4EUYA

Crystal structure of thioredoxin-like protein bce_0499 from bacillus cereus atcc 10987
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
86
Chain Sequence
b'ELATYIEEQQLVLLFIKTENCGVCDVMLRKVNYVLENYNYVEKIEILLQDMFTGPTVLLFYNGKEILRESRFISLENLERTIQLFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of thioredoxin-like protein BCE_0499 from Bacillus cereus
rcsb
source organism Bacillus cereus
molecule tags Structural genomics, unknown function
total genus 22
structure length 86
sequence length 95
ec nomenclature
pdb deposition date 2012-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4euyA00
5G5FA 3GH9A 2DJ1A 1LJRA 2NBSA 4TXOA 4G10A 1XZOA 4WF5A 2F8AA 1UC7A 3TKSC 2VLTA 3RPPA 3ZIJA 4MJAA 4ILFA 1A0RP 1PRXA 1TRUA 5CRGA 2B5XA 2HZEA 4KUNA 2RM5A 3FZ5A 3EMPA 1OE7A 2BTOT 4KAEA 1O73A 1WPIA 2HI7A 2YWIA 4V1Ap 3ZL5A 1LU4A 2X8HA 2IFQA 1G7OA 3GL3A 3WYWA 3IAS2 5A4WA 2AV4A 5AIVA 1PX6A 2RUFA 3APSA 3UEMA 5DDLA 2FWGA 2JU5A 5D96A 5C00A 1TRVA 1I9DA 3FRCA 3I43A 6GSTA 3CXGA 1EP8A 1PD21 4OCFA 5J9CA 5IM9A 2WCIA 4J56E 1GLQA 4Z7XA 1R7HA 3GKNA 3UJ1A 1K0DA 2PVOC 5FWGA 1GNEA 3KM6A 1E6BA 3CRUA 2O89A 1UVZA 4DSQA 4MJEA 2VCQA 2KP1A 2VLVA 3UIWA 1EOHA 1TW9A 1M2BA 2GZPA 3TJFA 2B5YA 5ENUA 2E0QA 2DJJA 3IXRA 2BMXA 3MSZA 1A8YA 4J2FA 1SJ6A 4YAPA 2G2QA 1GP1A 3APOA 3HDCA 2A2SA 2IMIA 3PH9A 1HQOA 2GS3A 2QGVA 4BPYA 2YWMA 2XPEA 1K3LA 2J23A 5J4UA 4MH3A 4HZ4A 3MAKA 1M0UA 2N5FA 2WDUA 3VI5A 4MJBA 2H19A 1X9WB 3F6FA 2FD3A 3D6IA 4FO5A 1PKWA 3FR9A 4MMMA 4TR1A 1XCCA 3D4TA 2WGRA 3TB2A 4Q5NA 1BAYA 3NIVA 5F0GA 4IJIA 1YJ6A 3M3MA 2H0HA 2VL2C 1R5PA 1XOBA 5HR3A 4I2TA 3FYGA 4NPBA 2O85A 2AAWA 3DGQA 1TTZA 3HYPA 2TRXA 2PU9C 1NSWA 2FWFA 3F63A 4TR3A 4RI6A 3LYKA 5DJLA 4MDCA 3KMOA 2FCHA 1XFLA 2YJHA 4F9ZA 5GAPD 4TRXA 5JWOB 3VLNA 2E2MA 14GSA 4LMWA 1H75A 1K0CA 1SENA 2NDOA 2EIRA 4OFMA 3O6TA 4K7IA 4KX4A 5HQPA 2VUPA 5ECNB 1XXUA 1VF1A 4POLA 1GUHA 3TKSA 2C4JA 2C0GA 2HZFA 1R4WA 5KEJA 2VO4A 2I81A 1YEPA 1YF0A 3LSZA 2ZCTA 2FWEA 2C3QA 4IBPA 3EE2A 2CX4A 2AHEA 3VPQA 5CRWA 1JZDA 3IOSA 3F0IA 4TN8A 2QKEA 2K8SA 4GTUA 2H6XA 4PQIA 4N11A 2HSYA 4MZCA 4GQFA 2JL4A 4ECBA 4POMA 4KSOA 2YCDA 2K18A 3KJYA 2CAQA 4EO3A 4AGSA 2PVQA 3ZMLA 4KB3A 2VD1A 1TJDA 2ALBA 3FR3A 3VI7A 3L9UA 8GSSA 3ZTLA 3FZAA 3GV1A 1WMJA 4OCEA 1EOGA 3IAM2 4RQRA 4GF0A 1O85A 1V9WA 2B7JA 3ZFLA 5IMFA 3LORA 3TGZA 4F0CA 1OAZA 1T8EB 5JWRB 3WT2A 3D4MA 3EMXA 3GKKA 1OVNA 2NTOA 4DEJA 2R2JA 4YQUA 3DEXA 1U87A 3C7MA 4EL1A 4HQSA 1EV4A 1A2JA 1EV9A 4HJ2A 6GSWA 3U5RE 1GTUA 2ZUPA 4I5QA 1BEDA 2HNLA 5CRDA 1K0OA 4KCAA 1YKCA 3GIXA 1XW6A 22GSA 3UOMA 1THOA 1TRWA 2MMAA 1TKDB 1WP0A 5ECLB 4KA0A 5HR0A 5B8AA 1K0NA 4NMUA 3TKQA 2OA7A 5C04A 3H4KA 3CMIA 1XOAA 4XS4A 4G19A 2VL2A 3GX0A 2HRNA 3HY2A 12GSA 4WR4A 2B5EA 1K0BA 2N5BA 5GSTA 1GSYA 5IMDA 1GSQA 5D9WA 2P5RA 1ZZYA 3VWWA 4MF6A 1XWGA 3LWAA 4WEYA 4AJ6A 1CQGA 1PN9A 4HEA2 1F6MC 3ZREA 4KH7A 2H30A 2GT5A 3C8EA 3QFAC 2WFCA 1EEJA 5DVBA 1B48A 3E3EA 2KHPA 2CVKA 4ZBBA 4PURA 2IMEA 1B4PA 2HSHA 5J41A 2EIOA 4ULXA 3KCMA 4XTSA 1FG4A 5IMZA 1JZOA 2IMDA 4F82A 3FR6A 4MABA 1AXDA 2K8VA 3EINA 3CYNA 4HI7A 1A23A 1MDIA 3G9BA 1GUMA 3ZYWA 3TKRA 4JR6A 2QC7A 5HFGA 1XWBA 4KDYA 2X8CA 3HCZA 4ZL8A 1KNGA 3TRXA 4K0NA 2RIIA 1XWCA 3DIEA 4IHUA 4IQ1A 5G1LA 1SD9A 4WBRD 3EYTA 3TDGA 1A0FA 2LRTA 4ISDA 3TOTA 2IN3A 1IYIA 5CAXA 1XW9A 4DSSB 1S3AA 1DBYA 2N5AA 1ILOA 1EP7A 5HR1A 1YQ1A 3QCPA 2H71A 1GTBA 2D2ZA 2H1AA 4ACSA 2PGTA 4Q5FA 2VIMA 1ZCPA 1BG5A 3HA9A 2C0FA 5JCWA 2OE0A 5ECOB 3VURA 1MD3A 2CX3A 2CZ2A 4EDYA 3F6DA 1TI3A 3D5JA 3GSTA 1FVKA 5D73A 1M9BA 3U6VA 1DE1A 4ZIJA 3TOUA 3TJJA 2LUSA 1XPVA 5F8BA 2M80A 4IELA 5F07A 1O8XA 1ZYEA 1X9MB 2C0EA 2H76A 1AW9A 4F2IA 1AIUA 3HJMA 1ZGNA 2H70A 5F05A 3QDNA 1ZMAA 4LMVA 4ZB9A 5IQYA 5CRHA 1AAZA 2CA8A 1OC8A 2OBIA 2H8LA 1OE8A 1F9MA 4IN0A 3D0ZA 1U3AA 5G31A 5CO3A 2YWOA 2C3TA 1R26A 1AUCA 3ED3A 4WETA 4NWYA 5EY6A 2C3NA 3ZFBA 2B7KA 1GTAA 2MYGA 2L4QA 4K7OA 1SU9A 1H4OA 4DVCA 4L0WA 3KXOA 5LNKe 1G6WA 2HRFA 2DJ3A 4V2LA 3J7Yb 1K3YA 2MZCA 2YWNA 4FYBA 5EL8A 1PX7A 3HJOA 3KTLA 3W8SA 5IOWA 2GQMA 2YNXA 1OC3A 3VWUA 2X99A 5D9TA 1XWKA 4FH8A 5LCZA 1DSBA 3M1GA 3QFBC 2PWJA 3GKXA 3CTFA 1O8WA 1XVQA 3VK9A 2KP2A 5H5RA 2FUG2 2VCTA 2KUCA 3TRQA 2F51A 3VFIA 1FB6A 1MD4A 4BA7A 1SK0A 2R6KA 2H1DA 2V41A 2MBTA 2IJYA 4MK3A 5H5SA 1HNCA 5CP1A 2CQ9A 18GSA 3GUSA 1Z7PA 2JSZA 3CSJA 2LJKA 2K9FA 2H73A 4TXVA 3F8UA 3KP8A 5KN1A 1T1VA 3ZZXA 1U3IA 2G0FA 4X1UA 2PERA 3GSSA 1XWAA 2IWTA 2I1UA 1PSQA 2FA8A 1VRSD 1Z3EA 4KGIA 4EVMA 5B6NA 2RLIA 4L5LA 1FO5A 5ID2B 1JZRA 4GQCA 1GNWA 3M0FA 2OADA 3ZLPA 1B4QA 2VL3A 1N8JA 3QAGA 2C1YA 1EWXA 4N0VA 1TXXA 3FW2A 1LBKA 1M7TA 3GN3A 5LD0A 4O92A 1TK8B 4I8BA 4EE0A 3P7XA 1SYXA 5AISA 4NXIA 2HLSA 3W8JA 4P3YB 2L59A 4KDUA 4EF0A 4D73B 3Q18A 4PGTA 3M9KA 2R3XA 5JWQB 2IMFA 2YOIA 3KP9A 3F4RA 2E7PA 3I9V2 3LFLA 3TKSE 5GZZB 4MA9A 5J9BA 1YEXA 5FT3A 1JLVA 2GZZA 1OC9A 3GRXA 4DSSA 2KLXA 1MTCA 4GXZA 1FAAA 3O76A 1S3DA 2L57A 2CVDA 5IPHA 2VD0A 4IGJA 4NHWA 2YZHA 4MZWA 4ZL7A 4HOJA 5JCUA 3Q74A 1F37A 2JSYA 2HYXA 5D93A 2PPTA 3QR6A 1QGVA 1ERVA 1T3BA 4HZ2A 4GLTA 2EIQA 2H01A 1QXHA 4IVFA 4GSNA 4AF2A 1QQ2A 1SJZA 1SL0B 5IO0A 2BJXA 2WRTA 3GTUB 4PNGA 2LNSA 3PR8A 2HXKA 1WJKA 2REMA 1AC1A 5H5QA 3VWXA 2FHEA 5A4VA 4GCIA 4HJMA 2DJ0A 2JZTA 2Z9SA 1Z9HA 1O6JA 3AY8A 1QMVA 1T7PB 3P2AA 4ML6A 4EC0A 6GSUA 4BWQA 1FW1A 1DE2A 1BYEA 11GSA 3MWHA 2DJKA 1XVWA 3S9FA 1WE0A 2XPDA 2LQQA 1F3AA 1SKRB 4MPFA 4GSTA 3GKMA 4NV2A 1GRXA 4RUVA 1KBNA 3GH6A 3KTBA 2TIRA 2C80A 1NW2A 1Z6NA 2O7KA 5EPFA 2JACA 2OE1A 5KN2A 3C71A 2LKUA 3BBYA 2O87A 3F9UA 4PX1A 4HDEA 1Z7RA 1GSFA 4YH2A 4OD7A 2B6MA 2JADA 1W89A 2IL3A 2V1MA 10GSA 1T00A 4OMVA 4L8EA 5D9XA 4EKZA 2P31A 3D21A 2VOCA 5ECQB 3D22A 4K7NA 2NVLA 4NHZA 3MNGA 2FA4A 3IR4A 3GNJA 4N10A 3IA1A 1SKWB 3ISOA 1JFUA 1EZKA 1GL8A 5ECRB 3HVXA 2AB6A 4O5RA 4LL1B 3DYRA 2GSRA 4WBJA 1GSSA 3KZQA 4K9ZA 5HFKA 1R5AA 1GULA 5KN3A 3RHBA 4ECIA 2YV9A 5DALB 4PQHA 1RK4A 2LJRA 1G6YA 2P5QA 3C1SA 1G0TA 3R2QA 3DRNA 3LJRA 2VM2A 3IBHA 4XS6A 3TUEA 3UARA 2DJ2A 3LG6A 2DBCA 1XW5A 3KGKA 4BL7A 4MLYA 3CRTA 4Q5RA 1PQNA 4WKWA 1HNAA 1M9AA 1ML6A 5A5KA 2OJLA 3DKSA 5B8BA 4POKA 4BVYA 4PUFC 1HD2A 2LJAA 1ABAA 19GSA 1V57A 1Q98A 5AIXA 2HE3A 2IMKA 4OO4A 3GHAA 1TP9A 2A2RA 2LV3A 2QSIA 3KEBA 3HD5A 2FLSA 3F4SA 2MMZA 1FHEA 1SL1B 2L4CA 1T4ZA 2GZYA 4JR4A 1ERWA 4LLRA 4WR5A 4V2NA 1WWJA 4JBBA 2XBQA 1GSUA 2LQOA 5COHA 5ECPB 1JLWA 3L78A 2X8GA 3SWLA 4I2UA 5CNWA 4TKYA 1I5GA 3IV4A 4JRRA 5E59A 1UA5A 4QL9A 5GSSA 2XC2A 1X5EA 5DAKB 2GSSA 2VCVA 2H0GA 4DSRA 5EVOA 1BQ7A 1ON4A 5ABRA 4IP6A 1TU7A 2I3YA 1BX9A 5ELGA 1GSEA 2M72A 1TK0B 1U6TA 2PBJA 2YN1A 1Z5YE 3RBTA 3DXBA 5B7CA 4HU9A 3PINA 1EGOA 2L6CA 1SKSB 3NOFA 1THXA 3EC3A 4J57E 1ACVA 1WOUA 2R37A 1PL2A 2LTKA 2IIYA 4FYCA 3W6GA 5J5NA 3QAVA 2VLUA 3V1WA 2MBSA 2YJ7A 1WRYA 4H86A 4JZQA 4KSMA 3ZIVA 1V40A 2HT9A 3CTGA 3K8NA 1JZWA 1PGTA 6GSYA 1ST9A 2WS2A 1EGRA 2I9HA 4IJ3A 4PUAA 4F0BA 4XCSA 7GSSA 4ZL9A 1YF1A 4ZBDA 3Q19A 4ZB8A 3US3A 5IMCA 3DMLA 5INYA 4MF7A 1NM3A 3ERGA 4WF4A 4MJCA 3O3TA 4KW6A 3UVTA 3J7Yk 1SL2B 2I4AA 2YZUA 5E4WA 4GSSA 3LXZA 4AJ7A 1PKZA 2WJUA 3BCKA 2H74A 3M8NA 5CREA 1O81A 3EU4A 3APQA 2LS5A 2LSTA 4TVEA 1AQXA 3HKRA 5FHIA 1S3CA 3N9JA 3LYPA 3ZRDA 1MDJA 2H1GA 2M46A 3WGDA 4K0GA 2PMTA 4G9HA 1K0AA 4XIHA 2LRCA 3EWLA 4ECJA 3G7YA 4I6XA 2H66A 1TU8A 3UMAA 3GURA 4ID0A 1YKAA 4KNDA 2WZ9A 2KOKA 4YQVA 2X64A 2E2GA 2O8VB 5ECMB 3KH7A 2R4VA 2DIYA 5G5EA 4EXJA 5KN0A 1RQMA 2GQLA 1FOVA 4L5OA 4ML1A 2AUVA 4NV5A 1KEBA 3QD9A 2CV4A 4XS4B 5DALA 4TOPA 3EURA 3QAWA 17GSA 4LL4B 4TW5A 5G2ZA 4K2DA 4QQ7A 1V58A 1C72A 4GRFA 1XIYA 3LQ7A 3IHQA 2V6OA 2MMNA 3RDWA 1MDKA 3C1RA 3HZ8A 1USBA 3UBKA 4ZBAA 1URMA 20GSA 4HS1A 1B9YC 4K8MA 3FK8A 3I6AA 2A4VA 3BOAA 3GX8A 1X5CA 1IYHA 3L4NA 3FEUA 5J3RA 2B3SA 4O32A 2ON5A 4N30A 1FB0A 2F9SA 2HFDA 2ON7A 2DMLA 5L71A 2V2GA 4IW9A 1X9SB 5IMVA 3OR5A 3ME7A 4G2EA 5D9VA 2L5LA 3A5WA 2VCZA 2CT6A 1SYRA 1U88A 1Q4JA 3IC4A 3A3TA 5IO2A 2NPBA 3HVSA 3RPNA 1A2LA 1PMTA 1W4VA 4FYUA 1PA3A 3G7JA 2VCWA 3IK9A 5DCGA 4F03A 4L0UA 3TJBA 4HQZA 3BCIA 5DAKA 3G7IA 2DC5A 3H79A 1GTIA 1HNBA 1X5DA 4X43A 3ZVJD 1A8LA 1TRSA 1GUKA 1AQVA 4K6XA 4MP4A 4BWSA 2OE3A 1NHYA 4O7HA 3VPTA 3QPMA 1AQWA 4TR4A 4CW9A 1E2YA 4MZBA 3H1NA 1YDKA 3NZNA 5B6MA 4BVXA 4QL7A 2FNOA 5ECSA 4X0XA 1N2AA 2DIZA 2K6VA 3UVHA 4ECCA 3L9SA 4ZXGA 1ZL9A 4MF5A 2GQKA 1BJXA 3GA4A 1GLPA 4MCUA 1QFNA 4N0ZA 1SK2A 3A2WA 3JCML 5CYYA 2TRCP 2YV7A 1HYUA 2YANA 2JZSA 1J9BA 3ME8A 5IMAA 2FGXA 1OKTA 3N5OA 2WB9A 4IS0A 1V98A 3KH9A 3L9VA 1X0RA 1VF4A 4KCEA 2WULA 3DD3A 4EUYA 4TR0A 1PL1A 1TDIA 2C0DA 3KD0A 5A4UA 3E9JB 2LNTA 1OYJA 3IPZA 4YQMA 4YAVA 5IPGA 4Q5QA 1ZYQB 4POBA 2JZRA 2H6YA 4IKHA 4LA1A 3TCOA 6GSSA 3FZ9A 4KE3A 1Y25A 4ZILA 3FY7A 5F06A 5JCGA 3ZVJA 2AYTA 2H72A 4JU5A 3HVVA 1ZOFA 3Q6OA 1QK8A 3C73A 3TJKA 4V2MA 2R5GA 5GAND 1TI1A 3KIJA 4TXOB 1Y6EA 4CHSA 4CDOA 1JHBA 1ERTA 2GSQA 4JEDA 2GVPA 2GT6A 4IQAA 1A2MA 2HZEB 1K3OA 1SD8A 3UL3A 1TK5B 3HXSA 1SJIA 2OACA 3ZITA 2IFQB 16GSA 4PNFA 1OKDA 1TOFA 2H6ZA 5HR2A 2IPAA 4OO5A 1G7EA 3CSIA 3UBLA 2XHFA 3CSHA 2CVBA 5ECHB 2B1LA 3ERWA 1M99A 3A2XA 3IDVA 3DVXA 3FZ4A 1V2AA 2LRNA 3PGTA 2GDRA 1B9XC 4AJ8A 2B1KA 1GH2A 3SBCA 3CBUA 4EDZA 1ERUA 3UAPA 3EVIA 2YP6A 1T4YA 3RAZA 3I69A 3GFKA 3WD6A 3FKFA 4E8HA 2CAIA 1O7UA 3H8QA 1GSDA 3H93A 2YPMA 4HUAA 3IE3A 3GL5A 3QOUA 9GSSA 4ZB6A 4I97A 3A2VA 2V32A 3ZMKA 4NAXA 3HJPA 1B8XA 5DQYA 1UN2A 2ZNMA 3WGEA 5G30A 4JE1A 1WIKA 1XBSA 3P90A 3BD2A 2FWHA 3IK7A 1F2EA 2XBIA 2DSAA 5ID2A 2V6KA 2GLRA 3M9JA 1J0FA 4XS1A 5ECKB 3EU3A 6GSVA 1M2DA 3E0UA 2OKAA 2P0GA 1KTEA 3ERFA 4TR1B 4FIWA 4E8EA 2DLXA 4PQ1A 2PUKC 2H1BA 4XHMA 2LEGA 3P8WA 2OBKA 2C8UA 3KMNA 2AJQB 3VWVA 2F8FA 4HU7A 4D73A 1GWCA 1EEMA 5DQSA 3FHKA 3TJGA 4MH2A 3MDKA 2VM1A 13GSA 1OC9B 4IP1A 2GTUA 1VF2A 2VAFA 2MMOA 2DMMA 3DVWA 4RI7A 1RW1A 4OFTA 3GMFA 5D8IA 3TRPA 1F3BA 3HHVA 2RM6A 2PN8A 4V1Ag 2GGTA 3IRAA 5DBQA 5DJMA 2RUEA 2H0IA 4K1FA 4OWYA 4OFNA 5G1KA 3GTUA 5AN1A 5ECIB 2CZ3A 1YY7A 5ELAA 2GSTA 3WT1A 3LXTA 5HFIA 2VL9A 1SK1A 5IIZA 4PXOA 3BJ5A 5AGYA 1MEKA 3L0HA 2FY6A 3RHCA 1M2AA 2J9HA 2L6DA 3F3RA 4MPGA 3F3QA 6GSXA 2ES7A 3TKPA 5IOXA 3DWVA 1VGLA 5DCHA 2EC4A 2H75A 1J08A 1QUWA 4WXTA 1Z6MA 1DUGA 4GWRA 4XRAA 1NHOA 1YZXA 2F3MA 1A24A 1FVJA 3QMXA 4XRDA 3F4TA 4RQXA 3LGCA 1VF3A 2VCXA 3GYKA 4KDXA 3LEFA 1K0MA 3HZ4A 3WGXA 1CQHA 2L5OA
chains in the Genus database with same CATH superfamily
5G5FA 3GH9A 2DJ1A 2QA2A 1LJRA 2NBSA 4TXOA 4G10A 1XZOA 4WF5A 2F8AA 1UC7A 3TKSC 2VLTA 3RPPA 3ZIJA 4MJAA 4ILFA 1A0RP 1PRXA 1TRUA 5CRGA 2B5XA 2HZEA 4KUNA 2RM5A 3FZ5A 3EMPA 1OE7A 2BTOT 4KAEA 1O73A 1WPIA 2HI7A 2YWIA 4V1Ap 3ZL5A 1LU4A 2X8HA 2IFQA 1G7OA 3GL3A 3WYWA 3IAS2 5A4WA 2AV4A 5AIVA 1PX6A 2RUFA 3APSA 3UEMA 5DDLA 2FWGA 2JU5A 5D96A 5C00A 1TRVA 1I9DA 3FRCA 3I43A 6GSTA 3CXGA 1EP8A 1PD21 4OCFA 5J9CA 5IM9A 2WCIA 4J56E 1GLQA 4Z7XA 1R7HA 3GKNA 3UJ1A 1K0DA 2PVOC 5FWGA 1GNEA 3KM6A 1E6BA 3CRUA 2O89A 1UVZA 4DSQA 4MJEA 2VCQA 2KP1A 2VLVA 3UIWA 1EOHA 1TW9A 1M2BA 2GZPA 3TJFA 2B5YA 5ENUA 4BVYB 2E0QA 2DJJA 3IXRA 2BMXA 3MSZA 1A8YA 4J2FA 1SJ6A 4YAPA 2G2QA 1GP1A 3APOA 3HDCA 2A2SA 2IMIA 3PH9A 1HQOA 2GS3A 2QGVA 4BPYA 2YWMA 2XPEA 3HVNA 1K3LA 2X4AA 2J23A 5J4UA 4MH3A 4HZ4A 3MAKA 1M0UA 2N5FA 2WDUA 3VI5A 4MJBA 2H19A 1X9WB 3F6FA 2FD3A 3D6IA 4FO5A 1PKWA 3FR9A 4MMMA 4TR1A 1XCCA 3D4TA 2WGRA 3TB2A 4Q5NA 1BAYA 3NIVA 5F0GA 4IJIA 1YJ6A 3M3MA 2H0HA 2VL2C 1R5PA 1XOBA 5HR3A 4I2TA 3FYGA 4NPBA 2O85A 2AAWA 3DGQA 1TTZA 3HYPA 2TRXA 2PU9C 1NSWA 2FWFA 3F63A 4TR3A 4RI6A 3LYKA 5DJLA 4MDCA 3KMOA 2FCHA 1XFLA 2YJHA 4F9ZA 5GAPD 4TRXA 5JWOB 3VLNA 2E2MA 14GSA 4LMWA 1H75A 1K0CA 1SENA 2NDOA 2EIRA 4OFMA 3O6TA 4K7IA 4KX4A 5HQPA 3FMWA 2VUPA 5ECNB 1XXUA 1VF1A 4POLA 1GUHA 3TKSA 2C4JA 2R0GA 2C0GA 2HRKA 2HZFA 1R4WA 5KEJA 2VO4A 2I81A 1YEPA 1YF0A 3LSZA 2ZCTA 2FWEA 2C3QA 4IBPA 3EE2A 2CX4A 2AHEA 3VPQA 5CRWA 4EIQA 1JZDA 3IOSA 3F0IA 4TN8A 2QKEA 2K8SA 4GTUA 4G0KA 2H6XA 4PQIA 4N11A 2HSYA 4MZCA 4GQFA 2JL4A 4ECBA 4POMA 4KSOA 2YCDA 2K18A 3KJYA 2CAQA 4EO3A 4AGSA 2PVQA 3ZMLA 4KB3A 2VD1A 1TJDA 2ALBA 3FR3A 3VI7A 3L9UA 8GSSA 2HSMA 3ZTLA 3FZAA 3GV1A 1WMJA 4OCEA 1EOGA 3IAM2 4RQRA 4GF0A 1O85A 1V9WA 2B7JA 3ZFLA 5IMFA 3LORA 3TGZA 4F0CA 1OAZA 1T8EB 5JWRB 3WT2A 4YKFA 3D4MA 3EMXA 3GKKA 1OVNA 2NTOA 4DEJA 2R2JA 4YQUA 3DEXA 1U87A 3C7MA 4EL1A 4HQSA 1EV4A 1A2JA 1EV9A 4HJ2A 6GSWA 3U5RE 1GTUA 2ZUPA 4I5QA 1BEDA 2HNLA 5CRDA 1K0OA 4KCAA 1YKCA 3GIXA 1XW6A 22GSA 3UOMA 1THOA 1TRWA 2MMAA 1TKDB 1WP0A 5ECLB 4KA0A 5HR0A 5B8AA 1K0NA 4NMUA 3TKQA 2OA7A 5C04A 3H4KA 3CMIA 1XOAA 4XS4A 4G19A 2VL2A 3GX0A 2HRNA 3HY2A 12GSA 4WR4A 2B5EA 1K0BA 2N5BA 5GSTA 1GSYA 5IMDA 1GSQA 5D9WA 2P5RA 4YKGA 3MIXA 1ZZYA 3VWWA 4MF6A 1XWGA 3LWAA 4WEYA 1S3RA 4AJ6A 1CQGA 1PN9A 4HEA2 1F6MC 3ZREA 4KH7A 4FQUA 2H30A 2GT5A 3C8EA 3LW9A 3QFAC 2WFCA 1EEJA 5DVBA 1B48A 3E3EA 2KHPA 2CVKA 4ZBBA 4PURA 2IMEA 1B4PA 2HSHA 5J41A 2EIOA 4ULXA 3KCMA 4XTSA 1FG4A 5IMZA 1JZOA 2IMDA 4F82A 3FR6A 4MABA 1AXDA 2K8VA 3EINA 3CYNA 4HI7A 1A23A 1MDIA 3G9BA 1GUMA 3ZYWA 3TKRA 4JR6A 2QC7A 5HFGA 1XWBA 4KDYA 2X8CA 3HCZA 4ZL8A 1KNGA 3TRXA 4K0NA 2RIIA 1XWCA 3DIEA 4IHUA 4IQ1A 5G1LA 1SD9A 4WBRD 3EYTA 3TDGA 1A0FA 4X4JA 2LRTA 4ISDA 3TOTA 2IN3A 1IYIA 5CAXA 1XW9A 4DSSB 1S3AA 1DBYA 2N5AA 1ILOA 1EP7A 5HR1A 1YQ1A 3QCPA 2H71A 1GTBA 2D2ZA 2H1AA 4ACSA 2PGTA 4Q5FA 1XG8A 2VIMA 4BVXB 1ZCPA 1BG5A 4K5SA 3HA9A 2C0FA 5JCWA 2OE0A 5ECOB 3VURA 1MD3A 2CX3A 2CZ2A 4EDYA 2A4HA 3F6DA 1TI3A 3D5JA 3GSTA 1FVKA 5D73A 1M9BA 3U6VA 1DE1A 4ZIJA 4A5PA 3TOUA 3TJJA 4KF9A 2LUSA 1XPVA 5F8BA 2M80A 4IELA 5F07A 1O8XA 1ZYEA 1X9MB 2C0EA 2H76A 1AW9A 4F2IA 1AIUA 3HJMA 1ZGNA 2H70A 5F05A 3QDNA 1ZMAA 4LMVA 4ZB9A 5IQYA 5CRHA 1AAZA 2CA8A 1OC8A 2OBIA 2H8LA 1OE8A 1F9MA 4IN0A 3D0ZA 1U3AA 5G31A 5CO3A 2YWOA 5KOWA 2C3TA 1R26A 1AUCA 3ED3A 4WETA 4NWYA 5EY6A 2C3NA 3ZFBA 2B7KA 1GTAA 2MYGA 2L4QA 4K7OA 1SU9A 1H4OA 4DVCA 4L0WA 3KXOA 5LNKe 1G6WA 2HRFA 2DJ3A 4V2LA 3J7Yb 1K3YA 2MZCA 2YWNA 4FYBA 1ZYPA 5EL8A 1PX7A 3HJOA 3KTLA 3W8SA 5IOWA 2GQMA 2YNXA 1OC3A 1M3IA 3VWUA 2X99A 5D9TA 1XWKA 4FH8A 2QA1A 5LCZA 1DSBA 3M1GA 3QFBC 2PWJA 3GKXA 3CTFA 1O8WA 1XVQA 3VK9A 2KP2A 5H5RA 2FUG2 2VCTA 2KUCA 4BL7B 3TRQA 2F51A 3VFIA 1FB6A 1MD4A 4BA7A 1PFOA 1SK0A 2R6KA 2H1DA 2V41A 2MBTA 2IJYA 4MK3A 5H5SA 1HNCA 5CP1A 2CQ9A 18GSA 3GUSA 1Z7PA 2JSZA 3CSJA 2LJKA 2K9FA 2H73A 4TXVA 3F8UA 3KP8A 5KN1A 1T1VA 3ZZXA 1U3IA 2G0FA 4X1UA 2PERA 3GSSA 1XWAA 2IWTA 4CY8A 4K5RA 2I1UA 1PSQA 2FA8A 1VRSD 1Z3EA 4KGIA 4EVMA 5B6NA 2RLIA 4L5LA 1FO5A 5ID2B 1JZRA 4GQCA 1GNWA 3M0FA 2OADA 3ZLPA 1B4QA 2VL3A 1N8JA 3QAGA 2C1YA 1EWXA 4N0VA 1TXXA 3FW2A 1LBKA 1M7TA 3GN3A 5LD0A 4O92A 1TK8B 4I8BA 4EE0A 3P7XA 1SYXA 5AISA 4NXIA 2HLSA 3W8JA 4P3YB 2L59A 4KDUA 4EF0A 4D73B 3Q18A 4PGTA 3M9KA 2R3XA 5JWQB 2IMFA 2YOIA 3KP9A 3F4RA 4Z2TA 2E7PA 4Z2RA 3I9V2 3LFLA 3TKSE 5GZZB 4MA9A 5J9BA 1YEXA 5FT3A 1JLVA 2GZZA 1OC9A 3GRXA 4DSSA 2KLXA 1MTCA 4GXZA 1FAAA 3O76A 1S3DA 2L57A 2CVDA 5IPHA 2VD0A 4IGJA 4NHWA 2YZHA 4MZWA 4ZL7A 4HOJA 5JCUA 3Q74A 1F37A 2JSYA 2HYXA 5D93A 2PPTA 3QR6A 1QGVA 1ERVA 1T3BA 4HZ2A 4GLTA 2EIQA 2H01A 1QXHA 4IVFA 4GSNA 4AF2A 1QQ2A 1SJZA 1SL0B 5IO0A 2BJXA 2WRTA 3R3EA 3GTUB 4PNGA 3EPTA 2LNSA 3PR8A 2HXKA 1WJKA 2REMA 1AC1A 5H5QA 3VWXA 2FHEA 5A4VA 4GCIA 4HJMA 2DJ0A 2JZTA 2Z9SA 1Z9HA 1O6JA 3AY8A 1QMVA 1T7PB 3P2AA 4ML6A 4EC0A 6GSUA 4BWQA 1FW1A 1DE2A 1BYEA 11GSA 3MWHA 2DJKA 1XVWA 3S9FA 1WE0A 2XPDA 2LQQA 1F3AA 1SKRB 4MPFA 4GSTA 3GKMA 4NV2A 1GRXA 4RUVA 1KBNA 3GH6A 3KTBA 2TIRA 2C80A 1NW2A 1Z6NA 2O7KA 5EPFA 2JACA 2OE1A 5KN2A 3C71A 2LKUA 3BBYA 2O87A 3F9UA 4PX1A 4HDEA 1Z7RA 1GSFA 4YH2A 4OD7A 2B6MA 4Z2UA 2JADA 1W89A 2IL3A 2V1MA 10GSA 1T00A 4OMVA 4L8EA 5D9XA 4EKZA 2P31A 1FOHA 3D21A 2VOCA 2R0CA 5ECQB 3D22A 4K7NA 2NVLA 4NHZA 3MNGA 2FA4A 3IC8A 3IR4A 3GNJA 4N10A 3IA1A 1SKWB 3ISOA 1JFUA 1EZKA 1GL8A 4HSCX 5ECRB 3HVXA 2AB6A 4O5RA 4LL1B 4PTSA 3DYRA 2GSRA 4WBJA 1GSSA 3KZQA 4K9ZA 5HFKA 1R5AA 1GULA 5KN3A 3RHBA 4ECIA 2YV9A 5DALB 4PQHA 1RK4A 2LJRA 1G6YA 2P5QA 3C1SA 1G0TA 3R2QA 3DRNA 3LJRA 2VM2A 3IBHA 4XS6A 3TUEA 3UARA 2DJ2A 3LG6A 2DBCA 1XW5A 3KGKA 4BL7A 4MLYA 3CRTA 4Q5RA 1PQNA 4WKWA 1HNAA 1M9AA 1ML6A 5A5KA 2OJLA 3DKSA 5B8BA 4POKA 4BVYA 4PUFC 1HD2A 2LJAA 1ABAA 19GSA 1V57A 1Q98A 5AIXA 2HE3A 2IMKA 4OO4A 3GHAA 1TP9A 2A2RA 2LV3A 2QSIA 3KEBA 3HD5A 2FLSA 3F4SA 2MMZA 1FHEA 1SL1B 2L4CA 1T4ZA 2GZYA 4JR4A 1ERWA 4LLRA 4WR5A 4V2NA 1WWJA 4JBBA 2XBQA 1GSUA 2LQOA 5COHA 5ECPB 1JLWA 3L78A 4MNNA 2X8GA 3SWLA 4I2UA 2A2PA 5CNWA 4TKYA 1I5GA 3IV4A 4JRRA 5E59A 1UA5A 4QL9A 5GSSA 2XC2A 1X5EA 5DAKB 2GSSA 2VCVA 2H0GA 4DSRA 5EVOA 1BQ7A 1ON4A 5ABRA 4IP6A 1TU7A 2I3YA 1BX9A 5ELGA 1GSEA 2M72A 1TK0B 1U6TA 2PBJA 2YN1A 1Z5YE 3RBTA 3DXBA 5B7CA 1PN0A 3PINA 4HU9A 1EGOA 4G0IA 2L6CA 1SKSB 3NOFA 1THXA 3EC3A 4J57E 1ACVA 4EIPA 1WOUA 2R37A 1PL2A 2LTKA 2IIYA 4FYCA 3W6GA 5J5NA 4K2XA 3QAVA 2VLUA 3V1WA 2MBSA 2YJ7A 1WRYA 4H86A 4JZQA 4KSMA 3ZIVA 1V40A 2HT9A 3CTGA 3K8NA 1JZWA 1PGTA 6GSYA 1ST9A 2WS2A 1EGRA 2I9HA 2X49A 4IJ3A 4PUAA 4F0BA 4XCSA 7GSSA 4ZL9A 5BMUA 1YF1A 4ZBDA 3Q19A 4ZB8A 3US3A 5IMCA 3DMLA 5INYA 4MF7A 1NM3A 3ERGA 4WF4A 4MJCA 3O3TA 4KW6A 3UVTA 3J7Yk 1SL2B 2I4AA 2YZUA 5E4WA 4GSSA 3LXZA 4AJ7A 1PKZA 2WJUA 3BCKA 2H74A 3M8NA 5CREA 1O81A 3EU4A 3APQA 2LS5A 2LSTA 4TVEA 1AQXA 3HKRA 5FHIA 1S3CA 3N9JA 3LYPA 4O5UA 3ZRDA 1MDJA 2H1GA 2M46A 3MYDA 3WGDA 4K0GA 2PMTA 4G9HA 3IHGA 1K0AA 4XIHA 2LRCA 3EWLA 4ECJA 3G7YA 4I6XA 2H66A 1TU8A 3UMAA 3GURA 4ID0A 4USSA 1YKAA 4KNDA 2WZ9A 2KOKA 4YQVA 2X64A 2E2GA 2O8VB 5ECMB 3KH7A 2R4VA 2DIYA 5G5EA 4EXJA 5KN0A 1RQMA 2GQLA 1FOVA 4L5OA 4ML1A 2AUVA 4NV5A 1KEBA 3QD9A 2CV4A 4XS4B 5DALA 4TOPA 3EURA 3QAWA 17GSA 4LL4B 4TW5A 5G2ZA 4K2DA 4QQ7A 1V58A 1C72A 4GRFA 1XIYA 3LQ7A 3IHQA 2V6OA 2MMNA 3RDWA 1MDKA 1M3JA 3C1RA 4BIKA 3HZ8A 1USBA 3UBKA 2R0PA 4ZBAA 1ZYNA 1URMA 20GSA 4HS1A 1B9YC 4K8MA 3FK8A 3I6AA 2A4VA 3BOAA 3GX8A 1X5CA 1IYHA 3L4NA 3FEUA 5J3RA 2B3SA 4O32A 2ON5A 4N30A 1FB0A 2F9SA 2HFDA 2ON7A 2DMLA 5L71A 2V2GA 4IW9A 1X9SB 5IMVA 3OR5A 3ME7A 4G2EA 5D9VA 2L5LA 3A5WA 2VCZA 2CT6A 1SYRA 1U88A 1Q4JA 3IC4A 3A3TA 5IO2A 2NPBA 3HVSA 3RPNA 1A2LA 1PMTA 1W4VA 4FYUA 1PA3A 3G7JA 2VCWA 3IK9A 5DCGA 4F03A 4L0UA 3TJBA 4HQZA 3BCIA 5DAKA 3G7IA 2DC5A 3H79A 1GTIA 1HNBA 1X5DA 4X43A 3ZVJD 1A8LA 1TRSA 1GUKA 1AQVA 4K6XA 4MP4A 4BWSA 2OE3A 1NHYA 4O7HA 4ICYA 3VPTA 3QPMA 2HRAA 1AQWA 4TR4A 4CW9A 1E2YA 4MZBA 3H1NA 1YDKA 3NZNA 5B6MA 4BVXA 4QL7A 2FNOA 4O5QA 4X0XA 5ECSA 1N2AA 2DIZA 2K6VA 3UVHA 4ECCA 3L9SA 4ZXGA 1ZL9A 4MF5A 2GQKA 2DKIA 1BJXA 3GA4A 1GLPA 4MCUA 1QFNA 4N0ZA 1SK2A 3A2WA 3JCML 5CYYA 2TRCP 2UZ8A 2DKHA 1HYUA 2YV7A 2YANA 2JZSA 1J9BA 3ME8A 5IMAA 2FGXA 1OKTA 3N5OA 2WB9A 4G0LA 4IS0A 1V98A 3KH9A 3L9VA 1X0RA 1VF4A 4KCEA 2WULA 3DD3A 4EUYA 4TR0A 1PL1A 1TDIA 2C0DA 3KD0A 5A4UA 3E9JB 2LNTA 1OYJA 3IPZA 4YQMA 4YAVA 5IPGA 4Q5QA 1ZYQB 4POBA 2JZRA 2H6YA 4IKHA 4LA1A 3TCOA 6GSSA 3FZ9A 4KE3A 1Y25A 4ZILA 3FY7A 5F06A 5JCGA 3ZVJA 2AYTA 2H72A 4JU5A 3HVVA 1ZOFA 3Q6OA 1QK8A 3C73A 3TJKA 4V2MA 2R5GA 5GAND 1TI1A 3KIJA 4TXOB 1Y6EA 4CHSA 4CDOA 1JHBA 1ERTA 2GSQA 4JEDA 2GVPA 2GT6A 4IQAA 1A2MA 2HZEB 1K3OA 1SD8A 3UL3A 1TK5B 3HXSA 1SJIA 2OACA 3ZITA 2IFQB 16GSA 4PNFA 1OKDA 1TOFA 2H6ZA 5HR2A 2IPAA 4OO5A 1G7EA 3CSIA 3UBLA 2XHFA 3CSHA 2CVBA 5ECHB 2B1LA 3ERWA 1M99A 3A2XA 3IDVA 3DVXA 3FZ4A 1V2AA 2LRNA 3PGTA 2GDRA 3PPUA 1B9XC 4AJ8A 2B1KA 3CQFA 1GH2A 3SBCA 3CBUA 4EDZA 1ERUA 3UAPA 3EVIA 2YP6A 1T4YA 3RAZA 3I69A 3GFKA 3WD6A 3FKFA 4E8HA 2CAIA 1O7UA 3H8QA 1GSDA 3H93A 3A5IA 2YPMA 4HUAA 3IE3A 3GL5A 3QOUA 9GSSA 4ZB6A 4I97A 3A2VA 2V32A 3ZMKA 4NAXA 3HJPA 1B8XA 5DQYA 1UN2A 2ZNMA 3WGEA 5G30A 4JE1A 1WIKA 1XBSA 3P90A 3BD2A 2FWHA 3IK7A 1F2EA 2XBIA 2DSAA 5ID2A 2V6KA 2GLRA 3M9JA 1J0FA 4XS1A 5ECKB 3EU3A 6GSVA 1M2DA 3E0UA 2OKAA 2P0GA 1KTEA 3ERFA 4TR1B 4FIWA 4E8EA 2DLXA 4PQ1A 2PUKC 2H1BA 4XHMA 2LEGA 3P8WA 2OBKA 2C8UA 3KMNA 2AJQB 3VWVA 2F8FA 4HU7A 4D73A 1GWCA 5BRTA 1EEMA 5DQSA 3FHKA 3TJGA 4MH2A 3MDKA 2VM1A 13GSA 1OC9B 4IP1A 2GTUA 1VF2A 2VAFA 2MMOA 2DMMA 3DVWA 4RI7A 1RW1A 4OFTA 3GMFA 5D8IA 3TRPA 1F3BA 3HHVA 2RM6A 2PN8A 4V1Ag 2GGTA 3IRAA 5DBQA 5DJMA 2RUEA 2H0IA 4K1FA 4CY6A 4OWYA 4OFNA 5G1KA 3GTUA 5AN1A 5ECIB 2CZ3A 1YY7A 5ELAA 2GSTA 3WT1A 3LXTA 5HFIA 2VL9A 1SK1A 5IIZA 4PXOA 3BJ5A 5AGYA 1MEKA 3L0HA 2FY6A 3RHCA 1M2AA 2J9HA 2L6DA 3F3RA 4MPGA 3F3QA 6GSXA 2ES7A 3TKPA 5IOXA 3DWVA 1VGLA 5DCHA 2EC4A 2H75A 1J08A 1QUWA 4WXTA 1Z6MA 1DUGA 4GWRA 4XRAA 1NHOA 1YZXA 2F3MA 1A24A 1FVJA 3QMXA 4XRDA 3F4TA 4RQXA 3LGCA 1VF3A 2VCXA 3GYKA 4KDXA 3LEFA 1K0MA 3HZ4A 3WGXA 1CQHA 5KOXA 2L5OA
chains in the Genus database with same CATH topology
5G5FA 3GH9A 2DJ1A 2QA2A 1LJRA 2NBSA 4TXOA 4G10A 1XZOA 4WF5A 2F8AA 1UC7A 3TKSC 2VLTA 3RPPA 3ZIJA 4MJAA 4ILFA 1A0RP 1PRXA 1TRUA 5CRGA 2B5XA 2HZEA 4KUNA 2RM5A 3FZ5A 3EMPA 1OE7A 2BTOT 4KAEA 1O73A 1WPIA 2HI7A 2YWIA 4V1Ap 3ZL5A 1LU4A 2X8HA 2IFQA 1G7OA 3GL3A 3WYWA 3IAS2 5A4WA 2AV4A 5AIVA 1PX6A 2RUFA 3APSA 3UEMA 5DDLA 2FWGA 2JU5A 5D96A 5C00A 1TRVA 1I9DA 3FRCA 3I43A 6GSTA 3CXGA 1EP8A 1PD21 4OCFA 5J9CA 5IM9A 2WCIA 4J56E 1GLQA 4Z7XA 1R7HA 3GKNA 3UJ1A 1K0DA 2PVOC 5FWGA 1GNEA 3KM6A 1E6BA 3CRUA 2O89A 1UVZA 4DSQA 4MJEA 2VCQA 2KP1A 2VLVA 3UIWA 1EOHA 1TW9A 1M2BA 2GZPA 3TJFA 2B5YA 5ENUA 4BVYB 2E0QA 2DJJA 3IXRA 2BMXA 3MSZA 1A8YA 4J2FA 1SJ6A 4YAPA 2G2QA 1GP1A 3APOA 3HDCA 2A2SA 2IMIA 3PH9A 1HQOA 2GS3A 2QGVA 4BPYA 2YWMA 2XPEA 1K3LA 2X4AA 2J23A 5J4UA 4MH3A 4HZ4A 3MAKA 1M0UA 2N5FA 2WDUA 3VI5A 4MJBA 2H19A 1X9WB 3F6FA 2FD3A 3D6IA 4FO5A 1PKWA 3FR9A 4MMMA 4TR1A 1XCCA 3D4TA 2WGRA 3TB2A 4Q5NA 1BAYA 3NIVA 5F0GA 4IJIA 1YJ6A 3M3MA 2H0HA 2VL2C 1R5PA 1XOBA 5HR3A 4I2TA 3FYGA 4NPBA 2O85A 2AAWA 3DGQA 1TTZA 3HYPA 2TRXA 2PU9C 1NSWA 2FWFA 3F63A 4TR3A 4RI6A 3LYKA 5DJLA 4MDCA 3KMOA 2FCHA 1XFLA 2YJHA 4F9ZA 5GAPD 4TRXA 5JWOB 3VLNA 2E2MA 14GSA 4LMWA 1H75A 1K0CA 1SENA 2NDOA 2EIRA 4OFMA 3O6TA 4K7IA 4KX4A 5HQPA 3FMWA 2VUPA 5ECNB 1XXUA 1VF1A 4POLA 1GUHA 3TKSA 2C4JA 2R0GA 2C0GA 2HRKA 2HZFA 1R4WA 5KEJA 2VO4A 2I81A 1YEPA 1YF0A 3LSZA 2ZCTA 2FWEA 2C3QA 4IBPA 3EE2A 2CX4A 2AHEA 3VPQA 5CRWA 4EIQA 1JZDA 3IOSA 3F0IA 4TN8A 2QKEA 2K8SA 4GTUA 4G0KA 2H6XA 4PQIA 4N11A 2HSYA 4MZCA 4GQFA 2JL4A 4ECBA 4POMA 4KSOA 2YCDA 2K18A 3KJYA 2CAQA 4EO3A 4AGSA 2PVQA 3ZMLA 4KB3A 2VD1A 1TJDA 2ALBA 3FR3A 3VI7A 3L9UA 8GSSA 2HSMA 3ZTLA 3FZAA 3GV1A 1WMJA 4OCEA 1EOGA 3IAM2 4RQRA 4GF0A 1O85A 1V9WA 2B7JA 3ZFLA 5IMFA 3LORA 3TGZA 4F0CA 1OAZA 1T8EB 5JWRB 3WT2A 4YKFA 3D4MA 3EMXA 3GKKA 1OVNA 2NTOA 4DEJA 2R2JA 4YQUA 3DEXA 1U87A 3C7MA 4EL1A 4HQSA 1EV4A 1A2JA 1EV9A 4HJ2A 6GSWA 3U5RE 1GTUA 2ZUPA 4I5QA 1BEDA 2HNLA 5CRDA 1K0OA 4KCAA 1YKCA 3GIXA 1XW6A 22GSA 3UOMA 1THOA 1TRWA 2MMAA 1TKDB 1WP0A 5ECLB 4KA0A 5HR0A 5B8AA 1K0NA 4NMUA 3TKQA 2OA7A 5C04A 3H4KA 3CMIA 1XOAA 4XS4A 4G19A 2VL2A 3GX0A 2HRNA 3HY2A 12GSA 4WR4A 2B5EA 1K0BA 2N5BA 5GSTA 1GSYA 5IMDA 1GSQA 5D9WA 2P5RA 4YKGA 3MIXA 1ZZYA 3VWWA 4MF6A 1XWGA 3LWAA 4WEYA 4AJ6A 1CQGA 1PN9A 4HEA2 1F6MC 3ZREA 4KH7A 4FQUA 2H30A 2GT5A 3C8EA 3LW9A 3QFAC 2WFCA 1EEJA 5DVBA 1B48A 3E3EA 2KHPA 2CVKA 4ZBBA 4PURA 2IMEA 1B4PA 2HSHA 5J41A 2EIOA 4ULXA 3KCMA 4XTSA 1FG4A 5IMZA 1JZOA 2IMDA 4F82A 3FR6A 4MABA 1AXDA 2K8VA 3EINA 3CYNA 4HI7A 1A23A 1MDIA 3G9BA 1GUMA 3ZYWA 3TKRA 4JR6A 2QC7A 5HFGA 1XWBA 4KDYA 2X8CA 3HCZA 4ZL8A 1KNGA 3TRXA 4K0NA 2RIIA 1XWCA 3DIEA 4IHUA 4IQ1A 5G1LA 1SD9A 4WBRD 3EYTA 3TDGA 1A0FA 4X4JA 2LRTA 4ISDA 3TOTA 2IN3A 1IYIA 5CAXA 1XW9A 4DSSB 1S3AA 1DBYA 2N5AA 1ILOA 1EP7A 5HR1A 1YQ1A 3QCPA 2H71A 1GTBA 2D2ZA 2H1AA 4ACSA 2PGTA 4Q5FA 2VIMA 4BVXB 1ZCPA 1BG5A 4K5SA 3HA9A 2C0FA 5JCWA 2OE0A 5ECOB 3VURA 1MD3A 2CX3A 2CZ2A 4EDYA 2A4HA 3F6DA 1TI3A 3D5JA 3GSTA 1FVKA 5D73A 1M9BA 3U6VA 1DE1A 4ZIJA 4A5PA 3TOUA 3TJJA 4KF9A 2LUSA 1XPVA 5F8BA 2M80A 4IELA 5F07A 1O8XA 1ZYEA 1X9MB 2C0EA 2H76A 1AW9A 4F2IA 1AIUA 3HJMA 1ZGNA 2H70A 5F05A 3QDNA 1ZMAA 4LMVA 4ZB9A 5IQYA 5CRHA 1AAZA 2CA8A 1OC8A 2OBIA 2H8LA 1OE8A 1F9MA 4IN0A 3D0ZA 1U3AA 5G31A 5CO3A 2YWOA 5KOWA 2C3TA 1R26A 1AUCA 3ED3A 4WETA 4NWYA 5EY6A 2C3NA 3ZFBA 2B7KA 1GTAA 2MYGA 2L4QA 4K7OA 1SU9A 1H4OA 4DVCA 4L0WA 3KXOA 5LNKe 1G6WA 2HRFA 2DJ3A 4V2LA 3J7Yb 1K3YA 2MZCA 2YWNA 4FYBA 1ZYPA 5EL8A 1PX7A 3HJOA 3KTLA 3W8SA 5IOWA 2GQMA 2YNXA 1OC3A 3VWUA 2X99A 5D9TA 1XWKA 4FH8A 2QA1A 5LCZA 1DSBA 3M1GA 3QFBC 2PWJA 3GKXA 3CTFA 1O8WA 1XVQA 3VK9A 2KP2A 5H5RA 2FUG2 2VCTA 2KUCA 4BL7B 3TRQA 2F51A 3VFIA 1FB6A 1MD4A 4BA7A 1SK0A 2R6KA 2H1DA 2V41A 2MBTA 2IJYA 4MK3A 5H5SA 1HNCA 5CP1A 2CQ9A 18GSA 3GUSA 1Z7PA 2JSZA 3CSJA 2LJKA 2K9FA 2H73A 4TXVA 3F8UA 3KP8A 5KN1A 1T1VA 3ZZXA 1U3IA 2G0FA 4X1UA 2PERA 3GSSA 1XWAA 2IWTA 4CY8A 4K5RA 2I1UA 1PSQA 2FA8A 1VRSD 1Z3EA 4KGIA 4EVMA 5B6NA 2RLIA 4L5LA 1FO5A 5ID2B 1JZRA 4GQCA 1GNWA 3M0FA 2OADA 3ZLPA 1B4QA 2VL3A 1N8JA 3QAGA 2C1YA 1EWXA 4N0VA 1TXXA 3FW2A 1LBKA 1M7TA 3GN3A 5LD0A 4O92A 1TK8B 4I8BA 4EE0A 3P7XA 1SYXA 5AISA 4NXIA 2HLSA 3W8JA 4P3YB 2L59A 4KDUA 4EF0A 4D73B 3Q18A 4PGTA 3M9KA 2R3XA 5JWQB 2IMFA 2YOIA 3KP9A 3F4RA 4Z2TA 2E7PA 4Z2RA 3I9V2 3LFLA 3TKSE 5GZZB 4MA9A 5J9BA 1YEXA 5FT3A 1JLVA 2GZZA 1OC9A 3GRXA 4DSSA 2KLXA 1MTCA 4GXZA 1FAAA 3O76A 1S3DA 2L57A 2CVDA 5IPHA 2VD0A 4IGJA 4NHWA 2YZHA 4MZWA 4ZL7A 4HOJA 5JCUA 3Q74A 1F37A 2JSYA 2HYXA 5D93A 2PPTA 3QR6A 1QGVA 1ERVA 1T3BA 4HZ2A 4GLTA 2EIQA 2H01A 1QXHA 4IVFA 4GSNA 4AF2A 1QQ2A 1SJZA 1SL0B 5IO0A 2BJXA 2WRTA 3R3EA 3GTUB 4PNGA 3EPTA 2LNSA 3PR8A 2HXKA 1WJKA 2REMA 1AC1A 5H5QA 3VWXA 2FHEA 5A4VA 4GCIA 4HJMA 2DJ0A 2JZTA 2Z9SA 1Z9HA 1O6JA 3AY8A 1QMVA 1T7PB 3P2AA 4ML6A 4EC0A 6GSUA 4BWQA 1FW1A 1DE2A 1BYEA 11GSA 3MWHA 2DJKA 1XVWA 3S9FA 1WE0A 2XPDA 2LQQA 1F3AA 1SKRB 4MPFA 4GSTA 3GKMA 4NV2A 1GRXA 4RUVA 1KBNA 3GH6A 3KTBA 2TIRA 2C80A 1NW2A 1Z6NA 2O7KA 5EPFA 2JACA 2OE1A 5KN2A 3C71A 2LKUA 3BBYA 2O87A 3F9UA 4PX1A 4HDEA 1Z7RA 1GSFA 4YH2A 4OD7A 2B6MA 4Z2UA 2JADA 1W89A 2IL3A 2V1MA 10GSA 1T00A 4OMVA 4L8EA 5D9XA 4EKZA 2P31A 1FOHA 3D21A 2VOCA 2R0CA 5ECQB 3D22A 4K7NA 2NVLA 4NHZA 3MNGA 2FA4A 3IC8A 3IR4A 3GNJA 4N10A 3IA1A 1SKWB 3ISOA 1JFUA 1EZKA 1GL8A 5ECRB 3HVXA 2AB6A 4O5RA 4LL1B 4PTSA 3DYRA 2GSRA 4WBJA 1GSSA 3KZQA 4K9ZA 5HFKA 1R5AA 1GULA 5KN3A 3RHBA 4ECIA 2YV9A 5DALB 4PQHA 1RK4A 2LJRA 1G6YA 2P5QA 3C1SA 1G0TA 3R2QA 3DRNA 3LJRA 2VM2A 3IBHA 4XS6A 3TUEA 3UARA 2DJ2A 3LG6A 2DBCA 1XW5A 3KGKA 4BL7A 4MLYA 3CRTA 4Q5RA 1PQNA 4WKWA 1HNAA 1M9AA 1ML6A 5A5KA 2OJLA 3DKSA 5B8BA 4POKA 4BVYA 4PUFC 1HD2A 2LJAA 1ABAA 19GSA 1V57A 1Q98A 5AIXA 2HE3A 2IMKA 4OO4A 3GHAA 1TP9A 2A2RA 2LV3A 2QSIA 3KEBA 3HD5A 2FLSA 3F4SA 2MMZA 1FHEA 1SL1B 2L4CA 1T4ZA 2GZYA 4JR4A 1ERWA 4LLRA 4WR5A 4V2NA 1WWJA 4JBBA 2XBQA 1GSUA 2LQOA 5COHA 5ECPB 1JLWA 3L78A 4MNNA 2X8GA 3SWLA 4I2UA 2A2PA 5CNWA 4TKYA 1I5GA 3IV4A 4JRRA 5E59A 1UA5A 4QL9A 5GSSA 2XC2A 1X5EA 5DAKB 2GSSA 2VCVA 2H0GA 4DSRA 5EVOA 1BQ7A 1ON4A 5ABRA 4IP6A 1TU7A 2I3YA 1BX9A 5ELGA 1GSEA 2M72A 1TK0B 1U6TA 2PBJA 2YN1A 1Z5YE 3RBTA 3DXBA 5B7CA 1PN0A 3PINA 4HU9A 1EGOA 4G0IA 2L6CA 1SKSB 3NOFA 1THXA 3EC3A 4J57E 1ACVA 4EIPA 1WOUA 2R37A 1PL2A 2LTKA 2IIYA 4FYCA 3W6GA 5J5NA 4K2XA 3QAVA 2VLUA 3V1WA 2MBSA 2YJ7A 1WRYA 4H86A 4JZQA 4KSMA 3ZIVA 1V40A 2HT9A 3CTGA 3K8NA 1JZWA 1PGTA 6GSYA 1ST9A 2WS2A 1EGRA 2I9HA 2X49A 4IJ3A 4PUAA 4F0BA 4XCSA 7GSSA 4ZL9A 5BMUA 1YF1A 4ZBDA 3Q19A 4ZB8A 3US3A 5IMCA 3DMLA 5INYA 4MF7A 1NM3A 3ERGA 4WF4A 4MJCA 3O3TA 4KW6A 3UVTA 3J7Yk 1SL2B 2I4AA 2YZUA 5E4WA 4GSSA 3LXZA 4AJ7A 1PKZA 2WJUA 3BCKA 2H74A 3M8NA 5CREA 1O81A 3EU4A 3APQA 2LS5A 2LSTA 4TVEA 1AQXA 3HKRA 5FHIA 1S3CA 3N9JA 3LYPA 4O5UA 3ZRDA 1MDJA 2H1GA 2M46A 3MYDA 3WGDA 4K0GA 2PMTA 4G9HA 3IHGA 1K0AA 4XIHA 2LRCA 3EWLA 4ECJA 3G7YA 4I6XA 2H66A 1TU8A 3UMAA 3GURA 4ID0A 4USSA 1YKAA 4KNDA 2WZ9A 2KOKA 4YQVA 2X64A 2E2GA 2O8VB 5ECMB 3KH7A 2R4VA 2DIYA 5G5EA 4EXJA 5KN0A 1RQMA 2GQLA 1FOVA 4L5OA 4ML1A 2AUVA 4NV5A 1KEBA 3QD9A 2CV4A 4XS4B 5DALA 4TOPA 3EURA 3QAWA 17GSA 4LL4B 4TW5A 5G2ZA 4K2DA 4QQ7A 1V58A 1C72A 4GRFA 1XIYA 3LQ7A 3IHQA 2V6OA 2MMNA 3RDWA 1MDKA 3C1RA 3HZ8A 1USBA 3UBKA 2R0PA 4ZBAA 1ZYNA 1URMA 20GSA 4HS1A 1B9YC 4K8MA 3FK8A 3I6AA 2A4VA 3BOAA 3GX8A 1X5CA 1IYHA 3L4NA 3FEUA 5J3RA 2B3SA 4O32A 2ON5A 4N30A 1FB0A 2F9SA 2HFDA 2ON7A 2DMLA 5L71A 2V2GA 4IW9A 1X9SB 5IMVA 3OR5A 3ME7A 4G2EA 5D9VA 2L5LA 3A5WA 2VCZA 2CT6A 1SYRA 1U88A 1Q4JA 3IC4A 3A3TA 5IO2A 2NPBA 3HVSA 3RPNA 1A2LA 1PMTA 1W4VA 4FYUA 1PA3A 3G7JA 2VCWA 3IK9A 5DCGA 4F03A 4L0UA 3TJBA 4HQZA 3BCIA 5DAKA 3G7IA 2DC5A 3H79A 1GTIA 1HNBA 1X5DA 4X43A 3ZVJD 1A8LA 1TRSA 1GUKA 1AQVA 4K6XA 4MP4A 4BWSA 2OE3A 1NHYA 4O7HA 4ICYA 3VPTA 3QPMA 2HRAA 1AQWA 4TR4A 4CW9A 1E2YA 4MZBA 3H1NA 1YDKA 3NZNA 5B6MA 4BVXA 4QL7A 2FNOA 4O5QA 4X0XA 5ECSA 1N2AA 2DIZA 2K6VA 3UVHA 4ECCA 3L9SA 4ZXGA 1ZL9A 4MF5A 2GQKA 2DKIA 1BJXA 3GA4A 1GLPA 4MCUA 1QFNA 4N0ZA 1SK2A 3A2WA 3JCML 5CYYA 2TRCP 2UZ8A 2DKHA 1HYUA 2YV7A 2YANA 2JZSA 1J9BA 3ME8A 5IMAA 2FGXA 1OKTA 3N5OA 2WB9A 4G0LA 4IS0A 1V98A 3KH9A 3L9VA 1X0RA 1VF4A 4KCEA 2WULA 3DD3A 4EUYA 4TR0A 1PL1A 1TDIA 2C0DA 3KD0A 5A4UA 3E9JB 2LNTA 1OYJA 3IPZA 4YQMA 4YAVA 5IPGA 4Q5QA 1ZYQB 4POBA 2JZRA 2H6YA 4IKHA 4LA1A 3TCOA 6GSSA 3FZ9A 4KE3A 1Y25A 4ZILA 3FY7A 5F06A 5JCGA 3ZVJA 2AYTA 2H72A 4JU5A 3HVVA 1ZOFA 3Q6OA 1QK8A 3C73A 3TJKA 4V2MA 2R5GA 5GAND 1TI1A 3KIJA 4TXOB 1Y6EA 4CHSA 4CDOA 1JHBA 1ERTA 2GSQA 4JEDA 2GVPA 2GT6A 4IQAA 1A2MA 2HZEB 1K3OA 1SD8A 3UL3A 1TK5B 3HXSA 1SJIA 2OACA 3ZITA 2IFQB 16GSA 4PNFA 1OKDA 1TOFA 2H6ZA 5HR2A 2IPAA 4OO5A 1G7EA 3CSIA 3UBLA 2XHFA 3CSHA 2CVBA 5ECHB 2B1LA 3ERWA 1M99A 3A2XA 3IDVA 3DVXA 3FZ4A 1V2AA 2LRNA 3PGTA 2GDRA 3PPUA 1B9XC 4AJ8A 2B1KA 1GH2A 3SBCA 3CBUA 4EDZA 1ERUA 3UAPA 3EVIA 2YP6A 1T4YA 3RAZA 3I69A 3GFKA 3WD6A 3FKFA 4E8HA 2CAIA 1O7UA 3H8QA 1GSDA 3H93A 3A5IA 2YPMA 4HUAA 3IE3A 3GL5A 3QOUA 9GSSA 4ZB6A 4I97A 3A2VA 2V32A 3ZMKA 4NAXA 3HJPA 1B8XA 5DQYA 1UN2A 2ZNMA 3WGEA 5G30A 4JE1A 1WIKA 1XBSA 3P90A 3BD2A 2FWHA 3IK7A 1F2EA 2XBIA 2DSAA 5ID2A 2V6KA 2GLRA 3M9JA 1J0FA 4XS1A 5ECKB 3EU3A 6GSVA 1M2DA 3E0UA 2OKAA 2P0GA 1KTEA 3ERFA 4TR1B 4FIWA 4E8EA 2DLXA 4PQ1A 2PUKC 2H1BA 4XHMA 2LEGA 3P8WA 2OBKA 2C8UA 3KMNA 2AJQB 3VWVA 2F8FA 4HU7A 4D73A 1GWCA 5BRTA 1EEMA 5DQSA 3FHKA 3TJGA 4MH2A 3MDKA 2VM1A 13GSA 1OC9B 4IP1A 2GTUA 1VF2A 2VAFA 2MMOA 2DMMA 3DVWA 4RI7A 1RW1A 4OFTA 3GMFA 5D8IA 3TRPA 1F3BA 3HHVA 2RM6A 2PN8A 4V1Ag 2GGTA 3IRAA 5DBQA 5DJMA 2RUEA 2H0IA 4K1FA 4CY6A 4OWYA 4OFNA 5G1KA 3GTUA 5AN1A 5ECIB 2CZ3A 1YY7A 5ELAA 2GSTA 3WT1A 3LXTA 5HFIA 2VL9A 1SK1A 5IIZA 4PXOA 3BJ5A 5AGYA 1MEKA 3L0HA 2FY6A 3RHCA 1M2AA 2J9HA 2L6DA 3F3RA 4MPGA 3F3QA 6GSXA 2ES7A 3TKPA 5IOXA 3DWVA 1VGLA 5DCHA 2EC4A 2H75A 1J08A 1QUWA 4WXTA 1Z6MA 1DUGA 4GWRA 4XRAA 1NHOA 1YZXA 2F3MA 1A24A 1FVJA 3QMXA 4XRDA 3F4TA 4RQXA 3LGCA 1VF3A 2VCXA 3GYKA 4KDXA 3LEFA 1K0MA 3HZ4A 3WGXA 1CQHA 5KOXA 2L5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G5F A;  3GH9 A;  2DJ1 A;  1LJR A;  2NBS A;  4TXO A;  4G10 A;  1XZO A;  4WF5 A;  2F8A A;  1UC7 A;  3TKS C;  2VLT A;  3RPP A;  3ZIJ A;  4MJA A;  4ILF A;  1A0R P;  1PRX A;  1TRU A;  5CRG A;  2B5X A;  2HZE A;  4KUN A;  2RM5 A;  3FZ5 A;  3EMP A;  1OE7 A;  2BTO T;  4KAE A;  1O73 A;  1WPI A;  2HI7 A;  2YWI A;  4V1A p;  3ZL5 A;  1LU4 A;  2X8H A;  2IFQ A;  1G7O A;  3GL3 A;  3WYW A;  3IAS 2;  5A4W A;  2AV4 A;  5AIV A;  1PX6 A;  2RUF A;  3APS A;  3UEM A;  5DDL A;  2FWG A;  2JU5 A;  5D96 A;  5C00 A;  1TRV A;  1I9D A;  3FRC A;  3I43 A;  6GST A;  3CXG A;  1EP8 A;  1PD2 1;  4OCF A;  5J9C A;  5IM9 A;  2WCI A;  4J56 E;  1GLQ A;  4Z7X A;  1R7H A;  3GKN A;  3UJ1 A;  1K0D A;  2PVO C;  5FWG A;  1GNE A;  3KM6 A;  1E6B A;  3CRU A;  2O89 A;  1UVZ A;  4DSQ A;  4MJE A;  2VCQ A;  2KP1 A;  2VLV A;  3UIW A;  1EOH A;  1TW9 A;  1M2B A;  2GZP A;  3TJF A;  2B5Y A;  5ENU A;  2E0Q A;  2DJJ A;  3IXR A;  2BMX A;  3MSZ A;  1A8Y A;  4J2F A;  1SJ6 A;  4YAP A;  2G2Q A;  1GP1 A;  3APO A;  3HDC A;  2A2S A;  2IMI A;  3PH9 A;  1HQO A;  2GS3 A;  2QGV A;  4BPY A;  2YWM A;  2XPE A;  1K3L A;  2J23 A;  5J4U A;  4MH3 A;  4HZ4 A;  3MAK A;  1M0U A;  2N5F A;  2WDU A;  3VI5 A;  4MJB A;  2H19 A;  1X9W B;  3F6F A;  2FD3 A;  3D6I A;  4FO5 A;  1PKW A;  3FR9 A;  4MMM A;  4TR1 A;  1XCC A;  3D4T A;  2WGR A;  3TB2 A;  4Q5N A;  1BAY A;  3NIV A;  5F0G A;  4IJI A;  1YJ6 A;  3M3M A;  2H0H A;  2VL2 C;  1R5P A;  1XOB A;  5HR3 A;  4I2T A;  3FYG A;  4NPB A;  2O85 A;  2AAW A;  3DGQ A;  1TTZ A;  3HYP A;  2TRX A;  2PU9 C;  1NSW A;  2FWF A;  3F63 A;  4TR3 A;  4RI6 A;  3LYK A;  5DJL A;  4MDC A;  3KMO A;  2FCH A;  1XFL A;  2YJH A;  4F9Z A;  5GAP D;  4TRX A;  5JWO B;  3VLN A;  2E2M A;  14GS A;  4LMW A;  1H75 A;  1K0C A;  1SEN A;  2NDO A;  2EIR A;  4OFM A;  3O6T A;  4K7I A;  4KX4 A;  5HQP A;  2VUP A;  5ECN B;  1XXU A;  1VF1 A;  4POL A;  1GUH A;  3TKS A;  2C4J A;  2C0G A;  2HZF A;  1R4W A;  5KEJ A;  2VO4 A;  2I81 A;  1YEP A;  1YF0 A;  3LSZ A;  2ZCT A;  2FWE A;  2C3Q A;  4IBP A;  3EE2 A;  2CX4 A;  2AHE A;  3VPQ A;  5CRW A;  1JZD A;  3IOS A;  3F0I A;  4TN8 A;  2QKE A;  2K8S A;  4GTU A;  2H6X A;  4PQI A;  4N11 A;  2HSY A;  4MZC A;  4GQF A;  2JL4 A;  4ECB A;  4POM A;  4KSO A;  2YCD A;  2K18 A;  3KJY A;  2CAQ A;  4EO3 A;  4AGS A;  2PVQ A;  3ZML A;  4KB3 A;  2VD1 A;  1TJD A;  2ALB A;  3FR3 A;  3VI7 A;  3L9U A;  8GSS A;  3ZTL A;  3FZA A;  3GV1 A;  1WMJ A;  4OCE A;  1EOG A;  3IAM 2;  4RQR A;  4GF0 A;  1O85 A;  1V9W A;  2B7J A;  3ZFL A;  5IMF A;  3LOR A;  3TGZ A;  4F0C A;  1OAZ A;  1T8E B;  5JWR B;  3WT2 A;  3D4M A;  3EMX A;  3GKK A;  1OVN A;  2NTO A;  4DEJ A;  2R2J A;  4YQU A;  3DEX A;  1U87 A;  3C7M A;  4EL1 A;  4HQS A;  1EV4 A;  1A2J A;  1EV9 A;  4HJ2 A;  6GSW A;  3U5R E;  1GTU A;  2ZUP A;  4I5Q A;  1BED A;  2HNL A;  5CRD A;  1K0O A;  4KCA A;  1YKC A;  3GIX A;  1XW6 A;  22GS A;  3UOM A;  1THO A;  1TRW A;  2MMA A;  1TKD B;  1WP0 A;  5ECL B;  4KA0 A;  5HR0 A;  5B8A A;  1K0N A;  4NMU A;  3TKQ A;  2OA7 A;  5C04 A;  3H4K A;  3CMI A;  1XOA A;  4XS4 A;  4G19 A;  2VL2 A;  3GX0 A;  2HRN A;  3HY2 A;  12GS A;  4WR4 A;  2B5E A;  1K0B A;  2N5B A;  5GST A;  1GSY A;  5IMD A;  1GSQ A;  5D9W A;  2P5R A;  1ZZY A;  3VWW A;  4MF6 A;  1XWG A;  3LWA A;  4WEY A;  4AJ6 A;  1CQG A;  1PN9 A;  4HEA 2;  1F6M C;  3ZRE A;  4KH7 A;  2H30 A;  2GT5 A;  3C8E A;  3QFA C;  2WFC A;  1EEJ A;  5DVB A;  1B48 A;  3E3E A;  2KHP A;  2CVK A;  4ZBB A;  4PUR A;  2IME A;  1B4P A;  2HSH A;  5J41 A;  2EIO A;  4ULX A;  3KCM A;  4XTS A;  1FG4 A;  5IMZ A;  1JZO A;  2IMD A;  4F82 A;  3FR6 A;  4MAB A;  1AXD A;  2K8V A;  3EIN A;  3CYN A;  4HI7 A;  1A23 A;  1MDI A;  3G9B A;  1GUM A;  3ZYW A;  3TKR A;  4JR6 A;  2QC7 A;  5HFG A;  1XWB A;  4KDY A;  2X8C A;  3HCZ A;  4ZL8 A;  1KNG A;  3TRX A;  4K0N A;  2RII A;  1XWC A;  3DIE A;  4IHU A;  4IQ1 A;  5G1L A;  1SD9 A;  4WBR D;  3EYT A;  3TDG A;  1A0F A;  2LRT A;  4ISD A;  3TOT A;  2IN3 A;  1IYI A;  5CAX A;  1XW9 A;  4DSS B;  1S3A A;  1DBY A;  2N5A A;  1ILO A;  1EP7 A;  5HR1 A;  1YQ1 A;  3QCP A;  2H71 A;  1GTB A;  2D2Z A;  2H1A A;  4ACS A;  2PGT A;  4Q5F A;  2VIM A;  1ZCP A;  1BG5 A;  3HA9 A;  2C0F A;  5JCW A;  2OE0 A;  5ECO B;  3VUR A;  1MD3 A;  2CX3 A;  2CZ2 A;  4EDY A;  3F6D A;  1TI3 A;  3D5J A;  3GST A;  1FVK A;  5D73 A;  1M9B A;  3U6V A;  1DE1 A;  4ZIJ A;  3TOU A;  3TJJ A;  2LUS A;  1XPV A;  5F8B A;  2M80 A;  4IEL A;  5F07 A;  1O8X A;  1ZYE A;  1X9M B;  2C0E A;  2H76 A;  1AW9 A;  4F2I A;  1AIU A;  3HJM A;  1ZGN A;  2H70 A;  5F05 A;  3QDN A;  1ZMA A;  4LMV A;  4ZB9 A;  5IQY A;  5CRH A;  1AAZ A;  2CA8 A;  1OC8 A;  2OBI A;  2H8L A;  1OE8 A;  1F9M A;  4IN0 A;  3D0Z A;  1U3A A;  5G31 A;  5CO3 A;  2YWO A;  2C3T A;  1R26 A;  1AUC A;  3ED3 A;  4WET A;  4NWY A;  5EY6 A;  2C3N A;  3ZFB A;  2B7K A;  1GTA A;  2MYG A;  2L4Q A;  4K7O A;  1SU9 A;  1H4O A;  4DVC A;  4L0W A;  3KXO A;  5LNK e;  1G6W A;  2HRF A;  2DJ3 A;  4V2L A;  3J7Y b;  1K3Y A;  2MZC A;  2YWN A;  4FYB A;  5EL8 A;  1PX7 A;  3HJO A;  3KTL A;  3W8S A;  5IOW A;  2GQM A;  2YNX A;  1OC3 A;  3VWU A;  2X99 A;  5D9T A;  1XWK A;  4FH8 A;  5LCZ A;  1DSB A;  3M1G A;  3QFB C;  2PWJ A;  3GKX A;  3CTF A;  1O8W A;  1XVQ A;  3VK9 A;  2KP2 A;  5H5R A;  2FUG 2;  2VCT A;  2KUC A;  3TRQ A;  2F51 A;  3VFI A;  1FB6 A;  1MD4 A;  4BA7 A;  1SK0 A;  2R6K A;  2H1D A;  2V41 A;  2MBT A;  2IJY A;  4MK3 A;  5H5S A;  1HNC A;  5CP1 A;  2CQ9 A;  18GS A;  3GUS A;  1Z7P A;  2JSZ A;  3CSJ A;  2LJK A;  2K9F A;  2H73 A;  4TXV A;  3F8U A;  3KP8 A;  5KN1 A;  1T1V A;  3ZZX A;  1U3I A;  2G0F A;  4X1U A;  2PER A;  3GSS A;  1XWA A;  2IWT A;  2I1U A;  1PSQ A;  2FA8 A;  1VRS D;  1Z3E A;  4KGI A;  4EVM A;  5B6N A;  2RLI A;  4L5L A;  1FO5 A;  5ID2 B;  1JZR A;  4GQC A;  1GNW A;  3M0F A;  2OAD A;  3ZLP A;  1B4Q A;  2VL3 A;  1N8J A;  3QAG A;  2C1Y A;  1EWX A;  4N0V A;  1TXX A;  3FW2 A;  1LBK A;  1M7T A;  3GN3 A;  5LD0 A;  4O92 A;  1TK8 B;  4I8B A;  4EE0 A;  3P7X A;  1SYX A;  5AIS A;  4NXI A;  2HLS A;  3W8J A;  4P3Y B;  2L59 A;  4KDU A;  4EF0 A;  4D73 B;  3Q18 A;  4PGT A;  3M9K A;  2R3X A;  5JWQ B;  2IMF A;  2YOI A;  3KP9 A;  3F4R A;  2E7P A;  3I9V 2;  3LFL A;  3TKS E;  5GZZ B;  4MA9 A;  5J9B A;  1YEX A;  5FT3 A;  1JLV A;  2GZZ A;  1OC9 A;  3GRX A;  4DSS A;  2KLX A;  1MTC A;  4GXZ A;  1FAA A;  3O76 A;  1S3D A;  2L57 A;  2CVD A;  5IPH A;  2VD0 A;  4IGJ A;  4NHW A;  2YZH A;  4MZW A;  4ZL7 A;  4HOJ A;  5JCU A;  3Q74 A;  1F37 A;  2JSY A;  2HYX A;  5D93 A;  2PPT A;  3QR6 A;  1QGV A;  1ERV A;  1T3B A;  4HZ2 A;  4GLT A;  2EIQ A;  2H01 A;  1QXH A;  4IVF A;  4GSN A;  4AF2 A;  1QQ2 A;  1SJZ A;  1SL0 B;  5IO0 A;  2BJX A;  2WRT A;  3GTU B;  4PNG A;  2LNS A;  3PR8 A;  2HXK A;  1WJK A;  2REM A;  1AC1 A;  5H5Q A;  3VWX A;  2FHE A;  5A4V A;  4GCI A;  4HJM A;  2DJ0 A;  2JZT A;  2Z9S A;  1Z9H A;  1O6J A;  3AY8 A;  1QMV A;  1T7P B;  3P2A A;  4ML6 A;  4EC0 A;  6GSU A;  4BWQ A;  1FW1 A;  1DE2 A;  1BYE A;  11GS A;  3MWH A;  2DJK A;  1XVW A;  3S9F A;  1WE0 A;  2XPD A;  2LQQ A;  1F3A A;  1SKR B;  4MPF A;  4GST A;  3GKM A;  4NV2 A;  1GRX A;  4RUV A;  1KBN A;  3GH6 A;  3KTB A;  2TIR A;  2C80 A;  1NW2 A;  1Z6N A;  2O7K A;  5EPF A;  2JAC A;  2OE1 A;  5KN2 A;  3C71 A;  2LKU A;  3BBY A;  2O87 A;  3F9U A;  4PX1 A;  4HDE A;  1Z7R A;  1GSF A;  4YH2 A;  4OD7 A;  2B6M A;  2JAD A;  1W89 A;  2IL3 A;  2V1M A;  10GS A;  1T00 A;  4OMV A;  4L8E A;  5D9X A;  4EKZ A;  2P31 A;  3D21 A;  2VOC A;  5ECQ B;  3D22 A;  4K7N A;  2NVL A;  4NHZ A;  3MNG A;  2FA4 A;  3IR4 A;  3GNJ A;  4N10 A;  3IA1 A;  1SKW B;  3ISO A;  1JFU A;  1EZK A;  1GL8 A;  5ECR B;  3HVX A;  2AB6 A;  4O5R A;  4LL1 B;  3DYR A;  2GSR A;  4WBJ A;  1GSS A;  3KZQ A;  4K9Z A;  5HFK A;  1R5A A;  1GUL A;  5KN3 A;  3RHB A;  4ECI A;  2YV9 A;  5DAL B;  4PQH A;  1RK4 A;  2LJR A;  1G6Y A;  2P5Q A;  3C1S A;  1G0T A;  3R2Q A;  3DRN A;  3LJR A;  2VM2 A;  3IBH A;  4XS6 A;  3TUE A;  3UAR A;  2DJ2 A;  3LG6 A;  2DBC A;  1XW5 A;  3KGK A;  4BL7 A;  4MLY A;  3CRT A;  4Q5R A;  1PQN A;  4WKW A;  1HNA A;  1M9A A;  1ML6 A;  5A5K A;  2OJL A;  3DKS A;  5B8B A;  4POK A;  4BVY A;  4PUF C;  1HD2 A;  2LJA A;  1ABA A;  19GS A;  1V57 A;  1Q98 A;  5AIX A;  2HE3 A;  2IMK A;  4OO4 A;  3GHA A;  1TP9 A;  2A2R A;  2LV3 A;  2QSI A;  3KEB A;  3HD5 A;  2FLS A;  3F4S A;  2MMZ A;  1FHE A;  1SL1 B;  2L4C A;  1T4Z A;  2GZY A;  4JR4 A;  1ERW A;  4LLR A;  4WR5 A;  4V2N A;  1WWJ A;  4JBB A;  2XBQ A;  1GSU A;  2LQO A;  5COH A;  5ECP B;  1JLW A;  3L78 A;  2X8G A;  3SWL A;  4I2U A;  5CNW A;  4TKY A;  1I5G A;  3IV4 A;  4JRR A;  5E59 A;  1UA5 A;  4QL9 A;  5GSS A;  2XC2 A;  1X5E A;  5DAK B;  2GSS A;  2VCV A;  2H0G A;  4DSR A;  5EVO A;  1BQ7 A;  1ON4 A;  5ABR A;  4IP6 A;  1TU7 A;  2I3Y A;  1BX9 A;  5ELG A;  1GSE A;  2M72 A;  1TK0 B;  1U6T A;  2PBJ A;  2YN1 A;  1Z5Y E;  3RBT A;  3DXB A;  5B7C A;  4HU9 A;  3PIN A;  1EGO A;  2L6C A;  1SKS B;  3NOF A;  1THX A;  3EC3 A;  4J57 E;  1ACV A;  1WOU A;  2R37 A;  1PL2 A;  2LTK A;  2IIY A;  4FYC A;  3W6G A;  5J5N A;  3QAV A;  2VLU A;  3V1W A;  2MBS A;  2YJ7 A;  1WRY A;  4H86 A;  4JZQ A;  4KSM A;  3ZIV A;  1V40 A;  2HT9 A;  3CTG A;  3K8N A;  1JZW A;  1PGT A;  6GSY A;  1ST9 A;  2WS2 A;  1EGR A;  2I9H A;  4IJ3 A;  4PUA A;  4F0B A;  4XCS A;  7GSS A;  4ZL9 A;  1YF1 A;  4ZBD A;  3Q19 A;  4ZB8 A;  3US3 A;  5IMC A;  3DML A;  5INY A;  4MF7 A;  1NM3 A;  3ERG A;  4WF4 A;  4MJC A;  3O3T A;  4KW6 A;  3UVT A;  3J7Y k;  1SL2 B;  2I4A A;  2YZU A;  5E4W A;  4GSS A;  3LXZ A;  4AJ7 A;  1PKZ A;  2WJU A;  3BCK A;  2H74 A;  3M8N A;  5CRE A;  1O81 A;  3EU4 A;  3APQ A;  2LS5 A;  2LST A;  4TVE A;  1AQX A;  3HKR A;  5FHI A;  1S3C A;  3N9J A;  3LYP A;  3ZRD A;  1MDJ A;  2H1G A;  2M46 A;  3WGD A;  4K0G A;  2PMT A;  4G9H A;  1K0A A;  4XIH A;  2LRC A;  3EWL A;  4ECJ A;  3G7Y A;  4I6X A;  2H66 A;  1TU8 A;  3UMA A;  3GUR A;  4ID0 A;  1YKA A;  4KND A;  2WZ9 A;  2KOK A;  4YQV A;  2X64 A;  2E2G A;  2O8V B;  5ECM B;  3KH7 A;  2R4V A;  2DIY A;  5G5E A;  4EXJ A;  5KN0 A;  1RQM A;  2GQL A;  1FOV A;  4L5O A;  4ML1 A;  2AUV A;  4NV5 A;  1KEB A;  3QD9 A;  2CV4 A;  4XS4 B;  5DAL A;  4TOP A;  3EUR A;  3QAW A;  17GS A;  4LL4 B;  4TW5 A;  5G2Z A;  4K2D A;  4QQ7 A;  1V58 A;  1C72 A;  4GRF A;  1XIY A;  3LQ7 A;  3IHQ A;  2V6O A;  2MMN A;  3RDW A;  1MDK A;  3C1R A;  3HZ8 A;  1USB A;  3UBK A;  4ZBA A;  1URM A;  20GS A;  4HS1 A;  1B9Y C;  4K8M A;  3FK8 A;  3I6A A;  2A4V A;  3BOA A;  3GX8 A;  1X5C A;  1IYH A;  3L4N A;  3FEU A;  5J3R A;  2B3S A;  4O32 A;  2ON5 A;  4N30 A;  1FB0 A;  2F9S A;  2HFD A;  2ON7 A;  2DML A;  5L71 A;  2V2G A;  4IW9 A;  1X9S B;  5IMV A;  3OR5 A;  3ME7 A;  4G2E A;  5D9V A;  2L5L A;  3A5W A;  2VCZ A;  2CT6 A;  1SYR A;  1U88 A;  1Q4J A;  3IC4 A;  3A3T A;  5IO2 A;  2NPB A;  3HVS A;  3RPN A;  1A2L A;  1PMT A;  1W4V A;  4FYU A;  1PA3 A;  3G7J A;  2VCW A;  3IK9 A;  5DCG A;  4F03 A;  4L0U A;  3TJB A;  4HQZ A;  3BCI A;  5DAK A;  3G7I A;  2DC5 A;  3H79 A;  1GTI A;  1HNB A;  1X5D A;  4X43 A;  3ZVJ D;  1A8L A;  1TRS A;  1GUK A;  1AQV A;  4K6X A;  4MP4 A;  4BWS A;  2OE3 A;  1NHY A;  4O7H A;  3VPT A;  3QPM A;  1AQW A;  4TR4 A;  4CW9 A;  1E2Y A;  4MZB A;  3H1N A;  1YDK A;  3NZN A;  5B6M A;  4BVX A;  4QL7 A;  2FNO A;  5ECS A;  4X0X A;  1N2A A;  2DIZ A;  2K6V A;  3UVH A;  4ECC A;  3L9S A;  4ZXG A;  1ZL9 A;  4MF5 A;  2GQK A;  1BJX A;  3GA4 A;  1GLP A;  4MCU A;  1QFN A;  4N0Z A;  1SK2 A;  3A2W A;  3JCM L;  5CYY A;  2TRC P;  2YV7 A;  1HYU A;  2YAN A;  2JZS A;  1J9B A;  3ME8 A;  5IMA A;  2FGX A;  1OKT A;  3N5O A;  2WB9 A;  4IS0 A;  1V98 A;  3KH9 A;  3L9V A;  1X0R A;  1VF4 A;  4KCE A;  2WUL A;  3DD3 A;  4EUY A;  4TR0 A;  1PL1 A;  1TDI A;  2C0D A;  3KD0 A;  5A4U A;  3E9J B;  2LNT A;  1OYJ A;  3IPZ A;  4YQM A;  4YAV A;  5IPG A;  4Q5Q A;  1ZYQ B;  4POB A;  2JZR A;  2H6Y A;  4IKH A;  4LA1 A;  3TCO A;  6GSS A;  3FZ9 A;  4KE3 A;  1Y25 A;  4ZIL A;  3FY7 A;  5F06 A;  5JCG A;  3ZVJ A;  2AYT A;  2H72 A;  4JU5 A;  3HVV A;  1ZOF A;  3Q6O A;  1QK8 A;  3C73 A;  3TJK A;  4V2M A;  2R5G A;  5GAN D;  1TI1 A;  3KIJ A;  4TXO B;  1Y6E A;  4CHS A;  4CDO A;  1JHB A;  1ERT A;  2GSQ A;  4JED A;  2GVP A;  2GT6 A;  4IQA A;  1A2M A;  2HZE B;  1K3O A;  1SD8 A;  3UL3 A;  1TK5 B;  3HXS A;  1SJI A;  2OAC A;  3ZIT A;  2IFQ B;  16GS A;  4PNF A;  1OKD A;  1TOF A;  2H6Z A;  5HR2 A;  2IPA A;  4OO5 A;  1G7E A;  3CSI A;  3UBL A;  2XHF A;  3CSH A;  2CVB A;  5ECH B;  2B1L A;  3ERW A;  1M99 A;  3A2X A;  3IDV A;  3DVX A;  3FZ4 A;  1V2A A;  2LRN A;  3PGT A;  2GDR A;  1B9X C;  4AJ8 A;  2B1K A;  1GH2 A;  3SBC A;  3CBU A;  4EDZ A;  1ERU A;  3UAP A;  3EVI A;  2YP6 A;  1T4Y A;  3RAZ A;  3I69 A;  3GFK A;  3WD6 A;  3FKF A;  4E8H A;  2CAI A;  1O7U A;  3H8Q A;  1GSD A;  3H93 A;  2YPM A;  4HUA A;  3IE3 A;  3GL5 A;  3QOU A;  9GSS A;  4ZB6 A;  4I97 A;  3A2V A;  2V32 A;  3ZMK A;  4NAX A;  3HJP A;  1B8X A;  5DQY A;  1UN2 A;  2ZNM A;  3WGE A;  5G30 A;  4JE1 A;  1WIK A;  1XBS A;  3P90 A;  3BD2 A;  2FWH A;  3IK7 A;  1F2E A;  2XBI A;  2DSA A;  5ID2 A;  2V6K A;  2GLR A;  3M9J A;  1J0F A;  4XS1 A;  5ECK B;  3EU3 A;  6GSV A;  1M2D A;  3E0U A;  2OKA A;  2P0G A;  1KTE A;  3ERF A;  4TR1 B;  4FIW A;  4E8E A;  2DLX A;  4PQ1 A;  2PUK C;  2H1B A;  4XHM A;  2LEG A;  3P8W A;  2OBK A;  2C8U A;  3KMN A;  2AJQ B;  3VWV A;  2F8F A;  4HU7 A;  4D73 A;  1GWC A;  1EEM A;  5DQS A;  3FHK A;  3TJG A;  4MH2 A;  3MDK A;  2VM1 A;  13GS A;  1OC9 B;  4IP1 A;  2GTU A;  1VF2 A;  2VAF A;  2MMO A;  2DMM A;  3DVW A;  4RI7 A;  1RW1 A;  4OFT A;  3GMF A;  5D8I A;  3TRP A;  1F3B A;  3HHV A;  2RM6 A;  2PN8 A;  4V1A g;  2GGT A;  3IRA A;  5DBQ A;  5DJM A;  2RUE A;  2H0I A;  4K1F A;  4OWY A;  4OFN A;  5G1K A;  3GTU A;  5AN1 A;  5ECI B;  2CZ3 A;  1YY7 A;  5ELA A;  2GST A;  3WT1 A;  3LXT A;  5HFI A;  2VL9 A;  1SK1 A;  5IIZ A;  4PXO A;  3BJ5 A;  5AGY A;  1MEK A;  3L0H A;  2FY6 A;  3RHC A;  1M2A A;  2J9H A;  2L6D A;  3F3R A;  4MPG A;  3F3Q A;  6GSX A;  2ES7 A;  3TKP A;  5IOX A;  3DWV A;  1VGL A;  5DCH A;  2EC4 A;  2H75 A;  1J08 A;  1QUW A;  4WXT A;  1Z6M A;  1DUG A;  4GWR A;  4XRA A;  1NHO A;  1YZX A;  2F3M A;  1A24 A;  1FVJ A;  3QMX A;  4XRD A;  3F4T A;  4RQX A;  3LGC A;  1VF3 A;  2VCX A;  3GYK A;  4KDX A;  3LEF A;  1K0M A;  3HZ4 A;  3WGX A;  1CQH A;  2L5O A; 
#chains in the Genus database with same CATH topology
 5G5F A;  3GH9 A;  2DJ1 A;  2QA2 A;  1LJR A;  2NBS A;  4TXO A;  4G10 A;  1XZO A;  4WF5 A;  2F8A A;  1UC7 A;  3TKS C;  2VLT A;  3RPP A;  3ZIJ A;  4MJA A;  4ILF A;  1A0R P;  1PRX A;  1TRU A;  5CRG A;  2B5X A;  2HZE A;  4KUN A;  2RM5 A;  3FZ5 A;  3EMP A;  1OE7 A;  2BTO T;  4KAE A;  1O73 A;  1WPI A;  2HI7 A;  2YWI A;  4V1A p;  3ZL5 A;  1LU4 A;  2X8H A;  2IFQ A;  1G7O A;  3GL3 A;  3WYW A;  3IAS 2;  5A4W A;  2AV4 A;  5AIV A;  1PX6 A;  2RUF A;  3APS A;  3UEM A;  5DDL A;  2FWG A;  2JU5 A;  5D96 A;  5C00 A;  1TRV A;  1I9D A;  3FRC A;  3I43 A;  6GST A;  3CXG A;  1EP8 A;  1PD2 1;  4OCF A;  5J9C A;  5IM9 A;  2WCI A;  4J56 E;  1GLQ A;  4Z7X A;  1R7H A;  3GKN A;  3UJ1 A;  1K0D A;  2PVO C;  5FWG A;  1GNE A;  3KM6 A;  1E6B A;  3CRU A;  2O89 A;  1UVZ A;  4DSQ A;  4MJE A;  2VCQ A;  2KP1 A;  2VLV A;  3UIW A;  1EOH A;  1TW9 A;  1M2B A;  2GZP A;  3TJF A;  2B5Y A;  5ENU A;  4BVY B;  2E0Q A;  2DJJ A;  3IXR A;  2BMX A;  3MSZ A;  1A8Y A;  4J2F A;  1SJ6 A;  4YAP A;  2G2Q A;  1GP1 A;  3APO A;  3HDC A;  2A2S A;  2IMI A;  3PH9 A;  1HQO A;  2GS3 A;  2QGV A;  4BPY A;  2YWM A;  2XPE A;  3HVN A;  1K3L A;  2X4A A;  2J23 A;  5J4U A;  4MH3 A;  4HZ4 A;  3MAK A;  1M0U A;  2N5F A;  2WDU A;  3VI5 A;  4MJB A;  2H19 A;  1X9W B;  3F6F A;  2FD3 A;  3D6I A;  4FO5 A;  1PKW A;  3FR9 A;  4MMM A;  4TR1 A;  1XCC A;  3D4T A;  2WGR A;  3TB2 A;  4Q5N A;  1BAY A;  3NIV A;  5F0G A;  4IJI A;  1YJ6 A;  3M3M A;  2H0H A;  2VL2 C;  1R5P A;  1XOB A;  5HR3 A;  4I2T A;  3FYG A;  4NPB A;  2O85 A;  2AAW A;  3DGQ A;  1TTZ A;  3HYP A;  2TRX A;  2PU9 C;  1NSW A;  2FWF A;  3F63 A;  4TR3 A;  4RI6 A;  3LYK A;  5DJL A;  4MDC A;  3KMO A;  2FCH A;  1XFL A;  2YJH A;  4F9Z A;  5GAP D;  4TRX A;  5JWO B;  3VLN A;  2E2M A;  14GS A;  4LMW A;  1H75 A;  1K0C A;  1SEN A;  2NDO A;  2EIR A;  4OFM A;  3O6T A;  4K7I A;  4KX4 A;  5HQP A;  3FMW A;  2VUP A;  5ECN B;  1XXU A;  1VF1 A;  4POL A;  1GUH A;  3TKS A;  2C4J A;  2R0G A;  2C0G A;  2HRK A;  2HZF A;  1R4W A;  5KEJ A;  2VO4 A;  2I81 A;  1YEP A;  1YF0 A;  3LSZ A;  2ZCT A;  2FWE A;  2C3Q A;  4IBP A;  3EE2 A;  2CX4 A;  2AHE A;  3VPQ A;  5CRW A;  4EIQ A;  1JZD A;  3IOS A;  3F0I A;  4TN8 A;  2QKE A;  2K8S A;  4GTU A;  4G0K A;  2H6X A;  4PQI A;  4N11 A;  2HSY A;  4MZC A;  4GQF A;  2JL4 A;  4ECB A;  4POM A;  4KSO A;  2YCD A;  2K18 A;  3KJY A;  2CAQ A;  4EO3 A;  4AGS A;  2PVQ A;  3ZML A;  4KB3 A;  2VD1 A;  1TJD A;  2ALB A;  3FR3 A;  3VI7 A;  3L9U A;  8GSS A;  2HSM A;  3ZTL A;  3FZA A;  3GV1 A;  1WMJ A;  4OCE A;  1EOG A;  3IAM 2;  4RQR A;  4GF0 A;  1O85 A;  1V9W A;  2B7J A;  3ZFL A;  5IMF A;  3LOR A;  3TGZ A;  4F0C A;  1OAZ A;  1T8E B;  5JWR B;  3WT2 A;  4YKF A;  3D4M A;  3EMX A;  3GKK A;  1OVN A;  2NTO A;  4DEJ A;  2R2J A;  4YQU A;  3DEX A;  1U87 A;  3C7M A;  4EL1 A;  4HQS A;  1EV4 A;  1A2J A;  1EV9 A;  4HJ2 A;  6GSW A;  3U5R E;  1GTU A;  2ZUP A;  4I5Q A;  1BED A;  2HNL A;  5CRD A;  1K0O A;  4KCA A;  1YKC A;  3GIX A;  1XW6 A;  22GS A;  3UOM A;  1THO A;  1TRW A;  2MMA A;  1TKD B;  1WP0 A;  5ECL B;  4KA0 A;  5HR0 A;  5B8A A;  1K0N A;  4NMU A;  3TKQ A;  2OA7 A;  5C04 A;  3H4K A;  3CMI A;  1XOA A;  4XS4 A;  4G19 A;  2VL2 A;  3GX0 A;  2HRN A;  3HY2 A;  12GS A;  4WR4 A;  2B5E A;  1K0B A;  2N5B A;  5GST A;  1GSY A;  5IMD A;  1GSQ A;  5D9W A;  2P5R A;  4YKG A;  3MIX A;  1ZZY A;  3VWW A;  4MF6 A;  1XWG A;  3LWA A;  4WEY A;  1S3R A;  4AJ6 A;  1CQG A;  1PN9 A;  4HEA 2;  1F6M C;  3ZRE A;  4KH7 A;  4FQU A;  2H30 A;  2GT5 A;  3C8E A;  3LW9 A;  3QFA C;  2WFC A;  1EEJ A;  5DVB A;  1B48 A;  3E3E A;  2KHP A;  2CVK A;  4ZBB A;  4PUR A;  2IME A;  1B4P A;  2HSH A;  5J41 A;  2EIO A;  4ULX A;  3KCM A;  4XTS A;  1FG4 A;  5IMZ A;  1JZO A;  2IMD A;  4F82 A;  3FR6 A;  4MAB A;  1AXD A;  2K8V A;  3EIN A;  3CYN A;  4HI7 A;  1A23 A;  1MDI A;  3G9B A;  1GUM A;  3ZYW A;  3TKR A;  4JR6 A;  2QC7 A;  5HFG A;  1XWB A;  4KDY A;  2X8C A;  3HCZ A;  4ZL8 A;  1KNG A;  3TRX A;  4K0N A;  2RII A;  1XWC A;  3DIE A;  4IHU A;  4IQ1 A;  5G1L A;  1SD9 A;  4WBR D;  3EYT A;  3TDG A;  1A0F A;  4X4J A;  2LRT A;  4ISD A;  3TOT A;  2IN3 A;  1IYI A;  5CAX A;  1XW9 A;  4DSS B;  1S3A A;  1DBY A;  2N5A A;  1ILO A;  1EP7 A;  5HR1 A;  1YQ1 A;  3QCP A;  2H71 A;  1GTB A;  2D2Z A;  2H1A A;  4ACS A;  2PGT A;  4Q5F A;  1XG8 A;  2VIM A;  4BVX B;  1ZCP A;  1BG5 A;  4K5S A;  3HA9 A;  2C0F A;  5JCW A;  2OE0 A;  5ECO B;  3VUR A;  1MD3 A;  2CX3 A;  2CZ2 A;  4EDY A;  2A4H A;  3F6D A;  1TI3 A;  3D5J A;  3GST A;  1FVK A;  5D73 A;  1M9B A;  3U6V A;  1DE1 A;  4ZIJ A;  4A5P A;  3TOU A;  3TJJ A;  4KF9 A;  2LUS A;  1XPV A;  5F8B A;  2M80 A;  4IEL A;  5F07 A;  1O8X A;  1ZYE A;  1X9M B;  2C0E A;  2H76 A;  1AW9 A;  4F2I A;  1AIU A;  3HJM A;  1ZGN A;  2H70 A;  5F05 A;  3QDN A;  1ZMA A;  4LMV A;  4ZB9 A;  5IQY A;  5CRH A;  1AAZ A;  2CA8 A;  1OC8 A;  2OBI A;  2H8L A;  1OE8 A;  1F9M A;  4IN0 A;  3D0Z A;  1U3A A;  5G31 A;  5CO3 A;  2YWO A;  5KOW A;  2C3T A;  1R26 A;  1AUC A;  3ED3 A;  4WET A;  4NWY A;  5EY6 A;  2C3N A;  3ZFB A;  2B7K A;  1GTA A;  2MYG A;  2L4Q A;  4K7O A;  1SU9 A;  1H4O A;  4DVC A;  4L0W A;  3KXO A;  5LNK e;  1G6W A;  2HRF A;  2DJ3 A;  4V2L A;  3J7Y b;  1K3Y A;  2MZC A;  2YWN A;  4FYB A;  1ZYP A;  5EL8 A;  1PX7 A;  3HJO A;  3KTL A;  3W8S A;  5IOW A;  2GQM A;  2YNX A;  1OC3 A;  1M3I A;  3VWU A;  2X99 A;  5D9T A;  1XWK A;  4FH8 A;  2QA1 A;  5LCZ A;  1DSB A;  3M1G A;  3QFB C;  2PWJ A;  3GKX A;  3CTF A;  1O8W A;  1XVQ A;  3VK9 A;  2KP2 A;  5H5R A;  2FUG 2;  2VCT A;  2KUC A;  4BL7 B;  3TRQ A;  2F51 A;  3VFI A;  1FB6 A;  1MD4 A;  4BA7 A;  1PFO A;  1SK0 A;  2R6K A;  2H1D A;  2V41 A;  2MBT A;  2IJY A;  4MK3 A;  5H5S A;  1HNC A;  5CP1 A;  2CQ9 A;  18GS A;  3GUS A;  1Z7P A;  2JSZ A;  3CSJ A;  2LJK A;  2K9F A;  2H73 A;  4TXV A;  3F8U A;  3KP8 A;  5KN1 A;  1T1V A;  3ZZX A;  1U3I A;  2G0F A;  4X1U A;  2PER A;  3GSS A;  1XWA A;  2IWT A;  4CY8 A;  4K5R A;  2I1U A;  1PSQ A;  2FA8 A;  1VRS D;  1Z3E A;  4KGI A;  4EVM A;  5B6N A;  2RLI A;  4L5L A;  1FO5 A;  5ID2 B;  1JZR A;  4GQC A;  1GNW A;  3M0F A;  2OAD A;  3ZLP A;  1B4Q A;  2VL3 A;  1N8J A;  3QAG A;  2C1Y A;  1EWX A;  4N0V A;  1TXX A;  3FW2 A;  1LBK A;  1M7T A;  3GN3 A;  5LD0 A;  4O92 A;  1TK8 B;  4I8B A;  4EE0 A;  3P7X A;  1SYX A;  5AIS A;  4NXI A;  2HLS A;  3W8J A;  4P3Y B;  2L59 A;  4KDU A;  4EF0 A;  4D73 B;  3Q18 A;  4PGT A;  3M9K A;  2R3X A;  5JWQ B;  2IMF A;  2YOI A;  3KP9 A;  3F4R A;  4Z2T A;  2E7P A;  4Z2R A;  3I9V 2;  3LFL A;  3TKS E;  5GZZ B;  4MA9 A;  5J9B A;  1YEX A;  5FT3 A;  1JLV A;  2GZZ A;  1OC9 A;  3GRX A;  4DSS A;  2KLX A;  1MTC A;  4GXZ A;  1FAA A;  3O76 A;  1S3D A;  2L57 A;  2CVD A;  5IPH A;  2VD0 A;  4IGJ A;  4NHW A;  2YZH A;  4MZW A;  4ZL7 A;  4HOJ A;  5JCU A;  3Q74 A;  1F37 A;  2JSY A;  2HYX A;  5D93 A;  2PPT A;  3QR6 A;  1QGV A;  1ERV A;  1T3B A;  4HZ2 A;  4GLT A;  2EIQ A;  2H01 A;  1QXH A;  4IVF A;  4GSN A;  4AF2 A;  1QQ2 A;  1SJZ A;  1SL0 B;  5IO0 A;  2BJX A;  2WRT A;  3R3E A;  3GTU B;  4PNG A;  3EPT A;  2LNS A;  3PR8 A;  2HXK A;  1WJK A;  2REM A;  1AC1 A;  5H5Q A;  3VWX A;  2FHE A;  5A4V A;  4GCI A;  4HJM A;  2DJ0 A;  2JZT A;  2Z9S A;  1Z9H A;  1O6J A;  3AY8 A;  1QMV A;  1T7P B;  3P2A A;  4ML6 A;  4EC0 A;  6GSU A;  4BWQ A;  1FW1 A;  1DE2 A;  1BYE A;  11GS A;  3MWH A;  2DJK A;  1XVW A;  3S9F A;  1WE0 A;  2XPD A;  2LQQ A;  1F3A A;  1SKR B;  4MPF A;  4GST A;  3GKM A;  4NV2 A;  1GRX A;  4RUV A;  1KBN A;  3GH6 A;  3KTB A;  2TIR A;  2C80 A;  1NW2 A;  1Z6N A;  2O7K A;  5EPF A;  2JAC A;  2OE1 A;  5KN2 A;  3C71 A;  2LKU A;  3BBY A;  2O87 A;  3F9U A;  4PX1 A;  4HDE A;  1Z7R A;  1GSF A;  4YH2 A;  4OD7 A;  2B6M A;  4Z2U A;  2JAD A;  1W89 A;  2IL3 A;  2V1M A;  10GS A;  1T00 A;  4OMV A;  4L8E A;  5D9X A;  4EKZ A;  2P31 A;  1FOH A;  3D21 A;  2VOC A;  2R0C A;  5ECQ B;  3D22 A;  4K7N A;  2NVL A;  4NHZ A;  3MNG A;  2FA4 A;  3IC8 A;  3IR4 A;  3GNJ A;  4N10 A;  3IA1 A;  1SKW B;  3ISO A;  1JFU A;  1EZK A;  1GL8 A;  4HSC X;  5ECR B;  3HVX A;  2AB6 A;  4O5R A;  4LL1 B;  4PTS A;  3DYR A;  2GSR A;  4WBJ A;  1GSS A;  3KZQ A;  4K9Z A;  5HFK A;  1R5A A;  1GUL A;  5KN3 A;  3RHB A;  4ECI A;  2YV9 A;  5DAL B;  4PQH A;  1RK4 A;  2LJR A;  1G6Y A;  2P5Q A;  3C1S A;  1G0T A;  3R2Q A;  3DRN A;  3LJR A;  2VM2 A;  3IBH A;  4XS6 A;  3TUE A;  3UAR A;  2DJ2 A;  3LG6 A;  2DBC A;  1XW5 A;  3KGK A;  4BL7 A;  4MLY A;  3CRT A;  4Q5R A;  1PQN A;  4WKW A;  1HNA A;  1M9A A;  1ML6 A;  5A5K A;  2OJL A;  3DKS A;  5B8B A;  4POK A;  4BVY A;  4PUF C;  1HD2 A;  2LJA A;  1ABA A;  19GS A;  1V57 A;  1Q98 A;  5AIX A;  2HE3 A;  2IMK A;  4OO4 A;  3GHA A;  1TP9 A;  2A2R A;  2LV3 A;  2QSI A;  3KEB A;  3HD5 A;  2FLS A;  3F4S A;  2MMZ A;  1FHE A;  1SL1 B;  2L4C A;  1T4Z A;  2GZY A;  4JR4 A;  1ERW A;  4LLR A;  4WR5 A;  4V2N A;  1WWJ A;  4JBB A;  2XBQ A;  1GSU A;  2LQO A;  5COH A;  5ECP B;  1JLW A;  3L78 A;  4MNN A;  2X8G A;  3SWL A;  4I2U A;  2A2P A;  5CNW A;  4TKY A;  1I5G A;  3IV4 A;  4JRR A;  5E59 A;  1UA5 A;  4QL9 A;  5GSS A;  2XC2 A;  1X5E A;  5DAK B;  2GSS A;  2VCV A;  2H0G A;  4DSR A;  5EVO A;  1BQ7 A;  1ON4 A;  5ABR A;  4IP6 A;  1TU7 A;  2I3Y A;  1BX9 A;  5ELG A;  1GSE A;  2M72 A;  1TK0 B;  1U6T A;  2PBJ A;  2YN1 A;  1Z5Y E;  3RBT A;  3DXB A;  5B7C A;  1PN0 A;  3PIN A;  4HU9 A;  1EGO A;  4G0I A;  2L6C A;  1SKS B;  3NOF A;  1THX A;  3EC3 A;  4J57 E;  1ACV A;  4EIP A;  1WOU A;  2R37 A;  1PL2 A;  2LTK A;  2IIY A;  4FYC A;  3W6G A;  5J5N A;  4K2X A;  3QAV A;  2VLU A;  3V1W A;  2MBS A;  2YJ7 A;  1WRY A;  4H86 A;  4JZQ A;  4KSM A;  3ZIV A;  1V40 A;  2HT9 A;  3CTG A;  3K8N A;  1JZW A;  1PGT A;  6GSY A;  1ST9 A;  2WS2 A;  1EGR A;  2I9H A;  2X49 A;  4IJ3 A;  4PUA A;  4F0B A;  4XCS A;  7GSS A;  4ZL9 A;  5BMU A;  1YF1 A;  4ZBD A;  3Q19 A;  4ZB8 A;  3US3 A;  5IMC A;  3DML A;  5INY A;  4MF7 A;  1NM3 A;  3ERG A;  4WF4 A;  4MJC A;  3O3T A;  4KW6 A;  3UVT A;  3J7Y k;  1SL2 B;  2I4A A;  2YZU A;  5E4W A;  4GSS A;  3LXZ A;  4AJ7 A;  1PKZ A;  2WJU A;  3BCK A;  2H74 A;  3M8N A;  5CRE A;  1O81 A;  3EU4 A;  3APQ A;  2LS5 A;  2LST A;  4TVE A;  1AQX A;  3HKR A;  5FHI A;  1S3C A;  3N9J A;  3LYP A;  4O5U A;  3ZRD A;  1MDJ A;  2H1G A;  2M46 A;  3MYD A;  3WGD A;  4K0G A;  2PMT A;  4G9H A;  3IHG A;  1K0A A;  4XIH A;  2LRC A;  3EWL A;  4ECJ A;  3G7Y A;  4I6X A;  2H66 A;  1TU8 A;  3UMA A;  3GUR A;  4ID0 A;  4USS A;  1YKA A;  4KND A;  2WZ9 A;  2KOK A;  4YQV A;  2X64 A;  2E2G A;  2O8V B;  5ECM B;  3KH7 A;  2R4V A;  2DIY A;  5G5E A;  4EXJ A;  5KN0 A;  1RQM A;  2GQL A;  1FOV A;  4L5O A;  4ML1 A;  2AUV A;  4NV5 A;  1KEB A;  3QD9 A;  2CV4 A;  4XS4 B;  5DAL A;  4TOP A;  3EUR A;  3QAW A;  17GS A;  4LL4 B;  4TW5 A;  5G2Z A;  4K2D A;  4QQ7 A;  1V58 A;  1C72 A;  4GRF A;  1XIY A;  3LQ7 A;  3IHQ A;  2V6O A;  2MMN A;  3RDW A;  1MDK A;  1M3J A;  3C1R A;  4BIK A;  3HZ8 A;  1USB A;  3UBK A;  2R0P A;  4ZBA A;  1ZYN A;  1URM A;  20GS A;  4HS1 A;  1B9Y C;  4K8M A;  3FK8 A;  3I6A A;  2A4V A;  3BOA A;  3GX8 A;  1X5C A;  1IYH A;  3L4N A;  3FEU A;  5J3R A;  2B3S A;  4O32 A;  2ON5 A;  4N30 A;  1FB0 A;  2F9S A;  2HFD A;  2ON7 A;  2DML A;  5L71 A;  2V2G A;  4IW9 A;  1X9S B;  5IMV A;  3OR5 A;  3ME7 A;  4G2E A;  5D9V A;  2L5L A;  3A5W A;  2VCZ A;  2CT6 A;  1SYR A;  1U88 A;  1Q4J A;  3IC4 A;  3A3T A;  5IO2 A;  2NPB A;  3HVS A;  3RPN A;  1A2L A;  1PMT A;  1W4V A;  4FYU A;  1PA3 A;  3G7J A;  2VCW A;  3IK9 A;  5DCG A;  4F03 A;  4L0U A;  3TJB A;  4HQZ A;  3BCI A;  5DAK A;  3G7I A;  2DC5 A;  3H79 A;  1GTI A;  1HNB A;  1X5D A;  4X43 A;  3ZVJ D;  1A8L A;  1TRS A;  1GUK A;  1AQV A;  4K6X A;  4MP4 A;  4BWS A;  2OE3 A;  1NHY A;  4O7H A;  4ICY A;  3VPT A;  3QPM A;  2HRA A;  1AQW A;  4TR4 A;  4CW9 A;  1E2Y A;  4MZB A;  3H1N A;  1YDK A;  3NZN A;  5B6M A;  4BVX A;  4QL7 A;  2FNO A;  4O5Q A;  4X0X A;  5ECS A;  1N2A A;  2DIZ A;  2K6V A;  3UVH A;  4ECC A;  3L9S A;  4ZXG A;  1ZL9 A;  4MF5 A;  2GQK A;  2DKI A;  1BJX A;  3GA4 A;  1GLP A;  4MCU A;  1QFN A;  4N0Z A;  1SK2 A;  3A2W A;  3JCM L;  5CYY A;  2TRC P;  2UZ8 A;  2DKH A;  1HYU A;  2YV7 A;  2YAN A;  2JZS A;  1J9B A;  3ME8 A;  5IMA A;  2FGX A;  1OKT A;  3N5O A;  2WB9 A;  4G0L A;  4IS0 A;  1V98 A;  3KH9 A;  3L9V A;  1X0R A;  1VF4 A;  4KCE A;  2WUL A;  3DD3 A;  4EUY A;  4TR0 A;  1PL1 A;  1TDI A;  2C0D A;  3KD0 A;  5A4U A;  3E9J B;  2LNT A;  1OYJ A;  3IPZ A;  4YQM A;  4YAV A;  5IPG A;  4Q5Q A;  1ZYQ B;  4POB A;  2JZR A;  2H6Y A;  4IKH A;  4LA1 A;  3TCO A;  6GSS A;  3FZ9 A;  4KE3 A;  1Y25 A;  4ZIL A;  3FY7 A;  5F06 A;  5JCG A;  3ZVJ A;  2AYT A;  2H72 A;  4JU5 A;  3HVV A;  1ZOF A;  3Q6O A;  1QK8 A;  3C73 A;  3TJK A;  4V2M A;  2R5G A;  5GAN D;  1TI1 A;  3KIJ A;  4TXO B;  1Y6E A;  4CHS A;  4CDO A;  1JHB A;  1ERT A;  2GSQ A;  4JED A;  2GVP A;  2GT6 A;  4IQA A;  1A2M A;  2HZE B;  1K3O A;  1SD8 A;  3UL3 A;  1TK5 B;  3HXS A;  1SJI A;  2OAC A;  3ZIT A;  2IFQ B;  16GS A;  4PNF A;  1OKD A;  1TOF A;  2H6Z A;  5HR2 A;  2IPA A;  4OO5 A;  1G7E A;  3CSI A;  3UBL A;  2XHF A;  3CSH A;  2CVB A;  5ECH B;  2B1L A;  3ERW A;  1M99 A;  3A2X A;  3IDV A;  3DVX A;  3FZ4 A;  1V2A A;  2LRN A;  3PGT A;  2GDR A;  3PPU A;  1B9X C;  4AJ8 A;  2B1K A;  3CQF A;  1GH2 A;  3SBC A;  3CBU A;  4EDZ A;  1ERU A;  3UAP A;  3EVI A;  2YP6 A;  1T4Y A;  3RAZ A;  3I69 A;  3GFK A;  3WD6 A;  3FKF A;  4E8H A;  2CAI A;  1O7U A;  3H8Q A;  1GSD A;  3H93 A;  3A5I A;  2YPM A;  4HUA A;  3IE3 A;  3GL5 A;  3QOU A;  9GSS A;  4ZB6 A;  4I97 A;  3A2V A;  2V32 A;  3ZMK A;  4NAX A;  3HJP A;  1B8X A;  5DQY A;  1UN2 A;  2ZNM A;  3WGE A;  5G30 A;  4JE1 A;  1WIK A;  1XBS A;  3P90 A;  3BD2 A;  2FWH A;  3IK7 A;  1F2E A;  2XBI A;  2DSA A;  5ID2 A;  2V6K A;  2GLR A;  3M9J A;  1J0F A;  4XS1 A;  5ECK B;  3EU3 A;  6GSV A;  1M2D A;  3E0U A;  2OKA A;  2P0G A;  1KTE A;  3ERF A;  4TR1 B;  4FIW A;  4E8E A;  2DLX A;  4PQ1 A;  2PUK C;  2H1B A;  4XHM A;  2LEG A;  3P8W A;  2OBK A;  2C8U A;  3KMN A;  2AJQ B;  3VWV A;  2F8F A;  4HU7 A;  4D73 A;  1GWC A;  5BRT A;  1EEM A;  5DQS A;  3FHK A;  3TJG A;  4MH2 A;  3MDK A;  2VM1 A;  13GS A;  1OC9 B;  4IP1 A;  2GTU A;  1VF2 A;  2VAF A;  2MMO A;  2DMM A;  3DVW A;  4RI7 A;  1RW1 A;  4OFT A;  3GMF A;  5D8I A;  3TRP A;  1F3B A;  3HHV A;  2RM6 A;  2PN8 A;  4V1A g;  2GGT A;  3IRA A;  5DBQ A;  5DJM A;  2RUE A;  2H0I A;  4K1F A;  4CY6 A;  4OWY A;  4OFN A;  5G1K A;  3GTU A;  5AN1 A;  5ECI B;  2CZ3 A;  1YY7 A;  5ELA A;  2GST A;  3WT1 A;  3LXT A;  5HFI A;  2VL9 A;  1SK1 A;  5IIZ A;  4PXO A;  3BJ5 A;  5AGY A;  1MEK A;  3L0H A;  2FY6 A;  3RHC A;  1M2A A;  2J9H A;  2L6D A;  3F3R A;  4MPG A;  3F3Q A;  6GSX A;  2ES7 A;  3TKP A;  5IOX A;  3DWV A;  1VGL A;  5DCH A;  2EC4 A;  2H75 A;  1J08 A;  1QUW A;  4WXT A;  1Z6M A;  1DUG A;  4GWR A;  4XRA A;  1NHO A;  1YZX A;  2F3M A;  1A24 A;  1FVJ A;  3QMX A;  4XRD A;  3F4T A;  4RQX A;  3LGC A;  1VF3 A;  2VCX A;  3GYK A;  4KDX A;  3LEF A;  1K0M A;  3HZ4 A;  3WGX A;  1CQH A;  5KOX A;  2L5O A; 
#chains in the Genus database with same CATH homology
 5G5F A;  3GH9 A;  2DJ1 A;  2QA2 A;  1LJR A;  2NBS A;  4TXO A;  4G10 A;  1XZO A;  4WF5 A;  2F8A A;  1UC7 A;  3TKS C;  2VLT A;  3RPP A;  3ZIJ A;  4MJA A;  4ILF A;  1A0R P;  1PRX A;  1TRU A;  5CRG A;  2B5X A;  2HZE A;  4KUN A;  2RM5 A;  3FZ5 A;  3EMP A;  1OE7 A;  2BTO T;  4KAE A;  1O73 A;  1WPI A;  2HI7 A;  2YWI A;  4V1A p;  3ZL5 A;  1LU4 A;  2X8H A;  2IFQ A;  1G7O A;  3GL3 A;  3WYW A;  3IAS 2;  5A4W A;  2AV4 A;  5AIV A;  1PX6 A;  2RUF A;  3APS A;  3UEM A;  5DDL A;  2FWG A;  2JU5 A;  5D96 A;  5C00 A;  1TRV A;  1I9D A;  3FRC A;  3I43 A;  6GST A;  3CXG A;  1EP8 A;  1PD2 1;  4OCF A;  5J9C A;  5IM9 A;  2WCI A;  4J56 E;  1GLQ A;  4Z7X A;  1R7H A;  3GKN A;  3UJ1 A;  1K0D A;  2PVO C;  5FWG A;  1GNE A;  3KM6 A;  1E6B A;  3CRU A;  2O89 A;  1UVZ A;  4DSQ A;  4MJE A;  2VCQ A;  2KP1 A;  2VLV A;  3UIW A;  1EOH A;  1TW9 A;  1M2B A;  2GZP A;  3TJF A;  2B5Y A;  5ENU A;  4BVY B;  2E0Q A;  2DJJ A;  3IXR A;  2BMX A;  3MSZ A;  1A8Y A;  4J2F A;  1SJ6 A;  4YAP A;  2G2Q A;  1GP1 A;  3APO A;  3HDC A;  2A2S A;  2IMI A;  3PH9 A;  1HQO A;  2GS3 A;  2QGV A;  4BPY A;  2YWM A;  2XPE A;  1K3L A;  2X4A A;  2J23 A;  5J4U A;  4MH3 A;  4HZ4 A;  3MAK A;  1M0U A;  2N5F A;  2WDU A;  3VI5 A;  4MJB A;  2H19 A;  1X9W B;  3F6F A;  2FD3 A;  3D6I A;  4FO5 A;  1PKW A;  3FR9 A;  4MMM A;  4TR1 A;  1XCC A;  3D4T A;  2WGR A;  3TB2 A;  4Q5N A;  1BAY A;  3NIV A;  5F0G A;  4IJI A;  1YJ6 A;  3M3M A;  2H0H A;  2VL2 C;  1R5P A;  1XOB A;  5HR3 A;  4I2T A;  3FYG A;  4NPB A;  2O85 A;  2AAW A;  3DGQ A;  1TTZ A;  3HYP A;  2TRX A;  2PU9 C;  1NSW A;  2FWF A;  3F63 A;  4TR3 A;  4RI6 A;  3LYK A;  5DJL A;  4MDC A;  3KMO A;  2FCH A;  1XFL A;  2YJH A;  4F9Z A;  5GAP D;  4TRX A;  5JWO B;  3VLN A;  2E2M A;  14GS A;  4LMW A;  1H75 A;  1K0C A;  1SEN A;  2NDO A;  2EIR A;  4OFM A;  3O6T A;  4K7I A;  4KX4 A;  5HQP A;  3FMW A;  2VUP A;  5ECN B;  1XXU A;  1VF1 A;  4POL A;  1GUH A;  3TKS A;  2C4J A;  2R0G A;  2C0G A;  2HRK A;  2HZF A;  1R4W A;  5KEJ A;  2VO4 A;  2I81 A;  1YEP A;  1YF0 A;  3LSZ A;  2ZCT A;  2FWE A;  2C3Q A;  4IBP A;  3EE2 A;  2CX4 A;  2AHE A;  3VPQ A;  5CRW A;  4EIQ A;  1JZD A;  3IOS A;  3F0I A;  4TN8 A;  2QKE A;  2K8S A;  4GTU A;  4G0K A;  2H6X A;  4PQI A;  4N11 A;  2HSY A;  4MZC A;  4GQF A;  2JL4 A;  4ECB A;  4POM A;  4KSO A;  2YCD A;  2K18 A;  3KJY A;  2CAQ A;  4EO3 A;  4AGS A;  2PVQ A;  3ZML A;  4KB3 A;  2VD1 A;  1TJD A;  2ALB A;  3FR3 A;  3VI7 A;  3L9U A;  8GSS A;  2HSM A;  3ZTL A;  3FZA A;  3GV1 A;  1WMJ A;  4OCE A;  1EOG A;  3IAM 2;  4RQR A;  4GF0 A;  1O85 A;  1V9W A;  2B7J A;  3ZFL A;  5IMF A;  3LOR A;  3TGZ A;  4F0C A;  1OAZ A;  1T8E B;  5JWR B;  3WT2 A;  4YKF A;  3D4M A;  3EMX A;  3GKK A;  1OVN A;  2NTO A;  4DEJ A;  2R2J A;  4YQU A;  3DEX A;  1U87 A;  3C7M A;  4EL1 A;  4HQS A;  1EV4 A;  1A2J A;  1EV9 A;  4HJ2 A;  6GSW A;  3U5R E;  1GTU A;  2ZUP A;  4I5Q A;  1BED A;  2HNL A;  5CRD A;  1K0O A;  4KCA A;  1YKC A;  3GIX A;  1XW6 A;  22GS A;  3UOM A;  1THO A;  1TRW A;  2MMA A;  1TKD B;  1WP0 A;  5ECL B;  4KA0 A;  5HR0 A;  5B8A A;  1K0N A;  4NMU A;  3TKQ A;  2OA7 A;  5C04 A;  3H4K A;  3CMI A;  1XOA A;  4XS4 A;  4G19 A;  2VL2 A;  3GX0 A;  2HRN A;  3HY2 A;  12GS A;  4WR4 A;  2B5E A;  1K0B A;  2N5B A;  5GST A;  1GSY A;  5IMD A;  1GSQ A;  5D9W A;  2P5R A;  4YKG A;  3MIX A;  1ZZY A;  3VWW A;  4MF6 A;  1XWG A;  3LWA A;  4WEY A;  4AJ6 A;  1CQG A;  1PN9 A;  4HEA 2;  1F6M C;  3ZRE A;  4KH7 A;  4FQU A;  2H30 A;  2GT5 A;  3C8E A;  3LW9 A;  3QFA C;  2WFC A;  1EEJ A;  5DVB A;  1B48 A;  3E3E A;  2KHP A;  2CVK A;  4ZBB A;  4PUR A;  2IME A;  1B4P A;  2HSH A;  5J41 A;  2EIO A;  4ULX A;  3KCM A;  4XTS A;  1FG4 A;  5IMZ A;  1JZO A;  2IMD A;  4F82 A;  3FR6 A;  4MAB A;  1AXD A;  2K8V A;  3EIN A;  3CYN A;  4HI7 A;  1A23 A;  1MDI A;  3G9B A;  1GUM A;  3ZYW A;  3TKR A;  4JR6 A;  2QC7 A;  5HFG A;  1XWB A;  4KDY A;  2X8C A;  3HCZ A;  4ZL8 A;  1KNG A;  3TRX A;  4K0N A;  2RII A;  1XWC A;  3DIE A;  4IHU A;  4IQ1 A;  5G1L A;  1SD9 A;  4WBR D;  3EYT A;  3TDG A;  1A0F A;  4X4J A;  2LRT A;  4ISD A;  3TOT A;  2IN3 A;  1IYI A;  5CAX A;  1XW9 A;  4DSS B;  1S3A A;  1DBY A;  2N5A A;  1ILO A;  1EP7 A;  5HR1 A;  1YQ1 A;  3QCP A;  2H71 A;  1GTB A;  2D2Z A;  2H1A A;  4ACS A;  2PGT A;  4Q5F A;  2VIM A;  4BVX B;  1ZCP A;  1BG5 A;  4K5S A;  3HA9 A;  2C0F A;  5JCW A;  2OE0 A;  5ECO B;  3VUR A;  1MD3 A;  2CX3 A;  2CZ2 A;  4EDY A;  2A4H A;  3F6D A;  1TI3 A;  3D5J A;  3GST A;  1FVK A;  5D73 A;  1M9B A;  3U6V A;  1DE1 A;  4ZIJ A;  4A5P A;  3TOU A;  3TJJ A;  4KF9 A;  2LUS A;  1XPV A;  5F8B A;  2M80 A;  4IEL A;  5F07 A;  1O8X A;  1ZYE A;  1X9M B;  2C0E A;  2H76 A;  1AW9 A;  4F2I A;  1AIU A;  3HJM A;  1ZGN A;  2H70 A;  5F05 A;  3QDN A;  1ZMA A;  4LMV A;  4ZB9 A;  5IQY A;  5CRH A;  1AAZ A;  2CA8 A;  1OC8 A;  2OBI A;  2H8L A;  1OE8 A;  1F9M A;  4IN0 A;  3D0Z A;  1U3A A;  5G31 A;  5CO3 A;  2YWO A;  5KOW A;  2C3T A;  1R26 A;  1AUC A;  3ED3 A;  4WET A;  4NWY A;  5EY6 A;  2C3N A;  3ZFB A;  2B7K A;  1GTA A;  2MYG A;  2L4Q A;  4K7O A;  1SU9 A;  1H4O A;  4DVC A;  4L0W A;  3KXO A;  5LNK e;  1G6W A;  2HRF A;  2DJ3 A;  4V2L A;  3J7Y b;  1K3Y A;  2MZC A;  2YWN A;  4FYB A;  1ZYP A;  5EL8 A;  1PX7 A;  3HJO A;  3KTL A;  3W8S A;  5IOW A;  2GQM A;  2YNX A;  1OC3 A;  3VWU A;  2X99 A;  5D9T A;  1XWK A;  4FH8 A;  2QA1 A;  5LCZ A;  1DSB A;  3M1G A;  3QFB C;  2PWJ A;  3GKX A;  3CTF A;  1O8W A;  1XVQ A;  3VK9 A;  2KP2 A;  5H5R A;  2FUG 2;  2VCT A;  2KUC A;  4BL7 B;  3TRQ A;  2F51 A;  3VFI A;  1FB6 A;  1MD4 A;  4BA7 A;  1SK0 A;  2R6K A;  2H1D A;  2V41 A;  2MBT A;  2IJY A;  4MK3 A;  5H5S A;  1HNC A;  5CP1 A;  2CQ9 A;  18GS A;  3GUS A;  1Z7P A;  2JSZ A;  3CSJ A;  2LJK A;  2K9F A;  2H73 A;  4TXV A;  3F8U A;  3KP8 A;  5KN1 A;  1T1V A;  3ZZX A;  1U3I A;  2G0F A;  4X1U A;  2PER A;  3GSS A;  1XWA A;  2IWT A;  4CY8 A;  4K5R A;  2I1U A;  1PSQ A;  2FA8 A;  1VRS D;  1Z3E A;  4KGI A;  4EVM A;  5B6N A;  2RLI A;  4L5L A;  1FO5 A;  5ID2 B;  1JZR A;  4GQC A;  1GNW A;  3M0F A;  2OAD A;  3ZLP A;  1B4Q A;  2VL3 A;  1N8J A;  3QAG A;  2C1Y A;  1EWX A;  4N0V A;  1TXX A;  3FW2 A;  1LBK A;  1M7T A;  3GN3 A;  5LD0 A;  4O92 A;  1TK8 B;  4I8B A;  4EE0 A;  3P7X A;  1SYX A;  5AIS A;  4NXI A;  2HLS A;  3W8J A;  4P3Y B;  2L59 A;  4KDU A;  4EF0 A;  4D73 B;  3Q18 A;  4PGT A;  3M9K A;  2R3X A;  5JWQ B;  2IMF A;  2YOI A;  3KP9 A;  3F4R A;  4Z2T A;  2E7P A;  4Z2R A;  3I9V 2;  3LFL A;  3TKS E;  5GZZ B;  4MA9 A;  5J9B A;  1YEX A;  5FT3 A;  1JLV A;  2GZZ A;  1OC9 A;  3GRX A;  4DSS A;  2KLX A;  1MTC A;  4GXZ A;  1FAA A;  3O76 A;  1S3D A;  2L57 A;  2CVD A;  5IPH A;  2VD0 A;  4IGJ A;  4NHW A;  2YZH A;  4MZW A;  4ZL7 A;  4HOJ A;  5JCU A;  3Q74 A;  1F37 A;  2JSY A;  2HYX A;  5D93 A;  2PPT A;  3QR6 A;  1QGV A;  1ERV A;  1T3B A;  4HZ2 A;  4GLT A;  2EIQ A;  2H01 A;  1QXH A;  4IVF A;  4GSN A;  4AF2 A;  1QQ2 A;  1SJZ A;  1SL0 B;  5IO0 A;  2BJX A;  2WRT A;  3R3E A;  3GTU B;  4PNG A;  3EPT A;  2LNS A;  3PR8 A;  2HXK A;  1WJK A;  2REM A;  1AC1 A;  5H5Q A;  3VWX A;  2FHE A;  5A4V A;  4GCI A;  4HJM A;  2DJ0 A;  2JZT A;  2Z9S A;  1Z9H A;  1O6J A;  3AY8 A;  1QMV A;  1T7P B;  3P2A A;  4ML6 A;  4EC0 A;  6GSU A;  4BWQ A;  1FW1 A;  1DE2 A;  1BYE A;  11GS A;  3MWH A;  2DJK A;  1XVW A;  3S9F A;  1WE0 A;  2XPD A;  2LQQ A;  1F3A A;  1SKR B;  4MPF A;  4GST A;  3GKM A;  4NV2 A;  1GRX A;  4RUV A;  1KBN A;  3GH6 A;  3KTB A;  2TIR A;  2C80 A;  1NW2 A;  1Z6N A;  2O7K A;  5EPF A;  2JAC A;  2OE1 A;  5KN2 A;  3C71 A;  2LKU A;  3BBY A;  2O87 A;  3F9U A;  4PX1 A;  4HDE A;  1Z7R A;  1GSF A;  4YH2 A;  4OD7 A;  2B6M A;  4Z2U A;  2JAD A;  1W89 A;  2IL3 A;  2V1M A;  10GS A;  1T00 A;  4OMV A;  4L8E A;  5D9X A;  4EKZ A;  2P31 A;  1FOH A;  3D21 A;  2VOC A;  2R0C A;  5ECQ B;  3D22 A;  4K7N A;  2NVL A;  4NHZ A;  3MNG A;  2FA4 A;  3IC8 A;  3IR4 A;  3GNJ A;  4N10 A;  3IA1 A;  1SKW B;  3ISO A;  1JFU A;  1EZK A;  1GL8 A;  5ECR B;  3HVX A;  2AB6 A;  4O5R A;  4LL1 B;  4PTS A;  3DYR A;  2GSR A;  4WBJ A;  1GSS A;  3KZQ A;  4K9Z A;  5HFK A;  1R5A A;  1GUL A;  5KN3 A;  3RHB A;  4ECI A;  2YV9 A;  5DAL B;  4PQH A;  1RK4 A;  2LJR A;  1G6Y A;  2P5Q A;  3C1S A;  1G0T A;  3R2Q A;  3DRN A;  3LJR A;  2VM2 A;  3IBH A;  4XS6 A;  3TUE A;  3UAR A;  2DJ2 A;  3LG6 A;  2DBC A;  1XW5 A;  3KGK A;  4BL7 A;  4MLY A;  3CRT A;  4Q5R A;  1PQN A;  4WKW A;  1HNA A;  1M9A A;  1ML6 A;  5A5K A;  2OJL A;  3DKS A;  5B8B A;  4POK A;  4BVY A;  4PUF C;  1HD2 A;  2LJA A;  1ABA A;  19GS A;  1V57 A;  1Q98 A;  5AIX A;  2HE3 A;  2IMK A;  4OO4 A;  3GHA A;  1TP9 A;  2A2R A;  2LV3 A;  2QSI A;  3KEB A;  3HD5 A;  2FLS A;  3F4S A;  2MMZ A;  1FHE A;  1SL1 B;  2L4C A;  1T4Z A;  2GZY A;  4JR4 A;  1ERW A;  4LLR A;  4WR5 A;  4V2N A;  1WWJ A;  4JBB A;  2XBQ A;  1GSU A;  2LQO A;  5COH A;  5ECP B;  1JLW A;  3L78 A;  4MNN A;  2X8G A;  3SWL A;  4I2U A;  2A2P A;  5CNW A;  4TKY A;  1I5G A;  3IV4 A;  4JRR A;  5E59 A;  1UA5 A;  4QL9 A;  5GSS A;  2XC2 A;  1X5E A;  5DAK B;  2GSS A;  2VCV A;  2H0G A;  4DSR A;  5EVO A;  1BQ7 A;  1ON4 A;  5ABR A;  4IP6 A;  1TU7 A;  2I3Y A;  1BX9 A;  5ELG A;  1GSE A;  2M72 A;  1TK0 B;  1U6T A;  2PBJ A;  2YN1 A;  1Z5Y E;  3RBT A;  3DXB A;  5B7C A;  1PN0 A;  3PIN A;  4HU9 A;  1EGO A;  4G0I A;  2L6C A;  1SKS B;  3NOF A;  1THX A;  3EC3 A;  4J57 E;  1ACV A;  4EIP A;  1WOU A;  2R37 A;  1PL2 A;  2LTK A;  2IIY A;  4FYC A;  3W6G A;  5J5N A;  4K2X A;  3QAV A;  2VLU A;  3V1W A;  2MBS A;  2YJ7 A;  1WRY A;  4H86 A;  4JZQ A;  4KSM A;  3ZIV A;  1V40 A;  2HT9 A;  3CTG A;  3K8N A;  1JZW A;  1PGT A;  6GSY A;  1ST9 A;  2WS2 A;  1EGR A;  2I9H A;  2X49 A;  4IJ3 A;  4PUA A;  4F0B A;  4XCS A;  7GSS A;  4ZL9 A;  5BMU A;  1YF1 A;  4ZBD A;  3Q19 A;  4ZB8 A;  3US3 A;  5IMC A;  3DML A;  5INY A;  4MF7 A;  1NM3 A;  3ERG A;  4WF4 A;  4MJC A;  3O3T A;  4KW6 A;  3UVT A;  3J7Y k;  1SL2 B;  2I4A A;  2YZU A;  5E4W A;  4GSS A;  3LXZ A;  4AJ7 A;  1PKZ A;  2WJU A;  3BCK A;  2H74 A;  3M8N A;  5CRE A;  1O81 A;  3EU4 A;  3APQ A;  2LS5 A;  2LST A;  4TVE A;  1AQX A;  3HKR A;  5FHI A;  1S3C A;  3N9J A;  3LYP A;  4O5U A;  3ZRD A;  1MDJ A;  2H1G A;  2M46 A;  3MYD A;  3WGD A;  4K0G A;  2PMT A;  4G9H A;  3IHG A;  1K0A A;  4XIH A;  2LRC A;  3EWL A;  4ECJ A;  3G7Y A;  4I6X A;  2H66 A;  1TU8 A;  3UMA A;  3GUR A;  4ID0 A;  4USS A;  1YKA A;  4KND A;  2WZ9 A;  2KOK A;  4YQV A;  2X64 A;  2E2G A;  2O8V B;  5ECM B;  3KH7 A;  2R4V A;  2DIY A;  5G5E A;  4EXJ A;  5KN0 A;  1RQM A;  2GQL A;  1FOV A;  4L5O A;  4ML1 A;  2AUV A;  4NV5 A;  1KEB A;  3QD9 A;  2CV4 A;  4XS4 B;  5DAL A;  4TOP A;  3EUR A;  3QAW A;  17GS A;  4LL4 B;  4TW5 A;  5G2Z A;  4K2D A;  4QQ7 A;  1V58 A;  1C72 A;  4GRF A;  1XIY A;  3LQ7 A;  3IHQ A;  2V6O A;  2MMN A;  3RDW A;  1MDK A;  3C1R A;  3HZ8 A;  1USB A;  3UBK A;  2R0P A;  4ZBA A;  1ZYN A;  1URM A;  20GS A;  4HS1 A;  1B9Y C;  4K8M A;  3FK8 A;  3I6A A;  2A4V A;  3BOA A;  3GX8 A;  1X5C A;  1IYH A;  3L4N A;  3FEU A;  5J3R A;  2B3S A;  4O32 A;  2ON5 A;  4N30 A;  1FB0 A;  2F9S A;  2HFD A;  2ON7 A;  2DML A;  5L71 A;  2V2G A;  4IW9 A;  1X9S B;  5IMV A;  3OR5 A;  3ME7 A;  4G2E A;  5D9V A;  2L5L A;  3A5W A;  2VCZ A;  2CT6 A;  1SYR A;  1U88 A;  1Q4J A;  3IC4 A;  3A3T A;  5IO2 A;  2NPB A;  3HVS A;  3RPN A;  1A2L A;  1PMT A;  1W4V A;  4FYU A;  1PA3 A;  3G7J A;  2VCW A;  3IK9 A;  5DCG A;  4F03 A;  4L0U A;  3TJB A;  4HQZ A;  3BCI A;  5DAK A;  3G7I A;  2DC5 A;  3H79 A;  1GTI A;  1HNB A;  1X5D A;  4X43 A;  3ZVJ D;  1A8L A;  1TRS A;  1GUK A;  1AQV A;  4K6X A;  4MP4 A;  4BWS A;  2OE3 A;  1NHY A;  4O7H A;  4ICY A;  3VPT A;  3QPM A;  2HRA A;  1AQW A;  4TR4 A;  4CW9 A;  1E2Y A;  4MZB A;  3H1N A;  1YDK A;  3NZN A;  5B6M A;  4BVX A;  4QL7 A;  2FNO A;  4O5Q A;  4X0X A;  5ECS A;  1N2A A;  2DIZ A;  2K6V A;  3UVH A;  4ECC A;  3L9S A;  4ZXG A;  1ZL9 A;  4MF5 A;  2GQK A;  2DKI A;  1BJX A;  3GA4 A;  1GLP A;  4MCU A;  1QFN A;  4N0Z A;  1SK2 A;  3A2W A;  3JCM L;  5CYY A;  2TRC P;  2UZ8 A;  2DKH A;  1HYU A;  2YV7 A;  2YAN A;  2JZS A;  1J9B A;  3ME8 A;  5IMA A;  2FGX A;  1OKT A;  3N5O A;  2WB9 A;  4G0L A;  4IS0 A;  1V98 A;  3KH9 A;  3L9V A;  1X0R A;  1VF4 A;  4KCE A;  2WUL A;  3DD3 A;  4EUY A;  4TR0 A;  1PL1 A;  1TDI A;  2C0D A;  3KD0 A;  5A4U A;  3E9J B;  2LNT A;  1OYJ A;  3IPZ A;  4YQM A;  4YAV A;  5IPG A;  4Q5Q A;  1ZYQ B;  4POB A;  2JZR A;  2H6Y A;  4IKH A;  4LA1 A;  3TCO A;  6GSS A;  3FZ9 A;  4KE3 A;  1Y25 A;  4ZIL A;  3FY7 A;  5F06 A;  5JCG A;  3ZVJ A;  2AYT A;  2H72 A;  4JU5 A;  3HVV A;  1ZOF A;  3Q6O A;  1QK8 A;  3C73 A;  3TJK A;  4V2M A;  2R5G A;  5GAN D;  1TI1 A;  3KIJ A;  4TXO B;  1Y6E A;  4CHS A;  4CDO A;  1JHB A;  1ERT A;  2GSQ A;  4JED A;  2GVP A;  2GT6 A;  4IQA A;  1A2M A;  2HZE B;  1K3O A;  1SD8 A;  3UL3 A;  1TK5 B;  3HXS A;  1SJI A;  2OAC A;  3ZIT A;  2IFQ B;  16GS A;  4PNF A;  1OKD A;  1TOF A;  2H6Z A;  5HR2 A;  2IPA A;  4OO5 A;  1G7E A;  3CSI A;  3UBL A;  2XHF A;  3CSH A;  2CVB A;  5ECH B;  2B1L A;  3ERW A;  1M99 A;  3A2X A;  3IDV A;  3DVX A;  3FZ4 A;  1V2A A;  2LRN A;  3PGT A;  2GDR A;  3PPU A;  1B9X C;  4AJ8 A;  2B1K A;  1GH2 A;  3SBC A;  3CBU A;  4EDZ A;  1ERU A;  3UAP A;  3EVI A;  2YP6 A;  1T4Y A;  3RAZ A;  3I69 A;  3GFK A;  3WD6 A;  3FKF A;  4E8H A;  2CAI A;  1O7U A;  3H8Q A;  1GSD A;  3H93 A;  3A5I A;  2YPM A;  4HUA A;  3IE3 A;  3GL5 A;  3QOU A;  9GSS A;  4ZB6 A;  4I97 A;  3A2V A;  2V32 A;  3ZMK A;  4NAX A;  3HJP A;  1B8X A;  5DQY A;  1UN2 A;  2ZNM A;  3WGE A;  5G30 A;  4JE1 A;  1WIK A;  1XBS A;  3P90 A;  3BD2 A;  2FWH A;  3IK7 A;  1F2E A;  2XBI A;  2DSA A;  5ID2 A;  2V6K A;  2GLR A;  3M9J A;  1J0F A;  4XS1 A;  5ECK B;  3EU3 A;  6GSV A;  1M2D A;  3E0U A;  2OKA A;  2P0G A;  1KTE A;  3ERF A;  4TR1 B;  4FIW A;  4E8E A;  2DLX A;  4PQ1 A;  2PUK C;  2H1B A;  4XHM A;  2LEG A;  3P8W A;  2OBK A;  2C8U A;  3KMN A;  2AJQ B;  3VWV A;  2F8F A;  4HU7 A;  4D73 A;  1GWC A;  5BRT A;  1EEM A;  5DQS A;  3FHK A;  3TJG A;  4MH2 A;  3MDK A;  2VM1 A;  13GS A;  1OC9 B;  4IP1 A;  2GTU A;  1VF2 A;  2VAF A;  2MMO A;  2DMM A;  3DVW A;  4RI7 A;  1RW1 A;  4OFT A;  3GMF A;  5D8I A;  3TRP A;  1F3B A;  3HHV A;  2RM6 A;  2PN8 A;  4V1A g;  2GGT A;  3IRA A;  5DBQ A;  5DJM A;  2RUE A;  2H0I A;  4K1F A;  4CY6 A;  4OWY A;  4OFN A;  5G1K A;  3GTU A;  5AN1 A;  5ECI B;  2CZ3 A;  1YY7 A;  5ELA A;  2GST A;  3WT1 A;  3LXT A;  5HFI A;  2VL9 A;  1SK1 A;  5IIZ A;  4PXO A;  3BJ5 A;  5AGY A;  1MEK A;  3L0H A;  2FY6 A;  3RHC A;  1M2A A;  2J9H A;  2L6D A;  3F3R A;  4MPG A;  3F3Q A;  6GSX A;  2ES7 A;  3TKP A;  5IOX A;  3DWV A;  1VGL A;  5DCH A;  2EC4 A;  2H75 A;  1J08 A;  1QUW A;  4WXT A;  1Z6M A;  1DUG A;  4GWR A;  4XRA A;  1NHO A;  1YZX A;  2F3M A;  1A24 A;  1FVJ A;  3QMX A;  4XRD A;  3F4T A;  4RQX A;  3LGC A;  1VF3 A;  2VCX A;  3GYK A;  4KDX A;  3LEF A;  1K0M A;  3HZ4 A;  3WGX A;  1CQH A;  5KOX A;  2L5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...