MPF A;  1ZYQ B;  2GDR A;  5LCZ A;  1TXX A;  5A4U A;  1EGR A;  1XVQ A;  5HR1 A;  1XVW A;  4OFT A;  1X5E A;  4YAP A;  1T3B A;  3SWL A;  5D8I A;  2H70 A;  1XPV A;  3ZIV A;  3TKS C;  2RLI A;  2PN8 A;  4GQF A;  5AIX A;  1TKD B;  1GL8 A;  5DAL B;  4AJ8 A;  4TRX A;  3LEF A;  4K1F A;  1EV4 A;  2HRA A;  2H0I A;  17GS A;  3UVT A;  4EXJ A;  2FLS A;  4TW5 A;  1PN0 A;  3UEM A;  2VUP A;  1OC9 B;  1BED A;  1O73 A;  1ZOF A;  2GQK A;  1PX6 A;  2H30 A;  3FKF A;  3IK7 A;  1V98 A;  3GKX A;  3LW9 A;  3P2A A;  3UVH A;  1X5C A;  5IOW A;  1GSS A;  5AIV A;  3GL3 A;  4YQU A;  3CRU A;  5FHI A;  2N5F A;  2X8G A;  3HA9 A;  1OAZ A;  3H4K A;  2MMA A;  1EP8 A;  5IOX A;  5HR0 A;  3JCM L;  1THX A;  1THO A;  1M2D A;  2B6M A;  3NOF A;  1MDJ A;  2XBQ A;  2P0G A;  1QUW A;  3BCK A;  1GWC A;  4RI6 A;  5FT3 A;  1FG4 A;  1A24 A;  3ERW A;  3ZZX A;  5GZZ B;  6GST A;  4K7O A;  5H5S A;  3LXT A;  4YKG A;  1NHO A;  1PL2 A;  4XIH A;  2LV3 A;  3VWX A;  3WGD A;  2GLR A;  1M9B A;  4ECJ A;  4NXI A;  10GS A;  3LSZ A;  4KA0 A;  2V2G A;  4KUN A;  3IXR A;  2HI7 A;  2BTO T;  1U3A A;  2DJJ A;  5CRG A;  4RUV A;  2ZCT A;  1XWC A;  2FHE A;  1LBK A;  1M2B A;  1OE8 A;  4JR6 A;  2WZ9 A;  3MAK A;  3A5W A;  2DML A;  1X9S B;  3TUE A;  1M3I A;  3ZRE A;  3QFB C;  4NHZ A;  3C73 A;  1X9M B;  3L0H A;  1T1V A;  2CX3 A;  2B1K A;  3WYW A;  2WS2 A;  6GSY A;  1Q98 A;  1XWB A;  2R3X A;  4HDE A;  1GTI A;  1EOH A;  4G0K A;  1U87 A;  1T4Y A;  6GSS A;  5CRD A;  1JZR A;  3L9U A;  3IC8 A;  2VL2 A;  2MMZ A;  4KSM A;  1OC8 A;  4MJC A;  5ID2 A;  2DJ0 A;  3TRQ A;  3VWV A;  3VPT A;  5HFI A;  4F9Z A;  2R6K A;  4I6X A;  2LS5 A;  2GQL A;  1JLV A;  2KHP A;  3FRC A;  3GKN A;  2O89 A;  3ZFL A;  2WUL A;  2LNS A;  2X99 A;  1B4Q A;  4CHS A;  1SJI A;  4GLT A;  3E3E A;  3KM6 A;  2DJ1 A;  3BD2 A;  3IHG A;  3LWA A;  4MF5 A;  2P5R A;  2F3M A;  2R2J A;  2REM A;  2IMK A;  4JED A;  3DRN A;  1F6M C;  4OMV A;  5ECL B;  3WT2 A;  2YJH A;  1ZYE A;  2PU9 C;  1GNE A;  3GHA A;  2K18 A;  1Y25 A;  2YZH A;  2JAD A;  1B48 A;  2O7K A;  4K9Z A;  4GXZ A;  2JU5 A;  4MK3 A;  4DSS B;  3ZIJ A;  4GTU A;  1PKW A;  2YWO A;  1ILO A;  4FYB A; 
#chains in the Genus database with same CATH homology
 2FY6 A;  2E2G A;  2G0F A;  3O76 A;  3FY7 A;  1GP1 A;  4K5R A;  1K3O A;  1OYJ A;  3EPT A;  1SYR A;  3LYK A;  4TR1 B;  2NPB A;  2UZ8 A;  1ERW A;  3KGK A;  2GT5 A;  3EE2 A;  4YH2 A;  1N8J A;  4OD7 A;  1EGO A;  4NPB A;  2GTU A;  4TKY A;  2H66 A;  3TJG A;  2V32 A;  3EU4 A;  5GAP D;  2EC4 A;  2L4C A;  3O6T A;  4G0I A;  2YP6 A;  4V1A p;  5G5E A;  1Z5Y E;  3FYG A;  1U88 A;  4MJE A;  4G0L A;  2GSQ A;  3HVS A;  2H8L A;  2F8A A;  1QQ2 A;  3W8S A;  3OR5 A;  4E8E A;  2G2Q A;  1YDK A;  2L5O A;  5E59 A;  4Q5F A;  1A0R P;  3WGX A;  3TJB A;  1XWA A;  3LGC A;  4N11 A;  4BVX A;  4ZL7 A;  4DSR A;  3EMX A;  4ISD A;  3IV4 A;  5IIZ A;  4WF4 A;  4RQX A;  1XW5 A;  4YKF A;  11GS A;  2MBT A;  3BCI A;  4X0X A;  3HKR A;  3HJP A;  4WR5 A;  2A2S A;  3UBK A;  2CZ3 A;  1T8E B;  4ZB6 A;  4NV5 A;  2I1U A;  2H74 A;  2JSZ A;  5CNW A;  5ECS A;  2HRN A;  1SJ6 A;  1ZL9 A;  5HR2 A;  4TR0 A;  2XHF A;  2IMD A;  3IC4 A;  1VRS D;  2VOC A;  4IJI A;  1I9D A;  1ZYN A;  1FOV A;  2NVL A;  2C0D A;  1GUH A;  3M1G A;  4F0B A;  1B9Y C;  1PD2 1;  1V40 A;  1ON4 A;  2NDO A;  2IWT A;  5IMD A;  1GTB A;  1QK8 A;  1JFU A;  5DBQ A;  1Z6M A;  3VWW A;  3L9V A;  3KP8 A;  3L9S A;  2KP2 A;  4LL1 B;  3M8N A;  2ES7 A;  1TOF A;  3HZ8 A;  4USS A;  1A8Y A;  4LMV A;  4AF2 A;  4ZXG A;  3ZML A;  2HZE B;  1PMT A;  2VD1 A;  1PGT A;  4CDO A;  4I8B A;  1QFN A;  2EIQ A;  4K2X A;  5L71 A;  2PBJ A;  1BG5 A;  3MYD A;  1S3A A;  2WGR A;  3G7I A;  1QGV A;  3GV1 A;  2NTO A;  4KDU A;  3A5I A;  1AIU A;  5JWR B;  12GS A;  4D73 B;  1C72 A;  4PGT A;  3KMO A;  1AQV A;  1K0B A;  4KGI A;  3C7M A;  1ERV A;  1GUL A;  4ZBB A;  8GSS A;  3KTL A;  3APQ A;  1MD3 A;  2QA1 A;  5ECH B;  1Q4J A;  2I81 A;  5CRW A;  4KAE A;  1PSQ A;  2QSI A;  4H86 A;  3DKS A;  1OC3 A;  4OO5 A;  1YQ1 A;  2IMI A;  2L6D A;  2DBC A;  3CMI A;  1K0N A;  3QCP A;  2AHE A;  3RHB A;  1G7E A;  2FA4 A;  4HQZ A;  1IYH A;  2MMO A;  1NM3 A;  3GIX A;  2E0Q A;  2MZC A;  2PWJ A;  5ECO B;  3KP9 A;  5BMU A;  3F4S A;  3U5R E;  20GS A;  5AIS A;  4KCA A;  2L57 A;  3GST A;  5CAX A;  3H93 A;  2WJU A;  2CQ9 A;  1UA5 A;  2JL4 A;  3I6A A;  3GL5 A;  4GQC A;  4HUA A;  2YOI A;  3CTF A;  5IMA A;  2M72 A;  4BL7 B;  5IMV A;  3BBY A;  3ISO A;  3GH9 A;  4BWQ A;  1TW9 A;  4L8E A;  2VIM A;  4MZB A;  5IMZ A;  2CT6 A;  1B8X A;  1VGL A;  2K6V A;  1ACV A;  1Y6E A;  1G7O A;  5IPG A;  4I97 A;  3A2W A;  3LFL A;  2P5Q A;  2H19 A;  4HU9 A;  3HXS A;  1YEX A;  2VCW A;  3IDV A;  2C0G A;  3QD9 A;  1XWG A;  1B4P A;  4BWS A;  1MDI A;  3GKK A;  1Z6N A;  3IPZ A;  4MH2 A;  5LNK e;  2EIR A;  1LJR A;  1HQO A;  2GGT A;  3GUR A;  4Z2U A;  1FVJ A;  2I9H A;  2CVB A;  2LTK A;  1O8W A;  2AUV A;  1KBN A;  3GX0 A;  1HYU A;  5DAK B;  1OKD A;  5EY6 A;  1WIK A;  2DJ3 A;  3H79 A;  5F07 A;  2FWH A;  4PQH A;  1UVZ A;  18GS A;  1WE0 A;  2KP1 A;  3TJF A;  3KEB A;  3GRX A;  4XRD A;  4WF5 A;  1NHY A;  4JRR A;  5DJM A;  2OE0 A;  3V1W A;  1GSU A;  2IFQ B;  4DSQ A;  1ZMA A;  3TKR A;  2LRT A;  3L78 A;  2VCQ A;  4I2T A;  2LJK A;  1O81 A;  3FZ9 A;  4PQI A;  2HLS A;  1JZD A;  5A5K A;  3MNG A;  3R3E A;  3P8W A;  4WR4 A;  2PGT A;  1MEK A;  4KX4 A;  1KTE A;  2H71 A;  1K0D A;  1X9W B;  3HHV A;  1XOB A;  1U3I A;  4LMW A;  4GSN A;  3ERF A;  2BJX A;  3KH9 A;  4WBR D;  4YQM A;  3WGE A;  2L6C A;  3FR3 A;  4Q5R A;  4TN8 A;  3A2X A;  4O7H A;  5G1L A;  3E0U A;  3G7Y A;  2YWM A;  3MIX A;  2FUG 2;  1SK1 A;  4RI7 A;  4DEJ A;  5B7C A;  4MF6 A;  5JCU A;  1AQW A;  2O85 A;  5H5Q A;  2J23 A;  5B6M A;  1TK0 B;  3UAR A;  1GUK A;  1EOG A;  4ML1 A;  4PX1 A;  5D73 A;  2LKU A;  2V1M A;  2GST A;  1XZO A;  4MJA A;  1AQX A;  4ZB9 A;  5GSS A;  4BA7 A;  3F9U A;  1V58 A;  2KUC A;  1TU8 A;  1A8L A;  1YY7 A;  2M80 A;  4POL A;  1SL1 B;  2VD0 A;  4PNF A;  2RM6 A;  1YF0 A;  3LJR A;  4DSS A;  1AW9 A;  4POM A;  5CO3 A;  6GSU A;  1O85 A;  5G30 A;  1F37 A;  1TI1 A;  4XS4 B;  4XHM A;  2H6Z A;  2PVO C;  3FR9 A;  2ZNM A;  4HOJ A;  4V2N A;  1HNB A;  2F9S A;  4JR4 A;  1SKS B;  3GTU B;  5J4U A;  4NV2 A;  4KH7 A;  5DJL A;  1IYI A;  1HNA A;  2LJA A;  2V6K A;  3C8E A;  2DJK A;  3CYN A;  3TKQ A;  1XIY A;  6GSX A;  3DVX A;  3EWL A;  5KN0 A;  4FQU A;  3LXZ A;  3Q18 A;  2RII A;  1YKA A;  3DYR A;  4JZQ A;  3D4T A;  4KW6 A;  4TR4 A;  4WBJ A;  4P3Y B;  1R5P A;  1K0O A;  2GZZ A;  2VM1 A;  3H8Q A;  1TRU A;  5ELG A;  2XBI A;  6GSW A;  2LQQ A;  2CVD A;  4O5R A;  3GX8 A;  1TTZ A;  4IGJ A;  2YN1 A;  5AN1 A;  2VL2 C;  1TK5 B;  3AY8 A;  2FWG A;  2EIO A;  2IL3 A;  5ECP B;  3DIE A;  4O5U A;  2GT6 A;  2OAD A;  1YZX A;  2H6X A;  1O8X A;  3QMX A;  2PER A;  5CRH A;  1HNC A;  5C04 A;  4AGS A;  4IJ3 A;  4K6X A;  3VWU A;  3DXB A;  1NSW A;  4QL7 A;  1FO5 A;  4OFM A;  5D93 A;  3UBL A;  3RDW A;  3CSH A;  1DBY A;  2F51 A;  2RUF A;  1WP0 A;  1PKZ A;  5HQP A;  4K5S A;  4ULX A;  2WCI A;  5GAN D;  3M3M A;  3GUS A;  1PQN A;  3M0F A;  2DIZ A;  4MF7 A;  5G1K A;  2DKH A;  2X49 A;  4BVY A;  1K3L A;  1SKW B;  2E2M A;  3ME7 A;  2OKA A;  5ENU A;  1JLW A;  3F63 A;  4XCS A;  1GLP A;  3C1S A;  3F6F A;  1GSF A;  2YV7 A;  3R2Q A;  1FB0 A;  4WXT A;  1XFL A;  1USB A;  2VLU A;  3TCO A;  2GVP A;  3TDG A;  3TRX A;  4ZBD A;  2HZE A;  3ZYW A;  3J7Y b;  2FWF A;  2LUS A;  1F2E A;  4KF9 A;  3VPQ A;  3APS A;  3O3T A;  3PGT A;  2GZY A;  5D9X A;  3MDK A;  4EL1 A;  1OVN A;  1GH2 A;  2I4A A;  2NBS A;  4IBP A;  5INY A;  1VF4 A;  3FHK A;  2VM2 A;  3TKP A;  3E9J B;  2XPD A;  4V2M A;  4MNN A;  2OBI A;  2YPM A;  1T4Z A;  2WRT A;  5ECI B;  1BAY A;  1AXD A;  1WJK A;  3BOA A;  1X5D A;  3IK9 A;  4KND A;  1T00 A;  2A4V A;  5B8A A;  4EC0 A;  3J7Y k;  2N5A A;  4KCE A;  4XTS A;  1XBS A;  5ID2 B;  1SEN A;  4CY8 A;  4HJM A;  1SKR B;  2FGX A;  2IJY A;  1AC1 A;  1EV9 A;  3I69 A;  2DMM A;  2Z9S A;  5ECM B;  1ERU A;  3KJY A;  4WKW A;  1FOH A;  3KD0 A;  4FYC A;  4G2E A;  5LD0 A;  4PTS A;  1ERT A;  1F3B A;  3DWV A;  3UIW A;  3GMF A;  5DCH A;  3CTG A;  3CBU A;  1TJD A;  3KCM A;  2C0F A;  2H76 A;  3GFK A;  3WT1 A;  3KIJ A;  2CAI A;  3IRA A;  14GS A;  1EEM A;  5KEJ A;  1A2J A;  1FVK A;  3GNJ A;  4BL7 A;  3G9B A;  4GF0 A;  2CVK A;  1YEP A;  4KB3 A;  1SD8 A;  4IN0 A;  5DQS A;  1TK8 B;  3VUR A;  5DCG A;  2X64 A;  1UC7 A;  2B7K A;  2AV4 A;  3PPU A;  3F8U A;  1R4W A;  5KN3 A;  4ID0 A;  5F0G A;  3VK9 A;  4G9H A;  3GA4 A;  1A0F A;  4PUR A;  13GS A;  4J2F A;  3HJM A;  2C8U A;  2J9H A;  3IHQ A;  4ECC A;  2K8S A;  1EZK A;  2IPA A;  3UOM A;  3VI5 A;  1DSB A;  3G7J A;  4N10 A;  4RQR A;  3U6V A;  1A23 A;  2FNO A;  3KXO A;  3D4M A;  2H6Y A;  4XS1 A;  2QA2 A;  5DAK A;  2H1B A;  3I9V 2;  4ML6 A;  2ALB A;  1WWJ A;  3DEX A;  1EP7 A;  2VL3 A;  5EL8 A;  1VF2 A;  5D9T A;  1GSQ A;  2FD3 A;  4PUA A;  3FK8 A;  5DAL A;  4HZ4 A;  3HYP A;  4OO4 A;  4TXO B;  2MMN A;  2GS3 A;  1GTA A;  3FZ4 A;  4N0V A;  3CXG A;  3S9F A;  4Q5N A;  4BVX B;  3LQ7 A;  2CAQ A;  1OC9 A;  5J9B A;  4HU7 A;  4F2I A;  2C3T A;  2F8F A;  4O32 A;  4NMU A;  4X1U A;  1M9A A;  4NHW A;  2WFC A;  1M99 A;  4BPY A;  3UMA A;  5J9C A;  5G31 A;  3D0Z A;  3UJ1 A;  3HY2 A;  2DC5 A;  1RQM A;  2H0G A;  3HD5 A;  1EWX A;  4N0Z A;  1NW2 A;  3US3 A;  1T7P B;  3LG6 A;  2V6O A;  3QPM A;  1PX7 A;  1TRW A;  1Z3E A;  3RBT A;  2LST A;  4FYU A;  2ZUP A;  2HFD A;  1YJ6 A;  4ICY A;  4XS6 A;  4I2U A;  4F82 A;  1YKC A;  3EVI A;  4V2L A;  1A2L A;  4GRF A;  1H4O A;  4ZIJ A;  2RUE A;  3TJJ A;  5G5F A;  3A3T A;  2C3N A;  2K9F A;  4HI7 A;  2QC7 A;  4OCE A;  3FZ5 A;  4FO5 A;  4AJ6 A;  3EUR A;  4WEY A;  4KDX A;  3LYP A;  2ON5 A;  2OBK A;  2CX4 A;  1GSD A;  5EPF A;  1Z7R A;  3W8J A;  3TRP A;  3IAS 2;  2VLT A;  3K8N A;  2R0C A;  2DIY A;  3GH6 A;  2VLV A;  1EEJ A;  4YQV A;  3HDC A;  9GSS A;  4G10 A;  2OE1 A;  3EU3 A;  4HEA 2;  1M0U A;  1VF3 A;  1K0C A;  2KLX A;  3P7X A;  3ZLP A;  2B3S A;  4ZL8 A;  3M9K A;  4FIW A;  4L5O A;  2VCZ A;  1WMJ A;  3TGZ A;  4IQ1 A;  4ACS A;  4O5Q A;  2IMF A;  4MZC A;  2ON7 A;  3KTB A;  2PUK C;  4WET A;  5B6N A;  1J0F A;  1N2A A;  2AYT A;  3F4R A;  2VO4 A;  3ZL5 A;  1VF1 A;  2C4J A;  4GWR A;  2LRN A;  3TKS A;  4EIQ A;  1R5A A;  3ED3 A;  3NZN A;  3IA1 A;  3ZIT A;  4EO3 A;  1OKT A;  3RAZ A;  3GYK A;  3IR4 A;  4LL4 B;  4YAV A;  3ZRD A;  3FZA A;  3DVW A;  2R4V A;  2IIY A;  2JSY A;  3F4T A;  6GSV A;  4IEL A;  4GCI A;  3RHC A;  5IMF A;  5DVB A;  2HE3 A;  3C71 A;  2TIR A;  5AGY A;  4Z2R A;  1BQ7 A;  3F6D A;  1RK4 A;  1ABA A;  4PNG A;  1E2Y A;  4K0N A;  4LLR A;  2YAN A;  5D9W A;  4HZ2 A;  3FR6 A;  4F0C A;  4HJ2 A;  2VCX A;  3ZVJ D;  1E6B A;  5COH A;  1WRY A;  4ECI A;  1DE1 A;  4IHU A;  2R5G A;  1DUG A;  2JZT A;  4IP6 A;  2DSA A;  1YF1 A;  1MDK A;  5IPH A;  3EIN A;  1PN9 A;  4Z7X A;  5B8B A;  2R37 A;  4MH3 A;  4TVE A;  5HR3 A;  2HNL A;  1JHB A;  3F3R A;  3DML A;  2YJ7 A;  5DDL A;  4I5Q A;  1QMV A;  4J56 E;  3FEU A;  4TR3 A;  1AAZ A;  4PXO A;  2I3Y A;  4K0G A;  4MDC A;  1LU4 A;  4NWY A;  1V2A A;  3HJO A;  5IO2 A;  2R0P A;  4MAB A;  2OAC A;  1O6J A;  1MTC A;  3IAM 2;  3A2V A;  2FCH A;  3KH7 A;  1J08 A;  3ERG A;  1K0A A;  5F05 A;  1U6T A;  4TR1 A;  2PPT A;  4EDY A;  4EF0 A;  1SK0 A;  1S3D A;  3PR8 A;  4ZB8 A;  2QGV A;  1JZO A;  4Z2T A;  1XOA A;  4CW9 A;  1G0T A;  2HRF A;  3D21 A;  2YNX A;  3QAW A;  4IKH A;  4EE0 A;  2FA8 A;  1FAA A;  2GSR A;  4OWY A;  5DQY A;  2JZS A;  3TB2 A;  4PQ1 A;  4QL9 A;  5JCG A;  1GUM A;  5IMC A;  1R26 A;  1M2A A;  4EUY A;  3D5J A;  1SJZ A;  3TOT A;  4MA9 A;  2LJR A;  1JZW A;  3MWH A;  16GS A;  4IW9 A;  4LA1 A;  2HZF A;  1ZYP A;  5KOW A;  1CQG A;  1H75 A;  1I5G A;  3KMN A;  2AAW A;  1HD2 A;  5HFK A;  3RPP A;  2DJ2 A;  1A2M A;  5JWO B;  2GSS A;  2GZP A;  1GLQ A;  3P90 A;  1PL1 A;  5J5N A;  3SBC A;  1M7T A;  2L59 A;  1KNG A;  1TU7 A;  4IQA A;  2LEG A;  3Q19 A;  3HVX A;  2LNT A;  1TRV A;  4MP4 A;  3GKM A;  2DLX A;  1SYX A;  2QKE A;  5IQY A;  2XC2 A;  2VCT A;  2C80 A;  2WDU A;  22GS A;  5CRE A;  1FB6 A;  1F9M A;  2HXK A;  4L5L A;  4Q5Q A;  2HYX A;  1XW6 A;  5HFG A;  5KOX A;  2DKI A;  2L5L A;  1FHE A;  1SU9 A;  3GSS A;  5A4W A;  2AJQ B;  1DE2 A;  1CQH A;  1TRS A;  2BMX A;  3UL3 A;  4JE1 A;  5ELA A;  1K3Y A;  1O7U A;  5ABR A;  2CV4 A;  1ZCP A;  2JAC A;  2YV9 A;  3D6I A;  4MMM A;  3TOU A;  5EVO A;  2TRC P;  3HVV A;  1S3C A;  3ZTL A;  1SD9 A;  4EVM A;  3D22 A;  5A4V A;  1BX9 A;  4A5P A;  2RM5 A;  4OCF A;  7GSS A;  1SK2 A;  2XPE A;  2YWN A;  2K8V A;  4D73 A;  3C1R A;  1WOU A;  1BYE A;  5IM9 A;  2C1Y A;  1G6Y A;  4EKZ A;  4HQS A;  1GTU A;  4K2D A;  1MD4 A;  3H1N A;  1PRX A;  1TI3 A;  3IBH A;  2PVQ A;  3VI7 A;  4GST A;  2HT9 A;  3W6G A;  2AB6 A;  5H5R A;  5D96 A;  4MLY A;  4TXO A;  5ECR B;  2FWE A;  4ZBA A;  4TOP A;  4POK A;  2A2R A;  2A4H A;  3QAG A;  4KE3 A;  1AUC A;  1Z9H A;  4MZW A;  2PMT A;  5JCW A;  5D9V A;  1XXU A;  2B5X A;  3FW2 A;  3CSI A;  5ECN B;  4GSS A;  2HSH A;  5C00 A;  2B7J A;  5CP1 A;  3Q74 A;  2LQO A;  2KOK A;  2C3Q A;  3EMP A;  2H73 A;  3QDN A;  3KZQ A;  1QXH A;  4KSO A;  3DD3 A;  1J9B A;  1UN2 A;  1V57 A;  4OFN A;  5JWQ B;  4NAX A;  1FW1 A;  4HS1 A;  2HSM A;  3ZVJ A;  1ML6 A;  3ZFB A;  5G2Z A;  1B9X C;  3VFI A;  2CA8 A;  2OE3 A;  1GRX A;  2VAF A;  1K0M A;  3QR6 A;  1TP9 A;  4K8M A;  4J57 E;  4BVY B;  1WPI A;  4O92 A;  19GS A;  4G19 A;  5J3R A;  3QFA C;  1G6W A;  3N5O A;  5BRT A;  3VLN A;  3GN3 A;  1F3A A;  2H1G A;  4MJB A;  4L0W A;  2H0H A;  3EC3 A;  1SL0 B;  2X4A A;  1GNW A;  4EDZ A;  2C0E A;  1BJX A;  4JBB A;  4JU5 A;  2X8H A;  1GSE A;  4IVF A;  1URM A;  1RW1 A;  4V1A g;  4ILF A;  3N9J A;  3ME8 A;  3MSZ A;  3WD6 A;  3UAP A;  2B1L A;  1PA3 A;  3CSJ A;  2LRC A;  4N30 A;  3TJK A;  3Q6O A;  5J41 A;  2IME A;  2OJL A;  4KDY A;  3TKS E;  5F8B A;  2N5B A;  1SL2 B;  2H01 A;  1XWK A;  3HCZ A;  3F3Q A;  2IFQ A;  2WB9 A;  4MCU A;  3CRT A;  3LOR A;  5E4W A;  1ZGN A;  4IP1 A;  5KN1 A;  1W4V A;  3M9J A;  4PUF C;  3F0I A;  2MBS A;  2B5E A;  2O87 A;  2GQM A;  3APO A;  5ECK B;  2TRX A;  2E7P A;  3QOU A;  4X43 A;  3NIV A;  1R7H A;  2O8V B;  1OE7 A;  4QQ7 A;  4IS0 A;  4CY6 A;  3BJ5 A;  4ZIL A;  4ZL9 A;  1KEB A;  1V9W A;  2YZU A;  1W89 A;  2CZ2 A;  2MYG A;  3ZMK A;  2HRK A;  2L4Q A;  4AJ7 A;  2HSY A;  4E8H A;  3RPN A;  4K7N A;  2A2P A;  2VCV A;  5IO0 A;  1TDI A;  2YWI A;  5FWG A;  4POB A;  3IOS A;  2B5Y A;  4FH8 A;  1GSY A;  4EIP A;  2H1A A;  2YCD A;  5ECQ B;  5GST A;  4X4J A;  1ZZY A;  2H75 A;  2P31 A;  3DGQ A;  4L0U A;  4F03 A;  5KN2 A;  3QAV A;  3FMW A;  2D2Z A;  2M46 A;  2H72 A;  3PIN A;  2X8C A;  4ECB A;  2V41 A;  1Z7P A;  4XS4 A;  2VL9 A;  2OA7 A;  3HZ4 A;  3I43 A;  4TXV A;  1XW9 A;  4DVC A;  3EYT A;  3L4N A;  5F06 A;  2IN3 A;  1X0R A;  3PH9 A;  3GTU A;  4XRA A;  5CYY A;  2JZR A;  2R0G A;  1ST9 A;  4MPG A;  1XCC A;  3IE3 A;  4K7I A;  2H1D A;  4MPF A;  1ZYQ B;  2GDR A;  5LCZ A;  1TXX A;  5A4U A;  1EGR A;  1XVQ A;  5HR1 A;  1XVW A;  4OFT A;  1X5E A;  4YAP A;  1T3B A;  3SWL A;  5D8I A;  2H70 A;  1XPV A;  3ZIV A;  3TKS C;  2RLI A;  2PN8 A;  4GQF A;  5AIX A;  1TKD B;  1GL8 A;  5DAL B;  4AJ8 A;  4TRX A;  3LEF A;  4K1F A;  1EV4 A;  2HRA A;  2H0I A;  17GS A;  3UVT A;  4EXJ A;  2FLS A;  4TW5 A;  1PN0 A;  3UEM A;  2VUP A;  1OC9 B;  1BED A;  1O73 A;  1ZOF A;  2GQK A;  1PX6 A;  2H30 A;  3FKF A;  3IK7 A;  1V98 A;  3GKX A;  3LW9 A;  3P2A A;  3UVH A;  1X5C A;  5IOW A;  5AIV A;  1GSS A;  3GL3 A;  4YQU A;  3CRU A;  5FHI A;  2N5F A;  2X8G A;  3HA9 A;  1OAZ A;  3H4K A;  2MMA A;  1EP8 A;  5IOX A;  5HR0 A;  3JCM L;  1THX A;  1THO A;  1M2D A;  2B6M A;  3NOF A;  1MDJ A;  2XBQ A;  2P0G A;  1QUW A;  3BCK A;  1GWC A;  4RI6 A;  5FT3 A;  1FG4 A;  1A24 A;  3ERW A;  3ZZX A;  5GZZ B;  6GST A;  4K7O A;  5H5S A;  3LXT A;  4YKG A;  1NHO A;  1PL2 A;  4XIH A;  2LV3 A;  3VWX A;  3WGD A;  2GLR A;  1M9B A;  4ECJ A;  4NXI A;  10GS A;  3LSZ A;  4KA0 A;  2V2G A;  4KUN A;  3IXR A;  2HI7 A;  2BTO T;  1U3A A;  2DJJ A;  5CRG A;  4RUV A;  2ZCT A;  1XWC A;  2FHE A;  1LBK A;  1M2B A;  1OE8 A;  4JR6 A;  2WZ9 A;  3MAK A;  3A5W A;  2DML A;  1X9S B;  3TUE A;  3ZRE A;  3QFB C;  4NHZ A;  3C73 A;  1X9M B;  3L0H A;  1T1V A;  2CX3 A;  2B1K A;  3WYW A;  2WS2 A;  6GSY A;  1Q98 A;  1XWB A;  2R3X A;  4HDE A;  1GTI A;  1EOH A;  4G0K A;  1U87 A;  1T4Y A;  6GSS A;  5CRD A;  1JZR A;  3L9U A;  3IC8 A;  2VL2 A;  2MMZ A;  4KSM A;  1OC8 A;  4MJC A;  5ID2 A;  2DJ0 A;  3TRQ A;  3VWV A;  3VPT A;  5HFI A;  4F9Z A;  2R6K A;  4I6X A;  2LS5 A;  2GQL A;  1JLV A;  2KHP A;  3FRC A;  3GKN A;  2O89 A;  3ZFL A;  2WUL A;  2LNS A;  2X99 A;  1B4Q A;  4CHS A;  1SJI A;  4GLT A;  3E3E A;  3KM6 A;  2DJ1 A;  3BD2 A;  3IHG A;  3LWA A;  4MF5 A;  2P5R A;  2F3M A;  2R2J A;  2REM A;  2IMK A;  4JED A;  3DRN A;  1F6M C;  4OMV A;  5ECL B;  3WT2 A;  2YJH A;  1ZYE A;  2PU9 C;  1GNE A;  3GHA A;  2K18 A;  1Y25 A;  2YZH A;  2JAD A;  1B48 A;  2O7K A;  4K9Z A;  4GXZ A;  2JU5 A;  4MK3 A;  4DSS B;  3ZIJ A;  4GTU A;  1PKW A;  2YWO A;  1ILO A;  4FYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...