4EUYA

Crystal structure of thioredoxin-like protein bce_0499 from bacillus cereus atcc 10987
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
86
Chain Sequence
ELATYIEEQQLVLLFIKTENCGVCDVMLRKVNYVLENYNYVEKIEILLQDMFTGPTVLLFYNGKEILRESRFISLENLERTIQLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of thioredoxin-like protein BCE_0499 from Bacillus cereus
rcsb
source organism Bacillus cereus
total genus 22
structure length 86
sequence length 95
ec nomenclature
pdb deposition date 2012-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4euyA00
1V58A 1T4ZA 4LA1A 2KOKA 5CRDA 5B8BA 2H71A 5HFIA 2PMTA 4MLYA 3TKSE 4ISDA 3PINA 1DUGA 2H8LA 1ZMAA 1VGLA 3F6DA 5F8BA 4F0BA 2GVPA 4OCFA 1U87A 1M2DA 5J9CA 3DYRA 5D73A 3F6FA 3HCZA 2VCWA 1E6BA 4WBJA 3F63A 5IPHA 2WGRA 2ZNMA 3RPPA 2IFQB 5A4VA 3P7XA 2DC5A 4MJEA 5B6NA 2VL2A 4IQ1A 2IL3A 2JSYA 1TRVA 1K0BA 1K0AA 2C3QA 1VF4A 3LYPA 3ZRDA 2D2ZA 2WB9A 2B5XA 5C00A 1XWCA 1K0MA 3GL5A 3NIVA 2PUKC 5AN1A 2CV4A 2Z9SA 4ZL9A 2XPEA 3VFIA 1PD21 1ABAA 2JZSA 1SYRA 1UN2A 5DQSA 2MMOA 1G6YA 4YQMA 3D0ZA 1VF3A 4F2IA 5B7CA 5HFKA 2QSIA 2B1LA 3H8QA 5EVOA 3F4RA 3TOUA 2IMDA 1KTEA 2H6YA 3G7YA 1M2BA 4O92A 2LV3A 5B8AA 2M80A 4DVCA 2PPTA 3FHKA 3L78A 1XVQA 1RW1A 4ZXGA 1GLPA 3IR4A 2K18A 4EXJA 1EV9A 4PUAA 3M1GA 2C80A 3L0HA 5HR0A 2HZEA 1KNGA 2LKUA 3C8EA 1WOUA 2DJ3A 3TKSA 1S3CA 3C73A 2G2QA 1URMA 1SK2A 2H72A 3DD3A 1TTZA 2GGTA 4KSOA 3HJPA 3FRCA 4XS4B 2C3TA 3CSJA 2NTOA 1T7PB 2B3SA 4CDOA 3RBTA 4KSMA 3G7IA 3HA9A 2O89A 1ZZYA 2YWMA 1TOFA 3ZITA 3O6TA 5JCUA 3LG6A 2V32A 2C3NA 4X0XA 5ECRB 4ZIJA 1GSDA 2IMFA 1YEPA 4FYUA 1JZRA 4AJ6A 3W6GA 3FR9A 2R2JA 5CYYA 4OFTA 2G0FA 3Q74A 1SKSB 3HJMA 1OC9A 2DJKA 2H01A 5CAXA 4K6XA 2O8VB 4HEA2 4MZBA 1SL2B 1GP1A 5F05A 4IP6A 2GDRA 3ZIJA 2AUVA 1EV4A 4K1FA 4O7HA 3UVHA 4FO5A 4GQFA 5ABRA 3QDNA 1PL2A 4MF6A 1HNBA 3DVWA 4V1Ag 3GKKA 3KIJA 3IK7A 2VD1A 1XZOA 4IQAA 5KN0A 2GQLA 2H1DA 4ZILA 3RAZA 3A2XA 5GSSA 2YV9A 5IMZA 4J56E 5J9BA 3ZFBA 5IOWA 3GYKA 3GSSA 1XWKA 1A2MA 2JU5A 5DQYA 4WF4A 3EURA 5G5EA 2JSZA 4N0VA 2ES7A 1O85A 3BD2A 1YJ6A 2IWTA 1ACVA 1ERVA 2PERA 1XW9A 3M9KA 4H86A 5HR3A 3BBYA 2C0FA 4Q5RA 1GSEA 1ZGNA 3ZVJD 3GKXA 1YQ1A 2YNXA 4PNGA 2YOIA 3KJYA 5G30A 1OC3A 1ERTA 1F6MC 2E0QA 1Q98A 2AAWA 4G2EA 1GTIA 1TRUA 2QKEA 3QAWA 3QMXA 3G9BA 1VRSD 4TXVA 5FT3A 4Q5NA 3ZMLA 1U88A 2GT5A 3H93A 4GSNA 3US3A 4HJ2A 3TKRA 3HZ8A 4K8MA 4K0NA 4JBBA 3VPQA 4ML1A 2CZ3A 3WD6A 1YF0A 5IO2A 2E7PA 1ML6A 5H5RA 3NZNA 4N0ZA 4L0WA 2HSHA 4CHSA 4JRRA 2LEGA 1GSYA 3FZAA 5ECPB 1GSUA 3ERWA 3FKFA 5HR2A 3TDGA 4JR4A 3DXBA 1NSWA 2PVQA 4XRAA 2P0GA 3F9UA 1QK8A 4OWYA 1ERUA 3VWXA 4I2TA 4P3YB 3IC4A 4WKWA 4EF0A 19GSA 1SKRB 3LYKA 5CRHA 4KDXA 1TU7A 3KXOA 3MSZA 2H19A 3LORA 1QFNA 1KEBA 3ME8A 4XS6A 2C0EA 2VM1A 2RUEA 1MEKA 5J4UA 3TCOA 1N2AA 2H1AA 1XCCA 1DBYA 3CYNA 1JZDA 4WXTA 1SK1A 1TRWA 4O5RA 1GTBA 1K0OA 2TIRA 4RQRA 2VCVA 1B4QA 3A5WA 1AQWA 6GSXA 3KMOA 4KW6A 3FR3A 4XTSA 4TRXA 3F3QA 2FUG2 1FVJA 1PX6A 2RM6A 4NHZA 4OO5A 1CQGA 4GLTA 3UIWA 3CXGA 3E3EA 4MJBA 3D4TA 3HY2A 4TXOB 3Q18A 4DSSB 2LTKA 3IK9A 3VWWA 1USBA 2HRFA 2GSRA 4N10A 3SWLA 3S9FA 3FY7A 4D73B 4OFMA 2X8CA 4GRFA 4KX4A 5AIXA 4HU7A 2V1MA 4ZL7A 3CMIA 4GQCA 4I5QA 4ZBBA 2X8GA 2FY6A 5E59A 1G7OA 2LJAA 4LMWA 2F8FA 4EO3A 4YQUA 2FWFA 3WGXA 2A4VA 2RIIA 4GCIA 3KM6A 2NPBA 4F82A 3VPTA 2IMKA 2DJ0A 4ECBA 2L6DA 1N8JA 3O76A 2PBJA 4ZBAA 3L9SA 3QFBC 4KCEA 1FB6A 2ALBA 1C72A 5J5NA 2H30A 3P8WA 1FOVA 4DEJA 3CTGA 2C0DA 4E8HA 4KCAA 3WGDA 2OBIA 1VF2A 4TR3A 1K0CA 1XXUA 1PN9A 5ECMB 3D6IA 5DVBA 3RPNA 2I81A 5ECHB 4AF2A 2YANA 2V6KA 4HOJA 3I69A 3DEXA 1ZOFA 3D21A 4MPFA 2VLTA 5A4WA 1PKZA 4IGJA 4K7NA 1F2EA 1TKDB 3KP9A 1HNCA 1WP0A 4TR4A 1FG4A 1GNWA 1TI1A 3N9JA 2E2GA 1SJ6A 3P90A 4NV5A 2NDOA 1FB0A 3APQA 1NHOA 3DKSA 4POMA 3IE3A 1QXHA 2YWNA 2KHPA 5H5SA 2A2RA 2ZUPA 1J08A 2KLXA 2VAFA 1RK4A 3ZIVA 5J3RA 4KGIA 1J9BA 2YN1A 3HJOA 2P5QA 3UARA 3VURA 2FGXA 2IMEA 2H6XA 4XHMA 2HRNA 2PU9C 3KZQA 4TW5A 4K9ZA 20GSA 1WRYA 2GS3A 3MAKA 3K8NA 4TR1A 1M0UA 1SJZA 2K9FA 5HR1A 2B1KA 13GSA 3WYWA 2EC4A 4J57E 1O7UA 1BG5A 2MMAA 2R37A 1BAYA 1Z7PA 1EOGA 2FWEA 5IMVA 4HZ4A 5DAKA 4MH2A 3EMPA 3NOFA 1TRSA 4Q5FA 4GWRA 2L5OA 5INYA 4CW9A 4GF0A 2C0GA 1Z3EA 3HHVA 5IIZA 3KH7A 3EU3A 3E9JB 2HZEB 1V9WA 5CRWA 1WJKA 2VD0A 1X9MB 4OMVA 2XC2A 5IOXA 2YP6A 3QR6A 2J9HA 3H4KA 2LQOA 1NHYA 4OFNA 3UOMA 2GZPA 3KP8A 5DJMA 4KH7A 3GSTA 4KNDA 2IN3A 3FZ5A 5EY6A 3C7MA 4RQXA 2L59A 1A0FA 2XBQA 3CSIA 2H70A 1MD4A 3IPZA 1U3AA 2LJRA 1T3BA 3KGKA 1S3AA 4X1UA 3KTBA 1F9MA 5KN3A 1AXDA 3ERGA 4BWSA 2R4VA 5AISA 2WS2A 1PSQA 6GSYA 4K7IA 4GXZA 2DIZA 4YQVA 1B4PA 2HLSA 1TJDA 2GSSA 1PQNA 5JCWA 2N5BA 2WCIA 1OC9B 4KDYA 3VK9A 3ERFA 3GIXA 4LL4B 3ZVJA 1W89A 4HDEA 3IRAA 2HXKA 4EUYA 2FA8A 3GFKA 2AYTA 4IBPA 3EWLA 3BCKA 1X9SB 1Z7RA 5IMAA 2WZ9A 1K0NA 4ZB6A 2CA8A 4FIWA 1GUMA 3LXTA 5DDLA 17GSA 2YV7A 2C8UA 4PX1A 3A2WA 4QL9A 5DALA 5G31A 1NW2A 2OJLA 3E0UA 1S3DA 3C71A 5ECOB 1R5PA 3IAS2 4OCEA 1UA5A 1AQVA 3BOAA 3D4MA 1O81A 3VI7A 1OVNA 2DMMA 1LJRA 3EVIA 3ZYWA 2B5EA 1X5DA 3GV1A 1A0RP 1R5AA 2GTUA 1JZWA 2IMIA 4RI7A 4MF5A 1XWGA 1A8LA 4GSSA 2R3XA 3RHBA 2MZCA 2LRTA 1LU4A 3CBUA 4PGTA 3U6VA 4I2UA 5G1KA 4K2DA 1GTUA 3GURA 2KP1A 1XOBA 3QOUA 3TRQA 1F3AA 1VF1A 1TDIA 1SYXA 4MZWA 1V98A 4QL7A 1JLVA 3QCPA 2DIYA 2VLUA 3QD9A 1U3IA 5D96A 4KB3A 1X5EA 3Q19A 3F0IA 5A5KA 5KEJA 4MH3A 2GLRA 3GX0A 1MD3A 2VIMA 3QAGA 1GNEA 3BJ5A 1O8XA 2ON7A 1YKAA 1M7TA 2V41A 3UVTA 1BJXA 5D8IA 4F0CA 1GL8A 4NPBA 2FLSA 4G19A 4PNFA 1OKTA 1EP8A 3ZREA 2GQMA 3GTUB 4FYBA 4ZB8A 3G7JA 4L8EA 4XRDA 3F4TA 1XW6A 2CQ9A 5HQPA 3OR5A 4L5OA 1B48A 3GHAA 1JLWA 5DCHA 1AC1A 1ZCPA 5ELGA 2EIOA 5D93A 5IQYA 2B7JA 4N30A 1ST9A 3M0FA 1UVZA 1EEMA 1M99A 5D9VA 1MDIA 3IXRA 4O32A 18GSA 1OC8A 1EGRA 2AHEA 2YZUA 4YAPA 1DE1A 2IPAA 1TK8B 1M9AA 4Q5QA 5ID2A 3H1NA 1GSQA 2OE0A 1SU9A 2DBCA 4K0GA 4XIHA 5HFGA 5A4UA 3CRUA 2YZHA 6GSWA 3DMLA 3ZLPA 5FWGA 4IN0A 3FYGA 4MMMA 3UMAA 1Y25A 2P5RA 2O7KA 3KD0A 3EYTA 1UC7A 5ECKB 4XCSA 5JCGA 3IV4A 5EPFA 1K3OA 2C1YA 3TUEA 4AJ7A 5DCGA 22GSA 1BYEA 1O8WA 2K6VA 3FW2A 3HXSA 1M9BA 4EC0A 2CVDA 1GWCA 2MBSA 2ON5A 3GUSA 2HFDA 1NM3A 2LRNA 3HD5A 3W8JA 1Z6MA 1DSBA 3TJGA 4HS1A 4TVEA 3IA1A 4I97A 6GSVA 3LFLA 3L4NA 2LSTA 3IDVA 5LNKe 4MZCA 3TRPA 3TRXA 2BTOT 3UBKA 4IJ3A 1HYUA 3RHCA 5G2ZA 1O73A 1A2JA 4BL7A 1U6TA 4F03A 1TK5B 4EKZA 2AJQB 3EU4A 2VCTA 3EINA 5DBQA 1XWBA 2DJJA 4KAEA 2GSTA 3QFAC 2ZCTA 1I5GA 4ZBDA 1DE2A 2VO4A 2BMXA 4YAVA 3C1RA 1QQ2A 2TRXA 1ZYQB 2HSYA 1EGOA 3JCML 1YKCA 3IHQA 4XS1A 2O85A 1WWJA 4ACSA 3P2AA 1YY7A 2VOCA 1HNAA 1FHEA 3TJFA 1V40A 2GZYA 1X5CA 1TP9A 3M8NA 4E8EA 2WJUA 1SENA 2FHEA 4PQ1A 2REMA 2YJ7A 5D9TA 4V2LA 4D73A 2PWJA 4EDZA 1T00A 5LCZA 1LBKA 3IBHA 2CVBA 2I9HA 2FWGA 1OYJA 4V2MA 3I43A 1FAAA 1GH2A 4PQHA 5D9WA 3APOA 3FK8A 1H4OA 1BQ7A 4MJCA 3LWAA 4EDYA 2V2GA 4OD7A 1YZXA 4K7OA 2B6MA 3ZL5A 3QPMA 3IAM2 1O6JA 3KTLA 1XW5A 1Z9HA 4HUAA 3VLNA 1QMVA 1A24A 5IO0A 1ILOA 4TR1B 3HVSA 3CTFA 3GH6A 2DJ2A 3ZFLA 3H79A 2OA7A 2VM2A 2PVOC 4NWYA 5GZZB 2N5AA 3M9JA 4TN8A 3A2VA 3V1WA 3HVXA 2XBIA 2EIQA 1GUKA 3EE2A 2AB6A 3ZTLA 5G5FA 4N11A 5B6MA 5DAKB 2AV4A 2I3YA 5COHA 4MDCA 4V2NA 5GAPD 5ECLB 4I8BA 2L6CA 3WT2A 2WRTA 2OADA 2PGTA 2DJ1A 3TGZA 3HVVA 4J2FA 14GSA 1QUWA 2YCDA 2B7KA 7GSSA 1X0RA 5CO3A 5F0GA 4KE3A 5ECSA 2FNOA 4MABA 3DIEA 5ECNB 2DSAA 1GLQA 5GSTA 3LGCA 2JZTA 2CAQA 5E4WA 2CVKA 3I9V2 1EWXA 2I4AA 1WE0A 2F51A 4NAXA 5F06A 3GNJA 4KUNA 2L4QA 1M2AA 1JZOA 3SBCA 3HYPA 1G6WA 5EL8A 5JWOB 1B9XC 2K8VA 2H73A 4NV2A 4WF5A 2EIRA 1SKWB 1SD9A 1E2YA 3TKQA 3LSZA 2VL2C 1GRXA 3I6AA 1SL0B 2IFQA 1Z5YE 3L9VA 3VWUA 2DLXA 3PR8A 1TW9A 4BPYA 1B9YC 4POBA 3FZ9A 2CT6A 3TJBA 2JACA 2L5LA 2O87A 4HQZA 2H6ZA 2N5FA 1T1VA 2F8AA 2E2MA 1AQXA 2VCZA 1PMTA 2YWOA 2LUSA 2V6OA 5KN1A 1V2AA 4I6XA 2HNLA 3HDCA 5DALB 5AGYA 2OBKA 3F8UA 5DJLA 2JADA 4QQ7A 3UJ1A 1KBNA 3DVXA 1HD2A 5CP1A 9GSSA 4IP1A 1MDJA 10GSA 3GL3A 3GX8A 1OE7A 1QGVA 3GN3A 5IMFA 2X99A 3EC3A 4DSRA 3BCIA 4WR5A 3ISOA 1A8YA 2H74A 3LXZA 1A2LA 2A2SA 2JZRA 3KEBA 3WGEA 4ZL8A 3TKPA 1IYIA 1XBSA 3HKRA 4IJIA 2FCHA 5CREA 1XIYA 4PURA 3TKSC 2B5YA 3GKNA 2NBSA 1YDKA 4ECCA 3QAVA 5CNWA 1JHBA 2MMNA 3MWHA 1ZYEA 3UAPA 4IKHA 3GKMA 3U5RE 3TJKA 4TKYA 5ECIB 1I9DA 4JU5A 2M72A 4ECIA 1R4WA 4ZB9A 1YEXA 5CRGA 4EVMA 1GULA 4EL1A 4XS4A 3UL3A 1BX9A 1OAZA 5C04A 2LQQA 2L4CA 5H5QA 1Z6NA 3GRXA 2OE3A 4NHWA 6GSSA 3A3TA 1GSSA 2HYXA 2GT6A 2VUPA 2F3MA 2LRCA 1X9WB 1GUHA 5IMCA 1IYHA 3DWVA 2LJKA 1GSFA 4ULXA 1F37A 5LD0A 2FWHA 2FA4A 2K8SA 4G10A 3CSHA 4FYCA 1A23A 4WBRD 3F4SA 4X43A 1MDKA 4AGSA 1FW1A 1T8EB 1JFUA 3C1SA 3M3MA 4JEDA 4LLRA 2LNTA 2IJYA 2X64A 3IOSA 1PGTA 1EEJA 5J41A 1HQOA 2OACA 2HI7A 1SL1B 4NMUA 4MA9A 4IS0A 1OE8A 2OKAA 2OE1A 1PX7A 2QGVA 2VL9A 1SD8A 2VCQA 3F3RA 4TOPA 5ENUA 4JZQA 1K3YA 1YF1A 4HZ2A 2F9SA 1TK0B 4HI7A 2XHFA 1TU8A 4MF7A 3PH9A 4Z7XA 4OO4A 3TB2A 5IPGA 1THOA 1G7EA 3J7Yb 2BJXA 3LJRA 3W8SA 3RDWA 5F07A 2VCXA 3ZZXA 5ID2B 1AW9A 4PUFC 2H1BA 5ELAA 2VL3A 2H75A 1WIKA 3PGTA 2H76A 4LMVA 1PA3A 1XFLA 2KP2A 1GTAA 1PKWA 1T4YA 4TR0A 4BA7A 2MMZA 1XVWA 1Y6EA 2H1GA 3MDKA 1F3BA 1V57A 5JWRB 4WEYA 2C4JA 2H66A 2QC7A 2KUCA 5IM9A 3ZMKA 1BEDA 1CQHA 4WETA 4MK3A 2CX3A 4PXOA 2HT9A 2GQKA 2RLIA 2GSQA 2TRCP 5FHIA 2JL4A 3GTUA 2XPDA 3TJJA 1PL1A 2YPMA 5G1LA 1WPIA 4MPGA 4HQSA 1EZKA 4V1Ap 1WMJA 1SJIA 3TOTA 11GSA 4JE1A 4IW9A 4RI6A 1FO5A 1ZL9A 4DSQA 2H0IA 3FR6A 3WT1A 5IMDA 3LEFA 3D5JA 1XOAA 4AJ8A 4KA0A 1R7HA 1AUCA 5JWQB 4NXIA 3UBLA 3MNGA 1TI3A 2PN8A 1W4VA 1AAZA 4ILFA 4WR4A 4BVXA 4LL1B 2WFCA 2WDUA 4RUVA 3KCMA 2CZ2A 2NVLA 1PRXA 3CRTA 1SK0A 4IHUA 1TXXA 4F9ZA 3GA4A 1J0FA 4MP4A 2R6KA 2M46A 3L9UA 3N5OA 1B8XA 1G0TA 3AY8A 3KH9A 2WULA 4GSTA 2FD3A 4FH8A 4POLA 3KMNA 2HE3A 1ON4A 8GSSA 1FVKA 1R26A 4L5LA 12GSA 1Q4JA 16GSA 5GAND 2LNSA 4HU9A 2CAIA 2H0GA 2YJHA 5ECQB 4IVFA 5D9XA 2YWIA 2RUFA 3DGQA 3DRNA 4EE0A 4JR6A 3LQ7A 4TXOA 3O3TA 3Q6OA 4DSSA 1K0DA 1RQMA 4BVYA 2X8HA 1ERWA 3R2QA 3FEUA 3GMFA 2GZZA 2J23A 4ML6A 2CX4A 2IIYA 1H75A 3VWVA 5KN2A 3ED3A 2L57A 4HJMA 1XWAA 4MCUA 4MJAA 1THXA 4YH2A 6GSUA 3J7Yk 2R5GA 3HZ4A 2H0HA 2DMLA 2MBTA 4PQIA 2RM5A 1AIUA 4IELA 1XPVA 1K3LA 5L71A 4G9HA 3VI5A 3EMXA 3GH9A 2HZFA 5AIVA 1OKDA 4BWQA 4ID0A 2LS5A 3D22A 4L0UA 2I1UA 3UEMA 1EP7A 1MTCA 3APSA 3ME7A 2MYGA 2P31A 6GSTA 4ECJA 1EOHA 4POKA 3FZ4A 2VLVA 4KDUA 4GTUA
chains in the Genus database with same CATH superfamily
1V58A 1T4ZA 4EIPA 4LA1A 2KOKA 5CRDA 5B8BA 2H71A 5HFIA 2PMTA 4MLYA 3TKSE 4ISDA 3PINA 1DUGA 2H8LA 1ZMAA 1VGLA 3F6DA 5F8BA 4F0BA 2GVPA 4OCFA 1U87A 4Z2RA 1M2DA 5J9CA 3DYRA 5D73A 3F6FA 3HCZA 2VCWA 1E6BA 4WBJA 3F63A 5IPHA 2WGRA 2QA1A 2ZNMA 3RPPA 2IFQB 5A4VA 3P7XA 2DC5A 4MJEA 5B6NA 4Z2TA 2VL2A 4IQ1A 2IL3A 2JSYA 1TRVA 1K0BA 1K0AA 2C3QA 1VF4A 3LYPA 3ZRDA 2D2ZA 2WB9A 2B5XA 5C00A 1XWCA 1K0MA 3GL5A 3NIVA 2PUKC 5AN1A 2CV4A 2Z9SA 4ZL9A 2XPEA 3VFIA 1PD21 1ABAA 2JZSA 1SYRA 1UN2A 5DQSA 2MMOA 1G6YA 4YQMA 3D0ZA 1VF3A 4F2IA 5B7CA 5HFKA 2QSIA 2B1LA 3H8QA 3F4RA 5EVOA 3TOUA 2IMDA 1KTEA 2H6YA 3G7YA 1M2BA 4O92A 2LV3A 5B8AA 2M80A 4DVCA 2PPTA 2X49A 3FHKA 3L78A 1XVQA 1RW1A 4ZXGA 1GLPA 3IR4A 2K18A 4EXJA 1EV9A 4PUAA 3M1GA 2C80A 3L0HA 3HVNA 5HR0A 2HZEA 1KNGA 2LKUA 3C8EA 1WOUA 2DJ3A 3TKSA 1S3CA 3C73A 2G2QA 1URMA 1SK2A 2H72A 3DD3A 1TTZA 2GGTA 4KSOA 3HJPA 4G0KA 3FRCA 4XS4B 2C3TA 3CSJA 2NTOA 1T7PB 2B3SA 4CDOA 3RBTA 4KSMA 3G7IA 3HA9A 1FOHA 2O89A 1ZZYA 2YWMA 1TOFA 3ZITA 3O6TA 5JCUA 4G0LA 3LG6A 1M3IA 2V32A 2C3NA 4X0XA 5ECRB 4ZIJA 1GSDA 2IMFA 1YEPA 4FYUA 1JZRA 4AJ6A 3W6GA 3FR9A 2R2JA 5CYYA 4OFTA 2G0FA 3Q74A 1SKSB 3HJMA 1OC9A 2DJKA 2H01A 5CAXA 4K6XA 2O8VB 4HEA2 4MZBA 1SL2B 1GP1A 5F05A 4IP6A 2GDRA 3ZIJA 2AUVA 1EV4A 4K1FA 4O7HA 3UVHA 4FO5A 4GQFA 5ABRA 3QDNA 1PL2A 4MF6A 1HNBA 3DVWA 4V1Ag 3GKKA 3KIJA 2HSMA 3IK7A 2VD1A 1XZOA 4IQAA 4G0IA 5KN0A 2GQLA 2H1DA 4ZILA 3RAZA 3A2XA 5GSSA 2YV9A 5IMZA 4J56E 5J9BA 3ZFBA 5IOWA 3GYKA 3GSSA 1XWKA 1A2MA 2JU5A 5DQYA 4WF4A 3EURA 5G5EA 2JSZA 4N0VA 2ES7A 1O85A 3BD2A 1YJ6A 2IWTA 1ACVA 1ERVA 2PERA 1XW9A 3M9KA 4H86A 5HR3A 3BBYA 2C0FA 4Q5RA 1GSEA 1ZGNA 3ZVJD 3GKXA 4CY6A 1YQ1A 2YNXA 4PNGA 2YOIA 3KJYA 5G30A 1OC3A 1ERTA 1F6MC 2E0QA 1Q98A 2AAWA 4G2EA 1GTIA 1TRUA 2QKEA 3QAWA 3QMXA 3G9BA 1VRSD 4TXVA 5FT3A 4Q5NA 3ZMLA 1U88A 2GT5A 3H93A 4GSNA 3US3A 4HJ2A 3TKRA 3HZ8A 4K8MA 4K0NA 4JBBA 3VPQA 4ML1A 2CZ3A 3WD6A 1YF0A 5IO2A 2E7PA 1ML6A 5H5RA 3NZNA 4N0ZA 4L0WA 2HSHA 4CHSA 4JRRA 2LEGA 1GSYA 3FZAA 1GSUA 3ERWA 3FKFA 5ECPB 5HR2A 3TDGA 4JR4A 3DXBA 1NSWA 2PVQA 4XRAA 2P0GA 3F9UA 1QK8A 4OWYA 1ERUA 3VWXA 4I2TA 4P3YB 3IC4A 4WKWA 4EF0A 19GSA 1SKRB 3LYKA 5CRHA 4KDXA 1TU7A 3KXOA 3MSZA 2H19A 3LORA 1QFNA 1KEBA 4BVXB 3ME8A 4XS6A 2C0EA 2VM1A 2RUEA 1MEKA 5J4UA 3TCOA 1N2AA 2H1AA 1XCCA 1DBYA 3CYNA 1JZDA 4WXTA 1SK1A 1TRWA 4O5RA 1M3JA 1GTBA 1K0OA 3MYDA 2TIRA 4RQRA 2VCVA 1B4QA 3A5WA 1AQWA 6GSXA 3KMOA 4KW6A 3FR3A 4XTSA 4TRXA 3F3QA 2FUG2 1FVJA 1PX6A 2RM6A 4NHZA 4OO5A 1CQGA 4GLTA 3UIWA 3CXGA 3E3EA 4MJBA 3D4TA 3HY2A 4TXOB 3Q18A 4DSSB 2LTKA 3IK9A 3VWWA 1USBA 2HRFA 2GSRA 4N10A 3SWLA 4BVYB 3FY7A 3S9FA 4D73B 4OFMA 2X8CA 4GRFA 4KX4A 4O5QA 5AIXA 4HU7A 2V1MA 4ZL7A 3CMIA 4GQCA 1PFOA 4I5QA 4ZBBA 2X8GA 2FY6A 5E59A 1G7OA 2LJAA 4LMWA 2F8FA 4EO3A 4YQUA 2FWFA 3WGXA 2A4VA 2RIIA 4GCIA 3KM6A 2NPBA 4F82A 3VPTA 2IMKA 2DJ0A 4ECBA 2L6DA 1N8JA 3O76A 2PBJA 4ZBAA 3L9SA 3QFBC 4KCEA 1FB6A 2ALBA 3PPUA 1C72A 5J5NA 4ICYA 2H30A 3P8WA 1FOVA 4DEJA 3CTGA 2C0DA 4E8HA 4KCAA 3WGDA 2OBIA 1VF2A 4TR3A 1K0CA 2UZ8A 1XXUA 1PN9A 5ECMB 3D6IA 5DVBA 3RPNA 2I81A 5ECHB 4AF2A 2YANA 2V6KA 4HOJA 3I69A 3DEXA 1ZOFA 3D21A 4MPFA 2VLTA 5A4WA 1PKZA 4IGJA 4K7NA 1F2EA 1TKDB 3KP9A 1HNCA 1WP0A 4TR4A 1FG4A 1GNWA 1TI1A 3N9JA 2E2GA 1SJ6A 3P90A 4NV5A 3CQFA 2NDOA 1FB0A 3APQA 1NHOA 3DKSA 4POMA 3IE3A 1QXHA 2YWNA 2KHPA 5H5SA 2A2RA 2ZUPA 1J08A 2KLXA 2VAFA 1RK4A 3ZIVA 5J3RA 4KGIA 1J9BA 2YN1A 3HJOA 2P5QA 3UARA 3VURA 2FGXA 2DKIA 2IMEA 2H6XA 4XHMA 2HRNA 2PU9C 3KZQA 4TW5A 4K9ZA 20GSA 1WRYA 2GS3A 3MAKA 3K8NA 4TR1A 1M0UA 1SJZA 2K9FA 5HR1A 2B1KA 13GSA 3WYWA 2EC4A 4J57E 1O7UA 1BG5A 2MMAA 2R37A 1BAYA 1Z7PA 1ZYPA 1EOGA 2FWEA 5IMVA 4HZ4A 5DAKA 4MH2A 3EMPA 3NOFA 1TRSA 4Q5FA 4GWRA 2R0CA 2L5OA 5INYA 4CW9A 4GF0A 2C0GA 1Z3EA 3HHVA 5IIZA 3KH7A 3EU3A 3E9JB 2HZEB 1V9WA 5CRWA 1WJKA 2VD0A 1X9MB 4OMVA 2XC2A 5IOXA 2YP6A 3QR6A 2J9HA 3H4KA 2LQOA 1NHYA 4OFNA 3UOMA 2GZPA 3KP8A 5DJMA 4KH7A 3GSTA 4KNDA 2IN3A 3FZ5A 5EY6A 3C7MA 4RQXA 2L59A 1A0FA 2XBQA 1ZYNA 3CSIA 4PTSA 2H70A 4HSCX 1MD4A 3IPZA 1U3AA 2LJRA 1T3BA 3KGKA 1S3AA 4X1UA 3KTBA 1F9MA 5KN3A 1AXDA 3ERGA 4BWSA 4EIQA 2R4VA 5AISA 2WS2A 1PSQA 6GSYA 4K7IA 4GXZA 2DIZA 4YQVA 1B4PA 2HLSA 1TJDA 2GSSA 1PQNA 5JCWA 2N5BA 2WCIA 1OC9B 4KDYA 3VK9A 3ERFA 3GIXA 4LL4B 3ZVJA 1W89A 4HDEA 3IRAA 2HXKA 4EUYA 2FA8A 3GFKA 2AYTA 4IBPA 3EWLA 3BCKA 5BMUA 1X9SB 1Z7RA 5IMAA 2WZ9A 1K0NA 4ZB6A 2CA8A 4FIWA 1GUMA 3LXTA 5DDLA 17GSA 2YV7A 2C8UA 4PX1A 3A2WA 4QL9A 5DALA 5G31A 1NW2A 2OJLA 3E0UA 1S3DA 3C71A 5ECOB 1R5PA 3IAS2 4OCEA 1UA5A 1AQVA 3BOAA 3D4MA 1O81A 3VI7A 1OVNA 2DMMA 1LJRA 3EVIA 3ZYWA 2B5EA 1X5DA 3GV1A 1A0RP 1R5AA 2GTUA 1JZWA 2IMIA 4RI7A 4MF5A 1XWGA 1A8LA 4GSSA 2R3XA 3RHBA 2MZCA 2LRTA 1LU4A 3CBUA 4PGTA 3U6VA 4I2UA 5G1KA 4K2DA 1GTUA 3GURA 2KP1A 1XOBA 3QOUA 3TRQA 1F3AA 1VF1A 1TDIA 1SYXA 4MZWA 1V98A 4QL7A 1JLVA 3QCPA 2DIYA 2VLUA 3QD9A 1U3IA 5D96A 4KB3A 1X5EA 3Q19A 3F0IA 5A5KA 5KEJA 4MH3A 2GLRA 3GX0A 1MD3A 2VIMA 3QAGA 4MNNA 1GNEA 3BJ5A 1O8XA 2ON7A 1YKAA 1M7TA 2V41A 3MIXA 3UVTA 1BJXA 5D8IA 4F0CA 1GL8A 4NPBA 2FLSA 4G19A 4PNFA 1OKTA 1EP8A 3ZREA 2GQMA 3GTUB 4FYBA 4ZB8A 3G7JA 4L8EA 4XRDA 3F4TA 1XW6A 2CQ9A 5HQPA 3OR5A 4L5OA 1B48A 3GHAA 1JLWA 5DCHA 1AC1A 1ZCPA 5ELGA 2EIOA 5D93A 5IQYA 2B7JA 4N30A 1ST9A 3M0FA 1UVZA 1EEMA 1M99A 5D9VA 1MDIA 3IXRA 4O32A 18GSA 1OC8A 1EGRA 2AHEA 2YZUA 4YAPA 1DE1A 2IPAA 1TK8B 1M9AA 4Q5QA 5ID2A 3H1NA 1GSQA 2OE0A 1SU9A 2DBCA 4K0GA 4XIHA 5HFGA 5A4UA 3CRUA 2YZHA 6GSWA 3DMLA 3ZLPA 5FWGA 4IN0A 3FYGA 4MMMA 3UMAA 1Y25A 2P5RA 2O7KA 3KD0A 4Z2UA 3EYTA 1UC7A 5ECKB 4XCSA 5JCGA 3IV4A 5EPFA 1K3OA 2C1YA 3TUEA 4AJ7A 5DCGA 22GSA 1BYEA 1O8WA 2K6VA 3FW2A 3HXSA 1M9BA 4EC0A 1S3RA 2CVDA 1GWCA 2MBSA 2ON5A 3GUSA 2HFDA 1NM3A 2LRNA 3HD5A 3W8JA 1Z6MA 1DSBA 3TJGA 4HS1A 4TVEA 3IA1A 4I97A 6GSVA 3LFLA 3L4NA 2LSTA 3IDVA 5LNKe 4MZCA 3TRPA 3TRXA 2BTOT 3IC8A 4IJ3A 3UBKA 1HYUA 3RHCA 5G2ZA 1O73A 1A2JA 4BL7A 1U6TA 4F03A 1TK5B 4EKZA 2AJQB 3EU4A 2VCTA 3EINA 5DBQA 1XWBA 2DJJA 4KAEA 2GSTA 3QFAC 2ZCTA 1I5GA 4ZBDA 1DE2A 2VO4A 2BMXA 4YAVA 3C1RA 1QQ2A 2TRXA 1ZYQB 2HSYA 1EGOA 3JCML 1YKCA 3IHQA 4XS1A 2O85A 1WWJA 4ACSA 3P2AA 1YY7A 2VOCA 1HNAA 1FHEA 3TJFA 1V40A 2GZYA 1X5CA 1TP9A 3M8NA 4E8EA 2WJUA 1SENA 2FHEA 4PQ1A 2REMA 2YJ7A 5D9TA 4V2LA 4D73A 2PWJA 4A5PA 4EDZA 1T00A 5LCZA 1LBKA 3IBHA 2CVBA 2I9HA 2FWGA 1OYJA 4V2MA 4K5RA 3I43A 1FAAA 1GH2A 4PQHA 5D9WA 3APOA 3FK8A 1H4OA 1PN0A 1BQ7A 4MJCA 3LWAA 4EDYA 2V2GA 4OD7A 1YZXA 4K7OA 2B6MA 3ZL5A 3QPMA 3IAM2 1O6JA 3KTLA 1XW5A 4O5UA 1Z9HA 4BIKA 4HUAA 3VLNA 1QMVA 1A24A 5IO0A 1ILOA 5BRTA 4TR1B 3HVSA 3CTFA 3GH6A 2DJ2A 3ZFLA 3H79A 2OA7A 2VM2A 2PVOC 4NWYA 5GZZB 2N5AA 3M9JA 4TN8A 3A2VA 3V1WA 3HVXA 2XBIA 2EIQA 1GUKA 3EE2A 2R0PA 2AB6A 3ZTLA 5G5FA 4CY8A 4N11A 5B6MA 5DAKB 2AV4A 2I3YA 5COHA 4MDCA 4V2NA 5GAPD 5ECLB 4I8BA 2L6CA 3WT2A 2WRTA 2OADA 2PGTA 2DJ1A 3TGZA 3HVVA 4J2FA 14GSA 1QUWA 4K2XA 2YCDA 2B7KA 7GSSA 1X0RA 4K5SA 5CO3A 5F0GA 4KE3A 5ECSA 2FNOA 4MABA 3DIEA 5ECNB 2DSAA 1GLQA 5GSTA 3LGCA 2JZTA 2CAQA 5E4WA 2CVKA 3I9V2 4YKFA 1EWXA 4X4JA 2I4AA 1WE0A 2F51A 4NAXA 5F06A 3GNJA 4KUNA 2L4QA 1M2AA 1JZOA 3IHGA 3SBCA 3HYPA 1G6WA 5EL8A 5JWOB 1B9XC 2K8VA 2H73A 4NV2A 5KOXA 4WF5A 2EIRA 1SKWB 1SD9A 1E2YA 3TKQA 2A4HA 3LSZA 2VL2C 3FMWA 1GRXA 3I6AA 1SL0B 2IFQA 1Z5YE 3L9VA 3VWUA 3LW9A 2DLXA 3PR8A 1TW9A 4BPYA 1B9YC 4POBA 3FZ9A 2CT6A 3TJBA 2JACA 2L5LA 2O87A 4HQZA 2H6ZA 2N5FA 1T1VA 2F8AA 2E2MA 1AQXA 2VCZA 4FQUA 1PMTA 2YWOA 2LUSA 2V6OA 5KN1A 1V2AA 4I6XA 2HNLA 3HDCA 5DALB 5AGYA 2OBKA 3F8UA 5DJLA 2JADA 4QQ7A 3UJ1A 1KBNA 3DVXA 1HD2A 5CP1A 9GSSA 4IP1A 3EPTA 1MDJA 10GSA 3GL3A 3GX8A 1OE7A 1QGVA 3GN3A 5IMFA 2X99A 3EC3A 4DSRA 3BCIA 4WR5A 3ISOA 1A8YA 2H74A 3LXZA 1A2LA 2A2SA 2JZRA 3KEBA 3WGEA 4ZL8A 3TKPA 1IYIA 1XBSA 3HKRA 4IJIA 2FCHA 5CREA 1XIYA 4PURA 3TKSC 2B5YA 3GKNA 2NBSA 1YDKA 4ECCA 3QAVA 5CNWA 1JHBA 2MMNA 3MWHA 1ZYEA 3UAPA 4IKHA 3GKMA 3U5RE 3TJKA 4TKYA 5ECIB 1I9DA 4JU5A 2M72A 4ECIA 1R4WA 4ZB9A 1YEXA 5CRGA 4EVMA 1GULA 4EL1A 4XS4A 3UL3A 1BX9A 1OAZA 5C04A 2LQQA 2L4CA 5H5QA 1Z6NA 3GRXA 2OE3A 4NHWA 6GSSA 3A3TA 1GSSA 2HYXA 2GT6A 2VUPA 2F3MA 2LRCA 1X9WB 1GUHA 5IMCA 1IYHA 3DWVA 2LJKA 1GSFA 4ULXA 1F37A 5LD0A 2FWHA 2FA4A 2K8SA 4G10A 3CSHA 4FYCA 1A23A 4WBRD 3F4SA 4X43A 1MDKA 4AGSA 1FW1A 1T8EB 1JFUA 2HRAA 5KOWA 3C1SA 3M3MA 4JEDA 4LLRA 2LNTA 2IJYA 2X64A 3IOSA 1PGTA 2DKHA 1EEJA 5J41A 1HQOA 2OACA 2HI7A 1SL1B 4NMUA 4MA9A 4IS0A 1OE8A 2OKAA 2OE1A 1PX7A 2QGVA 2VL9A 1SD8A 2VCQA 3F3RA 4TOPA 5ENUA 4JZQA 1K3YA 1YF1A 4HZ2A 2F9SA 1TK0B 4HI7A 2XHFA 1TU8A 4MF7A 3PH9A 4Z7XA 4OO4A 3TB2A 5IPGA 1THOA 1G7EA 3J7Yb 2BJXA 3LJRA 3W8SA 3RDWA 5F07A 2VCXA 3ZZXA 5ID2B 1AW9A 4PUFC 2H1BA 1XG8A 5ELAA 2VL3A 2H75A 1WIKA 3PGTA 2H76A 4LMVA 1PA3A 1XFLA 2KP2A 1GTAA 2A2PA 1PKWA 1T4YA 4TR0A 4BA7A 2MMZA 1XVWA 1Y6EA 2H1GA 3MDKA 1F3BA 1V57A 5JWRB 4WEYA 2C4JA 2H66A 2QC7A 2KUCA 5IM9A 3ZMKA 1BEDA 1CQHA 4WETA 4MK3A 2CX3A 4PXOA 2HT9A 2GQKA 2RLIA 2GSQA 2TRCP 5FHIA 2JL4A 3GTUA 2XPDA 3TJJA 1PL1A 2YPMA 5G1LA 1WPIA 4MPGA 4HQSA 2R0GA 1EZKA 4V1Ap 1WMJA 1SJIA 3TOTA 11GSA 4JE1A 4IW9A 4RI6A 1FO5A 1ZL9A 4DSQA 2H0IA 3FR6A 3WT1A 5IMDA 4BL7B 3LEFA 3D5JA 1XOAA 4AJ8A 4KA0A 1R7HA 2HRKA 1AUCA 5JWQB 4NXIA 3UBLA 3MNGA 1TI3A 2PN8A 2QA2A 1W4VA 1AAZA 4USSA 4ILFA 4WR4A 4BVXA 4LL1B 2WFCA 2WDUA 4RUVA 3KCMA 2CZ2A 2NVLA 1PRXA 3CRTA 1SK0A 4IHUA 1TXXA 4F9ZA 3GA4A 1J0FA 4MP4A 2R6KA 2M46A 3L9UA 3N5OA 1B8XA 1G0TA 3AY8A 3KH9A 2WULA 2X4AA 4GSTA 2FD3A 4FH8A 4POLA 3KMNA 2HE3A 1ON4A 8GSSA 1FVKA 1R26A 3R3EA 4L5LA 12GSA 1Q4JA 16GSA 5GAND 2LNSA 3A5IA 4HU9A 2CAIA 2H0GA 2YJHA 5ECQB 4IVFA 5D9XA 2YWIA 2RUFA 3DGQA 3DRNA 4EE0A 4JR6A 3LQ7A 4TXOA 3O3TA 3Q6OA 4DSSA 1K0DA 1RQMA 4BVYA 2X8HA 1ERWA 3R2QA 3FEUA 3GMFA 2GZZA 2J23A 4ML6A 2CX4A 2IIYA 1H75A 3VWVA 5KN2A 3ED3A 2L57A 4HJMA 1XWAA 4MCUA 4MJAA 1THXA 4YH2A 6GSUA 3J7Yk 2R5GA 3HZ4A 2H0HA 2DMLA 2MBTA 4PQIA 2RM5A 1AIUA 4IELA 1XPVA 1K3LA 5L71A 4G9HA 3VI5A 3EMXA 3GH9A 2HZFA 5AIVA 1OKDA 4BWQA 4ID0A 2LS5A 3D22A 4L0UA 2I1UA 3UEMA 1EP7A 4YKGA 1MTCA 4KF9A 3APSA 3ME7A 2MYGA 2P31A 6GSTA 4ECJA 1EOHA 4POKA 3FZ4A 2VLVA 4KDUA 4GTUA
chains in the Genus database with same CATH topology
1V58A 1T4ZA 4EIPA 4LA1A 2KOKA 5CRDA 5B8BA 2H71A 5HFIA 2PMTA 4MLYA 3TKSE 4ISDA 3PINA 1DUGA 2H8LA 1ZMAA 1VGLA 3F6DA 5F8BA 4F0BA 2GVPA 4OCFA 1U87A 4Z2RA 1M2DA 5J9CA 3DYRA 5D73A 3F6FA 3HCZA 2VCWA 1E6BA 4WBJA 3F63A 5IPHA 2WGRA 2QA1A 2ZNMA 3RPPA 2IFQB 5A4VA 3P7XA 2DC5A 4MJEA 5B6NA 4Z2TA 2VL2A 4IQ1A 2IL3A 2JSYA 1TRVA 1K0BA 1K0AA 2C3QA 1VF4A 3LYPA 3ZRDA 2D2ZA 2WB9A 2B5XA 5C00A 1XWCA 1K0MA 3GL5A 3NIVA 2PUKC 5AN1A 2CV4A 2Z9SA 4ZL9A 2XPEA 3VFIA 1PD21 1ABAA 2JZSA 1SYRA 1UN2A 5DQSA 2MMOA 1G6YA 4YQMA 3D0ZA 1VF3A 4F2IA 5B7CA 5HFKA 2QSIA 2B1LA 3H8QA 3F4RA 5EVOA 3TOUA 2IMDA 1KTEA 2H6YA 3G7YA 1M2BA 4O92A 2LV3A 5B8AA 2M80A 4DVCA 2PPTA 2X49A 3FHKA 3L78A 1XVQA 1RW1A 4ZXGA 1GLPA 3IR4A 2K18A 4EXJA 1EV9A 4PUAA 3M1GA 2C80A 3L0HA 5HR0A 2HZEA 1KNGA 2LKUA 3C8EA 1WOUA 2DJ3A 3TKSA 1S3CA 3C73A 2G2QA 1URMA 1SK2A 2H72A 3DD3A 1TTZA 2GGTA 4KSOA 3HJPA 4G0KA 3FRCA 4XS4B 2C3TA 3CSJA 2NTOA 1T7PB 2B3SA 4CDOA 3RBTA 4KSMA 3G7IA 3HA9A 1FOHA 2O89A 1ZZYA 2YWMA 1TOFA 3ZITA 3O6TA 5JCUA 4G0LA 3LG6A 2V32A 2C3NA 4X0XA 5ECRB 4ZIJA 1GSDA 2IMFA 1YEPA 4FYUA 1JZRA 4AJ6A 3W6GA 3FR9A 2R2JA 5CYYA 4OFTA 2G0FA 3Q74A 1SKSB 3HJMA 1OC9A 2DJKA 2H01A 5CAXA 4K6XA 2O8VB 4HEA2 4MZBA 1SL2B 1GP1A 5F05A 4IP6A 2GDRA 3ZIJA 2AUVA 1EV4A 4K1FA 4O7HA 3UVHA 4FO5A 4GQFA 5ABRA 3QDNA 1PL2A 4MF6A 1HNBA 3DVWA 4V1Ag 3GKKA 3KIJA 2HSMA 3IK7A 2VD1A 1XZOA 4IQAA 4G0IA 5KN0A 2GQLA 2H1DA 4ZILA 3RAZA 3A2XA 5GSSA 2YV9A 5IMZA 4J56E 5J9BA 3ZFBA 5IOWA 3GYKA 3GSSA 1XWKA 1A2MA 2JU5A 5DQYA 4WF4A 3EURA 5G5EA 2JSZA 4N0VA 2ES7A 1O85A 3BD2A 1YJ6A 2IWTA 1ACVA 1ERVA 2PERA 1XW9A 3M9KA 4H86A 5HR3A 3BBYA 2C0FA 4Q5RA 1GSEA 1ZGNA 3ZVJD 3GKXA 4CY6A 1YQ1A 2YNXA 4PNGA 2YOIA 3KJYA 5G30A 1OC3A 1ERTA 1F6MC 2E0QA 1Q98A 2AAWA 4G2EA 1GTIA 1TRUA 2QKEA 3QAWA 3QMXA 3G9BA 1VRSD 4TXVA 5FT3A 4Q5NA 3ZMLA 1U88A 2GT5A 3H93A 4GSNA 3US3A 4HJ2A 3TKRA 3HZ8A 4K8MA 4K0NA 4JBBA 3VPQA 4ML1A 2CZ3A 3WD6A 1YF0A 5IO2A 2E7PA 1ML6A 5H5RA 3NZNA 4N0ZA 4L0WA 2HSHA 4CHSA 4JRRA 2LEGA 1GSYA 3FZAA 1GSUA 3ERWA 3FKFA 5ECPB 5HR2A 3TDGA 4JR4A 3DXBA 1NSWA 2PVQA 4XRAA 2P0GA 3F9UA 1QK8A 4OWYA 1ERUA 3VWXA 4I2TA 4P3YB 3IC4A 4WKWA 4EF0A 19GSA 1SKRB 3LYKA 5CRHA 4KDXA 1TU7A 3KXOA 3MSZA 2H19A 3LORA 1QFNA 1KEBA 4BVXB 3ME8A 4XS6A 2C0EA 2VM1A 2RUEA 1MEKA 5J4UA 3TCOA 1N2AA 2H1AA 1XCCA 1DBYA 3CYNA 1JZDA 4WXTA 1SK1A 1TRWA 4O5RA 1GTBA 1K0OA 3MYDA 2TIRA 4RQRA 2VCVA 1B4QA 3A5WA 1AQWA 6GSXA 3KMOA 4KW6A 3FR3A 4XTSA 4TRXA 3F3QA 2FUG2 1FVJA 1PX6A 2RM6A 4NHZA 4OO5A 1CQGA 4GLTA 3UIWA 3CXGA 3E3EA 4MJBA 3D4TA 3HY2A 4TXOB 3Q18A 4DSSB 2LTKA 3IK9A 3VWWA 1USBA 2HRFA 2GSRA 4N10A 3SWLA 4BVYB 3FY7A 3S9FA 4D73B 4OFMA 2X8CA 4GRFA 4KX4A 4O5QA 5AIXA 4HU7A 2V1MA 4ZL7A 3CMIA 4GQCA 4I5QA 4ZBBA 2X8GA 2FY6A 5E59A 1G7OA 2LJAA 4LMWA 2F8FA 4EO3A 4YQUA 2FWFA 3WGXA 2A4VA 2RIIA 4GCIA 3KM6A 2NPBA 4F82A 3VPTA 2IMKA 2DJ0A 4ECBA 2L6DA 1N8JA 3O76A 2PBJA 4ZBAA 3L9SA 3QFBC 4KCEA 1FB6A 2ALBA 3PPUA 1C72A 5J5NA 4ICYA 2H30A 3P8WA 1FOVA 4DEJA 3CTGA 2C0DA 4E8HA 4KCAA 3WGDA 2OBIA 1VF2A 4TR3A 1K0CA 2UZ8A 1XXUA 1PN9A 5ECMB 3D6IA 5DVBA 3RPNA 2I81A 5ECHB 4AF2A 2YANA 2V6KA 4HOJA 3I69A 3DEXA 1ZOFA 3D21A 4MPFA 2VLTA 5A4WA 1PKZA 4IGJA 4K7NA 1F2EA 1TKDB 3KP9A 1HNCA 1WP0A 4TR4A 1FG4A 1GNWA 1TI1A 3N9JA 2E2GA 1SJ6A 3P90A 4NV5A 2NDOA 1FB0A 3APQA 1NHOA 3DKSA 4POMA 3IE3A 1QXHA 2YWNA 2KHPA 5H5SA 2A2RA 2ZUPA 1J08A 2KLXA 2VAFA 1RK4A 3ZIVA 5J3RA 4KGIA 1J9BA 2YN1A 3HJOA 2P5QA 3UARA 3VURA 2FGXA 2DKIA 2IMEA 2H6XA 4XHMA 2HRNA 2PU9C 3KZQA 4TW5A 4K9ZA 20GSA 1WRYA 2GS3A 3MAKA 3K8NA 4TR1A 1M0UA 1SJZA 2K9FA 5HR1A 2B1KA 13GSA 3WYWA 2EC4A 4J57E 1O7UA 1BG5A 2MMAA 2R37A 1BAYA 1Z7PA 1ZYPA 1EOGA 2FWEA 5IMVA 4HZ4A 5DAKA 4MH2A 3EMPA 3NOFA 1TRSA 4Q5FA 4GWRA 2R0CA 2L5OA 5INYA 4CW9A 4GF0A 2C0GA 1Z3EA 3HHVA 5IIZA 3KH7A 3EU3A 3E9JB 2HZEB 1V9WA 5CRWA 1WJKA 2VD0A 1X9MB 4OMVA 2XC2A 5IOXA 2YP6A 3QR6A 2J9HA 3H4KA 2LQOA 1NHYA 4OFNA 3UOMA 2GZPA 3KP8A 5DJMA 4KH7A 3GSTA 4KNDA 2IN3A 3FZ5A 5EY6A 3C7MA 4RQXA 2L59A 1A0FA 2XBQA 1ZYNA 3CSIA 4PTSA 2H70A 1MD4A 3IPZA 1U3AA 2LJRA 1T3BA 3KGKA 1S3AA 4X1UA 3KTBA 1F9MA 5KN3A 1AXDA 3ERGA 4BWSA 4EIQA 2R4VA 5AISA 2WS2A 1PSQA 6GSYA 4K7IA 4GXZA 2DIZA 4YQVA 1B4PA 2HLSA 1TJDA 2GSSA 1PQNA 5JCWA 2N5BA 2WCIA 1OC9B 4KDYA 3VK9A 3ERFA 3GIXA 4LL4B 3ZVJA 1W89A 4HDEA 3IRAA 2HXKA 4EUYA 2FA8A 3GFKA 2AYTA 4IBPA 3EWLA 3BCKA 5BMUA 1X9SB 1Z7RA 5IMAA 2WZ9A 1K0NA 4ZB6A 2CA8A 4FIWA 1GUMA 3LXTA 5DDLA 17GSA 2YV7A 2C8UA 4PX1A 3A2WA 4QL9A 5DALA 5G31A 1NW2A 2OJLA 3E0UA 1S3DA 3C71A 5ECOB 1R5PA 3IAS2 4OCEA 1UA5A 1AQVA 3BOAA 3D4MA 1O81A 3VI7A 1OVNA 2DMMA 1LJRA 3EVIA 3ZYWA 2B5EA 1X5DA 3GV1A 1A0RP 1R5AA 2GTUA 1JZWA 2IMIA 4RI7A 4MF5A 1XWGA 1A8LA 4GSSA 2R3XA 3RHBA 2MZCA 2LRTA 1LU4A 3CBUA 4PGTA 3U6VA 4I2UA 5G1KA 4K2DA 1GTUA 3GURA 2KP1A 1XOBA 3QOUA 3TRQA 1F3AA 1VF1A 1TDIA 1SYXA 4MZWA 1V98A 4QL7A 1JLVA 3QCPA 2DIYA 2VLUA 3QD9A 1U3IA 5D96A 4KB3A 1X5EA 3Q19A 3F0IA 5A5KA 5KEJA 4MH3A 2GLRA 3GX0A 1MD3A 2VIMA 3QAGA 4MNNA 1GNEA 3BJ5A 1O8XA 2ON7A 1YKAA 1M7TA 2V41A 3MIXA 3UVTA 1BJXA 5D8IA 4F0CA 1GL8A 4NPBA 2FLSA 4G19A 4PNFA 1OKTA 1EP8A 3ZREA 2GQMA 3GTUB 4FYBA 4ZB8A 3G7JA 4L8EA 4XRDA 3F4TA 1XW6A 2CQ9A 5HQPA 3OR5A 4L5OA 1B48A 3GHAA 1JLWA 5DCHA 1AC1A 1ZCPA 5ELGA 2EIOA 5D93A 5IQYA 2B7JA 4N30A 1ST9A 3M0FA 1UVZA 1EEMA 1M99A 5D9VA 1MDIA 3IXRA 4O32A 18GSA 1OC8A 1EGRA 2AHEA 2YZUA 4YAPA 1DE1A 2IPAA 1TK8B 1M9AA 4Q5QA 5ID2A 3H1NA 1GSQA 2OE0A 1SU9A 2DBCA 4K0GA 4XIHA 5HFGA 5A4UA 3CRUA 2YZHA 6GSWA 3DMLA 3ZLPA 5FWGA 4IN0A 3FYGA 4MMMA 3UMAA 1Y25A 2P5RA 2O7KA 3KD0A 4Z2UA 3EYTA 1UC7A 5ECKB 4XCSA 5JCGA 3IV4A 5EPFA 1K3OA 2C1YA 3TUEA 4AJ7A 5DCGA 22GSA 1BYEA 1O8WA 2K6VA 3FW2A 3HXSA 1M9BA 4EC0A 2CVDA 1GWCA 2MBSA 2ON5A 3GUSA 2HFDA 1NM3A 2LRNA 3HD5A 3W8JA 1Z6MA 1DSBA 3TJGA 4HS1A 4TVEA 3IA1A 4I97A 6GSVA 3LFLA 3L4NA 2LSTA 3IDVA 5LNKe 4MZCA 3TRPA 3TRXA 2BTOT 3IC8A 4IJ3A 3UBKA 1HYUA 3RHCA 5G2ZA 1O73A 1A2JA 4BL7A 1U6TA 4F03A 1TK5B 4EKZA 2AJQB 3EU4A 2VCTA 3EINA 5DBQA 1XWBA 2DJJA 4KAEA 2GSTA 3QFAC 2ZCTA 1I5GA 4ZBDA 1DE2A 2VO4A 2BMXA 4YAVA 3C1RA 1QQ2A 2TRXA 1ZYQB 2HSYA 1EGOA 3JCML 1YKCA 3IHQA 4XS1A 2O85A 1WWJA 4ACSA 3P2AA 1YY7A 2VOCA 1HNAA 1FHEA 3TJFA 1V40A 2GZYA 1X5CA 1TP9A 3M8NA 4E8EA 2WJUA 1SENA 2FHEA 4PQ1A 2REMA 2YJ7A 5D9TA 4V2LA 4D73A 2PWJA 4A5PA 4EDZA 1T00A 5LCZA 1LBKA 3IBHA 2CVBA 2I9HA 2FWGA 1OYJA 4V2MA 4K5RA 3I43A 1FAAA 1GH2A 4PQHA 5D9WA 3APOA 3FK8A 1H4OA 1PN0A 1BQ7A 4MJCA 3LWAA 4EDYA 2V2GA 4OD7A 1YZXA 4K7OA 2B6MA 3ZL5A 3QPMA 3IAM2 1O6JA 3KTLA 1XW5A 4O5UA 1Z9HA 4HUAA 3VLNA 1QMVA 1A24A 5IO0A 1ILOA 5BRTA 4TR1B 3HVSA 3CTFA 3GH6A 2DJ2A 3ZFLA 3H79A 2OA7A 2VM2A 2PVOC 4NWYA 5GZZB 2N5AA 3M9JA 4TN8A 3A2VA 3V1WA 3HVXA 2XBIA 2EIQA 1GUKA 3EE2A 2R0PA 2AB6A 3ZTLA 5G5FA 4CY8A 4N11A 5B6MA 5DAKB 2AV4A 2I3YA 5COHA 4MDCA 4V2NA 5GAPD 5ECLB 4I8BA 2L6CA 3WT2A 2WRTA 2OADA 2PGTA 2DJ1A 3TGZA 3HVVA 4J2FA 14GSA 1QUWA 4K2XA 2YCDA 2B7KA 7GSSA 1X0RA 4K5SA 5CO3A 5F0GA 4KE3A 5ECSA 2FNOA 4MABA 3DIEA 5ECNB 2DSAA 1GLQA 5GSTA 3LGCA 2JZTA 2CAQA 5E4WA 2CVKA 3I9V2 4YKFA 1EWXA 4X4JA 2I4AA 1WE0A 2F51A 4NAXA 5F06A 3GNJA 4KUNA 2L4QA 1M2AA 1JZOA 3IHGA 3SBCA 3HYPA 1G6WA 5EL8A 5JWOB 1B9XC 2K8VA 2H73A 4NV2A 5KOXA 4WF5A 2EIRA 1SKWB 1SD9A 1E2YA 3TKQA 2A4HA 3LSZA 2VL2C 3FMWA 1GRXA 3I6AA 1SL0B 2IFQA 1Z5YE 3L9VA 3VWUA 3LW9A 2DLXA 3PR8A 1TW9A 4BPYA 1B9YC 4POBA 3FZ9A 2CT6A 3TJBA 2JACA 2L5LA 2O87A 4HQZA 2H6ZA 2N5FA 1T1VA 2F8AA 2E2MA 1AQXA 2VCZA 4FQUA 1PMTA 2YWOA 2LUSA 2V6OA 5KN1A 1V2AA 4I6XA 2HNLA 3HDCA 5DALB 5AGYA 2OBKA 3F8UA 5DJLA 2JADA 4QQ7A 3UJ1A 1KBNA 3DVXA 1HD2A 5CP1A 9GSSA 4IP1A 3EPTA 1MDJA 10GSA 3GL3A 3GX8A 1OE7A 1QGVA 3GN3A 5IMFA 2X99A 3EC3A 4DSRA 3BCIA 4WR5A 3ISOA 1A8YA 2H74A 3LXZA 1A2LA 2A2SA 2JZRA 3KEBA 3WGEA 4ZL8A 3TKPA 1IYIA 1XBSA 3HKRA 4IJIA 2FCHA 5CREA 1XIYA 4PURA 3TKSC 2B5YA 3GKNA 2NBSA 1YDKA 4ECCA 3QAVA 5CNWA 1JHBA 2MMNA 3MWHA 1ZYEA 3UAPA 4IKHA 3GKMA 3U5RE 3TJKA 4TKYA 5ECIB 1I9DA 4JU5A 2M72A 4ECIA 1R4WA 4ZB9A 1YEXA 5CRGA 4EVMA 1GULA 4EL1A 4XS4A 3UL3A 1BX9A 1OAZA 5C04A 2LQQA 2L4CA 5H5QA 1Z6NA 3GRXA 2OE3A 4NHWA 6GSSA 3A3TA 1GSSA 2HYXA 2GT6A 2VUPA 2F3MA 2LRCA 1X9WB 1GUHA 5IMCA 1IYHA 3DWVA 2LJKA 1GSFA 4ULXA 1F37A 5LD0A 2FWHA 2FA4A 2K8SA 4G10A 3CSHA 4FYCA 1A23A 4WBRD 3F4SA 4X43A 1MDKA 4AGSA 1FW1A 1T8EB 1JFUA 2HRAA 5KOWA 3C1SA 3M3MA 4JEDA 4LLRA 2LNTA 2IJYA 2X64A 3IOSA 1PGTA 2DKHA 1EEJA 5J41A 1HQOA 2OACA 2HI7A 1SL1B 4NMUA 4MA9A 4IS0A 1OE8A 2OKAA 2OE1A 1PX7A 2QGVA 2VL9A 1SD8A 2VCQA 3F3RA 4TOPA 5ENUA 4JZQA 1K3YA 1YF1A 4HZ2A 2F9SA 1TK0B 4HI7A 2XHFA 1TU8A 4MF7A 3PH9A 4Z7XA 4OO4A 3TB2A 5IPGA 1THOA 1G7EA 3J7Yb 2BJXA 3LJRA 3W8SA 3RDWA 5F07A 2VCXA 3ZZXA 5ID2B 1AW9A 4PUFC 2H1BA 5ELAA 2VL3A 2H75A 1WIKA 3PGTA 2H76A 4LMVA 1PA3A 1XFLA 2KP2A 1GTAA 2A2PA 1PKWA 1T4YA 4TR0A 4BA7A 2MMZA 1XVWA 1Y6EA 2H1GA 3MDKA 1F3BA 1V57A 5JWRB 4WEYA 2C4JA 2H66A 2QC7A 2KUCA 5IM9A 3ZMKA 1BEDA 1CQHA 4WETA 4MK3A 2CX3A 4PXOA 2HT9A 2GQKA 2RLIA 2GSQA 2TRCP 5FHIA 2JL4A 3GTUA 2XPDA 3TJJA 1PL1A 2YPMA 5G1LA 1WPIA 4MPGA 4HQSA 2R0GA 1EZKA 4V1Ap 1WMJA 1SJIA 3TOTA 11GSA 4JE1A 4IW9A 4RI6A 1FO5A 1ZL9A 4DSQA 2H0IA 3FR6A 3WT1A 5IMDA 4BL7B 3LEFA 3D5JA 1XOAA 4AJ8A 4KA0A 1R7HA 2HRKA 1AUCA 5JWQB 4NXIA 3UBLA 3MNGA 1TI3A 2PN8A 2QA2A 1W4VA 1AAZA 4USSA 4ILFA 4WR4A 4BVXA 4LL1B 2WFCA 2WDUA 4RUVA 3KCMA 2CZ2A 2NVLA 1PRXA 3CRTA 1SK0A 4IHUA 1TXXA 4F9ZA 3GA4A 1J0FA 4MP4A 2R6KA 2M46A 3L9UA 3N5OA 1B8XA 1G0TA 3AY8A 3KH9A 2WULA 2X4AA 4GSTA 2FD3A 4FH8A 4POLA 3KMNA 2HE3A 1ON4A 8GSSA 1FVKA 1R26A 3R3EA 4L5LA 12GSA 1Q4JA 16GSA 5GAND 2LNSA 3A5IA 4HU9A 2CAIA 2H0GA 2YJHA 5ECQB 4IVFA 5D9XA 2YWIA 2RUFA 3DGQA 3DRNA 4EE0A 4JR6A 3LQ7A 4TXOA 3O3TA 3Q6OA 4DSSA 1K0DA 1RQMA 4BVYA 2X8HA 1ERWA 3R2QA 3FEUA 3GMFA 2GZZA 2J23A 4ML6A 2CX4A 2IIYA 1H75A 3VWVA 5KN2A 3ED3A 2L57A 4HJMA 1XWAA 4MCUA 4MJAA 1THXA 4YH2A 6GSUA 3J7Yk 2R5GA 3HZ4A 2H0HA 2DMLA 2MBTA 4PQIA 2RM5A 1AIUA 4IELA 1XPVA 1K3LA 5L71A 4G9HA 3VI5A 3EMXA 3GH9A 2HZFA 5AIVA 1OKDA 4BWQA 4ID0A 2LS5A 3D22A 4L0UA 2I1UA 3UEMA 1EP7A 4YKGA 1MTCA 4KF9A 3APSA 3ME7A 2MYGA 2P31A 6GSTA 4ECJA 1EOHA 4POKA 3FZ4A 2VLVA 4KDUA 4GTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V58 A;  1T4Z A;  4LA1 A;  2KOK A;  5CRD A;  5B8B A;  2H71 A;  5HFI A;  2PMT A;  4MLY A;  3TKS E;  4ISD A;  3PIN A;  1DUG A;  2H8L A;  1ZMA A;  1VGL A;  3F6D A;  5F8B A;  4F0B A;  2GVP A;  4OCF A;  1U87 A;  1M2D A;  5J9C A;  3DYR A;  5D73 A;  3F6F A;  3HCZ A;  2VCW A;  1E6B A;  4WBJ A;  3F63 A;  5IPH A;  2WGR A;  2ZNM A;  3RPP A;  2IFQ B;  5A4V A;  3P7X A;  2DC5 A;  4MJE A;  5B6N A;  2VL2 A;  4IQ1 A;  2IL3 A;  2JSY A;  1TRV A;  1K0B A;  1K0A A;  2C3Q A;  1VF4 A;  3LYP A;  3ZRD A;  2D2Z A;  2WB9 A;  2B5X A;  5C00 A;  1XWC A;  1K0M A;  3GL5 A;  3NIV A;  2PUK C;  5AN1 A;  2CV4 A;  2Z9S A;  4ZL9 A;  2XPE A;  3VFI A;  1PD2 1;  1ABA A;  2JZS A;  1SYR A;  1UN2 A;  5DQS A;  2MMO A;  1G6Y A;  4YQM A;  3D0Z A;  1VF3 A;  4F2I A;  5B7C A;  5HFK A;  2QSI A;  2B1L A;  3H8Q A;  5EVO A;  3F4R A;  3TOU A;  2IMD A;  1KTE A;  2H6Y A;  3G7Y A;  1M2B A;  4O92 A;  2LV3 A;  5B8A A;  2M80 A;  4DVC A;  2PPT A;  3FHK A;  3L78 A;  1XVQ A;  1RW1 A;  4ZXG A;  1GLP A;  3IR4 A;  2K18 A;  4EXJ A;  1EV9 A;  4PUA A;  3M1G A;  2C80 A;  3L0H A;  5HR0 A;  2HZE A;  1KNG A;  2LKU A;  3C8E A;  1WOU A;  2DJ3 A;  3TKS A;  1S3C A;  3C73 A;  2G2Q A;  1URM A;  1SK2 A;  2H72 A;  3DD3 A;  1TTZ A;  2GGT A;  4KSO A;  3HJP A;  3FRC A;  4XS4 B;  2C3T A;  3CSJ A;  2NTO A;  1T7P B;  2B3S A;  4CDO A;  3RBT A;  4KSM A;  3G7I A;  3HA9 A;  2O89 A;  1ZZY A;  2YWM A;  1TOF A;  3ZIT A;  3O6T A;  5JCU A;  3LG6 A;  2V32 A;  2C3N A;  4X0X A;  5ECR B;  4ZIJ A;  1GSD A;  2IMF A;  1YEP A;  4FYU A;  1JZR A;  4AJ6 A;  3W6G A;  3FR9 A;  2R2J A;  5CYY A;  4OFT A;  2G0F A;  3Q74 A;  1SKS B;  3HJM A;  1OC9 A;  2DJK A;  2H01 A;  5CAX A;  4K6X A;  2O8V B;  4HEA 2;  4MZB A;  1SL2 B;  1GP1 A;  5F05 A;  4IP6 A;  2GDR A;  3ZIJ A;  2AUV A;  1EV4 A;  4K1F A;  4O7H A;  3UVH A;  4FO5 A;  4GQF A;  5ABR A;  3QDN A;  1PL2 A;  4MF6 A;  1HNB A;  3DVW A;  4V1A g;  3GKK A;  3KIJ A;  3IK7 A;  2VD1 A;  1XZO A;  4IQA A;  5KN0 A;  2GQL A;  2H1D A;  4ZIL A;  3RAZ A;  3A2X A;  5GSS A;  2YV9 A;  5IMZ A;  4J56 E;  5J9B A;  3ZFB A;  5IOW A;  3GYK A;  3GSS A;  1XWK A;  1A2M A;  2JU5 A;  5DQY A;  4WF4 A;  3EUR A;  5G5E A;  2JSZ A;  4N0V A;  2ES7 A;  1O85 A;  3BD2 A;  1YJ6 A;  2IWT A;  1ACV A;  1ERV A;  2PER A;  1XW9 A;  3M9K A;  4H86 A;  5HR3 A;  3BBY A;  2C0F A;  4Q5R A;  1GSE A;  1ZGN A;  3ZVJ D;  3GKX A;  1YQ1 A;  2YNX A;  4PNG A;  2YOI A;  3KJY A;  5G30 A;  1OC3 A;  1ERT A;  1F6M C;  2E0Q A;  1Q98 A;  2AAW A;  4G2E A;  1GTI A;  1TRU A;  2QKE A;  3QAW A;  3QMX A;  3G9B A;  1VRS D;  4TXV A;  5FT3 A;  4Q5N A;  3ZML A;  1U88 A;  2GT5 A;  3H93 A;  4GSN A;  3US3 A;  4HJ2 A;  3TKR A;  3HZ8 A;  4K8M A;  4K0N A;  4JBB A;  3VPQ A;  4ML1 A;  2CZ3 A;  3WD6 A;  1YF0 A;  5IO2 A;  2E7P A;  1ML6 A;  5H5R A;  3NZN A;  4N0Z A;  4L0W A;  2HSH A;  4CHS A;  4JRR A;  2LEG A;  1GSY A;  3FZA A;  5ECP B;  1GSU A;  3ERW A;  3FKF A;  5HR2 A;  3TDG A;  4JR4 A;  3DXB A;  1NSW A;  2PVQ A;  4XRA A;  2P0G A;  3F9U A;  1QK8 A;  4OWY A;  1ERU A;  3VWX A;  4I2T A;  4P3Y B;  3IC4 A;  4WKW A;  4EF0 A;  19GS A;  1SKR B;  3LYK A;  5CRH A;  4KDX A;  1TU7 A;  3KXO A;  3MSZ A;  2H19 A;  3LOR A;  1QFN A;  1KEB A;  3ME8 A;  4XS6 A;  2C0E A;  2VM1 A;  2RUE A;  1MEK A;  5J4U A;  3TCO A;  1N2A A;  2H1A A;  1XCC A;  1DBY A;  3CYN A;  1JZD A;  4WXT A;  1SK1 A;  1TRW A;  4O5R A;  1GTB A;  1K0O A;  2TIR A;  4RQR A;  2VCV A;  1B4Q A;  3A5W A;  1AQW A;  6GSX A;  3KMO A;  4KW6 A;  3FR3 A;  4XTS A;  4TRX A;  3F3Q A;  2FUG 2;  1FVJ A;  1PX6 A;  2RM6 A;  4NHZ A;  4OO5 A;  1CQG A;  4GLT A;  3UIW A;  3CXG A;  3E3E A;  4MJB A;  3D4T A;  3HY2 A;  4TXO B;  3Q18 A;  4DSS B;  2LTK A;  3IK9 A;  3VWW A;  1USB A;  2HRF A;  2GSR A;  4N10 A;  3SWL A;  3S9F A;  3FY7 A;  4D73 B;  4OFM A;  2X8C A;  4GRF A;  4KX4 A;  5AIX A;  4HU7 A;  2V1M A;  4ZL7 A;  3CMI A;  4GQC A;  4I5Q A;  4ZBB A;  2X8G A;  2FY6 A;  5E59 A;  1G7O A;  2LJA A;  4LMW A;  2F8F A;  4EO3 A;  4YQU A;  2FWF A;  3WGX A;  2A4V A;  2RII A;  4GCI A;  3KM6 A;  2NPB A;  4F82 A;  3VPT A;  2IMK A;  2DJ0 A;  4ECB A;  2L6D A;  1N8J A;  3O76 A;  2PBJ A;  4ZBA A;  3L9S A;  3QFB C;  4KCE A;  1FB6 A;  2ALB A;  1C72 A;  5J5N A;  2H30 A;  3P8W A;  1FOV A;  4DEJ A;  3CTG A;  2C0D A;  4E8H A;  4KCA A;  3WGD A;  2OBI A;  1VF2 A;  4TR3 A;  1K0C A;  1XXU A;  1PN9 A;  5ECM B;  3D6I A;  5DVB A;  3RPN A;  2I81 A;  5ECH B;  4AF2 A;  2YAN A;  2V6K A;  4HOJ A;  3I69 A;  3DEX A;  1ZOF A;  3D21 A;  4MPF A;  2VLT A;  5A4W A;  1PKZ A;  4IGJ A;  4K7N A;  1F2E A;  1TKD B;  3KP9 A;  1HNC A;  1WP0 A;  4TR4 A;  1FG4 A;  1GNW A;  1TI1 A;  3N9J A;  2E2G A;  1SJ6 A;  3P90 A;  4NV5 A;  2NDO A;  1FB0 A;  3APQ A;  1NHO A;  3DKS A;  4POM A;  3IE3 A;  1QXH A;  2YWN A;  2KHP A;  5H5S A;  2A2R A;  2ZUP A;  1J08 A;  2KLX A;  2VAF A;  1RK4 A;  3ZIV A;  5J3R A;  4KGI A;  1J9B A;  2YN1 A;  3HJO A;  2P5Q A;  3UAR A;  3VUR A;  2FGX A;  2IME A;  2H6X A;  4XHM A;  2HRN A;  2PU9 C;  3KZQ A;  4TW5 A;  4K9Z A;  20GS A;  1WRY A;  2GS3 A;  3MAK A;  3K8N A;  4TR1 A;  1M0U A;  1SJZ A;  2K9F A;  5HR1 A;  2B1K A;  13GS A;  3WYW A;  2EC4 A;  4J57 E;  1O7U A;  1BG5 A;  2MMA A;  2R37 A;  1BAY A;  1Z7P A;  1EOG A;  2FWE A;  5IMV A;  4HZ4 A;  5DAK A;  4MH2 A;  3EMP A;  3NOF A;  1TRS A;  4Q5F A;  4GWR A;  2L5O A;  5INY A;  4CW9 A;  4GF0 A;  2C0G A;  1Z3E A;  3HHV A;  5IIZ A;  3KH7 A;  3EU3 A;  3E9J B;  2HZE B;  1V9W A;  5CRW A;  1WJK A;  2VD0 A;  1X9M B;  4OMV A;  2XC2 A;  5IOX A;  2YP6 A;  3QR6 A;  2J9H A;  3H4K A;  2LQO A;  1NHY A;  4OFN A;  3UOM A;  2GZP A;  3KP8 A;  5DJM A;  4KH7 A;  3GST A;  4KND A;  2IN3 A;  3FZ5 A;  5EY6 A;  3C7M A;  4RQX A;  2L59 A;  1A0F A;  2XBQ A;  3CSI A;  2H70 A;  1MD4 A;  3IPZ A;  1U3A A;  2LJR A;  1T3B A;  3KGK A;  1S3A A;  4X1U A;  3KTB A;  1F9M A;  5KN3 A;  1AXD A;  3ERG A;  4BWS A;  2R4V A;  5AIS A;  2WS2 A;  1PSQ A;  6GSY A;  4K7I A;  4GXZ A;  2DIZ A;  4YQV A;  1B4P A;  2HLS A;  1TJD A;  2GSS A;  1PQN A;  5JCW A;  2N5B A;  2WCI A;  1OC9 B;  4KDY A;  3VK9 A;  3ERF A;  3GIX A;  4LL4 B;  3ZVJ A;  1W89 A;  4HDE A;  3IRA A;  2HXK A;  4EUY A;  2FA8 A;  3GFK A;  2AYT A;  4IBP A;  3EWL A;  3BCK A;  1X9S B;  1Z7R A;  5IMA A;  2WZ9 A;  1K0N A;  4ZB6 A;  2CA8 A;  4FIW A;  1GUM A;  3LXT A;  5DDL A;  17GS A;  2YV7 A;  2C8U A;  4PX1 A;  3A2W A;  4QL9 A;  5DAL A;  5G31 A;  1NW2 A;  2OJL A;  3E0U A;  1S3D A;  3C71 A;  5ECO B;  1R5P A;  3IAS 2;  4OCE A;  1UA5 A;  1AQV A;  3BOA A;  3D4M A;  1O81 A;  3VI7 A;  1OVN A;  2DMM A;  1LJR A;  3EVI A;  3ZYW A;  2B5E A;  1X5D A;  3GV1 A;  1A0R P;  1R5A A;  2GTU A;  1JZW A;  2IMI A;  4RI7 A;  4MF5 A;  1XWG A;  1A8L A;  4GSS A;  2R3X A;  3RHB A;  2MZC A;  2LRT A;  1LU4 A;  3CBU A;  4PGT A;  3U6V A;  4I2U A;  5G1K A;  4K2D A;  1GTU A;  3GUR A;  2KP1 A;  1XOB A;  3QOU A;  3TRQ A;  1F3A A;  1VF1 A;  1TDI A;  1SYX A;  4MZW A;  1V98 A;  4QL7 A;  1JLV A;  3QCP A;  2DIY A;  2VLU A;  3QD9 A;  1U3I A;  5D96 A;  4KB3 A;  1X5E A;  3Q19 A;  3F0I A;  5A5K A;  5KEJ A;  4MH3 A;  2GLR A;  3GX0 A;  1MD3 A;  2VIM A;  3QAG A;  1GNE A;  3BJ5 A;  1O8X A;  2ON7 A;  1YKA A;  1M7T A;  2V41 A;  3UVT A;  1BJX A;  5D8I A;  4F0C A;  1GL8 A;  4NPB A;  2FLS A;  4G19 A;  4PNF A;  1OKT A;  1EP8 A;  3ZRE A;  2GQM A;  3GTU B;  4FYB A;  4ZB8 A;  3G7J A;  4L8E A;  4XRD A;  3F4T A;  1XW6 A;  2CQ9 A;  5HQP A;  3OR5 A;  4L5O A;  1B48 A;  3GHA A;  1JLW A;  5DCH A;  1AC1 A;  1ZCP A;  5ELG A;  2EIO A;  5D93 A;  5IQY A;  2B7J A;  4N30 A;  1ST9 A;  3M0F A;  1UVZ A;  1EEM A;  1M99 A;  5D9V A;  1MDI A;  3IXR A;  4O32 A;  18GS A;  1OC8 A;  1EGR A;  2AHE A;  2YZU A;  4YAP A;  1DE1 A;  2IPA A;  1TK8 B;  1M9A A;  4Q5Q A;  5ID2 A;  3H1N A;  1GSQ A;  2OE0 A;  1SU9 A;  2DBC A;  4K0G A;  4XIH A;  5HFG A;  5A4U A;  3CRU A;  2YZH A;  6GSW A;  3DML A;  3ZLP A;  5FWG A;  4IN0 A;  3FYG A;  4MMM A;  3UMA A;  1Y25 A;  2P5R A;  2O7K A;  3KD0 A;  3EYT A;  1UC7 A;  5ECK B;  4XCS A;  5JCG A;  3IV4 A;  5EPF A;  1K3O A;  2C1Y A;  3TUE A;  4AJ7 A;  5DCG A;  22GS A;  1BYE A;  1O8W A;  2K6V A;  3FW2 A;  3HXS A;  1M9B A;  4EC0 A;  2CVD A;  1GWC A;  2MBS A;  2ON5 A;  3GUS A;  2HFD A;  1NM3 A;  2LRN A;  3HD5 A;  3W8J A;  1Z6M A;  1DSB A;  3TJG A;  4HS1 A;  4TVE A;  3IA1 A;  4I97 A;  6GSV A;  3LFL A;  3L4N A;  2LST A;  3IDV A;  5LNK e;  4MZC A;  3TRP A;  3TRX A;  2BTO T;  3UBK A;  4IJ3 A;  1HYU A;  3RHC A;  5G2Z A;  1O73 A;  1A2J A;  4BL7 A;  1U6T A;  4F03 A;  1TK5 B;  4EKZ A;  2AJQ B;  3EU4 A;  2VCT A;  3EIN A;  5DBQ A;  1XWB A;  2DJJ A;  4KAE A;  2GST A;  3QFA C;  2ZCT A;  1I5G A;  4ZBD A;  1DE2 A;  2VO4 A;  2BMX A;  4YAV A;  3C1R A;  1QQ2 A;  2TRX A;  1ZYQ B;  2HSY A;  1EGO A;  3JCM L;  1YKC A;  3IHQ A;  4XS1 A;  2O85 A;  1WWJ A;  4ACS A;  3P2A A;  1YY7 A;  2VOC A;  1HNA A;  1FHE A;  3TJF A;  1V40 A;  2GZY A;  1X5C A;  1TP9 A;  3M8N A;  4E8E A;  2WJU A;  1SEN A;  2FHE A;  4PQ1 A;  2REM A;  2YJ7 A;  5D9T A;  4V2L A;  4D73 A;  2PWJ A;  4EDZ A;  1T00 A;  5LCZ A;  1LBK A;  3IBH A;  2CVB A;  2I9H A;  2FWG A;  1OYJ A;  4V2M A;  3I43 A;  1FAA A;  1GH2 A;  4PQH A;  5D9W A;  3APO A;  3FK8 A;  1H4O A;  1BQ7 A;  4MJC A;  3LWA A;  4EDY A;  2V2G A;  4OD7 A;  1YZX A;  4K7O A;  2B6M A;  3ZL5 A;  3QPM A;  3IAM 2;  1O6J A;  3KTL A;  1XW5 A;  1Z9H A;  4HUA A;  3VLN A;  1QMV A;  1A24 A;  5IO0 A;  1ILO A;  4TR1 B;  3HVS A;  3CTF A;  3GH6 A;  2DJ2 A;  3ZFL A;  3H79 A;  2OA7 A;  2VM2 A;  2PVO C;  4NWY A;  5GZZ B;  2N5A A;  3M9J A;  4TN8 A;  3A2V A;  3V1W A;  3HVX A;  2XBI A;  2EIQ A;  1GUK A;  3EE2 A;  2AB6 A;  3ZTL A;  5G5F A;  4N11 A;  5B6M A;  5DAK B;  2AV4 A;  2I3Y A;  5COH A;  4MDC A;  4V2N A;  5GAP D;  5ECL B;  4I8B A;  2L6C A;  3WT2 A;  2WRT A;  2OAD A;  2PGT A;  2DJ1 A;  3TGZ A;  3HVV A;  4J2F A;  14GS A;  1QUW A;  2YCD A;  2B7K A;  7GSS A;  1X0R A;  5CO3 A;  5F0G A;  4KE3 A;  5ECS A;  2FNO A;  4MAB A;  3DIE A;  5ECN B;  2DSA A;  1GLQ A;  5GST A;  3LGC A;  2JZT A;  2CAQ A;  5E4W A;  2CVK A;  3I9V 2;  1EWX A;  2I4A A;  1WE0 A;  2F51 A;  4NAX A;  5F06 A;  3GNJ A;  4KUN A;  2L4Q A;  1M2A A;  1JZO A;  3SBC A;  3HYP A;  1G6W A;  5EL8 A;  5JWO B;  1B9X C;  2K8V A;  2H73 A;  4NV2 A;  4WF5 A;  2EIR A;  1SKW B;  1SD9 A;  1E2Y A;  3TKQ A;  3LSZ A;  2VL2 C;  1GRX A;  3I6A A;  1SL0 B;  2IFQ A;  1Z5Y E;  3L9V A;  3VWU A;  2DLX A;  3PR8 A;  1TW9 A;  4BPY A;  1B9Y C;  4POB A;  3FZ9 A;  2CT6 A;  3TJB A;  2JAC A;  2L5L A;  2O87 A;  4HQZ A;  2H6Z A;  2N5F A;  1T1V A;  2F8A A;  2E2M A;  1AQX A;  2VCZ A;  1PMT A;  2YWO A;  2LUS A;  2V6O A;  5KN1 A;  1V2A A;  4I6X A;  2HNL A;  3HDC A;  5DAL B;  5AGY A;  2OBK A;  3F8U A;  5DJL A;  2JAD A;  4QQ7 A;  3UJ1 A;  1KBN A;  3DVX A;  1HD2 A;  5CP1 A;  9GSS A;  4IP1 A;  1MDJ A;  10GS A;  3GL3 A;  3GX8 A;  1OE7 A;  1QGV A;  3GN3 A;  5IMF A;  2X99 A;  3EC3 A;  4DSR A;  3BCI A;  4WR5 A;  3ISO A;  1A8Y A;  2H74 A;  3LXZ A;  1A2L A;  2A2S A;  2JZR A;  3KEB A;  3WGE A;  4ZL8 A;  3TKP A;  1IYI A;  1XBS A;  3HKR A;  4IJI A;  2FCH A;  5CRE A;  1XIY A;  4PUR A;  3TKS C;  2B5Y A;  3GKN A;  2NBS A;  1YDK A;  4ECC A;  3QAV A;  5CNW A;  1JHB A;  2MMN A;  3MWH A;  1ZYE A;  3UAP A;  4IKH A;  3GKM A;  3U5R E;  3TJK A;  4TKY A;  5ECI B;  1I9D A;  4JU5 A;  2M72 A;  4ECI A;  1R4W A;  4ZB9 A;  1YEX A;  5CRG A;  4EVM A;  1GUL A;  4EL1 A;  4XS4 A;  3UL3 A;  1BX9 A;  1OAZ A;  5C04 A;  2LQQ A;  2L4C A;  5H5Q A;  1Z6N A;  3GRX A;  2OE3 A;  4NHW A;  6GSS A;  3A3T A;  1GSS A;  2HYX A;  2GT6 A;  2VUP A;  2F3M A;  2LRC A;  1X9W B;  1GUH A;  5IMC A;  1IYH A;  3DWV A;  2LJK A;  1GSF A;  4ULX A;  1F37 A;  5LD0 A;  2FWH A;  2FA4 A;  2K8S A;  4G10 A;  3CSH A;  4FYC A;  1A23 A;  4WBR D;  3F4S A;  4X43 A;  1MDK A;  4AGS A;  1FW1 A;  1T8E B;  1JFU A;  3C1S A;  3M3M A;  4JED A;  4LLR A;  2LNT A;  2IJY A;  2X64 A;  3IOS A;  1PGT A;  1EEJ A;  5J41 A;  1HQO A;  2OAC A;  2HI7 A;  1SL1 B;  4NMU A;  4MA9 A;  4IS0 A;  1OE8 A;  2OKA A;  2OE1 A;  1PX7 A;  2QGV A;  2VL9 A;  1SD8 A;  2VCQ A;  3F3R A;  4TOP A;  5ENU A;  4JZQ A;  1K3Y A;  1YF1 A;  4HZ2 A;  2F9S A;  1TK0 B;  4HI7 A;  2XHF A;  1TU8 A;  4MF7 A;  3PH9 A;  4Z7X A;  4OO4 A;  3TB2 A;  5IPG A;  1THO A;  1G7E A;  3J7Y b;  2BJX A;  3LJR A;  3W8S A;  3RDW A;  5F07 A;  2VCX A;  3ZZX A;  5ID2 B;  1AW9 A;  4PUF C;  2H1B A;  5ELA A;  2VL3 A;  2H75 A;  1WIK A;  3PGT A;  2H76 A;  4LMV A;  1PA3 A;  1XFL A;  2KP2 A;  1GTA A;  1PKW A;  1T4Y A;  4TR0 A;  4BA7 A;  2MMZ A;  1XVW A;  1Y6E A;  2H1G A;  3MDK A;  1F3B A;  1V57 A;  5JWR B;  4WEY A;  2C4J A;  2H66 A;  2QC7 A;  2KUC A;  5IM9 A;  3ZMK A;  1BED A;  1CQH A;  4WET A;  4MK3 A;  2CX3 A;  4PXO A;  2HT9 A;  2GQK A;  2RLI A;  2GSQ A;  2TRC P;  5FHI A;  2JL4 A;  3GTU A;  2XPD A;  3TJJ A;  1PL1 A;  2YPM A;  5G1L A;  1WPI A;  4MPG A;  4HQS A;  1EZK A;  4V1A p;  1WMJ A;  1SJI A;  3TOT A;  11GS A;  4JE1 A;  4IW9 A;  4RI6 A;  1FO5 A;  1ZL9 A;  4DSQ A;  2H0I A;  3FR6 A;  3WT1 A;  5IMD A;  3LEF A;  3D5J A;  1XOA A;  4AJ8 A;  4KA0 A;  1R7H A;  1AUC A;  5JWQ B;  4NXI A;  3UBL A;  3MNG A;  1TI3 A;  2PN8 A;  1W4V A;  1AAZ A;  4ILF A;  4WR4 A;  4BVX A;  4LL1 B;  2WFC A;  2WDU A;  4RUV A;  3KCM A;  2CZ2 A;  2NVL A;  1PRX A;  3CRT A;  1SK0 A;  4IHU A;  1TXX A;  4F9Z A;  3GA4 A;  1J0F A;  4MP4 A;  2R6K A;  2M46 A;  3L9U A;  3N5O A;  1B8X A;  1G0T A;  3AY8 A;  3KH9 A;  2WUL A;  4GST A;  2FD3 A;  4FH8 A;  4POL A;  3KMN A;  2HE3 A;  1ON4 A;  8GSS A;  1FVK A;  1R26 A;  4L5L A;  12GS A;  1Q4J A;  16GS A;  5GAN D;  2LNS A;  4HU9 A;  2CAI A;  2H0G A;  2YJH A;  5ECQ B;  4IVF A;  5D9X A;  2YWI A;  2RUF A;  3DGQ A;  3DRN A;  4EE0 A;  4JR6 A;  3LQ7 A;  4TXO A;  3O3T A;  3Q6O A;  4DSS A;  1K0D A;  1RQM A;  4BVY A;  2X8H A;  1ERW A;  3R2Q A;  3FEU A;  3GMF A;  2GZZ A;  2J23 A;  4ML6 A;  2CX4 A;  2IIY A;  1H75 A;  3VWV A;  5KN2 A;  3ED3 A;  2L57 A;  4HJM A;  1XWA A;  4MCU A;  4MJA A;  1THX A;  4YH2 A;  6GSU A;  3J7Y k;  2R5G A;  3HZ4 A;  2H0H A;  2DML A;  2MBT A;  4PQI A;  2RM5 A;  1AIU A;  4IEL A;  1XPV A;  1K3L A;  5L71 A;  4G9H A;  3VI5 A;  3EMX A;  3GH9 A;  2HZF A;  5AIV A;  1OKD A;  4BWQ A;  4ID0 A;  2LS5 A;  3D22 A;  4L0U A;  2I1U A;  3UEM A;  1EP7 A;  1MTC A;  3APS A;  3ME7 A;  2MYG A;  2P31 A;  6GST A;  4ECJ A;  1EOH A;  4POK A;  3FZ4 A;  2VLV A;  4KDU A;  4GTU A; 
#chains in the Genus database with same CATH topology
 1V58 A;  1T4Z A;  4EIP A;  4LA1 A;  2KOK A;  5CRD A;  5B8B A;  2H71 A;  5HFI A;  2PMT A;  4MLY A;  3TKS E;  4ISD A;  3PIN A;  1DUG A;  2H8L A;  1ZMA A;  1VGL A;  3F6D A;  5F8B A;  4F0B A;  2GVP A;  4OCF A;  1U87 A;  4Z2R A;  1M2D A;  5J9C A;  3DYR A;  5D73 A;  3F6F A;  3HCZ A;  2VCW A;  1E6B A;  4WBJ A;  3F63 A;  5IPH A;  2WGR A;  2QA1 A;  2ZNM A;  3RPP A;  2IFQ B;  5A4V A;  3P7X A;  2DC5 A;  4MJE A;  5B6N A;  4Z2T A;  2VL2 A;  4IQ1 A;  2IL3 A;  2JSY A;  1TRV A;  1K0B A;  1K0A A;  2C3Q A;  1VF4 A;  3LYP A;  3ZRD A;  2D2Z A;  2WB9 A;  2B5X A;  5C00 A;  1XWC A;  1K0M A;  3GL5 A;  3NIV A;  2PUK C;  5AN1 A;  2CV4 A;  2Z9S A;  4ZL9 A;  2XPE A;  3VFI A;  1PD2 1;  1ABA A;  2JZS A;  1SYR A;  1UN2 A;  5DQS A;  2MMO A;  1G6Y A;  4YQM A;  3D0Z A;  1VF3 A;  4F2I A;  5B7C A;  5HFK A;  2QSI A;  2B1L A;  3H8Q A;  3F4R A;  5EVO A;  3TOU A;  2IMD A;  1KTE A;  2H6Y A;  3G7Y A;  1M2B A;  4O92 A;  2LV3 A;  5B8A A;  2M80 A;  4DVC A;  2PPT A;  2X49 A;  3FHK A;  3L78 A;  1XVQ A;  1RW1 A;  4ZXG A;  1GLP A;  3IR4 A;  2K18 A;  4EXJ A;  1EV9 A;  4PUA A;  3M1G A;  2C80 A;  3L0H A;  3HVN A;  5HR0 A;  2HZE A;  1KNG A;  2LKU A;  3C8E A;  1WOU A;  2DJ3 A;  3TKS A;  1S3C A;  3C73 A;  2G2Q A;  1URM A;  1SK2 A;  2H72 A;  3DD3 A;  1TTZ A;  2GGT A;  4KSO A;  3HJP A;  4G0K A;  3FRC A;  4XS4 B;  2C3T A;  3CSJ A;  2NTO A;  1T7P B;  2B3S A;  4CDO A;  3RBT A;  4KSM A;  3G7I A;  3HA9 A;  1FOH A;  2O89 A;  1ZZY A;  2YWM A;  1TOF A;  3ZIT A;  3O6T A;  5JCU A;  4G0L A;  3LG6 A;  1M3I A;  2V32 A;  2C3N A;  4X0X A;  5ECR B;  4ZIJ A;  1GSD A;  2IMF A;  1YEP A;  4FYU A;  1JZR A;  4AJ6 A;  3W6G A;  3FR9 A;  2R2J A;  5CYY A;  4OFT A;  2G0F A;  3Q74 A;  1SKS B;  3HJM A;  1OC9 A;  2DJK A;  2H01 A;  5CAX A;  4K6X A;  2O8V B;  4HEA 2;  4MZB A;  1SL2 B;  1GP1 A;  5F05 A;  4IP6 A;  2GDR A;  3ZIJ A;  2AUV A;  1EV4 A;  4K1F A;  4O7H A;  3UVH A;  4FO5 A;  4GQF A;  5ABR A;  3QDN A;  1PL2 A;  4MF6 A;  1HNB A;  3DVW A;  4V1A g;  3GKK A;  3KIJ A;  2HSM A;  3IK7 A;  2VD1 A;  1XZO A;  4IQA A;  4G0I A;  5KN0 A;  2GQL A;  2H1D A;  4ZIL A;  3RAZ A;  3A2X A;  5GSS A;  2YV9 A;  5IMZ A;  4J56 E;  5J9B A;  3ZFB A;  5IOW A;  3GYK A;  3GSS A;  1XWK A;  1A2M A;  2JU5 A;  5DQY A;  4WF4 A;  3EUR A;  5G5E A;  2JSZ A;  4N0V A;  2ES7 A;  1O85 A;  3BD2 A;  1YJ6 A;  2IWT A;  1ACV A;  1ERV A;  2PER A;  1XW9 A;  3M9K A;  4H86 A;  5HR3 A;  3BBY A;  2C0F A;  4Q5R A;  1GSE A;  1ZGN A;  3ZVJ D;  3GKX A;  4CY6 A;  1YQ1 A;  2YNX A;  4PNG A;  2YOI A;  3KJY A;  5G30 A;  1OC3 A;  1ERT A;  1F6M C;  2E0Q A;  1Q98 A;  2AAW A;  4G2E A;  1GTI A;  1TRU A;  2QKE A;  3QAW A;  3QMX A;  3G9B A;  1VRS D;  4TXV A;  5FT3 A;  4Q5N A;  3ZML A;  1U88 A;  2GT5 A;  3H93 A;  4GSN A;  3US3 A;  4HJ2 A;  3TKR A;  3HZ8 A;  4K8M A;  4K0N A;  4JBB A;  3VPQ A;  4ML1 A;  2CZ3 A;  3WD6 A;  1YF0 A;  5IO2 A;  2E7P A;  1ML6 A;  5H5R A;  3NZN A;  4N0Z A;  4L0W A;  2HSH A;  4CHS A;  4JRR A;  2LEG A;  1GSY A;  3FZA A;  1GSU A;  3ERW A;  3FKF A;  5ECP B;  5HR2 A;  3TDG A;  4JR4 A;  3DXB A;  1NSW A;  2PVQ A;  4XRA A;  2P0G A;  3F9U A;  1QK8 A;  4OWY A;  1ERU A;  3VWX A;  4I2T A;  4P3Y B;  3IC4 A;  4WKW A;  4EF0 A;  19GS A;  1SKR B;  3LYK A;  5CRH A;  4KDX A;  1TU7 A;  3KXO A;  3MSZ A;  2H19 A;  3LOR A;  1QFN A;  1KEB A;  4BVX B;  3ME8 A;  4XS6 A;  2C0E A;  2VM1 A;  2RUE A;  1MEK A;  5J4U A;  3TCO A;  1N2A A;  2H1A A;  1XCC A;  1DBY A;  3CYN A;  1JZD A;  4WXT A;  1SK1 A;  1TRW A;  4O5R A;  1M3J A;  1GTB A;  1K0O A;  3MYD A;  2TIR A;  4RQR A;  2VCV A;  1B4Q A;  3A5W A;  1AQW A;  6GSX A;  3KMO A;  4KW6 A;  3FR3 A;  4XTS A;  4TRX A;  3F3Q A;  2FUG 2;  1FVJ A;  1PX6 A;  2RM6 A;  4NHZ A;  4OO5 A;  1CQG A;  4GLT A;  3UIW A;  3CXG A;  3E3E A;  4MJB A;  3D4T A;  3HY2 A;  4TXO B;  3Q18 A;  4DSS B;  2LTK A;  3IK9 A;  3VWW A;  1USB A;  2HRF A;  2GSR A;  4N10 A;  3SWL A;  4BVY B;  3FY7 A;  3S9F A;  4D73 B;  4OFM A;  2X8C A;  4GRF A;  4KX4 A;  4O5Q A;  5AIX A;  4HU7 A;  2V1M A;  4ZL7 A;  3CMI A;  4GQC A;  1PFO A;  4I5Q A;  4ZBB A;  2X8G A;  2FY6 A;  5E59 A;  1G7O A;  2LJA A;  4LMW A;  2F8F A;  4EO3 A;  4YQU A;  2FWF A;  3WGX A;  2A4V A;  2RII A;  4GCI A;  3KM6 A;  2NPB A;  4F82 A;  3VPT A;  2IMK A;  2DJ0 A;  4ECB A;  2L6D A;  1N8J A;  3O76 A;  2PBJ A;  4ZBA A;  3L9S A;  3QFB C;  4KCE A;  1FB6 A;  2ALB A;  3PPU A;  1C72 A;  5J5N A;  4ICY A;  2H30 A;  3P8W A;  1FOV A;  4DEJ A;  3CTG A;  2C0D A;  4E8H A;  4KCA A;  3WGD A;  2OBI A;  1VF2 A;  4TR3 A;  1K0C A;  2UZ8 A;  1XXU A;  1PN9 A;  5ECM B;  3D6I A;  5DVB A;  3RPN A;  2I81 A;  5ECH B;  4AF2 A;  2YAN A;  2V6K A;  4HOJ A;  3I69 A;  3DEX A;  1ZOF A;  3D21 A;  4MPF A;  2VLT A;  5A4W A;  1PKZ A;  4IGJ A;  4K7N A;  1F2E A;  1TKD B;  3KP9 A;  1HNC A;  1WP0 A;  4TR4 A;  1FG4 A;  1GNW A;  1TI1 A;  3N9J A;  2E2G A;  1SJ6 A;  3P90 A;  4NV5 A;  3CQF A;  2NDO A;  1FB0 A;  3APQ A;  1NHO A;  3DKS A;  4POM A;  3IE3 A;  1QXH A;  2YWN A;  2KHP A;  5H5S A;  2A2R A;  2ZUP A;  1J08 A;  2KLX A;  2VAF A;  1RK4 A;  3ZIV A;  5J3R A;  4KGI A;  1J9B A;  2YN1 A;  3HJO A;  2P5Q A;  3UAR A;  3VUR A;  2FGX A;  2DKI A;  2IME A;  2H6X A;  4XHM A;  2HRN A;  2PU9 C;  3KZQ A;  4TW5 A;  4K9Z A;  20GS A;  1WRY A;  2GS3 A;  3MAK A;  3K8N A;  4TR1 A;  1M0U A;  1SJZ A;  2K9F A;  5HR1 A;  2B1K A;  13GS A;  3WYW A;  2EC4 A;  4J57 E;  1O7U A;  1BG5 A;  2MMA A;  2R37 A;  1BAY A;  1Z7P A;  1ZYP A;  1EOG A;  2FWE A;  5IMV A;  4HZ4 A;  5DAK A;  4MH2 A;  3EMP A;  3NOF A;  1TRS A;  4Q5F A;  4GWR A;  2R0C A;  2L5O A;  5INY A;  4CW9 A;  4GF0 A;  2C0G A;  1Z3E A;  3HHV A;  5IIZ A;  3KH7 A;  3EU3 A;  3E9J B;  2HZE B;  1V9W A;  5CRW A;  1WJK A;  2VD0 A;  1X9M B;  4OMV A;  2XC2 A;  5IOX A;  2YP6 A;  3QR6 A;  2J9H A;  3H4K A;  2LQO A;  1NHY A;  4OFN A;  3UOM A;  2GZP A;  3KP8 A;  5DJM A;  4KH7 A;  3GST A;  4KND A;  2IN3 A;  3FZ5 A;  5EY6 A;  3C7M A;  4RQX A;  2L59 A;  1A0F A;  2XBQ A;  1ZYN A;  3CSI A;  4PTS A;  2H70 A;  4HSC X;  1MD4 A;  3IPZ A;  1U3A A;  2LJR A;  1T3B A;  3KGK A;  1S3A A;  4X1U A;  3KTB A;  1F9M A;  5KN3 A;  1AXD A;  3ERG A;  4BWS A;  4EIQ A;  2R4V A;  5AIS A;  2WS2 A;  1PSQ A;  6GSY A;  4K7I A;  4GXZ A;  2DIZ A;  4YQV A;  1B4P A;  2HLS A;  1TJD A;  2GSS A;  1PQN A;  5JCW A;  2N5B A;  2WCI A;  1OC9 B;  4KDY A;  3VK9 A;  3ERF A;  3GIX A;  4LL4 B;  3ZVJ A;  1W89 A;  4HDE A;  3IRA A;  2HXK A;  4EUY A;  2FA8 A;  3GFK A;  2AYT A;  4IBP A;  3EWL A;  3BCK A;  5BMU A;  1X9S B;  1Z7R A;  5IMA A;  2WZ9 A;  1K0N A;  4ZB6 A;  2CA8 A;  4FIW A;  1GUM A;  3LXT A;  5DDL A;  17GS A;  2YV7 A;  2C8U A;  4PX1 A;  3A2W A;  4QL9 A;  5DAL A;  5G31 A;  1NW2 A;  2OJL A;  3E0U A;  1S3D A;  3C71 A;  5ECO B;  1R5P A;  3IAS 2;  4OCE A;  1UA5 A;  1AQV A;  3BOA A;  3D4M A;  1O81 A;  3VI7 A;  1OVN A;  2DMM A;  1LJR A;  3EVI A;  3ZYW A;  2B5E A;  1X5D A;  3GV1 A;  1A0R P;  1R5A A;  2GTU A;  1JZW A;  2IMI A;  4RI7 A;  4MF5 A;  1XWG A;  1A8L A;  4GSS A;  2R3X A;  3RHB A;  2MZC A;  2LRT A;  1LU4 A;  3CBU A;  4PGT A;  3U6V A;  4I2U A;  5G1K A;  4K2D A;  1GTU A;  3GUR A;  2KP1 A;  1XOB A;  3QOU A;  3TRQ A;  1F3A A;  1VF1 A;  1TDI A;  1SYX A;  4MZW A;  1V98 A;  4QL7 A;  1JLV A;  3QCP A;  2DIY A;  2VLU A;  3QD9 A;  1U3I A;  5D96 A;  4KB3 A;  1X5E A;  3Q19 A;  3F0I A;  5A5K A;  5KEJ A;  4MH3 A;  2GLR A;  3GX0 A;  1MD3 A;  2VIM A;  3QAG A;  4MNN A;  1GNE A;  3BJ5 A;  1O8X A;  2ON7 A;  1YKA A;  1M7T A;  2V41 A;  3MIX A;  3UVT A;  1BJX A;  5D8I A;  4F0C A;  1GL8 A;  4NPB A;  2FLS A;  4G19 A;  4PNF A;  1OKT A;  1EP8 A;  3ZRE A;  2GQM A;  3GTU B;  4FYB A;  4ZB8 A;  3G7J A;  4L8E A;  4XRD A;  3F4T A;  1XW6 A;  2CQ9 A;  5HQP A;  3OR5 A;  4L5O A;  1B48 A;  3GHA A;  1JLW A;  5DCH A;  1AC1 A;  1ZCP A;  5ELG A;  2EIO A;  5D93 A;  5IQY A;  2B7J A;  4N30 A;  1ST9 A;  3M0F A;  1UVZ A;  1EEM A;  1M99 A;  5D9V A;  1MDI A;  3IXR A;  4O32 A;  18GS A;  1OC8 A;  1EGR A;  2AHE A;  2YZU A;  4YAP A;  1DE1 A;  2IPA A;  1TK8 B;  1M9A A;  4Q5Q A;  5ID2 A;  3H1N A;  1GSQ A;  2OE0 A;  1SU9 A;  2DBC A;  4K0G A;  4XIH A;  5HFG A;  5A4U A;  3CRU A;  2YZH A;  6GSW A;  3DML A;  3ZLP A;  5FWG A;  4IN0 A;  3FYG A;  4MMM A;  3UMA A;  1Y25 A;  2P5R A;  2O7K A;  3KD0 A;  4Z2U A;  3EYT A;  1UC7 A;  5ECK B;  4XCS A;  5JCG A;  3IV4 A;  5EPF A;  1K3O A;  2C1Y A;  3TUE A;  4AJ7 A;  5DCG A;  22GS A;  1BYE A;  1O8W A;  2K6V A;  3FW2 A;  3HXS A;  1M9B A;  4EC0 A;  1S3R A;  2CVD A;  1GWC A;  2MBS A;  2ON5 A;  3GUS A;  2HFD A;  1NM3 A;  2LRN A;  3HD5 A;  3W8J A;  1Z6M A;  1DSB A;  3TJG A;  4HS1 A;  4TVE A;  3IA1 A;  4I97 A;  6GSV A;  3LFL A;  3L4N A;  2LST A;  3IDV A;  5LNK e;  4MZC A;  3TRP A;  3TRX A;  2BTO T;  3IC8 A;  4IJ3 A;  3UBK A;  1HYU A;  3RHC A;  5G2Z A;  1O73 A;  1A2J A;  4BL7 A;  1U6T A;  4F03 A;  1TK5 B;  4EKZ A;  2AJQ B;  3EU4 A;  2VCT A;  3EIN A;  5DBQ A;  1XWB A;  2DJJ A;  4KAE A;  2GST A;  3QFA C;  2ZCT A;  1I5G A;  4ZBD A;  1DE2 A;  2VO4 A;  2BMX A;  4YAV A;  3C1R A;  1QQ2 A;  2TRX A;  1ZYQ B;  2HSY A;  1EGO A;  3JCM L;  1YKC A;  3IHQ A;  4XS1 A;  2O85 A;  1WWJ A;  4ACS A;  3P2A A;  1YY7 A;  2VOC A;  1HNA A;  1FHE A;  3TJF A;  1V40 A;  2GZY A;  1X5C A;  1TP9 A;  3M8N A;  4E8E A;  2WJU A;  1SEN A;  2FHE A;  4PQ1 A;  2REM A;  2YJ7 A;  5D9T A;  4V2L A;  4D73 A;  2PWJ A;  4A5P A;  4EDZ A;  1T00 A;  5LCZ A;  1LBK A;  3IBH A;  2CVB A;  2I9H A;  2FWG A;  1OYJ A;  4V2M A;  4K5R A;  3I43 A;  1FAA A;  1GH2 A;  4PQH A;  5D9W A;  3APO A;  3FK8 A;  1H4O A;  1PN0 A;  1BQ7 A;  4MJC A;  3LWA A;  4EDY A;  2V2G A;  4OD7 A;  1YZX A;  4K7O A;  2B6M A;  3ZL5 A;  3QPM A;  3IAM 2;  1O6J A;  3KTL A;  1XW5 A;  4O5U A;  1Z9H A;  4BIK A;  4HUA A;  3VLN A;  1QMV A;  1A24 A;  5IO0 A;  1ILO A;  5BRT A;  4TR1 B;  3HVS A;  3CTF A;  3GH6 A;  2DJ2 A;  3ZFL A;  3H79 A;  2OA7 A;  2VM2 A;  2PVO C;  4NWY A;  5GZZ B;  2N5A A;  3M9J A;  4TN8 A;  3A2V A;  3V1W A;  3HVX A;  2XBI A;  2EIQ A;  1GUK A;  3EE2 A;  2R0P A;  2AB6 A;  3ZTL A;  5G5F A;  4CY8 A;  4N11 A;  5B6M A;  5DAK B;  2AV4 A;  2I3Y A;  5COH A;  4MDC A;  4V2N A;  5GAP D;  5ECL B;  4I8B A;  2L6C A;  3WT2 A;  2WRT A;  2OAD A;  2PGT A;  2DJ1 A;  3TGZ A;  3HVV A;  4J2F A;  14GS A;  1QUW A;  4K2X A;  2YCD A;  2B7K A;  7GSS A;  1X0R A;  4K5S A;  5CO3 A;  5F0G A;  4KE3 A;  5ECS A;  2FNO A;  4MAB A;  3DIE A;  5ECN B;  2DSA A;  1GLQ A;  5GST A;  3LGC A;  2JZT A;  2CAQ A;  5E4W A;  2CVK A;  3I9V 2;  4YKF A;  1EWX A;  4X4J A;  2I4A A;  1WE0 A;  2F51 A;  4NAX A;  5F06 A;  3GNJ A;  4KUN A;  2L4Q A;  1M2A A;  1JZO A;  3IHG A;  3SBC A;  3HYP A;  1G6W A;  5EL8 A;  5JWO B;  1B9X C;  2K8V A;  2H73 A;  4NV2 A;  5KOX A;  4WF5 A;  2EIR A;  1SKW B;  1SD9 A;  1E2Y A;  3TKQ A;  2A4H A;  3LSZ A;  2VL2 C;  3FMW A;  1GRX A;  3I6A A;  1SL0 B;  2IFQ A;  1Z5Y E;  3L9V A;  3VWU A;  3LW9 A;  2DLX A;  3PR8 A;  1TW9 A;  4BPY A;  1B9Y C;  4POB A;  3FZ9 A;  2CT6 A;  3TJB A;  2JAC A;  2L5L A;  2O87 A;  4HQZ A;  2H6Z A;  2N5F A;  1T1V A;  2F8A A;  2E2M A;  1AQX A;  2VCZ A;  4FQU A;  1PMT A;  2YWO A;  2LUS A;  2V6O A;  5KN1 A;  1V2A A;  4I6X A;  2HNL A;  3HDC A;  5DAL B;  5AGY A;  2OBK A;  3F8U A;  5DJL A;  2JAD A;  4QQ7 A;  3UJ1 A;  1KBN A;  3DVX A;  1HD2 A;  5CP1 A;  9GSS A;  4IP1 A;  3EPT A;  1MDJ A;  10GS A;  3GL3 A;  3GX8 A;  1OE7 A;  1QGV A;  3GN3 A;  5IMF A;  2X99 A;  3EC3 A;  4DSR A;  3BCI A;  4WR5 A;  3ISO A;  1A8Y A;  2H74 A;  3LXZ A;  1A2L A;  2A2S A;  2JZR A;  3KEB A;  3WGE A;  4ZL8 A;  3TKP A;  1IYI A;  1XBS A;  3HKR A;  4IJI A;  2FCH A;  5CRE A;  1XIY A;  4PUR A;  3TKS C;  2B5Y A;  3GKN A;  2NBS A;  1YDK A;  4ECC A;  3QAV A;  5CNW A;  1JHB A;  2MMN A;  3MWH A;  1ZYE A;  3UAP A;  4IKH A;  3GKM A;  3U5R E;  3TJK A;  4TKY A;  5ECI B;  1I9D A;  4JU5 A;  2M72 A;  4ECI A;  1R4W A;  4ZB9 A;  1YEX A;  5CRG A;  4EVM A;  1GUL A;  4EL1 A;  4XS4 A;  3UL3 A;  1BX9 A;  1OAZ A;  5C04 A;  2LQQ A;  2L4C A;  5H5Q A;  1Z6N A;  3GRX A;  2OE3 A;  4NHW A;  6GSS A;  3A3T A;  1GSS A;  2HYX A;  2GT6 A;  2VUP A;  2F3M A;  2LRC A;  1X9W B;  1GUH A;  5IMC A;  1IYH A;  3DWV A;  2LJK A;  1GSF A;  4ULX A;  1F37 A;  5LD0 A;  2FWH A;  2FA4 A;  2K8S A;  4G10 A;  3CSH A;  4FYC A;  1A23 A;  4WBR D;  3F4S A;  4X43 A;  1MDK A;  4AGS A;  1FW1 A;  1T8E B;  1JFU A;  2HRA A;  5KOW A;  3C1S A;  3M3M A;  4JED A;  4LLR A;  2LNT A;  2IJY A;  2X64 A;  3IOS A;  1PGT A;  2DKH A;  1EEJ A;  5J41 A;  1HQO A;  2OAC A;  2HI7 A;  1SL1 B;  4NMU A;  4MA9 A;  4IS0 A;  1OE8 A;  2OKA A;  2OE1 A;  1PX7 A;  2QGV A;  2VL9 A;  1SD8 A;  2VCQ A;  3F3R A;  4TOP A;  5ENU A;  4JZQ A;  1K3Y A;  1YF1 A;  4HZ2 A;  2F9S A;  1TK0 B;  4HI7 A;  2XHF A;  1TU8 A;  4MF7 A;  3PH9 A;  4Z7X A;  4OO4 A;  3TB2 A;  5IPG A;  1THO A;  1G7E A;  3J7Y b;  2BJX A;  3LJR A;  3W8S A;  3RDW A;  5F07 A;  2VCX A;  3ZZX A;  5ID2 B;  1AW9 A;  4PUF C;  2H1B A;  1XG8 A;  5ELA A;  2VL3 A;  2H75 A;  1WIK A;  3PGT A;  2H76 A;  4LMV A;  1PA3 A;  1XFL A;  2KP2 A;  1GTA A;  2A2P A;  1PKW A;  1T4Y A;  4TR0 A;  4BA7 A;  2MMZ A;  1XVW A;  1Y6E A;  2H1G A;  3MDK A;  1F3B A;  1V57 A;  5JWR B;  4WEY A;  2C4J A;  2H66 A;  2QC7 A;  2KUC A;  5IM9 A;  3ZMK A;  1BED A;  1CQH A;  4WET A;  4MK3 A;  2CX3 A;  4PXO A;  2HT9 A;  2GQK A;  2RLI A;  2GSQ A;  2TRC P;  5FHI A;  2JL4 A;  3GTU A;  2XPD A;  3TJJ A;  1PL1 A;  2YPM A;  5G1L A;  1WPI A;  4MPG A;  4HQS A;  2R0G A;  1EZK A;  4V1A p;  1WMJ A;  1SJI A;  3TOT A;  11GS A;  4JE1 A;  4IW9 A;  4RI6 A;  1FO5 A;  1ZL9 A;  4DSQ A;  2H0I A;  3FR6 A;  3WT1 A;  5IMD A;  4BL7 B;  3LEF A;  3D5J A;  1XOA A;  4AJ8 A;  4KA0 A;  1R7H A;  2HRK A;  1AUC A;  5JWQ B;  4NXI A;  3UBL A;  3MNG A;  1TI3 A;  2PN8 A;  2QA2 A;  1W4V A;  1AAZ A;  4USS A;  4ILF A;  4WR4 A;  4BVX A;  4LL1 B;  2WFC A;  2WDU A;  4RUV A;  3KCM A;  2CZ2 A;  2NVL A;  1PRX A;  3CRT A;  1SK0 A;  4IHU A;  1TXX A;  4F9Z A;  3GA4 A;  1J0F A;  4MP4 A;  2R6K A;  2M46 A;  3L9U A;  3N5O A;  1B8X A;  1G0T A;  3AY8 A;  3KH9 A;  2WUL A;  2X4A A;  4GST A;  2FD3 A;  4FH8 A;  4POL A;  3KMN A;  2HE3 A;  1ON4 A;  8GSS A;  1FVK A;  1R26 A;  3R3E A;  4L5L A;  12GS A;  1Q4J A;  16GS A;  5GAN D;  2LNS A;  3A5I A;  4HU9 A;  2CAI A;  2H0G A;  2YJH A;  5ECQ B;  4IVF A;  5D9X A;  2YWI A;  2RUF A;  3DGQ A;  3DRN A;  4EE0 A;  4JR6 A;  3LQ7 A;  4TXO A;  3O3T A;  3Q6O A;  4DSS A;  1K0D A;  1RQM A;  4BVY A;  2X8H A;  1ERW A;  3R2Q A;  3FEU A;  3GMF A;  2GZZ A;  2J23 A;  4ML6 A;  2CX4 A;  2IIY A;  1H75 A;  3VWV A;  5KN2 A;  3ED3 A;  2L57 A;  4HJM A;  1XWA A;  4MCU A;  4MJA A;  1THX A;  4YH2 A;  6GSU A;  3J7Y k;  2R5G A;  3HZ4 A;  2H0H A;  2DML A;  2MBT A;  4PQI A;  2RM5 A;  1AIU A;  4IEL A;  1XPV A;  1K3L A;  5L71 A;  4G9H A;  3VI5 A;  3EMX A;  3GH9 A;  2HZF A;  5AIV A;  1OKD A;  4BWQ A;  4ID0 A;  2LS5 A;  3D22 A;  4L0U A;  2I1U A;  3UEM A;  1EP7 A;  4YKG A;  1MTC A;  4KF9 A;  3APS A;  3ME7 A;  2MYG A;  2P31 A;  6GST A;  4ECJ A;  1EOH A;  4POK A;  3FZ4 A;  2VLV A;  4KDU A;  4GTU A; 
#chains in the Genus database with same CATH homology
 1V58 A;  1T4Z A;  4EIP A;  4LA1 A;  2KOK A;  5CRD A;  5B8B A;  2H71 A;  5HFI A;  2PMT A;  4MLY A;  3TKS E;  4ISD A;  3PIN A;  1DUG A;  2H8L A;  1ZMA A;  1VGL A;  3F6D A;  5F8B A;  4F0B A;  2GVP A;  4OCF A;  1U87 A;  4Z2R A;  1M2D A;  5J9C A;  3DYR A;  5D73 A;  3F6F A;  3HCZ A;  2VCW A;  1E6B A;  4WBJ A;  3F63 A;  5IPH A;  2WGR A;  2QA1 A;  2ZNM A;  3RPP A;  2IFQ B;  5A4V A;  3P7X A;  2DC5 A;  4MJE A;  5B6N A;  4Z2T A;  2VL2 A;  4IQ1 A;  2IL3 A;  2JSY A;  1TRV A;  1K0B A;  1K0A A;  2C3Q A;  1VF4 A;  3LYP A;  3ZRD A;  2D2Z A;  2WB9 A;  2B5X A;  5C00 A;  1XWC A;  1K0M A;  3GL5 A;  3NIV A;  2PUK C;  5AN1 A;  2CV4 A;  2Z9S A;  4ZL9 A;  2XPE A;  3VFI A;  1PD2 1;  1ABA A;  2JZS A;  1SYR A;  1UN2 A;  5DQS A;  2MMO A;  1G6Y A;  4YQM A;  3D0Z A;  1VF3 A;  4F2I A;  5B7C A;  5HFK A;  2QSI A;  2B1L A;  3H8Q A;  3F4R A;  5EVO A;  3TOU A;  2IMD A;  1KTE A;  2H6Y A;  3G7Y A;  1M2B A;  4O92 A;  2LV3 A;  5B8A A;  2M80 A;  4DVC A;  2PPT A;  2X49 A;  3FHK A;  3L78 A;  1XVQ A;  1RW1 A;  4ZXG A;  1GLP A;  3IR4 A;  2K18 A;  4EXJ A;  1EV9 A;  4PUA A;  3M1G A;  2C80 A;  3L0H A;  5HR0 A;  2HZE A;  1KNG A;  2LKU A;  3C8E A;  1WOU A;  2DJ3 A;  3TKS A;  1S3C A;  3C73 A;  2G2Q A;  1URM A;  1SK2 A;  2H72 A;  3DD3 A;  1TTZ A;  2GGT A;  4KSO A;  3HJP A;  4G0K A;  3FRC A;  4XS4 B;  2C3T A;  3CSJ A;  2NTO A;  1T7P B;  2B3S A;  4CDO A;  3RBT A;  4KSM A;  3G7I A;  3HA9 A;  1FOH A;  2O89 A;  1ZZY A;  2YWM A;  1TOF A;  3ZIT A;  3O6T A;  5JCU A;  4G0L A;  3LG6 A;  2V32 A;  2C3N A;  4X0X A;  5ECR B;  4ZIJ A;  1GSD A;  2IMF A;  1YEP A;  4FYU A;  1JZR A;  4AJ6 A;  3W6G A;  3FR9 A;  2R2J A;  5CYY A;  4OFT A;  2G0F A;  3Q74 A;  1SKS B;  3HJM A;  1OC9 A;  2DJK A;  2H01 A;  5CAX A;  4K6X A;  2O8V B;  4HEA 2;  4MZB A;  1SL2 B;  1GP1 A;  5F05 A;  4IP6 A;  2GDR A;  3ZIJ A;  2AUV A;  1EV4 A;  4K1F A;  4O7H A;  3UVH A;  4FO5 A;  4GQF A;  5ABR A;  3QDN A;  1PL2 A;  4MF6 A;  1HNB A;  3DVW A;  4V1A g;  3GKK A;  3KIJ A;  2HSM A;  3IK7 A;  2VD1 A;  1XZO A;  4IQA A;  4G0I A;  5KN0 A;  2GQL A;  2H1D A;  4ZIL A;  3RAZ A;  3A2X A;  5GSS A;  2YV9 A;  5IMZ A;  4J56 E;  5J9B A;  3ZFB A;  5IOW A;  3GYK A;  3GSS A;  1XWK A;  1A2M A;  2JU5 A;  5DQY A;  4WF4 A;  3EUR A;  5G5E A;  2JSZ A;  4N0V A;  2ES7 A;  1O85 A;  3BD2 A;  1YJ6 A;  2IWT A;  1ACV A;  1ERV A;  2PER A;  1XW9 A;  3M9K A;  4H86 A;  5HR3 A;  3BBY A;  2C0F A;  4Q5R A;  1GSE A;  1ZGN A;  3ZVJ D;  3GKX A;  4CY6 A;  1YQ1 A;  2YNX A;  4PNG A;  2YOI A;  3KJY A;  5G30 A;  1OC3 A;  1ERT A;  1F6M C;  2E0Q A;  1Q98 A;  2AAW A;  4G2E A;  1GTI A;  1TRU A;  2QKE A;  3QAW A;  3QMX A;  3G9B A;  1VRS D;  4TXV A;  5FT3 A;  4Q5N A;  3ZML A;  1U88 A;  2GT5 A;  3H93 A;  4GSN A;  3US3 A;  4HJ2 A;  3TKR A;  3HZ8 A;  4K8M A;  4K0N A;  4JBB A;  3VPQ A;  4ML1 A;  2CZ3 A;  3WD6 A;  1YF0 A;  5IO2 A;  2E7P A;  1ML6 A;  5H5R A;  3NZN A;  4N0Z A;  4L0W A;  2HSH A;  4CHS A;  4JRR A;  2LEG A;  1GSY A;  3FZA A;  1GSU A;  3ERW A;  3FKF A;  5ECP B;  5HR2 A;  3TDG A;  4JR4 A;  3DXB A;  1NSW A;  2PVQ A;  4XRA A;  2P0G A;  3F9U A;  1QK8 A;  4OWY A;  1ERU A;  3VWX A;  4I2T A;  4P3Y B;  3IC4 A;  4WKW A;  4EF0 A;  19GS A;  1SKR B;  3LYK A;  5CRH A;  4KDX A;  1TU7 A;  3KXO A;  3MSZ A;  2H19 A;  3LOR A;  1QFN A;  1KEB A;  4BVX B;  3ME8 A;  4XS6 A;  2C0E A;  2VM1 A;  2RUE A;  1MEK A;  5J4U A;  3TCO A;  1N2A A;  2H1A A;  1XCC A;  1DBY A;  3CYN A;  1JZD A;  4WXT A;  1SK1 A;  1TRW A;  4O5R A;  1GTB A;  1K0O A;  3MYD A;  2TIR A;  4RQR A;  2VCV A;  1B4Q A;  3A5W A;  1AQW A;  6GSX A;  3KMO A;  4KW6 A;  3FR3 A;  4XTS A;  4TRX A;  3F3Q A;  2FUG 2;  1FVJ A;  1PX6 A;  2RM6 A;  4NHZ A;  4OO5 A;  1CQG A;  4GLT A;  3UIW A;  3CXG A;  3E3E A;  4MJB A;  3D4T A;  3HY2 A;  4TXO B;  3Q18 A;  4DSS B;  2LTK A;  3IK9 A;  3VWW A;  1USB A;  2HRF A;  2GSR A;  4N10 A;  3SWL A;  4BVY B;  3FY7 A;  3S9F A;  4D73 B;  4OFM A;  2X8C A;  4GRF A;  4KX4 A;  4O5Q A;  5AIX A;  4HU7 A;  2V1M A;  4ZL7 A;  3CMI A;  4GQC A;  4I5Q A;  4ZBB A;  2X8G A;  2FY6 A;  5E59 A;  1G7O A;  2LJA A;  4LMW A;  2F8F A;  4EO3 A;  4YQU A;  2FWF A;  3WGX A;  2A4V A;  2RII A;  4GCI A;  3KM6 A;  2NPB A;  4F82 A;  3VPT A;  2IMK A;  2DJ0 A;  4ECB A;  2L6D A;  1N8J A;  3O76 A;  2PBJ A;  4ZBA A;  3L9S A;  3QFB C;  4KCE A;  1FB6 A;  2ALB A;  3PPU A;  1C72 A;  5J5N A;  4ICY A;  2H30 A;  3P8W A;  1FOV A;  4DEJ A;  3CTG A;  2C0D A;  4E8H A;  4KCA A;  3WGD A;  2OBI A;  1VF2 A;  4TR3 A;  1K0C A;  2UZ8 A;  1XXU A;  1PN9 A;  5ECM B;  3D6I A;  5DVB A;  3RPN A;  2I81 A;  5ECH B;  4AF2 A;  2YAN A;  2V6K A;  4HOJ A;  3I69 A;  3DEX A;  1ZOF A;  3D21 A;  4MPF A;  2VLT A;  5A4W A;  1PKZ A;  4IGJ A;  4K7N A;  1F2E A;  1TKD B;  3KP9 A;  1HNC A;  1WP0 A;  4TR4 A;  1FG4 A;  1GNW A;  1TI1 A;  3N9J A;  2E2G A;  1SJ6 A;  3P90 A;  4NV5 A;  2NDO A;  1FB0 A;  3APQ A;  1NHO A;  3DKS A;  4POM A;  3IE3 A;  1QXH A;  2YWN A;  2KHP A;  5H5S A;  2A2R A;  2ZUP A;  1J08 A;  2KLX A;  2VAF A;  1RK4 A;  3ZIV A;  5J3R A;  4KGI A;  1J9B A;  2YN1 A;  3HJO A;  2P5Q A;  3UAR A;  3VUR A;  2FGX A;  2DKI A;  2IME A;  2H6X A;  4XHM A;  2HRN A;  2PU9 C;  3KZQ A;  4TW5 A;  4K9Z A;  20GS A;  1WRY A;  2GS3 A;  3MAK A;  3K8N A;  4TR1 A;  1M0U A;  1SJZ A;  2K9F A;  5HR1 A;  2B1K A;  13GS A;  3WYW A;  2EC4 A;  4J57 E;  1O7U A;  1BG5 A;  2MMA A;  2R37 A;  1BAY A;  1Z7P A;  1ZYP A;  1EOG A;  2FWE A;  5IMV A;  4HZ4 A;  5DAK A;  4MH2 A;  3EMP A;  3NOF A;  1TRS A;  4Q5F A;  4GWR A;  2R0C A;  2L5O A;  5INY A;  4CW9 A;  4GF0 A;  2C0G A;  1Z3E A;  3HHV A;  5IIZ A;  3KH7 A;  3EU3 A;  3E9J B;  2HZE B;  1V9W A;  5CRW A;  1WJK A;  2VD0 A;  1X9M B;  4OMV A;  2XC2 A;  5IOX A;  2YP6 A;  3QR6 A;  2J9H A;  3H4K A;  2LQO A;  1NHY A;  4OFN A;  3UOM A;  2GZP A;  3KP8 A;  5DJM A;  4KH7 A;  3GST A;  4KND A;  2IN3 A;  3FZ5 A;  5EY6 A;  3C7M A;  4RQX A;  2L59 A;  1A0F A;  2XBQ A;  1ZYN A;  3CSI A;  4PTS A;  2H70 A;  1MD4 A;  3IPZ A;  1U3A A;  2LJR A;  1T3B A;  3KGK A;  1S3A A;  4X1U A;  3KTB A;  1F9M A;  5KN3 A;  1AXD A;  3ERG A;  4BWS A;  4EIQ A;  2R4V A;  5AIS A;  2WS2 A;  1PSQ A;  6GSY A;  4K7I A;  4GXZ A;  2DIZ A;  4YQV A;  1B4P A;  2HLS A;  1TJD A;  2GSS A;  1PQN A;  5JCW A;  2N5B A;  2WCI A;  1OC9 B;  4KDY A;  3VK9 A;  3ERF A;  3GIX A;  4LL4 B;  3ZVJ A;  1W89 A;  4HDE A;  3IRA A;  2HXK A;  4EUY A;  2FA8 A;  3GFK A;  2AYT A;  4IBP A;  3EWL A;  3BCK A;  5BMU A;  1X9S B;  1Z7R A;  5IMA A;  2WZ9 A;  1K0N A;  4ZB6 A;  2CA8 A;  4FIW A;  1GUM A;  3LXT A;  5DDL A;  17GS A;  2YV7 A;  2C8U A;  4PX1 A;  3A2W A;  4QL9 A;  5DAL A;  5G31 A;  1NW2 A;  2OJL A;  3E0U A;  1S3D A;  3C71 A;  5ECO B;  1R5P A;  3IAS 2;  4OCE A;  1UA5 A;  1AQV A;  3BOA A;  3D4M A;  1O81 A;  3VI7 A;  1OVN A;  2DMM A;  1LJR A;  3EVI A;  3ZYW A;  2B5E A;  1X5D A;  3GV1 A;  1A0R P;  1R5A A;  2GTU A;  1JZW A;  2IMI A;  4RI7 A;  4MF5 A;  1XWG A;  1A8L A;  4GSS A;  2R3X A;  3RHB A;  2MZC A;  2LRT A;  1LU4 A;  3CBU A;  4PGT A;  3U6V A;  4I2U A;  5G1K A;  4K2D A;  1GTU A;  3GUR A;  2KP1 A;  1XOB A;  3QOU A;  3TRQ A;  1F3A A;  1VF1 A;  1TDI A;  1SYX A;  4MZW A;  1V98 A;  4QL7 A;  1JLV A;  3QCP A;  2DIY A;  2VLU A;  3QD9 A;  1U3I A;  5D96 A;  4KB3 A;  1X5E A;  3Q19 A;  3F0I A;  5A5K A;  5KEJ A;  4MH3 A;  2GLR A;  3GX0 A;  1MD3 A;  2VIM A;  3QAG A;  4MNN A;  1GNE A;  3BJ5 A;  1O8X A;  2ON7 A;  1YKA A;  1M7T A;  2V41 A;  3MIX A;  3UVT A;  1BJX A;  5D8I A;  4F0C A;  1GL8 A;  4NPB A;  2FLS A;  4G19 A;  4PNF A;  1OKT A;  1EP8 A;  3ZRE A;  2GQM A;  3GTU B;  4FYB A;  4ZB8 A;  3G7J A;  4L8E A;  4XRD A;  3F4T A;  1XW6 A;  2CQ9 A;  5HQP A;  3OR5 A;  4L5O A;  1B48 A;  3GHA A;  1JLW A;  5DCH A;  1AC1 A;  1ZCP A;  5ELG A;  2EIO A;  5D93 A;  5IQY A;  2B7J A;  4N30 A;  1ST9 A;  3M0F A;  1UVZ A;  1EEM A;  1M99 A;  5D9V A;  1MDI A;  3IXR A;  4O32 A;  18GS A;  1OC8 A;  1EGR A;  2AHE A;  2YZU A;  4YAP A;  1DE1 A;  2IPA A;  1TK8 B;  1M9A A;  4Q5Q A;  5ID2 A;  3H1N A;  1GSQ A;  2OE0 A;  1SU9 A;  2DBC A;  4K0G A;  4XIH A;  5HFG A;  5A4U A;  3CRU A;  2YZH A;  6GSW A;  3DML A;  3ZLP A;  5FWG A;  4IN0 A;  3FYG A;  4MMM A;  3UMA A;  1Y25 A;  2P5R A;  2O7K A;  3KD0 A;  4Z2U A;  3EYT A;  1UC7 A;  5ECK B;  4XCS A;  5JCG A;  3IV4 A;  5EPF A;  1K3O A;  2C1Y A;  3TUE A;  4AJ7 A;  5DCG A;  22GS A;  1BYE A;  1O8W A;  2K6V A;  3FW2 A;  3HXS A;  1M9B A;  4EC0 A;  2CVD A;  1GWC A;  2MBS A;  2ON5 A;  3GUS A;  2HFD A;  1NM3 A;  2LRN A;  3HD5 A;  3W8J A;  1Z6M A;  1DSB A;  3TJG A;  4HS1 A;  4TVE A;  3IA1 A;  4I97 A;  6GSV A;  3LFL A;  3L4N A;  2LST A;  3IDV A;  5LNK e;  4MZC A;  3TRP A;  3TRX A;  2BTO T;  3IC8 A;  4IJ3 A;  3UBK A;  1HYU A;  3RHC A;  5G2Z A;  1O73 A;  1A2J A;  4BL7 A;  1U6T A;  4F03 A;  1TK5 B;  4EKZ A;  2AJQ B;  3EU4 A;  2VCT A;  3EIN A;  5DBQ A;  1XWB A;  2DJJ A;  4KAE A;  2GST A;  3QFA C;  2ZCT A;  1I5G A;  4ZBD A;  1DE2 A;  2VO4 A;  2BMX A;  4YAV A;  3C1R A;  1QQ2 A;  2TRX A;  1ZYQ B;  2HSY A;  1EGO A;  3JCM L;  1YKC A;  3IHQ A;  4XS1 A;  2O85 A;  1WWJ A;  4ACS A;  3P2A A;  1YY7 A;  2VOC A;  1HNA A;  1FHE A;  3TJF A;  1V40 A;  2GZY A;  1X5C A;  1TP9 A;  3M8N A;  4E8E A;  2WJU A;  1SEN A;  2FHE A;  4PQ1 A;  2REM A;  2YJ7 A;  5D9T A;  4V2L A;  4D73 A;  2PWJ A;  4A5P A;  4EDZ A;  1T00 A;  5LCZ A;  1LBK A;  3IBH A;  2CVB A;  2I9H A;  2FWG A;  1OYJ A;  4V2M A;  4K5R A;  3I43 A;  1FAA A;  1GH2 A;  4PQH A;  5D9W A;  3APO A;  3FK8 A;  1H4O A;  1PN0 A;  1BQ7 A;  4MJC A;  3LWA A;  4EDY A;  2V2G A;  4OD7 A;  1YZX A;  4K7O A;  2B6M A;  3ZL5 A;  3QPM A;  3IAM 2;  1O6J A;  3KTL A;  1XW5 A;  4O5U A;  1Z9H A;  4HUA A;  3VLN A;  1QMV A;  1A24 A;  5IO0 A;  1ILO A;  5BRT A;  4TR1 B;  3HVS A;  3CTF A;  3GH6 A;  2DJ2 A;  3ZFL A;  3H79 A;  2OA7 A;  2VM2 A;  2PVO C;  4NWY A;  5GZZ B;  2N5A A;  3M9J A;  4TN8 A;  3A2V A;  3V1W A;  3HVX A;  2XBI A;  2EIQ A;  1GUK A;  3EE2 A;  2R0P A;  2AB6 A;  3ZTL A;  5G5F A;  4CY8 A;  4N11 A;  5B6M A;  5DAK B;  2AV4 A;  2I3Y A;  5COH A;  4MDC A;  4V2N A;  5GAP D;  5ECL B;  4I8B A;  2L6C A;  3WT2 A;  2WRT A;  2OAD A;  2PGT A;  2DJ1 A;  3TGZ A;  3HVV A;  4J2F A;  14GS A;  1QUW A;  4K2X A;  2YCD A;  2B7K A;  7GSS A;  1X0R A;  4K5S A;  5CO3 A;  5F0G A;  4KE3 A;  5ECS A;  2FNO A;  4MAB A;  3DIE A;  5ECN B;  2DSA A;  1GLQ A;  5GST A;  3LGC A;  2JZT A;  2CAQ A;  5E4W A;  2CVK A;  3I9V 2;  4YKF A;  1EWX A;  4X4J A;  2I4A A;  1WE0 A;  2F51 A;  4NAX A;  5F06 A;  3GNJ A;  4KUN A;  2L4Q A;  1M2A A;  1JZO A;  3IHG A;  3SBC A;  3HYP A;  1G6W A;  5EL8 A;  5JWO B;  1B9X C;  2K8V A;  2H73 A;  4NV2 A;  5KOX A;  4WF5 A;  2EIR A;  1SKW B;  1SD9 A;  1E2Y A;  3TKQ A;  2A4H A;  3LSZ A;  2VL2 C;  3FMW A;  1GRX A;  3I6A A;  1SL0 B;  2IFQ A;  1Z5Y E;  3L9V A;  3VWU A;  3LW9 A;  2DLX A;  3PR8 A;  1TW9 A;  4BPY A;  1B9Y C;  4POB A;  3FZ9 A;  2CT6 A;  3TJB A;  2JAC A;  2L5L A;  2O87 A;  4HQZ A;  2H6Z A;  2N5F A;  1T1V A;  2F8A A;  2E2M A;  1AQX A;  2VCZ A;  4FQU A;  1PMT A;  2YWO A;  2LUS A;  2V6O A;  5KN1 A;  1V2A A;  4I6X A;  2HNL A;  3HDC A;  5DAL B;  5AGY A;  2OBK A;  3F8U A;  5DJL A;  2JAD A;  4QQ7 A;  3UJ1 A;  1KBN A;  3DVX A;  1HD2 A;  5CP1 A;  9GSS A;  4IP1 A;  3EPT A;  1MDJ A;  10GS A;  3GL3 A;  3GX8 A;  1OE7 A;  1QGV A;  3GN3 A;  5IMF A;  2X99 A;  3EC3 A;  4DSR A;  3BCI A;  4WR5 A;  3ISO A;  1A8Y A;  2H74 A;  3LXZ A;  1A2L A;  2A2S A;  2JZR A;  3KEB A;  3WGE A;  4ZL8 A;  3TKP A;  1IYI A;  1XBS A;  3HKR A;  4IJI A;  2FCH A;  5CRE A;  1XIY A;  4PUR A;  3TKS C;  2B5Y A;  3GKN A;  2NBS A;  1YDK A;  4ECC A;  3QAV A;  5CNW A;  1JHB A;  2MMN A;  3MWH A;  1ZYE A;  3UAP A;  4IKH A;  3GKM A;  3U5R E;  3TJK A;  4TKY A;  5ECI B;  1I9D A;  4JU5 A;  2M72 A;  4ECI A;  1R4W A;  4ZB9 A;  1YEX A;  5CRG A;  4EVM A;  1GUL A;  4EL1 A;  4XS4 A;  3UL3 A;  1BX9 A;  1OAZ A;  5C04 A;  2LQQ A;  2L4C A;  5H5Q A;  1Z6N A;  3GRX A;  2OE3 A;  4NHW A;  6GSS A;  3A3T A;  1GSS A;  2HYX A;  2GT6 A;  2VUP A;  2F3M A;  2LRC A;  1X9W B;  1GUH A;  5IMC A;  1IYH A;  3DWV A;  2LJK A;  1GSF A;  4ULX A;  1F37 A;  5LD0 A;  2FWH A;  2FA4 A;  2K8S A;  4G10 A;  3CSH A;  4FYC A;  1A23 A;  4WBR D;  3F4S A;  4X43 A;  1MDK A;  4AGS A;  1FW1 A;  1T8E B;  1JFU A;  2HRA A;  5KOW A;  3C1S A;  3M3M A;  4JED A;  4LLR A;  2LNT A;  2IJY A;  2X64 A;  3IOS A;  1PGT A;  2DKH A;  1EEJ A;  5J41 A;  1HQO A;  2OAC A;  2HI7 A;  1SL1 B;  4NMU A;  4MA9 A;  4IS0 A;  1OE8 A;  2OKA A;  2OE1 A;  1PX7 A;  2QGV A;  2VL9 A;  1SD8 A;  2VCQ A;  3F3R A;  4TOP A;  5ENU A;  4JZQ A;  1K3Y A;  1YF1 A;  4HZ2 A;  2F9S A;  1TK0 B;  4HI7 A;  2XHF A;  1TU8 A;  4MF7 A;  3PH9 A;  4Z7X A;  4OO4 A;  3TB2 A;  5IPG A;  1THO A;  1G7E A;  3J7Y b;  2BJX A;  3LJR A;  3W8S A;  3RDW A;  5F07 A;  2VCX A;  3ZZX A;  5ID2 B;  1AW9 A;  4PUF C;  2H1B A;  5ELA A;  2VL3 A;  2H75 A;  1WIK A;  3PGT A;  2H76 A;  4LMV A;  1PA3 A;  1XFL A;  2KP2 A;  1GTA A;  2A2P A;  1PKW A;  1T4Y A;  4TR0 A;  4BA7 A;  2MMZ A;  1XVW A;  1Y6E A;  2H1G A;  3MDK A;  1F3B A;  1V57 A;  5JWR B;  4WEY A;  2C4J A;  2H66 A;  2QC7 A;  2KUC A;  5IM9 A;  3ZMK A;  1BED A;  1CQH A;  4WET A;  4MK3 A;  2CX3 A;  4PXO A;  2HT9 A;  2GQK A;  2RLI A;  2GSQ A;  2TRC P;  5FHI A;  2JL4 A;  3GTU A;  2XPD A;  3TJJ A;  1PL1 A;  2YPM A;  5G1L A;  1WPI A;  4MPG A;  4HQS A;  2R0G A;  1EZK A;  4V1A p;  1WMJ A;  1SJI A;  3TOT A;  11GS A;  4JE1 A;  4IW9 A;  4RI6 A;  1FO5 A;  1ZL9 A;  4DSQ A;  2H0I A;  3FR6 A;  3WT1 A;  5IMD A;  4BL7 B;  3LEF A;  3D5J A;  1XOA A;  4AJ8 A;  4KA0 A;  1R7H A;  2HRK A;  1AUC A;  5JWQ B;  4NXI A;  3UBL A;  3MNG A;  1TI3 A;  2PN8 A;  2QA2 A;  1W4V A;  1AAZ A;  4USS A;  4ILF A;  4WR4 A;  4BVX A;  4LL1 B;  2WFC A;  2WDU A;  4RUV A;  3KCM A;  2CZ2 A;  2NVL A;  1PRX A;  3CRT A;  1SK0 A;  4IHU A;  1TXX A;  4F9Z A;  3GA4 A;  1J0F A;  4MP4 A;  2R6K A;  2M46 A;  3L9U A;  3N5O A;  1B8X A;  1G0T A;  3AY8 A;  3KH9 A;  2WUL A;  2X4A A;  4GST A;  2FD3 A;  4FH8 A;  4POL A;  3KMN A;  2HE3 A;  1ON4 A;  8GSS A;  1FVK A;  1R26 A;  3R3E A;  4L5L A;  12GS A;  1Q4J A;  16GS A;  5GAN D;  2LNS A;  3A5I A;  4HU9 A;  2CAI A;  2H0G A;  2YJH A;  5ECQ B;  4IVF A;  5D9X A;  2YWI A;  2RUF A;  3DGQ A;  3DRN A;  4EE0 A;  4JR6 A;  3LQ7 A;  4TXO A;  3O3T A;  3Q6O A;  4DSS A;  1K0D A;  1RQM A;  4BVY A;  2X8H A;  1ERW A;  3R2Q A;  3FEU A;  3GMF A;  2GZZ A;  2J23 A;  4ML6 A;  2CX4 A;  2IIY A;  1H75 A;  3VWV A;  5KN2 A;  3ED3 A;  2L57 A;  4HJM A;  1XWA A;  4MCU A;  4MJA A;  1THX A;  4YH2 A;  6GSU A;  3J7Y k;  2R5G A;  3HZ4 A;  2H0H A;  2DML A;  2MBT A;  4PQI A;  2RM5 A;  1AIU A;  4IEL A;  1XPV A;  1K3L A;  5L71 A;  4G9H A;  3VI5 A;  3EMX A;  3GH9 A;  2HZF A;  5AIV A;  1OKD A;  4BWQ A;  4ID0 A;  2LS5 A;  3D22 A;  4L0U A;  2I1U A;  3UEM A;  1EP7 A;  4YKG A;  1MTC A;  4KF9 A;  3APS A;  3ME7 A;  2MYG A;  2P31 A;  6GST A;  4ECJ A;  1EOH A;  4POK A;  3FZ4 A;  2VLV A;  4KDU A;  4GTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...