2HT9A

The structure of dimeric human glutaredoxin 2
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
104
structure length
104
Chain Sequence
LATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin-2
publication title Reversible sequestration of active site cysteines in a 2Fe-2S-bridged dimer provides a mechanism for glutaredoxin 2 regulation in human mitochondria
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 33
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ht9A00
3EURA 2JL4A 4K7IA 3TUEA 3CSJA 3UEMA 4DSSB 1GNEA 1B4PA 3UBLA 2IFQB 1SD8A 3WD6A 4MJAA 4QL7A 4NAXA 3FZ5A 2LRCA 3VLNA 2MZCA 1PGTA 5D73A 1WE0A 3ERFA 4MH3A 5DALB 2JU5A 2KP2A 1QXHA 3D0ZA 3SBCA 3ZFLA 3ERGA 3WGEA 1A24A 2JZTA 4GWRA 10GSA 3CSIA 2NBSA 3EU3A 4EO3A 2KLXA 2H01A 3KCMA 4JZQA 2H66A 3TRXA 4YQVA 1ZL9A 5CRGA 2G2QA 1ACVA 2OBIA 4IBPA 4YH2A 5ECLB 1FG4A 3UARA 3IPZA 4KDXA 3R2QA 4YQMA 4HZ4A 13GSA 1W89A 5D9TA 2EIQA 5G5EA 1JLWA 2HZFA 1ST9A 5ECQB 1WWJA 3TJBA 2ZNMA 3O6TA 2C0GA 3CSHA 1VGLA 2XBQA 5IM9A 3TB2A 3A2WA 3D22A 2VCVA 2YZHA 2WZ9A 3I9V2 4I2TA 4F03A 2XPEA 1SU9A 2H0IA 1Y6EA 8GSSA 19GSA 1XXUA 5ECSA 4ZB8A 1ERVA 4BVYA 4AGSA 4OD7A 2CZ2A 1PL1A 2C1YA 1GSQA 5IMAA 3M3MA 2OE3A 4RQRA 1XWCA 2KHPA 1ERWA 2FWEA 5C00A 1G7EA 2LTKA 5D9XA 2XPDA 3CTFA 1J08A 2B1KA 2IWTA 1H75A 1J9BA 1E2YA 2M72A 1VRSD 1UC7A 1N8JA 3A2VA 4PX1A 3DD3A 1G0TA 9GSSA 5CAXA 5A4UA 2L59A 2RM5A 4O32A 1XCCA 3C71A 5AIVA 4Q5FA 3CRTA 3ZREA 5KN0A 3DWVA 2L57A 3C7MA 1S3CA 2PBJA 2LKUA 3APQA 1X9SB 1XVWA 5IMDA 3ZVJD 1PN9A 1A23A 2HZEA 2C0EA 2LRNA 3DGQA 3LXZA 3GV1A 1T3BA 1FB6A 4TR1A 2X8HA 2LSTA 2HFDA 2VD1A 4ID0A 3BJ5A 4HOJA 2HLSA 5IIZA 4EVMA 3LXTA 5F06A 4POMA 3D6IA 5G1LA 2RM6A 2WULA 2RLIA 2KUCA 4HUAA 2VAFA 1K3OA 3NIVA 1GH2A 1GL8A 22GSA 2GSSA 1G6WA 3UOMA 3K8NA 3H79A 1OE8A 3UAPA 1X9WB 1K3LA 4TRXA 3TKQA 1ZMAA 5ECRB 5F05A 5ECNB 1TRVA 2X64A 1EP8A 4GLTA 4L8EA 3VURA 5DQYA 2O7KA 4DVCA 3ZIVA 3DEXA 1MDIA 5FT3A 2H19A 1ZYEA 2C3TA 3HD5A 3FR6A 4P3YB 4WBJA 4D73A 1KEBA 4NWYA 5IMVA 1BAYA 4QL9A 2G0FA 1SL1B 5G31A 4HQZA 1H4OA 3HVVA 2QKEA 3IHQA 4K0NA 4XS4B 5D93A 5HFGA 3QAVA 4FH8A 1YY7A 4IN0A 2MMZA 4RI7A 1GSEA 4GSSA 3CTGA 4WR5A 5ECPB 3PINA 4K9ZA 2DMMA 3D4TA 1V9WA 3H4KA 4V1Ag 1TI3A 1XPVA 3HZ8A 1W4VA 4HU9A 1O8WA 5D9VA 2CZ3A 2VM2A 5CRHA 2JZSA 4PNFA 5CREA 1EGRA 2GSQA 3Q6OA 2AAWA 1A0FA 4EXJA 1TOFA 1AUCA 2PWJA 4XS1A 1ON4A 3TCOA 2K9FA 6GSYA 2I3YA 2LQOA 2N5BA 1MEKA 4L0WA 5D96A 3IK7A 2HYXA 1R4WA 3M8NA 1JFUA 2FCHA 1O7UA 5IPGA 5HQPA 3HYPA 2GSRA 4TXOB 2P31A 4LMVA 2PUKC 4IHUA 1SD9A 4ZXGA 5LD0A 1YEPA 4FYCA 3RAZA 2K6VA 2H72A 4HU7A 1S3DA 2EIRA 4OWYA 2IMKA 4PQHA 7GSSA 4H86A 5A4WA 2HXKA 4LA1A 1Z5YE 4WKWA 2DJJA 5IMFA 1GLQA 5J4UA 1JZDA 1O81A 2FLSA 18GSA 2YNXA 5EY6A 3ZLPA 5J3RA 1GTAA 1N2AA 6GSSA 2BTOT 2OA7A 5ID2A 2DJKA 4MZCA 3GKKA 1TP9A 4POBA 2H1DA 2CX4A 5B8BA 3U5RE 4XCSA 4EC0A 2PVQA 3EU4A 3CBUA 5JCGA 1AW9A 4MA9A 4N11A 5H5SA 1QGVA 1PA3A 1M99A 4KW6A 4OFTA 1Z6NA 1TTZA 2E2GA 4EDZA 2LV3A 4IGJA 1U88A 1YEXA 2FY6A 2IJYA 4F9ZA 5IMCA 2H1GA 1FB0A 1PD21 3A5WA 1J0FA 3G7IA 1PL2A 4OFMA 4XRDA 3J7Yb 5F07A 4KDUA 1NHOA 2ON7A 5E59A 4IQAA 4TR4A 5AGYA 4EL1A 2H1BA 2EC4A 2OE0A 2VLTA 3IR4A 4IP6A 1THOA 2O85A 1JZRA 1EEJA 3C1SA 2WDUA 5KN2A 1S3AA 2GTUA 1UN2A 5IO2A 1SKRB 3DVXA 5ELGA 1YKCA 4MF6A 4X43A 1SKSB 3SWLA 4EF0A 1K0CA 2H6YA 4XS6A 2GZYA 2QSIA 4KSOA 2YANA 4EKZA 1AQVA 2L5OA 1RW1A 2JZRA 3APSA 4FO5A 1WMJA 1GUHA 2HRNA 2H76A 2N5AA 1I5GA 3MWHA 2V1MA 4NPBA 1FOVA 4KSMA 4AJ8A 2I4AA 4HS1A 4NV2A 3RHCA 3VI5A 3DVWA 5GAPD 5AN1A 1ZCPA 1U87A 2OKAA 2F9SA 2YPMA 2C80A 2GGTA 5JCUA 2REMA 3F4TA 3L9VA 4V2MA 1XWGA 4BWQA 4MF7A 1G7OA 2L6CA 2VCQA 1YJ6A 4JR4A 2M46A 1OKDA 5HFIA 14GSA 3KZQA 5FHIA 3FHKA 1HQOA 3VWWA 3H8QA 3NOFA 4F0CA 1OC9A 1X9MB 5IQYA 2H74A 1BQ7A 1PX7A 1LJRA 3ZTLA 5IO0A 4K8MA 3TOUA 1Q4JA 4MDCA 4QQ7A 3BCKA 3L78A 5F0GA 2HZEB 3IV4A 2IIYA 2DLXA 3EVIA 4O5RA 4OO5A 4WXTA 4K7OA 4ZBBA 5LNKe 4OCEA 3P2AA 11GSA 2HI7A 3Q18A 3M9JA 2CVDA 4F82A 4PURA 4IJ3A 1XW5A 1AC1A 1XW9A 1OC8A 3DRNA 3NZNA 5B8AA 3HVXA 3TJFA 3ZRDA 2FHEA 5B6MA 3GX0A 2ZCTA 4HJMA 3ZYWA 1LU4A 3U6VA 1OAZA 3VK9A 2R3XA 3LSZA 4XHMA 3HXSA 3UVTA 3WYWA 5DJLA 4ECJA 2I81A 5B7CA 4HI7A 3JCML 4KGIA 2RUFA 5CP1A 1HNBA 1FW1A 1JLVA 1DSBA 3HKRA 3HZ4A 1T7PB 4I2UA 4D73B 3H93A 4FYBA 4WBRD 4AF2A 3EC3A 4CW9A 1VF4A 4PQIA 4YAPA 1F9MA 5KN1A 1X5EA 1C72A 1PRXA 4MZWA 3HY2A 1F6MC 3LGCA 2DJ0A 2IMDA 2E7PA 1HD2A 3P90A 1GTUA 1Z7PA 1Z3EA 6GSWA 3GURA 16GSA 2GQKA 2HT9A 2LQQA 4XRAA 2E0QA 4KA0A 2DMLA 2H8LA 3G7JA 4LL4B 2KOKA 1R7HA 5ABRA 2I9HA 4TKYA 2C0DA 4MH2A 2X8GA 4FIWA 3KIJA 2CQ9A 1JZWA 1GSYA 2JADA 1SYXA 2PU9C 4ISDA 4Z7XA 2OADA 3ZVJA 3M9KA 1PQNA 4ZL7A 3EYTA 4KUNA 2NPBA 4KE3A 2AV4A 5A5KA 3WT1A 3IC4A 4NXIA 3HJPA 5IOXA 3EMXA 3DKSA 1TXXA 5GZZB 2AUVA 3L0HA 4CDOA 1TU7A 4HDEA 1URMA 1USBA 3UMAA 3HCZA 2CAIA 3F63A 1A8YA 1XFLA 1QUWA 1OC3A 4KH7A 3GYKA 4TOPA 4V2NA 4ZBAA 4MP4A 2B7JA 2H6ZA 1F3AA 3TOTA 1GULA 3F4RA 3LEFA 4K1FA 2FWFA 1O73A 4WF4A 2DJ3A 1SK2A 3EE2A 5KEJA 4J56E 3TRQA 4ZB6A 3OR5A 1GSUA 5ID2B 5DVBA 1TK8B 2WCIA 1BJXA 3GFKA 5CNWA 4MPGA 1I9DA 4XIHA 4TN8A 2TRXA 1HNCA 2XC2A 2AHEA 1M9BA 5JCWA 1GNWA 1IYIA 2PMTA 4O7HA 1YZXA 1GSFA 3EINA 3F0IA 3UBKA 3TJGA 5H5QA 3KH9A 3VFIA 4IKHA 1SYRA 2ES7A 1PMTA 2YWNA 2GT5A 2DBCA 1YF1A 2ALBA 4N30A 2MBTA 2MMOA 1V40A 5EVOA 1DUGA 4MMMA 4L0UA 1VF2A 3BCIA 3ZIJA 4ZIJA 3F8UA 2O87A 3GHAA 4PUFC 5DAKB 3MAKA 1SL2B 3Q74A 3GRXA 2X8CA 6GSTA 3IK9A 3QD9A 3HVSA 1SJIA 1DE1A 2VL9A 4RQXA 1ILOA 4BVXA 2B5XA 1ZZYA 3IAS2 4X0XA 5CRDA 2GLRA 1SK0A 1YDKA 5A4VA 4PQ1A 3I6AA 4KCEA 1FVJA 3LQ7A 3UL3A 4KX4A 2C8UA 1SKWB 1EZKA 4POKA 4ZL9A 2MMAA 3E9JB 3FZ9A 3ZMLA 4GQFA 2VL2C 3LORA 1JHBA 4K0GA 5E4WA 2FWHA 4HJ2A 4JE1A 5ECHB 1X5CA 4ECIA 1PKWA 2V6OA 1WOUA 1V98A 3GNJA 5G2ZA 3QFAC 2NVLA 3L9UA 3L4NA 1BG5A 1T1VA 5ECIB 1R5PA 5J41A 2LJKA 2KP1A 2L6DA 1V2AA 3VWVA 2A2SA 2HSYA 3UIWA 3VI7A 2H0GA 3ERWA 2VOCA 2J23A 1NHYA 3QMXA 3BBYA 3ZITA 3KGKA 1A2JA 3LG6A 3TKSE 1FO5A 4MJCA 4GSTA 4KDYA 5EL8A 1OE7A 3KMNA 1LBKA 1O6JA 3IOSA 2GVPA 3TKRA 3WGXA 1OC9B 6GSXA 3CMIA 1U3IA 4NMUA 1PKZA 1A8LA 3RBTA 3FEUA 5ENUA 3L9SA 4IJIA 2QC7A 1TI1A 4MF5A 3ZMKA 2OJLA 4LLRA 2XHFA 5GSSA 1RK4A 2IN3A 4HEA2 5LCZA 1AXDA 1O8XA 2VD0A 12GSA 3F3QA 2RIIA 1HYUA 2CAQA 2VL2A 4KAEA 1MTCA 1QK8A 1F3BA 1YKAA 2K8SA 3ME8A 1XOBA 4GSNA 2VO4A 1TK5B 4G10A 5FWGA 3BD2A 1BYEA 1BEDA 4MJEA 2IMIA 2PPTA 3QFBC 6GSUA 3WGDA 1TRUA 2LEGA 2E2MA 1TKDB 3ISOA 2LUSA 4OCFA 2VIMA 4K6XA 2HNLA 2F51A 2YV7A 2GSTA 1EWXA 2H30A 2H6XA 3KMOA 1A2LA 4AJ6A 1EOGA 4X1UA 4MCUA 4G19A 4ML1A 4IELA 5G5FA 4ECBA 3PR8A 1K0NA 1MDJA 1EGOA 2LS5A 4MZBA 1AIUA 5ECKB 2TRCP 1ERTA 3A2XA 3VPQA 5HFKA 4LL1B 2L5LA 3V1WA 1UVZA 2LNSA 2VUPA 2JACA 4GF0A 3HJMA 4L5LA 5DDLA 5B6NA 3P7XA 4N0VA 3ZZXA 1XBSA 3F3RA 2K8VA 5G30A 3FYGA 4K7NA 2GQMA 1XIYA 2EIOA 1B8XA 1SENA 3TJJA 1OKTA 2MYGA 4IQ1A 2FA8A 1SK1A 2YWOA 1GRXA 3GSSA 1Z7RA 4IP1A 2K18A 2VLUA 4TR3A 3D4MA 1NM3A 1MDKA 4GCIA 4N0ZA 5EPFA 2TIRA 4EDYA 3KD0A 3I69A 1XWKA 3M1GA 2DJ1A 1GSSA 2WGRA 3C1RA 3BOAA 3WT2A 2DJ2A 5HR1A 1K0MA 4TR1B 1M2DA 1VF3A 2R37A 1CQGA 2FWGA 4ILFA 2R6KA 1K0DA 3ME7A 1EV9A 5CO3A 4RUVA 1YF0A 2VCTA 3F6FA 4I97A 1F37A 4PGTA 3KP9A 4J57E 1AAZA 1SJ6A 2FGXA 3KTLA 4JRRA 2ON5A 3KP8A 3GN3A 4KB3A 4KNDA 1ML6A 3E3EA 2YWMA 1GUMA 5F8BA 4GQCA 3N5OA 3FK8A 3G9BA 1TU8A 2V2GA 2R5GA 2IMEA 1DE2A 2DIZA 4G9HA 1U6TA 5L71A 3LYPA 3N9JA 3FY7A 3HA9A 4YAVA 2CT6A 2BJXA 3GH6A 1M7TA 2HSHA 4V1Ap 4JU5A 4NHZA 2CA8A 2FUG2 2O89A 3KEBA 1G6YA 2Z9SA 2O8VB 5CRWA 4NV5A 4FYUA 4CHSA 1VF1A 1XWAA 1SL0B 3KXOA 5AISA 1B9XC 1R5AA 1K0AA 5G1KA 4TW5A 1EEMA 4AJ7A 3C8EA 3IE3A 1V58A 5HR0A 5J9BA 1O85A 3TKPA 1EOHA 3E0UA 4YQUA 4MPFA 5C04A 2H70A 3IXRA 1CQHA 2B7KA 1K3YA 2GS3A 2C4JA 2VL3A 3G7YA 1EV4A 2I1UA 3DMLA 1QMVA 3S9FA 3ED3A 3GTUA 1XZOA 1K0BA 5CYYA 1Z6MA 1QQ2A 5HR2A 1KNGA 1RQMA 3PGTA 2VCXA 2B6MA 4ECCA 5IMZA 3W6GA 1WJKA 4DSSA 4WEYA 2VCWA 2IFQA 2LJAA 3GL5A 4PUAA 2OE1A 3F4SA 1OVNA 5KN3A 4ZILA 2NDOA 5INYA 2P5QA 2B5YA 2AB6A 1XOAA 5DALA 2PN8A 2YJHA 3DIEA 3VWUA 3CYNA 3P8WA 4E8HA 1TDIA 4HQSA 2CVBA 2VCZA 1BX9A 3QR6A 1OYJA 17GSA 2V6KA 1TW9A 2WJUA 4ZBDA 4WR4A 1NW2A 3MNGA 3M0FA 5DCHA 2PVOC 3Q19A 1A2MA 1FHEA 1GTBA 3VPTA 2YOIA 3IAM2 2YCDA 4O92A 3VWXA 1GSDA 3D21A 2FD3A 3FZ4A 1XVQA 2IPAA 1TRWA 1WIKA 3AY8A 2D2ZA 2PERA 1XWBA 1JZOA 3KTBA 4JEDA 5H5RA 4F0BA 1M0UA 4WF5A 2OBKA 3HJOA 1THXA 2GQLA 4MJBA 2WFCA 2JSYA 2GDRA 5D8IA 2IMFA 2R2JA 2B5EA 3LJRA 3KH7A 1GTIA 1XW6A 1UA5A 1NSWA 5DJMA 4Q5NA 3HDCA 2P5RA 4WETA 3TGZA 1M9AA 2LRTA 4TVEA 2C0FA 2YWIA 4RI6A 2P0GA 1MD3A 5D9WA 3QAWA 4KCAA 2ZUPA 4JBBA 4N10A 3IA1A 5ELAA 2NTOA 3ZL5A 3TKSC 1WRYA 2F8AA 1AQXA 4BPYA 1F2EA 3MSZA 2VLVA 5DCGA 2HE3A 4ML6A 3RHBA 2WRTA 3O3TA 4DSQA 2B3SA 2J9HA 3RPNA 2CV4A 5DBQA 2YN1A 3EWLA 1V57A 4ULXA 4PXOA 5JWOB 5GAND 2F3MA 3GUSA 4ACSA 2H1AA 3TJKA 1FVKA 1T8EB 3GH9A 1IYHA 2V32A 4L5OA 3F9UA 1ZOFA 3J7Yk 3EMPA 5COHA 3UJ1A 2YJ7A 2A4VA 2H73A 5DQSA 1B4QA 3KM6A 2H75A 1WPIA 6GSVA 3TKSA 2N5FA 2H71A 4ZB9A 3IBHA 2CX3A 1FAAA 4DEJA 2IL3A 4OFNA 1TK0B 3US3A 3ZFBA 4F2IA 2CVKA 2RUEA 2DC5A 4E8EA 1TRSA 2BMXA 4BL7A 1Z9HA 2R4VA 1SJZA 4OO4A 2F8FA 3A3TA 3PH9A 4EUYA 4I6XA 1YQ1A 1PSQA 5J9CA 1M2BA 2OACA 1TJDA 4POLA 1DBYA 1T4ZA 5IOWA 5GSTA 2FNOA 1GUKA 4Q5QA 5IPHA 2AJQB 3GKXA 4GTUA 2WB9A 3F6DA 1X5DA 1A0RP 1Q98A 4XTSA 3FRCA 3I43A 3GIXA 5JWRB 2DSAA 1X0RA 4XS4A 2L4QA 3CXGA 3TRPA 4G2EA 4LMWA 4J2FA 3UVHA 4K2DA 2LNTA 1GWCA 4BWSA 2C3QA 2V41A 3GKNA 2C3NA 2L4CA 2M80A 3QDNA 1Y25A 2LJRA 3FZAA 1K0OA 3QCPA 1T4YA 3MDKA 4IW9A 2VM1A 1ZYQB 5ECMB 3C73A 3QAGA 3APOA 4IVFA 3FR9A 2MMNA 2PGTA 3LFLA 4DSRA 1ERUA 5DAKA 4BA7A 3D5JA 4Q5RA 2QGVA 4MLYA 5HR3A 1MD4A 3O76A 2AYTA 4TR0A 1ABAA 3GA4A 2YZUA 3QPMA 2GZZA 3GMFA 1U3AA 2GT6A 1KBNA 3LWAA 5JWQB 3CRUA 2HRFA 1WP0A 2X99A 3DXBA 3HHVA 1B9YC 3TDGA 4HZ2A 4IS0A 3LYKA 3KJYA 2XBIA 4EE0A 3DYRA 1ZGNA 2WS2A 3QOUA 3GL3A 3GSTA 5ECOB 1QFNA 4TXOA 3RDWA 1R26A 2YV9A 4ZL8A 4NHWA 3IRAA 4PNGA 2A2RA 4JR6A 4MABA 1GLPA 3IDVA 3H1NA 1M2AA 4I5QA 2B1LA 3GX8A 1EP7A 1AQWA 4V2LA 4I8BA 5J5NA 4GXZA 2YP6A 2GZPA 5AIXA 3W8JA 4TXVA 1PX6A 3RPPA 2FA4A 3FW2A 4OMVA 1GP1A 2JSZA 3FR3A 1B48A 1HNAA 3GTUB 1T00A 1KTEA 1E6BA 20GSA 2MBSA 4GRFA 3GKMA 3FKFA 3W8SA 4MK3A 2DIYA 2H0HA
chains in the Genus database with same CATH superfamily
3EURA 2JL4A 4K7IA 3TUEA 3CSJA 3UEMA 4DSSB 1GNEA 1B4PA 3UBLA 2IFQB 1SD8A 3WD6A 4MJAA 4QL7A 4NAXA 3FZ5A 2LRCA 3VLNA 2MZCA 1PGTA 5D73A 1WE0A 3ERFA 4MH3A 5DALB 2JU5A 2KP2A 1QXHA 3D0ZA 4A5PA 3SBCA 3ZFLA 3ERGA 3WGEA 1A24A 2JZTA 4GWRA 10GSA 3CSIA 2NBSA 3EU3A 4EO3A 2KLXA 2H01A 2R0GA 3KCMA 2H66A 4JZQA 3TRXA 4YQVA 1ZL9A 5CRGA 2G2QA 1ACVA 2OBIA 4IBPA 4YH2A 5ECLB 1FG4A 3UARA 3IPZA 4KDXA 3R2QA 4YQMA 4HZ4A 13GSA 1W89A 5D9TA 2EIQA 3A5IA 5G5EA 1JLWA 2HZFA 1ST9A 5ECQB 1ZYNA 1WWJA 3TJBA 2ZNMA 3O6TA 2C0GA 3CSHA 2A4HA 1VGLA 2XBQA 5IM9A 3TB2A 3A2WA 3D22A 2VCVA 2YZHA 2UZ8A 2WZ9A 3I9V2 4I2TA 4F03A 2XPEA 1SU9A 2H0IA 1Y6EA 8GSSA 19GSA 1XXUA 5ECSA 2R0PA 4ZB8A 1ERVA 4BVYA 4AGSA 4OD7A 2CZ2A 1PL1A 2C1YA 1GSQA 5IMAA 3M3MA 2OE3A 4RQRA 1XWCA 2KHPA 1ERWA 2FWEA 5C00A 1G7EA 2LTKA 5D9XA 2XPDA 3CTFA 1J08A 2B1KA 2IWTA 1H75A 1J9BA 1E2YA 2M72A 1VRSD 1UC7A 1N8JA 3A2VA 4PX1A 3DD3A 1G0TA 9GSSA 5CAXA 5A4UA 1M3JA 2L59A 2RM5A 4O32A 1XCCA 3C71A 5AIVA 4Q5FA 3CRTA 3ZREA 5KN0A 3DWVA 2L57A 3C7MA 1S3CA 2PBJA 2LKUA 3APQA 1X9SB 1XVWA 5IMDA 3ZVJD 1PN9A 1A23A 2HZEA 2C0EA 2LRNA 3DGQA 3LXZA 1ZYPA 3GV1A 1FOHA 1T3BA 1FB6A 4TR1A 2X8HA 2LSTA 4K2XA 2HFDA 2VD1A 4ID0A 3BJ5A 4HOJA 2HLSA 5IIZA 4EVMA 3LXTA 5F06A 4POMA 3D6IA 5G1LA 2RM6A 2WULA 2RLIA 2KUCA 4HUAA 2VAFA 1K3OA 3NIVA 4BL7B 1GH2A 4KF9A 1GL8A 22GSA 2GSSA 1G6WA 3UOMA 3K8NA 3H79A 1OE8A 3UAPA 1X9WB 1K3LA 4TRXA 3TKQA 1ZMAA 5ECRB 5F05A 5ECNB 1TRVA 2X64A 1EP8A 4GLTA 4L8EA 3VURA 5DQYA 2O7KA 4DVCA 3ZIVA 3DEXA 1MDIA 5FT3A 2H19A 1ZYEA 2C3TA 3HD5A 3FR6A 4P3YB 4WBJA 4D73A 1KEBA 4NWYA 5IMVA 1BAYA 4QL9A 2G0FA 1SL1B 5G31A 4HQZA 1H4OA 3HVVA 2QKEA 3IHQA 4K0NA 4XS4B 5D93A 5HFGA 3QAVA 4FH8A 1YY7A 4IN0A 2MMZA 4RI7A 1GSEA 4GSSA 3CTGA 4WR5A 5ECPB 3PINA 4K9ZA 2DMMA 3D4TA 1V9WA 3H4KA 4V1Ag 1TI3A 1XPVA 3HZ8A 1W4VA 4HU9A 1O8WA 5D9VA 2CZ3A 2VM2A 5CRHA 2JZSA 4PNFA 4EIPA 5CREA 1EGRA 2GSQA 3Q6OA 2AAWA 1A0FA 4EXJA 1TOFA 1AUCA 2PWJA 4XS1A 1ON4A 3TCOA 2K9FA 6GSYA 2I3YA 2LQOA 2N5BA 1MEKA 4L0WA 5D96A 3IK7A 2HYXA 1R4WA 3M8NA 1JFUA 2FCHA 1O7UA 5IPGA 5HQPA 3HYPA 2GSRA 4TXOB 2P31A 4LMVA 2PUKC 4IHUA 1SD9A 4ZXGA 5LD0A 1YEPA 4FYCA 3RAZA 2K6VA 2H72A 4HU7A 1S3DA 2EIRA 4OWYA 2IMKA 4PQHA 7GSSA 4H86A 5A4WA 2HXKA 4LA1A 5BRTA 1Z5YE 4WKWA 2DJJA 5IMFA 1GLQA 5J4UA 1JZDA 1O81A 2FLSA 18GSA 2YNXA 5EY6A 3ZLPA 5J3RA 1GTAA 1N2AA 6GSSA 2BTOT 2OA7A 5ID2A 2DJKA 4MZCA 3GKKA 1TP9A 4POBA 2H1DA 2CX4A 5B8BA 3U5RE 4XCSA 4EC0A 2PVQA 3EU4A 3CBUA 5JCGA 1AW9A 4MA9A 4N11A 5H5SA 1QGVA 1PA3A 1M99A 4KW6A 4OFTA 1Z6NA 1TTZA 2E2GA 4EDZA 2LV3A 4Z2TA 4IGJA 1U88A 1YEXA 2FY6A 2IJYA 4F9ZA 5IMCA 2H1GA 1FB0A 1PD21 3A5WA 1J0FA 3G7IA 1PL2A 4OFMA 4XRDA 3J7Yb 5F07A 4KDUA 1NHOA 2ON7A 5E59A 4IQAA 4TR4A 5AGYA 4EL1A 2H1BA 2EC4A 2OE0A 2VLTA 3IR4A 4IP6A 1THOA 2O85A 1JZRA 1EEJA 3C1SA 2WDUA 5KN2A 1S3AA 2GTUA 1UN2A 5IO2A 1SKRB 3DVXA 5ELGA 1YKCA 4MF6A 4X43A 1SKSB 3SWLA 4EF0A 1K0CA 3HVNA 2H6YA 4XS6A 2GZYA 2QSIA 4KSOA 2YANA 4EKZA 1AQVA 2L5OA 1RW1A 2JZRA 3APSA 4FO5A 3PPUA 1WMJA 1GUHA 2HRNA 2H76A 2N5AA 1I5GA 3MWHA 2V1MA 4NPBA 1FOVA 4YKFA 4KSMA 4AJ8A 2I4AA 4HS1A 4NV2A 3RHCA 3VI5A 3DVWA 5GAPD 5AN1A 4BVYB 1ZCPA 1U87A 2OKAA 2F9SA 2YPMA 2C80A 2GGTA 5JCUA 2REMA 3F4TA 3L9VA 4V2MA 1XWGA 4K5RA 4BWQA 4MF7A 1G7OA 2L6CA 2VCQA 1YJ6A 4JR4A 2M46A 1OKDA 5HFIA 14GSA 3KZQA 5FHIA 2R0CA 3FHKA 1HQOA 3VWWA 3H8QA 3NOFA 4F0CA 1OC9A 1X9MB 5IQYA 2H74A 1BQ7A 1PX7A 1LJRA 4O5UA 3ZTLA 5IO0A 4K8MA 3TOUA 1Q4JA 4MDCA 4QQ7A 3BCKA 3L78A 5F0GA 2HZEB 3IV4A 2IIYA 2DLXA 3EVIA 4O5RA 4OO5A 4WXTA 4K7OA 4ZBBA 5LNKe 4OCEA 3P2AA 11GSA 2HI7A 3Q18A 3M9JA 2CVDA 4F82A 2QA2A 4PURA 4IJ3A 1XW5A 1AC1A 1XW9A 1OC8A 3DRNA 3NZNA 5B8AA 3HVXA 3TJFA 3ZRDA 2FHEA 5B6MA 3GX0A 2ZCTA 4HJMA 3ZYWA 1LU4A 3U6VA 1OAZA 3VK9A 2R3XA 3LSZA 4XHMA 3HXSA 1PFOA 3UVTA 3WYWA 5DJLA 4ECJA 2I81A 5B7CA 4HI7A 3JCML 4KGIA 2RUFA 5CP1A 1HNBA 1FW1A 1JLVA 1DSBA 3HKRA 3HZ4A 1T7PB 4I2UA 4D73B 3H93A 4FYBA 4WBRD 4AF2A 3EC3A 4CW9A 1VF4A 4PQIA 4YAPA 1F9MA 5KN1A 4K5SA 1X5EA 1C72A 1PRXA 4MZWA 3HY2A 1F6MC 3LGCA 2DJ0A 2IMDA 2E7PA 1HD2A 1PN0A 3P90A 1GTUA 1Z7PA 1Z3EA 6GSWA 3GURA 16GSA 2GQKA 2HT9A 2LQQA 4XRAA 2E0QA 4KA0A 2DMLA 2H8LA 3CQFA 3G7JA 4LL4B 2KOKA 1R7HA 5ABRA 2I9HA 4TKYA 4USSA 2C0DA 4MH2A 2X8GA 4FIWA 3KIJA 2CQ9A 1JZWA 1GSYA 2JADA 1SYXA 2PU9C 4MNNA 4ISDA 4Z7XA 2OADA 3ZVJA 3M9KA 1PQNA 4ZL7A 3EYTA 4KUNA 2NPBA 4KE3A 2AV4A 5A5KA 3WT1A 3EPTA 3IC4A 4NXIA 3HJPA 5IOXA 3EMXA 3DKSA 1TXXA 5GZZB 2AUVA 3L0HA 4CDOA 1TU7A 4HDEA 1URMA 1USBA 4FQUA 3UMAA 3R3EA 3HCZA 2CAIA 3F63A 1A8YA 1XFLA 1QUWA 1OC3A 4KH7A 3GYKA 4TOPA 4V2NA 4ZBAA 4MP4A 2B7JA 2H6ZA 1F3AA 3TOTA 1GULA 3F4RA 3LEFA 4K1FA 2FWFA 1O73A 4WF4A 2DJ3A 1SK2A 3EE2A 5KEJA 4J56E 3TRQA 4ZB6A 3OR5A 1GSUA 5ID2B 5DVBA 1TK8B 2WCIA 1BJXA 3GFKA 5CNWA 4MPGA 1I9DA 4XIHA 4TN8A 2TRXA 1HNCA 2XC2A 2AHEA 1M9BA 5JCWA 1GNWA 1IYIA 2PMTA 4O7HA 1YZXA 1GSFA 3EINA 3F0IA 3UBKA 3TJGA 5H5QA 3KH9A 3VFIA 4IKHA 1SYRA 2ES7A 1PMTA 2YWNA 2GT5A 2DBCA 1YF1A 2ALBA 4N30A 2MBTA 2MMOA 1V40A 5EVOA 1DUGA 4MMMA 4L0UA 1VF2A 3BCIA 3ZIJA 4ZIJA 3F8UA 2O87A 3GHAA 4PUFC 5DAKB 3MAKA 1SL2B 3Q74A 3GRXA 2X8CA 6GSTA 3IK9A 4O5QA 3QD9A 3HVSA 1SJIA 1DE1A 2VL9A 4RQXA 1ILOA 4PTSA 4BVXA 2B5XA 1ZZYA 3IAS2 4X0XA 5CRDA 2GLRA 1SK0A 1YDKA 5A4VA 4PQ1A 3I6AA 4KCEA 1FVJA 3LQ7A 3UL3A 4KX4A 2C8UA 1SKWB 1EZKA 4POKA 4ZL9A 2MMAA 3E9JB 3FZ9A 3ZMLA 4GQFA 2VL2C 3LORA 1JHBA 4K0GA 5E4WA 2FWHA 4HJ2A 4JE1A 5ECHB 1X5CA 4ECIA 1PKWA 2V6OA 1WOUA 1V98A 3GNJA 5G2ZA 3QFAC 2NVLA 3L9UA 3L4NA 1BG5A 1T1VA 5ECIB 1R5PA 5J41A 2LJKA 2KP1A 2L6DA 1V2AA 3VWVA 2A2SA 2HSYA 3UIWA 3VI7A 2H0GA 3ERWA 2VOCA 2J23A 1NHYA 3QMXA 3BBYA 3ZITA 3KGKA 1A2JA 3LG6A 3TKSE 1FO5A 4MJCA 4YKGA 4GSTA 4KDYA 5EL8A 3MIXA 1OE7A 3KMNA 1LBKA 1O6JA 3IOSA 2GVPA 3TKRA 3WGXA 1OC9B 6GSXA 3CMIA 1U3IA 4NMUA 1PKZA 1A8LA 5KOWA 3RBTA 3FEUA 5ENUA 3L9SA 4IJIA 2QC7A 1TI1A 4MF5A 3ZMKA 2OJLA 4LLRA 2XHFA 5GSSA 1RK4A 2IN3A 4HEA2 5LCZA 1AXDA 1O8XA 2VD0A 12GSA 3F3QA 2RIIA 1HYUA 2CAQA 2VL2A 4KAEA 1MTCA 1QK8A 1F3BA 1YKAA 2K8SA 3ME8A 1XOBA 4GSNA 2VO4A 1TK5B 4G10A 5FWGA 3BD2A 1BYEA 1BEDA 3IC8A 4MJEA 2IMIA 2PPTA 3QFBC 6GSUA 3WGDA 1TRUA 2LEGA 2E2MA 1TKDB 3ISOA 2LUSA 4OCFA 2VIMA 4K6XA 2HNLA 2F51A 2YV7A 2GSTA 1EWXA 2H30A 2H6XA 3KMOA 1A2LA 2X49A 4AJ6A 1EOGA 4X1UA 4MCUA 4G19A 4ML1A 4IELA 5G5FA 4ECBA 3PR8A 1K0NA 1MDJA 4CY8A 1EGOA 2LS5A 4MZBA 1AIUA 5ECKB 2TRCP 1ERTA 3A2XA 3VPQA 5HFKA 4LL1B 2L5LA 3V1WA 1UVZA 2LNSA 2VUPA 4BIKA 2JACA 4GF0A 3HJMA 4L5LA 5DDLA 5B6NA 3P7XA 4N0VA 3ZZXA 1XBSA 3F3RA 2K8VA 5G30A 3FYGA 4K7NA 2GQMA 1XIYA 2EIOA 1B8XA 1SENA 3TJJA 1OKTA 2MYGA 4IQ1A 2FA8A 1SK1A 2YWOA 1GRXA 3GSSA 1Z7RA 4IP1A 2K18A 2VLUA 4TR3A 3D4MA 1NM3A 1MDKA 4GCIA 4N0ZA 5EPFA 2TIRA 4EDYA 3KD0A 3I69A 1XWKA 3M1GA 2DJ1A 1GSSA 2WGRA 1M3IA 3C1RA 3BOAA 3FMWA 2DJ2A 3WT2A 5HR1A 1K0MA 4TR1B 1M2DA 1VF3A 2R37A 1CQGA 2FWGA 4ILFA 2R6KA 1K0DA 3ME7A 1EV9A 5CO3A 5KOXA 4RUVA 1YF0A 2VCTA 3F6FA 4I97A 1F37A 4PGTA 3KP9A 4J57E 1AAZA 1SJ6A 2FGXA 3KTLA 4JRRA 2ON5A 3KP8A 3GN3A 4KB3A 4KNDA 1ML6A 3E3EA 2A2PA 2YWMA 1GUMA 5F8BA 4GQCA 3N5OA 3FK8A 3G9BA 1TU8A 2V2GA 2R5GA 2IMEA 1DE2A 2DIZA 4G9HA 1U6TA 5L71A 3LYPA 3N9JA 3FY7A 3HA9A 4YAVA 2CT6A 2BJXA 3GH6A 1M7TA 2HSHA 4V1Ap 4JU5A 4NHZA 2CA8A 2FUG2 2O89A 3KEBA 1G6YA 2Z9SA 2O8VB 4HSCX 5CRWA 4NV5A 4FYUA 4CHSA 1VF1A 1XWAA 1SL0B 3KXOA 5AISA 1B9XC 1R5AA 1K0AA 5G1KA 4TW5A 1EEMA 4AJ7A 3C8EA 3IE3A 1V58A 5HR0A 5J9BA 1O85A 3TKPA 1EOHA 3E0UA 4YQUA 4MPFA 5C04A 2H70A 3IXRA 1CQHA 2B7KA 1K3YA 2GS3A 2C4JA 2VL3A 3G7YA 1EV4A 2I1UA 3DMLA 1QMVA 3S9FA 3ED3A 3GTUA 1XZOA 1K0BA 5CYYA 1Z6MA 1QQ2A 5HR2A 1KNGA 1RQMA 3PGTA 2VCXA 2B6MA 4ECCA 5IMZA 3W6GA 1WJKA 4DSSA 4WEYA 2VCWA 2IFQA 2LJAA 3GL5A 4PUAA 3MYDA 2OE1A 3F4SA 1OVNA 5KN3A 4ZILA 2NDOA 5INYA 2P5QA 2B5YA 4BVXB 2AB6A 1XOAA 5DALA 2PN8A 2YJHA 3DIEA 3VWUA 3CYNA 3P8WA 4E8HA 1TDIA 4HQSA 2CVBA 4G0KA 2VCZA 1BX9A 3QR6A 1OYJA 17GSA 2V6KA 1TW9A 2WJUA 4ZBDA 4WR4A 1NW2A 3MNGA 3M0FA 4CY6A 5DCHA 2PVOC 3Q19A 1A2MA 1FHEA 1GTBA 3VPTA 2YOIA 3IAM2 2YCDA 4O92A 3VWXA 1GSDA 3D21A 2FD3A 3FZ4A 1XVQA 2IPAA 1TRWA 1WIKA 3AY8A 2D2ZA 2PERA 1XWBA 1JZOA 3KTBA 4JEDA 5H5RA 4F0BA 1M0UA 4WF5A 2OBKA 3HJOA 1THXA 2GQLA 4MJBA 2WFCA 2JSYA 2GDRA 5D8IA 2IMFA 2R2JA 2B5EA 3LJRA 3KH7A 1GTIA 2X4AA 1XW6A 1UA5A 1NSWA 5DJMA 4Q5NA 3HDCA 2P5RA 4WETA 3TGZA 1M9AA 2LRTA 4TVEA 2C0FA 2YWIA 4RI6A 2P0GA 1MD3A 5D9WA 3QAWA 4KCAA 2ZUPA 2HRKA 4JBBA 4N10A 3IA1A 5ELAA 2NTOA 3ZL5A 3TKSC 1WRYA 2F8AA 4G0LA 1AQXA 4BPYA 1F2EA 2HRAA 3MSZA 2VLVA 5DCGA 2HE3A 4ML6A 3RHBA 2WRTA 3O3TA 4Z2RA 4DSQA 2B3SA 2J9HA 3RPNA 2CV4A 5DBQA 2YN1A 3EWLA 1V57A 4ULXA 4PXOA 5JWOB 5GAND 2F3MA 5BMUA 3GUSA 4ACSA 2H1AA 3TJKA 4EIQA 1FVKA 1T8EB 3GH9A 1IYHA 2V32A 4L5OA 3F9UA 1ZOFA 3J7Yk 3EMPA 5COHA 3UJ1A 2YJ7A 2A4VA 2H73A 5DQSA 1B4QA 3KM6A 2H75A 1WPIA 6GSVA 3TKSA 2N5FA 3LW9A 2H71A 4ZB9A 3IBHA 2CX3A 1FAAA 4DEJA 2IL3A 4OFNA 1TK0B 3US3A 3ZFBA 4F2IA 2CVKA 2RUEA 2DC5A 4E8EA 1TRSA 1XG8A 2BMXA 4BL7A 1Z9HA 2R4VA 1SJZA 4OO4A 2F8FA 3A3TA 3PH9A 4EUYA 4I6XA 1YQ1A 1PSQA 5J9CA 1M2BA 3IHGA 2OACA 1TJDA 4POLA 1DBYA 1T4ZA 5IOWA 5GSTA 2FNOA 1GUKA 4Q5QA 5IPHA 2AJQB 3GKXA 4GTUA 2WB9A 3F6DA 1X5DA 1A0RP 1Q98A 2DKHA 4XTSA 3FRCA 3I43A 3GIXA 5JWRB 2DSAA 1X0RA 4XS4A 2L4QA 3CXGA 3TRPA 4G2EA 4LMWA 4J2FA 3UVHA 4K2DA 2LNTA 1GWCA 4BWSA 2C3QA 2V41A 3GKNA 2C3NA 2L4CA 2M80A 2QA1A 3QDNA 1Y25A 2LJRA 3FZAA 1K0OA 3QCPA 1T4YA 3MDKA 4IW9A 2VM1A 1ZYQB 5ECMB 3C73A 3QAGA 3APOA 4IVFA 3FR9A 2MMNA 2DKIA 2PGTA 3LFLA 4X4JA 4DSRA 1ERUA 5DAKA 4BA7A 3D5JA 4Q5RA 2QGVA 4MLYA 5HR3A 1MD4A 3O76A 2AYTA 4TR0A 1ABAA 3GA4A 2YZUA 3QPMA 2GZZA 3GMFA 1U3AA 2GT6A 1KBNA 3LWAA 5JWQB 3CRUA 2HRFA 1WP0A 2X99A 3DXBA 3HHVA 1B9YC 3TDGA 4HZ2A 4IS0A 3LYKA 3KJYA 2XBIA 4EE0A 4ICYA 3DYRA 1ZGNA 2WS2A 3QOUA 3GL3A 3GSTA 5ECOB 1QFNA 4TXOA 3RDWA 1R26A 2YV9A 4ZL8A 4NHWA 3IRAA 4PNGA 2A2RA 4JR6A 4MABA 1GLPA 3IDVA 3H1NA 1M2AA 4I5QA 2B1LA 3GX8A 1EP7A 1AQWA 4V2LA 4I8BA 5J5NA 1S3RA 4GXZA 2YP6A 2GZPA 5AIXA 3W8JA 4TXVA 1PX6A 3RPPA 2FA4A 3FW2A 4G0IA 4Z2UA 4OMVA 1GP1A 2JSZA 3FR3A 1B48A 1HNAA 3GTUB 1T00A 1KTEA 1E6BA 20GSA 2MBSA 4GRFA 3GKMA 3FKFA 3W8SA 4MK3A 2HSMA 2DIYA 2H0HA
chains in the Genus database with same CATH topology
3EURA 2JL4A 4K7IA 3TUEA 3CSJA 3UEMA 4DSSB 1GNEA 1B4PA 3UBLA 2IFQB 1SD8A 3WD6A 4MJAA 4QL7A 4NAXA 3FZ5A 2LRCA 3VLNA 2MZCA 1PGTA 5D73A 1WE0A 3ERFA 4MH3A 5DALB 2JU5A 2KP2A 1QXHA 3D0ZA 4A5PA 3SBCA 3ZFLA 3ERGA 3WGEA 1A24A 2JZTA 4GWRA 10GSA 3CSIA 2NBSA 3EU3A 4EO3A 2KLXA 2H01A 2R0GA 3KCMA 2H66A 4JZQA 3TRXA 4YQVA 1ZL9A 5CRGA 2G2QA 1ACVA 2OBIA 4IBPA 4YH2A 5ECLB 1FG4A 3UARA 3IPZA 4KDXA 3R2QA 4YQMA 4HZ4A 13GSA 1W89A 5D9TA 2EIQA 3A5IA 5G5EA 1JLWA 2HZFA 1ST9A 5ECQB 1ZYNA 1WWJA 3TJBA 2ZNMA 3O6TA 2C0GA 3CSHA 2A4HA 1VGLA 2XBQA 5IM9A 3TB2A 3A2WA 3D22A 2VCVA 2YZHA 2UZ8A 2WZ9A 3I9V2 4I2TA 4F03A 2XPEA 1SU9A 2H0IA 1Y6EA 8GSSA 19GSA 1XXUA 5ECSA 2R0PA 4ZB8A 1ERVA 4BVYA 4AGSA 4OD7A 2CZ2A 1PL1A 2C1YA 1GSQA 5IMAA 3M3MA 2OE3A 4RQRA 1XWCA 2KHPA 1ERWA 2FWEA 5C00A 1G7EA 2LTKA 5D9XA 2XPDA 3CTFA 1J08A 2B1KA 2IWTA 1H75A 1J9BA 1E2YA 2M72A 1VRSD 1UC7A 1N8JA 3A2VA 4PX1A 3DD3A 1G0TA 9GSSA 5CAXA 5A4UA 2L59A 2RM5A 4O32A 1XCCA 3C71A 5AIVA 4Q5FA 3CRTA 3ZREA 5KN0A 3DWVA 2L57A 3C7MA 1S3CA 2PBJA 2LKUA 3APQA 1X9SB 1XVWA 5IMDA 3ZVJD 1PN9A 1A23A 2HZEA 2C0EA 2LRNA 3DGQA 3LXZA 1ZYPA 3GV1A 1FOHA 1T3BA 1FB6A 4TR1A 2X8HA 2LSTA 4K2XA 2HFDA 2VD1A 4ID0A 3BJ5A 4HOJA 2HLSA 5IIZA 4EVMA 3LXTA 5F06A 4POMA 3D6IA 5G1LA 2RM6A 2WULA 2RLIA 2KUCA 4HUAA 2VAFA 1K3OA 3NIVA 4BL7B 1GH2A 4KF9A 1GL8A 22GSA 2GSSA 1G6WA 3UOMA 3K8NA 3H79A 1OE8A 3UAPA 1X9WB 1K3LA 4TRXA 3TKQA 1ZMAA 5ECRB 5F05A 5ECNB 1TRVA 2X64A 1EP8A 4GLTA 4L8EA 3VURA 5DQYA 2O7KA 4DVCA 3ZIVA 3DEXA 1MDIA 5FT3A 2H19A 1ZYEA 2C3TA 3HD5A 3FR6A 4P3YB 4WBJA 4D73A 1KEBA 4NWYA 5IMVA 1BAYA 4QL9A 2G0FA 1SL1B 5G31A 4HQZA 1H4OA 3HVVA 2QKEA 3IHQA 4K0NA 4XS4B 5D93A 5HFGA 3QAVA 4FH8A 1YY7A 4IN0A 2MMZA 4RI7A 1GSEA 4GSSA 3CTGA 4WR5A 5ECPB 3PINA 4K9ZA 2DMMA 3D4TA 1V9WA 3H4KA 4V1Ag 1TI3A 1XPVA 3HZ8A 1W4VA 4HU9A 1O8WA 5D9VA 2CZ3A 2VM2A 5CRHA 2JZSA 4PNFA 4EIPA 5CREA 1EGRA 2GSQA 3Q6OA 2AAWA 1A0FA 4EXJA 1TOFA 1AUCA 2PWJA 4XS1A 1ON4A 3TCOA 2K9FA 6GSYA 2I3YA 2LQOA 2N5BA 1MEKA 4L0WA 5D96A 3IK7A 2HYXA 1R4WA 3M8NA 1JFUA 2FCHA 1O7UA 5IPGA 5HQPA 3HYPA 2GSRA 4TXOB 2P31A 4LMVA 2PUKC 4IHUA 1SD9A 4ZXGA 5LD0A 1YEPA 4FYCA 3RAZA 2K6VA 2H72A 4HU7A 1S3DA 2EIRA 4OWYA 2IMKA 4PQHA 7GSSA 4H86A 5A4WA 2HXKA 4LA1A 5BRTA 1Z5YE 4WKWA 2DJJA 5IMFA 1GLQA 5J4UA 1JZDA 1O81A 2FLSA 18GSA 2YNXA 5EY6A 3ZLPA 5J3RA 1GTAA 1N2AA 6GSSA 2BTOT 2OA7A 5ID2A 2DJKA 4MZCA 3GKKA 1TP9A 4POBA 2H1DA 2CX4A 5B8BA 3U5RE 4XCSA 4EC0A 2PVQA 3EU4A 3CBUA 5JCGA 1AW9A 4MA9A 4N11A 5H5SA 1QGVA 1PA3A 1M99A 4KW6A 4OFTA 1Z6NA 1TTZA 2E2GA 4EDZA 2LV3A 4Z2TA 4IGJA 1U88A 1YEXA 2FY6A 2IJYA 4F9ZA 5IMCA 2H1GA 1FB0A 1PD21 3A5WA 1J0FA 3G7IA 1PL2A 4OFMA 4XRDA 3J7Yb 5F07A 4KDUA 1NHOA 2ON7A 5E59A 4IQAA 4TR4A 5AGYA 4EL1A 2H1BA 2EC4A 2OE0A 2VLTA 3IR4A 4IP6A 1THOA 2O85A 1JZRA 1EEJA 3C1SA 2WDUA 5KN2A 1S3AA 2GTUA 1UN2A 5IO2A 1SKRB 3DVXA 5ELGA 1YKCA 4MF6A 4X43A 1SKSB 3SWLA 4EF0A 1K0CA 2H6YA 4XS6A 2GZYA 2QSIA 4KSOA 2YANA 4EKZA 1AQVA 2L5OA 1RW1A 2JZRA 3APSA 4FO5A 3PPUA 1WMJA 1GUHA 2HRNA 2H76A 2N5AA 1I5GA 3MWHA 2V1MA 4NPBA 1FOVA 4YKFA 4KSMA 4AJ8A 2I4AA 4HS1A 4NV2A 3RHCA 3VI5A 3DVWA 5GAPD 5AN1A 4BVYB 1ZCPA 1U87A 2OKAA 2F9SA 2YPMA 2C80A 2GGTA 5JCUA 2REMA 3F4TA 3L9VA 4V2MA 1XWGA 4K5RA 4BWQA 4MF7A 1G7OA 2L6CA 2VCQA 1YJ6A 4JR4A 2M46A 1OKDA 5HFIA 14GSA 3KZQA 5FHIA 2R0CA 3FHKA 1HQOA 3VWWA 3H8QA 3NOFA 4F0CA 1OC9A 1X9MB 5IQYA 2H74A 1BQ7A 1PX7A 1LJRA 4O5UA 3ZTLA 5IO0A 4K8MA 3TOUA 1Q4JA 4MDCA 4QQ7A 3BCKA 3L78A 5F0GA 2HZEB 3IV4A 2IIYA 2DLXA 3EVIA 4O5RA 4OO5A 4WXTA 4K7OA 4ZBBA 5LNKe 4OCEA 3P2AA 11GSA 2HI7A 3Q18A 3M9JA 2CVDA 4F82A 2QA2A 4PURA 4IJ3A 1XW5A 1AC1A 1XW9A 1OC8A 3DRNA 3NZNA 5B8AA 3HVXA 3TJFA 3ZRDA 2FHEA 5B6MA 3GX0A 2ZCTA 4HJMA 3ZYWA 1LU4A 3U6VA 1OAZA 3VK9A 2R3XA 3LSZA 4XHMA 3HXSA 3UVTA 3WYWA 5DJLA 4ECJA 2I81A 5B7CA 4HI7A 3JCML 4KGIA 2RUFA 5CP1A 1HNBA 1FW1A 1JLVA 1DSBA 3HKRA 3HZ4A 1T7PB 4I2UA 4D73B 3H93A 4FYBA 4WBRD 4AF2A 3EC3A 4CW9A 1VF4A 4PQIA 4YAPA 1F9MA 5KN1A 4K5SA 1X5EA 1C72A 1PRXA 4MZWA 3HY2A 1F6MC 3LGCA 2DJ0A 2IMDA 2E7PA 1HD2A 1PN0A 3P90A 1GTUA 1Z7PA 1Z3EA 6GSWA 3GURA 16GSA 2GQKA 2HT9A 2LQQA 4XRAA 2E0QA 4KA0A 2DMLA 2H8LA 3G7JA 4LL4B 2KOKA 1R7HA 5ABRA 2I9HA 4TKYA 4USSA 2C0DA 4MH2A 2X8GA 4FIWA 3KIJA 2CQ9A 1JZWA 1GSYA 2JADA 1SYXA 2PU9C 4MNNA 4ISDA 4Z7XA 2OADA 3ZVJA 3M9KA 1PQNA 4ZL7A 3EYTA 4KUNA 2NPBA 4KE3A 2AV4A 5A5KA 3WT1A 3EPTA 3IC4A 4NXIA 3HJPA 5IOXA 3EMXA 3DKSA 1TXXA 5GZZB 2AUVA 3L0HA 4CDOA 1TU7A 4HDEA 1URMA 1USBA 4FQUA 3UMAA 3R3EA 3HCZA 2CAIA 3F63A 1A8YA 1XFLA 1QUWA 1OC3A 4KH7A 3GYKA 4TOPA 4V2NA 4ZBAA 4MP4A 2B7JA 2H6ZA 1F3AA 3TOTA 1GULA 3F4RA 3LEFA 4K1FA 2FWFA 1O73A 4WF4A 2DJ3A 1SK2A 3EE2A 5KEJA 4J56E 3TRQA 4ZB6A 3OR5A 1GSUA 5ID2B 5DVBA 1TK8B 2WCIA 1BJXA 3GFKA 5CNWA 4MPGA 1I9DA 4XIHA 4TN8A 2TRXA 1HNCA 2XC2A 2AHEA 1M9BA 5JCWA 1GNWA 1IYIA 2PMTA 4O7HA 1YZXA 1GSFA 3EINA 3F0IA 3UBKA 3TJGA 5H5QA 3KH9A 3VFIA 4IKHA 1SYRA 2ES7A 1PMTA 2YWNA 2GT5A 2DBCA 1YF1A 2ALBA 4N30A 2MBTA 2MMOA 1V40A 5EVOA 1DUGA 4MMMA 4L0UA 1VF2A 3BCIA 3ZIJA 4ZIJA 3F8UA 2O87A 3GHAA 4PUFC 5DAKB 3MAKA 1SL2B 3Q74A 3GRXA 2X8CA 6GSTA 3IK9A 4O5QA 3QD9A 3HVSA 1SJIA 1DE1A 2VL9A 4RQXA 1ILOA 4PTSA 4BVXA 2B5XA 1ZZYA 3IAS2 4X0XA 5CRDA 2GLRA 1SK0A 1YDKA 5A4VA 4PQ1A 3I6AA 4KCEA 1FVJA 3LQ7A 3UL3A 4KX4A 2C8UA 1SKWB 1EZKA 4POKA 4ZL9A 2MMAA 3E9JB 3FZ9A 3ZMLA 4GQFA 2VL2C 3LORA 1JHBA 4K0GA 5E4WA 2FWHA 4HJ2A 4JE1A 5ECHB 1X5CA 4ECIA 1PKWA 2V6OA 1WOUA 1V98A 3GNJA 5G2ZA 3QFAC 2NVLA 3L9UA 3L4NA 1BG5A 1T1VA 5ECIB 1R5PA 5J41A 2LJKA 2KP1A 2L6DA 1V2AA 3VWVA 2A2SA 2HSYA 3UIWA 3VI7A 2H0GA 3ERWA 2VOCA 2J23A 1NHYA 3QMXA 3BBYA 3ZITA 3KGKA 1A2JA 3LG6A 3TKSE 1FO5A 4MJCA 4YKGA 4GSTA 4KDYA 5EL8A 3MIXA 1OE7A 3KMNA 1LBKA 1O6JA 3IOSA 2GVPA 3TKRA 3WGXA 1OC9B 6GSXA 3CMIA 1U3IA 4NMUA 1PKZA 1A8LA 5KOWA 3RBTA 3FEUA 5ENUA 3L9SA 4IJIA 2QC7A 1TI1A 4MF5A 3ZMKA 2OJLA 4LLRA 2XHFA 5GSSA 1RK4A 2IN3A 4HEA2 5LCZA 1AXDA 1O8XA 2VD0A 12GSA 3F3QA 2RIIA 1HYUA 2CAQA 2VL2A 4KAEA 1MTCA 1QK8A 1F3BA 1YKAA 2K8SA 3ME8A 1XOBA 4GSNA 2VO4A 1TK5B 4G10A 5FWGA 3BD2A 1BYEA 1BEDA 3IC8A 4MJEA 2IMIA 2PPTA 3QFBC 6GSUA 3WGDA 1TRUA 2LEGA 2E2MA 1TKDB 3ISOA 2LUSA 4OCFA 2VIMA 4K6XA 2HNLA 2F51A 2YV7A 2GSTA 1EWXA 2H30A 2H6XA 3KMOA 1A2LA 2X49A 4AJ6A 1EOGA 4X1UA 4MCUA 4G19A 4ML1A 4IELA 5G5FA 4ECBA 3PR8A 1K0NA 1MDJA 4CY8A 1EGOA 2LS5A 4MZBA 1AIUA 5ECKB 2TRCP 1ERTA 3A2XA 3VPQA 5HFKA 4LL1B 2L5LA 3V1WA 1UVZA 2LNSA 2VUPA 2JACA 4GF0A 3HJMA 4L5LA 5DDLA 5B6NA 3P7XA 4N0VA 3ZZXA 1XBSA 3F3RA 2K8VA 5G30A 3FYGA 4K7NA 2GQMA 1XIYA 2EIOA 1B8XA 1SENA 3TJJA 1OKTA 2MYGA 4IQ1A 2FA8A 1SK1A 2YWOA 1GRXA 3GSSA 1Z7RA 4IP1A 2K18A 2VLUA 4TR3A 3D4MA 1NM3A 1MDKA 4GCIA 4N0ZA 5EPFA 2TIRA 4EDYA 3KD0A 3I69A 1XWKA 3M1GA 2DJ1A 1GSSA 2WGRA 3C1RA 3BOAA 3FMWA 2DJ2A 3WT2A 5HR1A 1K0MA 4TR1B 1M2DA 1VF3A 2R37A 1CQGA 2FWGA 4ILFA 2R6KA 1K0DA 3ME7A 1EV9A 5CO3A 5KOXA 4RUVA 1YF0A 2VCTA 3F6FA 4I97A 1F37A 4PGTA 3KP9A 4J57E 1AAZA 1SJ6A 2FGXA 3KTLA 4JRRA 2ON5A 3KP8A 3GN3A 4KB3A 4KNDA 1ML6A 3E3EA 2A2PA 2YWMA 1GUMA 5F8BA 4GQCA 3N5OA 3FK8A 3G9BA 1TU8A 2V2GA 2R5GA 2IMEA 1DE2A 2DIZA 4G9HA 1U6TA 5L71A 3LYPA 3N9JA 3FY7A 3HA9A 4YAVA 2CT6A 2BJXA 3GH6A 1M7TA 2HSHA 4V1Ap 4JU5A 4NHZA 2CA8A 2FUG2 2O89A 3KEBA 1G6YA 2Z9SA 2O8VB 5CRWA 4NV5A 4FYUA 4CHSA 1VF1A 1XWAA 1SL0B 3KXOA 5AISA 1B9XC 1R5AA 1K0AA 5G1KA 4TW5A 1EEMA 4AJ7A 3C8EA 3IE3A 1V58A 5HR0A 5J9BA 1O85A 3TKPA 1EOHA 3E0UA 4YQUA 4MPFA 5C04A 2H70A 3IXRA 1CQHA 2B7KA 1K3YA 2GS3A 2C4JA 2VL3A 3G7YA 1EV4A 2I1UA 3DMLA 1QMVA 3S9FA 3ED3A 3GTUA 1XZOA 1K0BA 5CYYA 1Z6MA 1QQ2A 5HR2A 1KNGA 1RQMA 3PGTA 2VCXA 2B6MA 4ECCA 5IMZA 3W6GA 1WJKA 4DSSA 4WEYA 2VCWA 2IFQA 2LJAA 3GL5A 4PUAA 3MYDA 2OE1A 3F4SA 1OVNA 5KN3A 4ZILA 2NDOA 5INYA 2P5QA 2B5YA 4BVXB 2AB6A 1XOAA 5DALA 2PN8A 2YJHA 3DIEA 3VWUA 3CYNA 3P8WA 4E8HA 1TDIA 4HQSA 2CVBA 4G0KA 2VCZA 1BX9A 3QR6A 1OYJA 17GSA 2V6KA 1TW9A 2WJUA 4ZBDA 4WR4A 1NW2A 3MNGA 3M0FA 4CY6A 5DCHA 2PVOC 3Q19A 1A2MA 1FHEA 1GTBA 3VPTA 2YOIA 3IAM2 2YCDA 4O92A 3VWXA 1GSDA 3D21A 2FD3A 3FZ4A 1XVQA 2IPAA 1TRWA 1WIKA 3AY8A 2D2ZA 2PERA 1XWBA 1JZOA 3KTBA 4JEDA 5H5RA 4F0BA 1M0UA 4WF5A 2OBKA 3HJOA 1THXA 2GQLA 4MJBA 2WFCA 2JSYA 2GDRA 5D8IA 2IMFA 2R2JA 2B5EA 3LJRA 3KH7A 1GTIA 2X4AA 1XW6A 1UA5A 1NSWA 5DJMA 4Q5NA 3HDCA 2P5RA 4WETA 3TGZA 1M9AA 2LRTA 4TVEA 2C0FA 2YWIA 4RI6A 2P0GA 1MD3A 5D9WA 3QAWA 4KCAA 2ZUPA 2HRKA 4JBBA 4N10A 3IA1A 5ELAA 2NTOA 3ZL5A 3TKSC 1WRYA 2F8AA 4G0LA 1AQXA 4BPYA 1F2EA 2HRAA 3MSZA 2VLVA 5DCGA 2HE3A 4ML6A 3RHBA 2WRTA 3O3TA 4Z2RA 4DSQA 2B3SA 2J9HA 3RPNA 2CV4A 5DBQA 2YN1A 3EWLA 1V57A 4ULXA 4PXOA 5JWOB 5GAND 2F3MA 5BMUA 3GUSA 4ACSA 2H1AA 3TJKA 4EIQA 1FVKA 1T8EB 3GH9A 1IYHA 2V32A 4L5OA 3F9UA 1ZOFA 3J7Yk 3EMPA 5COHA 3UJ1A 2YJ7A 2A4VA 2H73A 5DQSA 1B4QA 3KM6A 2H75A 1WPIA 6GSVA 3TKSA 2N5FA 3LW9A 2H71A 4ZB9A 3IBHA 2CX3A 1FAAA 4DEJA 2IL3A 4OFNA 1TK0B 3US3A 3ZFBA 4F2IA 2CVKA 2RUEA 2DC5A 4E8EA 1TRSA 2BMXA 4BL7A 1Z9HA 2R4VA 1SJZA 4OO4A 2F8FA 3A3TA 3PH9A 4EUYA 4I6XA 1YQ1A 1PSQA 5J9CA 1M2BA 3IHGA 2OACA 1TJDA 4POLA 1DBYA 1T4ZA 5IOWA 5GSTA 2FNOA 1GUKA 4Q5QA 5IPHA 2AJQB 3GKXA 4GTUA 2WB9A 3F6DA 1X5DA 1A0RP 1Q98A 2DKHA 4XTSA 3FRCA 3I43A 3GIXA 5JWRB 2DSAA 1X0RA 4XS4A 2L4QA 3CXGA 3TRPA 4G2EA 4LMWA 4J2FA 3UVHA 4K2DA 2LNTA 1GWCA 4BWSA 2C3QA 2V41A 3GKNA 2C3NA 2L4CA 2M80A 2QA1A 3QDNA 1Y25A 2LJRA 3FZAA 1K0OA 3QCPA 1T4YA 3MDKA 4IW9A 2VM1A 1ZYQB 5ECMB 3C73A 3QAGA 3APOA 4IVFA 3FR9A 2MMNA 2DKIA 2PGTA 3LFLA 4X4JA 4DSRA 1ERUA 5DAKA 4BA7A 3D5JA 4Q5RA 2QGVA 4MLYA 5HR3A 1MD4A 3O76A 2AYTA 4TR0A 1ABAA 3GA4A 2YZUA 3QPMA 2GZZA 3GMFA 1U3AA 2GT6A 1KBNA 3LWAA 5JWQB 3CRUA 2HRFA 1WP0A 2X99A 3DXBA 3HHVA 1B9YC 3TDGA 4HZ2A 4IS0A 3LYKA 3KJYA 2XBIA 4EE0A 4ICYA 3DYRA 1ZGNA 2WS2A 3QOUA 3GL3A 3GSTA 5ECOB 1QFNA 4TXOA 3RDWA 1R26A 2YV9A 4ZL8A 4NHWA 3IRAA 4PNGA 2A2RA 4JR6A 4MABA 1GLPA 3IDVA 3H1NA 1M2AA 4I5QA 2B1LA 3GX8A 1EP7A 1AQWA 4V2LA 4I8BA 5J5NA 4GXZA 2YP6A 2GZPA 5AIXA 3W8JA 4TXVA 1PX6A 3RPPA 2FA4A 3FW2A 4G0IA 4Z2UA 4OMVA 1GP1A 2JSZA 3FR3A 1B48A 1HNAA 3GTUB 1T00A 1KTEA 1E6BA 20GSA 2MBSA 4GRFA 3GKMA 3FKFA 3W8SA 4MK3A 2HSMA 2DIYA 2H0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EUR A;  2JL4 A;  4K7I A;  3TUE A;  3CSJ A;  3UEM A;  4DSS B;  1GNE A;  1B4P A;  3UBL A;  2IFQ B;  1SD8 A;  3WD6 A;  4MJA A;  4QL7 A;  4NAX A;  3FZ5 A;  2LRC A;  3VLN A;  2MZC A;  1PGT A;  5D73 A;  1WE0 A;  3ERF A;  4MH3 A;  5DAL B;  2JU5 A;  2KP2 A;  1QXH A;  3D0Z A;  3SBC A;  3ZFL A;  3ERG A;  3WGE A;  1A24 A;  2JZT A;  4GWR A;  10GS A;  3CSI A;  2NBS A;  3EU3 A;  4EO3 A;  2KLX A;  2H01 A;  3KCM A;  4JZQ A;  2H66 A;  3TRX A;  4YQV A;  1ZL9 A;  5CRG A;  2G2Q A;  1ACV A;  2OBI A;  4IBP A;  4YH2 A;  5ECL B;  1FG4 A;  3UAR A;  3IPZ A;  4KDX A;  3R2Q A;  4YQM A;  4HZ4 A;  13GS A;  1W89 A;  5D9T A;  2EIQ A;  5G5E A;  1JLW A;  2HZF A;  1ST9 A;  5ECQ B;  1WWJ A;  3TJB A;  2ZNM A;  3O6T A;  2C0G A;  3CSH A;  1VGL A;  2XBQ A;  5IM9 A;  3TB2 A;  3A2W A;  3D22 A;  2VCV A;  2YZH A;  2WZ9 A;  3I9V 2;  4I2T A;  4F03 A;  2XPE A;  1SU9 A;  2H0I A;  1Y6E A;  8GSS A;  19GS A;  1XXU A;  5ECS A;  4ZB8 A;  1ERV A;  4BVY A;  4AGS A;  4OD7 A;  2CZ2 A;  1PL1 A;  2C1Y A;  1GSQ A;  5IMA A;  3M3M A;  2OE3 A;  4RQR A;  1XWC A;  2KHP A;  1ERW A;  2FWE A;  5C00 A;  1G7E A;  2LTK A;  5D9X A;  2XPD A;  3CTF A;  1J08 A;  2B1K A;  2IWT A;  1H75 A;  1J9B A;  1E2Y A;  2M72 A;  1VRS D;  1UC7 A;  1N8J A;  3A2V A;  4PX1 A;  3DD3 A;  1G0T A;  9GSS A;  5CAX A;  5A4U A;  2L59 A;  2RM5 A;  4O32 A;  1XCC A;  3C71 A;  5AIV A;  4Q5F A;  3CRT A;  3ZRE A;  5KN0 A;  3DWV A;  2L57 A;  3C7M A;  1S3C A;  2PBJ A;  2LKU A;  3APQ A;  1X9S B;  1XVW A;  5IMD A;  3ZVJ D;  1PN9 A;  1A23 A;  2HZE A;  2C0E A;  2LRN A;  3DGQ A;  3LXZ A;  3GV1 A;  1T3B A;  1FB6 A;  4TR1 A;  2X8H A;  2LST A;  2HFD A;  2VD1 A;  4ID0 A;  3BJ5 A;  4HOJ A;  2HLS A;  5IIZ A;  4EVM A;  3LXT A;  5F06 A;  4POM A;  3D6I A;  5G1L A;  2RM6 A;  2WUL A;  2RLI A;  2KUC A;  4HUA A;  2VAF A;  1K3O A;  3NIV A;  1GH2 A;  1GL8 A;  22GS A;  2GSS A;  1G6W A;  3UOM A;  3K8N A;  3H79 A;  1OE8 A;  3UAP A;  1X9W B;  1K3L A;  4TRX A;  3TKQ A;  1ZMA A;  5ECR B;  5F05 A;  5ECN B;  1TRV A;  2X64 A;  1EP8 A;  4GLT A;  4L8E A;  3VUR A;  5DQY A;  2O7K A;  4DVC A;  3ZIV A;  3DEX A;  1MDI A;  5FT3 A;  2H19 A;  1ZYE A;  2C3T A;  3HD5 A;  3FR6 A;  4P3Y B;  4WBJ A;  4D73 A;  1KEB A;  4NWY A;  5IMV A;  1BAY A;  4QL9 A;  2G0F A;  1SL1 B;  5G31 A;  4HQZ A;  1H4O A;  3HVV A;  2QKE A;  3IHQ A;  4K0N A;  4XS4 B;  5D93 A;  5HFG A;  3QAV A;  4FH8 A;  1YY7 A;  4IN0 A;  2MMZ A;  4RI7 A;  1GSE A;  4GSS A;  3CTG A;  4WR5 A;  5ECP B;  3PIN A;  4K9Z A;  2DMM A;  3D4T A;  1V9W A;  3H4K A;  4V1A g;  1TI3 A;  1XPV A;  3HZ8 A;  1W4V A;  4HU9 A;  1O8W A;  5D9V A;  2CZ3 A;  2VM2 A;  5CRH A;  2JZS A;  4PNF A;  5CRE A;  1EGR A;  2GSQ A;  3Q6O A;  2AAW A;  1A0F A;  4EXJ A;  1TOF A;  1AUC A;  2PWJ A;  4XS1 A;  1ON4 A;  3TCO A;  2K9F A;  6GSY A;  2I3Y A;  2LQO A;  2N5B A;  1MEK A;  4L0W A;  5D96 A;  3IK7 A;  2HYX A;  1R4W A;  3M8N A;  1JFU A;  2FCH A;  1O7U A;  5IPG A;  5HQP A;  3HYP A;  2GSR A;  4TXO B;  2P31 A;  4LMV A;  2PUK C;  4IHU A;  1SD9 A;  4ZXG A;  5LD0 A;  1YEP A;  4FYC A;  3RAZ A;  2K6V A;  2H72 A;  4HU7 A;  1S3D A;  2EIR A;  4OWY A;  2IMK A;  4PQH A;  7GSS A;  4H86 A;  5A4W A;  2HXK A;  4LA1 A;  1Z5Y E;  4WKW A;  2DJJ A;  5IMF A;  1GLQ A;  5J4U A;  1JZD A;  1O81 A;  2FLS A;  18GS A;  2YNX A;  5EY6 A;  3ZLP A;  5J3R A;  1GTA A;  1N2A A;  6GSS A;  2BTO T;  2OA7 A;  5ID2 A;  2DJK A;  4MZC A;  3GKK A;  1TP9 A;  4POB A;  2H1D A;  2CX4 A;  5B8B A;  3U5R E;  4XCS A;  4EC0 A;  2PVQ A;  3EU4 A;  3CBU A;  5JCG A;  1AW9 A;  4MA9 A;  4N11 A;  5H5S A;  1QGV A;  1PA3 A;  1M99 A;  4KW6 A;  4OFT A;  1Z6N A;  1TTZ A;  2E2G A;  4EDZ A;  2LV3 A;  4IGJ A;  1U88 A;  1YEX A;  2FY6 A;  2IJY A;  4F9Z A;  5IMC A;  2H1G A;  1FB0 A;  1PD2 1;  3A5W A;  1J0F A;  3G7I A;  1PL2 A;  4OFM A;  4XRD A;  3J7Y b;  5F07 A;  4KDU A;  1NHO A;  2ON7 A;  5E59 A;  4IQA A;  4TR4 A;  5AGY A;  4EL1 A;  2H1B A;  2EC4 A;  2OE0 A;  2VLT A;  3IR4 A;  4IP6 A;  1THO A;  2O85 A;  1JZR A;  1EEJ A;  3C1S A;  2WDU A;  5KN2 A;  1S3A A;  2GTU A;  1UN2 A;  5IO2 A;  1SKR B;  3DVX A;  5ELG A;  1YKC A;  4MF6 A;  4X43 A;  1SKS B;  3SWL A;  4EF0 A;  1K0C A;  2H6Y A;  4XS6 A;  2GZY A;  2QSI A;  4KSO A;  2YAN A;  4EKZ A;  1AQV A;  2L5O A;  1RW1 A;  2JZR A;  3APS A;  4FO5 A;  1WMJ A;  1GUH A;  2HRN A;  2H76 A;  2N5A A;  1I5G A;  3MWH A;  2V1M A;  4NPB A;  1FOV A;  4KSM A;  4AJ8 A;  2I4A A;  4HS1 A;  4NV2 A;  3RHC A;  3VI5 A;  3DVW A;  5GAP D;  5AN1 A;  1ZCP A;  1U87 A;  2OKA A;  2F9S A;  2YPM A;  2C80 A;  2GGT A;  5JCU A;  2REM A;  3F4T A;  3L9V A;  4V2M A;  1XWG A;  4BWQ A;  4MF7 A;  1G7O A;  2L6C A;  2VCQ A;  1YJ6 A;  4JR4 A;  2M46 A;  1OKD A;  5HFI A;  14GS A;  3KZQ A;  5FHI A;  3FHK A;  1HQO A;  3VWW A;  3H8Q A;  3NOF A;  4F0C A;  1OC9 A;  1X9M B;  5IQY A;  2H74 A;  1BQ7 A;  1PX7 A;  1LJR A;  3ZTL A;  5IO0 A;  4K8M A;  3TOU A;  1Q4J A;  4MDC A;  4QQ7 A;  3BCK A;  3L78 A;  5F0G A;  2HZE B;  3IV4 A;  2IIY A;  2DLX A;  3EVI A;  4O5R A;  4OO5 A;  4WXT A;  4K7O A;  4ZBB A;  5LNK e;  4OCE A;  3P2A A;  11GS A;  2HI7 A;  3Q18 A;  3M9J A;  2CVD A;  4F82 A;  4PUR A;  4IJ3 A;  1XW5 A;  1AC1 A;  1XW9 A;  1OC8 A;  3DRN A;  3NZN A;  5B8A A;  3HVX A;  3TJF A;  3ZRD A;  2FHE A;  5B6M A;  3GX0 A;  2ZCT A;  4HJM A;  3ZYW A;  1LU4 A;  3U6V A;  1OAZ A;  3VK9 A;  2R3X A;  3LSZ A;  4XHM A;  3HXS A;  3UVT A;  3WYW A;  5DJL A;  4ECJ A;  2I81 A;  5B7C A;  4HI7 A;  3JCM L;  4KGI A;  2RUF A;  5CP1 A;  1HNB A;  1FW1 A;  1JLV A;  1DSB A;  3HKR A;  3HZ4 A;  1T7P B;  4I2U A;  4D73 B;  3H93 A;  4FYB A;  4WBR D;  4AF2 A;  3EC3 A;  4CW9 A;  1VF4 A;  4PQI A;  4YAP A;  1F9M A;  5KN1 A;  1X5E A;  1C72 A;  1PRX A;  4MZW A;  3HY2 A;  1F6M C;  3LGC A;  2DJ0 A;  2IMD A;  2E7P A;  1HD2 A;  3P90 A;  1GTU A;  1Z7P A;  1Z3E A;  6GSW A;  3GUR A;  16GS A;  2GQK A;  2HT9 A;  2LQQ A;  4XRA A;  2E0Q A;  4KA0 A;  2DML A;  2H8L A;  3G7J A;  4LL4 B;  2KOK A;  1R7H A;  5ABR A;  2I9H A;  4TKY A;  2C0D A;  4MH2 A;  2X8G A;  4FIW A;  3KIJ A;  2CQ9 A;  1JZW A;  1GSY A;  2JAD A;  1SYX A;  2PU9 C;  4ISD A;  4Z7X A;  2OAD A;  3ZVJ A;  3M9K A;  1PQN A;  4ZL7 A;  3EYT A;  4KUN A;  2NPB A;  4KE3 A;  2AV4 A;  5A5K A;  3WT1 A;  3IC4 A;  4NXI A;  3HJP A;  5IOX A;  3EMX A;  3DKS A;  1TXX A;  5GZZ B;  2AUV A;  3L0H A;  4CDO A;  1TU7 A;  4HDE A;  1URM A;  1USB A;  3UMA A;  3HCZ A;  2CAI A;  3F63 A;  1A8Y A;  1XFL A;  1QUW A;  1OC3 A;  4KH7 A;  3GYK A;  4TOP A;  4V2N A;  4ZBA A;  4MP4 A;  2B7J A;  2H6Z A;  1F3A A;  3TOT A;  1GUL A;  3F4R A;  3LEF A;  4K1F A;  2FWF A;  1O73 A;  4WF4 A;  2DJ3 A;  1SK2 A;  3EE2 A;  5KEJ A;  4J56 E;  3TRQ A;  4ZB6 A;  3OR5 A;  1GSU A;  5ID2 B;  5DVB A;  1TK8 B;  2WCI A;  1BJX A;  3GFK A;  5CNW A;  4MPG A;  1I9D A;  4XIH A;  4TN8 A;  2TRX A;  1HNC A;  2XC2 A;  2AHE A;  1M9B A;  5JCW A;  1GNW A;  1IYI A;  2PMT A;  4O7H A;  1YZX A;  1GSF A;  3EIN A;  3F0I A;  3UBK A;  3TJG A;  5H5Q A;  3KH9 A;  3VFI A;  4IKH A;  1SYR A;  2ES7 A;  1PMT A;  2YWN A;  2GT5 A;  2DBC A;  1YF1 A;  2ALB A;  4N30 A;  2MBT A;  2MMO A;  1V40 A;  5EVO A;  1DUG A;  4MMM A;  4L0U A;  1VF2 A;  3BCI A;  3ZIJ A;  4ZIJ A;  3F8U A;  2O87 A;  3GHA A;  4PUF C;  5DAK B;  3MAK A;  1SL2 B;  3Q74 A;  3GRX A;  2X8C A;  6GST A;  3IK9 A;  3QD9 A;  3HVS A;  1SJI A;  1DE1 A;  2VL9 A;  4RQX A;  1ILO A;  4BVX A;  2B5X A;  1ZZY A;  3IAS 2;  4X0X A;  5CRD A;  2GLR A;  1SK0 A;  1YDK A;  5A4V A;  4PQ1 A;  3I6A A;  4KCE A;  1FVJ A;  3LQ7 A;  3UL3 A;  4KX4 A;  2C8U A;  1SKW B;  1EZK A;  4POK A;  4ZL9 A;  2MMA A;  3E9J B;  3FZ9 A;  3ZML A;  4GQF A;  2VL2 C;  3LOR A;  1JHB A;  4K0G A;  5E4W A;  2FWH A;  4HJ2 A;  4JE1 A;  5ECH B;  1X5C A;  4ECI A;  1PKW A;  2V6O A;  1WOU A;  1V98 A;  3GNJ A;  5G2Z A;  3QFA C;  2NVL A;  3L9U A;  3L4N A;  1BG5 A;  1T1V A;  5ECI B;  1R5P A;  5J41 A;  2LJK A;  2KP1 A;  2L6D A;  1V2A A;  3VWV A;  2A2S A;  2HSY A;  3UIW A;  3VI7 A;  2H0G A;  3ERW A;  2VOC A;  2J23 A;  1NHY A;  3QMX A;  3BBY A;  3ZIT A;  3KGK A;  1A2J A;  3LG6 A;  3TKS E;  1FO5 A;  4MJC A;  4GST A;  4KDY A;  5EL8 A;  1OE7 A;  3KMN A;  1LBK A;  1O6J A;  3IOS A;  2GVP A;  3TKR A;  3WGX A;  1OC9 B;  6GSX A;  3CMI A;  1U3I A;  4NMU A;  1PKZ A;  1A8L A;  3RBT A;  3FEU A;  5ENU A;  3L9S A;  4IJI A;  2QC7 A;  1TI1 A;  4MF5 A;  3ZMK A;  2OJL A;  4LLR A;  2XHF A;  5GSS A;  1RK4 A;  2IN3 A;  4HEA 2;  5LCZ A;  1AXD A;  1O8X A;  2VD0 A;  12GS A;  3F3Q A;  2RII A;  1HYU A;  2CAQ A;  2VL2 A;  4KAE A;  1MTC A;  1QK8 A;  1F3B A;  1YKA A;  2K8S A;  3ME8 A;  1XOB A;  4GSN A;  2VO4 A;  1TK5 B;  4G10 A;  5FWG A;  3BD2 A;  1BYE A;  1BED A;  4MJE A;  2IMI A;  2PPT A;  3QFB C;  6GSU A;  3WGD A;  1TRU A;  2LEG A;  2E2M A;  1TKD B;  3ISO A;  2LUS A;  4OCF A;  2VIM A;  4K6X A;  2HNL A;  2F51 A;  2YV7 A;  2GST A;  1EWX A;  2H30 A;  2H6X A;  3KMO A;  1A2L A;  4AJ6 A;  1EOG A;  4X1U A;  4MCU A;  4G19 A;  4ML1 A;  4IEL A;  5G5F A;  4ECB A;  3PR8 A;  1K0N A;  1MDJ A;  1EGO A;  2LS5 A;  4MZB A;  1AIU A;  5ECK B;  2TRC P;  1ERT A;  3A2X A;  3VPQ A;  5HFK A;  4LL1 B;  2L5L A;  3V1W A;  1UVZ A;  2LNS A;  2VUP A;  2JAC A;  4GF0 A;  3HJM A;  4L5L A;  5DDL A;  5B6N A;  3P7X A;  4N0V A;  3ZZX A;  1XBS A;  3F3R A;  2K8V A;  5G30 A;  3FYG A;  4K7N A;  2GQM A;  1XIY A;  2EIO A;  1B8X A;  1SEN A;  3TJJ A;  1OKT A;  2MYG A;  4IQ1 A;  2FA8 A;  1SK1 A;  2YWO A;  1GRX A;  3GSS A;  1Z7R A;  4IP1 A;  2K18 A;  2VLU A;  4TR3 A;  3D4M A;  1NM3 A;  1MDK A;  4GCI A;  4N0Z A;  5EPF A;  2TIR A;  4EDY A;  3KD0 A;  3I69 A;  1XWK A;  3M1G A;  2DJ1 A;  1GSS A;  2WGR A;  3C1R A;  3BOA A;  3WT2 A;  2DJ2 A;  5HR1 A;  1K0M A;  4TR1 B;  1M2D A;  1VF3 A;  2R37 A;  1CQG A;  2FWG A;  4ILF A;  2R6K A;  1K0D A;  3ME7 A;  1EV9 A;  5CO3 A;  4RUV A;  1YF0 A;  2VCT A;  3F6F A;  4I97 A;  1F37 A;  4PGT A;  3KP9 A;  4J57 E;  1AAZ A;  1SJ6 A;  2FGX A;  3KTL A;  4JRR A;  2ON5 A;  3KP8 A;  3GN3 A;  4KB3 A;  4KND A;  1ML6 A;  3E3E A;  2YWM A;  1GUM A;  5F8B A;  4GQC A;  3N5O A;  3FK8 A;  3G9B A;  1TU8 A;  2V2G A;  2R5G A;  2IME A;  1DE2 A;  2DIZ A;  4G9H A;  1U6T A;  5L71 A;  3LYP A;  3N9J A;  3FY7 A;  3HA9 A;  4YAV A;  2CT6 A;  2BJX A;  3GH6 A;  1M7T A;  2HSH A;  4V1A p;  4JU5 A;  4NHZ A;  2CA8 A;  2FUG 2;  2O89 A;  3KEB A;  1G6Y A;  2Z9S A;  2O8V B;  5CRW A;  4NV5 A;  4FYU A;  4CHS A;  1VF1 A;  1XWA A;  1SL0 B;  3KXO A;  5AIS A;  1B9X C;  1R5A A;  1K0A A;  5G1K A;  4TW5 A;  1EEM A;  4AJ7 A;  3C8E A;  3IE3 A;  1V58 A;  5HR0 A;  5J9B A;  1O85 A;  3TKP A;  1EOH A;  3E0U A;  4YQU A;  4MPF A;  5C04 A;  2H70 A;  3IXR A;  1CQH A;  2B7K A;  1K3Y A;  2GS3 A;  2C4J A;  2VL3 A;  3G7Y A;  1EV4 A;  2I1U A;  3DML A;  1QMV A;  3S9F A;  3ED3 A;  3GTU A;  1XZO A;  1K0B A;  5CYY A;  1Z6M A;  1QQ2 A;  5HR2 A;  1KNG A;  1RQM A;  3PGT A;  2VCX A;  2B6M A;  4ECC A;  5IMZ A;  3W6G A;  1WJK A;  4DSS A;  4WEY A;  2VCW A;  2IFQ A;  2LJA A;  3GL5 A;  4PUA A;  2OE1 A;  3F4S A;  1OVN A;  5KN3 A;  4ZIL A;  2NDO A;  5INY A;  2P5Q A;  2B5Y A;  2AB6 A;  1XOA A;  5DAL A;  2PN8 A;  2YJH A;  3DIE A;  3VWU A;  3CYN A;  3P8W A;  4E8H A;  1TDI A;  4HQS A;  2CVB A;  2VCZ A;  1BX9 A;  3QR6 A;  1OYJ A;  17GS A;  2V6K A;  1TW9 A;  2WJU A;  4ZBD A;  4WR4 A;  1NW2 A;  3MNG A;  3M0F A;  5DCH A;  2PVO C;  3Q19 A;  1A2M A;  1FHE A;  1GTB A;  3VPT A;  2YOI A;  3IAM 2;  2YCD A;  4O92 A;  3VWX A;  1GSD A;  3D21 A;  2FD3 A;  3FZ4 A;  1XVQ A;  2IPA A;  1TRW A;  1WIK A;  3AY8 A;  2D2Z A;  2PER A;  1XWB A;  1JZO A;  3KTB A;  4JED A;  5H5R A;  4F0B A;  1M0U A;  4WF5 A;  2OBK A;  3HJO A;  1THX A;  2GQL A;  4MJB A;  2WFC A;  2JSY A;  2GDR A;  5D8I A;  2IMF A;  2R2J A;  2B5E A;  3LJR A;  3KH7 A;  1GTI A;  1XW6 A;  1UA5 A;  1NSW A;  5DJM A;  4Q5N A;  3HDC A;  2P5R A;  4WET A;  3TGZ A;  1M9A A;  2LRT A;  4TVE A;  2C0F A;  2YWI A;  4RI6 A;  2P0G A;  1MD3 A;  5D9W A;  3QAW A;  4KCA A;  2ZUP A;  4JBB A;  4N10 A;  3IA1 A;  5ELA A;  2NTO A;  3ZL5 A;  3TKS C;  1WRY A;  2F8A A;  1AQX A;  4BPY A;  1F2E A;  3MSZ A;  2VLV A;  5DCG A;  2HE3 A;  4ML6 A;  3RHB A;  2WRT A;  3O3T A;  4DSQ A;  2B3S A;  2J9H A;  3RPN A;  2CV4 A;  5DBQ A;  2YN1 A;  3EWL A;  1V57 A;  4ULX A;  4PXO A;  5JWO B;  5GAN D;  2F3M A;  3GUS A;  4ACS A;  2H1A A;  3TJK A;  1FVK A;  1T8E B;  3GH9 A;  1IYH A;  2V32 A;  4L5O A;  3F9U A;  1ZOF A;  3J7Y k;  3EMP A;  5COH A;  3UJ1 A;  2YJ7 A;  2A4V A;  2H73 A;  5DQS A;  1B4Q A;  3KM6 A;  2H75 A;  1WPI A;  6GSV A;  3TKS A;  2N5F A;  2H71 A;  4ZB9 A;  3IBH A;  2CX3 A;  1FAA A;  4DEJ A;  2IL3 A;  4OFN A;  1TK0 B;  3US3 A;  3ZFB A;  4F2I A;  2CVK A;  2RUE A;  2DC5 A;  4E8E A;  1TRS A;  2BMX A;  4BL7 A;  1Z9H A;  2R4V A;  1SJZ A;  4OO4 A;  2F8F A;  3A3T A;  3PH9 A;  4EUY A;  4I6X A;  1YQ1 A;  1PSQ A;  5J9C A;  1M2B A;  2OAC A;  1TJD A;  4POL A;  1DBY A;  1T4Z A;  5IOW A;  5GST A;  2FNO A;  1GUK A;  4Q5Q A;  5IPH A;  2AJQ B;  3GKX A;  4GTU A;  2WB9 A;  3F6D A;  1X5D A;  1A0R P;  1Q98 A;  4XTS A;  3FRC A;  3I43 A;  3GIX A;  5JWR B;  2DSA A;  1X0R A;  4XS4 A;  2L4Q A;  3CXG A;  3TRP A;  4G2E A;  4LMW A;  4J2F A;  3UVH A;  4K2D A;  2LNT A;  1GWC A;  4BWS A;  2C3Q A;  2V41 A;  3GKN A;  2C3N A;  2L4C A;  2M80 A;  3QDN A;  1Y25 A;  2LJR A;  3FZA A;  1K0O A;  3QCP A;  1T4Y A;  3MDK A;  4IW9 A;  2VM1 A;  1ZYQ B;  5ECM B;  3C73 A;  3QAG A;  3APO A;  4IVF A;  3FR9 A;  2MMN A;  2PGT A;  3LFL A;  4DSR A;  1ERU A;  5DAK A;  4BA7 A;  3D5J A;  4Q5R A;  2QGV A;  4MLY A;  5HR3 A;  1MD4 A;  3O76 A;  2AYT A;  4TR0 A;  1ABA A;  3GA4 A;  2YZU A;  3QPM A;  2GZZ A;  3GMF A;  1U3A A;  2GT6 A;  1KBN A;  3LWA A;  5JWQ B;  3CRU A;  2HRF A;  1WP0 A;  2X99 A;  3DXB A;  3HHV A;  1B9Y C;  3TDG A;  4HZ2 A;  4IS0 A;  3LYK A;  3KJY A;  2XBI A;  4EE0 A;  3DYR A;  1ZGN A;  2WS2 A;  3QOU A;  3GL3 A;  3GST A;  5ECO B;  1QFN A;  4TXO A;  3RDW A;  1R26 A;  2YV9 A;  4ZL8 A;  4NHW A;  3IRA A;  4PNG A;  2A2R A;  4JR6 A;  4MAB A;  1GLP A;  3IDV A;  3H1N A;  1M2A A;  4I5Q A;  2B1L A;  3GX8 A;  1EP7 A;  1AQW A;  4V2L A;  4I8B A;  5J5N A;  4GXZ A;  2YP6 A;  2GZP A;  5AIX A;  3W8J A;  4TXV A;  1PX6 A;  3RPP A;  2FA4 A;  3FW2 A;  4OMV A;  1GP1 A;  2JSZ A;  3FR3 A;  1B48 A;  1HNA A;  3GTU B;  1T00 A;  1KTE A;  1E6B A;  20GS A;  2MBS A;  4GRF A;  3GKM A;  3FKF A;  3W8S A;  4MK3 A;  2DIY A;  2H0H A; 
#chains in the Genus database with same CATH topology
 3EUR A;  2JL4 A;  4K7I A;  3TUE A;  3CSJ A;  3UEM A;  4DSS B;  1GNE A;  1B4P A;  3UBL A;  2IFQ B;  1SD8 A;  3WD6 A;  4MJA A;  4QL7 A;  4NAX A;  3FZ5 A;  2LRC A;  3VLN A;  2MZC A;  1PGT A;  5D73 A;  1WE0 A;  3ERF A;  4MH3 A;  5DAL B;  2JU5 A;  2KP2 A;  1QXH A;  3D0Z A;  4A5P A;  3SBC A;  3ZFL A;  3ERG A;  3WGE A;  1A24 A;  2JZT A;  4GWR A;  10GS A;  3CSI A;  2NBS A;  3EU3 A;  4EO3 A;  2KLX A;  2H01 A;  2R0G A;  3KCM A;  2H66 A;  4JZQ A;  3TRX A;  4YQV A;  1ZL9 A;  5CRG A;  2G2Q A;  1ACV A;  2OBI A;  4IBP A;  4YH2 A;  5ECL B;  1FG4 A;  3UAR A;  3IPZ A;  4KDX A;  3R2Q A;  4YQM A;  4HZ4 A;  13GS A;  1W89 A;  5D9T A;  2EIQ A;  3A5I A;  5G5E A;  1JLW A;  2HZF A;  1ST9 A;  5ECQ B;  1ZYN A;  1WWJ A;  3TJB A;  2ZNM A;  3O6T A;  2C0G A;  3CSH A;  2A4H A;  1VGL A;  2XBQ A;  5IM9 A;  3TB2 A;  3A2W A;  3D22 A;  2VCV A;  2YZH A;  2UZ8 A;  2WZ9 A;  3I9V 2;  4I2T A;  4F03 A;  2XPE A;  1SU9 A;  2H0I A;  1Y6E A;  8GSS A;  19GS A;  1XXU A;  5ECS A;  2R0P A;  4ZB8 A;  1ERV A;  4BVY A;  4AGS A;  4OD7 A;  2CZ2 A;  1PL1 A;  2C1Y A;  1GSQ A;  5IMA A;  3M3M A;  2OE3 A;  4RQR A;  1XWC A;  2KHP A;  1ERW A;  2FWE A;  5C00 A;  1G7E A;  2LTK A;  5D9X A;  2XPD A;  3CTF A;  1J08 A;  2B1K A;  2IWT A;  1H75 A;  1J9B A;  1E2Y A;  2M72 A;  1VRS D;  1UC7 A;  1N8J A;  3A2V A;  4PX1 A;  3DD3 A;  1G0T A;  9GSS A;  5CAX A;  5A4U A;  1M3J A;  2L59 A;  2RM5 A;  4O32 A;  1XCC A;  3C71 A;  5AIV A;  4Q5F A;  3CRT A;  3ZRE A;  5KN0 A;  3DWV A;  2L57 A;  3C7M A;  1S3C A;  2PBJ A;  2LKU A;  3APQ A;  1X9S B;  1XVW A;  5IMD A;  3ZVJ D;  1PN9 A;  1A23 A;  2HZE A;  2C0E A;  2LRN A;  3DGQ A;  3LXZ A;  1ZYP A;  3GV1 A;  1FOH A;  1T3B A;  1FB6 A;  4TR1 A;  2X8H A;  2LST A;  4K2X A;  2HFD A;  2VD1 A;  4ID0 A;  3BJ5 A;  4HOJ A;  2HLS A;  5IIZ A;  4EVM A;  3LXT A;  5F06 A;  4POM A;  3D6I A;  5G1L A;  2RM6 A;  2WUL A;  2RLI A;  2KUC A;  4HUA A;  2VAF A;  1K3O A;  3NIV A;  4BL7 B;  1GH2 A;  4KF9 A;  1GL8 A;  22GS A;  2GSS A;  1G6W A;  3UOM A;  3K8N A;  3H79 A;  1OE8 A;  3UAP A;  1X9W B;  1K3L A;  4TRX A;  3TKQ A;  1ZMA A;  5ECR B;  5F05 A;  5ECN B;  1TRV A;  2X64 A;  1EP8 A;  4GLT A;  4L8E A;  3VUR A;  5DQY A;  2O7K A;  4DVC A;  3ZIV A;  3DEX A;  1MDI A;  5FT3 A;  2H19 A;  1ZYE A;  2C3T A;  3HD5 A;  3FR6 A;  4P3Y B;  4WBJ A;  4D73 A;  1KEB A;  4NWY A;  5IMV A;  1BAY A;  4QL9 A;  2G0F A;  1SL1 B;  5G31 A;  4HQZ A;  1H4O A;  3HVV A;  2QKE A;  3IHQ A;  4K0N A;  4XS4 B;  5D93 A;  5HFG A;  3QAV A;  4FH8 A;  1YY7 A;  4IN0 A;  2MMZ A;  4RI7 A;  1GSE A;  4GSS A;  3CTG A;  4WR5 A;  5ECP B;  3PIN A;  4K9Z A;  2DMM A;  3D4T A;  1V9W A;  3H4K A;  4V1A g;  1TI3 A;  1XPV A;  3HZ8 A;  1W4V A;  4HU9 A;  1O8W A;  5D9V A;  2CZ3 A;  2VM2 A;  5CRH A;  2JZS A;  4PNF A;  4EIP A;  5CRE A;  1EGR A;  2GSQ A;  3Q6O A;  2AAW A;  1A0F A;  4EXJ A;  1TOF A;  1AUC A;  2PWJ A;  4XS1 A;  1ON4 A;  3TCO A;  2K9F A;  6GSY A;  2I3Y A;  2LQO A;  2N5B A;  1MEK A;  4L0W A;  5D96 A;  3IK7 A;  2HYX A;  1R4W A;  3M8N A;  1JFU A;  2FCH A;  1O7U A;  5IPG A;  5HQP A;  3HYP A;  2GSR A;  4TXO B;  2P31 A;  4LMV A;  2PUK C;  4IHU A;  1SD9 A;  4ZXG A;  5LD0 A;  1YEP A;  4FYC A;  3RAZ A;  2K6V A;  2H72 A;  4HU7 A;  1S3D A;  2EIR A;  4OWY A;  2IMK A;  4PQH A;  7GSS A;  4H86 A;  5A4W A;  2HXK A;  4LA1 A;  5BRT A;  1Z5Y E;  4WKW A;  2DJJ A;  5IMF A;  1GLQ A;  5J4U A;  1JZD A;  1O81 A;  2FLS A;  18GS A;  2YNX A;  5EY6 A;  3ZLP A;  5J3R A;  1GTA A;  1N2A A;  6GSS A;  2BTO T;  2OA7 A;  5ID2 A;  2DJK A;  4MZC A;  3GKK A;  1TP9 A;  4POB A;  2H1D A;  2CX4 A;  5B8B A;  3U5R E;  4XCS A;  4EC0 A;  2PVQ A;  3EU4 A;  3CBU A;  5JCG A;  1AW9 A;  4MA9 A;  4N11 A;  5H5S A;  1QGV A;  1PA3 A;  1M99 A;  4KW6 A;  4OFT A;  1Z6N A;  1TTZ A;  2E2G A;  4EDZ A;  2LV3 A;  4Z2T A;  4IGJ A;  1U88 A;  1YEX A;  2FY6 A;  2IJY A;  4F9Z A;  5IMC A;  2H1G A;  1FB0 A;  1PD2 1;  3A5W A;  1J0F A;  3G7I A;  1PL2 A;  4OFM A;  4XRD A;  3J7Y b;  5F07 A;  4KDU A;  1NHO A;  2ON7 A;  5E59 A;  4IQA A;  4TR4 A;  5AGY A;  4EL1 A;  2H1B A;  2EC4 A;  2OE0 A;  2VLT A;  3IR4 A;  4IP6 A;  1THO A;  2O85 A;  1JZR A;  1EEJ A;  3C1S A;  2WDU A;  5KN2 A;  1S3A A;  2GTU A;  1UN2 A;  5IO2 A;  1SKR B;  3DVX A;  5ELG A;  1YKC A;  4MF6 A;  4X43 A;  1SKS B;  3SWL A;  4EF0 A;  1K0C A;  3HVN A;  2H6Y A;  4XS6 A;  2GZY A;  2QSI A;  4KSO A;  2YAN A;  4EKZ A;  1AQV A;  2L5O A;  1RW1 A;  2JZR A;  3APS A;  4FO5 A;  3PPU A;  1WMJ A;  1GUH A;  2HRN A;  2H76 A;  2N5A A;  1I5G A;  3MWH A;  2V1M A;  4NPB A;  1FOV A;  4YKF A;  4KSM A;  4AJ8 A;  2I4A A;  4HS1 A;  4NV2 A;  3RHC A;  3VI5 A;  3DVW A;  5GAP D;  5AN1 A;  4BVY B;  1ZCP A;  1U87 A;  2OKA A;  2F9S A;  2YPM A;  2C80 A;  2GGT A;  5JCU A;  2REM A;  3F4T A;  3L9V A;  4V2M A;  1XWG A;  4K5R A;  4BWQ A;  4MF7 A;  1G7O A;  2L6C A;  2VCQ A;  1YJ6 A;  4JR4 A;  2M46 A;  1OKD A;  5HFI A;  14GS A;  3KZQ A;  5FHI A;  2R0C A;  3FHK A;  1HQO A;  3VWW A;  3H8Q A;  3NOF A;  4F0C A;  1OC9 A;  1X9M B;  5IQY A;  2H74 A;  1BQ7 A;  1PX7 A;  1LJR A;  4O5U A;  3ZTL A;  5IO0 A;  4K8M A;  3TOU A;  1Q4J A;  4MDC A;  4QQ7 A;  3BCK A;  3L78 A;  5F0G A;  2HZE B;  3IV4 A;  2IIY A;  2DLX A;  3EVI A;  4O5R A;  4OO5 A;  4WXT A;  4K7O A;  4ZBB A;  5LNK e;  4OCE A;  3P2A A;  11GS A;  2HI7 A;  3Q18 A;  3M9J A;  2CVD A;  4F82 A;  2QA2 A;  4PUR A;  4IJ3 A;  1XW5 A;  1AC1 A;  1XW9 A;  1OC8 A;  3DRN A;  3NZN A;  5B8A A;  3HVX A;  3TJF A;  3ZRD A;  2FHE A;  5B6M A;  3GX0 A;  2ZCT A;  4HJM A;  3ZYW A;  1LU4 A;  3U6V A;  1OAZ A;  3VK9 A;  2R3X A;  3LSZ A;  4XHM A;  3HXS A;  1PFO A;  3UVT A;  3WYW A;  5DJL A;  4ECJ A;  2I81 A;  5B7C A;  4HI7 A;  3JCM L;  4KGI A;  2RUF A;  5CP1 A;  1HNB A;  1FW1 A;  1JLV A;  1DSB A;  3HKR A;  3HZ4 A;  1T7P B;  4I2U A;  4D73 B;  3H93 A;  4FYB A;  4WBR D;  4AF2 A;  3EC3 A;  4CW9 A;  1VF4 A;  4PQI A;  4YAP A;  1F9M A;  5KN1 A;  4K5S A;  1X5E A;  1C72 A;  1PRX A;  4MZW A;  3HY2 A;  1F6M C;  3LGC A;  2DJ0 A;  2IMD A;  2E7P A;  1HD2 A;  1PN0 A;  3P90 A;  1GTU A;  1Z7P A;  1Z3E A;  6GSW A;  3GUR A;  16GS A;  2GQK A;  2HT9 A;  2LQQ A;  4XRA A;  2E0Q A;  4KA0 A;  2DML A;  2H8L A;  3CQF A;  3G7J A;  4LL4 B;  2KOK A;  1R7H A;  5ABR A;  2I9H A;  4TKY A;  4USS A;  2C0D A;  4MH2 A;  2X8G A;  4FIW A;  3KIJ A;  2CQ9 A;  1JZW A;  1GSY A;  2JAD A;  1SYX A;  2PU9 C;  4MNN A;  4ISD A;  4Z7X A;  2OAD A;  3ZVJ A;  3M9K A;  1PQN A;  4ZL7 A;  3EYT A;  4KUN A;  2NPB A;  4KE3 A;  2AV4 A;  5A5K A;  3WT1 A;  3EPT A;  3IC4 A;  4NXI A;  3HJP A;  5IOX A;  3EMX A;  3DKS A;  1TXX A;  5GZZ B;  2AUV A;  3L0H A;  4CDO A;  1TU7 A;  4HDE A;  1URM A;  1USB A;  4FQU A;  3UMA A;  3R3E A;  3HCZ A;  2CAI A;  3F63 A;  1A8Y A;  1XFL A;  1QUW A;  1OC3 A;  4KH7 A;  3GYK A;  4TOP A;  4V2N A;  4ZBA A;  4MP4 A;  2B7J A;  2H6Z A;  1F3A A;  3TOT A;  1GUL A;  3F4R A;  3LEF A;  4K1F A;  2FWF A;  1O73 A;  4WF4 A;  2DJ3 A;  1SK2 A;  3EE2 A;  5KEJ A;  4J56 E;  3TRQ A;  4ZB6 A;  3OR5 A;  1GSU A;  5ID2 B;  5DVB A;  1TK8 B;  2WCI A;  1BJX A;  3GFK A;  5CNW A;  4MPG A;  1I9D A;  4XIH A;  4TN8 A;  2TRX A;  1HNC A;  2XC2 A;  2AHE A;  1M9B A;  5JCW A;  1GNW A;  1IYI A;  2PMT A;  4O7H A;  1YZX A;  1GSF A;  3EIN A;  3F0I A;  3UBK A;  3TJG A;  5H5Q A;  3KH9 A;  3VFI A;  4IKH A;  1SYR A;  2ES7 A;  1PMT A;  2YWN A;  2GT5 A;  2DBC A;  1YF1 A;  2ALB A;  4N30 A;  2MBT A;  2MMO A;  1V40 A;  5EVO A;  1DUG A;  4MMM A;  4L0U A;  1VF2 A;  3BCI A;  3ZIJ A;  4ZIJ A;  3F8U A;  2O87 A;  3GHA A;  4PUF C;  5DAK B;  3MAK A;  1SL2 B;  3Q74 A;  3GRX A;  2X8C A;  6GST A;  3IK9 A;  4O5Q A;  3QD9 A;  3HVS A;  1SJI A;  1DE1 A;  2VL9 A;  4RQX A;  1ILO A;  4PTS A;  4BVX A;  2B5X A;  1ZZY A;  3IAS 2;  4X0X A;  5CRD A;  2GLR A;  1SK0 A;  1YDK A;  5A4V A;  4PQ1 A;  3I6A A;  4KCE A;  1FVJ A;  3LQ7 A;  3UL3 A;  4KX4 A;  2C8U A;  1SKW B;  1EZK A;  4POK A;  4ZL9 A;  2MMA A;  3E9J B;  3FZ9 A;  3ZML A;  4GQF A;  2VL2 C;  3LOR A;  1JHB A;  4K0G A;  5E4W A;  2FWH A;  4HJ2 A;  4JE1 A;  5ECH B;  1X5C A;  4ECI A;  1PKW A;  2V6O A;  1WOU A;  1V98 A;  3GNJ A;  5G2Z A;  3QFA C;  2NVL A;  3L9U A;  3L4N A;  1BG5 A;  1T1V A;  5ECI B;  1R5P A;  5J41 A;  2LJK A;  2KP1 A;  2L6D A;  1V2A A;  3VWV A;  2A2S A;  2HSY A;  3UIW A;  3VI7 A;  2H0G A;  3ERW A;  2VOC A;  2J23 A;  1NHY A;  3QMX A;  3BBY A;  3ZIT A;  3KGK A;  1A2J A;  3LG6 A;  3TKS E;  1FO5 A;  4MJC A;  4YKG A;  4GST A;  4KDY A;  5EL8 A;  3MIX A;  1OE7 A;  3KMN A;  1LBK A;  1O6J A;  3IOS A;  2GVP A;  3TKR A;  3WGX A;  1OC9 B;  6GSX A;  3CMI A;  1U3I A;  4NMU A;  1PKZ A;  1A8L A;  5KOW A;  3RBT A;  3FEU A;  5ENU A;  3L9S A;  4IJI A;  2QC7 A;  1TI1 A;  4MF5 A;  3ZMK A;  2OJL A;  4LLR A;  2XHF A;  5GSS A;  1RK4 A;  2IN3 A;  4HEA 2;  5LCZ A;  1AXD A;  1O8X A;  2VD0 A;  12GS A;  3F3Q A;  2RII A;  1HYU A;  2CAQ A;  2VL2 A;  4KAE A;  1MTC A;  1QK8 A;  1F3B A;  1YKA A;  2K8S A;  3ME8 A;  1XOB A;  4GSN A;  2VO4 A;  1TK5 B;  4G10 A;  5FWG A;  3BD2 A;  1BYE A;  1BED A;  3IC8 A;  4MJE A;  2IMI A;  2PPT A;  3QFB C;  6GSU A;  3WGD A;  1TRU A;  2LEG A;  2E2M A;  1TKD B;  3ISO A;  2LUS A;  4OCF A;  2VIM A;  4K6X A;  2HNL A;  2F51 A;  2YV7 A;  2GST A;  1EWX A;  2H30 A;  2H6X A;  3KMO A;  1A2L A;  2X49 A;  4AJ6 A;  1EOG A;  4X1U A;  4MCU A;  4G19 A;  4ML1 A;  4IEL A;  5G5F A;  4ECB A;  3PR8 A;  1K0N A;  1MDJ A;  4CY8 A;  1EGO A;  2LS5 A;  4MZB A;  1AIU A;  5ECK B;  2TRC P;  1ERT A;  3A2X A;  3VPQ A;  5HFK A;  4LL1 B;  2L5L A;  3V1W A;  1UVZ A;  2LNS A;  2VUP A;  4BIK A;  2JAC A;  4GF0 A;  3HJM A;  4L5L A;  5DDL A;  5B6N A;  3P7X A;  4N0V A;  3ZZX A;  1XBS A;  3F3R A;  2K8V A;  5G30 A;  3FYG A;  4K7N A;  2GQM A;  1XIY A;  2EIO A;  1B8X A;  1SEN A;  3TJJ A;  1OKT A;  2MYG A;  4IQ1 A;  2FA8 A;  1SK1 A;  2YWO A;  1GRX A;  3GSS A;  1Z7R A;  4IP1 A;  2K18 A;  2VLU A;  4TR3 A;  3D4M A;  1NM3 A;  1MDK A;  4GCI A;  4N0Z A;  5EPF A;  2TIR A;  4EDY A;  3KD0 A;  3I69 A;  1XWK A;  3M1G A;  2DJ1 A;  1GSS A;  2WGR A;  1M3I A;  3C1R A;  3BOA A;  3FMW A;  2DJ2 A;  3WT2 A;  5HR1 A;  1K0M A;  4TR1 B;  1M2D A;  1VF3 A;  2R37 A;  1CQG A;  2FWG A;  4ILF A;  2R6K A;  1K0D A;  3ME7 A;  1EV9 A;  5CO3 A;  5KOX A;  4RUV A;  1YF0 A;  2VCT A;  3F6F A;  4I97 A;  1F37 A;  4PGT A;  3KP9 A;  4J57 E;  1AAZ A;  1SJ6 A;  2FGX A;  3KTL A;  4JRR A;  2ON5 A;  3KP8 A;  3GN3 A;  4KB3 A;  4KND A;  1ML6 A;  3E3E A;  2A2P A;  2YWM A;  1GUM A;  5F8B A;  4GQC A;  3N5O A;  3FK8 A;  3G9B A;  1TU8 A;  2V2G A;  2R5G A;  2IME A;  1DE2 A;  2DIZ A;  4G9H A;  1U6T A;  5L71 A;  3LYP A;  3N9J A;  3FY7 A;  3HA9 A;  4YAV A;  2CT6 A;  2BJX A;  3GH6 A;  1M7T A;  2HSH A;  4V1A p;  4JU5 A;  4NHZ A;  2CA8 A;  2FUG 2;  2O89 A;  3KEB A;  1G6Y A;  2Z9S A;  2O8V B;  4HSC X;  5CRW A;  4NV5 A;  4FYU A;  4CHS A;  1VF1 A;  1XWA A;  1SL0 B;  3KXO A;  5AIS A;  1B9X C;  1R5A A;  1K0A A;  5G1K A;  4TW5 A;  1EEM A;  4AJ7 A;  3C8E A;  3IE3 A;  1V58 A;  5HR0 A;  5J9B A;  1O85 A;  3TKP A;  1EOH A;  3E0U A;  4YQU A;  4MPF A;  5C04 A;  2H70 A;  3IXR A;  1CQH A;  2B7K A;  1K3Y A;  2GS3 A;  2C4J A;  2VL3 A;  3G7Y A;  1EV4 A;  2I1U A;  3DML A;  1QMV A;  3S9F A;  3ED3 A;  3GTU A;  1XZO A;  1K0B A;  5CYY A;  1Z6M A;  1QQ2 A;  5HR2 A;  1KNG A;  1RQM A;  3PGT A;  2VCX A;  2B6M A;  4ECC A;  5IMZ A;  3W6G A;  1WJK A;  4DSS A;  4WEY A;  2VCW A;  2IFQ A;  2LJA A;  3GL5 A;  4PUA A;  3MYD A;  2OE1 A;  3F4S A;  1OVN A;  5KN3 A;  4ZIL A;  2NDO A;  5INY A;  2P5Q A;  2B5Y A;  4BVX B;  2AB6 A;  1XOA A;  5DAL A;  2PN8 A;  2YJH A;  3DIE A;  3VWU A;  3CYN A;  3P8W A;  4E8H A;  1TDI A;  4HQS A;  2CVB A;  4G0K A;  2VCZ A;  1BX9 A;  3QR6 A;  1OYJ A;  17GS A;  2V6K A;  1TW9 A;  2WJU A;  4ZBD A;  4WR4 A;  1NW2 A;  3MNG A;  3M0F A;  4CY6 A;  5DCH A;  2PVO C;  3Q19 A;  1A2M A;  1FHE A;  1GTB A;  3VPT A;  2YOI A;  3IAM 2;  2YCD A;  4O92 A;  3VWX A;  1GSD A;  3D21 A;  2FD3 A;  3FZ4 A;  1XVQ A;  2IPA A;  1TRW A;  1WIK A;  3AY8 A;  2D2Z A;  2PER A;  1XWB A;  1JZO A;  3KTB A;  4JED A;  5H5R A;  4F0B A;  1M0U A;  4WF5 A;  2OBK A;  3HJO A;  1THX A;  2GQL A;  4MJB A;  2WFC A;  2JSY A;  2GDR A;  5D8I A;  2IMF A;  2R2J A;  2B5E A;  3LJR A;  3KH7 A;  1GTI A;  2X4A A;  1XW6 A;  1UA5 A;  1NSW A;  5DJM A;  4Q5N A;  3HDC A;  2P5R A;  4WET A;  3TGZ A;  1M9A A;  2LRT A;  4TVE A;  2C0F A;  2YWI A;  4RI6 A;  2P0G A;  1MD3 A;  5D9W A;  3QAW A;  4KCA A;  2ZUP A;  2HRK A;  4JBB A;  4N10 A;  3IA1 A;  5ELA A;  2NTO A;  3ZL5 A;  3TKS C;  1WRY A;  2F8A A;  4G0L A;  1AQX A;  4BPY A;  1F2E A;  2HRA A;  3MSZ A;  2VLV A;  5DCG A;  2HE3 A;  4ML6 A;  3RHB A;  2WRT A;  3O3T A;  4Z2R A;  4DSQ A;  2B3S A;  2J9H A;  3RPN A;  2CV4 A;  5DBQ A;  2YN1 A;  3EWL A;  1V57 A;  4ULX A;  4PXO A;  5JWO B;  5GAN D;  2F3M A;  5BMU A;  3GUS A;  4ACS A;  2H1A A;  3TJK A;  4EIQ A;  1FVK A;  1T8E B;  3GH9 A;  1IYH A;  2V32 A;  4L5O A;  3F9U A;  1ZOF A;  3J7Y k;  3EMP A;  5COH A;  3UJ1 A;  2YJ7 A;  2A4V A;  2H73 A;  5DQS A;  1B4Q A;  3KM6 A;  2H75 A;  1WPI A;  6GSV A;  3TKS A;  2N5F A;  3LW9 A;  2H71 A;  4ZB9 A;  3IBH A;  2CX3 A;  1FAA A;  4DEJ A;  2IL3 A;  4OFN A;  1TK0 B;  3US3 A;  3ZFB A;  4F2I A;  2CVK A;  2RUE A;  2DC5 A;  4E8E A;  1TRS A;  1XG8 A;  2BMX A;  4BL7 A;  1Z9H A;  2R4V A;  1SJZ A;  4OO4 A;  2F8F A;  3A3T A;  3PH9 A;  4EUY A;  4I6X A;  1YQ1 A;  1PSQ A;  5J9C A;  1M2B A;  3IHG A;  2OAC A;  1TJD A;  4POL A;  1DBY A;  1T4Z A;  5IOW A;  5GST A;  2FNO A;  1GUK A;  4Q5Q A;  5IPH A;  2AJQ B;  3GKX A;  4GTU A;  2WB9 A;  3F6D A;  1X5D A;  1A0R P;  1Q98 A;  2DKH A;  4XTS A;  3FRC A;  3I43 A;  3GIX A;  5JWR B;  2DSA A;  1X0R A;  4XS4 A;  2L4Q A;  3CXG A;  3TRP A;  4G2E A;  4LMW A;  4J2F A;  3UVH A;  4K2D A;  2LNT A;  1GWC A;  4BWS A;  2C3Q A;  2V41 A;  3GKN A;  2C3N A;  2L4C A;  2M80 A;  2QA1 A;  3QDN A;  1Y25 A;  2LJR A;  3FZA A;  1K0O A;  3QCP A;  1T4Y A;  3MDK A;  4IW9 A;  2VM1 A;  1ZYQ B;  5ECM B;  3C73 A;  3QAG A;  3APO A;  4IVF A;  3FR9 A;  2MMN A;  2DKI A;  2PGT A;  3LFL A;  4X4J A;  4DSR A;  1ERU A;  5DAK A;  4BA7 A;  3D5J A;  4Q5R A;  2QGV A;  4MLY A;  5HR3 A;  1MD4 A;  3O76 A;  2AYT A;  4TR0 A;  1ABA A;  3GA4 A;  2YZU A;  3QPM A;  2GZZ A;  3GMF A;  1U3A A;  2GT6 A;  1KBN A;  3LWA A;  5JWQ B;  3CRU A;  2HRF A;  1WP0 A;  2X99 A;  3DXB A;  3HHV A;  1B9Y C;  3TDG A;  4HZ2 A;  4IS0 A;  3LYK A;  3KJY A;  2XBI A;  4EE0 A;  4ICY A;  3DYR A;  1ZGN A;  2WS2 A;  3QOU A;  3GL3 A;  3GST A;  5ECO B;  1QFN A;  4TXO A;  3RDW A;  1R26 A;  2YV9 A;  4ZL8 A;  4NHW A;  3IRA A;  4PNG A;  2A2R A;  4JR6 A;  4MAB A;  1GLP A;  3IDV A;  3H1N A;  1M2A A;  4I5Q A;  2B1L A;  3GX8 A;  1EP7 A;  1AQW A;  4V2L A;  4I8B A;  5J5N A;  1S3R A;  4GXZ A;  2YP6 A;  2GZP A;  5AIX A;  3W8J A;  4TXV A;  1PX6 A;  3RPP A;  2FA4 A;  3FW2 A;  4G0I A;  4Z2U A;  4OMV A;  1GP1 A;  2JSZ A;  3FR3 A;  1B48 A;  1HNA A;  3GTU B;  1T00 A;  1KTE A;  1E6B A;  20GS A;  2MBS A;  4GRF A;  3GKM A;  3FKF A;  3W8S A;  4MK3 A;  2HSM A;  2DIY A;  2H0H A; 
#chains in the Genus database with same CATH homology
 3EUR A;  2JL4 A;  4K7I A;  3TUE A;  3CSJ A;  3UEM A;  4DSS B;  1GNE A;  1B4P A;  3UBL A;  2IFQ B;  1SD8 A;  3WD6 A;  4MJA A;  4QL7 A;  4NAX A;  3FZ5 A;  2LRC A;  3VLN A;  2MZC A;  1PGT A;  5D73 A;  1WE0 A;  3ERF A;  4MH3 A;  5DAL B;  2JU5 A;  2KP2 A;  1QXH A;  3D0Z A;  4A5P A;  3SBC A;  3ZFL A;  3ERG A;  3WGE A;  1A24 A;  2JZT A;  4GWR A;  10GS A;  3CSI A;  2NBS A;  3EU3 A;  4EO3 A;  2KLX A;  2H01 A;  2R0G A;  3KCM A;  2H66 A;  4JZQ A;  3TRX A;  4YQV A;  1ZL9 A;  5CRG A;  2G2Q A;  1ACV A;  2OBI A;  4IBP A;  4YH2 A;  5ECL B;  1FG4 A;  3UAR A;  3IPZ A;  4KDX A;  3R2Q A;  4YQM A;  4HZ4 A;  13GS A;  1W89 A;  5D9T A;  2EIQ A;  3A5I A;  5G5E A;  1JLW A;  2HZF A;  1ST9 A;  5ECQ B;  1ZYN A;  1WWJ A;  3TJB A;  2ZNM A;  3O6T A;  2C0G A;  3CSH A;  2A4H A;  1VGL A;  2XBQ A;  5IM9 A;  3TB2 A;  3A2W A;  3D22 A;  2VCV A;  2YZH A;  2UZ8 A;  2WZ9 A;  3I9V 2;  4I2T A;  4F03 A;  2XPE A;  1SU9 A;  2H0I A;  1Y6E A;  8GSS A;  19GS A;  1XXU A;  5ECS A;  2R0P A;  4ZB8 A;  1ERV A;  4BVY A;  4AGS A;  4OD7 A;  2CZ2 A;  1PL1 A;  2C1Y A;  1GSQ A;  5IMA A;  3M3M A;  2OE3 A;  4RQR A;  1XWC A;  2KHP A;  1ERW A;  2FWE A;  5C00 A;  1G7E A;  2LTK A;  5D9X A;  2XPD A;  3CTF A;  1J08 A;  2B1K A;  2IWT A;  1H75 A;  1J9B A;  1E2Y A;  2M72 A;  1VRS D;  1UC7 A;  1N8J A;  3A2V A;  4PX1 A;  3DD3 A;  1G0T A;  9GSS A;  5CAX A;  5A4U A;  2L59 A;  2RM5 A;  4O32 A;  1XCC A;  3C71 A;  5AIV A;  4Q5F A;  3CRT A;  3ZRE A;  5KN0 A;  3DWV A;  2L57 A;  3C7M A;  1S3C A;  2PBJ A;  2LKU A;  3APQ A;  1X9S B;  1XVW A;  5IMD A;  3ZVJ D;  1PN9 A;  1A23 A;  2HZE A;  2C0E A;  2LRN A;  3DGQ A;  3LXZ A;  1ZYP A;  3GV1 A;  1FOH A;  1T3B A;  1FB6 A;  4TR1 A;  2X8H A;  2LST A;  4K2X A;  2HFD A;  2VD1 A;  4ID0 A;  3BJ5 A;  4HOJ A;  2HLS A;  5IIZ A;  4EVM A;  3LXT A;  5F06 A;  4POM A;  3D6I A;  5G1L A;  2RM6 A;  2WUL A;  2RLI A;  2KUC A;  4HUA A;  2VAF A;  1K3O A;  3NIV A;  4BL7 B;  1GH2 A;  4KF9 A;  1GL8 A;  22GS A;  2GSS A;  1G6W A;  3UOM A;  3K8N A;  3H79 A;  1OE8 A;  3UAP A;  1X9W B;  1K3L A;  4TRX A;  3TKQ A;  1ZMA A;  5ECR B;  5F05 A;  5ECN B;  1TRV A;  2X64 A;  1EP8 A;  4GLT A;  4L8E A;  3VUR A;  5DQY A;  2O7K A;  4DVC A;  3ZIV A;  3DEX A;  1MDI A;  5FT3 A;  2H19 A;  1ZYE A;  2C3T A;  3HD5 A;  3FR6 A;  4P3Y B;  4WBJ A;  4D73 A;  1KEB A;  4NWY A;  5IMV A;  1BAY A;  4QL9 A;  2G0F A;  1SL1 B;  5G31 A;  4HQZ A;  1H4O A;  3HVV A;  2QKE A;  3IHQ A;  4K0N A;  4XS4 B;  5D93 A;  5HFG A;  3QAV A;  4FH8 A;  1YY7 A;  4IN0 A;  2MMZ A;  4RI7 A;  1GSE A;  4GSS A;  3CTG A;  4WR5 A;  5ECP B;  3PIN A;  4K9Z A;  2DMM A;  3D4T A;  1V9W A;  3H4K A;  4V1A g;  1TI3 A;  1XPV A;  3HZ8 A;  1W4V A;  4HU9 A;  1O8W A;  5D9V A;  2CZ3 A;  2VM2 A;  5CRH A;  2JZS A;  4PNF A;  4EIP A;  5CRE A;  1EGR A;  2GSQ A;  3Q6O A;  2AAW A;  1A0F A;  4EXJ A;  1TOF A;  1AUC A;  2PWJ A;  4XS1 A;  1ON4 A;  3TCO A;  2K9F A;  6GSY A;  2I3Y A;  2LQO A;  2N5B A;  1MEK A;  4L0W A;  5D96 A;  3IK7 A;  2HYX A;  1R4W A;  3M8N A;  1JFU A;  2FCH A;  1O7U A;  5IPG A;  5HQP A;  3HYP A;  2GSR A;  4TXO B;  2P31 A;  4LMV A;  2PUK C;  4IHU A;  1SD9 A;  4ZXG A;  5LD0 A;  1YEP A;  4FYC A;  3RAZ A;  2K6V A;  2H72 A;  4HU7 A;  1S3D A;  2EIR A;  4OWY A;  2IMK A;  4PQH A;  7GSS A;  4H86 A;  5A4W A;  2HXK A;  4LA1 A;  5BRT A;  1Z5Y E;  4WKW A;  2DJJ A;  5IMF A;  1GLQ A;  5J4U A;  1JZD A;  1O81 A;  2FLS A;  18GS A;  2YNX A;  5EY6 A;  3ZLP A;  5J3R A;  1GTA A;  1N2A A;  6GSS A;  2BTO T;  2OA7 A;  5ID2 A;  2DJK A;  4MZC A;  3GKK A;  1TP9 A;  4POB A;  2H1D A;  2CX4 A;  5B8B A;  3U5R E;  4XCS A;  4EC0 A;  2PVQ A;  3EU4 A;  3CBU A;  5JCG A;  1AW9 A;  4MA9 A;  4N11 A;  5H5S A;  1QGV A;  1PA3 A;  1M99 A;  4KW6 A;  4OFT A;  1Z6N A;  1TTZ A;  2E2G A;  4EDZ A;  2LV3 A;  4Z2T A;  4IGJ A;  1U88 A;  1YEX A;  2FY6 A;  2IJY A;  4F9Z A;  5IMC A;  2H1G A;  1FB0 A;  1PD2 1;  3A5W A;  1J0F A;  3G7I A;  1PL2 A;  4OFM A;  4XRD A;  3J7Y b;  5F07 A;  4KDU A;  1NHO A;  2ON7 A;  5E59 A;  4IQA A;  4TR4 A;  5AGY A;  4EL1 A;  2H1B A;  2EC4 A;  2OE0 A;  2VLT A;  3IR4 A;  4IP6 A;  1THO A;  2O85 A;  1JZR A;  1EEJ A;  3C1S A;  2WDU A;  5KN2 A;  1S3A A;  2GTU A;  1UN2 A;  5IO2 A;  1SKR B;  3DVX A;  5ELG A;  1YKC A;  4MF6 A;  4X43 A;  1SKS B;  3SWL A;  4EF0 A;  1K0C A;  2H6Y A;  4XS6 A;  2GZY A;  2QSI A;  4KSO A;  2YAN A;  4EKZ A;  1AQV A;  2L5O A;  1RW1 A;  2JZR A;  3APS A;  4FO5 A;  3PPU A;  1WMJ A;  1GUH A;  2HRN A;  2H76 A;  2N5A A;  1I5G A;  3MWH A;  2V1M A;  4NPB A;  1FOV A;  4YKF A;  4KSM A;  4AJ8 A;  2I4A A;  4HS1 A;  4NV2 A;  3RHC A;  3VI5 A;  3DVW A;  5GAP D;  5AN1 A;  4BVY B;  1ZCP A;  1U87 A;  2OKA A;  2F9S A;  2YPM A;  2C80 A;  2GGT A;  5JCU A;  2REM A;  3F4T A;  3L9V A;  4V2M A;  1XWG A;  4K5R A;  4BWQ A;  4MF7 A;  1G7O A;  2L6C A;  2VCQ A;  1YJ6 A;  4JR4 A;  2M46 A;  1OKD A;  5HFI A;  14GS A;  3KZQ A;  5FHI A;  2R0C A;  3FHK A;  1HQO A;  3VWW A;  3H8Q A;  3NOF A;  4F0C A;  1OC9 A;  1X9M B;  5IQY A;  2H74 A;  1BQ7 A;  1PX7 A;  1LJR A;  4O5U A;  3ZTL A;  5IO0 A;  4K8M A;  3TOU A;  1Q4J A;  4MDC A;  4QQ7 A;  3BCK A;  3L78 A;  5F0G A;  2HZE B;  3IV4 A;  2IIY A;  2DLX A;  3EVI A;  4O5R A;  4OO5 A;  4WXT A;  4K7O A;  4ZBB A;  5LNK e;  4OCE A;  3P2A A;  11GS A;  2HI7 A;  3Q18 A;  3M9J A;  2CVD A;  4F82 A;  2QA2 A;  4PUR A;  4IJ3 A;  1XW5 A;  1AC1 A;  1XW9 A;  1OC8 A;  3DRN A;  3NZN A;  5B8A A;  3HVX A;  3TJF A;  3ZRD A;  2FHE A;  5B6M A;  3GX0 A;  2ZCT A;  4HJM A;  3ZYW A;  1LU4 A;  3U6V A;  1OAZ A;  3VK9 A;  2R3X A;  3LSZ A;  4XHM A;  3HXS A;  3UVT A;  3WYW A;  5DJL A;  4ECJ A;  2I81 A;  5B7C A;  4HI7 A;  3JCM L;  4KGI A;  2RUF A;  5CP1 A;  1HNB A;  1FW1 A;  1JLV A;  1DSB A;  3HKR A;  3HZ4 A;  1T7P B;  4I2U A;  4D73 B;  3H93 A;  4FYB A;  4WBR D;  4AF2 A;  3EC3 A;  4CW9 A;  1VF4 A;  4PQI A;  4YAP A;  1F9M A;  5KN1 A;  4K5S A;  1X5E A;  1C72 A;  1PRX A;  4MZW A;  3HY2 A;  1F6M C;  3LGC A;  2DJ0 A;  2IMD A;  2E7P A;  1HD2 A;  1PN0 A;  3P90 A;  1GTU A;  1Z7P A;  1Z3E A;  6GSW A;  3GUR A;  16GS A;  2GQK A;  2HT9 A;  2LQQ A;  4XRA A;  2E0Q A;  4KA0 A;  2DML A;  2H8L A;  3G7J A;  4LL4 B;  2KOK A;  1R7H A;  5ABR A;  2I9H A;  4TKY A;  4USS A;  2C0D A;  4MH2 A;  2X8G A;  4FIW A;  3KIJ A;  2CQ9 A;  1JZW A;  1GSY A;  2JAD A;  1SYX A;  2PU9 C;  4MNN A;  4ISD A;  4Z7X A;  2OAD A;  3ZVJ A;  3M9K A;  1PQN A;  4ZL7 A;  3EYT A;  4KUN A;  2NPB A;  4KE3 A;  2AV4 A;  5A5K A;  3WT1 A;  3EPT A;  3IC4 A;  4NXI A;  3HJP A;  5IOX A;  3EMX A;  3DKS A;  1TXX A;  5GZZ B;  2AUV A;  3L0H A;  4CDO A;  1TU7 A;  4HDE A;  1URM A;  1USB A;  4FQU A;  3UMA A;  3R3E A;  3HCZ A;  2CAI A;  3F63 A;  1A8Y A;  1XFL A;  1QUW A;  1OC3 A;  4KH7 A;  3GYK A;  4TOP A;  4V2N A;  4ZBA A;  4MP4 A;  2B7J A;  2H6Z A;  1F3A A;  3TOT A;  1GUL A;  3F4R A;  3LEF A;  4K1F A;  2FWF A;  1O73 A;  4WF4 A;  2DJ3 A;  1SK2 A;  3EE2 A;  5KEJ A;  4J56 E;  3TRQ A;  4ZB6 A;  3OR5 A;  1GSU A;  5ID2 B;  5DVB A;  1TK8 B;  2WCI A;  1BJX A;  3GFK A;  5CNW A;  4MPG A;  1I9D A;  4XIH A;  4TN8 A;  2TRX A;  1HNC A;  2XC2 A;  2AHE A;  1M9B A;  5JCW A;  1GNW A;  1IYI A;  2PMT A;  4O7H A;  1YZX A;  1GSF A;  3EIN A;  3F0I A;  3UBK A;  3TJG A;  5H5Q A;  3KH9 A;  3VFI A;  4IKH A;  1SYR A;  2ES7 A;  1PMT A;  2YWN A;  2GT5 A;  2DBC A;  1YF1 A;  2ALB A;  4N30 A;  2MBT A;  2MMO A;  1V40 A;  5EVO A;  1DUG A;  4MMM A;  4L0U A;  1VF2 A;  3BCI A;  3ZIJ A;  4ZIJ A;  3F8U A;  2O87 A;  3GHA A;  4PUF C;  5DAK B;  3MAK A;  1SL2 B;  3Q74 A;  3GRX A;  2X8C A;  6GST A;  3IK9 A;  4O5Q A;  3QD9 A;  3HVS A;  1SJI A;  1DE1 A;  2VL9 A;  4RQX A;  1ILO A;  4PTS A;  4BVX A;  2B5X A;  1ZZY A;  3IAS 2;  4X0X A;  5CRD A;  2GLR A;  1SK0 A;  1YDK A;  5A4V A;  4PQ1 A;  3I6A A;  4KCE A;  1FVJ A;  3LQ7 A;  3UL3 A;  4KX4 A;  2C8U A;  1SKW B;  1EZK A;  4POK A;  4ZL9 A;  2MMA A;  3E9J B;  3FZ9 A;  3ZML A;  4GQF A;  2VL2 C;  3LOR A;  1JHB A;  4K0G A;  5E4W A;  2FWH A;  4HJ2 A;  4JE1 A;  5ECH B;  1X5C A;  4ECI A;  1PKW A;  2V6O A;  1WOU A;  1V98 A;  3GNJ A;  5G2Z A;  3QFA C;  2NVL A;  3L9U A;  3L4N A;  1BG5 A;  1T1V A;  5ECI B;  1R5P A;  5J41 A;  2LJK A;  2KP1 A;  2L6D A;  1V2A A;  3VWV A;  2A2S A;  2HSY A;  3UIW A;  3VI7 A;  2H0G A;  3ERW A;  2VOC A;  2J23 A;  1NHY A;  3QMX A;  3BBY A;  3ZIT A;  3KGK A;  1A2J A;  3LG6 A;  3TKS E;  1FO5 A;  4MJC A;  4YKG A;  4GST A;  4KDY A;  5EL8 A;  3MIX A;  1OE7 A;  3KMN A;  1LBK A;  1O6J A;  3IOS A;  2GVP A;  3TKR A;  3WGX A;  1OC9 B;  6GSX A;  3CMI A;  1U3I A;  4NMU A;  1PKZ A;  1A8L A;  5KOW A;  3RBT A;  3FEU A;  5ENU A;  3L9S A;  4IJI A;  2QC7 A;  1TI1 A;  4MF5 A;  3ZMK A;  2OJL A;  4LLR A;  2XHF A;  5GSS A;  1RK4 A;  2IN3 A;  4HEA 2;  5LCZ A;  1AXD A;  1O8X A;  2VD0 A;  12GS A;  3F3Q A;  2RII A;  1HYU A;  2CAQ A;  2VL2 A;  4KAE A;  1MTC A;  1QK8 A;  1F3B A;  1YKA A;  2K8S A;  3ME8 A;  1XOB A;  4GSN A;  2VO4 A;  1TK5 B;  4G10 A;  5FWG A;  3BD2 A;  1BYE A;  1BED A;  3IC8 A;  4MJE A;  2IMI A;  2PPT A;  3QFB C;  6GSU A;  3WGD A;  1TRU A;  2LEG A;  2E2M A;  1TKD B;  3ISO A;  2LUS A;  4OCF A;  2VIM A;  4K6X A;  2HNL A;  2F51 A;  2YV7 A;  2GST A;  1EWX A;  2H30 A;  2H6X A;  3KMO A;  1A2L A;  2X49 A;  4AJ6 A;  1EOG A;  4X1U A;  4MCU A;  4G19 A;  4ML1 A;  4IEL A;  5G5F A;  4ECB A;  3PR8 A;  1K0N A;  1MDJ A;  4CY8 A;  1EGO A;  2LS5 A;  4MZB A;  1AIU A;  5ECK B;  2TRC P;  1ERT A;  3A2X A;  3VPQ A;  5HFK A;  4LL1 B;  2L5L A;  3V1W A;  1UVZ A;  2LNS A;  2VUP A;  2JAC A;  4GF0 A;  3HJM A;  4L5L A;  5DDL A;  5B6N A;  3P7X A;  4N0V A;  3ZZX A;  1XBS A;  3F3R A;  2K8V A;  5G30 A;  3FYG A;  4K7N A;  2GQM A;  1XIY A;  2EIO A;  1B8X A;  1SEN A;  3TJJ A;  1OKT A;  2MYG A;  4IQ1 A;  2FA8 A;  1SK1 A;  2YWO A;  1GRX A;  3GSS A;  1Z7R A;  4IP1 A;  2K18 A;  2VLU A;  4TR3 A;  3D4M A;  1NM3 A;  1MDK A;  4GCI A;  4N0Z A;  5EPF A;  2TIR A;  4EDY A;  3KD0 A;  3I69 A;  1XWK A;  3M1G A;  2DJ1 A;  1GSS A;  2WGR A;  3C1R A;  3BOA A;  3FMW A;  2DJ2 A;  3WT2 A;  5HR1 A;  1K0M A;  4TR1 B;  1M2D A;  1VF3 A;  2R37 A;  1CQG A;  2FWG A;  4ILF A;  2R6K A;  1K0D A;  3ME7 A;  1EV9 A;  5CO3 A;  5KOX A;  4RUV A;  1YF0 A;  2VCT A;  3F6F A;  4I97 A;  1F37 A;  4PGT A;  3KP9 A;  4J57 E;  1AAZ A;  1SJ6 A;  2FGX A;  3KTL A;  4JRR A;  2ON5 A;  3KP8 A;  3GN3 A;  4KB3 A;  4KND A;  1ML6 A;  3E3E A;  2A2P A;  2YWM A;  1GUM A;  5F8B A;  4GQC A;  3N5O A;  3FK8 A;  3G9B A;  1TU8 A;  2V2G A;  2R5G A;  2IME A;  1DE2 A;  2DIZ A;  4G9H A;  1U6T A;  5L71 A;  3LYP A;  3N9J A;  3FY7 A;  3HA9 A;  4YAV A;  2CT6 A;  2BJX A;  3GH6 A;  1M7T A;  2HSH A;  4V1A p;  4JU5 A;  4NHZ A;  2CA8 A;  2FUG 2;  2O89 A;  3KEB A;  1G6Y A;  2Z9S A;  2O8V B;  5CRW A;  4NV5 A;  4FYU A;  4CHS A;  1VF1 A;  1XWA A;  1SL0 B;  3KXO A;  5AIS A;  1B9X C;  1R5A A;  1K0A A;  5G1K A;  4TW5 A;  1EEM A;  4AJ7 A;  3C8E A;  3IE3 A;  1V58 A;  5HR0 A;  5J9B A;  1O85 A;  3TKP A;  1EOH A;  3E0U A;  4YQU A;  4MPF A;  5C04 A;  2H70 A;  3IXR A;  1CQH A;  2B7K A;  1K3Y A;  2GS3 A;  2C4J A;  2VL3 A;  3G7Y A;  1EV4 A;  2I1U A;  3DML A;  1QMV A;  3S9F A;  3ED3 A;  3GTU A;  1XZO A;  1K0B A;  5CYY A;  1Z6M A;  1QQ2 A;  5HR2 A;  1KNG A;  1RQM A;  3PGT A;  2VCX A;  2B6M A;  4ECC A;  5IMZ A;  3W6G A;  1WJK A;  4DSS A;  4WEY A;  2VCW A;  2IFQ A;  2LJA A;  3GL5 A;  4PUA A;  3MYD A;  2OE1 A;  3F4S A;  1OVN A;  5KN3 A;  4ZIL A;  2NDO A;  5INY A;  2P5Q A;  2B5Y A;  4BVX B;  2AB6 A;  1XOA A;  5DAL A;  2PN8 A;  2YJH A;  3DIE A;  3VWU A;  3CYN A;  3P8W A;  4E8H A;  1TDI A;  4HQS A;  2CVB A;  4G0K A;  2VCZ A;  1BX9 A;  3QR6 A;  1OYJ A;  17GS A;  2V6K A;  1TW9 A;  2WJU A;  4ZBD A;  4WR4 A;  1NW2 A;  3MNG A;  3M0F A;  4CY6 A;  5DCH A;  2PVO C;  3Q19 A;  1A2M A;  1FHE A;  1GTB A;  3VPT A;  2YOI A;  3IAM 2;  2YCD A;  4O92 A;  3VWX A;  1GSD A;  3D21 A;  2FD3 A;  3FZ4 A;  1XVQ A;  2IPA A;  1TRW A;  1WIK A;  3AY8 A;  2D2Z A;  2PER A;  1XWB A;  1JZO A;  3KTB A;  4JED A;  5H5R A;  4F0B A;  1M0U A;  4WF5 A;  2OBK A;  3HJO A;  1THX A;  2GQL A;  4MJB A;  2WFC A;  2JSY A;  2GDR A;  5D8I A;  2IMF A;  2R2J A;  2B5E A;  3LJR A;  3KH7 A;  1GTI A;  2X4A A;  1XW6 A;  1UA5 A;  1NSW A;  5DJM A;  4Q5N A;  3HDC A;  2P5R A;  4WET A;  3TGZ A;  1M9A A;  2LRT A;  4TVE A;  2C0F A;  2YWI A;  4RI6 A;  2P0G A;  1MD3 A;  5D9W A;  3QAW A;  4KCA A;  2ZUP A;  2HRK A;  4JBB A;  4N10 A;  3IA1 A;  5ELA A;  2NTO A;  3ZL5 A;  3TKS C;  1WRY A;  2F8A A;  4G0L A;  1AQX A;  4BPY A;  1F2E A;  2HRA A;  3MSZ A;  2VLV A;  5DCG A;  2HE3 A;  4ML6 A;  3RHB A;  2WRT A;  3O3T A;  4Z2R A;  4DSQ A;  2B3S A;  2J9H A;  3RPN A;  2CV4 A;  5DBQ A;  2YN1 A;  3EWL A;  1V57 A;  4ULX A;  4PXO A;  5JWO B;  5GAN D;  2F3M A;  5BMU A;  3GUS A;  4ACS A;  2H1A A;  3TJK A;  4EIQ A;  1FVK A;  1T8E B;  3GH9 A;  1IYH A;  2V32 A;  4L5O A;  3F9U A;  1ZOF A;  3J7Y k;  3EMP A;  5COH A;  3UJ1 A;  2YJ7 A;  2A4V A;  2H73 A;  5DQS A;  1B4Q A;  3KM6 A;  2H75 A;  1WPI A;  6GSV A;  3TKS A;  2N5F A;  3LW9 A;  2H71 A;  4ZB9 A;  3IBH A;  2CX3 A;  1FAA A;  4DEJ A;  2IL3 A;  4OFN A;  1TK0 B;  3US3 A;  3ZFB A;  4F2I A;  2CVK A;  2RUE A;  2DC5 A;  4E8E A;  1TRS A;  2BMX A;  4BL7 A;  1Z9H A;  2R4V A;  1SJZ A;  4OO4 A;  2F8F A;  3A3T A;  3PH9 A;  4EUY A;  4I6X A;  1YQ1 A;  1PSQ A;  5J9C A;  1M2B A;  3IHG A;  2OAC A;  1TJD A;  4POL A;  1DBY A;  1T4Z A;  5IOW A;  5GST A;  2FNO A;  1GUK A;  4Q5Q A;  5IPH A;  2AJQ B;  3GKX A;  4GTU A;  2WB9 A;  3F6D A;  1X5D A;  1A0R P;  1Q98 A;  2DKH A;  4XTS A;  3FRC A;  3I43 A;  3GIX A;  5JWR B;  2DSA A;  1X0R A;  4XS4 A;  2L4Q A;  3CXG A;  3TRP A;  4G2E A;  4LMW A;  4J2F A;  3UVH A;  4K2D A;  2LNT A;  1GWC A;  4BWS A;  2C3Q A;  2V41 A;  3GKN A;  2C3N A;  2L4C A;  2M80 A;  2QA1 A;  3QDN A;  1Y25 A;  2LJR A;  3FZA A;  1K0O A;  3QCP A;  1T4Y A;  3MDK A;  4IW9 A;  2VM1 A;  1ZYQ B;  5ECM B;  3C73 A;  3QAG A;  3APO A;  4IVF A;  3FR9 A;  2MMN A;  2DKI A;  2PGT A;  3LFL A;  4X4J A;  4DSR A;  1ERU A;  5DAK A;  4BA7 A;  3D5J A;  4Q5R A;  2QGV A;  4MLY A;  5HR3 A;  1MD4 A;  3O76 A;  2AYT A;  4TR0 A;  1ABA A;  3GA4 A;  2YZU A;  3QPM A;  2GZZ A;  3GMF A;  1U3A A;  2GT6 A;  1KBN A;  3LWA A;  5JWQ B;  3CRU A;  2HRF A;  1WP0 A;  2X99 A;  3DXB A;  3HHV A;  1B9Y C;  3TDG A;  4HZ2 A;  4IS0 A;  3LYK A;  3KJY A;  2XBI A;  4EE0 A;  4ICY A;  3DYR A;  1ZGN A;  2WS2 A;  3QOU A;  3GL3 A;  3GST A;  5ECO B;  1QFN A;  4TXO A;  3RDW A;  1R26 A;  2YV9 A;  4ZL8 A;  4NHW A;  3IRA A;  4PNG A;  2A2R A;  4JR6 A;  4MAB A;  1GLP A;  3IDV A;  3H1N A;  1M2A A;  4I5Q A;  2B1L A;  3GX8 A;  1EP7 A;  1AQW A;  4V2L A;  4I8B A;  5J5N A;  4GXZ A;  2YP6 A;  2GZP A;  5AIX A;  3W8J A;  4TXV A;  1PX6 A;  3RPP A;  2FA4 A;  3FW2 A;  4G0I A;  4Z2U A;  4OMV A;  1GP1 A;  2JSZ A;  3FR3 A;  1B48 A;  1HNA A;  3GTU B;  1T00 A;  1KTE A;  1E6B A;  20GS A;  2MBS A;  4GRF A;  3GKM A;  3FKF A;  3W8S A;  4MK3 A;  2HSM A;  2DIY A;  2H0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...