2HT9A

The structure of dimeric human glutaredoxin 2
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
104
structure length
104
Chain Sequence
LATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin-2
publication title Reversible sequestration of active site cysteines in a 2Fe-2S-bridged dimer provides a mechanism for glutaredoxin 2 regulation in human mitochondria
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ht9A00
2VM1A 2R2JA 4PQIA 4KCEA 4NMUA 5B8AA 2I1UA 2FWGA 2LKUA 4MF7A 3EWLA 3Q6OA 5JWQB 1GULA 4Q5RA 2K6VA 5EPFA 2C80A 2O7KA 1ABAA 3DWVA 1E2YA 5CAXA 2VLTA 4F82A 1ZL9A 5ELGA 3QOUA 1R4WA 4OO4A 3LXZA 2N5AA 1GH2A 1SYXA 4ECCA 2H1BA 3CSHA 1YKCA 4ZB8A 1XOAA 2GS3A 5HR1A 1FB6A 2X99A 2YNXA 5DJLA 4TOPA 3IA1A 1V98A 3DIEA 5IMFA 2BMXA 5IMVA 2GSTA 3GH9A 4XS4B 3TJGA 1YEPA 2L57A 1U87A 2FA4A 1C72A 4MPGA 3C71A 2YZUA 1A2MA 2YWOA 3HVSA 2HSYA 1THXA 1XW6A 2L4QA 4ZL9A 4XHMA 4XS4A 3VLNA 1M9AA 2CZ2A 3UMAA 3ISOA 5DAKB 1IYIA 2LRTA 5B6NA 3QFBC 4GF0A 4EXJA 5GSSA 4KX4A 3DGQA 1ERWA 3EMPA 1TI3A 5DAKA 1K3OA 2KUCA 3UL3A 3ZYWA 4PGTA 2N5FA 3ZIJA 3O6TA 2LSTA 2J23A 4IJ3A 2AAWA 2LJRA 3CSJA 1JZWA 3GKMA 4J2FA 2GGTA 1I9DA 4PX1A 3GHAA 4Q5QA 3KXOA 4KDUA 4N0ZA 2YV7A 3KD0A 2B1LA 2YPMA 1SU9A 1MD3A 4N0VA 1TK0B 1HD2A 3ZTLA 5C00A 3GL5A 4ZBAA 1SKRB 1BAYA 1WPIA 1XWGA 5CRWA 4Q5NA 1ZMAA 2VCWA 4ILFA 3TJKA 4O32A 4EO3A 3F3QA 5KN3A 1TRSA 4WR5A 3EE2A 2R6KA 1BX9A 4O5RA 2DMMA 1LU4A 3EU3A 4BWQA 3GUSA 3C7MA 2QSIA 2VM2A 1Z3EA 2R37A 1GUKA 2DMLA 3TJJA 3KCMA 1F3AA 1WRYA 4HI7A 1EGRA 3KMOA 4K1FA 2O8VB 4EVMA 3BCKA 2JZRA 3KTLA 1TOFA 1XW5A 5ECRB 5EL8A 3KP9A 2L4CA 1GSEA 4BPYA 4MCUA 2RIIA 2E2GA 2LUSA 1ZGNA 3KJYA 4HU9A 3WT1A 3W6GA 4CDOA 4DSQA 3L9UA 1K0DA 1GTIA 1TW9A 2BJXA 4EL1A 3ZREA 19GSA 2IFQB 1QMVA 3I6AA 5AGYA 1UC7A 3TRPA 2OBKA 1BEDA 18GSA 3UJ1A 3VWWA 4FH8A 2RLIA 3M9KA 2IFQA 1WWJA 3SWLA 4MDCA 2CVBA 1CQHA 1T7PB 1EEMA 3GMFA 3FYGA 4IP6A 3CRTA 1A8YA 3C1SA 3FHKA 5A4WA 1M2DA 2XPEA 5ECLB 2A4VA 4OO5A 2YWNA 1MDJA 1TRWA 1ZYEA 2B6MA 4EUYA 5J3RA 1JLVA 1Q98A 1F3BA 3RPNA 4FYUA 1M9BA 3DD3A 3ZMLA 4AF2A 4N30A 5JCWA 2H0IA 1RK4A 2L59A 3M8NA 1YDKA 1VGLA 3H79A 1PMTA 2YN1A 1BYEA 5GSTA 1O8WA 2PMTA 1O81A 2PWJA 1TU8A 1O6JA 4EKZA 1F6MC 2H01A 16GSA 2HRFA 4LMWA 4OCFA 2LNTA 1KTEA 4IGJA 4HDEA 4OMVA 3TRXA 2LQOA 3JCML 4AJ6A 1TI1A 3R2QA 2TRCP 3D22A 5IQYA 4X43A 3TJBA 4OFNA 2JZSA 4KAEA 2G2QA 2DJ0A 3GTUB 4WR4A 2K8SA 3ME7A 1VF1A 2DJKA 4OWYA 2CA8A 2X8CA 5F05A 5HR2A 1SKSB 20GSA 3LXTA 2ALBA 2C4JA 3TRQA 2GSRA 2F8AA 2HLSA 3MSZA 3GTUA 2TIRA 2O87A 3E9JB 5HQPA 3A2XA 3TUEA 2HI7A 3M9JA 4V2LA 2H0HA 2CVDA 2WJUA 3IBHA 4TXVA 4IQ1A 4KW6A 3OR5A 1SYRA 5C04A 5ABRA 4E8HA 1OC3A 5ECOB 2E0QA 3L4NA 2O89A 4PQ1A 1B4PA 5JWRB 4WBRD 3RHCA 2IMFA 3UEMA 2IN3A 4RI6A 5DALB 4K7NA 5L71A 1H4OA 3PINA 2H1AA 2MYGA 1G6YA 4POKA 4YQMA 3RAZA 2V41A 2JL4A 3Q74A 2MMZA 5DALA 5D9TA 5FHIA 1K3LA 1QUWA 3V1WA 1THOA 2R4VA 5ECHB 2AYTA 4MF6A 5JWOB 4L8EA 4IQAA 4X1UA 3MAKA 4MH3A 2DLXA 2ON5A 1FVJA 2H72A 3CSIA 3ME8A 5IOXA 1EWXA 4ZL7A 1B8XA 1NM3A 4XIHA 1BJXA 1XZOA 2CX3A 3WT2A 2IIYA 2HNLA 4XTSA 3IPZA 1XXUA 2P0GA 2KHPA 1SENA 2RM5A 2PVQA 3FR9A 2O85A 3A3TA 2XBIA 2H0GA 1YQ1A 1FW1A 4KA0A 1KEBA 5F06A 1T4ZA 2MBSA 6GSYA 3QMXA 1DE2A 5DQYA 2HRNA 4MK3A 4GSNA 3U6VA 1GL8A 2I3YA 3GRXA 2GZPA 1O7UA 4JR4A 4MJAA 3EVIA 2P5RA 4YQVA 2YWIA 2CVKA 1A0RP 4RI7A 4IVFA 4PXOA 3ERFA 4NHZA 2YANA 3GIXA 2CQ9A 5LD0A 2FY6A 1FB0A 3GV1A 4AGSA 2XBQA 5G5EA 4HQSA 3PH9A 4IS0A 2KOKA 1GWCA 1WP0A 3GURA 4GTUA 4BVYA 3QAWA 4NXIA 4BVXA 5HFGA 2HT9A 2WRTA 5FWGA 1JHBA 3RBTA 1GSDA 5DBQA 2IMKA 3C8EA 5HFKA 5JCUA 1H75A 2C8UA 1J08A 2YJHA 3HZ8A 3KIJA 14GSA 2C0FA 5IMZA 1ILOA 1EP7A 4FYCA 4WETA 4V1Ag 3TCOA 1SK2A 1F2EA 5A4UA 3VPQA 3TKSE 3A2VA 1EZKA 3RDWA 3P2AA 2A2RA 5G5FA 1OAZA 1U3AA 5A4VA 5DVBA 1NHYA 4GQCA 2K8VA 2H19A 3LYKA 1EEJA 1MTCA 1XWCA 1T1VA 1YF0A 2RUFA 1AW9A 4DEJA 4OFTA 1JZRA 2MMNA 4NHWA 1TDIA 3P7XA 1KBNA 1AAZA 4N10A 2ZCTA 4HZ2A 1G6WA 3HJOA 2MMOA 2E7PA 2M72A 2JZTA 10GSA 2PGTA 3F4SA 1TRVA 4IP1A 2VL2C 2FA8A 1E6BA 2M46A 1QQ2A 4ZBBA 1JZOA 4CHSA 2ZNMA 1XWKA 2WDUA 4PUFC 3LG6A 2GSQA 1AQVA 2D2ZA 1PKWA 4TVEA 1X5EA 1W89A 4I2TA 3EMXA 3BOAA 2H74A 1QK8A 3LGCA 4WXTA 4PURA 3UBLA 3TJFA 3ED3A 2YOIA 2F51A 5IO2A 1UA5A 1G7EA 2FWHA 4TR0A 2AB6A 1N8JA 4K7IA 3QPMA 2GQLA 1OE7A 4GRFA 1Z7PA 2VL2A 3HVVA 1TJDA 3ZITA 3IK9A 3FKFA 3N5OA 5J4UA 2J9HA 4XRDA 2PPTA 2EC4A 1Z7RA 2QGVA 4I8BA 4HOJA 4MPFA 1TKDB 4PNGA 5AIXA 1G0TA 2VAFA 3PR8A 1MEKA 1R26A 4TR3A 4ML1A 1T00A 1XWAA 3F4RA 3J7Yk 5HR0A 3TDGA 2OKAA 3ZFLA 1J9BA 2C3NA 2MZCA 2C0GA 5J5NA 1FO5A 2VL9A 4F0BA 2R5GA 2F9SA 1O8XA 1V57A 2KP2A 4JU5A 3UARA 3ZVJA 2E2MA 4IBPA 3GKNA 3NZNA 2OA7A 2VCQA 1Y6EA 3QDNA 3IE3A 3S9FA 3EU4A 4OD7A 5IMCA 1OKDA 1S3DA 1PA3A 4ECBA 2LJAA 3BD2A 4DVCA 5LNKe 2V1MA 3KGKA 2FLSA 4GWRA 4V2MA 4I6XA 5F8BA 1TK8B 5IMDA 6GSWA 2B7JA 2NVLA 3ZFBA 3EURA 3M1GA 3FY7A 4GXZA 4AJ7A 3KH9A 3A2WA 2WZ9A 1V58A 3GL3A 3ERWA 2AV4A 1O73A 1PGTA 4I97A 3ERGA 4NPBA 5ECIB 1SJIA 1YZXA 4H86A 1EOHA 5H5QA 2PU9C 1EV4A 2LEGA 2CX4A 1M2AA 2H76A 5HFIA 3WD6A 3WYWA 2I9HA 3LORA 4LL1B 2OE1A 2KP1A 4LL4B 1PL1A 5CREA 4G10A 3UOMA 4YAPA 4BL7A 1FAAA 3LSZA 1PQNA 4JZQA 1V9WA 3P90A 4QL7A 2NPBA 3D6IA 2NBSA 2I81A 12GSA 2DC5A 5CRGA 4MP4A 2QKEA 3VWVA 3HY2A 2VCXA 5COHA 11GSA 1M0UA 2C0EA 2GLRA 3D5JA 3UVTA 2H75A 1GLPA 2IMEA 3APQA 5GZZB 2VD0A 4MZCA 5IPGA 2JACA 1EV9A 2B5XA 4NWYA 2M80A 3F0IA 3G7YA 3GSTA 4KB3A 3H93A 4KSMA 1TK5B 4TRXA 2IPAA 4GQFA 4WEYA 2H6ZA 2AJQB 1GSQA 1PX7A 5EVOA 3HHVA 3VPTA 5D8IA 2EIRA 4FYBA 4QL9A 3VURA 1GSYA 1R7HA 3HKRA 1A2JA 2F3MA 4KGIA 5H5RA 1GTUA 3ZRDA 1OKTA 4MJEA 2GZYA 3QR6A 3QFAC 2RUEA 2DBCA 4JE1A 1SJ6A 3TKRA 4TR4A 2XHFA 4HZ4A 1ERTA 1GUMA 4EE0A 1GSUA 2C0DA 2X8GA 5CRHA 1Z6NA 2FUG2 1WIKA 1K0MA 2LS5A 2LRNA 2NDOA 4IJIA 1WJKA 2V6OA 4XS1A 3DYRA 5HR3A 2PUKC 3BCIA 1SD8A 3CYNA 1XOBA 1SJZA 1M2BA 1YF1A 3IRAA 4RUVA 3A5WA 1ZZYA 1SL1B 3H1NA 4N11A 1DSBA 1AXDA 1T8EB 1ON4A 5KEJA 3F4TA 1EGOA 1TTZA 1YEXA 1HNBA 6GSUA 2EIQA 1MD4A 3FZ9A 1B48A 2PN8A 2ZUPA 4ACSA 5CYYA 4ISDA 1DUGA 1SL2B 3ZLPA 3ZMKA 2JSZA 3D4MA 1GP1A 3VWXA 4HJMA 4YQUA 2GTUA 4EF0A 4HS1A 1YJ6A 2OE3A 1ZCPA 3QCPA 9GSSA 1OYJA 4LA1A 1CQGA 2DIYA 3APOA 3DMLA 4HQZA 3L0HA 2H73A 5ECMB 1HYUA 2MBTA 4ECJA 4E8EA 5IPHA 1GNEA 4GCIA 3F3RA 3PGTA 2GZZA 1Z5YE 4O7HA 1WMJA 2YWMA 1GTAA 5CRDA 2GSSA 3CXGA 4LLRA 1JFUA 5E4WA 4F03A 2IJYA 4K0NA 3VI5A 4I5QA 4GSTA 5DCHA 3CBUA 1GNWA 1YY7A 3GNJA 1QXHA 1ML6A 2REMA 2OBIA 1UN2A 1N2AA 1USBA 4D73B 2H30A 2OACA 1UVZA 2BTOT 4K0GA 1T4YA 3FRCA 5B7CA 2KLXA 2DJ2A 1A2LA 2B1KA 2H8LA 1V40A 4D73A 4ID0A 1O85A 3FZ4A 2WFCA 4ZILA 3IDVA 3L78A 3IC4A 2VOCA 5KN1A 6GSTA 1GSSA 3CMIA 1JZDA 4FIWA 3IXRA 3D21A 4OCEA 5IOWA 1TXXA 2IMIA 1ZOFA 1K0NA 3DVWA 4F9ZA 2GVPA 2HE3A 4KH7A 3MNGA 4RQRA 4DSSB 2VLUA 3WGDA 3J7Yb 4KCAA 1GLQA 3BJ5A 3W8SA 5D9XA 2H71A 1VRSD 2L6DA 2DSAA 3IAS2 1U88A 3SBCA 4XCSA 2WCIA 4DSSA 5IMAA 4L5OA 5IO0A 3GSSA 5B6MA 1A0FA 4BA7A 1K3YA 3L9VA 4G19A 2LNSA 2K18A 4ML6A 3LQ7A 3VWUA 3HJPA 1K0BA 3LWAA 3HXSA 1EOGA 5G1KA 2ES7A 1ST9A 5E59A 1W4VA 2FNOA 5FT3A 2OADA 1FOVA 2DJ3A 3M0FA 3CRUA 4ULXA 2YP6A 3H8QA 5B8BA 2HZEB 4JR6A 3KH7A 5LCZA 5ECNB 1XVQA 3ZIVA 4G9HA 3IHQA 2C3TA 4HJ2A 1I5GA 3LEFA 2GT5A 5INYA 2H66A 3LYPA 22GSA 1Y25A 2HZEA 1AQXA 2Z9SA 4TXOB 2CV4A 2WB9A 4ZIJA 1HNCA 2V2GA 4Q5FA 3EYTA 4MJBA 1OVNA 5CO3A 2PVOC 4TXOA 4MZWA 5IM9A 2R3XA 1VF3A 1SD9A 4MZBA 1ERVA 3KZQA 3UBKA 4NV2A 2P5QA 1X0RA 2C1YA 3F8UA 4JBBA 5AN1A 2LJKA 3FZAA 4XS6A 4POBA 1TRUA 6GSVA 3DEXA 2P31A 1X9SB 4TN8A 3VFIA 3O3TA 3G7JA 3TKQA 3ZL5A 5GAPD 17GSA 4DSRA 2A2SA 4IKHA 5IIZA 5DQSA 5CNWA 3HA9A 3RHBA 1X9MB 4AJ8A 4KDXA 4KUNA 5D9WA 4POMA 1Q4JA 1HNAA 2HXKA 1JLWA 2EIOA 1PD21 2VCVA 1FG4A 4JEDA 1T3BA 4MLYA 1MDIA 2LV3A 2N5BA 2DJJA 2YCDA 3DKSA 5J9BA 5ELAA 1BG5A 2HYXA 1A23A 5DJMA 2H6YA 3GX8A 1B9XC 2DIZA 2AUVA 1LBKA 3P8WA 3N9JA 1AQWA 3HZ4A 5G31A 3F9UA 4YAVA 1XBSA 6GSSA 3LJRA 1OC9B 2HFDA 2G0FA 4TW5A 2WULA 5AISA 5ECPB 3F63A 3HDCA 1YKAA 1BQ7A 4L0UA 3IK7A 3KEBA 1PL2A 1FHEA 1OC9A 5H5SA 4EDYA 2WGRA 3GX0A 4ZXGA 1TP9A 5DCGA 4EDZA 4K9ZA 3DRNA 5J9CA 5EY6A 1LJRA 5F07A 3Q18A 3L9SA 1X9WB 5G30A 3CTGA 3MWHA 4K8MA 3HJMA 4P3YB 3APSA 4IHUA 3HYPA 3EC3A 1SK1A 2VIMA 1XWBA 3G7IA 3RPPA 1AC1A 4RQXA 4V2NA 1VF2A 5DDLA 3GFKA 3FR6A 1GSFA 3QD9A 1GUHA 8GSSA 4WF5A 1X5CA 1PX6A 4J57E 2DJ1A 5AIVA 2GQMA 4EC0A 1ERUA 3GYKA 2I4AA 1ACVA 3W8JA 4GSSA 3TKSC 4O92A 1F37A 4ZB6A 4JRRA 4WBJA 4J56E 4ECIA 1AIUA 3WGEA 1URMA 4HEA2 2L5OA 3Q19A 1S3AA 1OC8A 2X8HA 4TR1B 3IR4A 2C3QA 3FZ5A 3BBYA 1GRXA 3UAPA 4IELA 1M7TA 4MJCA 3ZZXA 2VD1A 5JCGA 3IAM2 4V1Ap 1AUCA 4OFMA 1SKWB 2FGXA 1B4QA 1WOUA 4TR1A 1IYHA 3KP8A 1RW1A 1V2AA 4IW9A 1EP8A 2JU5A 3GKXA 4YH2A 2V32A 3KM6A 4K2DA 5D73A 2CAIA 3MDKA 1F9MA 3CTFA 4PQHA 4PNFA 3HD5A 3TKSA 4MMMA 3E0UA 3IV4A 3D4TA 2IL3A 2B5YA 2GT6A 4POLA 1QGVA 4G2EA 1J0FA 2L5LA 1K0AA 1Z6MA 1MDKA 1XFLA 3AY8A 2GQKA 4MH2A 2FCHA 2TRXA 3E3EA 3U5RE 4ZB9A 4F0CA 4MABA 5ID2B 3UVHA 2OJLA 1PN9A 4IN0A 3UIWA 4I2UA 2VL3A 4KNDA 1OE8A 2YJ7A 1A24A 3I9V2 2CT6A 2PERA 2RM6A 4FO5A 2L6CA 5ID2A 4Z7XA 1ZYQB 1K0OA 4F2IA 5ECSA 2LRCA 3FW2A 2XPDA 1A8LA 2YV9A 3HVXA 4L5LA 2X64A 2LTKA 1Z9HA 3ZVJD 2MMAA 3I43A 4MA9A 4QQ7A 3US3A 2VCTA 1U6TA 1K0CA 2FWFA 5D96A 2H70A 1U3IA 2VO4A 3C1RA 3GA4A 3QAGA 1X5DA 1NSWA 13GSA 4K7OA 4X0XA 3TKPA 2HSHA 1PKZA 3M3MA 5J41A 5D9VA 3VK9A 1QFNA 1SL0B 1FVKA 3GH6A 5ECQB 3LFLA 1PSQA 1XPVA 5F0GA 5GAND 2OE0A 2WS2A 2ON7A 1S3CA 3EINA 3O76A 3VI7A 3IOSA 2FD3A 4KDYA 3QAVA 4LMVA 5G2ZA 5KN2A 3KMNA 3DXBA 1KNGA 1XCCA 2XC2A 5CP1A 5ECKB 2NTOA 1XVWA 2FHEA 3D0ZA 2YZHA 4KE3A 3FK8A 2VUPA 4K6XA 2B5EA 2QC7A 2AHEA 1XIYA 1DE1A 2H6XA 3GKKA 2H1DA 1TU7A 4WKWA 3TOUA 3K8NA 1R5PA 1XW9A 4ZL8A 4L0WA 3H4KA 4MF5A 3NOFA 6GSXA 1NHOA 3C73A 3FR3A 3GN3A 1PRXA 1B9YC 1DBYA 4NV5A 2PBJA 5G1LA 4KSOA 2LQQA 2CZ3A 1WE0A 2FWEA 3KTBA 5KN0A 2F8FA 3DVXA 2VCZA 1NW2A 5D93A 1HQOA 4CW9A 4NAXA 1RQMA 1SK0A 4XRAA 4BWSA 5A5KA 1M99A 1G7OA 2K9FA 4HUAA 2JSYA 4PUAA 3F6DA 2CAQA 2GDRA 3TOTA 2IWTA 2IMDA 2V6KA 1GTBA 4TKYA 3NIVA 2B3SA 3WGXA 2B7KA 2H1GA 3HCZA 2VLVA 1R5AA 3G9BA 4GLTA 3TGZA 3I69A 4HU7A 2HZFA 3FEUA 3F6FA 2JADA 4ZBDA 7GSSA 5ENUA 3TB2A 1VF4A 4WF4A
chains in the Genus database with same CATH superfamily
2VM1A 2R2JA 4PQIA 4KCEA 4NMUA 5B8AA 2I1UA 2FWGA 2LKUA 4MF7A 3EWLA 3Q6OA 5JWQB 1GULA 4Q5RA 2K6VA 3PPUA 5EPFA 2C80A 2O7KA 1ABAA 3DWVA 1E2YA 5CAXA 2VLTA 4F82A 1ZL9A 5ELGA 3QOUA 1R4WA 4OO4A 3LXZA 2N5AA 1GH2A 1SYXA 4ECCA 2H1BA 3CSHA 1YKCA 4ZB8A 1XOAA 2GS3A 5HR1A 4EIQA 1FB6A 2X99A 2YNXA 5DJLA 4KF9A 4TOPA 3IA1A 1V98A 3DIEA 5IMFA 2BMXA 4O5UA 5IMVA 2GSTA 3GH9A 4XS4B 3TJGA 1YEPA 2L57A 1U87A 2FA4A 1C72A 4MPGA 3C71A 2YZUA 1A2MA 2YWOA 3HVSA 2HSYA 1THXA 1XW6A 2L4QA 4ZL9A 4XHMA 4XS4A 3VLNA 1M9AA 2CZ2A 3UMAA 3ISOA 5DAKB 1IYIA 2LRTA 5B6NA 3QFBC 4GF0A 4EXJA 5GSSA 4KX4A 3DGQA 4A5PA 1ERWA 3EMPA 1TI3A 5DAKA 1K3OA 2KUCA 3UL3A 1XG8A 3ZYWA 4PGTA 2N5FA 3ZIJA 3O6TA 2LSTA 2J23A 4IJ3A 2AAWA 2LJRA 3CSJA 1JZWA 3GKMA 4J2FA 2GGTA 1I9DA 4PX1A 3GHAA 4Q5QA 3KXOA 4KDUA 4N0ZA 2YV7A 4YKFA 3KD0A 2B1LA 2YPMA 1SU9A 1MD3A 4N0VA 1TK0B 1HD2A 3ZTLA 5C00A 3GL5A 4ZBAA 1SKRB 1BAYA 1WPIA 1XWGA 5CRWA 4Q5NA 1ZMAA 2VCWA 4ILFA 3TJKA 4O32A 4EO3A 3F3QA 5KN3A 1TRSA 4WR5A 1M3IA 3EE2A 2R6KA 1BX9A 4O5RA 2DMMA 1LU4A 3EU3A 4BWQA 3GUSA 3C7MA 2QSIA 2VM2A 1Z3EA 2R37A 1GUKA 2DMLA 3TJJA 3KCMA 1F3AA 1WRYA 4HI7A 1EGRA 3KMOA 4K1FA 2O8VB 4EVMA 3BCKA 2JZRA 3KTLA 1TOFA 1XW5A 5ECRB 5EL8A 3KP9A 2L4CA 1GSEA 4BPYA 4MCUA 2RIIA 2E2GA 2LUSA 1ZGNA 3KJYA 4HU9A 3WT1A 3W6GA 4CDOA 4DSQA 3L9UA 1K0DA 1GTIA 1TW9A 2BJXA 4EL1A 3ZREA 19GSA 2IFQB 1QMVA 3I6AA 5AGYA 1UC7A 3TRPA 2OBKA 1BEDA 18GSA 3UJ1A 3VWWA 4FH8A 2RLIA 3M9KA 2IFQA 1WWJA 3SWLA 4MDCA 2CVBA 1CQHA 1T7PB 1EEMA 3GMFA 3FYGA 4IP6A 3CRTA 1A8YA 3C1SA 3FHKA 5A4WA 1M2DA 2XPEA 5ECLB 2A4VA 4OO5A 2YWNA 1MDJA 1TRWA 1ZYEA 2B6MA 4EUYA 5J3RA 1JLVA 1Q98A 1F3BA 3RPNA 4FYUA 1M9BA 3DD3A 3ZMLA 4AF2A 4N30A 5JCWA 2H0IA 1RK4A 2L59A 3M8NA 1YDKA 1VGLA 3H79A 1PMTA 2YN1A 1BYEA 5GSTA 1O8WA 2PMTA 1O81A 2PWJA 1TU8A 1O6JA 4EKZA 1F6MC 2H01A 16GSA 2HRFA 4LMWA 4OCFA 2LNTA 1KTEA 4IGJA 4HDEA 4OMVA 3TRXA 2LQOA 3JCML 4AJ6A 1TI1A 3R2QA 4G0KA 2TRCP 3D22A 5IQYA 4X43A 3TJBA 4OFNA 2JZSA 4KAEA 2G2QA 2DJ0A 3GTUB 4WR4A 2K8SA 3ME7A 2DKHA 1VF1A 2DJKA 4OWYA 2CA8A 2X8CA 5F05A 3LW9A 5HR2A 1SKSB 20GSA 3LXTA 2ALBA 2C4JA 3TRQA 2GSRA 2F8AA 2HLSA 3MSZA 3GTUA 2TIRA 2O87A 3E9JB 5HQPA 3A2XA 3TUEA 2HI7A 3M9JA 4V2LA 2H0HA 2CVDA 2WJUA 3IBHA 4TXVA 4IQ1A 4KW6A 3OR5A 1SYRA 5C04A 5ABRA 4E8HA 1OC3A 3L4NA 2E0QA 5ECOB 2O89A 4PQ1A 1B4PA 5JWRB 4WBRD 3RHCA 2IMFA 3UEMA 2IN3A 4RI6A 5DALB 4K7NA 5L71A 1H4OA 3PINA 2H1AA 2MYGA 1G6YA 4POKA 4YQMA 3RAZA 2V41A 2JL4A 3Q74A 2MMZA 5DALA 5D9TA 5FHIA 1K3LA 1QUWA 3V1WA 1THOA 2R4VA 5ECHB 2AYTA 4MF6A 5JWOB 4L8EA 4IQAA 4X1UA 3MAKA 4MH3A 2DLXA 2ON5A 1FVJA 2H72A 3CSIA 3ME8A 4CY8A 5IOXA 1EWXA 4ZL7A 1B8XA 1NM3A 4XIHA 1BJXA 1XZOA 2CX3A 3WT2A 2IIYA 2HNLA 4XTSA 3IPZA 1XXUA 2P0GA 2KHPA 1SENA 2RM5A 2PVQA 3FR9A 2O85A 3A3TA 2XBIA 2H0GA 1YQ1A 1FW1A 4KA0A 1KEBA 5F06A 1T4ZA 2MBSA 2UZ8A 6GSYA 3QMXA 1DE2A 5DQYA 2HRNA 4MK3A 4GSNA 3U6VA 1GL8A 2I3YA 3GRXA 4K5SA 2GZPA 1O7UA 4JR4A 4MJAA 3EVIA 2P5RA 4YQVA 2YWIA 2CVKA 1A0RP 4RI7A 4IVFA 4PXOA 3ERFA 4NHZA 2YANA 3GIXA 2CQ9A 5LD0A 4BVYB 2FY6A 1FB0A 3GV1A 4AGSA 2XBQA 4BVXB 5G5EA 4HQSA 3PH9A 4IS0A 2KOKA 1GWCA 1WP0A 3GURA 4GTUA 4BVYA 3QAWA 4NXIA 4BVXA 5HFGA 2HT9A 2WRTA 5FWGA 1JHBA 3RBTA 1GSDA 5DBQA 2IMKA 3C8EA 5HFKA 5JCUA 1H75A 2C8UA 1J08A 2YJHA 3HZ8A 3KIJA 14GSA 2C0FA 5IMZA 1ILOA 1EP7A 4FYCA 4WETA 4V1Ag 3TCOA 1SK2A 1F2EA 5A4UA 3VPQA 3TKSE 3A2VA 1EZKA 3RDWA 3P2AA 4CY6A 2A2RA 2R0GA 5G5FA 1OAZA 1U3AA 5A4VA 5DVBA 1NHYA 4GQCA 2K8VA 2H19A 3LYKA 2R0CA 1EEJA 1MTCA 1XWCA 1T1VA 1YF0A 2RUFA 1AW9A 4DEJA 4OFTA 1JZRA 3R3EA 2MMNA 4NHWA 1TDIA 3P7XA 1KBNA 1AAZA 4N10A 2ZCTA 4HZ2A 1G6WA 3HJOA 2MMOA 2E7PA 2M72A 2JZTA 10GSA 2PGTA 3CQFA 3F4SA 1TRVA 4IP1A 2VL2C 2FA8A 1E6BA 2M46A 1QQ2A 4ZBBA 4Z2TA 1JZOA 4CHSA 2ZNMA 5BMUA 1XWKA 2WDUA 4PUFC 3LG6A 2GSQA 1AQVA 2D2ZA 4O5QA 1PKWA 4TVEA 1X5EA 1W89A 4I2TA 3EMXA 3BOAA 2H74A 1QK8A 3LGCA 4WXTA 4PURA 3UBLA 3TJFA 3ED3A 2YOIA 2F51A 5IO2A 1UA5A 1G7EA 2FWHA 4TR0A 2AB6A 1N8JA 4K7IA 3QPMA 2GQLA 1OE7A 4GRFA 1Z7PA 2VL2A 3HVVA 1TJDA 3ZITA 3IK9A 3FKFA 3N5OA 5J4UA 2J9HA 4XRDA 2PPTA 2EC4A 1Z7RA 2QGVA 4I8BA 4HOJA 4MPFA 1TKDB 4PNGA 5AIXA 1G0TA 2VAFA 3PR8A 1MEKA 1R26A 4TR3A 4ML1A 1T00A 1XWAA 3F4RA 3J7Yk 5HR0A 3TDGA 2OKAA 3ZFLA 1J9BA 2C3NA 2MZCA 2C0GA 5J5NA 1FO5A 2VL9A 4F0BA 2R5GA 2F9SA 1O8XA 1V57A 2KP2A 4JU5A 3UARA 3ZVJA 2E2MA 4IBPA 3GKNA 3NZNA 2OA7A 2VCQA 3MYDA 1Y6EA 3QDNA 3IE3A 3S9FA 3EU4A 4OD7A 5IMCA 1OKDA 1S3DA 1PA3A 4ECBA 2LJAA 3BD2A 4DVCA 5LNKe 2V1MA 3KGKA 2FLSA 4GWRA 4V2MA 4I6XA 5KOXA 5F8BA 1TK8B 5IMDA 6GSWA 2B7JA 2NVLA 3ZFBA 3EURA 3M1GA 4FQUA 4PTSA 3FY7A 4GXZA 4AJ7A 3KH9A 3A2WA 2WZ9A 1V58A 3GL3A 3ERWA 2AV4A 1O73A 1PGTA 4I97A 3ERGA 4NPBA 5ECIB 1SJIA 1YZXA 4H86A 1EOHA 5H5QA 2PU9C 1EV4A 2LEGA 2CX4A 1M2AA 2H76A 5HFIA 3WD6A 3WYWA 4BL7B 4K2XA 2I9HA 3LORA 4LL1B 2OE1A 2KP1A 4LL4B 1PL1A 5CREA 4G10A 3UOMA 4YAPA 4BL7A 1FAAA 3LSZA 1PQNA 4X4JA 4JZQA 1V9WA 3P90A 4QL7A 2NPBA 3D6IA 2NBSA 2I81A 12GSA 2DC5A 5CRGA 4MP4A 2QKEA 3HVNA 3VWVA 3HY2A 2VCXA 5COHA 11GSA 1M0UA 2C0EA 2GLRA 3D5JA 3UVTA 2H75A 1GLPA 2IMEA 3APQA 5GZZB 2VD0A 4MZCA 5IPGA 2JACA 1EV9A 2B5XA 4NWYA 2M80A 3F0IA 3G7YA 3GSTA 4KB3A 3H93A 4KSMA 1TK5B 4TRXA 2IPAA 4GQFA 4WEYA 4EIPA 2H6ZA 2AJQB 1GSQA 2A2PA 1PX7A 5EVOA 3HHVA 3VPTA 5D8IA 2EIRA 4FYBA 4QL9A 3VURA 1GSYA 1R7HA 3HKRA 1A2JA 2F3MA 4KGIA 5H5RA 1GTUA 3ZRDA 1OKTA 4MJEA 2GZYA 3QR6A 3QFAC 2RUEA 2DBCA 4JE1A 1SJ6A 3TKRA 4TR4A 2XHFA 4HZ4A 1ERTA 2R0PA 1GUMA 4USSA 4EE0A 1GSUA 2C0DA 2X8GA 5CRHA 1Z6NA 2FUG2 1WIKA 1K0MA 2LS5A 2LRNA 2NDOA 4IJIA 1WJKA 2V6OA 4XS1A 3DYRA 5HR3A 2PUKC 3BCIA 1SD8A 3CYNA 1XOBA 1SJZA 1M2BA 1YF1A 3IRAA 4RUVA 3A5WA 1ZZYA 4ICYA 1SL1B 3H1NA 4N11A 1DSBA 1AXDA 1T8EB 1ON4A 5KEJA 3F4TA 1EGOA 1TTZA 1YEXA 1HNBA 6GSUA 2EIQA 1MD4A 5BRTA 3FZ9A 1B48A 2PN8A 2ZUPA 4ACSA 5CYYA 4ISDA 1DUGA 1SL2B 3ZLPA 3ZMKA 2JSZA 3D4MA 1GP1A 3VWXA 4HJMA 4YQUA 2GTUA 4EF0A 4HS1A 1YJ6A 2OE3A 1ZCPA 3QCPA 9GSSA 1OYJA 4LA1A 1CQGA 2DIYA 3APOA 3DMLA 4HQZA 3L0HA 4Z2RA 2H73A 5ECMB 1HYUA 2MBTA 4ECJA 4E8EA 5IPHA 1GNEA 4GCIA 3F3RA 3PGTA 2GZZA 1Z5YE 4O7HA 1WMJA 2YWMA 1GTAA 5CRDA 2GSSA 3CXGA 4LLRA 1JFUA 5E4WA 4F03A 2IJYA 4K0NA 3VI5A 4I5QA 4GSTA 5DCHA 3CBUA 2HSMA 1GNWA 1YY7A 3GNJA 1QXHA 1ML6A 2REMA 2OBIA 1UN2A 1N2AA 1USBA 4D73B 2H30A 1ZYPA 2OACA 1UVZA 2BTOT 4K0GA 1T4YA 3FRCA 5B7CA 2KLXA 2DJ2A 1A2LA 2B1KA 2H8LA 1V40A 4D73A 3MIXA 4ID0A 1O85A 3FZ4A 2WFCA 4ZILA 3IDVA 3L78A 3IC4A 2DKIA 2VOCA 5KN1A 6GSTA 1GSSA 3CMIA 1JZDA 4FIWA 3IXRA 3D21A 4OCEA 5IOWA 1TXXA 2IMIA 1ZOFA 1K0NA 3DVWA 3IHGA 4F9ZA 3IC8A 2GVPA 2HE3A 4KH7A 3MNGA 4RQRA 4DSSB 2VLUA 3WGDA 3J7Yb 4KCAA 1GLQA 3BJ5A 3W8SA 5D9XA 2H71A 1ZYNA 1VRSD 2L6DA 2DSAA 3IAS2 1U88A 3SBCA 4XCSA 2WCIA 4DSSA 5IMAA 4L5OA 5IO0A 3GSSA 5B6MA 1A0FA 4BA7A 1K3YA 3L9VA 4G19A 2LNSA 2K18A 4ML6A 3LQ7A 3VWUA 3HJPA 1K0BA 3LWAA 3HXSA 1EOGA 5G1KA 2ES7A 1ST9A 5E59A 1W4VA 2FNOA 4Z2UA 5FT3A 2OADA 2QA1A 1FOVA 2DJ3A 3M0FA 3CRUA 4ULXA 2YP6A 4YKGA 3H8QA 5B8BA 2HZEB 4JR6A 4BIKA 3KH7A 5LCZA 5ECNB 1XVQA 3ZIVA 4G9HA 3IHQA 2C3TA 4HJ2A 1I5GA 3LEFA 2GT5A 5INYA 2H66A 3LYPA 22GSA 1Y25A 2HZEA 1AQXA 2Z9SA 4TXOB 2CV4A 2WB9A 4ZIJA 1HNCA 2V2GA 4Q5FA 3EYTA 4MJBA 1OVNA 5CO3A 2PVOC 4TXOA 4MZWA 1S3RA 5IM9A 2R3XA 4G0IA 1VF3A 1SD9A 4MZBA 1ERVA 3KZQA 3UBKA 4NV2A 2P5QA 1X0RA 2C1YA 3F8UA 4JBBA 2LJKA 3FZAA 5AN1A 4XS6A 4POBA 4HSCX 1TRUA 6GSVA 3DEXA 2P31A 1X9SB 4TN8A 3VFIA 3O3TA 3G7JA 3TKQA 3ZL5A 5GAPD 17GSA 4DSRA 2A2SA 4IKHA 5IIZA 5DQSA 5CNWA 3HA9A 3RHBA 1X9MB 4AJ8A 4KDXA 4KUNA 5D9WA 4POMA 1Q4JA 1HNAA 2HXKA 1JLWA 2EIOA 1PD21 2VCVA 1FG4A 4JEDA 1T3BA 4MLYA 1MDIA 2LV3A 2N5BA 2DJJA 2YCDA 3DKSA 5J9BA 5ELAA 1BG5A 2HYXA 1A23A 5DJMA 2H6YA 3GX8A 1B9XC 2DIZA 2AUVA 1LBKA 3P8WA 3N9JA 1AQWA 3HZ4A 5G31A 3F9UA 4YAVA 1XBSA 6GSSA 3LJRA 1OC9B 2HFDA 2G0FA 4TW5A 2WULA 5AISA 5ECPB 3F63A 3HDCA 1YKAA 1BQ7A 4L0UA 3IK7A 3KEBA 1PL2A 1FHEA 1OC9A 5H5SA 4EDYA 2WGRA 3GX0A 4ZXGA 1TP9A 5DCGA 4EDZA 4K9ZA 3DRNA 5J9CA 5EY6A 1LJRA 5F07A 3Q18A 3L9SA 1X9WB 5G30A 3CTGA 3EPTA 3MWHA 4K8MA 3HJMA 4P3YB 3APSA 4IHUA 3HYPA 3EC3A 1SK1A 2VIMA 1XWBA 3G7IA 3RPPA 1AC1A 2HRAA 4RQXA 4V2NA 1VF2A 5DDLA 3GFKA 3FR6A 1GSFA 2A4HA 3QD9A 4K5RA 1GUHA 8GSSA 4WF5A 1X5CA 1PX6A 4J57E 2DJ1A 5AIVA 2GQMA 4EC0A 1ERUA 3GYKA 2I4AA 1ACVA 3W8JA 4GSSA 3TKSC 4O92A 1F37A 4ZB6A 4JRRA 4WBJA 4J56E 4ECIA 1AIUA 3WGEA 1URMA 4HEA2 2L5OA 3Q19A 1S3AA 1OC8A 2X8HA 2X4AA 4TR1B 3IR4A 2C3QA 3FZ5A 3BBYA 1GRXA 3UAPA 4IELA 1M7TA 4MJCA 3ZZXA 2VD1A 5JCGA 3IAM2 1FOHA 4V1Ap 1AUCA 4OFMA 1SKWB 2FGXA 1B4QA 1WOUA 4TR1A 1IYHA 3KP8A 1RW1A 1V2AA 4IW9A 1EP8A 2JU5A 3GKXA 4YH2A 2V32A 3KM6A 4K2DA 5KOWA 5D73A 2CAIA 3MDKA 1F9MA 3CTFA 4PQHA 4PNFA 3HD5A 3TKSA 4MMMA 3E0UA 3IV4A 3D4TA 2IL3A 2B5YA 2GT6A 4POLA 1QGVA 4G2EA 1J0FA 2L5LA 1K0AA 1Z6MA 1MDKA 1XFLA 3AY8A 2GQKA 4MH2A 2FCHA 2TRXA 3E3EA 3U5RE 4ZB9A 4F0CA 4MABA 5ID2B 3UVHA 2OJLA 1PN9A 4IN0A 3UIWA 4I2UA 1PFOA 2VL3A 4KNDA 1OE8A 2YJ7A 1A24A 3I9V2 2CT6A 2PERA 2RM6A 4FO5A 2L6CA 5ID2A 4Z7XA 1ZYQB 1K0OA 4F2IA 5ECSA 2LRCA 3FMWA 3FW2A 2XPDA 1A8LA 2YV9A 3HVXA 4L5LA 2X64A 2LTKA 1Z9HA 3ZVJD 2HRKA 2MMAA 3I43A 4MA9A 4QQ7A 3US3A 2VCTA 1PN0A 1U6TA 1K0CA 2FWFA 5D96A 2H70A 1U3IA 2VO4A 3C1RA 3GA4A 3QAGA 1X5DA 1NSWA 2X49A 13GSA 4K7OA 4X0XA 3TKPA 2HSHA 1PKZA 3M3MA 5J41A 5D9VA 3VK9A 1M3JA 1QFNA 1SL0B 1FVKA 3GH6A 5ECQB 3LFLA 1PSQA 1XPVA 5F0GA 5GAND 2OE0A 2WS2A 2ON7A 1S3CA 3EINA 3O76A 3VI7A 3IOSA 2FD3A 4KDYA 3QAVA 4LMVA 5G2ZA 5KN2A 3KMNA 3DXBA 1KNGA 1XCCA 2XC2A 5CP1A 5ECKB 2NTOA 1XVWA 2FHEA 3D0ZA 2YZHA 4KE3A 3FK8A 2VUPA 4K6XA 2B5EA 2QC7A 2AHEA 1XIYA 1DE1A 2H6XA 3GKKA 2H1DA 1TU7A 4WKWA 3TOUA 3K8NA 1R5PA 1XW9A 4ZL8A 4L0WA 3H4KA 4MF5A 3NOFA 6GSXA 1NHOA 3C73A 3FR3A 3GN3A 1PRXA 1B9YC 4MNNA 4G0LA 1DBYA 4NV5A 2PBJA 5G1LA 4KSOA 2LQQA 2CZ3A 1WE0A 2FWEA 3KTBA 5KN0A 2F8FA 3DVXA 2VCZA 1NW2A 5D93A 1HQOA 4CW9A 4NAXA 1RQMA 1SK0A 4XRAA 2QA2A 4BWSA 5A5KA 1M99A 1G7OA 2K9FA 3A5IA 4HUAA 2JSYA 4PUAA 3F6DA 2CAQA 2GDRA 3TOTA 2IWTA 2IMDA 2V6KA 1GTBA 4TKYA 3NIVA 2B3SA 3WGXA 2B7KA 2H1GA 3HCZA 2VLVA 1R5AA 3G9BA 4GLTA 3TGZA 3I69A 4HU7A 2HZFA 3FEUA 3F6FA 2JADA 4ZBDA 7GSSA 5ENUA 3TB2A 1VF4A 4WF4A
chains in the Genus database with same CATH topology
2VM1A 2R2JA 4PQIA 4KCEA 4NMUA 5B8AA 2I1UA 2FWGA 2LKUA 4MF7A 3EWLA 3Q6OA 5JWQB 1GULA 4Q5RA 2K6VA 3PPUA 5EPFA 2C80A 2O7KA 1ABAA 3DWVA 1E2YA 5CAXA 2VLTA 4F82A 1ZL9A 5ELGA 3QOUA 1R4WA 4OO4A 3LXZA 2N5AA 1GH2A 1SYXA 4ECCA 2H1BA 3CSHA 1YKCA 4ZB8A 1XOAA 2GS3A 5HR1A 4EIQA 1FB6A 2X99A 2YNXA 5DJLA 4KF9A 4TOPA 3IA1A 1V98A 3DIEA 5IMFA 2BMXA 4O5UA 5IMVA 2GSTA 3GH9A 4XS4B 3TJGA 1YEPA 2L57A 1U87A 2FA4A 1C72A 4MPGA 3C71A 2YZUA 1A2MA 2YWOA 3HVSA 2HSYA 1THXA 1XW6A 2L4QA 4ZL9A 4XHMA 4XS4A 3VLNA 1M9AA 2CZ2A 3UMAA 3ISOA 5DAKB 1IYIA 2LRTA 5B6NA 3QFBC 4GF0A 4EXJA 5GSSA 4KX4A 3DGQA 4A5PA 1ERWA 3EMPA 1TI3A 5DAKA 1K3OA 2KUCA 3UL3A 3ZYWA 4PGTA 2N5FA 3ZIJA 3O6TA 2LSTA 2J23A 4IJ3A 2AAWA 2LJRA 3CSJA 1JZWA 3GKMA 4J2FA 2GGTA 1I9DA 4PX1A 3GHAA 4Q5QA 3KXOA 4KDUA 4N0ZA 2YV7A 4YKFA 3KD0A 2B1LA 2YPMA 1SU9A 1MD3A 4N0VA 1TK0B 1HD2A 3ZTLA 5C00A 3GL5A 4ZBAA 1SKRB 1BAYA 1WPIA 1XWGA 5CRWA 4Q5NA 1ZMAA 2VCWA 4ILFA 3TJKA 4O32A 4EO3A 3F3QA 5KN3A 1TRSA 4WR5A 3EE2A 2R6KA 1BX9A 4O5RA 2DMMA 1LU4A 3EU3A 4BWQA 3GUSA 3C7MA 2QSIA 2VM2A 1Z3EA 2R37A 1GUKA 2DMLA 3TJJA 3KCMA 1F3AA 1WRYA 4HI7A 1EGRA 3KMOA 4K1FA 2O8VB 4EVMA 3BCKA 2JZRA 3KTLA 1TOFA 1XW5A 5ECRB 5EL8A 3KP9A 2L4CA 1GSEA 4BPYA 4MCUA 2RIIA 2E2GA 2LUSA 1ZGNA 3KJYA 4HU9A 3WT1A 3W6GA 4CDOA 4DSQA 3L9UA 1K0DA 1GTIA 1TW9A 2BJXA 4EL1A 3ZREA 19GSA 2IFQB 1QMVA 3I6AA 5AGYA 1UC7A 3TRPA 2OBKA 1BEDA 18GSA 3UJ1A 3VWWA 4FH8A 2RLIA 3M9KA 2IFQA 1WWJA 3SWLA 4MDCA 2CVBA 1CQHA 1T7PB 1EEMA 3GMFA 3FYGA 4IP6A 3CRTA 1A8YA 3C1SA 3FHKA 5A4WA 1M2DA 2XPEA 5ECLB 2A4VA 4OO5A 2YWNA 1MDJA 1TRWA 1ZYEA 2B6MA 4EUYA 5J3RA 1JLVA 1Q98A 1F3BA 3RPNA 4FYUA 1M9BA 3DD3A 3ZMLA 4AF2A 4N30A 5JCWA 2H0IA 1RK4A 2L59A 3M8NA 1YDKA 1VGLA 3H79A 1PMTA 2YN1A 1BYEA 5GSTA 1O8WA 2PMTA 1O81A 2PWJA 1TU8A 1O6JA 4EKZA 1F6MC 2H01A 16GSA 2HRFA 4LMWA 4OCFA 2LNTA 1KTEA 4IGJA 4HDEA 4OMVA 3TRXA 2LQOA 3JCML 4AJ6A 1TI1A 3R2QA 4G0KA 2TRCP 3D22A 5IQYA 4X43A 3TJBA 4OFNA 2JZSA 4KAEA 2G2QA 2DJ0A 3GTUB 4WR4A 2K8SA 3ME7A 2DKHA 1VF1A 2DJKA 4OWYA 2CA8A 2X8CA 5F05A 3LW9A 5HR2A 1SKSB 20GSA 3LXTA 2ALBA 2C4JA 3TRQA 2GSRA 2F8AA 2HLSA 3MSZA 3GTUA 2TIRA 2O87A 3E9JB 5HQPA 3A2XA 3TUEA 2HI7A 3M9JA 4V2LA 2H0HA 2CVDA 2WJUA 3IBHA 4TXVA 4IQ1A 4KW6A 3OR5A 1SYRA 5C04A 5ABRA 4E8HA 1OC3A 3L4NA 2E0QA 5ECOB 2O89A 4PQ1A 1B4PA 5JWRB 4WBRD 3RHCA 2IMFA 3UEMA 2IN3A 4RI6A 5DALB 4K7NA 5L71A 1H4OA 3PINA 2H1AA 2MYGA 1G6YA 4POKA 4YQMA 3RAZA 2V41A 2JL4A 3Q74A 2MMZA 5DALA 5D9TA 5FHIA 1K3LA 1QUWA 3V1WA 1THOA 2R4VA 5ECHB 2AYTA 4MF6A 5JWOB 4L8EA 4IQAA 4X1UA 3MAKA 4MH3A 2DLXA 2ON5A 1FVJA 2H72A 3CSIA 3ME8A 4CY8A 5IOXA 1EWXA 4ZL7A 1B8XA 1NM3A 4XIHA 1BJXA 1XZOA 2CX3A 3WT2A 2IIYA 2HNLA 4XTSA 3IPZA 1XXUA 2P0GA 2KHPA 1SENA 2RM5A 2PVQA 3FR9A 2O85A 3A3TA 2XBIA 2H0GA 1YQ1A 1FW1A 4KA0A 1KEBA 5F06A 1T4ZA 2MBSA 2UZ8A 6GSYA 3QMXA 1DE2A 5DQYA 2HRNA 4MK3A 4GSNA 3U6VA 1GL8A 2I3YA 3GRXA 4K5SA 2GZPA 1O7UA 4JR4A 4MJAA 3EVIA 2P5RA 4YQVA 2YWIA 2CVKA 1A0RP 4RI7A 4IVFA 4PXOA 3ERFA 4NHZA 2YANA 3GIXA 2CQ9A 5LD0A 4BVYB 2FY6A 1FB0A 3GV1A 4AGSA 2XBQA 4BVXB 5G5EA 4HQSA 3PH9A 4IS0A 2KOKA 1GWCA 1WP0A 3GURA 4GTUA 4BVYA 3QAWA 4NXIA 4BVXA 5HFGA 2HT9A 2WRTA 5FWGA 1JHBA 3RBTA 1GSDA 5DBQA 2IMKA 3C8EA 5HFKA 5JCUA 1H75A 2C8UA 1J08A 2YJHA 3HZ8A 3KIJA 14GSA 2C0FA 5IMZA 1ILOA 1EP7A 4FYCA 4WETA 4V1Ag 3TCOA 1SK2A 1F2EA 5A4UA 3VPQA 3TKSE 3A2VA 1EZKA 3RDWA 3P2AA 4CY6A 2A2RA 2R0GA 5G5FA 1OAZA 1U3AA 5A4VA 5DVBA 1NHYA 4GQCA 2K8VA 2H19A 3LYKA 2R0CA 1EEJA 1MTCA 1XWCA 1T1VA 1YF0A 2RUFA 1AW9A 4DEJA 4OFTA 1JZRA 3R3EA 2MMNA 4NHWA 1TDIA 3P7XA 1KBNA 1AAZA 4N10A 2ZCTA 4HZ2A 1G6WA 3HJOA 2MMOA 2E7PA 2M72A 2JZTA 10GSA 2PGTA 3F4SA 1TRVA 4IP1A 2VL2C 2FA8A 1E6BA 2M46A 1QQ2A 4ZBBA 4Z2TA 1JZOA 4CHSA 2ZNMA 5BMUA 1XWKA 2WDUA 4PUFC 3LG6A 2GSQA 1AQVA 2D2ZA 4O5QA 1PKWA 4TVEA 1X5EA 1W89A 4I2TA 3EMXA 3BOAA 2H74A 1QK8A 3LGCA 4WXTA 4PURA 3UBLA 3TJFA 3ED3A 2YOIA 2F51A 5IO2A 1UA5A 1G7EA 2FWHA 4TR0A 2AB6A 1N8JA 4K7IA 3QPMA 2GQLA 1OE7A 4GRFA 1Z7PA 2VL2A 3HVVA 1TJDA 3ZITA 3IK9A 3FKFA 3N5OA 5J4UA 2J9HA 4XRDA 2PPTA 2EC4A 1Z7RA 2QGVA 4I8BA 4HOJA 4MPFA 1TKDB 4PNGA 5AIXA 1G0TA 2VAFA 3PR8A 1MEKA 1R26A 4TR3A 4ML1A 1T00A 1XWAA 3F4RA 3J7Yk 5HR0A 3TDGA 2OKAA 3ZFLA 1J9BA 2C3NA 2MZCA 2C0GA 5J5NA 1FO5A 2VL9A 4F0BA 2R5GA 2F9SA 1O8XA 1V57A 2KP2A 4JU5A 3UARA 3ZVJA 2E2MA 4IBPA 3GKNA 3NZNA 2OA7A 2VCQA 3MYDA 1Y6EA 3QDNA 3IE3A 3S9FA 3EU4A 4OD7A 5IMCA 1OKDA 1S3DA 1PA3A 4ECBA 2LJAA 3BD2A 4DVCA 5LNKe 2V1MA 3KGKA 2FLSA 4GWRA 4V2MA 4I6XA 5KOXA 5F8BA 1TK8B 5IMDA 6GSWA 2B7JA 2NVLA 3ZFBA 3EURA 3M1GA 4FQUA 4PTSA 3FY7A 4GXZA 4AJ7A 3KH9A 3A2WA 2WZ9A 1V58A 3GL3A 3ERWA 2AV4A 1O73A 1PGTA 4I97A 3ERGA 4NPBA 5ECIB 1SJIA 1YZXA 4H86A 1EOHA 5H5QA 2PU9C 1EV4A 2LEGA 2CX4A 1M2AA 2H76A 5HFIA 3WD6A 3WYWA 4BL7B 4K2XA 2I9HA 3LORA 4LL1B 2OE1A 2KP1A 4LL4B 1PL1A 5CREA 4G10A 3UOMA 4YAPA 4BL7A 1FAAA 3LSZA 1PQNA 4X4JA 4JZQA 1V9WA 3P90A 4QL7A 2NPBA 3D6IA 2NBSA 2I81A 12GSA 2DC5A 5CRGA 4MP4A 2QKEA 3VWVA 3HY2A 2VCXA 5COHA 11GSA 1M0UA 2C0EA 2GLRA 3D5JA 3UVTA 2H75A 1GLPA 2IMEA 3APQA 5GZZB 2VD0A 4MZCA 5IPGA 2JACA 1EV9A 2B5XA 4NWYA 2M80A 3F0IA 3G7YA 3GSTA 4KB3A 3H93A 4KSMA 1TK5B 4TRXA 2IPAA 4GQFA 4WEYA 4EIPA 2H6ZA 2AJQB 1GSQA 2A2PA 1PX7A 5EVOA 3HHVA 3VPTA 5D8IA 2EIRA 4FYBA 4QL9A 3VURA 1GSYA 1R7HA 3HKRA 1A2JA 2F3MA 4KGIA 5H5RA 1GTUA 3ZRDA 1OKTA 4MJEA 2GZYA 3QR6A 3QFAC 2RUEA 2DBCA 4JE1A 1SJ6A 3TKRA 4TR4A 2XHFA 4HZ4A 1ERTA 2R0PA 1GUMA 4USSA 4EE0A 1GSUA 2C0DA 2X8GA 5CRHA 1Z6NA 2FUG2 1WIKA 1K0MA 2LS5A 2LRNA 2NDOA 4IJIA 1WJKA 2V6OA 4XS1A 3DYRA 5HR3A 2PUKC 3BCIA 1SD8A 3CYNA 1XOBA 1SJZA 1M2BA 1YF1A 3IRAA 4RUVA 3A5WA 1ZZYA 4ICYA 1SL1B 3H1NA 4N11A 1DSBA 1AXDA 1T8EB 1ON4A 5KEJA 3F4TA 1EGOA 1TTZA 1YEXA 1HNBA 6GSUA 2EIQA 1MD4A 5BRTA 3FZ9A 1B48A 2PN8A 2ZUPA 4ACSA 5CYYA 4ISDA 1DUGA 1SL2B 3ZLPA 3ZMKA 2JSZA 3D4MA 1GP1A 3VWXA 4HJMA 4YQUA 2GTUA 4EF0A 4HS1A 1YJ6A 2OE3A 1ZCPA 3QCPA 9GSSA 1OYJA 4LA1A 1CQGA 2DIYA 3APOA 3DMLA 4HQZA 3L0HA 4Z2RA 2H73A 5ECMB 1HYUA 2MBTA 4ECJA 4E8EA 5IPHA 1GNEA 4GCIA 3F3RA 3PGTA 2GZZA 1Z5YE 4O7HA 1WMJA 2YWMA 1GTAA 5CRDA 2GSSA 3CXGA 4LLRA 1JFUA 5E4WA 4F03A 2IJYA 4K0NA 3VI5A 4I5QA 4GSTA 5DCHA 3CBUA 2HSMA 1GNWA 1YY7A 3GNJA 1QXHA 1ML6A 2REMA 2OBIA 1UN2A 1N2AA 1USBA 4D73B 2H30A 1ZYPA 2OACA 1UVZA 2BTOT 4K0GA 1T4YA 3FRCA 5B7CA 2KLXA 2DJ2A 1A2LA 2B1KA 2H8LA 1V40A 4D73A 3MIXA 4ID0A 1O85A 3FZ4A 2WFCA 4ZILA 3IDVA 3L78A 3IC4A 2DKIA 2VOCA 5KN1A 6GSTA 1GSSA 3CMIA 1JZDA 4FIWA 3IXRA 3D21A 4OCEA 5IOWA 1TXXA 2IMIA 1ZOFA 1K0NA 3DVWA 3IHGA 4F9ZA 3IC8A 2GVPA 2HE3A 4KH7A 3MNGA 4RQRA 4DSSB 2VLUA 3WGDA 3J7Yb 4KCAA 1GLQA 3BJ5A 3W8SA 5D9XA 2H71A 1ZYNA 1VRSD 2L6DA 2DSAA 3IAS2 1U88A 3SBCA 4XCSA 2WCIA 4DSSA 5IMAA 4L5OA 5IO0A 3GSSA 5B6MA 1A0FA 4BA7A 1K3YA 3L9VA 4G19A 2LNSA 2K18A 4ML6A 3LQ7A 3VWUA 3HJPA 1K0BA 3LWAA 3HXSA 1EOGA 5G1KA 2ES7A 1ST9A 5E59A 1W4VA 2FNOA 4Z2UA 5FT3A 2OADA 2QA1A 1FOVA 2DJ3A 3M0FA 3CRUA 4ULXA 2YP6A 4YKGA 3H8QA 5B8BA 2HZEB 4JR6A 3KH7A 5LCZA 5ECNB 1XVQA 3ZIVA 4G9HA 3IHQA 2C3TA 4HJ2A 1I5GA 3LEFA 2GT5A 5INYA 2H66A 3LYPA 22GSA 1Y25A 2HZEA 1AQXA 2Z9SA 4TXOB 2CV4A 2WB9A 4ZIJA 1HNCA 2V2GA 4Q5FA 3EYTA 4MJBA 1OVNA 5CO3A 2PVOC 4TXOA 4MZWA 5IM9A 2R3XA 4G0IA 1VF3A 1SD9A 4MZBA 1ERVA 3KZQA 3UBKA 4NV2A 2P5QA 1X0RA 2C1YA 3F8UA 4JBBA 2LJKA 3FZAA 5AN1A 4XS6A 4POBA 1TRUA 6GSVA 3DEXA 2P31A 1X9SB 4TN8A 3VFIA 3O3TA 3G7JA 3TKQA 3ZL5A 5GAPD 17GSA 4DSRA 2A2SA 4IKHA 5IIZA 5DQSA 5CNWA 3HA9A 3RHBA 1X9MB 4AJ8A 4KDXA 4KUNA 5D9WA 4POMA 1Q4JA 1HNAA 2HXKA 1JLWA 2EIOA 1PD21 2VCVA 1FG4A 4JEDA 1T3BA 4MLYA 1MDIA 2LV3A 2N5BA 2DJJA 2YCDA 3DKSA 5J9BA 5ELAA 1BG5A 2HYXA 1A23A 5DJMA 2H6YA 3GX8A 1B9XC 2DIZA 2AUVA 1LBKA 3P8WA 3N9JA 1AQWA 3HZ4A 5G31A 3F9UA 4YAVA 1XBSA 6GSSA 3LJRA 1OC9B 2HFDA 2G0FA 4TW5A 2WULA 5AISA 5ECPB 3F63A 3HDCA 1YKAA 1BQ7A 4L0UA 3IK7A 3KEBA 1PL2A 1FHEA 1OC9A 5H5SA 4EDYA 2WGRA 3GX0A 4ZXGA 1TP9A 5DCGA 4EDZA 4K9ZA 3DRNA 5J9CA 5EY6A 1LJRA 5F07A 3Q18A 3L9SA 1X9WB 5G30A 3CTGA 3EPTA 3MWHA 4K8MA 3HJMA 4P3YB 3APSA 4IHUA 3HYPA 3EC3A 1SK1A 2VIMA 1XWBA 3G7IA 3RPPA 1AC1A 2HRAA 4RQXA 4V2NA 1VF2A 5DDLA 3GFKA 3FR6A 1GSFA 2A4HA 3QD9A 4K5RA 1GUHA 8GSSA 4WF5A 1X5CA 1PX6A 4J57E 2DJ1A 5AIVA 2GQMA 4EC0A 1ERUA 3GYKA 2I4AA 1ACVA 3W8JA 4GSSA 3TKSC 4O92A 1F37A 4ZB6A 4JRRA 4WBJA 4J56E 4ECIA 1AIUA 3WGEA 1URMA 4HEA2 2L5OA 3Q19A 1S3AA 1OC8A 2X8HA 2X4AA 4TR1B 3IR4A 2C3QA 3FZ5A 3BBYA 1GRXA 3UAPA 4IELA 1M7TA 4MJCA 3ZZXA 2VD1A 5JCGA 3IAM2 1FOHA 4V1Ap 1AUCA 4OFMA 1SKWB 2FGXA 1B4QA 1WOUA 4TR1A 1IYHA 3KP8A 1RW1A 1V2AA 4IW9A 1EP8A 2JU5A 3GKXA 4YH2A 2V32A 3KM6A 4K2DA 5KOWA 5D73A 2CAIA 3MDKA 1F9MA 3CTFA 4PQHA 4PNFA 3HD5A 3TKSA 4MMMA 3E0UA 3IV4A 3D4TA 2IL3A 2B5YA 2GT6A 4POLA 1QGVA 4G2EA 1J0FA 2L5LA 1K0AA 1Z6MA 1MDKA 1XFLA 3AY8A 2GQKA 4MH2A 2FCHA 2TRXA 3E3EA 3U5RE 4ZB9A 4F0CA 4MABA 5ID2B 3UVHA 2OJLA 1PN9A 4IN0A 3UIWA 4I2UA 2VL3A 4KNDA 1OE8A 2YJ7A 1A24A 3I9V2 2CT6A 2PERA 2RM6A 4FO5A 2L6CA 5ID2A 4Z7XA 1ZYQB 1K0OA 4F2IA 5ECSA 2LRCA 3FMWA 3FW2A 2XPDA 1A8LA 2YV9A 3HVXA 4L5LA 2X64A 2LTKA 1Z9HA 3ZVJD 2HRKA 2MMAA 3I43A 4MA9A 4QQ7A 3US3A 2VCTA 1PN0A 1U6TA 1K0CA 2FWFA 5D96A 2H70A 1U3IA 2VO4A 3C1RA 3GA4A 3QAGA 1X5DA 1NSWA 2X49A 13GSA 4K7OA 4X0XA 3TKPA 2HSHA 1PKZA 3M3MA 5J41A 5D9VA 3VK9A 1QFNA 1SL0B 1FVKA 3GH6A 5ECQB 3LFLA 1PSQA 1XPVA 5F0GA 5GAND 2OE0A 2WS2A 2ON7A 1S3CA 3EINA 3O76A 3VI7A 3IOSA 2FD3A 4KDYA 3QAVA 4LMVA 5G2ZA 5KN2A 3KMNA 3DXBA 1KNGA 1XCCA 2XC2A 5CP1A 5ECKB 2NTOA 1XVWA 2FHEA 3D0ZA 2YZHA 4KE3A 3FK8A 2VUPA 4K6XA 2B5EA 2QC7A 2AHEA 1XIYA 1DE1A 2H6XA 3GKKA 2H1DA 1TU7A 4WKWA 3TOUA 3K8NA 1R5PA 1XW9A 4ZL8A 4L0WA 3H4KA 4MF5A 3NOFA 6GSXA 1NHOA 3C73A 3FR3A 3GN3A 1PRXA 1B9YC 4MNNA 4G0LA 1DBYA 4NV5A 2PBJA 5G1LA 4KSOA 2LQQA 2CZ3A 1WE0A 2FWEA 3KTBA 5KN0A 2F8FA 3DVXA 2VCZA 1NW2A 5D93A 1HQOA 4CW9A 4NAXA 1RQMA 1SK0A 4XRAA 2QA2A 4BWSA 5A5KA 1M99A 1G7OA 2K9FA 3A5IA 4HUAA 2JSYA 4PUAA 3F6DA 2CAQA 2GDRA 3TOTA 2IWTA 2IMDA 2V6KA 1GTBA 4TKYA 3NIVA 2B3SA 3WGXA 2B7KA 2H1GA 3HCZA 2VLVA 1R5AA 3G9BA 4GLTA 3TGZA 3I69A 4HU7A 2HZFA 3FEUA 3F6FA 2JADA 4ZBDA 7GSSA 5ENUA 3TB2A 1VF4A 4WF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VM1 A;  2R2J A;  4PQI A;  4KCE A;  4NMU A;  5B8A A;  2I1U A;  2FWG A;  2LKU A;  4MF7 A;  3EWL A;  3Q6O A;  5JWQ B;  1GUL A;  4Q5R A;  2K6V A;  5EPF A;  2C80 A;  2O7K A;  1ABA A;  3DWV A;  1E2Y A;  5CAX A;  2VLT A;  4F82 A;  1ZL9 A;  5ELG A;  3QOU A;  1R4W A;  4OO4 A;  3LXZ A;  2N5A A;  1GH2 A;  1SYX A;  4ECC A;  2H1B A;  3CSH A;  1YKC A;  4ZB8 A;  1XOA A;  2GS3 A;  5HR1 A;  1FB6 A;  2X99 A;  2YNX A;  5DJL A;  4TOP A;  3IA1 A;  1V98 A;  3DIE A;  5IMF A;  2BMX A;  5IMV A;  2GST A;  3GH9 A;  4XS4 B;  3TJG A;  1YEP A;  2L57 A;  1U87 A;  2FA4 A;  1C72 A;  4MPG A;  3C71 A;  2YZU A;  1A2M A;  2YWO A;  3HVS A;  2HSY A;  1THX A;  1XW6 A;  2L4Q A;  4ZL9 A;  4XHM A;  4XS4 A;  3VLN A;  1M9A A;  2CZ2 A;  3UMA A;  3ISO A;  5DAK B;  1IYI A;  2LRT A;  5B6N A;  3QFB C;  4GF0 A;  4EXJ A;  5GSS A;  4KX4 A;  3DGQ A;  1ERW A;  3EMP A;  1TI3 A;  5DAK A;  1K3O A;  2KUC A;  3UL3 A;  3ZYW A;  4PGT A;  2N5F A;  3ZIJ A;  3O6T A;  2LST A;  2J23 A;  4IJ3 A;  2AAW A;  2LJR A;  3CSJ A;  1JZW A;  3GKM A;  4J2F A;  2GGT A;  1I9D A;  4PX1 A;  3GHA A;  4Q5Q A;  3KXO A;  4KDU A;  4N0Z A;  2YV7 A;  3KD0 A;  2B1L A;  2YPM A;  1SU9 A;  1MD3 A;  4N0V A;  1TK0 B;  1HD2 A;  3ZTL A;  5C00 A;  3GL5 A;  4ZBA A;  1SKR B;  1BAY A;  1WPI A;  1XWG A;  5CRW A;  4Q5N A;  1ZMA A;  2VCW A;  4ILF A;  3TJK A;  4O32 A;  4EO3 A;  3F3Q A;  5KN3 A;  1TRS A;  4WR5 A;  3EE2 A;  2R6K A;  1BX9 A;  4O5R A;  2DMM A;  1LU4 A;  3EU3 A;  4BWQ A;  3GUS A;  3C7M A;  2QSI A;  2VM2 A;  1Z3E A;  2R37 A;  1GUK A;  2DML A;  3TJJ A;  3KCM A;  1F3A A;  1WRY A;  4HI7 A;  1EGR A;  3KMO A;  4K1F A;  2O8V B;  4EVM A;  3BCK A;  2JZR A;  3KTL A;  1TOF A;  1XW5 A;  5ECR B;  5EL8 A;  3KP9 A;  2L4C A;  1GSE A;  4BPY A;  4MCU A;  2RII A;  2E2G A;  2LUS A;  1ZGN A;  3KJY A;  4HU9 A;  3WT1 A;  3W6G A;  4CDO A;  4DSQ A;  3L9U A;  1K0D A;  1GTI A;  1TW9 A;  2BJX A;  4EL1 A;  3ZRE A;  19GS A;  2IFQ B;  1QMV A;  3I6A A;  5AGY A;  1UC7 A;  3TRP A;  2OBK A;  1BED A;  18GS A;  3UJ1 A;  3VWW A;  4FH8 A;  2RLI A;  3M9K A;  2IFQ A;  1WWJ A;  3SWL A;  4MDC A;  2CVB A;  1CQH A;  1T7P B;  1EEM A;  3GMF A;  3FYG A;  4IP6 A;  3CRT A;  1A8Y A;  3C1S A;  3FHK A;  5A4W A;  1M2D A;  2XPE A;  5ECL B;  2A4V A;  4OO5 A;  2YWN A;  1MDJ A;  1TRW A;  1ZYE A;  2B6M A;  4EUY A;  5J3R A;  1JLV A;  1Q98 A;  1F3B A;  3RPN A;  4FYU A;  1M9B A;  3DD3 A;  3ZML A;  4AF2 A;  4N30 A;  5JCW A;  2H0I A;  1RK4 A;  2L59 A;  3M8N A;  1YDK A;  1VGL A;  3H79 A;  1PMT A;  2YN1 A;  1BYE A;  5GST A;  1O8W A;  2PMT A;  1O81 A;  2PWJ A;  1TU8 A;  1O6J A;  4EKZ A;  1F6M C;  2H01 A;  16GS A;  2HRF A;  4LMW A;  4OCF A;  2LNT A;  1KTE A;  4IGJ A;  4HDE A;  4OMV A;  3TRX A;  2LQO A;  3JCM L;  4AJ6 A;  1TI1 A;  3R2Q A;  2TRC P;  3D22 A;  5IQY A;  4X43 A;  3TJB A;  4OFN A;  2JZS A;  4KAE A;  2G2Q A;  2DJ0 A;  3GTU B;  4WR4 A;  2K8S A;  3ME7 A;  1VF1 A;  2DJK A;  4OWY A;  2CA8 A;  2X8C A;  5F05 A;  5HR2 A;  1SKS B;  20GS A;  3LXT A;  2ALB A;  2C4J A;  3TRQ A;  2GSR A;  2F8A A;  2HLS A;  3MSZ A;  3GTU A;  2TIR A;  2O87 A;  3E9J B;  5HQP A;  3A2X A;  3TUE A;  2HI7 A;  3M9J A;  4V2L A;  2H0H A;  2CVD A;  2WJU A;  3IBH A;  4TXV A;  4IQ1 A;  4KW6 A;  3OR5 A;  1SYR A;  5C04 A;  5ABR A;  4E8H A;  1OC3 A;  5ECO B;  2E0Q A;  3L4N A;  2O89 A;  4PQ1 A;  1B4P A;  5JWR B;  4WBR D;  3RHC A;  2IMF A;  3UEM A;  2IN3 A;  4RI6 A;  5DAL B;  4K7N A;  5L71 A;  1H4O A;  3PIN A;  2H1A A;  2MYG A;  1G6Y A;  4POK A;  4YQM A;  3RAZ A;  2V41 A;  2JL4 A;  3Q74 A;  2MMZ A;  5DAL A;  5D9T A;  5FHI A;  1K3L A;  1QUW A;  3V1W A;  1THO A;  2R4V A;  5ECH B;  2AYT A;  4MF6 A;  5JWO B;  4L8E A;  4IQA A;  4X1U A;  3MAK A;  4MH3 A;  2DLX A;  2ON5 A;  1FVJ A;  2H72 A;  3CSI A;  3ME8 A;  5IOX A;  1EWX A;  4ZL7 A;  1B8X A;  1NM3 A;  4XIH A;  1BJX A;  1XZO A;  2CX3 A;  3WT2 A;  2IIY A;  2HNL A;  4XTS A;  3IPZ A;  1XXU A;  2P0G A;  2KHP A;  1SEN A;  2RM5 A;  2PVQ A;  3FR9 A;  2O85 A;  3A3T A;  2XBI A;  2H0G A;  1YQ1 A;  1FW1 A;  4KA0 A;  1KEB A;  5F06 A;  1T4Z A;  2MBS A;  6GSY A;  3QMX A;  1DE2 A;  5DQY A;  2HRN A;  4MK3 A;  4GSN A;  3U6V A;  1GL8 A;  2I3Y A;  3GRX A;  2GZP A;  1O7U A;  4JR4 A;  4MJA A;  3EVI A;  2P5R A;  4YQV A;  2YWI A;  2CVK A;  1A0R P;  4RI7 A;  4IVF A;  4PXO A;  3ERF A;  4NHZ A;  2YAN A;  3GIX A;  2CQ9 A;  5LD0 A;  2FY6 A;  1FB0 A;  3GV1 A;  4AGS A;  2XBQ A;  5G5E A;  4HQS A;  3PH9 A;  4IS0 A;  2KOK A;  1GWC A;  1WP0 A;  3GUR A;  4GTU A;  4BVY A;  3QAW A;  4NXI A;  4BVX A;  5HFG A;  2HT9 A;  2WRT A;  5FWG A;  1JHB A;  3RBT A;  1GSD A;  5DBQ A;  2IMK A;  3C8E A;  5HFK A;  5JCU A;  1H75 A;  2C8U A;  1J08 A;  2YJH A;  3HZ8 A;  3KIJ A;  14GS A;  2C0F A;  5IMZ A;  1ILO A;  1EP7 A;  4FYC A;  4WET A;  4V1A g;  3TCO A;  1SK2 A;  1F2E A;  5A4U A;  3VPQ A;  3TKS E;  3A2V A;  1EZK A;  3RDW A;  3P2A A;  2A2R A;  5G5F A;  1OAZ A;  1U3A A;  5A4V A;  5DVB A;  1NHY A;  4GQC A;  2K8V A;  2H19 A;  3LYK A;  1EEJ A;  1MTC A;  1XWC A;  1T1V A;  1YF0 A;  2RUF A;  1AW9 A;  4DEJ A;  4OFT A;  1JZR A;  2MMN A;  4NHW A;  1TDI A;  3P7X A;  1KBN A;  1AAZ A;  4N10 A;  2ZCT A;  4HZ2 A;  1G6W A;  3HJO A;  2MMO A;  2E7P A;  2M72 A;  2JZT A;  10GS A;  2PGT A;  3F4S A;  1TRV A;  4IP1 A;  2VL2 C;  2FA8 A;  1E6B A;  2M46 A;  1QQ2 A;  4ZBB A;  1JZO A;  4CHS A;  2ZNM A;  1XWK A;  2WDU A;  4PUF C;  3LG6 A;  2GSQ A;  1AQV A;  2D2Z A;  1PKW A;  4TVE A;  1X5E A;  1W89 A;  4I2T A;  3EMX A;  3BOA A;  2H74 A;  1QK8 A;  3LGC A;  4WXT A;  4PUR A;  3UBL A;  3TJF A;  3ED3 A;  2YOI A;  2F51 A;  5IO2 A;  1UA5 A;  1G7E A;  2FWH A;  4TR0 A;  2AB6 A;  1N8J A;  4K7I A;  3QPM A;  2GQL A;  1OE7 A;  4GRF A;  1Z7P A;  2VL2 A;  3HVV A;  1TJD A;  3ZIT A;  3IK9 A;  3FKF A;  3N5O A;  5J4U A;  2J9H A;  4XRD A;  2PPT A;  2EC4 A;  1Z7R A;  2QGV A;  4I8B A;  4HOJ A;  4MPF A;  1TKD B;  4PNG A;  5AIX A;  1G0T A;  2VAF A;  3PR8 A;  1MEK A;  1R26 A;  4TR3 A;  4ML1 A;  1T00 A;  1XWA A;  3F4R A;  3J7Y k;  5HR0 A;  3TDG A;  2OKA A;  3ZFL A;  1J9B A;  2C3N A;  2MZC A;  2C0G A;  5J5N A;  1FO5 A;  2VL9 A;  4F0B A;  2R5G A;  2F9S A;  1O8X A;  1V57 A;  2KP2 A;  4JU5 A;  3UAR A;  3ZVJ A;  2E2M A;  4IBP A;  3GKN A;  3NZN A;  2OA7 A;  2VCQ A;  1Y6E A;  3QDN A;  3IE3 A;  3S9F A;  3EU4 A;  4OD7 A;  5IMC A;  1OKD A;  1S3D A;  1PA3 A;  4ECB A;  2LJA A;  3BD2 A;  4DVC A;  5LNK e;  2V1M A;  3KGK A;  2FLS A;  4GWR A;  4V2M A;  4I6X A;  5F8B A;  1TK8 B;  5IMD A;  6GSW A;  2B7J A;  2NVL A;  3ZFB A;  3EUR A;  3M1G A;  3FY7 A;  4GXZ A;  4AJ7 A;  3KH9 A;  3A2W A;  2WZ9 A;  1V58 A;  3GL3 A;  3ERW A;  2AV4 A;  1O73 A;  1PGT A;  4I97 A;  3ERG A;  4NPB A;  5ECI B;  1SJI A;  1YZX A;  4H86 A;  1EOH A;  5H5Q A;  2PU9 C;  1EV4 A;  2LEG A;  2CX4 A;  1M2A A;  2H76 A;  5HFI A;  3WD6 A;  3WYW A;  2I9H A;  3LOR A;  4LL1 B;  2OE1 A;  2KP1 A;  4LL4 B;  1PL1 A;  5CRE A;  4G10 A;  3UOM A;  4YAP A;  4BL7 A;  1FAA A;  3LSZ A;  1PQN A;  4JZQ A;  1V9W A;  3P90 A;  4QL7 A;  2NPB A;  3D6I A;  2NBS A;  2I81 A;  12GS A;  2DC5 A;  5CRG A;  4MP4 A;  2QKE A;  3VWV A;  3HY2 A;  2VCX A;  5COH A;  11GS A;  1M0U A;  2C0E A;  2GLR A;  3D5J A;  3UVT A;  2H75 A;  1GLP A;  2IME A;  3APQ A;  5GZZ B;  2VD0 A;  4MZC A;  5IPG A;  2JAC A;  1EV9 A;  2B5X A;  4NWY A;  2M80 A;  3F0I A;  3G7Y A;  3GST A;  4KB3 A;  3H93 A;  4KSM A;  1TK5 B;  4TRX A;  2IPA A;  4GQF A;  4WEY A;  2H6Z A;  2AJQ B;  1GSQ A;  1PX7 A;  5EVO A;  3HHV A;  3VPT A;  5D8I A;  2EIR A;  4FYB A;  4QL9 A;  3VUR A;  1GSY A;  1R7H A;  3HKR A;  1A2J A;  2F3M A;  4KGI A;  5H5R A;  1GTU A;  3ZRD A;  1OKT A;  4MJE A;  2GZY A;  3QR6 A;  3QFA C;  2RUE A;  2DBC A;  4JE1 A;  1SJ6 A;  3TKR A;  4TR4 A;  2XHF A;  4HZ4 A;  1ERT A;  1GUM A;  4EE0 A;  1GSU A;  2C0D A;  2X8G A;  5CRH A;  1Z6N A;  2FUG 2;  1WIK A;  1K0M A;  2LS5 A;  2LRN A;  2NDO A;  4IJI A;  1WJK A;  2V6O A;  4XS1 A;  3DYR A;  5HR3 A;  2PUK C;  3BCI A;  1SD8 A;  3CYN A;  1XOB A;  1SJZ A;  1M2B A;  1YF1 A;  3IRA A;  4RUV A;  3A5W A;  1ZZY A;  1SL1 B;  3H1N A;  4N11 A;  1DSB A;  1AXD A;  1T8E B;  1ON4 A;  5KEJ A;  3F4T A;  1EGO A;  1TTZ A;  1YEX A;  1HNB A;  6GSU A;  2EIQ A;  1MD4 A;  3FZ9 A;  1B48 A;  2PN8 A;  2ZUP A;  4ACS A;  5CYY A;  4ISD A;  1DUG A;  1SL2 B;  3ZLP A;  3ZMK A;  2JSZ A;  3D4M A;  1GP1 A;  3VWX A;  4HJM A;  4YQU A;  2GTU A;  4EF0 A;  4HS1 A;  1YJ6 A;  2OE3 A;  1ZCP A;  3QCP A;  9GSS A;  1OYJ A;  4LA1 A;  1CQG A;  2DIY A;  3APO A;  3DML A;  4HQZ A;  3L0H A;  2H73 A;  5ECM B;  1HYU A;  2MBT A;  4ECJ A;  4E8E A;  5IPH A;  1GNE A;  4GCI A;  3F3R A;  3PGT A;  2GZZ A;  1Z5Y E;  4O7H A;  1WMJ A;  2YWM A;  1GTA A;  5CRD A;  2GSS A;  3CXG A;  4LLR A;  1JFU A;  5E4W A;  4F03 A;  2IJY A;  4K0N A;  3VI5 A;  4I5Q A;  4GST A;  5DCH A;  3CBU A;  1GNW A;  1YY7 A;  3GNJ A;  1QXH A;  1ML6 A;  2REM A;  2OBI A;  1UN2 A;  1N2A A;  1USB A;  4D73 B;  2H30 A;  2OAC A;  1UVZ A;  2BTO T;  4K0G A;  1T4Y A;  3FRC A;  5B7C A;  2KLX A;  2DJ2 A;  1A2L A;  2B1K A;  2H8L A;  1V40 A;  4D73 A;  4ID0 A;  1O85 A;  3FZ4 A;  2WFC A;  4ZIL A;  3IDV A;  3L78 A;  3IC4 A;  2VOC A;  5KN1 A;  6GST A;  1GSS A;  3CMI A;  1JZD A;  4FIW A;  3IXR A;  3D21 A;  4OCE A;  5IOW A;  1TXX A;  2IMI A;  1ZOF A;  1K0N A;  3DVW A;  4F9Z A;  2GVP A;  2HE3 A;  4KH7 A;  3MNG A;  4RQR A;  4DSS B;  2VLU A;  3WGD A;  3J7Y b;  4KCA A;  1GLQ A;  3BJ5 A;  3W8S A;  5D9X A;  2H71 A;  1VRS D;  2L6D A;  2DSA A;  3IAS 2;  1U88 A;  3SBC A;  4XCS A;  2WCI A;  4DSS A;  5IMA A;  4L5O A;  5IO0 A;  3GSS A;  5B6M A;  1A0F A;  4BA7 A;  1K3Y A;  3L9V A;  4G19 A;  2LNS A;  2K18 A;  4ML6 A;  3LQ7 A;  3VWU A;  3HJP A;  1K0B A;  3LWA A;  3HXS A;  1EOG A;  5G1K A;  2ES7 A;  1ST9 A;  5E59 A;  1W4V A;  2FNO A;  5FT3 A;  2OAD A;  1FOV A;  2DJ3 A;  3M0F A;  3CRU A;  4ULX A;  2YP6 A;  3H8Q A;  5B8B A;  2HZE B;  4JR6 A;  3KH7 A;  5LCZ A;  5ECN B;  1XVQ A;  3ZIV A;  4G9H A;  3IHQ A;  2C3T A;  4HJ2 A;  1I5G A;  3LEF A;  2GT5 A;  5INY A;  2H66 A;  3LYP A;  22GS A;  1Y25 A;  2HZE A;  1AQX A;  2Z9S A;  4TXO B;  2CV4 A;  2WB9 A;  4ZIJ A;  1HNC A;  2V2G A;  4Q5F A;  3EYT A;  4MJB A;  1OVN A;  5CO3 A;  2PVO C;  4TXO A;  4MZW A;  5IM9 A;  2R3X A;  1VF3 A;  1SD9 A;  4MZB A;  1ERV A;  3KZQ A;  3UBK A;  4NV2 A;  2P5Q A;  1X0R A;  2C1Y A;  3F8U A;  4JBB A;  5AN1 A;  2LJK A;  3FZA A;  4XS6 A;  4POB A;  1TRU A;  6GSV A;  3DEX A;  2P31 A;  1X9S B;  4TN8 A;  3VFI A;  3O3T A;  3G7J A;  3TKQ A;  3ZL5 A;  5GAP D;  17GS A;  4DSR A;  2A2S A;  4IKH A;  5IIZ A;  5DQS A;  5CNW A;  3HA9 A;  3RHB A;  1X9M B;  4AJ8 A;  4KDX A;  4KUN A;  5D9W A;  4POM A;  1Q4J A;  1HNA A;  2HXK A;  1JLW A;  2EIO A;  1PD2 1;  2VCV A;  1FG4 A;  4JED A;  1T3B A;  4MLY A;  1MDI A;  2LV3 A;  2N5B A;  2DJJ A;  2YCD A;  3DKS A;  5J9B A;  5ELA A;  1BG5 A;  2HYX A;  1A23 A;  5DJM A;  2H6Y A;  3GX8 A;  1B9X C;  2DIZ A;  2AUV A;  1LBK A;  3P8W A;  3N9J A;  1AQW A;  3HZ4 A;  5G31 A;  3F9U A;  4YAV A;  1XBS A;  6GSS A;  3LJR A;  1OC9 B;  2HFD A;  2G0F A;  4TW5 A;  2WUL A;  5AIS A;  5ECP B;  3F63 A;  3HDC A;  1YKA A;  1BQ7 A;  4L0U A;  3IK7 A;  3KEB A;  1PL2 A;  1FHE A;  1OC9 A;  5H5S A;  4EDY A;  2WGR A;  3GX0 A;  4ZXG A;  1TP9 A;  5DCG A;  4EDZ A;  4K9Z A;  3DRN A;  5J9C A;  5EY6 A;  1LJR A;  5F07 A;  3Q18 A;  3L9S A;  1X9W B;  5G30 A;  3CTG A;  3MWH A;  4K8M A;  3HJM A;  4P3Y B;  3APS A;  4IHU A;  3HYP A;  3EC3 A;  1SK1 A;  2VIM A;  1XWB A;  3G7I A;  3RPP A;  1AC1 A;  4RQX A;  4V2N A;  1VF2 A;  5DDL A;  3GFK A;  3FR6 A;  1GSF A;  3QD9 A;  1GUH A;  8GSS A;  4WF5 A;  1X5C A;  1PX6 A;  4J57 E;  2DJ1 A;  5AIV A;  2GQM A;  4EC0 A;  1ERU A;  3GYK A;  2I4A A;  1ACV A;  3W8J A;  4GSS A;  3TKS C;  4O92 A;  1F37 A;  4ZB6 A;  4JRR A;  4WBJ A;  4J56 E;  4ECI A;  1AIU A;  3WGE A;  1URM A;  4HEA 2;  2L5O A;  3Q19 A;  1S3A A;  1OC8 A;  2X8H A;  4TR1 B;  3IR4 A;  2C3Q A;  3FZ5 A;  3BBY A;  1GRX A;  3UAP A;  4IEL A;  1M7T A;  4MJC A;  3ZZX A;  2VD1 A;  5JCG A;  3IAM 2;  4V1A p;  1AUC A;  4OFM A;  1SKW B;  2FGX A;  1B4Q A;  1WOU A;  4TR1 A;  1IYH A;  3KP8 A;  1RW1 A;  1V2A A;  4IW9 A;  1EP8 A;  2JU5 A;  3GKX A;  4YH2 A;  2V32 A;  3KM6 A;  4K2D A;  5D73 A;  2CAI A;  3MDK A;  1F9M A;  3CTF A;  4PQH A;  4PNF A;  3HD5 A;  3TKS A;  4MMM A;  3E0U A;  3IV4 A;  3D4T A;  2IL3 A;  2B5Y A;  2GT6 A;  4POL A;  1QGV A;  4G2E A;  1J0F A;  2L5L A;  1K0A A;  1Z6M A;  1MDK A;  1XFL A;  3AY8 A;  2GQK A;  4MH2 A;  2FCH A;  2TRX A;  3E3E A;  3U5R E;  4ZB9 A;  4F0C A;  4MAB A;  5ID2 B;  3UVH A;  2OJL A;  1PN9 A;  4IN0 A;  3UIW A;  4I2U A;  2VL3 A;  4KND A;  1OE8 A;  2YJ7 A;  1A24 A;  3I9V 2;  2CT6 A;  2PER A;  2RM6 A;  4FO5 A;  2L6C A;  5ID2 A;  4Z7X A;  1ZYQ B;  1K0O A;  4F2I A;  5ECS A;  2LRC A;  3FW2 A;  2XPD A;  1A8L A;  2YV9 A;  3HVX A;  4L5L A;  2X64 A;  2LTK A;  1Z9H A;  3ZVJ D;  2MMA A;  3I43 A;  4MA9 A;  4QQ7 A;  3US3 A;  2VCT A;  1U6T A;  1K0C A;  2FWF A;  5D96 A;  2H70 A;  1U3I A;  2VO4 A;  3C1R A;  3GA4 A;  3QAG A;  1X5D A;  1NSW A;  13GS A;  4K7O A;  4X0X A;  3TKP A;  2HSH A;  1PKZ A;  3M3M A;  5J41 A;  5D9V A;  3VK9 A;  1QFN A;  1SL0 B;  1FVK A;  3GH6 A;  5ECQ B;  3LFL A;  1PSQ A;  1XPV A;  5F0G A;  5GAN D;  2OE0 A;  2WS2 A;  2ON7 A;  1S3C A;  3EIN A;  3O76 A;  3VI7 A;  3IOS A;  2FD3 A;  4KDY A;  3QAV A;  4LMV A;  5G2Z A;  5KN2 A;  3KMN A;  3DXB A;  1KNG A;  1XCC A;  2XC2 A;  5CP1 A;  5ECK B;  2NTO A;  1XVW A;  2FHE A;  3D0Z A;  2YZH A;  4KE3 A;  3FK8 A;  2VUP A;  4K6X A;  2B5E A;  2QC7 A;  2AHE A;  1XIY A;  1DE1 A;  2H6X A;  3GKK A;  2H1D A;  1TU7 A;  4WKW A;  3TOU A;  3K8N A;  1R5P A;  1XW9 A;  4ZL8 A;  4L0W A;  3H4K A;  4MF5 A;  3NOF A;  6GSX A;  1NHO A;  3C73 A;  3FR3 A;  3GN3 A;  1PRX A;  1B9Y C;  1DBY A;  4NV5 A;  2PBJ A;  5G1L A;  4KSO A;  2LQQ A;  2CZ3 A;  1WE0 A;  2FWE A;  3KTB A;  5KN0 A;  2F8F A;  3DVX A;  2VCZ A;  1NW2 A;  5D93 A;  1HQO A;  4CW9 A;  4NAX A;  1RQM A;  1SK0 A;  4XRA A;  4BWS A;  5A5K A;  1M99 A;  1G7O A;  2K9F A;  4HUA A;  2JSY A;  4PUA A;  3F6D A;  2CAQ A;  2GDR A;  3TOT A;  2IWT A;  2IMD A;  2V6K A;  1GTB A;  4TKY A;  3NIV A;  2B3S A;  3WGX A;  2B7K A;  2H1G A;  3HCZ A;  2VLV A;  1R5A A;  3G9B A;  4GLT A;  3TGZ A;  3I69 A;  4HU7 A;  2HZF A;  3FEU A;  3F6F A;  2JAD A;  4ZBD A;  7GSS A;  5ENU A;  3TB2 A;  1VF4 A;  4WF4 A; 
#chains in the Genus database with same CATH topology
 2VM1 A;  2R2J A;  4PQI A;  4KCE A;  4NMU A;  5B8A A;  2I1U A;  2FWG A;  2LKU A;  4MF7 A;  3EWL A;  3Q6O A;  5JWQ B;  1GUL A;  4Q5R A;  2K6V A;  3PPU A;  5EPF A;  2C80 A;  2O7K A;  1ABA A;  3DWV A;  1E2Y A;  5CAX A;  2VLT A;  4F82 A;  1ZL9 A;  5ELG A;  3QOU A;  1R4W A;  4OO4 A;  3LXZ A;  2N5A A;  1GH2 A;  1SYX A;  4ECC A;  2H1B A;  3CSH A;  1YKC A;  4ZB8 A;  1XOA A;  2GS3 A;  5HR1 A;  4EIQ A;  1FB6 A;  2X99 A;  2YNX A;  5DJL A;  4KF9 A;  4TOP A;  3IA1 A;  1V98 A;  3DIE A;  5IMF A;  2BMX A;  4O5U A;  5IMV A;  2GST A;  3GH9 A;  4XS4 B;  3TJG A;  1YEP A;  2L57 A;  1U87 A;  2FA4 A;  1C72 A;  4MPG A;  3C71 A;  2YZU A;  1A2M A;  2YWO A;  3HVS A;  2HSY A;  1THX A;  1XW6 A;  2L4Q A;  4ZL9 A;  4XHM A;  4XS4 A;  3VLN A;  1M9A A;  2CZ2 A;  3UMA A;  3ISO A;  5DAK B;  1IYI A;  2LRT A;  5B6N A;  3QFB C;  4GF0 A;  4EXJ A;  5GSS A;  4KX4 A;  3DGQ A;  4A5P A;  1ERW A;  3EMP A;  1TI3 A;  5DAK A;  1K3O A;  2KUC A;  3UL3 A;  1XG8 A;  3ZYW A;  4PGT A;  2N5F A;  3ZIJ A;  3O6T A;  2LST A;  2J23 A;  4IJ3 A;  2AAW A;  2LJR A;  3CSJ A;  1JZW A;  3GKM A;  4J2F A;  2GGT A;  1I9D A;  4PX1 A;  3GHA A;  4Q5Q A;  3KXO A;  4KDU A;  4N0Z A;  2YV7 A;  4YKF A;  3KD0 A;  2B1L A;  2YPM A;  1SU9 A;  1MD3 A;  4N0V A;  1TK0 B;  1HD2 A;  3ZTL A;  5C00 A;  3GL5 A;  4ZBA A;  1SKR B;  1BAY A;  1WPI A;  1XWG A;  5CRW A;  4Q5N A;  1ZMA A;  2VCW A;  4ILF A;  3TJK A;  4O32 A;  4EO3 A;  3F3Q A;  5KN3 A;  1TRS A;  4WR5 A;  1M3I A;  3EE2 A;  2R6K A;  1BX9 A;  4O5R A;  2DMM A;  1LU4 A;  3EU3 A;  4BWQ A;  3GUS A;  3C7M A;  2QSI A;  2VM2 A;  1Z3E A;  2R37 A;  1GUK A;  2DML A;  3TJJ A;  3KCM A;  1F3A A;  1WRY A;  4HI7 A;  1EGR A;  3KMO A;  4K1F A;  2O8V B;  4EVM A;  3BCK A;  2JZR A;  3KTL A;  1TOF A;  1XW5 A;  5ECR B;  5EL8 A;  3KP9 A;  2L4C A;  1GSE A;  4BPY A;  4MCU A;  2RII A;  2E2G A;  2LUS A;  1ZGN A;  3KJY A;  4HU9 A;  3WT1 A;  3W6G A;  4CDO A;  4DSQ A;  3L9U A;  1K0D A;  1GTI A;  1TW9 A;  2BJX A;  4EL1 A;  3ZRE A;  19GS A;  2IFQ B;  1QMV A;  3I6A A;  5AGY A;  1UC7 A;  3TRP A;  2OBK A;  1BED A;  18GS A;  3UJ1 A;  3VWW A;  4FH8 A;  2RLI A;  3M9K A;  2IFQ A;  1WWJ A;  3SWL A;  4MDC A;  2CVB A;  1CQH A;  1T7P B;  1EEM A;  3GMF A;  3FYG A;  4IP6 A;  3CRT A;  1A8Y A;  3C1S A;  3FHK A;  5A4W A;  1M2D A;  2XPE A;  5ECL B;  2A4V A;  4OO5 A;  2YWN A;  1MDJ A;  1TRW A;  1ZYE A;  2B6M A;  4EUY A;  5J3R A;  1JLV A;  1Q98 A;  1F3B A;  3RPN A;  4FYU A;  1M9B A;  3DD3 A;  3ZML A;  4AF2 A;  4N30 A;  5JCW A;  2H0I A;  1RK4 A;  2L59 A;  3M8N A;  1YDK A;  1VGL A;  3H79 A;  1PMT A;  2YN1 A;  1BYE A;  5GST A;  1O8W A;  2PMT A;  1O81 A;  2PWJ A;  1TU8 A;  1O6J A;  4EKZ A;  1F6M C;  2H01 A;  16GS A;  2HRF A;  4LMW A;  4OCF A;  2LNT A;  1KTE A;  4IGJ A;  4HDE A;  4OMV A;  3TRX A;  2LQO A;  3JCM L;  4AJ6 A;  1TI1 A;  3R2Q A;  4G0K A;  2TRC P;  3D22 A;  5IQY A;  4X43 A;  3TJB A;  4OFN A;  2JZS A;  4KAE A;  2G2Q A;  2DJ0 A;  3GTU B;  4WR4 A;  2K8S A;  3ME7 A;  2DKH A;  1VF1 A;  2DJK A;  4OWY A;  2CA8 A;  2X8C A;  5F05 A;  3LW9 A;  5HR2 A;  1SKS B;  20GS A;  3LXT A;  2ALB A;  2C4J A;  3TRQ A;  2GSR A;  2F8A A;  2HLS A;  3MSZ A;  3GTU A;  2TIR A;  2O87 A;  3E9J B;  5HQP A;  3A2X A;  3TUE A;  2HI7 A;  3M9J A;  4V2L A;  2H0H A;  2CVD A;  2WJU A;  3IBH A;  4TXV A;  4IQ1 A;  4KW6 A;  3OR5 A;  1SYR A;  5C04 A;  5ABR A;  4E8H A;  1OC3 A;  3L4N A;  2E0Q A;  5ECO B;  2O89 A;  4PQ1 A;  1B4P A;  5JWR B;  4WBR D;  3RHC A;  2IMF A;  3UEM A;  2IN3 A;  4RI6 A;  5DAL B;  4K7N A;  5L71 A;  1H4O A;  3PIN A;  2H1A A;  2MYG A;  1G6Y A;  4POK A;  4YQM A;  3RAZ A;  2V41 A;  2JL4 A;  3Q74 A;  2MMZ A;  5DAL A;  5D9T A;  5FHI A;  1K3L A;  1QUW A;  3V1W A;  1THO A;  2R4V A;  5ECH B;  2AYT A;  4MF6 A;  5JWO B;  4L8E A;  4IQA A;  4X1U A;  3MAK A;  4MH3 A;  2DLX A;  2ON5 A;  1FVJ A;  2H72 A;  3CSI A;  3ME8 A;  4CY8 A;  5IOX A;  1EWX A;  4ZL7 A;  1B8X A;  1NM3 A;  4XIH A;  1BJX A;  1XZO A;  2CX3 A;  3WT2 A;  2IIY A;  2HNL A;  4XTS A;  3IPZ A;  1XXU A;  2P0G A;  2KHP A;  1SEN A;  2RM5 A;  2PVQ A;  3FR9 A;  2O85 A;  3A3T A;  2XBI A;  2H0G A;  1YQ1 A;  1FW1 A;  4KA0 A;  1KEB A;  5F06 A;  1T4Z A;  2MBS A;  2UZ8 A;  6GSY A;  3QMX A;  1DE2 A;  5DQY A;  2HRN A;  4MK3 A;  4GSN A;  3U6V A;  1GL8 A;  2I3Y A;  3GRX A;  4K5S A;  2GZP A;  1O7U A;  4JR4 A;  4MJA A;  3EVI A;  2P5R A;  4YQV A;  2YWI A;  2CVK A;  1A0R P;  4RI7 A;  4IVF A;  4PXO A;  3ERF A;  4NHZ A;  2YAN A;  3GIX A;  2CQ9 A;  5LD0 A;  4BVY B;  2FY6 A;  1FB0 A;  3GV1 A;  4AGS A;  2XBQ A;  4BVX B;  5G5E A;  4HQS A;  3PH9 A;  4IS0 A;  2KOK A;  1GWC A;  1WP0 A;  3GUR A;  4GTU A;  4BVY A;  3QAW A;  4NXI A;  4BVX A;  5HFG A;  2HT9 A;  2WRT A;  5FWG A;  1JHB A;  3RBT A;  1GSD A;  5DBQ A;  2IMK A;  3C8E A;  5HFK A;  5JCU A;  1H75 A;  2C8U A;  1J08 A;  2YJH A;  3HZ8 A;  3KIJ A;  14GS A;  2C0F A;  5IMZ A;  1ILO A;  1EP7 A;  4FYC A;  4WET A;  4V1A g;  3TCO A;  1SK2 A;  1F2E A;  5A4U A;  3VPQ A;  3TKS E;  3A2V A;  1EZK A;  3RDW A;  3P2A A;  4CY6 A;  2A2R A;  2R0G A;  5G5F A;  1OAZ A;  1U3A A;  5A4V A;  5DVB A;  1NHY A;  4GQC A;  2K8V A;  2H19 A;  3LYK A;  2R0C A;  1EEJ A;  1MTC A;  1XWC A;  1T1V A;  1YF0 A;  2RUF A;  1AW9 A;  4DEJ A;  4OFT A;  1JZR A;  3R3E A;  2MMN A;  4NHW A;  1TDI A;  3P7X A;  1KBN A;  1AAZ A;  4N10 A;  2ZCT A;  4HZ2 A;  1G6W A;  3HJO A;  2MMO A;  2E7P A;  2M72 A;  2JZT A;  10GS A;  2PGT A;  3CQF A;  3F4S A;  1TRV A;  4IP1 A;  2VL2 C;  2FA8 A;  1E6B A;  2M46 A;  1QQ2 A;  4ZBB A;  4Z2T A;  1JZO A;  4CHS A;  2ZNM A;  5BMU A;  1XWK A;  2WDU A;  4PUF C;  3LG6 A;  2GSQ A;  1AQV A;  2D2Z A;  4O5Q A;  1PKW A;  4TVE A;  1X5E A;  1W89 A;  4I2T A;  3EMX A;  3BOA A;  2H74 A;  1QK8 A;  3LGC A;  4WXT A;  4PUR A;  3UBL A;  3TJF A;  3ED3 A;  2YOI A;  2F51 A;  5IO2 A;  1UA5 A;  1G7E A;  2FWH A;  4TR0 A;  2AB6 A;  1N8J A;  4K7I A;  3QPM A;  2GQL A;  1OE7 A;  4GRF A;  1Z7P A;  2VL2 A;  3HVV A;  1TJD A;  3ZIT A;  3IK9 A;  3FKF A;  3N5O A;  5J4U A;  2J9H A;  4XRD A;  2PPT A;  2EC4 A;  1Z7R A;  2QGV A;  4I8B A;  4HOJ A;  4MPF A;  1TKD B;  4PNG A;  5AIX A;  1G0T A;  2VAF A;  3PR8 A;  1MEK A;  1R26 A;  4TR3 A;  4ML1 A;  1T00 A;  1XWA A;  3F4R A;  3J7Y k;  5HR0 A;  3TDG A;  2OKA A;  3ZFL A;  1J9B A;  2C3N A;  2MZC A;  2C0G A;  5J5N A;  1FO5 A;  2VL9 A;  4F0B A;  2R5G A;  2F9S A;  1O8X A;  1V57 A;  2KP2 A;  4JU5 A;  3UAR A;  3ZVJ A;  2E2M A;  4IBP A;  3GKN A;  3NZN A;  2OA7 A;  2VCQ A;  3MYD A;  1Y6E A;  3QDN A;  3IE3 A;  3S9F A;  3EU4 A;  4OD7 A;  5IMC A;  1OKD A;  1S3D A;  1PA3 A;  4ECB A;  2LJA A;  3BD2 A;  4DVC A;  5LNK e;  2V1M A;  3KGK A;  2FLS A;  4GWR A;  4V2M A;  4I6X A;  5KOX A;  5F8B A;  1TK8 B;  5IMD A;  6GSW A;  2B7J A;  2NVL A;  3ZFB A;  3EUR A;  3M1G A;  4FQU A;  4PTS A;  3FY7 A;  4GXZ A;  4AJ7 A;  3KH9 A;  3A2W A;  2WZ9 A;  1V58 A;  3GL3 A;  3ERW A;  2AV4 A;  1O73 A;  1PGT A;  4I97 A;  3ERG A;  4NPB A;  5ECI B;  1SJI A;  1YZX A;  4H86 A;  1EOH A;  5H5Q A;  2PU9 C;  1EV4 A;  2LEG A;  2CX4 A;  1M2A A;  2H76 A;  5HFI A;  3WD6 A;  3WYW A;  4BL7 B;  4K2X A;  2I9H A;  3LOR A;  4LL1 B;  2OE1 A;  2KP1 A;  4LL4 B;  1PL1 A;  5CRE A;  4G10 A;  3UOM A;  4YAP A;  4BL7 A;  1FAA A;  3LSZ A;  1PQN A;  4X4J A;  4JZQ A;  1V9W A;  3P90 A;  4QL7 A;  2NPB A;  3D6I A;  2NBS A;  2I81 A;  12GS A;  2DC5 A;  5CRG A;  4MP4 A;  2QKE A;  3HVN A;  3VWV A;  3HY2 A;  2VCX A;  5COH A;  11GS A;  1M0U A;  2C0E A;  2GLR A;  3D5J A;  3UVT A;  2H75 A;  1GLP A;  2IME A;  3APQ A;  5GZZ B;  2VD0 A;  4MZC A;  5IPG A;  2JAC A;  1EV9 A;  2B5X A;  4NWY A;  2M80 A;  3F0I A;  3G7Y A;  3GST A;  4KB3 A;  3H93 A;  4KSM A;  1TK5 B;  4TRX A;  2IPA A;  4GQF A;  4WEY A;  4EIP A;  2H6Z A;  2AJQ B;  1GSQ A;  2A2P A;  1PX7 A;  5EVO A;  3HHV A;  3VPT A;  5D8I A;  2EIR A;  4FYB A;  4QL9 A;  3VUR A;  1GSY A;  1R7H A;  3HKR A;  1A2J A;  2F3M A;  4KGI A;  5H5R A;  1GTU A;  3ZRD A;  1OKT A;  4MJE A;  2GZY A;  3QR6 A;  3QFA C;  2RUE A;  2DBC A;  4JE1 A;  1SJ6 A;  3TKR A;  4TR4 A;  2XHF A;  4HZ4 A;  1ERT A;  2R0P A;  1GUM A;  4USS A;  4EE0 A;  1GSU A;  2C0D A;  2X8G A;  5CRH A;  1Z6N A;  2FUG 2;  1WIK A;  1K0M A;  2LS5 A;  2LRN A;  2NDO A;  4IJI A;  1WJK A;  2V6O A;  4XS1 A;  3DYR A;  5HR3 A;  2PUK C;  3BCI A;  1SD8 A;  3CYN A;  1XOB A;  1SJZ A;  1M2B A;  1YF1 A;  3IRA A;  4RUV A;  3A5W A;  1ZZY A;  4ICY A;  1SL1 B;  3H1N A;  4N11 A;  1DSB A;  1AXD A;  1T8E B;  1ON4 A;  5KEJ A;  3F4T A;  1EGO A;  1TTZ A;  1YEX A;  1HNB A;  6GSU A;  2EIQ A;  1MD4 A;  5BRT A;  3FZ9 A;  1B48 A;  2PN8 A;  2ZUP A;  4ACS A;  5CYY A;  4ISD A;  1DUG A;  1SL2 B;  3ZLP A;  3ZMK A;  2JSZ A;  3D4M A;  1GP1 A;  3VWX A;  4HJM A;  4YQU A;  2GTU A;  4EF0 A;  4HS1 A;  1YJ6 A;  2OE3 A;  1ZCP A;  3QCP A;  9GSS A;  1OYJ A;  4LA1 A;  1CQG A;  2DIY A;  3APO A;  3DML A;  4HQZ A;  3L0H A;  4Z2R A;  2H73 A;  5ECM B;  1HYU A;  2MBT A;  4ECJ A;  4E8E A;  5IPH A;  1GNE A;  4GCI A;  3F3R A;  3PGT A;  2GZZ A;  1Z5Y E;  4O7H A;  1WMJ A;  2YWM A;  1GTA A;  5CRD A;  2GSS A;  3CXG A;  4LLR A;  1JFU A;  5E4W A;  4F03 A;  2IJY A;  4K0N A;  3VI5 A;  4I5Q A;  4GST A;  5DCH A;  3CBU A;  2HSM A;  1GNW A;  1YY7 A;  3GNJ A;  1QXH A;  1ML6 A;  2REM A;  2OBI A;  1UN2 A;  1N2A A;  1USB A;  4D73 B;  2H30 A;  1ZYP A;  2OAC A;  1UVZ A;  2BTO T;  4K0G A;  1T4Y A;  3FRC A;  5B7C A;  2KLX A;  2DJ2 A;  1A2L A;  2B1K A;  2H8L A;  1V40 A;  4D73 A;  3MIX A;  4ID0 A;  1O85 A;  3FZ4 A;  2WFC A;  4ZIL A;  3IDV A;  3L78 A;  3IC4 A;  2DKI A;  2VOC A;  5KN1 A;  6GST A;  1GSS A;  3CMI A;  1JZD A;  4FIW A;  3IXR A;  3D21 A;  4OCE A;  5IOW A;  1TXX A;  2IMI A;  1ZOF A;  1K0N A;  3DVW A;  3IHG A;  4F9Z A;  3IC8 A;  2GVP A;  2HE3 A;  4KH7 A;  3MNG A;  4RQR A;  4DSS B;  2VLU A;  3WGD A;  3J7Y b;  4KCA A;  1GLQ A;  3BJ5 A;  3W8S A;  5D9X A;  2H71 A;  1ZYN A;  1VRS D;  2L6D A;  2DSA A;  3IAS 2;  1U88 A;  3SBC A;  4XCS A;  2WCI A;  4DSS A;  5IMA A;  4L5O A;  5IO0 A;  3GSS A;  5B6M A;  1A0F A;  4BA7 A;  1K3Y A;  3L9V A;  4G19 A;  2LNS A;  2K18 A;  4ML6 A;  3LQ7 A;  3VWU A;  3HJP A;  1K0B A;  3LWA A;  3HXS A;  1EOG A;  5G1K A;  2ES7 A;  1ST9 A;  5E59 A;  1W4V A;  2FNO A;  4Z2U A;  5FT3 A;  2OAD A;  2QA1 A;  1FOV A;  2DJ3 A;  3M0F A;  3CRU A;  4ULX A;  2YP6 A;  4YKG A;  3H8Q A;  5B8B A;  2HZE B;  4JR6 A;  4BIK A;  3KH7 A;  5LCZ A;  5ECN B;  1XVQ A;  3ZIV A;  4G9H A;  3IHQ A;  2C3T A;  4HJ2 A;  1I5G A;  3LEF A;  2GT5 A;  5INY A;  2H66 A;  3LYP A;  22GS A;  1Y25 A;  2HZE A;  1AQX A;  2Z9S A;  4TXO B;  2CV4 A;  2WB9 A;  4ZIJ A;  1HNC A;  2V2G A;  4Q5F A;  3EYT A;  4MJB A;  1OVN A;  5CO3 A;  2PVO C;  4TXO A;  4MZW A;  1S3R A;  5IM9 A;  2R3X A;  4G0I A;  1VF3 A;  1SD9 A;  4MZB A;  1ERV A;  3KZQ A;  3UBK A;  4NV2 A;  2P5Q A;  1X0R A;  2C1Y A;  3F8U A;  4JBB A;  2LJK A;  3FZA A;  5AN1 A;  4XS6 A;  4POB A;  4HSC X;  1TRU A;  6GSV A;  3DEX A;  2P31 A;  1X9S B;  4TN8 A;  3VFI A;  3O3T A;  3G7J A;  3TKQ A;  3ZL5 A;  5GAP D;  17GS A;  4DSR A;  2A2S A;  4IKH A;  5IIZ A;  5DQS A;  5CNW A;  3HA9 A;  3RHB A;  1X9M B;  4AJ8 A;  4KDX A;  4KUN A;  5D9W A;  4POM A;  1Q4J A;  1HNA A;  2HXK A;  1JLW A;  2EIO A;  1PD2 1;  2VCV A;  1FG4 A;  4JED A;  1T3B A;  4MLY A;  1MDI A;  2LV3 A;  2N5B A;  2DJJ A;  2YCD A;  3DKS A;  5J9B A;  5ELA A;  1BG5 A;  2HYX A;  1A23 A;  5DJM A;  2H6Y A;  3GX8 A;  1B9X C;  2DIZ A;  2AUV A;  1LBK A;  3P8W A;  3N9J A;  1AQW A;  3HZ4 A;  5G31 A;  3F9U A;  4YAV A;  1XBS A;  6GSS A;  3LJR A;  1OC9 B;  2HFD A;  2G0F A;  4TW5 A;  2WUL A;  5AIS A;  5ECP B;  3F63 A;  3HDC A;  1YKA A;  1BQ7 A;  4L0U A;  3IK7 A;  3KEB A;  1PL2 A;  1FHE A;  1OC9 A;  5H5S A;  4EDY A;  2WGR A;  3GX0 A;  4ZXG A;  1TP9 A;  5DCG A;  4EDZ A;  4K9Z A;  3DRN A;  5J9C A;  5EY6 A;  1LJR A;  5F07 A;  3Q18 A;  3L9S A;  1X9W B;  5G30 A;  3CTG A;  3EPT A;  3MWH A;  4K8M A;  3HJM A;  4P3Y B;  3APS A;  4IHU A;  3HYP A;  3EC3 A;  1SK1 A;  2VIM A;  1XWB A;  3G7I A;  3RPP A;  1AC1 A;  2HRA A;  4RQX A;  4V2N A;  1VF2 A;  5DDL A;  3GFK A;  3FR6 A;  1GSF A;  2A4H A;  3QD9 A;  4K5R A;  1GUH A;  8GSS A;  4WF5 A;  1X5C A;  1PX6 A;  4J57 E;  2DJ1 A;  5AIV A;  2GQM A;  4EC0 A;  1ERU A;  3GYK A;  2I4A A;  1ACV A;  3W8J A;  4GSS A;  3TKS C;  4O92 A;  1F37 A;  4ZB6 A;  4JRR A;  4WBJ A;  4J56 E;  4ECI A;  1AIU A;  3WGE A;  1URM A;  4HEA 2;  2L5O A;  3Q19 A;  1S3A A;  1OC8 A;  2X8H A;  2X4A A;  4TR1 B;  3IR4 A;  2C3Q A;  3FZ5 A;  3BBY A;  1GRX A;  3UAP A;  4IEL A;  1M7T A;  4MJC A;  3ZZX A;  2VD1 A;  5JCG A;  3IAM 2;  1FOH A;  4V1A p;  1AUC A;  4OFM A;  1SKW B;  2FGX A;  1B4Q A;  1WOU A;  4TR1 A;  1IYH A;  3KP8 A;  1RW1 A;  1V2A A;  4IW9 A;  1EP8 A;  2JU5 A;  3GKX A;  4YH2 A;  2V32 A;  3KM6 A;  4K2D A;  5KOW A;  5D73 A;  2CAI A;  3MDK A;  1F9M A;  3CTF A;  4PQH A;  4PNF A;  3HD5 A;  3TKS A;  4MMM A;  3E0U A;  3IV4 A;  3D4T A;  2IL3 A;  2B5Y A;  2GT6 A;  4POL A;  1QGV A;  4G2E A;  1J0F A;  2L5L A;  1K0A A;  1Z6M A;  1MDK A;  1XFL A;  3AY8 A;  2GQK A;  4MH2 A;  2FCH A;  2TRX A;  3E3E A;  3U5R E;  4ZB9 A;  4F0C A;  4MAB A;  5ID2 B;  3UVH A;  2OJL A;  1PN9 A;  4IN0 A;  3UIW A;  4I2U A;  1PFO A;  2VL3 A;  4KND A;  1OE8 A;  2YJ7 A;  1A24 A;  3I9V 2;  2CT6 A;  2PER A;  2RM6 A;  4FO5 A;  2L6C A;  5ID2 A;  4Z7X A;  1ZYQ B;  1K0O A;  4F2I A;  5ECS A;  2LRC A;  3FMW A;  3FW2 A;  2XPD A;  1A8L A;  2YV9 A;  3HVX A;  4L5L A;  2X64 A;  2LTK A;  1Z9H A;  3ZVJ D;  2HRK A;  2MMA A;  3I43 A;  4MA9 A;  4QQ7 A;  3US3 A;  2VCT A;  1PN0 A;  1U6T A;  1K0C A;  2FWF A;  5D96 A;  2H70 A;  1U3I A;  2VO4 A;  3C1R A;  3GA4 A;  3QAG A;  1X5D A;  1NSW A;  2X49 A;  13GS A;  4K7O A;  4X0X A;  3TKP A;  2HSH A;  1PKZ A;  3M3M A;  5J41 A;  5D9V A;  3VK9 A;  1M3J A;  1QFN A;  1SL0 B;  1FVK A;  3GH6 A;  5ECQ B;  3LFL A;  1PSQ A;  1XPV A;  5F0G A;  5GAN D;  2OE0 A;  2WS2 A;  2ON7 A;  1S3C A;  3EIN A;  3O76 A;  3VI7 A;  3IOS A;  2FD3 A;  4KDY A;  3QAV A;  4LMV A;  5G2Z A;  5KN2 A;  3KMN A;  3DXB A;  1KNG A;  1XCC A;  2XC2 A;  5CP1 A;  5ECK B;  2NTO A;  1XVW A;  2FHE A;  3D0Z A;  2YZH A;  4KE3 A;  3FK8 A;  2VUP A;  4K6X A;  2B5E A;  2QC7 A;  2AHE A;  1XIY A;  1DE1 A;  2H6X A;  3GKK A;  2H1D A;  1TU7 A;  4WKW A;  3TOU A;  3K8N A;  1R5P A;  1XW9 A;  4ZL8 A;  4L0W A;  3H4K A;  4MF5 A;  3NOF A;  6GSX A;  1NHO A;  3C73 A;  3FR3 A;  3GN3 A;  1PRX A;  1B9Y C;  4MNN A;  4G0L A;  1DBY A;  4NV5 A;  2PBJ A;  5G1L A;  4KSO A;  2LQQ A;  2CZ3 A;  1WE0 A;  2FWE A;  3KTB A;  5KN0 A;  2F8F A;  3DVX A;  2VCZ A;  1NW2 A;  5D93 A;  1HQO A;  4CW9 A;  4NAX A;  1RQM A;  1SK0 A;  4XRA A;  2QA2 A;  4BWS A;  5A5K A;  1M99 A;  1G7O A;  2K9F A;  3A5I A;  4HUA A;  2JSY A;  4PUA A;  3F6D A;  2CAQ A;  2GDR A;  3TOT A;  2IWT A;  2IMD A;  2V6K A;  1GTB A;  4TKY A;  3NIV A;  2B3S A;  3WGX A;  2B7K A;  2H1G A;  3HCZ A;  2VLV A;  1R5A A;  3G9B A;  4GLT A;  3TGZ A;  3I69 A;  4HU7 A;  2HZF A;  3FEU A;  3F6F A;  2JAD A;  4ZBD A;  7GSS A;  5ENU A;  3TB2 A;  1VF4 A;  4WF4 A; 
#chains in the Genus database with same CATH homology
 2VM1 A;  2R2J A;  4PQI A;  4KCE A;  4NMU A;  5B8A A;  2I1U A;  2FWG A;  2LKU A;  4MF7 A;  3EWL A;  3Q6O A;  5JWQ B;  1GUL A;  4Q5R A;  2K6V A;  3PPU A;  5EPF A;  2C80 A;  2O7K A;  1ABA A;  3DWV A;  1E2Y A;  5CAX A;  2VLT A;  4F82 A;  1ZL9 A;  5ELG A;  3QOU A;  1R4W A;  4OO4 A;  3LXZ A;  2N5A A;  1GH2 A;  1SYX A;  4ECC A;  2H1B A;  3CSH A;  1YKC A;  4ZB8 A;  1XOA A;  2GS3 A;  5HR1 A;  4EIQ A;  1FB6 A;  2X99 A;  2YNX A;  5DJL A;  4KF9 A;  4TOP A;  3IA1 A;  1V98 A;  3DIE A;  5IMF A;  2BMX A;  4O5U A;  5IMV A;  2GST A;  3GH9 A;  4XS4 B;  3TJG A;  1YEP A;  2L57 A;  1U87 A;  2FA4 A;  1C72 A;  4MPG A;  3C71 A;  2YZU A;  1A2M A;  2YWO A;  3HVS A;  2HSY A;  1THX A;  1XW6 A;  2L4Q A;  4ZL9 A;  4XHM A;  4XS4 A;  3VLN A;  1M9A A;  2CZ2 A;  3UMA A;  3ISO A;  5DAK B;  1IYI A;  2LRT A;  5B6N A;  3QFB C;  4GF0 A;  4EXJ A;  5GSS A;  4KX4 A;  3DGQ A;  4A5P A;  1ERW A;  3EMP A;  1TI3 A;  5DAK A;  1K3O A;  2KUC A;  3UL3 A;  3ZYW A;  4PGT A;  2N5F A;  3ZIJ A;  3O6T A;  2LST A;  2J23 A;  4IJ3 A;  2AAW A;  2LJR A;  3CSJ A;  1JZW A;  3GKM A;  4J2F A;  2GGT A;  1I9D A;  4PX1 A;  3GHA A;  4Q5Q A;  3KXO A;  4KDU A;  4N0Z A;  2YV7 A;  4YKF A;  3KD0 A;  2B1L A;  2YPM A;  1SU9 A;  1MD3 A;  4N0V A;  1TK0 B;  1HD2 A;  3ZTL A;  5C00 A;  3GL5 A;  4ZBA A;  1SKR B;  1BAY A;  1WPI A;  1XWG A;  5CRW A;  4Q5N A;  1ZMA A;  2VCW A;  4ILF A;  3TJK A;  4O32 A;  4EO3 A;  3F3Q A;  5KN3 A;  1TRS A;  4WR5 A;  3EE2 A;  2R6K A;  1BX9 A;  4O5R A;  2DMM A;  1LU4 A;  3EU3 A;  4BWQ A;  3GUS A;  3C7M A;  2QSI A;  2VM2 A;  1Z3E A;  2R37 A;  1GUK A;  2DML A;  3TJJ A;  3KCM A;  1F3A A;  1WRY A;  4HI7 A;  1EGR A;  3KMO A;  4K1F A;  2O8V B;  4EVM A;  3BCK A;  2JZR A;  3KTL A;  1TOF A;  1XW5 A;  5ECR B;  5EL8 A;  3KP9 A;  2L4C A;  1GSE A;  4BPY A;  4MCU A;  2RII A;  2E2G A;  2LUS A;  1ZGN A;  3KJY A;  4HU9 A;  3WT1 A;  3W6G A;  4CDO A;  4DSQ A;  3L9U A;  1K0D A;  1GTI A;  1TW9 A;  2BJX A;  4EL1 A;  3ZRE A;  19GS A;  2IFQ B;  1QMV A;  3I6A A;  5AGY A;  1UC7 A;  3TRP A;  2OBK A;  1BED A;  18GS A;  3UJ1 A;  3VWW A;  4FH8 A;  2RLI A;  3M9K A;  2IFQ A;  1WWJ A;  3SWL A;  4MDC A;  2CVB A;  1CQH A;  1T7P B;  1EEM A;  3GMF A;  3FYG A;  4IP6 A;  3CRT A;  1A8Y A;  3C1S A;  3FHK A;  5A4W A;  1M2D A;  2XPE A;  5ECL B;  2A4V A;  4OO5 A;  2YWN A;  1MDJ A;  1TRW A;  1ZYE A;  2B6M A;  4EUY A;  5J3R A;  1JLV A;  1Q98 A;  1F3B A;  3RPN A;  4FYU A;  1M9B A;  3DD3 A;  3ZML A;  4AF2 A;  4N30 A;  5JCW A;  2H0I A;  1RK4 A;  2L59 A;  3M8N A;  1YDK A;  1VGL A;  3H79 A;  1PMT A;  2YN1 A;  1BYE A;  5GST A;  1O8W A;  2PMT A;  1O81 A;  2PWJ A;  1TU8 A;  1O6J A;  4EKZ A;  1F6M C;  2H01 A;  16GS A;  2HRF A;  4LMW A;  4OCF A;  2LNT A;  1KTE A;  4IGJ A;  4HDE A;  4OMV A;  3TRX A;  2LQO A;  3JCM L;  4AJ6 A;  1TI1 A;  3R2Q A;  4G0K A;  2TRC P;  3D22 A;  5IQY A;  4X43 A;  3TJB A;  4OFN A;  2JZS A;  4KAE A;  2G2Q A;  2DJ0 A;  3GTU B;  4WR4 A;  2K8S A;  3ME7 A;  2DKH A;  1VF1 A;  2DJK A;  4OWY A;  2CA8 A;  2X8C A;  5F05 A;  3LW9 A;  5HR2 A;  1SKS B;  20GS A;  3LXT A;  2ALB A;  2C4J A;  3TRQ A;  2GSR A;  2F8A A;  2HLS A;  3MSZ A;  3GTU A;  2TIR A;  2O87 A;  3E9J B;  5HQP A;  3A2X A;  3TUE A;  2HI7 A;  3M9J A;  4V2L A;  2H0H A;  2CVD A;  2WJU A;  3IBH A;  4TXV A;  4IQ1 A;  4KW6 A;  3OR5 A;  1SYR A;  5C04 A;  5ABR A;  4E8H A;  1OC3 A;  3L4N A;  2E0Q A;  5ECO B;  2O89 A;  4PQ1 A;  1B4P A;  5JWR B;  4WBR D;  3RHC A;  2IMF A;  3UEM A;  2IN3 A;  4RI6 A;  5DAL B;  4K7N A;  5L71 A;  1H4O A;  3PIN A;  2H1A A;  2MYG A;  1G6Y A;  4POK A;  4YQM A;  3RAZ A;  2V41 A;  2JL4 A;  3Q74 A;  2MMZ A;  5DAL A;  5D9T A;  5FHI A;  1K3L A;  1QUW A;  3V1W A;  1THO A;  2R4V A;  5ECH B;  2AYT A;  4MF6 A;  5JWO B;  4L8E A;  4IQA A;  4X1U A;  3MAK A;  4MH3 A;  2DLX A;  2ON5 A;  1FVJ A;  2H72 A;  3CSI A;  3ME8 A;  4CY8 A;  5IOX A;  1EWX A;  4ZL7 A;  1B8X A;  1NM3 A;  4XIH A;  1BJX A;  1XZO A;  2CX3 A;  3WT2 A;  2IIY A;  2HNL A;  4XTS A;  3IPZ A;  1XXU A;  2P0G A;  2KHP A;  1SEN A;  2RM5 A;  2PVQ A;  3FR9 A;  2O85 A;  3A3T A;  2XBI A;  2H0G A;  1YQ1 A;  1FW1 A;  4KA0 A;  1KEB A;  5F06 A;  1T4Z A;  2MBS A;  2UZ8 A;  6GSY A;  3QMX A;  1DE2 A;  5DQY A;  2HRN A;  4MK3 A;  4GSN A;  3U6V A;  1GL8 A;  2I3Y A;  3GRX A;  4K5S A;  2GZP A;  1O7U A;  4JR4 A;  4MJA A;  3EVI A;  2P5R A;  4YQV A;  2YWI A;  2CVK A;  1A0R P;  4RI7 A;  4IVF A;  4PXO A;  3ERF A;  4NHZ A;  2YAN A;  3GIX A;  2CQ9 A;  5LD0 A;  4BVY B;  2FY6 A;  1FB0 A;  3GV1 A;  4AGS A;  2XBQ A;  4BVX B;  5G5E A;  4HQS A;  3PH9 A;  4IS0 A;  2KOK A;  1GWC A;  1WP0 A;  3GUR A;  4GTU A;  4BVY A;  3QAW A;  4NXI A;  4BVX A;  5HFG A;  2HT9 A;  2WRT A;  5FWG A;  1JHB A;  3RBT A;  1GSD A;  5DBQ A;  2IMK A;  3C8E A;  5HFK A;  5JCU A;  1H75 A;  2C8U A;  1J08 A;  2YJH A;  3HZ8 A;  3KIJ A;  14GS A;  2C0F A;  5IMZ A;  1ILO A;  1EP7 A;  4FYC A;  4WET A;  4V1A g;  3TCO A;  1SK2 A;  1F2E A;  5A4U A;  3VPQ A;  3TKS E;  3A2V A;  1EZK A;  3RDW A;  3P2A A;  4CY6 A;  2A2R A;  2R0G A;  5G5F A;  1OAZ A;  1U3A A;  5A4V A;  5DVB A;  1NHY A;  4GQC A;  2K8V A;  2H19 A;  3LYK A;  2R0C A;  1EEJ A;  1MTC A;  1XWC A;  1T1V A;  1YF0 A;  2RUF A;  1AW9 A;  4DEJ A;  4OFT A;  1JZR A;  3R3E A;  2MMN A;  4NHW A;  1TDI A;  3P7X A;  1KBN A;  1AAZ A;  4N10 A;  2ZCT A;  4HZ2 A;  1G6W A;  3HJO A;  2MMO A;  2E7P A;  2M72 A;  2JZT A;  10GS A;  2PGT A;  3F4S A;  1TRV A;  4IP1 A;  2VL2 C;  2FA8 A;  1E6B A;  2M46 A;  1QQ2 A;  4ZBB A;  4Z2T A;  1JZO A;  4CHS A;  2ZNM A;  5BMU A;  1XWK A;  2WDU A;  4PUF C;  3LG6 A;  2GSQ A;  1AQV A;  2D2Z A;  4O5Q A;  1PKW A;  4TVE A;  1X5E A;  1W89 A;  4I2T A;  3EMX A;  3BOA A;  2H74 A;  1QK8 A;  3LGC A;  4WXT A;  4PUR A;  3UBL A;  3TJF A;  3ED3 A;  2YOI A;  2F51 A;  5IO2 A;  1UA5 A;  1G7E A;  2FWH A;  4TR0 A;  2AB6 A;  1N8J A;  4K7I A;  3QPM A;  2GQL A;  1OE7 A;  4GRF A;  1Z7P A;  2VL2 A;  3HVV A;  1TJD A;  3ZIT A;  3IK9 A;  3FKF A;  3N5O A;  5J4U A;  2J9H A;  4XRD A;  2PPT A;  2EC4 A;  1Z7R A;  2QGV A;  4I8B A;  4HOJ A;  4MPF A;  1TKD B;  4PNG A;  5AIX A;  1G0T A;  2VAF A;  3PR8 A;  1MEK A;  1R26 A;  4TR3 A;  4ML1 A;  1T00 A;  1XWA A;  3F4R A;  3J7Y k;  5HR0 A;  3TDG A;  2OKA A;  3ZFL A;  1J9B A;  2C3N A;  2MZC A;  2C0G A;  5J5N A;  1FO5 A;  2VL9 A;  4F0B A;  2R5G A;  2F9S A;  1O8X A;  1V57 A;  2KP2 A;  4JU5 A;  3UAR A;  3ZVJ A;  2E2M A;  4IBP A;  3GKN A;  3NZN A;  2OA7 A;  2VCQ A;  3MYD A;  1Y6E A;  3QDN A;  3IE3 A;  3S9F A;  3EU4 A;  4OD7 A;  5IMC A;  1OKD A;  1S3D A;  1PA3 A;  4ECB A;  2LJA A;  3BD2 A;  4DVC A;  5LNK e;  2V1M A;  3KGK A;  2FLS A;  4GWR A;  4V2M A;  4I6X A;  5KOX A;  5F8B A;  1TK8 B;  5IMD A;  6GSW A;  2B7J A;  2NVL A;  3ZFB A;  3EUR A;  3M1G A;  4FQU A;  4PTS A;  3FY7 A;  4GXZ A;  4AJ7 A;  3KH9 A;  3A2W A;  2WZ9 A;  1V58 A;  3GL3 A;  3ERW A;  2AV4 A;  1O73 A;  1PGT A;  4I97 A;  3ERG A;  4NPB A;  5ECI B;  1SJI A;  1YZX A;  4H86 A;  1EOH A;  5H5Q A;  2PU9 C;  1EV4 A;  2LEG A;  2CX4 A;  1M2A A;  2H76 A;  5HFI A;  3WD6 A;  3WYW A;  4BL7 B;  4K2X A;  2I9H A;  3LOR A;  4LL1 B;  2OE1 A;  2KP1 A;  4LL4 B;  1PL1 A;  5CRE A;  4G10 A;  3UOM A;  4YAP A;  4BL7 A;  1FAA A;  3LSZ A;  1PQN A;  4X4J A;  4JZQ A;  1V9W A;  3P90 A;  4QL7 A;  2NPB A;  3D6I A;  2NBS A;  2I81 A;  12GS A;  2DC5 A;  5CRG A;  4MP4 A;  2QKE A;  3VWV A;  3HY2 A;  2VCX A;  5COH A;  11GS A;  1M0U A;  2C0E A;  2GLR A;  3D5J A;  3UVT A;  2H75 A;  1GLP A;  2IME A;  3APQ A;  5GZZ B;  2VD0 A;  4MZC A;  5IPG A;  2JAC A;  1EV9 A;  2B5X A;  4NWY A;  2M80 A;  3F0I A;  3G7Y A;  3GST A;  4KB3 A;  3H93 A;  4KSM A;  1TK5 B;  4TRX A;  2IPA A;  4GQF A;  4WEY A;  4EIP A;  2H6Z A;  2AJQ B;  1GSQ A;  2A2P A;  1PX7 A;  5EVO A;  3HHV A;  3VPT A;  5D8I A;  2EIR A;  4FYB A;  4QL9 A;  3VUR A;  1GSY A;  1R7H A;  3HKR A;  1A2J A;  2F3M A;  4KGI A;  5H5R A;  1GTU A;  3ZRD A;  1OKT A;  4MJE A;  2GZY A;  3QR6 A;  3QFA C;  2RUE A;  2DBC A;  4JE1 A;  1SJ6 A;  3TKR A;  4TR4 A;  2XHF A;  4HZ4 A;  1ERT A;  2R0P A;  1GUM A;  4USS A;  4EE0 A;  1GSU A;  2C0D A;  2X8G A;  5CRH A;  1Z6N A;  2FUG 2;  1WIK A;  1K0M A;  2LS5 A;  2LRN A;  2NDO A;  4IJI A;  1WJK A;  2V6O A;  4XS1 A;  3DYR A;  5HR3 A;  2PUK C;  3BCI A;  1SD8 A;  3CYN A;  1XOB A;  1SJZ A;  1M2B A;  1YF1 A;  3IRA A;  4RUV A;  3A5W A;  1ZZY A;  4ICY A;  1SL1 B;  3H1N A;  4N11 A;  1DSB A;  1AXD A;  1T8E B;  1ON4 A;  5KEJ A;  3F4T A;  1EGO A;  1TTZ A;  1YEX A;  1HNB A;  6GSU A;  2EIQ A;  1MD4 A;  5BRT A;  3FZ9 A;  1B48 A;  2PN8 A;  2ZUP A;  4ACS A;  5CYY A;  4ISD A;  1DUG A;  1SL2 B;  3ZLP A;  3ZMK A;  2JSZ A;  3D4M A;  1GP1 A;  3VWX A;  4HJM A;  4YQU A;  2GTU A;  4EF0 A;  4HS1 A;  1YJ6 A;  2OE3 A;  1ZCP A;  3QCP A;  9GSS A;  1OYJ A;  4LA1 A;  1CQG A;  2DIY A;  3APO A;  3DML A;  4HQZ A;  3L0H A;  4Z2R A;  2H73 A;  5ECM B;  1HYU A;  2MBT A;  4ECJ A;  4E8E A;  5IPH A;  1GNE A;  4GCI A;  3F3R A;  3PGT A;  2GZZ A;  1Z5Y E;  4O7H A;  1WMJ A;  2YWM A;  1GTA A;  5CRD A;  2GSS A;  3CXG A;  4LLR A;  1JFU A;  5E4W A;  4F03 A;  2IJY A;  4K0N A;  3VI5 A;  4I5Q A;  4GST A;  5DCH A;  3CBU A;  2HSM A;  1GNW A;  1YY7 A;  3GNJ A;  1QXH A;  1ML6 A;  2REM A;  2OBI A;  1UN2 A;  1N2A A;  1USB A;  4D73 B;  2H30 A;  1ZYP A;  2OAC A;  1UVZ A;  2BTO T;  4K0G A;  1T4Y A;  3FRC A;  5B7C A;  2KLX A;  2DJ2 A;  1A2L A;  2B1K A;  2H8L A;  1V40 A;  4D73 A;  3MIX A;  4ID0 A;  1O85 A;  3FZ4 A;  2WFC A;  4ZIL A;  3IDV A;  3L78 A;  3IC4 A;  2DKI A;  2VOC A;  5KN1 A;  6GST A;  1GSS A;  3CMI A;  1JZD A;  4FIW A;  3IXR A;  3D21 A;  4OCE A;  5IOW A;  1TXX A;  2IMI A;  1ZOF A;  1K0N A;  3DVW A;  3IHG A;  4F9Z A;  3IC8 A;  2GVP A;  2HE3 A;  4KH7 A;  3MNG A;  4RQR A;  4DSS B;  2VLU A;  3WGD A;  3J7Y b;  4KCA A;  1GLQ A;  3BJ5 A;  3W8S A;  5D9X A;  2H71 A;  1ZYN A;  1VRS D;  2L6D A;  2DSA A;  3IAS 2;  1U88 A;  3SBC A;  4XCS A;  2WCI A;  4DSS A;  5IMA A;  4L5O A;  5IO0 A;  3GSS A;  5B6M A;  1A0F A;  4BA7 A;  1K3Y A;  3L9V A;  4G19 A;  2LNS A;  2K18 A;  4ML6 A;  3LQ7 A;  3VWU A;  3HJP A;  1K0B A;  3LWA A;  3HXS A;  1EOG A;  5G1K A;  2ES7 A;  1ST9 A;  5E59 A;  1W4V A;  2FNO A;  4Z2U A;  5FT3 A;  2OAD A;  2QA1 A;  1FOV A;  2DJ3 A;  3M0F A;  3CRU A;  4ULX A;  2YP6 A;  4YKG A;  3H8Q A;  5B8B A;  2HZE B;  4JR6 A;  3KH7 A;  5LCZ A;  5ECN B;  1XVQ A;  3ZIV A;  4G9H A;  3IHQ A;  2C3T A;  4HJ2 A;  1I5G A;  3LEF A;  2GT5 A;  5INY A;  2H66 A;  3LYP A;  22GS A;  1Y25 A;  2HZE A;  1AQX A;  2Z9S A;  4TXO B;  2CV4 A;  2WB9 A;  4ZIJ A;  1HNC A;  2V2G A;  4Q5F A;  3EYT A;  4MJB A;  1OVN A;  5CO3 A;  2PVO C;  4TXO A;  4MZW A;  5IM9 A;  2R3X A;  4G0I A;  1VF3 A;  1SD9 A;  4MZB A;  1ERV A;  3KZQ A;  3UBK A;  4NV2 A;  2P5Q A;  1X0R A;  2C1Y A;  3F8U A;  4JBB A;  2LJK A;  3FZA A;  5AN1 A;  4XS6 A;  4POB A;  1TRU A;  6GSV A;  3DEX A;  2P31 A;  1X9S B;  4TN8 A;  3VFI A;  3O3T A;  3G7J A;  3TKQ A;  3ZL5 A;  5GAP D;  17GS A;  4DSR A;  2A2S A;  4IKH A;  5IIZ A;  5DQS A;  5CNW A;  3HA9 A;  3RHB A;  1X9M B;  4AJ8 A;  4KDX A;  4KUN A;  5D9W A;  4POM A;  1Q4J A;  1HNA A;  2HXK A;  1JLW A;  2EIO A;  1PD2 1;  2VCV A;  1FG4 A;  4JED A;  1T3B A;  4MLY A;  1MDI A;  2LV3 A;  2N5B A;  2DJJ A;  2YCD A;  3DKS A;  5J9B A;  5ELA A;  1BG5 A;  2HYX A;  1A23 A;  5DJM A;  2H6Y A;  3GX8 A;  1B9X C;  2DIZ A;  2AUV A;  1LBK A;  3P8W A;  3N9J A;  1AQW A;  3HZ4 A;  5G31 A;  3F9U A;  4YAV A;  1XBS A;  6GSS A;  3LJR A;  1OC9 B;  2HFD A;  2G0F A;  4TW5 A;  2WUL A;  5AIS A;  5ECP B;  3F63 A;  3HDC A;  1YKA A;  1BQ7 A;  4L0U A;  3IK7 A;  3KEB A;  1PL2 A;  1FHE A;  1OC9 A;  5H5S A;  4EDY A;  2WGR A;  3GX0 A;  4ZXG A;  1TP9 A;  5DCG A;  4EDZ A;  4K9Z A;  3DRN A;  5J9C A;  5EY6 A;  1LJR A;  5F07 A;  3Q18 A;  3L9S A;  1X9W B;  5G30 A;  3CTG A;  3EPT A;  3MWH A;  4K8M A;  3HJM A;  4P3Y B;  3APS A;  4IHU A;  3HYP A;  3EC3 A;  1SK1 A;  2VIM A;  1XWB A;  3G7I A;  3RPP A;  1AC1 A;  2HRA A;  4RQX A;  4V2N A;  1VF2 A;  5DDL A;  3GFK A;  3FR6 A;  1GSF A;  2A4H A;  3QD9 A;  4K5R A;  1GUH A;  8GSS A;  4WF5 A;  1X5C A;  1PX6 A;  4J57 E;  2DJ1 A;  5AIV A;  2GQM A;  4EC0 A;  1ERU A;  3GYK A;  2I4A A;  1ACV A;  3W8J A;  4GSS A;  3TKS C;  4O92 A;  1F37 A;  4ZB6 A;  4JRR A;  4WBJ A;  4J56 E;  4ECI A;  1AIU A;  3WGE A;  1URM A;  4HEA 2;  2L5O A;  3Q19 A;  1S3A A;  1OC8 A;  2X8H A;  2X4A A;  4TR1 B;  3IR4 A;  2C3Q A;  3FZ5 A;  3BBY A;  1GRX A;  3UAP A;  4IEL A;  1M7T A;  4MJC A;  3ZZX A;  2VD1 A;  5JCG A;  3IAM 2;  1FOH A;  4V1A p;  1AUC A;  4OFM A;  1SKW B;  2FGX A;  1B4Q A;  1WOU A;  4TR1 A;  1IYH A;  3KP8 A;  1RW1 A;  1V2A A;  4IW9 A;  1EP8 A;  2JU5 A;  3GKX A;  4YH2 A;  2V32 A;  3KM6 A;  4K2D A;  5KOW A;  5D73 A;  2CAI A;  3MDK A;  1F9M A;  3CTF A;  4PQH A;  4PNF A;  3HD5 A;  3TKS A;  4MMM A;  3E0U A;  3IV4 A;  3D4T A;  2IL3 A;  2B5Y A;  2GT6 A;  4POL A;  1QGV A;  4G2E A;  1J0F A;  2L5L A;  1K0A A;  1Z6M A;  1MDK A;  1XFL A;  3AY8 A;  2GQK A;  4MH2 A;  2FCH A;  2TRX A;  3E3E A;  3U5R E;  4ZB9 A;  4F0C A;  4MAB A;  5ID2 B;  3UVH A;  2OJL A;  1PN9 A;  4IN0 A;  3UIW A;  4I2U A;  2VL3 A;  4KND A;  1OE8 A;  2YJ7 A;  1A24 A;  3I9V 2;  2CT6 A;  2PER A;  2RM6 A;  4FO5 A;  2L6C A;  5ID2 A;  4Z7X A;  1ZYQ B;  1K0O A;  4F2I A;  5ECS A;  2LRC A;  3FMW A;  3FW2 A;  2XPD A;  1A8L A;  2YV9 A;  3HVX A;  4L5L A;  2X64 A;  2LTK A;  1Z9H A;  3ZVJ D;  2HRK A;  2MMA A;  3I43 A;  4MA9 A;  4QQ7 A;  3US3 A;  2VCT A;  1PN0 A;  1U6T A;  1K0C A;  2FWF A;  5D96 A;  2H70 A;  1U3I A;  2VO4 A;  3C1R A;  3GA4 A;  3QAG A;  1X5D A;  1NSW A;  2X49 A;  13GS A;  4K7O A;  4X0X A;  3TKP A;  2HSH A;  1PKZ A;  3M3M A;  5J41 A;  5D9V A;  3VK9 A;  1QFN A;  1SL0 B;  1FVK A;  3GH6 A;  5ECQ B;  3LFL A;  1PSQ A;  1XPV A;  5F0G A;  5GAN D;  2OE0 A;  2WS2 A;  2ON7 A;  1S3C A;  3EIN A;  3O76 A;  3VI7 A;  3IOS A;  2FD3 A;  4KDY A;  3QAV A;  4LMV A;  5G2Z A;  5KN2 A;  3KMN A;  3DXB A;  1KNG A;  1XCC A;  2XC2 A;  5CP1 A;  5ECK B;  2NTO A;  1XVW A;  2FHE A;  3D0Z A;  2YZH A;  4KE3 A;  3FK8 A;  2VUP A;  4K6X A;  2B5E A;  2QC7 A;  2AHE A;  1XIY A;  1DE1 A;  2H6X A;  3GKK A;  2H1D A;  1TU7 A;  4WKW A;  3TOU A;  3K8N A;  1R5P A;  1XW9 A;  4ZL8 A;  4L0W A;  3H4K A;  4MF5 A;  3NOF A;  6GSX A;  1NHO A;  3C73 A;  3FR3 A;  3GN3 A;  1PRX A;  1B9Y C;  4MNN A;  4G0L A;  1DBY A;  4NV5 A;  2PBJ A;  5G1L A;  4KSO A;  2LQQ A;  2CZ3 A;  1WE0 A;  2FWE A;  3KTB A;  5KN0 A;  2F8F A;  3DVX A;  2VCZ A;  1NW2 A;  5D93 A;  1HQO A;  4CW9 A;  4NAX A;  1RQM A;  1SK0 A;  4XRA A;  2QA2 A;  4BWS A;  5A5K A;  1M99 A;  1G7O A;  2K9F A;  3A5I A;  4HUA A;  2JSY A;  4PUA A;  3F6D A;  2CAQ A;  2GDR A;  3TOT A;  2IWT A;  2IMD A;  2V6K A;  1GTB A;  4TKY A;  3NIV A;  2B3S A;  3WGX A;  2B7K A;  2H1G A;  3HCZ A;  2VLV A;  1R5A A;  3G9B A;  4GLT A;  3TGZ A;  3I69 A;  4HU7 A;  2HZF A;  3FEU A;  3F6F A;  2JAD A;  4ZBD A;  7GSS A;  5ENU A;  3TB2 A;  1VF4 A;  4WF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...