2KP2A

Solution structure of the b' domain of thermophilic fungal protein disulfide isomerase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
133
structure length
133
Chain Sequence
GPLGSPLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNLKTDKFPAFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Protein disulfide-isomerase
publication title Redox-Dependent Domain Rearrangement of Protein Disulfide Isomerase Coupled with Exposure of Its Substrate-Binding Hydrophobic Surface
pubmed doi rcsb
source organism Humicola insolens
total genus 30
structure length 133
sequence length 133
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2009-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2kp2A01
4G9HA 1GSQA 1B9YC 1ZYQB 1T8EB 3GN3A 1X9WB 4E8EA 3DXBA 5IQYA 4I97A 3LSZA 1VF2A 4K1FA 1EV4A 5J41A 5D93A 1NHYA 3DD3A 2XPEA 4IN0A 2IPAA 3EE2A 3L4NA 4POMA 4WEYA 2GDRA 4TVEA 2C0DA 4IKHA 1H4OA 2KUCA 2I9HA 2VCXA 5G31A 3TKQA 3FZ9A 2C1YA 5DALB 5GAND 3A2XA 5ENUA 1XWBA 3WT1A 3GKNA 1IYHA 2RM5A 4PNGA 4ECBA 5JCGA 2FGXA 2AJQB 3RPNA 4N0VA 2FD3A 3H1NA 2G0FA 2HFDA 2RM6A 1YEXA 3QFAC 5D9WA 5B7CA 4MABA 4CDOA 4IS0A 2A2RA 3J7Yb 5CRDA 3A3TA 3VWXA 4MCUA 3EYTA 4WBRD 4XCSA 3Q19A 2ES7A 2N5FA 4XS1A 1UVZA 3L9VA 2OADA 5ECPB 4Z7XA 3AY8A 4XRAA 3HJPA 3QCPA 1GSSA 18GSA 3FR3A 2A4VA 4H86A 3ERFA 5J9CA 5KN2A 4F82A 2XBIA 4MF6A 2BTOT 4O32A 3CMIA 2J23A 4MPFA 4K7NA 4MH3A 1LU4A 2WFCA 3VFIA 2DJ2A 2CZ2A 4TXOB 2MBSA 2B7KA 1MDKA 2H8LA 2VLTA 4FYBA 3HHVA 2VAFA 4FYUA 4PQIA 3MAKA 2VO4A 3KD0A 2QSIA 2LRCA 5IMVA 3UAPA 1ZGNA 1HQOA 1DUGA 2C80A 1JZRA 1XW6A 3I69A 4ECCA 1ZL9A 4ID0A 6GSXA 4POBA 2LNSA 1OAZA 4J56E 4N11A 1GUKA 2DBCA 4EDYA 3H4KA 2LNTA 3KGKA 4KNDA 2E2MA 1S3CA 4BWQA 1JZDA 4Q5NA 2HXKA 4XHMA 5IPHA 1FW1A 3E0UA 2I4AA 2AV4A 4WR4A 2FY6A 4TR1B 3WYWA 5LNKe 5DQSA 1X5DA 3LXTA 1YZXA 4FO5A 13GSA 3FW2A 2VM1A 1PSQA 5E59A 1F2EA 2L6DA 4POLA 4YQUA 2VD0A 2VM2A 1S3AA 3QDNA 4ZB8A 1QUWA 2DJ0A 4WBJA 5DVBA 3C73A 3TKSA 3LYKA 3APSA 1T00A 2WGRA 4ZILA 4OFNA 1SD9A 1GTAA 1Z3EA 1TK8B 3EU4A 4MZCA 5DAKA 20GSA 3UVHA 1USBA 4DSSA 2OE1A 5INYA 2AAWA 2M46A 1A2JA 5COHA 4OCFA 5AN1A 2C3NA 5AIVA 2LJRA 1O8XA 1ON4A 1ZOFA 1GSDA 2QC7A 2H6ZA 4K0GA 3W6GA 1JLVA 3VI7A 2B5EA 2IFQB 1AQXA 3P2AA 5IMAA 2L5OA 3W8JA 5KEJA 1AUCA 3KH9A 4P3YB 3HCZA 4EO3A 2NPBA 3TRQA 1T3BA 2HE3A 2YZHA 1FVJA 1NHOA 3GTUA 1V98A 2DIYA 2B1LA 2C3QA 3UBKA 2H19A 3G7YA 5IMFA 2XBQA 1TK5B 4MK3A 3E9JB 5ECLB 3WGDA 2GZPA 1EV9A 2R5GA 1PX7A 2YWOA 1Z9HA 1QXHA 3TB2A 2GS3A 1M9AA 1Q4JA 1UN2A 2X8HA 1SJIA 3CXGA 4QL7A 3BCKA 4GLTA 2H76A 1TU7A 1KTEA 5ABRA 3DEXA 3IA1A 3FR6A 5DDLA 3DMLA 1AQWA 4TN8A 3APQA 1JZWA 1FVKA 3GFKA 3TKSC 5B6MA 1TRUA 4IP1A 2TIRA 2ON5A 5D9TA 4ZBAA 1ACVA 3KTLA 2HZEB 2F8FA 2FWHA 2R3XA 5G30A 2V6OA 2KHPA 5D9VA 4WF4A 5F07A 3KM6A 3EC3A 5H5SA 2I1UA 5JCWA 4V2LA 1YF0A 4IW9A 3IE3A 1A2MA 2PN8A 1C72A 5C04A 1OKDA 1AAZA 4EL1A 1SK1A 14GSA 4TOPA 1XVWA 2V41A 5KN1A 2L4QA 2LQQA 3U5RE 4G2EA 1UA5A 1PMTA 4KUNA 3D0ZA 6GSWA 4ZL8A 3D5JA 4MA9A 5AGYA 2NTOA 5G1LA 4WKWA 4MH2A 8GSSA 1A0RP 2YANA 4F2IA 1FB0A 2NBSA 3HKRA 2OJLA 2IMDA 2MYGA 3BBYA 3CBUA 2R6KA 1OE8A 5JWRB 3WD6A 2R2JA 2WULA 4O7HA 3HA9A 4MMMA 1E6BA 1SJ6A 5G2ZA 1GTUA 5FT3A 3F6DA 1AW9A 1M2AA 3M1GA 1DBYA 5B8AA 2H0IA 2YWMA 4HU9A 3EWLA 4OWYA 2AB6A 3KTBA 1K3YA 2RUEA 4GWRA 4L5LA 2CV4A 2WZ9A 3KZQA 1YQ1A 3ZZXA 3HJMA 2B5YA 3UJ1A 3GH6A 1Z7PA 2WCIA 4JEDA 5EVOA 1WMJA 4JU5A 1M7TA 4I5QA 4ACSA 2PU9C 3VURA 3TGZA 1YEPA 4OCEA 4TW5A 2N5BA 4NXIA 1MD3A 2P5QA 3LG6A 1KEBA 4ZL7A 2HI7A 2WS2A 3ISOA 2H75A 3IHQA 5IMZA 1R4WA 2BMXA 1YF1A 1SENA 4J2FA 2OACA 4KSMA 3VI5A 2C3TA 2H6XA 3EVIA 4IVFA 5CAXA 4F0BA 3UEMA 1GUHA 3KEBA 2O87A 4E8HA 2FLSA 5J3RA 12GSA 4K8MA 1MD4A 2HZFA 2YP6A 2ZUPA 5J9BA 3ERGA 2V32A 1BJXA 4NHZA 4N30A 1TXXA 1BX9A 1F3AA 3FR9A 2DSAA 2GTUA 3ZFLA 2VCTA 2L57A 1F37A 3ZIJA 1N8JA 4MF5A 4YAPA 3TRXA 3L9SA 1V58A 4JRRA 4XS4A 4MP4A 1PRXA 3FKFA 4AJ8A 1SL2B 4ML1A 2GT6A 2NVLA 4XTSA 1J0FA 1TRVA 2B7JA 1TI3A 1TTZA 3Q6OA 3PINA 2K9FA 5ELGA 1NM3A 1VF3A 1O81A 1M99A 3I6AA 1SK0A 4HDEA 3RHCA 5DCGA 2HLSA 3F4SA 1HNBA 4IJ3A 5D8IA 6GSSA 1NSWA 1YY7A 3ZIVA 2VL2C 1XOBA 5LD0A 4JBBA 3DYRA 6GSVA 3CSJA 1EP7A 1PKZA 3IAM2 1SYXA 2EIRA 5IM9A 3EU3A 3LGCA 4NHWA 4RUVA 4TR4A 2PPTA 4KX4A 2YWIA 3VK9A 1ML6A 3ZLPA 4O92A 3F3RA 4ZIJA 2OE3A 3LORA 3GMFA 1GULA 1K0OA 5CO3A 1QGVA 3NIVA 1JLWA 1ERWA 1OC9A 2HYXA 4JE1A 3TJFA 4N0ZA 1EEMA 4EXJA 3MNGA 3G9BA 3WGXA 3C1RA 1TJDA 4FH8A 3O76A 9GSSA 2H1BA 4HQSA 5CRGA 1F3BA 4LLRA 2H1DA 3FK8A 4WETA 1ERTA 1A8YA 4KE3A 1SJZA 2YOIA 3ERWA 2M72A 3GSSA 3D4TA 4HJMA 2WDUA 3ZTLA 1GTBA 5DAKB 2B3SA 2VCVA 1WJKA 4KGIA 4DSSB 1GL8A 1EZKA 4OO4A 2H72A 2CT6A 1IYIA 2H73A 3M0FA 5CRWA 1M0UA 4GSTA 3GUSA 3QR6A 3VWUA 1BYEA 5A5KA 1G6YA 4IQ1A 3CSHA 3F8UA 3UOMA 4PQHA 2AHEA 1ILOA 2DJ3A 1B48A 3D4MA 3GTUB 1K0AA 4KA0A 2X8GA 1HNAA 2LEGA 3I43A 4I2TA 1F6MC 1PX6A 4Q5QA 3IBHA 5DALA 1QK8A 5IPGA 4MF7A 1GNEA 2TRXA 3CTGA 2P31A 1EGRA 1THXA 2Z9SA 2JU5A 2VD1A 10GSA 4PUFC 1XXUA 5D96A 2H71A 1JFUA 3APOA 1K0DA 3IAS2 3MDKA 1GSYA 3GSTA 4IBPA 2QKEA 5A4VA 4BVXA 4F03A 1FOVA 4KSOA 4PUAA 4NV5A 1T4YA 1PGTA 4HOJA 2LRNA 1CQGA 4IELA 2F9SA 2JL4A 3QOUA 4JR4A 4I6XA 4LMWA 2LJKA 3L0HA 4PNFA 4HZ2A 4YQVA 4NAXA 1HYUA 3GYKA 4JR6A 3GH9A 4TRXA 4MZWA 2HSYA 2IMKA 2R37A 2X99A 1KBNA 1TDIA 2WRTA 2H74A 3Q74A 1WIKA 5ECQB 5JWQB 2V1MA 2L59A 2HSHA 1B4QA 3FZ5A 3OR5A 1TW9A 2DC5A 4PQ1A 1M9BA 2LS5A 5HR0A 4OD7A 2OE0A 3RDWA 1A0FA 1U87A 2PWJA 3ZVJA 6GSTA 1URMA 4XRDA 1TKDB 2YJHA 2I3YA 2WB9A 3EMPA 3HVXA 3ZYWA 2E7PA 2H66A 1TRWA 2CQ9A 3LFLA 3BJ5A 2YCDA 1AQVA 1GWCA 2H0HA 1WRYA 3Q18A 5DCHA 1SL1B 3RAZA 3UBLA 2PMTA 5DJLA 1GSUA 3ZVJD 5ID2A 4IGJA 1YDKA 1W4VA 2J9HA 2PBJA 2ON7A 1H75A 2JZTA 2QGVA 4LMVA 2O7KA 3KP9A 4FYCA 4X43A 1X0RA 2MBTA 2LKUA 3TKSE 4GTUA 3PGTA 1G6WA 3H8QA 4POKA 1GNWA 1FB6A 2L6CA 1XW9A 3P8WA 1RK4A 1GSFA 3IXRA 2VCWA 4ZL9A 3VPQA 3WGEA 2VCQA 3F4RA 3UIWA 4BVYA 5H5QA 3C8EA 4EF0A 4HUAA 2D2ZA 1MTCA 3FY7A 3IR4A 3TJKA 5ECKB 2K6VA 2IWTA 3VPTA 1R7HA 2XPDA 1F9MA 4XIHA 4MJCA 1PA3A 2XC2A 4TR0A 1GUMA 4OFMA 2AYTA 4HU7A 3F3QA 3GX0A 2HT9A 3K8NA 1ERVA 5AIXA 5EL8A 5D9XA 1SKWB 1UC7A 2CVKA 1OC8A 1ZCPA 5B6NA 5ECMB 1QQ2A 1FAAA 3ZITA 2VIMA 1TP9A 1T1VA 4GQFA 2P5RA 3TDGA 2KOKA 4EC0A 3FZAA 3IOSA 1EWXA 1J9BA 3RBTA 5GSTA 1XWKA 5FWGA 1LBKA 1XBSA 1K3LA 4LA1A 3BCIA 4MDCA 4AJ7A 1OC3A 3TKRA 3UVTA 19GSA 2LQOA 5AISA 1X5EA 1YKAA 4XS4B 2HNLA 4KDYA 1AIUA 1U3IA 1QFNA 3F6FA 2PVOC 2CA8A 2IJYA 4ECJA 2EIOA 2LJAA 4ILFA 5ECSA 5E4WA 3EURA 1O8WA 2IL3A 4RI7A 1MDIA 4FIWA 2HZEA 5IO2A 4YH2A 5J4UA 2EC4A 1EP8A 4TXVA 1RQMA 1GLPA 5IMCA 4K7OA 4BWSA 1XPVA 3HXSA 2L5LA 4N10A 4DEJA 1MEKA 3CRTA 2FCHA 3GIXA 1EOGA 3IRAA 4ISDA 1Z6MA 3WT2A 5GAPD 4MPGA 1B9XC 3E3EA 3TJBA 2E0QA 4D73A 4GQCA 5L71A 3HDCA 3M9KA 5IOXA 3M9JA 3UMAA 4HS1A 4X0XA 2ZCTA 4V2NA 4K0NA 2F51A 2DJJA 4NWYA 2VL9A 5GSSA 2GVPA 4DSQA 2CAQA 4NMUA 3C7MA 1OC9B 3J7Yk 1X5CA 2FWGA 3IK7A 3M3MA 2RIIA 1I5GA 4F0CA 3GX8A 2AUVA 1QMVA 4F9ZA 1X9SB 1V9WA 4YQMA 2MMAA 3NOFA 2CX4A 3GL5A 1GRXA 1XWAA 4GCIA 4EUYA 2GSTA 4YAVA 4KDXA 2C4JA 2YPMA 2ALBA 3IDVA 3QMXA 1G7EA 4DSRA 3DIEA 3F4TA 4WF5A 1SYRA 1DE1A 1B4PA 2A2SA 2P0GA 3F9UA 3TCOA 2C0EA 1TI1A 2FNOA 1XVQA 4K6XA 2DMMA 3SBCA 1WE0A 4OO5A 3FZ4A 3KH7A 1EEJA 2VOCA 1A23A 1TRSA 1XIYA 1X9MB 4MJBA 1XWGA 3F63A 2LV3A 1PN9A 3BOAA 4V1Ag 4I8BA 2JACA 3L9UA 5DJMA 1GP1A 5EY6A 2JADA 3ZMKA 4GRFA 2RUFA 2C0FA 3TKPA 5CYYA 2OA7A 2OKAA 5G5FA 2GT5A 2FA4A 3QAWA 1A24A 4ZXGA 2B1KA 3M8NA 2PUKC 5IOWA 2H01A 3GHAA 11GSA 4GSSA 1V40A 2GSRA 3IV4A 1VF4A 4ULXA 3O6TA 2VL3A 1PQNA 1FO5A 3W8SA 4G19A 1PL1A 2X64A 1ST9A 3KMOA 2PGTA 1WWJA 1R26A 2YV7A 4IQAA 4NPBA 5KN0A 1TOFA 3FHKA 1XOAA 1G7OA 3EINA 4NV2A 1SK2A 5HR1A 5HR2A 1KNGA 2DJ1A 4MJEA 2FWFA 3DVWA 4ZB6A 4AJ6A 4JZQA 1Q98A 2GQKA 2GZYA 2FUG2 5JWOB 4PXOA 4K7IA 3O3TA 2I81A 4OMVA 2K18A 1O7UA 2GZZA 5ECHB 3C1SA 3C71A 1LJRA 5D73A 2IMEA 3RPPA 4TKYA 1WOUA 4MZBA 4HZ4A 1Y6EA 2CVBA 22GSA 17GSA 1O6JA 3LYPA 4IP6A 1YJ6A 1GTIA 3KJYA 2KP1A 3GURA 1BEDA 5A4WA 1PKWA 1VRSD 3LEFA 1RW1A 2OBKA 1CQHA 1Y25A 7GSSA 1JHBA 2O89A 3GKXA 5ECIB 2LRTA 1HD2A 3IK9A 1ZMAA 3P7XA 1A2LA 5ID2B 2YJ7A 2JSZA 4O5RA 2K8VA 2PERA 4HJ2A 1ABAA 1G0TA 3FYGA 5G1KA 4LL4B 3HZ8A 1I9DA 2X8CA 2MMZA 3D6IA 1AC1A 4GXZA 3VWWA 5F8BA 4X1UA 5DBQA 4L8EA 2DJKA 4I2UA 2H1GA 2G2QA 4TXOA 2O85A 4G10A 2YNXA 1E2YA 4BL7A 1U6TA 3GA4A 3CYNA 2LSTA 2CVDA 4ML6A 3VWVA 5HFIA 2L4CA 1ZYEA 4KAEA 2GQLA 3ZFBA 1SKSB 2M80A 4QQ7A 4ZBDA 3D21A 6GSYA 3RHBA 4MJAA 5ELAA 5FHIA 1DSBA 1XZOA 3US3A 3ZRDA 3N5OA 1T7PB 2NDOA 1TU8A 2GGTA 2F8AA 2IMFA 2MMNA 3GNJA 3KIJA 3MSZA 4BA7A 2HRFA 3HVVA 3HY2A 5HQPA 3TUEA 3NZNA 1BQ7A 5ECNB 2MZCA 4GSNA 1O85A 3I9V2 1O73A 1SD8A 4EVMA 2CX3A 3PR8A 2VLVA 1Z6NA 2GSSA 3A5WA 2JZSA 3DVXA 1M2DA 5F0GA 3IPZA 4KB3A 4TR1A 1AXDA 1K0MA 4J57E 3LWAA 1U3AA 4K2DA 2IN3A 4PURA 3DWVA 1OVNA 3R2QA 3KP8A 4TR3A 2BJXA 1XFLA 1ERUA 4XS6A 2C8UA 2VCZA 1K0CA 1WPIA 1B8XA 1YKCA 3ED3A 1S3DA 3TOTA 1R5AA 4KDUA 3H93A 4PGTA 4WR5A 2HRNA 3G7IA 2FA8A 4CHSA 2DLXA 4AGSA 5HR3A 5B8BA 1XCCA 1MDJA 2JZRA 3FRCA 4LL1B 3QD9A 4DVCA 2FWEA 3F0IA 4HI7A 5EPFA 5KN3A 3A2VA 1VF1A 1K3OA 4L0WA 2C0GA 4ECIA 1HNCA 3DRNA 3L78A 4CW9A 4KW6A 5HFGA 1N2AA 3DKSA 2IFQA 1ZZYA 4L0UA 3KCMA 3KXOA 2LTKA 1OYJA 4EKZA 1TK0B 2JSYA 1XWCA 5C00A 2YN1A 1PL2A 4BPYA 2H0GA 5J5NA 16GSA 3FEUA 4V1Ap 1BG5A 2CAIA 3TRPA 4KCAA 1K0BA 4IJIA 4RI6A 3HYPA 4GF0A 2K8SA 3GKMA 5H5RA 2DIZA 4D73B 5DQYA 2WJUA 5G5EA 3TOUA 1SKRB 3JCML 2GLRA 3CSIA 2VLUA 3CRUA 4OFTA 3HZ4A 4L5OA 3IC4A 3QAVA 2MMOA 1JZOA 1Z5YE 5F05A 5CREA 1V57A 1VGLA 2CZ3A 3ZREA 3QFBC 4Q5RA 2GSQA 2H1AA 1R5PA 3H79A 2E2GA 1OKTA 3HD5A 1T4ZA 2GQMA 4PX1A 4IHUA 1DE2A 3QPMA 3GL3A 5CP1A 2EIQA 3LXZA 4KH7A 3D22A 1NW2A 2LUSA 2F3MA 1M2BA 1GSEA 3GV1A 5CRHA 3PH9A 2VUPA 2FHEA 2OBIA 4HEA2 1EOHA 3HVSA 1EGOA 5ECRB 3UL3A 5IMDA 1GLQA 1XW5A 3GKKA 3N9JA 2H30A 3ME7A 2ZNMA 3A2WA 3MWHA 5F06A 5LCZA 2PVQA 3TJJA 3HJOA 4RQXA 3VLNA 1OE7A 2V2GA 4WXTA 4EE0A 2VL2A 1U88A 2H6YA 2TRCP 1THOA 1Z7RA 3GRXA 1SU9A 5CNWA 1J08A 3EMXA 2IMIA 1PD21 1FHEA 1A8LA 3ME8A 2N5AA 2YV9A 3CTFA 2V6KA 2H70A 4RQRA 1GH2A 5HFKA 4K9ZA 4MLYA 1V2AA 3V1WA 5A4UA 2IIYA 3SWLA 4ZB9A 4Q5FA 3LJRA 2XHFA 5GZZB 2REMA 3BD2A 4V2MA 2B6MA 2R4VA 4QL9A 4AF2A 2YWNA 5ECOB 4ZBBA 3TJGA 3KMNA 6GSUA 1WP0A 3ZMLA 4KCEA 3QAGA 1K0NA 2O8VB 3ZL5A 5IIZA 1FG4A 5JCUA 5IO0A 2YZUA 2KP2A 1W89A 3G7JA 2B5XA 3U6VA 1BAYA 2RLIA 3UARA 3P90A 4HQZA 3LQ7A 2DMLA 3DGQA 4EDZA 1SL0B 3S9FA 2KLXA
chains in the Genus database with same CATH superfamily
4G9HA 1GSQA 1B9YC 1ZYQB 1T8EB 3GN3A 1X9WB 4E8EA 3DXBA 5IQYA 4I97A 3LSZA 1VF2A 4PTSA 4K1FA 1EV4A 5J41A 5D93A 1NHYA 3DD3A 2XPEA 4IN0A 2IPAA 3EE2A 5BMUA 3L4NA 4POMA 4WEYA 2GDRA 4TVEA 2C0DA 4IKHA 1H4OA 2KUCA 2I9HA 2VCXA 5G31A 3TKQA 3FZ9A 2C1YA 5DALB 5GAND 3A2XA 5ENUA 1XWBA 3WT1A 3GKNA 1IYHA 3IC8A 2RM5A 4PNGA 4ECBA 2UZ8A 5JCGA 2FGXA 3PPUA 2AJQB 3RPNA 4N0VA 2FD3A 3H1NA 2G0FA 2HFDA 2RM6A 1YEXA 3QFAC 5D9WA 5B7CA 4MABA 4CDOA 4IS0A 2A2RA 3J7Yb 2R0PA 5CRDA 3A3TA 3VWXA 4MCUA 3EYTA 4WBRD 4CY6A 4XCSA 3Q19A 2QA1A 2ES7A 2N5FA 4XS1A 1UVZA 3L9VA 2OADA 5ECPB 4Z7XA 3AY8A 4XRAA 4BVXB 3HJPA 3QCPA 1GSSA 18GSA 3FR3A 2A4VA 4H86A 3ERFA 5J9CA 5KN2A 4F82A 2XBIA 4MF6A 2BTOT 4O32A 3CMIA 2J23A 4MPFA 4K7NA 4MH3A 1LU4A 2WFCA 3VFIA 2DJ2A 2CZ2A 4TXOB 2MBSA 2B7KA 1MDKA 2H8LA 2VLTA 4FYBA 4BL7B 3HHVA 4Z2TA 2VAFA 4FYUA 1PN0A 4PQIA 3MAKA 2VO4A 3KD0A 2QSIA 2LRCA 5IMVA 3UAPA 1ZGNA 1HQOA 1DUGA 2C80A 1JZRA 1XW6A 3I69A 4ECCA 1ZL9A 4ID0A 6GSXA 4POBA 2LNSA 1OAZA 4J56E 4N11A 1GUKA 2DBCA 4EDYA 3H4KA 2LNTA 3KGKA 4KNDA 2E2MA 1S3CA 4BWQA 1JZDA 4Q5NA 2HXKA 4XHMA 5IPHA 1FW1A 3E0UA 2I4AA 2AV4A 4WR4A 2FY6A 4TR1B 3WYWA 5LNKe 5DQSA 1X5DA 3LXTA 1YZXA 4FO5A 13GSA 3FW2A 2VM1A 3MYDA 1PSQA 5E59A 1F2EA 2L6DA 4POLA 4YQUA 3LW9A 2VD0A 2VM2A 1S3AA 3QDNA 4ZB8A 1QUWA 2R0CA 2DJ0A 4WBJA 5DVBA 3C73A 3TKSA 3LYKA 3APSA 1T00A 2WGRA 4ZILA 4OFNA 1SD9A 1GTAA 1Z3EA 1TK8B 3EU4A 4MZCA 5DAKA 20GSA 3UVHA 1USBA 4DSSA 2OE1A 5INYA 2AAWA 2M46A 1A2JA 5COHA 3IHGA 4OCFA 5AN1A 2C3NA 5AIVA 2LJRA 1O8XA 1ON4A 1ZOFA 1GSDA 2QC7A 2H6ZA 4K0GA 3W6GA 1JLVA 3VI7A 2B5EA 2IFQB 1AQXA 3P2AA 5IMAA 2L5OA 3W8JA 5KEJA 1AUCA 3KH9A 4P3YB 3HCZA 4EO3A 2NPBA 3TRQA 1T3BA 2HE3A 2YZHA 1FVJA 1NHOA 3GTUA 1V98A 2DIYA 2B1LA 2C3QA 3UBKA 2H19A 3G7YA 5IMFA 2XBQA 1TK5B 4MK3A 3E9JB 5ECLB 3WGDA 2GZPA 1EV9A 2R5GA 1PX7A 2YWOA 1Z9HA 1QXHA 3TB2A 2GS3A 1M9AA 1Q4JA 1UN2A 2X8HA 1SJIA 3CXGA 4QL7A 3BCKA 4GLTA 2H76A 2A4HA 1TU7A 1KTEA 5ABRA 3DEXA 3IA1A 3FR6A 5DDLA 3DMLA 4USSA 1AQWA 4TN8A 3APQA 1JZWA 2HRKA 1FVKA 4HSCX 3GFKA 3TKSC 5B6MA 1TRUA 4IP1A 2TIRA 2ON5A 5D9TA 4ZBAA 1ACVA 3KTLA 2HZEB 2F8FA 2FWHA 2R3XA 5G30A 2V6OA 2KHPA 5D9VA 4WF4A 5F07A 3KM6A 3EC3A 2DKIA 5H5SA 2I1UA 5JCWA 4V2LA 1YF0A 4IW9A 3MIXA 3IE3A 1A2MA 2PN8A 1C72A 5C04A 1OKDA 1AAZA 4EL1A 1SK1A 14GSA 4TOPA 1XVWA 2V41A 5KN1A 2L4QA 2LQQA 3U5RE 4G2EA 4KF9A 1UA5A 1PMTA 4KUNA 3D0ZA 6GSWA 4ZL8A 3D5JA 4K5SA 4MA9A 5AGYA 2NTOA 5G1LA 2X4AA 4WKWA 4MH2A 8GSSA 1A0RP 2YANA 4F2IA 1FB0A 2NBSA 3HKRA 2OJLA 2IMDA 2MYGA 3BBYA 3CBUA 2R6KA 1OE8A 5KOXA 5JWRB 3WD6A 2R2JA 4YKFA 2WULA 4O7HA 3HA9A 4MMMA 1E6BA 1SJ6A 5G2ZA 1GTUA 5FT3A 3F6DA 1AW9A 1M2AA 3M1GA 1DBYA 5B8AA 2H0IA 2YWMA 4HU9A 3EWLA 4OWYA 2AB6A 3KTBA 1K3YA 2RUEA 4GWRA 4L5LA 2CV4A 2WZ9A 3KZQA 1YQ1A 4CY8A 3ZZXA 3HJMA 2B5YA 3UJ1A 3GH6A 1Z7PA 2WCIA 4JEDA 5EVOA 1WMJA 4JU5A 1M7TA 4I5QA 4ACSA 2PU9C 3VURA 3TGZA 1YEPA 4OCEA 4TW5A 2N5BA 4NXIA 1MD3A 2P5QA 3LG6A 1KEBA 4ZL7A 2HI7A 2R0GA 2WS2A 3ISOA 2X49A 2H75A 3IHQA 5IMZA 1R4WA 2BMXA 1YF1A 1SENA 4J2FA 2OACA 4KSMA 3VI5A 2C3TA 2H6XA 3EVIA 4IVFA 5CAXA 4F0BA 3UEMA 1GUHA 3KEBA 2O87A 4E8HA 2FLSA 5J3RA 12GSA 4K8MA 1MD4A 2HZFA 2YP6A 2ZUPA 5J9BA 3ERGA 2V32A 1BJXA 4NHZA 4N30A 1TXXA 1BX9A 4G0LA 1F3AA 3FR9A 2DSAA 2GTUA 3ZFLA 2VCTA 2L57A 1F37A 3ZIJA 1N8JA 4MF5A 4YAPA 3TRXA 3L9SA 1V58A 4JRRA 4XS4A 4MP4A 1PRXA 3FKFA 4AJ8A 1SL2B 4ML1A 2GT6A 2NVLA 4XTSA 1J0FA 1TRVA 2B7JA 1TI3A 1TTZA 3Q6OA 3PINA 2K9FA 5ELGA 1NM3A 1VF3A 1O81A 1M99A 3I6AA 1SK0A 4HDEA 3RHCA 5DCGA 2HLSA 3F4SA 4A5PA 1HNBA 4IJ3A 5D8IA 6GSSA 1NSWA 1YY7A 3ZIVA 2VL2C 1XOBA 5LD0A 4JBBA 3DYRA 6GSVA 3CSJA 1EP7A 1PKZA 3IAM2 1SYXA 2EIRA 5IM9A 3EU3A 3LGCA 4NHWA 4RUVA 4TR4A 2PPTA 4KX4A 2YWIA 3VK9A 1ML6A 3ZLPA 4O92A 3F3RA 4ZIJA 2OE3A 3LORA 3GMFA 1GULA 1K0OA 5CO3A 1QGVA 3NIVA 1JLWA 1ERWA 1OC9A 2HYXA 4JE1A 3TJFA 4N0ZA 1EEMA 4EXJA 3MNGA 3G9BA 3WGXA 3C1RA 1TJDA 4FH8A 3O76A 9GSSA 2H1BA 4HQSA 5CRGA 1F3BA 4LLRA 2H1DA 3FK8A 4WETA 1ERTA 1A8YA 4KE3A 1SJZA 2YOIA 3ERWA 2M72A 3GSSA 3D4TA 4HJMA 2WDUA 3ZTLA 1GTBA 5DAKB 2B3SA 2VCVA 1WJKA 4KGIA 2HRAA 4DSSB 1GL8A 1EZKA 4OO4A 2H72A 2CT6A 1IYIA 2H73A 4K2XA 3M0FA 5CRWA 1M0UA 4GSTA 5BRTA 3GUSA 3QR6A 3VWUA 1BYEA 5A5KA 1G6YA 4IQ1A 3CSHA 3F8UA 3UOMA 4PQHA 2AHEA 1ILOA 2DJ3A 1B48A 3D4MA 4MNNA 3GTUB 1K0AA 4KA0A 2X8GA 2HSMA 1HNAA 2LEGA 3I43A 4I2TA 1F6MC 1PX6A 4Q5QA 3IBHA 5DALA 1QK8A 5IPGA 4MF7A 1GNEA 2TRXA 3CTGA 2P31A 1EGRA 1THXA 2Z9SA 2JU5A 2VD1A 10GSA 4PUFC 1XXUA 5D96A 2H71A 1JFUA 3APOA 1K0DA 3IAS2 3MDKA 1GSYA 2A2PA 3GSTA 4IBPA 2QKEA 5A4VA 4BVXA 4F03A 1FOVA 4KSOA 4PUAA 4G0IA 4NV5A 1T4YA 1PGTA 4HOJA 2LRNA 1M3IA 1CQGA 4IELA 2F9SA 2JL4A 3QOUA 4JR4A 4I6XA 4LMWA 2LJKA 3L0HA 4PNFA 4HZ2A 4YQVA 4NAXA 1HYUA 3GYKA 4JR6A 3GH9A 4TRXA 4MZWA 2HSYA 2IMKA 2R37A 2X99A 1KBNA 1TDIA 2WRTA 2H74A 3Q74A 1WIKA 5ECQB 5JWQB 2V1MA 2L59A 2HSHA 1B4QA 3FZ5A 3OR5A 1TW9A 2DC5A 4PQ1A 1M9BA 2LS5A 5HR0A 4OD7A 2OE0A 3RDWA 1A0FA 1U87A 2PWJA 3ZVJA 6GSTA 1URMA 4XRDA 1TKDB 2YJHA 2I3YA 2DKHA 2WB9A 4G0KA 3EMPA 3HVXA 3ZYWA 2E7PA 2H66A 1TRWA 2CQ9A 3LFLA 3BJ5A 2YCDA 1AQVA 1GWCA 2H0HA 1WRYA 3Q18A 5DCHA 1SL1B 3RAZA 3UBLA 2PMTA 5DJLA 1GSUA 3ZVJD 5ID2A 4IGJA 1YDKA 1W4VA 2J9HA 2PBJA 2ON7A 1H75A 2JZTA 2QGVA 4LMVA 2O7KA 3KP9A 4FYCA 4X43A 1X0RA 2MBTA 4Z2UA 2LKUA 3TKSE 4GTUA 3PGTA 1G6WA 3H8QA 4POKA 1GNWA 1FB6A 2L6CA 1XW9A 3P8WA 1RK4A 1GSFA 3IXRA 2VCWA 4ZL9A 3VPQA 3WGEA 2VCQA 3F4RA 3UIWA 4BVYA 5H5QA 3C8EA 4EF0A 4HUAA 2D2ZA 1MTCA 3FY7A 3IR4A 3TJKA 5ECKB 2K6VA 2IWTA 3VPTA 1R7HA 2XPDA 1F9MA 4XIHA 4MJCA 1PA3A 2XC2A 4TR0A 1GUMA 4OFMA 2AYTA 4HU7A 3F3QA 3GX0A 2HT9A 3K8NA 1ERVA 5AIXA 5EL8A 5D9XA 1SKWB 1UC7A 2CVKA 1OC8A 1ZCPA 5B6NA 5ECMB 1QQ2A 1FAAA 3ZITA 2VIMA 1TP9A 1T1VA 4GQFA 2P5RA 3TDGA 2KOKA 4EC0A 3FZAA 3IOSA 1EWXA 1J9BA 3RBTA 5GSTA 1XWKA 5FWGA 1LBKA 1XBSA 1K3LA 4LA1A 3BCIA 4MDCA 4AJ7A 1OC3A 3TKRA 3UVTA 19GSA 2LQOA 5AISA 1X5EA 1YKAA 4XS4B 2HNLA 4KDYA 1AIUA 1U3IA 1QFNA 3F6FA 1ZYNA 2PVOC 2CA8A 2IJYA 4ECJA 2EIOA 4YKGA 2LJAA 4ILFA 5ECSA 5E4WA 3EURA 1O8WA 2IL3A 4RI7A 1MDIA 4FIWA 2HZEA 5IO2A 4YH2A 5J4UA 4EIQA 2EC4A 1EP8A 4TXVA 1RQMA 1GLPA 5IMCA 4K7OA 4BWSA 1XPVA 3FMWA 3HXSA 2L5LA 4N10A 4DEJA 1MEKA 3CRTA 2FCHA 3GIXA 1EOGA 3IRAA 4ISDA 1Z6MA 3WT2A 5GAPD 4MPGA 1B9XC 3E3EA 3TJBA 2E0QA 4D73A 4GQCA 5L71A 3HDCA 3M9KA 5IOXA 3M9JA 3UMAA 4HS1A 4X0XA 2ZCTA 4V2NA 4K0NA 2F51A 2DJJA 4NWYA 2VL9A 5GSSA 2GVPA 4DSQA 2CAQA 4NMUA 3C7MA 1OC9B 3J7Yk 1X5CA 2FWGA 3IK7A 3M3MA 2RIIA 1I5GA 4F0CA 3GX8A 2AUVA 1QMVA 4F9ZA 1X9SB 1V9WA 4YQMA 2MMAA 3NOFA 4BIKA 2CX4A 3GL5A 1GRXA 1XWAA 4GCIA 4EUYA 2GSTA 4YAVA 4KDXA 5KOWA 2C4JA 2YPMA 2ALBA 3IDVA 3QMXA 1G7EA 4DSRA 3DIEA 3F4TA 4WF5A 1SYRA 1DE1A 1B4PA 2A2SA 2P0GA 3F9UA 4K5RA 4ICYA 3TCOA 2C0EA 1TI1A 2FNOA 1XVQA 4K6XA 2DMMA 3SBCA 1WE0A 4OO5A 3R3EA 3FZ4A 3KH7A 1EEJA 2VOCA 1A23A 1TRSA 1XIYA 1X9MB 4MJBA 1XWGA 3F63A 2LV3A 1PN9A 3BOAA 4V1Ag 4I8BA 2JACA 3L9UA 5DJMA 1GP1A 5EY6A 2JADA 3ZMKA 4GRFA 4X4JA 2RUFA 2C0FA 3TKPA 5CYYA 2OA7A 2OKAA 5G5FA 2GT5A 2FA4A 3QAWA 1A24A 4ZXGA 2B1KA 3M8NA 2PUKC 5IOWA 2H01A 3GHAA 11GSA 4GSSA 1V40A 2GSRA 3IV4A 1VF4A 4ULXA 3O6TA 2VL3A 1PQNA 1FO5A 3W8SA 4G19A 1PL1A 2X64A 1ST9A 3KMOA 2PGTA 1WWJA 1R26A 2YV7A 4IQAA 3EPTA 4NPBA 5KN0A 1TOFA 3FHKA 1XOAA 1G7OA 4EIPA 3EINA 4NV2A 1SK2A 5HR1A 5HR2A 1KNGA 2DJ1A 4MJEA 2FWFA 3DVWA 4ZB6A 4AJ6A 4JZQA 1Q98A 2GQKA 2GZYA 2FUG2 5JWOB 4PXOA 4K7IA 3O3TA 2I81A 4OMVA 2K18A 1O7UA 2GZZA 1ZYPA 5ECHB 3C1SA 3C71A 1LJRA 5D73A 2IMEA 3RPPA 4TKYA 1WOUA 4MZBA 4HZ4A 1Y6EA 2CVBA 2QA2A 22GSA 17GSA 1O6JA 3LYPA 4IP6A 1YJ6A 1GTIA 3KJYA 2KP1A 3GURA 1BEDA 4O5QA 5A4WA 1PKWA 1VRSD 3LEFA 1RW1A 2OBKA 1CQHA 1Y25A 7GSSA 1JHBA 2O89A 3GKXA 3HVNA 5ECIB 2LRTA 1HD2A 3IK9A 1ZMAA 3P7XA 1A2LA 5ID2B 2YJ7A 2JSZA 4O5RA 2K8VA 2PERA 4HJ2A 1ABAA 1G0TA 3FYGA 5G1KA 4LL4B 3HZ8A 1I9DA 2X8CA 2MMZA 3D6IA 1AC1A 4GXZA 3VWWA 5F8BA 4O5UA 4X1UA 5DBQA 4L8EA 2DJKA 4I2UA 2H1GA 2G2QA 4TXOA 2O85A 4G10A 2YNXA 1E2YA 4BL7A 1U6TA 3GA4A 3CYNA 2LSTA 2CVDA 4ML6A 4BVYB 3VWVA 5HFIA 2L4CA 1XG8A 1ZYEA 4KAEA 2GQLA 3ZFBA 1SKSB 2M80A 4QQ7A 4ZBDA 3D21A 6GSYA 3RHBA 4MJAA 5ELAA 5FHIA 1DSBA 1XZOA 3US3A 3ZRDA 3N5OA 1T7PB 2NDOA 1TU8A 2GGTA 2F8AA 2IMFA 2MMNA 3GNJA 3KIJA 3MSZA 4BA7A 2HRFA 3HVVA 3HY2A 5HQPA 3TUEA 3NZNA 1BQ7A 5ECNB 2MZCA 4GSNA 1O85A 3I9V2 1O73A 1SD8A 4EVMA 2CX3A 1S3RA 3PR8A 2VLVA 1Z6NA 2GSSA 3A5WA 2JZSA 3DVXA 1M2DA 5F0GA 3IPZA 4KB3A 4TR1A 1AXDA 1K0MA 4J57E 3LWAA 1U3AA 4K2DA 2IN3A 4PURA 3DWVA 1OVNA 3R2QA 3KP8A 4TR3A 2BJXA 1XFLA 1ERUA 4XS6A 2C8UA 2VCZA 1K0CA 1WPIA 1B8XA 1YKCA 3ED3A 1S3DA 3TOTA 1R5AA 4KDUA 3H93A 4PGTA 4WR5A 2HRNA 3G7IA 2FA8A 4CHSA 2DLXA 4AGSA 5HR3A 1FOHA 5B8BA 1XCCA 1MDJA 2JZRA 3FRCA 4LL1B 3QD9A 4DVCA 2FWEA 3F0IA 4HI7A 5EPFA 5KN3A 3A2VA 1VF1A 1K3OA 4L0WA 2C0GA 4ECIA 1HNCA 3DRNA 3L78A 4CW9A 4KW6A 5HFGA 1N2AA 4FQUA 3DKSA 2IFQA 3A5IA 1ZZYA 4L0UA 3KCMA 4Z2RA 3KXOA 2LTKA 1OYJA 4EKZA 1TK0B 2JSYA 1XWCA 5C00A 2YN1A 1PL2A 4BPYA 2H0GA 5J5NA 16GSA 3FEUA 4V1Ap 1BG5A 2CAIA 3TRPA 4KCAA 1K0BA 4IJIA 4RI6A 3HYPA 4GF0A 2K8SA 3GKMA 5H5RA 2DIZA 4D73B 5DQYA 2WJUA 5G5EA 3TOUA 1SKRB 3JCML 2GLRA 1PFOA 3CSIA 2VLUA 3CRUA 4OFTA 3HZ4A 4L5OA 3IC4A 3QAVA 2MMOA 1JZOA 1Z5YE 5F05A 5CREA 1V57A 1VGLA 2CZ3A 3ZREA 3QFBC 4Q5RA 2GSQA 2H1AA 1R5PA 3H79A 2E2GA 1OKTA 3HD5A 1T4ZA 2GQMA 4PX1A 4IHUA 1DE2A 3QPMA 3GL3A 5CP1A 2EIQA 3LXZA 4KH7A 3D22A 1NW2A 2LUSA 2F3MA 1M2BA 1M3JA 1GSEA 3GV1A 5CRHA 3PH9A 2VUPA 2FHEA 2OBIA 4HEA2 1EOHA 3HVSA 1EGOA 5ECRB 3UL3A 5IMDA 1GLQA 1XW5A 3GKKA 3N9JA 2H30A 3ME7A 3MWHA 2ZNMA 3A2WA 5F06A 5LCZA 2PVQA 3TJJA 3HJOA 4RQXA 3VLNA 1OE7A 2V2GA 4WXTA 4EE0A 2VL2A 1U88A 2H6YA 2TRCP 1THOA 1Z7RA 3GRXA 1SU9A 5CNWA 1J08A 3EMXA 2IMIA 1PD21 1FHEA 1A8LA 3ME8A 2N5AA 2YV9A 3CTFA 2V6KA 2H70A 4RQRA 1GH2A 5HFKA 4K9ZA 4MLYA 1V2AA 3V1WA 5A4UA 2IIYA 3SWLA 4ZB9A 4Q5FA 3LJRA 2XHFA 5GZZB 2REMA 3BD2A 4V2MA 2B6MA 2R4VA 4QL9A 4AF2A 2YWNA 5ECOB 4ZBBA 3TJGA 3KMNA 6GSUA 1WP0A 3ZMLA 4KCEA 3QAGA 1K0NA 2O8VB 3ZL5A 5IIZA 1FG4A 5JCUA 5IO0A 2YZUA 2KP2A 1W89A 3G7JA 3CQFA 2B5XA 3U6VA 1BAYA 2RLIA 3UARA 3P90A 4HQZA 3LQ7A 2DMLA 3DGQA 4EDZA 1SL0B 3S9FA 2KLXA
chains in the Genus database with same CATH topology
4G9HA 1GSQA 1B9YC 1ZYQB 1T8EB 3GN3A 1X9WB 4E8EA 3DXBA 5IQYA 4I97A 3LSZA 1VF2A 4PTSA 4K1FA 1EV4A 5J41A 5D93A 1NHYA 3DD3A 2XPEA 4IN0A 2IPAA 3EE2A 5BMUA 3L4NA 4POMA 4WEYA 2GDRA 4TVEA 2C0DA 4IKHA 1H4OA 2KUCA 2I9HA 2VCXA 5G31A 3TKQA 3FZ9A 2C1YA 5DALB 5GAND 3A2XA 5ENUA 1XWBA 3WT1A 3GKNA 1IYHA 3IC8A 2RM5A 4PNGA 4ECBA 2UZ8A 5JCGA 2FGXA 3PPUA 2AJQB 3RPNA 4N0VA 2FD3A 3H1NA 2G0FA 2HFDA 2RM6A 1YEXA 3QFAC 5D9WA 5B7CA 4MABA 4CDOA 4IS0A 2A2RA 3J7Yb 2R0PA 5CRDA 3A3TA 3VWXA 4MCUA 3EYTA 4WBRD 4CY6A 4XCSA 3Q19A 2QA1A 2ES7A 2N5FA 4XS1A 1UVZA 3L9VA 2OADA 5ECPB 4Z7XA 3AY8A 4XRAA 4BVXB 3HJPA 3QCPA 1GSSA 18GSA 3FR3A 2A4VA 4H86A 3ERFA 5J9CA 5KN2A 4F82A 2XBIA 4MF6A 2BTOT 4O32A 3CMIA 2J23A 4MPFA 4K7NA 4MH3A 1LU4A 2WFCA 3VFIA 2DJ2A 2CZ2A 4TXOB 2MBSA 2B7KA 1MDKA 2H8LA 2VLTA 4FYBA 4BL7B 3HHVA 4Z2TA 2VAFA 4FYUA 1PN0A 4PQIA 3MAKA 2VO4A 3KD0A 2QSIA 2LRCA 5IMVA 3UAPA 1ZGNA 1HQOA 1DUGA 2C80A 1JZRA 1XW6A 3I69A 4ECCA 1ZL9A 4ID0A 6GSXA 4POBA 2LNSA 1OAZA 4J56E 4N11A 1GUKA 2DBCA 4EDYA 3H4KA 2LNTA 3KGKA 4KNDA 2E2MA 1S3CA 4BWQA 1JZDA 4Q5NA 2HXKA 4XHMA 5IPHA 1FW1A 3E0UA 2I4AA 2AV4A 4WR4A 2FY6A 4TR1B 3WYWA 5LNKe 5DQSA 1X5DA 3LXTA 1YZXA 4FO5A 13GSA 3FW2A 2VM1A 3MYDA 1PSQA 5E59A 1F2EA 2L6DA 4POLA 4YQUA 3LW9A 2VD0A 2VM2A 1S3AA 3QDNA 4ZB8A 1QUWA 2R0CA 2DJ0A 4WBJA 5DVBA 3C73A 3TKSA 3LYKA 3APSA 1T00A 2WGRA 4ZILA 4OFNA 1SD9A 1GTAA 1Z3EA 1TK8B 3EU4A 4MZCA 5DAKA 20GSA 3UVHA 1USBA 4DSSA 2OE1A 5INYA 2AAWA 2M46A 1A2JA 5COHA 3IHGA 4OCFA 5AN1A 2C3NA 5AIVA 2LJRA 1O8XA 1ON4A 1ZOFA 1GSDA 2QC7A 2H6ZA 4K0GA 3W6GA 1JLVA 3VI7A 2B5EA 2IFQB 1AQXA 3P2AA 5IMAA 2L5OA 3W8JA 5KEJA 1AUCA 3KH9A 4P3YB 3HCZA 4EO3A 2NPBA 3TRQA 1T3BA 2HE3A 2YZHA 1FVJA 1NHOA 3GTUA 1V98A 2DIYA 2B1LA 2C3QA 3UBKA 2H19A 3G7YA 5IMFA 2XBQA 1TK5B 4MK3A 3E9JB 5ECLB 3WGDA 2GZPA 1EV9A 2R5GA 1PX7A 2YWOA 1Z9HA 1QXHA 3TB2A 2GS3A 1M9AA 1Q4JA 1UN2A 2X8HA 1SJIA 3CXGA 4QL7A 3BCKA 4GLTA 2H76A 2A4HA 1TU7A 1KTEA 5ABRA 3DEXA 3IA1A 3FR6A 5DDLA 3DMLA 4USSA 1AQWA 4TN8A 3APQA 1JZWA 2HRKA 1FVKA 3GFKA 3TKSC 5B6MA 1TRUA 4IP1A 2TIRA 2ON5A 5D9TA 4ZBAA 1ACVA 3KTLA 2HZEB 2F8FA 2FWHA 2R3XA 5G30A 2V6OA 2KHPA 5D9VA 4WF4A 5F07A 3KM6A 3EC3A 2DKIA 5H5SA 2I1UA 5JCWA 4V2LA 1YF0A 4IW9A 3MIXA 3IE3A 1A2MA 2PN8A 1C72A 5C04A 1OKDA 1AAZA 4EL1A 1SK1A 14GSA 4TOPA 1XVWA 2V41A 5KN1A 2L4QA 2LQQA 3U5RE 4G2EA 4KF9A 1UA5A 1PMTA 4KUNA 3D0ZA 6GSWA 4ZL8A 3D5JA 4K5SA 4MA9A 5AGYA 2NTOA 5G1LA 2X4AA 4WKWA 4MH2A 8GSSA 1A0RP 2YANA 4F2IA 1FB0A 2NBSA 3HKRA 2OJLA 2IMDA 2MYGA 3BBYA 3CBUA 2R6KA 1OE8A 5KOXA 5JWRB 3WD6A 2R2JA 4YKFA 2WULA 4O7HA 3HA9A 4MMMA 1E6BA 1SJ6A 5G2ZA 1GTUA 5FT3A 3F6DA 1AW9A 1M2AA 3M1GA 1DBYA 5B8AA 2H0IA 2YWMA 4HU9A 3EWLA 4OWYA 2AB6A 3KTBA 1K3YA 2RUEA 4GWRA 4L5LA 2CV4A 2WZ9A 3KZQA 1YQ1A 4CY8A 3ZZXA 3HJMA 2B5YA 3UJ1A 3GH6A 1Z7PA 2WCIA 4JEDA 5EVOA 1WMJA 4JU5A 1M7TA 4I5QA 4ACSA 2PU9C 3VURA 3TGZA 1YEPA 4OCEA 4TW5A 2N5BA 4NXIA 1MD3A 2P5QA 3LG6A 1KEBA 4ZL7A 2HI7A 2R0GA 2WS2A 3ISOA 2X49A 2H75A 3IHQA 5IMZA 1R4WA 2BMXA 1YF1A 1SENA 4J2FA 2OACA 4KSMA 3VI5A 2C3TA 2H6XA 3EVIA 4IVFA 5CAXA 4F0BA 3UEMA 1GUHA 3KEBA 2O87A 4E8HA 2FLSA 5J3RA 12GSA 4K8MA 1MD4A 2HZFA 2YP6A 2ZUPA 5J9BA 3ERGA 2V32A 1BJXA 4NHZA 4N30A 1TXXA 1BX9A 4G0LA 1F3AA 3FR9A 2DSAA 2GTUA 3ZFLA 2VCTA 2L57A 1F37A 3ZIJA 1N8JA 4MF5A 4YAPA 3TRXA 3L9SA 1V58A 4JRRA 4XS4A 4MP4A 1PRXA 3FKFA 4AJ8A 1SL2B 4ML1A 2GT6A 2NVLA 4XTSA 1J0FA 1TRVA 2B7JA 1TI3A 1TTZA 3Q6OA 3PINA 2K9FA 5ELGA 1NM3A 1VF3A 1O81A 1M99A 3I6AA 1SK0A 4HDEA 3RHCA 5DCGA 2HLSA 3F4SA 4A5PA 1HNBA 4IJ3A 5D8IA 6GSSA 1NSWA 1YY7A 3ZIVA 2VL2C 1XOBA 5LD0A 4JBBA 3DYRA 6GSVA 3CSJA 1EP7A 1PKZA 3IAM2 1SYXA 2EIRA 5IM9A 3EU3A 3LGCA 4NHWA 4RUVA 4TR4A 2PPTA 4KX4A 2YWIA 3VK9A 1ML6A 3ZLPA 4O92A 3F3RA 4ZIJA 2OE3A 3LORA 3GMFA 1GULA 1K0OA 5CO3A 1QGVA 3NIVA 1JLWA 1ERWA 1OC9A 2HYXA 4JE1A 3TJFA 4N0ZA 1EEMA 4EXJA 3MNGA 3G9BA 3WGXA 3C1RA 1TJDA 4FH8A 3O76A 9GSSA 2H1BA 4HQSA 5CRGA 1F3BA 4LLRA 2H1DA 3FK8A 4WETA 1ERTA 1A8YA 4KE3A 1SJZA 2YOIA 3ERWA 2M72A 3GSSA 3D4TA 4HJMA 2WDUA 3ZTLA 1GTBA 5DAKB 2B3SA 2VCVA 1WJKA 4KGIA 2HRAA 4DSSB 1GL8A 1EZKA 4OO4A 2H72A 2CT6A 1IYIA 2H73A 4K2XA 3M0FA 5CRWA 1M0UA 4GSTA 5BRTA 3GUSA 3QR6A 3VWUA 1BYEA 5A5KA 1G6YA 4IQ1A 3CSHA 3F8UA 3UOMA 4PQHA 2AHEA 1ILOA 2DJ3A 1B48A 3D4MA 4MNNA 3GTUB 1K0AA 4KA0A 2X8GA 2HSMA 1HNAA 2LEGA 3I43A 4I2TA 1F6MC 1PX6A 4Q5QA 3IBHA 5DALA 1QK8A 5IPGA 4MF7A 1GNEA 2TRXA 3CTGA 2P31A 1EGRA 1THXA 2Z9SA 2JU5A 2VD1A 10GSA 4PUFC 1XXUA 5D96A 2H71A 1JFUA 3APOA 1K0DA 3IAS2 3MDKA 1GSYA 2A2PA 3GSTA 4IBPA 2QKEA 5A4VA 4BVXA 4F03A 1FOVA 4KSOA 4PUAA 4G0IA 4NV5A 1T4YA 1PGTA 4HOJA 2LRNA 1CQGA 4IELA 2F9SA 2JL4A 3QOUA 4JR4A 4I6XA 4LMWA 2LJKA 3L0HA 4PNFA 4HZ2A 4YQVA 4NAXA 1HYUA 3GYKA 4JR6A 3GH9A 4TRXA 4MZWA 2HSYA 2IMKA 2R37A 2X99A 1KBNA 1TDIA 2WRTA 2H74A 3Q74A 1WIKA 5ECQB 5JWQB 2V1MA 2L59A 2HSHA 1B4QA 3FZ5A 3OR5A 1TW9A 2DC5A 4PQ1A 1M9BA 2LS5A 5HR0A 4OD7A 2OE0A 3RDWA 1A0FA 1U87A 2PWJA 3ZVJA 6GSTA 1URMA 4XRDA 1TKDB 2YJHA 2I3YA 2DKHA 2WB9A 4G0KA 3EMPA 3HVXA 3ZYWA 2E7PA 2H66A 1TRWA 2CQ9A 3LFLA 3BJ5A 2YCDA 1AQVA 1GWCA 2H0HA 1WRYA 3Q18A 5DCHA 1SL1B 3RAZA 3UBLA 2PMTA 5DJLA 1GSUA 3ZVJD 5ID2A 4IGJA 1YDKA 1W4VA 2J9HA 2PBJA 2ON7A 1H75A 2JZTA 2QGVA 4LMVA 2O7KA 3KP9A 4FYCA 4X43A 1X0RA 2MBTA 4Z2UA 2LKUA 3TKSE 4GTUA 3PGTA 1G6WA 3H8QA 4POKA 1GNWA 1FB6A 2L6CA 1XW9A 3P8WA 1RK4A 1GSFA 3IXRA 2VCWA 4ZL9A 3VPQA 3WGEA 2VCQA 3F4RA 3UIWA 4BVYA 5H5QA 3C8EA 4EF0A 4HUAA 2D2ZA 1MTCA 3FY7A 3IR4A 3TJKA 5ECKB 2K6VA 2IWTA 3VPTA 1R7HA 2XPDA 1F9MA 4XIHA 4MJCA 1PA3A 2XC2A 4TR0A 1GUMA 4OFMA 2AYTA 4HU7A 3F3QA 3GX0A 2HT9A 3K8NA 1ERVA 5AIXA 5EL8A 5D9XA 1SKWB 1UC7A 2CVKA 1OC8A 1ZCPA 5B6NA 5ECMB 1QQ2A 1FAAA 3ZITA 2VIMA 1TP9A 1T1VA 4GQFA 2P5RA 3TDGA 2KOKA 4EC0A 3FZAA 3IOSA 1EWXA 1J9BA 3RBTA 5GSTA 1XWKA 5FWGA 1LBKA 1XBSA 1K3LA 4LA1A 3BCIA 4MDCA 4AJ7A 1OC3A 3TKRA 3UVTA 19GSA 2LQOA 5AISA 1X5EA 1YKAA 4XS4B 2HNLA 4KDYA 1AIUA 1U3IA 1QFNA 3F6FA 1ZYNA 2PVOC 2CA8A 2IJYA 4ECJA 2EIOA 4YKGA 2LJAA 4ILFA 5ECSA 5E4WA 3EURA 1O8WA 2IL3A 4RI7A 1MDIA 4FIWA 2HZEA 5IO2A 4YH2A 5J4UA 4EIQA 2EC4A 1EP8A 4TXVA 1RQMA 1GLPA 5IMCA 4K7OA 4BWSA 1XPVA 3FMWA 3HXSA 2L5LA 4N10A 4DEJA 1MEKA 3CRTA 2FCHA 3GIXA 1EOGA 3IRAA 4ISDA 1Z6MA 3WT2A 5GAPD 4MPGA 1B9XC 3E3EA 3TJBA 2E0QA 4D73A 4GQCA 5L71A 3HDCA 3M9KA 5IOXA 3M9JA 3UMAA 4HS1A 4X0XA 2ZCTA 4V2NA 4K0NA 2F51A 2DJJA 4NWYA 2VL9A 5GSSA 2GVPA 4DSQA 2CAQA 4NMUA 3C7MA 1OC9B 3J7Yk 1X5CA 2FWGA 3IK7A 3M3MA 2RIIA 1I5GA 4F0CA 3GX8A 2AUVA 1QMVA 4F9ZA 1X9SB 1V9WA 4YQMA 2MMAA 3NOFA 2CX4A 3GL5A 1GRXA 1XWAA 4GCIA 4EUYA 2GSTA 4YAVA 4KDXA 5KOWA 2C4JA 2YPMA 2ALBA 3IDVA 3QMXA 1G7EA 4DSRA 3DIEA 3F4TA 4WF5A 1SYRA 1DE1A 1B4PA 2A2SA 2P0GA 3F9UA 4K5RA 4ICYA 3TCOA 2C0EA 1TI1A 2FNOA 1XVQA 4K6XA 2DMMA 3SBCA 1WE0A 4OO5A 3R3EA 3FZ4A 3KH7A 1EEJA 2VOCA 1A23A 1TRSA 1XIYA 1X9MB 4MJBA 1XWGA 3F63A 2LV3A 1PN9A 3BOAA 4V1Ag 4I8BA 2JACA 3L9UA 5DJMA 1GP1A 5EY6A 2JADA 3ZMKA 4GRFA 4X4JA 2RUFA 2C0FA 3TKPA 5CYYA 2OA7A 2OKAA 5G5FA 2GT5A 2FA4A 3QAWA 1A24A 4ZXGA 2B1KA 3M8NA 2PUKC 5IOWA 2H01A 3GHAA 11GSA 4GSSA 1V40A 2GSRA 3IV4A 1VF4A 4ULXA 3O6TA 2VL3A 1PQNA 1FO5A 3W8SA 4G19A 1PL1A 2X64A 1ST9A 3KMOA 2PGTA 1WWJA 1R26A 2YV7A 4IQAA 3EPTA 4NPBA 5KN0A 1TOFA 3FHKA 1XOAA 1G7OA 4EIPA 3EINA 4NV2A 1SK2A 5HR1A 5HR2A 1KNGA 2DJ1A 4MJEA 2FWFA 3DVWA 4ZB6A 4AJ6A 4JZQA 1Q98A 2GQKA 2GZYA 2FUG2 5JWOB 4PXOA 4K7IA 3O3TA 2I81A 4OMVA 2K18A 1O7UA 2GZZA 1ZYPA 5ECHB 3C1SA 3C71A 1LJRA 5D73A 2IMEA 3RPPA 4TKYA 1WOUA 4MZBA 4HZ4A 1Y6EA 2CVBA 2QA2A 22GSA 17GSA 1O6JA 3LYPA 4IP6A 1YJ6A 1GTIA 3KJYA 2KP1A 3GURA 1BEDA 4O5QA 5A4WA 1PKWA 1VRSD 3LEFA 1RW1A 2OBKA 1CQHA 1Y25A 7GSSA 1JHBA 2O89A 3GKXA 5ECIB 2LRTA 1HD2A 3IK9A 1ZMAA 3P7XA 1A2LA 5ID2B 2YJ7A 2JSZA 4O5RA 2K8VA 2PERA 4HJ2A 1ABAA 1G0TA 3FYGA 5G1KA 4LL4B 3HZ8A 1I9DA 2X8CA 2MMZA 3D6IA 1AC1A 4GXZA 3VWWA 5F8BA 4O5UA 4X1UA 5DBQA 4L8EA 2DJKA 4I2UA 2H1GA 2G2QA 4TXOA 2O85A 4G10A 2YNXA 1E2YA 4BL7A 1U6TA 3GA4A 3CYNA 2LSTA 2CVDA 4ML6A 4BVYB 3VWVA 5HFIA 2L4CA 1ZYEA 4KAEA 2GQLA 3ZFBA 1SKSB 2M80A 4QQ7A 4ZBDA 3D21A 6GSYA 3RHBA 4MJAA 5ELAA 5FHIA 1DSBA 1XZOA 3US3A 3ZRDA 3N5OA 1T7PB 2NDOA 1TU8A 2GGTA 2F8AA 2IMFA 2MMNA 3GNJA 3KIJA 3MSZA 4BA7A 2HRFA 3HVVA 3HY2A 5HQPA 3TUEA 3NZNA 1BQ7A 5ECNB 2MZCA 4GSNA 1O85A 3I9V2 1O73A 1SD8A 4EVMA 2CX3A 3PR8A 2VLVA 1Z6NA 2GSSA 3A5WA 2JZSA 3DVXA 1M2DA 5F0GA 3IPZA 4KB3A 4TR1A 1AXDA 1K0MA 4J57E 3LWAA 1U3AA 4K2DA 2IN3A 4PURA 3DWVA 1OVNA 3R2QA 3KP8A 4TR3A 2BJXA 1XFLA 1ERUA 4XS6A 2C8UA 2VCZA 1K0CA 1WPIA 1B8XA 1YKCA 3ED3A 1S3DA 3TOTA 1R5AA 4KDUA 3H93A 4PGTA 4WR5A 2HRNA 3G7IA 2FA8A 4CHSA 2DLXA 4AGSA 5HR3A 1FOHA 5B8BA 1XCCA 1MDJA 2JZRA 3FRCA 4LL1B 3QD9A 4DVCA 2FWEA 3F0IA 4HI7A 5EPFA 5KN3A 3A2VA 1VF1A 1K3OA 4L0WA 2C0GA 4ECIA 1HNCA 3DRNA 3L78A 4CW9A 4KW6A 5HFGA 1N2AA 4FQUA 3DKSA 2IFQA 3A5IA 1ZZYA 4L0UA 3KCMA 4Z2RA 3KXOA 2LTKA 1OYJA 4EKZA 1TK0B 2JSYA 1XWCA 5C00A 2YN1A 1PL2A 4BPYA 2H0GA 5J5NA 16GSA 3FEUA 4V1Ap 1BG5A 2CAIA 3TRPA 4KCAA 1K0BA 4IJIA 4RI6A 3HYPA 4GF0A 2K8SA 3GKMA 5H5RA 2DIZA 4D73B 5DQYA 2WJUA 5G5EA 3TOUA 1SKRB 3JCML 2GLRA 3CSIA 2VLUA 3CRUA 4OFTA 3HZ4A 4L5OA 3IC4A 3QAVA 2MMOA 1JZOA 1Z5YE 5F05A 5CREA 1V57A 1VGLA 2CZ3A 3ZREA 3QFBC 4Q5RA 2GSQA 2H1AA 1R5PA 3H79A 2E2GA 1OKTA 3HD5A 1T4ZA 2GQMA 4PX1A 4IHUA 1DE2A 3QPMA 3GL3A 5CP1A 2EIQA 3LXZA 4KH7A 3D22A 1NW2A 2LUSA 2F3MA 1M2BA 1GSEA 3GV1A 5CRHA 3PH9A 2VUPA 2FHEA 2OBIA 4HEA2 1EOHA 3HVSA 1EGOA 5ECRB 3UL3A 5IMDA 1GLQA 1XW5A 3GKKA 3N9JA 2H30A 3ME7A 3MWHA 2ZNMA 3A2WA 5F06A 5LCZA 2PVQA 3TJJA 3HJOA 4RQXA 3VLNA 1OE7A 2V2GA 4WXTA 4EE0A 2VL2A 1U88A 2H6YA 2TRCP 1THOA 1Z7RA 3GRXA 1SU9A 5CNWA 1J08A 3EMXA 2IMIA 1PD21 1FHEA 1A8LA 3ME8A 2N5AA 2YV9A 3CTFA 2V6KA 2H70A 4RQRA 1GH2A 5HFKA 4K9ZA 4MLYA 1V2AA 3V1WA 5A4UA 2IIYA 3SWLA 4ZB9A 4Q5FA 3LJRA 2XHFA 5GZZB 2REMA 3BD2A 4V2MA 2B6MA 2R4VA 4QL9A 4AF2A 2YWNA 5ECOB 4ZBBA 3TJGA 3KMNA 6GSUA 1WP0A 3ZMLA 4KCEA 3QAGA 1K0NA 2O8VB 3ZL5A 5IIZA 1FG4A 5JCUA 5IO0A 2YZUA 2KP2A 1W89A 3G7JA 2B5XA 3U6VA 1BAYA 2RLIA 3UARA 3P90A 4HQZA 3LQ7A 2DMLA 3DGQA 4EDZA 1SL0B 3S9FA 2KLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G9H A;  1GSQ A;  1B9Y C;  1ZYQ B;  1T8E B;  3GN3 A;  1X9W B;  4E8E A;  3DXB A;  5IQY A;  4I97 A;  3LSZ A;  1VF2 A;  4K1F A;  1EV4 A;  5J41 A;  5D93 A;  1NHY A;  3DD3 A;  2XPE A;  4IN0 A;  2IPA A;  3EE2 A;  3L4N A;  4POM A;  4WEY A;  2GDR A;  4TVE A;  2C0D A;  4IKH A;  1H4O A;  2KUC A;  2I9H A;  2VCX A;  5G31 A;  3TKQ A;  3FZ9 A;  2C1Y A;  5DAL B;  5GAN D;  3A2X A;  5ENU A;  1XWB A;  3WT1 A;  3GKN A;  1IYH A;  2RM5 A;  4PNG A;  4ECB A;  5JCG A;  2FGX A;  2AJQ B;  3RPN A;  4N0V A;  2FD3 A;  3H1N A;  2G0F A;  2HFD A;  2RM6 A;  1YEX A;  3QFA C;  5D9W A;  5B7C A;  4MAB A;  4CDO A;  4IS0 A;  2A2R A;  3J7Y b;  5CRD A;  3A3T A;  3VWX A;  4MCU A;  3EYT A;  4WBR D;  4XCS A;  3Q19 A;  2ES7 A;  2N5F A;  4XS1 A;  1UVZ A;  3L9V A;  2OAD A;  5ECP B;  4Z7X A;  3AY8 A;  4XRA A;  3HJP A;  3QCP A;  1GSS A;  18GS A;  3FR3 A;  2A4V A;  4H86 A;  3ERF A;  5J9C A;  5KN2 A;  4F82 A;  2XBI A;  4MF6 A;  2BTO T;  4O32 A;  3CMI A;  2J23 A;  4MPF A;  4K7N A;  4MH3 A;  1LU4 A;  2WFC A;  3VFI A;  2DJ2 A;  2CZ2 A;  4TXO B;  2MBS A;  2B7K A;  1MDK A;  2H8L A;  2VLT A;  4FYB A;  3HHV A;  2VAF A;  4FYU A;  4PQI A;  3MAK A;  2VO4 A;  3KD0 A;  2QSI A;  2LRC A;  5IMV A;  3UAP A;  1ZGN A;  1HQO A;  1DUG A;  2C80 A;  1JZR A;  1XW6 A;  3I69 A;  4ECC A;  1ZL9 A;  4ID0 A;  6GSX A;  4POB A;  2LNS A;  1OAZ A;  4J56 E;  4N11 A;  1GUK A;  2DBC A;  4EDY A;  3H4K A;  2LNT A;  3KGK A;  4KND A;  2E2M A;  1S3C A;  4BWQ A;  1JZD A;  4Q5N A;  2HXK A;  4XHM A;  5IPH A;  1FW1 A;  3E0U A;  2I4A A;  2AV4 A;  4WR4 A;  2FY6 A;  4TR1 B;  3WYW A;  5LNK e;  5DQS A;  1X5D A;  3LXT A;  1YZX A;  4FO5 A;  13GS A;  3FW2 A;  2VM1 A;  1PSQ A;  5E59 A;  1F2E A;  2L6D A;  4POL A;  4YQU A;  2VD0 A;  2VM2 A;  1S3A A;  3QDN A;  4ZB8 A;  1QUW A;  2DJ0 A;  4WBJ A;  5DVB A;  3C73 A;  3TKS A;  3LYK A;  3APS A;  1T00 A;  2WGR A;  4ZIL A;  4OFN A;  1SD9 A;  1GTA A;  1Z3E A;  1TK8 B;  3EU4 A;  4MZC A;  5DAK A;  20GS A;  3UVH A;  1USB A;  4DSS A;  2OE1 A;  5INY A;  2AAW A;  2M46 A;  1A2J A;  5COH A;  4OCF A;  5AN1 A;  2C3N A;  5AIV A;  2LJR A;  1O8X A;  1ON4 A;  1ZOF A;  1GSD A;  2QC7 A;  2H6Z A;  4K0G A;  3W6G A;  1JLV A;  3VI7 A;  2B5E A;  2IFQ B;  1AQX A;  3P2A A;  5IMA A;  2L5O A;  3W8J A;  5KEJ A;  1AUC A;  3KH9 A;  4P3Y B;  3HCZ A;  4EO3 A;  2NPB A;  3TRQ A;  1T3B A;  2HE3 A;  2YZH A;  1FVJ A;  1NHO A;  3GTU A;  1V98 A;  2DIY A;  2B1L A;  2C3Q A;  3UBK A;  2H19 A;  3G7Y A;  5IMF A;  2XBQ A;  1TK5 B;  4MK3 A;  3E9J B;  5ECL B;  3WGD A;  2GZP A;  1EV9 A;  2R5G A;  1PX7 A;  2YWO A;  1Z9H A;  1QXH A;  3TB2 A;  2GS3 A;  1M9A A;  1Q4J A;  1UN2 A;  2X8H A;  1SJI A;  3CXG A;  4QL7 A;  3BCK A;  4GLT A;  2H76 A;  1TU7 A;  1KTE A;  5ABR A;  3DEX A;  3IA1 A;  3FR6 A;  5DDL A;  3DML A;  1AQW A;  4TN8 A;  3APQ A;  1JZW A;  1FVK A;  3GFK A;  3TKS C;  5B6M A;  1TRU A;  4IP1 A;  2TIR A;  2ON5 A;  5D9T A;  4ZBA A;  1ACV A;  3KTL A;  2HZE B;  2F8F A;  2FWH A;  2R3X A;  5G30 A;  2V6O A;  2KHP A;  5D9V A;  4WF4 A;  5F07 A;  3KM6 A;  3EC3 A;  5H5S A;  2I1U A;  5JCW A;  4V2L A;  1YF0 A;  4IW9 A;  3IE3 A;  1A2M A;  2PN8 A;  1C72 A;  5C04 A;  1OKD A;  1AAZ A;  4EL1 A;  1SK1 A;  14GS A;  4TOP A;  1XVW A;  2V41 A;  5KN1 A;  2L4Q A;  2LQQ A;  3U5R E;  4G2E A;  1UA5 A;  1PMT A;  4KUN A;  3D0Z A;  6GSW A;  4ZL8 A;  3D5J A;  4MA9 A;  5AGY A;  2NTO A;  5G1L A;  4WKW A;  4MH2 A;  8GSS A;  1A0R P;  2YAN A;  4F2I A;  1FB0 A;  2NBS A;  3HKR A;  2OJL A;  2IMD A;  2MYG A;  3BBY A;  3CBU A;  2R6K A;  1OE8 A;  5JWR B;  3WD6 A;  2R2J A;  2WUL A;  4O7H A;  3HA9 A;  4MMM A;  1E6B A;  1SJ6 A;  5G2Z A;  1GTU A;  5FT3 A;  3F6D A;  1AW9 A;  1M2A A;  3M1G A;  1DBY A;  5B8A A;  2H0I A;  2YWM A;  4HU9 A;  3EWL A;  4OWY A;  2AB6 A;  3KTB A;  1K3Y A;  2RUE A;  4GWR A;  4L5L A;  2CV4 A;  2WZ9 A;  3KZQ A;  1YQ1 A;  3ZZX A;  3HJM A;  2B5Y A;  3UJ1 A;  3GH6 A;  1Z7P A;  2WCI A;  4JED A;  5EVO A;  1WMJ A;  4JU5 A;  1M7T A;  4I5Q A;  4ACS A;  2PU9 C;  3VUR A;  3TGZ A;  1YEP A;  4OCE A;  4TW5 A;  2N5B A;  4NXI A;  1MD3 A;  2P5Q A;  3LG6 A;  1KEB A;  4ZL7 A;  2HI7 A;  2WS2 A;  3ISO A;  2H75 A;  3IHQ A;  5IMZ A;  1R4W A;  2BMX A;  1YF1 A;  1SEN A;  4J2F A;  2OAC A;  4KSM A;  3VI5 A;  2C3T A;  2H6X A;  3EVI A;  4IVF A;  5CAX A;  4F0B A;  3UEM A;  1GUH A;  3KEB A;  2O87 A;  4E8H A;  2FLS A;  5J3R A;  12GS A;  4K8M A;  1MD4 A;  2HZF A;  2YP6 A;  2ZUP A;  5J9B A;  3ERG A;  2V32 A;  1BJX A;  4NHZ A;  4N30 A;  1TXX A;  1BX9 A;  1F3A A;  3FR9 A;  2DSA A;  2GTU A;  3ZFL A;  2VCT A;  2L57 A;  1F37 A;  3ZIJ A;  1N8J A;  4MF5 A;  4YAP A;  3TRX A;  3L9S A;  1V58 A;  4JRR A;  4XS4 A;  4MP4 A;  1PRX A;  3FKF A;  4AJ8 A;  1SL2 B;  4ML1 A;  2GT6 A;  2NVL A;  4XTS A;  1J0F A;  1TRV A;  2B7J A;  1TI3 A;  1TTZ A;  3Q6O A;  3PIN A;  2K9F A;  5ELG A;  1NM3 A;  1VF3 A;  1O81 A;  1M99 A;  3I6A A;  1SK0 A;  4HDE A;  3RHC A;  5DCG A;  2HLS A;  3F4S A;  1HNB A;  4IJ3 A;  5D8I A;  6GSS A;  1NSW A;  1YY7 A;  3ZIV A;  2VL2 C;  1XOB A;  5LD0 A;  4JBB A;  3DYR A;  6GSV A;  3CSJ A;  1EP7 A;  1PKZ A;  3IAM 2;  1SYX A;  2EIR A;  5IM9 A;  3EU3 A;  3LGC A;  4NHW A;  4RUV A;  4TR4 A;  2PPT A;  4KX4 A;  2YWI A;  3VK9 A;  1ML6 A;  3ZLP A;  4O92 A;  3F3R A;  4ZIJ A;  2OE3 A;  3LOR A;  3GMF A;  1GUL A;  1K0O A;  5CO3 A;  1QGV A;  3NIV A;  1JLW A;  1ERW A;  1OC9 A;  2HYX A;  4JE1 A;  3TJF A;  4N0Z A;  1EEM A;  4EXJ A;  3MNG A;  3G9B A;  3WGX A;  3C1R A;  1TJD A;  4FH8 A;  3O76 A;  9GSS A;  2H1B A;  4HQS A;  5CRG A;  1F3B A;  4LLR A;  2H1D A;  3FK8 A;  4WET A;  1ERT A;  1A8Y A;  4KE3 A;  1SJZ A;  2YOI A;  3ERW A;  2M72 A;  3GSS A;  3D4T A;  4HJM A;  2WDU A;  3ZTL A;  1GTB A;  5DAK B;  2B3S A;  2VCV A;  1WJK A;  4KGI A;  4DSS B;  1GL8 A;  1EZK A;  4OO4 A;  2H72 A;  2CT6 A;  1IYI A;  2H73 A;  3M0F A;  5CRW A;  1M0U A;  4GST A;  3GUS A;  3QR6 A;  3VWU A;  1BYE A;  5A5K A;  1G6Y A;  4IQ1 A;  3CSH A;  3F8U A;  3UOM A;  4PQH A;  2AHE A;  1ILO A;  2DJ3 A;  1B48 A;  3D4M A;  3GTU B;  1K0A A;  4KA0 A;  2X8G A;  1HNA A;  2LEG A;  3I43 A;  4I2T A;  1F6M C;  1PX6 A;  4Q5Q A;  3IBH A;  5DAL A;  1QK8 A;  5IPG A;  4MF7 A;  1GNE A;  2TRX A;  3CTG A;  2P31 A;  1EGR A;  1THX A;  2Z9S A;  2JU5 A;  2VD1 A;  10GS A;  4PUF C;  1XXU A;  5D96 A;  2H71 A;  1JFU A;  3APO A;  1K0D A;  3IAS 2;  3MDK A;  1GSY A;  3GST A;  4IBP A;  2QKE A;  5A4V A;  4BVX A;  4F03 A;  1FOV A;  4KSO A;  4PUA A;  4NV5 A;  1T4Y A;  1PGT A;  4HOJ A;  2LRN A;  1CQG A;  4IEL A;  2F9S A;  2JL4 A;  3QOU A;  4JR4 A;  4I6X A;  4LMW A;  2LJK A;  3L0H A;  4PNF A;  4HZ2 A;  4YQV A;  4NAX A;  1HYU A;  3GYK A;  4JR6 A;  3GH9 A;  4TRX A;  4MZW A;  2HSY A;  2IMK A;  2R37 A;  2X99 A;  1KBN A;  1TDI A;  2WRT A;  2H74 A;  3Q74 A;  1WIK A;  5ECQ B;  5JWQ B;  2V1M A;  2L59 A;  2HSH A;  1B4Q A;  3FZ5 A;  3OR5 A;  1TW9 A;  2DC5 A;  4PQ1 A;  1M9B A;  2LS5 A;  5HR0 A;  4OD7 A;  2OE0 A;  3RDW A;  1A0F A;  1U87 A;  2PWJ A;  3ZVJ A;  6GST A;  1URM A;  4XRD A;  1TKD B;  2YJH A;  2I3Y A;  2WB9 A;  3EMP A;  3HVX A;  3ZYW A;  2E7P A;  2H66 A;  1TRW A;  2CQ9 A;  3LFL A;  3BJ5 A;  2YCD A;  1AQV A;  1GWC A;  2H0H A;  1WRY A;  3Q18 A;  5DCH A;  1SL1 B;  3RAZ A;  3UBL A;  2PMT A;  5DJL A;  1GSU A;  3ZVJ D;  5ID2 A;  4IGJ A;  1YDK A;  1W4V A;  2J9H A;  2PBJ A;  2ON7 A;  1H75 A;  2JZT A;  2QGV A;  4LMV A;  2O7K A;  3KP9 A;  4FYC A;  4X43 A;  1X0R A;  2MBT A;  2LKU A;  3TKS E;  4GTU A;  3PGT A;  1G6W A;  3H8Q A;  4POK A;  1GNW A;  1FB6 A;  2L6C A;  1XW9 A;  3P8W A;  1RK4 A;  1GSF A;  3IXR A;  2VCW A;  4ZL9 A;  3VPQ A;  3WGE A;  2VCQ A;  3F4R A;  3UIW A;  4BVY A;  5H5Q A;  3C8E A;  4EF0 A;  4HUA A;  2D2Z A;  1MTC A;  3FY7 A;  3IR4 A;  3TJK A;  5ECK B;  2K6V A;  2IWT A;  3VPT A;  1R7H A;  2XPD A;  1F9M A;  4XIH A;  4MJC A;  1PA3 A;  2XC2 A;  4TR0 A;  1GUM A;  4OFM A;  2AYT A;  4HU7 A;  3F3Q A;  3GX0 A;  2HT9 A;  3K8N A;  1ERV A;  5AIX A;  5EL8 A;  5D9X A;  1SKW B;  1UC7 A;  2CVK A;  1OC8 A;  1ZCP A;  5B6N A;  5ECM B;  1QQ2 A;  1FAA A;  3ZIT A;  2VIM A;  1TP9 A;  1T1V A;  4GQF A;  2P5R A;  3TDG A;  2KOK A;  4EC0 A;  3FZA A;  3IOS A;  1EWX A;  1J9B A;  3RBT A;  5GST A;  1XWK A;  5FWG A;  1LBK A;  1XBS A;  1K3L A;  4LA1 A;  3BCI A;  4MDC A;  4AJ7 A;  1OC3 A;  3TKR A;  3UVT A;  19GS A;  2LQO A;  5AIS A;  1X5E A;  1YKA A;  4XS4 B;  2HNL A;  4KDY A;  1AIU A;  1U3I A;  1QFN A;  3F6F A;  2PVO C;  2CA8 A;  2IJY A;  4ECJ A;  2EIO A;  2LJA A;  4ILF A;  5ECS A;  5E4W A;  3EUR A;  1O8W A;  2IL3 A;  4RI7 A;  1MDI A;  4FIW A;  2HZE A;  5IO2 A;  4YH2 A;  5J4U A;  2EC4 A;  1EP8 A;  4TXV A;  1RQM A;  1GLP A;  5IMC A;  4K7O A;  4BWS A;  1XPV A;  3HXS A;  2L5L A;  4N10 A;  4DEJ A;  1MEK A;  3CRT A;  2FCH A;  3GIX A;  1EOG A;  3IRA A;  4ISD A;  1Z6M A;  3WT2 A;  5GAP D;  4MPG A;  1B9X C;  3E3E A;  3TJB A;  2E0Q A;  4D73 A;  4GQC A;  5L71 A;  3HDC A;  3M9K A;  5IOX A;  3M9J A;  3UMA A;  4HS1 A;  4X0X A;  2ZCT A;  4V2N A;  4K0N A;  2F51 A;  2DJJ A;  4NWY A;  2VL9 A;  5GSS A;  2GVP A;  4DSQ A;  2CAQ A;  4NMU A;  3C7M A;  1OC9 B;  3J7Y k;  1X5C A;  2FWG A;  3IK7 A;  3M3M A;  2RII A;  1I5G A;  4F0C A;  3GX8 A;  2AUV A;  1QMV A;  4F9Z A;  1X9S B;  1V9W A;  4YQM A;  2MMA A;  3NOF A;  2CX4 A;  3GL5 A;  1GRX A;  1XWA A;  4GCI A;  4EUY A;  2GST A;  4YAV A;  4KDX A;  2C4J A;  2YPM A;  2ALB A;  3IDV A;  3QMX A;  1G7E A;  4DSR A;  3DIE A;  3F4T A;  4WF5 A;  1SYR A;  1DE1 A;  1B4P A;  2A2S A;  2P0G A;  3F9U A;  3TCO A;  2C0E A;  1TI1 A;  2FNO A;  1XVQ A;  4K6X A;  2DMM A;  3SBC A;  1WE0 A;  4OO5 A;  3FZ4 A;  3KH7 A;  1EEJ A;  2VOC A;  1A23 A;  1TRS A;  1XIY A;  1X9M B;  4MJB A;  1XWG A;  3F63 A;  2LV3 A;  1PN9 A;  3BOA A;  4V1A g;  4I8B A;  2JAC A;  3L9U A;  5DJM A;  1GP1 A;  5EY6 A;  2JAD A;  3ZMK A;  4GRF A;  2RUF A;  2C0F A;  3TKP A;  5CYY A;  2OA7 A;  2OKA A;  5G5F A;  2GT5 A;  2FA4 A;  3QAW A;  1A24 A;  4ZXG A;  2B1K A;  3M8N A;  2PUK C;  5IOW A;  2H01 A;  3GHA A;  11GS A;  4GSS A;  1V40 A;  2GSR A;  3IV4 A;  1VF4 A;  4ULX A;  3O6T A;  2VL3 A;  1PQN A;  1FO5 A;  3W8S A;  4G19 A;  1PL1 A;  2X64 A;  1ST9 A;  3KMO A;  2PGT A;  1WWJ A;  1R26 A;  2YV7 A;  4IQA A;  4NPB A;  5KN0 A;  1TOF A;  3FHK A;  1XOA A;  1G7O A;  3EIN A;  4NV2 A;  1SK2 A;  5HR1 A;  5HR2 A;  1KNG A;  2DJ1 A;  4MJE A;  2FWF A;  3DVW A;  4ZB6 A;  4AJ6 A;  4JZQ A;  1Q98 A;  2GQK A;  2GZY A;  2FUG 2;  5JWO B;  4PXO A;  4K7I A;  3O3T A;  2I81 A;  4OMV A;  2K18 A;  1O7U A;  2GZZ A;  5ECH B;  3C1S A;  3C71 A;  1LJR A;  5D73 A;  2IME A;  3RPP A;  4TKY A;  1WOU A;  4MZB A;  4HZ4 A;  1Y6E A;  2CVB A;  22GS A;  17GS A;  1O6J A;  3LYP A;  4IP6 A;  1YJ6 A;  1GTI A;  3KJY A;  2KP1 A;  3GUR A;  1BED A;  5A4W A;  1PKW A;  1VRS D;  3LEF A;  1RW1 A;  2OBK A;  1CQH A;  1Y25 A;  7GSS A;  1JHB A;  2O89 A;  3GKX A;  5ECI B;  2LRT A;  1HD2 A;  3IK9 A;  1ZMA A;  3P7X A;  1A2L A;  5ID2 B;  2YJ7 A;  2JSZ A;  4O5R A;  2K8V A;  2PER A;  4HJ2 A;  1ABA A;  1G0T A;  3FYG A;  5G1K A;  4LL4 B;  3HZ8 A;  1I9D A;  2X8C A;  2MMZ A;  3D6I A;  1AC1 A;  4GXZ A;  3VWW A;  5F8B A;  4X1U A;  5DBQ A;  4L8E A;  2DJK A;  4I2U A;  2H1G A;  2G2Q A;  4TXO A;  2O85 A;  4G10 A;  2YNX A;  1E2Y A;  4BL7 A;  1U6T A;  3GA4 A;  3CYN A;  2LST A;  2CVD A;  4ML6 A;  3VWV A;  5HFI A;  2L4C A;  1ZYE A;  4KAE A;  2GQL A;  3ZFB A;  1SKS B;  2M80 A;  4QQ7 A;  4ZBD A;  3D21 A;  6GSY A;  3RHB A;  4MJA A;  5ELA A;  5FHI A;  1DSB A;  1XZO A;  3US3 A;  3ZRD A;  3N5O A;  1T7P B;  2NDO A;  1TU8 A;  2GGT A;  2F8A A;  2IMF A;  2MMN A;  3GNJ A;  3KIJ A;  3MSZ A;  4BA7 A;  2HRF A;  3HVV A;  3HY2 A;  5HQP A;  3TUE A;  3NZN A;  1BQ7 A;  5ECN B;  2MZC A;  4GSN A;  1O85 A;  3I9V 2;  1O73 A;  1SD8 A;  4EVM A;  2CX3 A;  3PR8 A;  2VLV A;  1Z6N A;  2GSS A;  3A5W A;  2JZS A;  3DVX A;  1M2D A;  5F0G A;  3IPZ A;  4KB3 A;  4TR1 A;  1AXD A;  1K0M A;  4J57 E;  3LWA A;  1U3A A;  4K2D A;  2IN3 A;  4PUR A;  3DWV A;  1OVN A;  3R2Q A;  3KP8 A;  4TR3 A;  2BJX A;  1XFL A;  1ERU A;  4XS6 A;  2C8U A;  2VCZ A;  1K0C A;  1WPI A;  1B8X A;  1YKC A;  3ED3 A;  1S3D A;  3TOT A;  1R5A A;  4KDU A;  3H93 A;  4PGT A;  4WR5 A;  2HRN A;  3G7I A;  2FA8 A;  4CHS A;  2DLX A;  4AGS A;  5HR3 A;  5B8B A;  1XCC A;  1MDJ A;  2JZR A;  3FRC A;  4LL1 B;  3QD9 A;  4DVC A;  2FWE A;  3F0I A;  4HI7 A;  5EPF A;  5KN3 A;  3A2V A;  1VF1 A;  1K3O A;  4L0W A;  2C0G A;  4ECI A;  1HNC A;  3DRN A;  3L78 A;  4CW9 A;  4KW6 A;  5HFG A;  1N2A A;  3DKS A;  2IFQ A;  1ZZY A;  4L0U A;  3KCM A;  3KXO A;  2LTK A;  1OYJ A;  4EKZ A;  1TK0 B;  2JSY A;  1XWC A;  5C00 A;  2YN1 A;  1PL2 A;  4BPY A;  2H0G A;  5J5N A;  16GS A;  3FEU A;  4V1A p;  1BG5 A;  2CAI A;  3TRP A;  4KCA A;  1K0B A;  4IJI A;  4RI6 A;  3HYP A;  4GF0 A;  2K8S A;  3GKM A;  5H5R A;  2DIZ A;  4D73 B;  5DQY A;  2WJU A;  5G5E A;  3TOU A;  1SKR B;  3JCM L;  2GLR A;  3CSI A;  2VLU A;  3CRU A;  4OFT A;  3HZ4 A;  4L5O A;  3IC4 A;  3QAV A;  2MMO A;  1JZO A;  1Z5Y E;  5F05 A;  5CRE A;  1V57 A;  1VGL A;  2CZ3 A;  3ZRE A;  3QFB C;  4Q5R A;  2GSQ A;  2H1A A;  1R5P A;  3H79 A;  2E2G A;  1OKT A;  3HD5 A;  1T4Z A;  2GQM A;  4PX1 A;  4IHU A;  1DE2 A;  3QPM A;  3GL3 A;  5CP1 A;  2EIQ A;  3LXZ A;  4KH7 A;  3D22 A;  1NW2 A;  2LUS A;  2F3M A;  1M2B A;  1GSE A;  3GV1 A;  5CRH A;  3PH9 A;  2VUP A;  2FHE A;  2OBI A;  4HEA 2;  1EOH A;  3HVS A;  1EGO A;  5ECR B;  3UL3 A;  5IMD A;  1GLQ A;  1XW5 A;  3GKK A;  3N9J A;  2H30 A;  3ME7 A;  2ZNM A;  3A2W A;  3MWH A;  5F06 A;  5LCZ A;  2PVQ A;  3TJJ A;  3HJO A;  4RQX A;  3VLN A;  1OE7 A;  2V2G A;  4WXT A;  4EE0 A;  2VL2 A;  1U88 A;  2H6Y A;  2TRC P;  1THO A;  1Z7R A;  3GRX A;  1SU9 A;  5CNW A;  1J08 A;  3EMX A;  2IMI A;  1PD2 1;  1FHE A;  1A8L A;  3ME8 A;  2N5A A;  2YV9 A;  3CTF A;  2V6K A;  2H70 A;  4RQR A;  1GH2 A;  5HFK A;  4K9Z A;  4MLY A;  1V2A A;  3V1W A;  5A4U A;  2IIY A;  3SWL A;  4ZB9 A;  4Q5F A;  3LJR A;  2XHF A;  5GZZ B;  2REM A;  3BD2 A;  4V2M A;  2B6M A;  2R4V A;  4QL9 A;  4AF2 A;  2YWN A;  5ECO B;  4ZBB A;  3TJG A;  3KMN A;  6GSU A;  1WP0 A;  3ZML A;  4KCE A;  3QAG A;  1K0N A;  2O8V B;  3ZL5 A;  5IIZ A;  1FG4 A;  5JCU A;  5IO0 A;  2YZU A;  2KP2 A;  1W89 A;  3G7J A;  2B5X A;  3U6V A;  1BAY A;  2RLI A;  3UAR A;  3P90 A;  4HQZ A;  3LQ7 A;  2DML A;  3DGQ A;  4EDZ A;  1SL0 B;  3S9F A;  2KLX A; 
#chains in the Genus database with same CATH topology
 4G9H A;  1GSQ A;  1B9Y C;  1ZYQ B;  1T8E B;  3GN3 A;  1X9W B;  4E8E A;  3DXB A;  5IQY A;  4I97 A;  3LSZ A;  1VF2 A;  4PTS A;  4K1F A;  1EV4 A;  5J41 A;  5D93 A;  1NHY A;  3DD3 A;  2XPE A;  4IN0 A;  2IPA A;  3EE2 A;  5BMU A;  3L4N A;  4POM A;  4WEY A;  2GDR A;  4TVE A;  2C0D A;  4IKH A;  1H4O A;  2KUC A;  2I9H A;  2VCX A;  5G31 A;  3TKQ A;  3FZ9 A;  2C1Y A;  5DAL B;  5GAN D;  3A2X A;  5ENU A;  1XWB A;  3WT1 A;  3GKN A;  1IYH A;  3IC8 A;  2RM5 A;  4PNG A;  4ECB A;  2UZ8 A;  5JCG A;  2FGX A;  3PPU A;  2AJQ B;  3RPN A;  4N0V A;  2FD3 A;  3H1N A;  2G0F A;  2HFD A;  2RM6 A;  1YEX A;  3QFA C;  5D9W A;  5B7C A;  4MAB A;  4CDO A;  4IS0 A;  2A2R A;  3J7Y b;  2R0P A;  5CRD A;  3A3T A;  3VWX A;  4MCU A;  3EYT A;  4WBR D;  4CY6 A;  4XCS A;  3Q19 A;  2QA1 A;  2ES7 A;  2N5F A;  4XS1 A;  1UVZ A;  3L9V A;  2OAD A;  5ECP B;  4Z7X A;  3AY8 A;  4XRA A;  4BVX B;  3HJP A;  3QCP A;  1GSS A;  18GS A;  3FR3 A;  2A4V A;  4H86 A;  3ERF A;  5J9C A;  5KN2 A;  4F82 A;  2XBI A;  4MF6 A;  2BTO T;  4O32 A;  3CMI A;  2J23 A;  4MPF A;  4K7N A;  4MH3 A;  1LU4 A;  2WFC A;  3VFI A;  2DJ2 A;  2CZ2 A;  4TXO B;  2MBS A;  2B7K A;  1MDK A;  2H8L A;  2VLT A;  4FYB A;  4BL7 B;  3HHV A;  4Z2T A;  2VAF A;  4FYU A;  1PN0 A;  4PQI A;  3MAK A;  2VO4 A;  3KD0 A;  2QSI A;  2LRC A;  5IMV A;  3UAP A;  1ZGN A;  1HQO A;  1DUG A;  2C80 A;  1JZR A;  1XW6 A;  3I69 A;  4ECC A;  1ZL9 A;  4ID0 A;  6GSX A;  4POB A;  2LNS A;  1OAZ A;  4J56 E;  4N11 A;  1GUK A;  2DBC A;  4EDY A;  3H4K A;  2LNT A;  3KGK A;  4KND A;  2E2M A;  1S3C A;  4BWQ A;  1JZD A;  4Q5N A;  2HXK A;  4XHM A;  5IPH A;  1FW1 A;  3E0U A;  2I4A A;  2AV4 A;  4WR4 A;  2FY6 A;  4TR1 B;  3WYW A;  5LNK e;  5DQS A;  1X5D A;  3LXT A;  1YZX A;  4FO5 A;  13GS A;  3FW2 A;  2VM1 A;  3MYD A;  1PSQ A;  5E59 A;  1F2E A;  2L6D A;  4POL A;  4YQU A;  3LW9 A;  2VD0 A;  2VM2 A;  1S3A A;  3QDN A;  4ZB8 A;  1QUW A;  2R0C A;  2DJ0 A;  4WBJ A;  5DVB A;  3C73 A;  3TKS A;  3LYK A;  3APS A;  1T00 A;  2WGR A;  4ZIL A;  4OFN A;  1SD9 A;  1GTA A;  1Z3E A;  1TK8 B;  3EU4 A;  4MZC A;  5DAK A;  20GS A;  3UVH A;  1USB A;  4DSS A;  2OE1 A;  5INY A;  2AAW A;  2M46 A;  1A2J A;  5COH A;  3IHG A;  4OCF A;  5AN1 A;  2C3N A;  5AIV A;  2LJR A;  1O8X A;  1ON4 A;  1ZOF A;  1GSD A;  2QC7 A;  2H6Z A;  4K0G A;  3W6G A;  1JLV A;  3VI7 A;  2B5E A;  2IFQ B;  1AQX A;  3P2A A;  5IMA A;  2L5O A;  3W8J A;  5KEJ A;  1AUC A;  3KH9 A;  4P3Y B;  3HCZ A;  4EO3 A;  2NPB A;  3TRQ A;  1T3B A;  2HE3 A;  2YZH A;  1FVJ A;  1NHO A;  3GTU A;  1V98 A;  2DIY A;  2B1L A;  2C3Q A;  3UBK A;  2H19 A;  3G7Y A;  5IMF A;  2XBQ A;  1TK5 B;  4MK3 A;  3E9J B;  5ECL B;  3WGD A;  2GZP A;  1EV9 A;  2R5G A;  1PX7 A;  2YWO A;  1Z9H A;  1QXH A;  3TB2 A;  2GS3 A;  1M9A A;  1Q4J A;  1UN2 A;  2X8H A;  1SJI A;  3CXG A;  4QL7 A;  3BCK A;  4GLT A;  2H76 A;  2A4H A;  1TU7 A;  1KTE A;  5ABR A;  3DEX A;  3IA1 A;  3FR6 A;  5DDL A;  3DML A;  4USS A;  1AQW A;  4TN8 A;  3APQ A;  1JZW A;  2HRK A;  1FVK A;  4HSC X;  3GFK A;  3TKS C;  5B6M A;  1TRU A;  4IP1 A;  2TIR A;  2ON5 A;  5D9T A;  4ZBA A;  1ACV A;  3KTL A;  2HZE B;  2F8F A;  2FWH A;  2R3X A;  5G30 A;  2V6O A;  2KHP A;  5D9V A;  4WF4 A;  5F07 A;  3KM6 A;  3EC3 A;  2DKI A;  5H5S A;  2I1U A;  5JCW A;  4V2L A;  1YF0 A;  4IW9 A;  3MIX A;  3IE3 A;  1A2M A;  2PN8 A;  1C72 A;  5C04 A;  1OKD A;  1AAZ A;  4EL1 A;  1SK1 A;  14GS A;  4TOP A;  1XVW A;  2V41 A;  5KN1 A;  2L4Q A;  2LQQ A;  3U5R E;  4G2E A;  4KF9 A;  1UA5 A;  1PMT A;  4KUN A;  3D0Z A;  6GSW A;  4ZL8 A;  3D5J A;  4K5S A;  4MA9 A;  5AGY A;  2NTO A;  5G1L A;  2X4A A;  4WKW A;  4MH2 A;  8GSS A;  1A0R P;  2YAN A;  4F2I A;  1FB0 A;  2NBS A;  3HKR A;  2OJL A;  2IMD A;  2MYG A;  3BBY A;  3CBU A;  2R6K A;  1OE8 A;  5KOX A;  5JWR B;  3WD6 A;  2R2J A;  4YKF A;  2WUL A;  4O7H A;  3HA9 A;  4MMM A;  1E6B A;  1SJ6 A;  5G2Z A;  1GTU A;  5FT3 A;  3F6D A;  1AW9 A;  1M2A A;  3M1G A;  1DBY A;  5B8A A;  2H0I A;  2YWM A;  4HU9 A;  3EWL A;  4OWY A;  2AB6 A;  3KTB A;  1K3Y A;  2RUE A;  4GWR A;  4L5L A;  2CV4 A;  2WZ9 A;  3KZQ A;  1YQ1 A;  4CY8 A;  3ZZX A;  3HJM A;  2B5Y A;  3UJ1 A;  3GH6 A;  1Z7P A;  2WCI A;  4JED A;  5EVO A;  1WMJ A;  4JU5 A;  1M7T A;  4I5Q A;  4ACS A;  2PU9 C;  3VUR A;  3TGZ A;  1YEP A;  4OCE A;  4TW5 A;  2N5B A;  4NXI A;  1MD3 A;  2P5Q A;  3LG6 A;  1KEB A;  4ZL7 A;  2HI7 A;  2R0G A;  2WS2 A;  3ISO A;  2X49 A;  2H75 A;  3IHQ A;  5IMZ A;  1R4W A;  2BMX A;  1YF1 A;  1SEN A;  4J2F A;  2OAC A;  4KSM A;  3VI5 A;  2C3T A;  2H6X A;  3EVI A;  4IVF A;  5CAX A;  4F0B A;  3UEM A;  1GUH A;  3KEB A;  2O87 A;  4E8H A;  2FLS A;  5J3R A;  12GS A;  4K8M A;  1MD4 A;  2HZF A;  2YP6 A;  2ZUP A;  5J9B A;  3ERG A;  2V32 A;  1BJX A;  4NHZ A;  4N30 A;  1TXX A;  1BX9 A;  4G0L A;  1F3A A;  3FR9 A;  2DSA A;  2GTU A;  3ZFL A;  2VCT A;  2L57 A;  1F37 A;  3ZIJ A;  1N8J A;  4MF5 A;  4YAP A;  3TRX A;  3L9S A;  1V58 A;  4JRR A;  4XS4 A;  4MP4 A;  1PRX A;  3FKF A;  4AJ8 A;  1SL2 B;  4ML1 A;  2GT6 A;  2NVL A;  4XTS A;  1J0F A;  1TRV A;  2B7J A;  1TI3 A;  1TTZ A;  3Q6O A;  3PIN A;  2K9F A;  5ELG A;  1NM3 A;  1VF3 A;  1O81 A;  1M99 A;  3I6A A;  1SK0 A;  4HDE A;  3RHC A;  5DCG A;  2HLS A;  3F4S A;  4A5P A;  1HNB A;  4IJ3 A;  5D8I A;  6GSS A;  1NSW A;  1YY7 A;  3ZIV A;  2VL2 C;  1XOB A;  5LD0 A;  4JBB A;  3DYR A;  6GSV A;  3CSJ A;  1EP7 A;  1PKZ A;  3IAM 2;  1SYX A;  2EIR A;  5IM9 A;  3EU3 A;  3LGC A;  4NHW A;  4RUV A;  4TR4 A;  2PPT A;  4KX4 A;  2YWI A;  3VK9 A;  1ML6 A;  3ZLP A;  4O92 A;  3F3R A;  4ZIJ A;  2OE3 A;  3LOR A;  3GMF A;  1GUL A;  1K0O A;  5CO3 A;  1QGV A;  3NIV A;  1JLW A;  1ERW A;  1OC9 A;  2HYX A;  4JE1 A;  3TJF A;  4N0Z A;  1EEM A;  4EXJ A;  3MNG A;  3G9B A;  3WGX A;  3C1R A;  1TJD A;  4FH8 A;  3O76 A;  9GSS A;  2H1B A;  4HQS A;  5CRG A;  1F3B A;  4LLR A;  2H1D A;  3FK8 A;  4WET A;  1ERT A;  1A8Y A;  4KE3 A;  1SJZ A;  2YOI A;  3ERW A;  2M72 A;  3GSS A;  3D4T A;  4HJM A;  2WDU A;  3ZTL A;  1GTB A;  5DAK B;  2B3S A;  2VCV A;  1WJK A;  4KGI A;  2HRA A;  4DSS B;  1GL8 A;  1EZK A;  4OO4 A;  2H72 A;  2CT6 A;  1IYI A;  2H73 A;  4K2X A;  3M0F A;  5CRW A;  1M0U A;  4GST A;  5BRT A;  3GUS A;  3QR6 A;  3VWU A;  1BYE A;  5A5K A;  1G6Y A;  4IQ1 A;  3CSH A;  3F8U A;  3UOM A;  4PQH A;  2AHE A;  1ILO A;  2DJ3 A;  1B48 A;  3D4M A;  4MNN A;  3GTU B;  1K0A A;  4KA0 A;  2X8G A;  2HSM A;  1HNA A;  2LEG A;  3I43 A;  4I2T A;  1F6M C;  1PX6 A;  4Q5Q A;  3IBH A;  5DAL A;  1QK8 A;  5IPG A;  4MF7 A;  1GNE A;  2TRX A;  3CTG A;  2P31 A;  1EGR A;  1THX A;  2Z9S A;  2JU5 A;  2VD1 A;  10GS A;  4PUF C;  1XXU A;  5D96 A;  2H71 A;  1JFU A;  3APO A;  1K0D A;  3IAS 2;  3MDK A;  1GSY A;  2A2P A;  3GST A;  4IBP A;  2QKE A;  5A4V A;  4BVX A;  4F03 A;  1FOV A;  4KSO A;  4PUA A;  4G0I A;  4NV5 A;  1T4Y A;  1PGT A;  4HOJ A;  2LRN A;  1M3I A;  1CQG A;  4IEL A;  2F9S A;  2JL4 A;  3QOU A;  4JR4 A;  4I6X A;  4LMW A;  2LJK A;  3L0H A;  4PNF A;  4HZ2 A;  4YQV A;  4NAX A;  1HYU A;  3GYK A;  4JR6 A;  3GH9 A;  4TRX A;  4MZW A;  2HSY A;  2IMK A;  2R37 A;  2X99 A;  1KBN A;  1TDI A;  2WRT A;  2H74 A;  3Q74 A;  1WIK A;  5ECQ B;  5JWQ B;  2V1M A;  2L59 A;  2HSH A;  1B4Q A;  3FZ5 A;  3OR5 A;  1TW9 A;  2DC5 A;  4PQ1 A;  1M9B A;  2LS5 A;  5HR0 A;  4OD7 A;  2OE0 A;  3RDW A;  1A0F A;  1U87 A;  2PWJ A;  3ZVJ A;  6GST A;  1URM A;  4XRD A;  1TKD B;  2YJH A;  2I3Y A;  2DKH A;  2WB9 A;  4G0K A;  3EMP A;  3HVX A;  3ZYW A;  2E7P A;  2H66 A;  1TRW A;  2CQ9 A;  3LFL A;  3BJ5 A;  2YCD A;  1AQV A;  1GWC A;  2H0H A;  1WRY A;  3Q18 A;  5DCH A;  1SL1 B;  3RAZ A;  3UBL A;  2PMT A;  5DJL A;  1GSU A;  3ZVJ D;  5ID2 A;  4IGJ A;  1YDK A;  1W4V A;  2J9H A;  2PBJ A;  2ON7 A;  1H75 A;  2JZT A;  2QGV A;  4LMV A;  2O7K A;  3KP9 A;  4FYC A;  4X43 A;  1X0R A;  2MBT A;  4Z2U A;  2LKU A;  3TKS E;  4GTU A;  3PGT A;  1G6W A;  3H8Q A;  4POK A;  1GNW A;  1FB6 A;  2L6C A;  1XW9 A;  3P8W A;  1RK4 A;  1GSF A;  3IXR A;  2VCW A;  4ZL9 A;  3VPQ A;  3WGE A;  2VCQ A;  3F4R A;  3UIW A;  4BVY A;  5H5Q A;  3C8E A;  4EF0 A;  4HUA A;  2D2Z A;  1MTC A;  3FY7 A;  3IR4 A;  3TJK A;  5ECK B;  2K6V A;  2IWT A;  3VPT A;  1R7H A;  2XPD A;  1F9M A;  4XIH A;  4MJC A;  1PA3 A;  2XC2 A;  4TR0 A;  1GUM A;  4OFM A;  2AYT A;  4HU7 A;  3F3Q A;  3GX0 A;  2HT9 A;  3K8N A;  1ERV A;  5AIX A;  5EL8 A;  5D9X A;  1SKW B;  1UC7 A;  2CVK A;  1OC8 A;  1ZCP A;  5B6N A;  5ECM B;  1QQ2 A;  1FAA A;  3ZIT A;  2VIM A;  1TP9 A;  1T1V A;  4GQF A;  2P5R A;  3TDG A;  2KOK A;  4EC0 A;  3FZA A;  3IOS A;  1EWX A;  1J9B A;  3RBT A;  5GST A;  1XWK A;  5FWG A;  1LBK A;  1XBS A;  1K3L A;  4LA1 A;  3BCI A;  4MDC A;  4AJ7 A;  1OC3 A;  3TKR A;  3UVT A;  19GS A;  2LQO A;  5AIS A;  1X5E A;  1YKA A;  4XS4 B;  2HNL A;  4KDY A;  1AIU A;  1U3I A;  1QFN A;  3F6F A;  1ZYN A;  2PVO C;  2CA8 A;  2IJY A;  4ECJ A;  2EIO A;  4YKG A;  2LJA A;  4ILF A;  5ECS A;  5E4W A;  3EUR A;  1O8W A;  2IL3 A;  4RI7 A;  1MDI A;  4FIW A;  2HZE A;  5IO2 A;  4YH2 A;  5J4U A;  4EIQ A;  2EC4 A;  1EP8 A;  4TXV A;  1RQM A;  1GLP A;  5IMC A;  4K7O A;  4BWS A;  1XPV A;  3FMW A;  3HXS A;  2L5L A;  4N10 A;  4DEJ A;  1MEK A;  3CRT A;  2FCH A;  3GIX A;  1EOG A;  3IRA A;  4ISD A;  1Z6M A;  3WT2 A;  5GAP D;  4MPG A;  1B9X C;  3E3E A;  3TJB A;  2E0Q A;  4D73 A;  4GQC A;  5L71 A;  3HDC A;  3M9K A;  5IOX A;  3M9J A;  3UMA A;  4HS1 A;  4X0X A;  2ZCT A;  4V2N A;  4K0N A;  2F51 A;  2DJJ A;  4NWY A;  2VL9 A;  5GSS A;  2GVP A;  4DSQ A;  2CAQ A;  4NMU A;  3C7M A;  1OC9 B;  3J7Y k;  1X5C A;  2FWG A;  3IK7 A;  3M3M A;  2RII A;  1I5G A;  4F0C A;  3GX8 A;  2AUV A;  1QMV A;  4F9Z A;  1X9S B;  1V9W A;  4YQM A;  2MMA A;  3NOF A;  4BIK A;  2CX4 A;  3GL5 A;  1GRX A;  1XWA A;  4GCI A;  4EUY A;  2GST A;  4YAV A;  4KDX A;  5KOW A;  2C4J A;  2YPM A;  2ALB A;  3IDV A;  3QMX A;  1G7E A;  4DSR A;  3DIE A;  3F4T A;  4WF5 A;  1SYR A;  1DE1 A;  1B4P A;  2A2S A;  2P0G A;  3F9U A;  4K5R A;  4ICY A;  3TCO A;  2C0E A;  1TI1 A;  2FNO A;  1XVQ A;  4K6X A;  2DMM A;  3SBC A;  1WE0 A;  4OO5 A;  3R3E A;  3FZ4 A;  3KH7 A;  1EEJ A;  2VOC A;  1A23 A;  1TRS A;  1XIY A;  1X9M B;  4MJB A;  1XWG A;  3F63 A;  2LV3 A;  1PN9 A;  3BOA A;  4V1A g;  4I8B A;  2JAC A;  3L9U A;  5DJM A;  1GP1 A;  5EY6 A;  2JAD A;  3ZMK A;  4GRF A;  4X4J A;  2RUF A;  2C0F A;  3TKP A;  5CYY A;  2OA7 A;  2OKA A;  5G5F A;  2GT5 A;  2FA4 A;  3QAW A;  1A24 A;  4ZXG A;  2B1K A;  3M8N A;  2PUK C;  5IOW A;  2H01 A;  3GHA A;  11GS A;  4GSS A;  1V40 A;  2GSR A;  3IV4 A;  1VF4 A;  4ULX A;  3O6T A;  2VL3 A;  1PQN A;  1FO5 A;  3W8S A;  4G19 A;  1PL1 A;  2X64 A;  1ST9 A;  3KMO A;  2PGT A;  1WWJ A;  1R26 A;  2YV7 A;  4IQA A;  3EPT A;  4NPB A;  5KN0 A;  1TOF A;  3FHK A;  1XOA A;  1G7O A;  4EIP A;  3EIN A;  4NV2 A;  1SK2 A;  5HR1 A;  5HR2 A;  1KNG A;  2DJ1 A;  4MJE A;  2FWF A;  3DVW A;  4ZB6 A;  4AJ6 A;  4JZQ A;  1Q98 A;  2GQK A;  2GZY A;  2FUG 2;  5JWO B;  4PXO A;  4K7I A;  3O3T A;  2I81 A;  4OMV A;  2K18 A;  1O7U A;  2GZZ A;  1ZYP A;  5ECH B;  3C1S A;  3C71 A;  1LJR A;  5D73 A;  2IME A;  3RPP A;  4TKY A;  1WOU A;  4MZB A;  4HZ4 A;  1Y6E A;  2CVB A;  2QA2 A;  22GS A;  17GS A;  1O6J A;  3LYP A;  4IP6 A;  1YJ6 A;  1GTI A;  3KJY A;  2KP1 A;  3GUR A;  1BED A;  4O5Q A;  5A4W A;  1PKW A;  1VRS D;  3LEF A;  1RW1 A;  2OBK A;  1CQH A;  1Y25 A;  7GSS A;  1JHB A;  2O89 A;  3GKX A;  3HVN A;  5ECI B;  2LRT A;  1HD2 A;  3IK9 A;  1ZMA A;  3P7X A;  1A2L A;  5ID2 B;  2YJ7 A;  2JSZ A;  4O5R A;  2K8V A;  2PER A;  4HJ2 A;  1ABA A;  1G0T A;  3FYG A;  5G1K A;  4LL4 B;  3HZ8 A;  1I9D A;  2X8C A;  2MMZ A;  3D6I A;  1AC1 A;  4GXZ A;  3VWW A;  5F8B A;  4O5U A;  4X1U A;  5DBQ A;  4L8E A;  2DJK A;  4I2U A;  2H1G A;  2G2Q A;  4TXO A;  2O85 A;  4G10 A;  2YNX A;  1E2Y A;  4BL7 A;  1U6T A;  3GA4 A;  3CYN A;  2LST A;  2CVD A;  4ML6 A;  4BVY B;  3VWV A;  5HFI A;  2L4C A;  1XG8 A;  1ZYE A;  4KAE A;  2GQL A;  3ZFB A;  1SKS B;  2M80 A;  4QQ7 A;  4ZBD A;  3D21 A;  6GSY A;  3RHB A;  4MJA A;  5ELA A;  5FHI A;  1DSB A;  1XZO A;  3US3 A;  3ZRD A;  3N5O A;  1T7P B;  2NDO A;  1TU8 A;  2GGT A;  2F8A A;  2IMF A;  2MMN A;  3GNJ A;  3KIJ A;  3MSZ A;  4BA7 A;  2HRF A;  3HVV A;  3HY2 A;  5HQP A;  3TUE A;  3NZN A;  1BQ7 A;  5ECN B;  2MZC A;  4GSN A;  1O85 A;  3I9V 2;  1O73 A;  1SD8 A;  4EVM A;  2CX3 A;  1S3R A;  3PR8 A;  2VLV A;  1Z6N A;  2GSS A;  3A5W A;  2JZS A;  3DVX A;  1M2D A;  5F0G A;  3IPZ A;  4KB3 A;  4TR1 A;  1AXD A;  1K0M A;  4J57 E;  3LWA A;  1U3A A;  4K2D A;  2IN3 A;  4PUR A;  3DWV A;  1OVN A;  3R2Q A;  3KP8 A;  4TR3 A;  2BJX A;  1XFL A;  1ERU A;  4XS6 A;  2C8U A;  2VCZ A;  1K0C A;  1WPI A;  1B8X A;  1YKC A;  3ED3 A;  1S3D A;  3TOT A;  1R5A A;  4KDU A;  3H93 A;  4PGT A;  4WR5 A;  2HRN A;  3G7I A;  2FA8 A;  4CHS A;  2DLX A;  4AGS A;  5HR3 A;  1FOH A;  5B8B A;  1XCC A;  1MDJ A;  2JZR A;  3FRC A;  4LL1 B;  3QD9 A;  4DVC A;  2FWE A;  3F0I A;  4HI7 A;  5EPF A;  5KN3 A;  3A2V A;  1VF1 A;  1K3O A;  4L0W A;  2C0G A;  4ECI A;  1HNC A;  3DRN A;  3L78 A;  4CW9 A;  4KW6 A;  5HFG A;  1N2A A;  4FQU A;  3DKS A;  2IFQ A;  3A5I A;  1ZZY A;  4L0U A;  3KCM A;  4Z2R A;  3KXO A;  2LTK A;  1OYJ A;  4EKZ A;  1TK0 B;  2JSY A;  1XWC A;  5C00 A;  2YN1 A;  1PL2 A;  4BPY A;  2H0G A;  5J5N A;  16GS A;  3FEU A;  4V1A p;  1BG5 A;  2CAI A;  3TRP A;  4KCA A;  1K0B A;  4IJI A;  4RI6 A;  3HYP A;  4GF0 A;  2K8S A;  3GKM A;  5H5R A;  2DIZ A;  4D73 B;  5DQY A;  2WJU A;  5G5E A;  3TOU A;  1SKR B;  3JCM L;  2GLR A;  1PFO A;  3CSI A;  2VLU A;  3CRU A;  4OFT A;  3HZ4 A;  4L5O A;  3IC4 A;  3QAV A;  2MMO A;  1JZO A;  1Z5Y E;  5F05 A;  5CRE A;  1V57 A;  1VGL A;  2CZ3 A;  3ZRE A;  3QFB C;  4Q5R A;  2GSQ A;  2H1A A;  1R5P A;  3H79 A;  2E2G A;  1OKT A;  3HD5 A;  1T4Z A;  2GQM A;  4PX1 A;  4IHU A;  1DE2 A;  3QPM A;  3GL3 A;  5CP1 A;  2EIQ A;  3LXZ A;  4KH7 A;  3D22 A;  1NW2 A;  2LUS A;  2F3M A;  1M2B A;  1M3J A;  1GSE A;  3GV1 A;  5CRH A;  3PH9 A;  2VUP A;  2FHE A;  2OBI A;  4HEA 2;  1EOH A;  3HVS A;  1EGO A;  5ECR B;  3UL3 A;  5IMD A;  1GLQ A;  1XW5 A;  3GKK A;  3N9J A;  2H30 A;  3ME7 A;  3MWH A;  2ZNM A;  3A2W A;  5F06 A;  5LCZ A;  2PVQ A;  3TJJ A;  3HJO A;  4RQX A;  3VLN A;  1OE7 A;  2V2G A;  4WXT A;  4EE0 A;  2VL2 A;  1U88 A;  2H6Y A;  2TRC P;  1THO A;  1Z7R A;  3GRX A;  1SU9 A;  5CNW A;  1J08 A;  3EMX A;  2IMI A;  1PD2 1;  1FHE A;  1A8L A;  3ME8 A;  2N5A A;  2YV9 A;  3CTF A;  2V6K A;  2H70 A;  4RQR A;  1GH2 A;  5HFK A;  4K9Z A;  4MLY A;  1V2A A;  3V1W A;  5A4U A;  2IIY A;  3SWL A;  4ZB9 A;  4Q5F A;  3LJR A;  2XHF A;  5GZZ B;  2REM A;  3BD2 A;  4V2M A;  2B6M A;  2R4V A;  4QL9 A;  4AF2 A;  2YWN A;  5ECO B;  4ZBB A;  3TJG A;  3KMN A;  6GSU A;  1WP0 A;  3ZML A;  4KCE A;  3QAG A;  1K0N A;  2O8V B;  3ZL5 A;  5IIZ A;  1FG4 A;  5JCU A;  5IO0 A;  2YZU A;  2KP2 A;  1W89 A;  3G7J A;  3CQF A;  2B5X A;  3U6V A;  1BAY A;  2RLI A;  3UAR A;  3P90 A;  4HQZ A;  3LQ7 A;  2DML A;  3DGQ A;  4EDZ A;  1SL0 B;  3S9F A;  2KLX A; 
#chains in the Genus database with same CATH homology
 4G9H A;  1GSQ A;  1B9Y C;  1ZYQ B;  1T8E B;  3GN3 A;  1X9W B;  4E8E A;  3DXB A;  5IQY A;  4I97 A;  3LSZ A;  1VF2 A;  4PTS A;  4K1F A;  1EV4 A;  5J41 A;  5D93 A;  1NHY A;  3DD3 A;  2XPE A;  4IN0 A;  2IPA A;  3EE2 A;  5BMU A;  3L4N A;  4POM A;  4WEY A;  2GDR A;  4TVE A;  2C0D A;  4IKH A;  1H4O A;  2KUC A;  2I9H A;  2VCX A;  5G31 A;  3TKQ A;  3FZ9 A;  2C1Y A;  5DAL B;  5GAN D;  3A2X A;  5ENU A;  1XWB A;  3WT1 A;  3GKN A;  1IYH A;  3IC8 A;  2RM5 A;  4PNG A;  4ECB A;  2UZ8 A;  5JCG A;  2FGX A;  3PPU A;  2AJQ B;  3RPN A;  4N0V A;  2FD3 A;  3H1N A;  2G0F A;  2HFD A;  2RM6 A;  1YEX A;  3QFA C;  5D9W A;  5B7C A;  4MAB A;  4CDO A;  4IS0 A;  2A2R A;  3J7Y b;  2R0P A;  5CRD A;  3A3T A;  3VWX A;  4MCU A;  3EYT A;  4WBR D;  4CY6 A;  4XCS A;  3Q19 A;  2QA1 A;  2ES7 A;  2N5F A;  4XS1 A;  1UVZ A;  3L9V A;  2OAD A;  5ECP B;  4Z7X A;  3AY8 A;  4XRA A;  4BVX B;  3HJP A;  3QCP A;  1GSS A;  18GS A;  3FR3 A;  2A4V A;  4H86 A;  3ERF A;  5J9C A;  5KN2 A;  4F82 A;  2XBI A;  4MF6 A;  2BTO T;  4O32 A;  3CMI A;  2J23 A;  4MPF A;  4K7N A;  4MH3 A;  1LU4 A;  2WFC A;  3VFI A;  2DJ2 A;  2CZ2 A;  4TXO B;  2MBS A;  2B7K A;  1MDK A;  2H8L A;  2VLT A;  4FYB A;  4BL7 B;  3HHV A;  4Z2T A;  2VAF A;  4FYU A;  1PN0 A;  4PQI A;  3MAK A;  2VO4 A;  3KD0 A;  2QSI A;  2LRC A;  5IMV A;  3UAP A;  1ZGN A;  1HQO A;  1DUG A;  2C80 A;  1JZR A;  1XW6 A;  3I69 A;  4ECC A;  1ZL9 A;  4ID0 A;  6GSX A;  4POB A;  2LNS A;  1OAZ A;  4J56 E;  4N11 A;  1GUK A;  2DBC A;  4EDY A;  3H4K A;  2LNT A;  3KGK A;  4KND A;  2E2M A;  1S3C A;  4BWQ A;  1JZD A;  4Q5N A;  2HXK A;  4XHM A;  5IPH A;  1FW1 A;  3E0U A;  2I4A A;  2AV4 A;  4WR4 A;  2FY6 A;  4TR1 B;  3WYW A;  5LNK e;  5DQS A;  1X5D A;  3LXT A;  1YZX A;  4FO5 A;  13GS A;  3FW2 A;  2VM1 A;  3MYD A;  1PSQ A;  5E59 A;  1F2E A;  2L6D A;  4POL A;  4YQU A;  3LW9 A;  2VD0 A;  2VM2 A;  1S3A A;  3QDN A;  4ZB8 A;  1QUW A;  2R0C A;  2DJ0 A;  4WBJ A;  5DVB A;  3C73 A;  3TKS A;  3LYK A;  3APS A;  1T00 A;  2WGR A;  4ZIL A;  4OFN A;  1SD9 A;  1GTA A;  1Z3E A;  1TK8 B;  3EU4 A;  4MZC A;  5DAK A;  20GS A;  3UVH A;  1USB A;  4DSS A;  2OE1 A;  5INY A;  2AAW A;  2M46 A;  1A2J A;  5COH A;  3IHG A;  4OCF A;  5AN1 A;  2C3N A;  5AIV A;  2LJR A;  1O8X A;  1ON4 A;  1ZOF A;  1GSD A;  2QC7 A;  2H6Z A;  4K0G A;  3W6G A;  1JLV A;  3VI7 A;  2B5E A;  2IFQ B;  1AQX A;  3P2A A;  5IMA A;  2L5O A;  3W8J A;  5KEJ A;  1AUC A;  3KH9 A;  4P3Y B;  3HCZ A;  4EO3 A;  2NPB A;  3TRQ A;  1T3B A;  2HE3 A;  2YZH A;  1FVJ A;  1NHO A;  3GTU A;  1V98 A;  2DIY A;  2B1L A;  2C3Q A;  3UBK A;  2H19 A;  3G7Y A;  5IMF A;  2XBQ A;  1TK5 B;  4MK3 A;  3E9J B;  5ECL B;  3WGD A;  2GZP A;  1EV9 A;  2R5G A;  1PX7 A;  2YWO A;  1Z9H A;  1QXH A;  3TB2 A;  2GS3 A;  1M9A A;  1Q4J A;  1UN2 A;  2X8H A;  1SJI A;  3CXG A;  4QL7 A;  3BCK A;  4GLT A;  2H76 A;  2A4H A;  1TU7 A;  1KTE A;  5ABR A;  3DEX A;  3IA1 A;  3FR6 A;  5DDL A;  3DML A;  4USS A;  1AQW A;  4TN8 A;  3APQ A;  1JZW A;  2HRK A;  1FVK A;  3GFK A;  3TKS C;  5B6M A;  1TRU A;  4IP1 A;  2TIR A;  2ON5 A;  5D9T A;  4ZBA A;  1ACV A;  3KTL A;  2HZE B;  2F8F A;  2FWH A;  2R3X A;  5G30 A;  2V6O A;  2KHP A;  5D9V A;  4WF4 A;  5F07 A;  3KM6 A;  3EC3 A;  2DKI A;  5H5S A;  2I1U A;  5JCW A;  4V2L A;  1YF0 A;  4IW9 A;  3MIX A;  3IE3 A;  1A2M A;  2PN8 A;  1C72 A;  5C04 A;  1OKD A;  1AAZ A;  4EL1 A;  1SK1 A;  14GS A;  4TOP A;  1XVW A;  2V41 A;  5KN1 A;  2L4Q A;  2LQQ A;  3U5R E;  4G2E A;  4KF9 A;  1UA5 A;  1PMT A;  4KUN A;  3D0Z A;  6GSW A;  4ZL8 A;  3D5J A;  4K5S A;  4MA9 A;  5AGY A;  2NTO A;  5G1L A;  2X4A A;  4WKW A;  4MH2 A;  8GSS A;  1A0R P;  2YAN A;  4F2I A;  1FB0 A;  2NBS A;  3HKR A;  2OJL A;  2IMD A;  2MYG A;  3BBY A;  3CBU A;  2R6K A;  1OE8 A;  5KOX A;  5JWR B;  3WD6 A;  2R2J A;  4YKF A;  2WUL A;  4O7H A;  3HA9 A;  4MMM A;  1E6B A;  1SJ6 A;  5G2Z A;  1GTU A;  5FT3 A;  3F6D A;  1AW9 A;  1M2A A;  3M1G A;  1DBY A;  5B8A A;  2H0I A;  2YWM A;  4HU9 A;  3EWL A;  4OWY A;  2AB6 A;  3KTB A;  1K3Y A;  2RUE A;  4GWR A;  4L5L A;  2CV4 A;  2WZ9 A;  3KZQ A;  1YQ1 A;  4CY8 A;  3ZZX A;  3HJM A;  2B5Y A;  3UJ1 A;  3GH6 A;  1Z7P A;  2WCI A;  4JED A;  5EVO A;  1WMJ A;  4JU5 A;  1M7T A;  4I5Q A;  4ACS A;  2PU9 C;  3VUR A;  3TGZ A;  1YEP A;  4OCE A;  4TW5 A;  2N5B A;  4NXI A;  1MD3 A;  2P5Q A;  3LG6 A;  1KEB A;  4ZL7 A;  2HI7 A;  2R0G A;  2WS2 A;  3ISO A;  2X49 A;  2H75 A;  3IHQ A;  5IMZ A;  1R4W A;  2BMX A;  1YF1 A;  1SEN A;  4J2F A;  2OAC A;  4KSM A;  3VI5 A;  2C3T A;  2H6X A;  3EVI A;  4IVF A;  5CAX A;  4F0B A;  3UEM A;  1GUH A;  3KEB A;  2O87 A;  4E8H A;  2FLS A;  5J3R A;  12GS A;  4K8M A;  1MD4 A;  2HZF A;  2YP6 A;  2ZUP A;  5J9B A;  3ERG A;  2V32 A;  1BJX A;  4NHZ A;  4N30 A;  1TXX A;  1BX9 A;  4G0L A;  1F3A A;  3FR9 A;  2DSA A;  2GTU A;  3ZFL A;  2VCT A;  2L57 A;  1F37 A;  3ZIJ A;  1N8J A;  4MF5 A;  4YAP A;  3TRX A;  3L9S A;  1V58 A;  4JRR A;  4XS4 A;  4MP4 A;  1PRX A;  3FKF A;  4AJ8 A;  1SL2 B;  4ML1 A;  2GT6 A;  2NVL A;  4XTS A;  1J0F A;  1TRV A;  2B7J A;  1TI3 A;  1TTZ A;  3Q6O A;  3PIN A;  2K9F A;  5ELG A;  1NM3 A;  1VF3 A;  1O81 A;  1M99 A;  3I6A A;  1SK0 A;  4HDE A;  3RHC A;  5DCG A;  2HLS A;  3F4S A;  4A5P A;  1HNB A;  4IJ3 A;  5D8I A;  6GSS A;  1NSW A;  1YY7 A;  3ZIV A;  2VL2 C;  1XOB A;  5LD0 A;  4JBB A;  3DYR A;  6GSV A;  3CSJ A;  1EP7 A;  1PKZ A;  3IAM 2;  1SYX A;  2EIR A;  5IM9 A;  3EU3 A;  3LGC A;  4NHW A;  4RUV A;  4TR4 A;  2PPT A;  4KX4 A;  2YWI A;  3VK9 A;  1ML6 A;  3ZLP A;  4O92 A;  3F3R A;  4ZIJ A;  2OE3 A;  3LOR A;  3GMF A;  1GUL A;  1K0O A;  5CO3 A;  1QGV A;  3NIV A;  1JLW A;  1ERW A;  1OC9 A;  2HYX A;  4JE1 A;  3TJF A;  4N0Z A;  1EEM A;  4EXJ A;  3MNG A;  3G9B A;  3WGX A;  3C1R A;  1TJD A;  4FH8 A;  3O76 A;  9GSS A;  2H1B A;  4HQS A;  5CRG A;  1F3B A;  4LLR A;  2H1D A;  3FK8 A;  4WET A;  1ERT A;  1A8Y A;  4KE3 A;  1SJZ A;  2YOI A;  3ERW A;  2M72 A;  3GSS A;  3D4T A;  4HJM A;  2WDU A;  3ZTL A;  1GTB A;  5DAK B;  2B3S A;  2VCV A;  1WJK A;  4KGI A;  2HRA A;  4DSS B;  1GL8 A;  1EZK A;  4OO4 A;  2H72 A;  2CT6 A;  1IYI A;  2H73 A;  4K2X A;  3M0F A;  5CRW A;  1M0U A;  4GST A;  5BRT A;  3GUS A;  3QR6 A;  3VWU A;  1BYE A;  5A5K A;  1G6Y A;  4IQ1 A;  3CSH A;  3F8U A;  3UOM A;  4PQH A;  2AHE A;  1ILO A;  2DJ3 A;  1B48 A;  3D4M A;  4MNN A;  3GTU B;  1K0A A;  4KA0 A;  2X8G A;  2HSM A;  1HNA A;  2LEG A;  3I43 A;  4I2T A;  1F6M C;  1PX6 A;  4Q5Q A;  3IBH A;  5DAL A;  1QK8 A;  5IPG A;  4MF7 A;  1GNE A;  2TRX A;  3CTG A;  2P31 A;  1EGR A;  1THX A;  2Z9S A;  2JU5 A;  2VD1 A;  10GS A;  4PUF C;  1XXU A;  5D96 A;  2H71 A;  1JFU A;  3APO A;  1K0D A;  3IAS 2;  3MDK A;  1GSY A;  2A2P A;  3GST A;  4IBP A;  2QKE A;  5A4V A;  4BVX A;  4F03 A;  1FOV A;  4KSO A;  4PUA A;  4G0I A;  4NV5 A;  1T4Y A;  1PGT A;  4HOJ A;  2LRN A;  1CQG A;  4IEL A;  2F9S A;  2JL4 A;  3QOU A;  4JR4 A;  4I6X A;  4LMW A;  2LJK A;  3L0H A;  4PNF A;  4HZ2 A;  4YQV A;  4NAX A;  1HYU A;  3GYK A;  4JR6 A;  3GH9 A;  4TRX A;  4MZW A;  2HSY A;  2IMK A;  2R37 A;  2X99 A;  1KBN A;  1TDI A;  2WRT A;  2H74 A;  3Q74 A;  1WIK A;  5ECQ B;  5JWQ B;  2V1M A;  2L59 A;  2HSH A;  1B4Q A;  3FZ5 A;  3OR5 A;  1TW9 A;  2DC5 A;  4PQ1 A;  1M9B A;  2LS5 A;  5HR0 A;  4OD7 A;  2OE0 A;  3RDW A;  1A0F A;  1U87 A;  2PWJ A;  3ZVJ A;  6GST A;  1URM A;  4XRD A;  1TKD B;  2YJH A;  2I3Y A;  2DKH A;  2WB9 A;  4G0K A;  3EMP A;  3HVX A;  3ZYW A;  2E7P A;  2H66 A;  1TRW A;  2CQ9 A;  3LFL A;  3BJ5 A;  2YCD A;  1AQV A;  1GWC A;  2H0H A;  1WRY A;  3Q18 A;  5DCH A;  1SL1 B;  3RAZ A;  3UBL A;  2PMT A;  5DJL A;  1GSU A;  3ZVJ D;  5ID2 A;  4IGJ A;  1YDK A;  1W4V A;  2J9H A;  2PBJ A;  2ON7 A;  1H75 A;  2JZT A;  2QGV A;  4LMV A;  2O7K A;  3KP9 A;  4FYC A;  4X43 A;  1X0R A;  2MBT A;  4Z2U A;  2LKU A;  3TKS E;  4GTU A;  3PGT A;  1G6W A;  3H8Q A;  4POK A;  1GNW A;  1FB6 A;  2L6C A;  1XW9 A;  3P8W A;  1RK4 A;  1GSF A;  3IXR A;  2VCW A;  4ZL9 A;  3VPQ A;  3WGE A;  2VCQ A;  3F4R A;  3UIW A;  4BVY A;  5H5Q A;  3C8E A;  4EF0 A;  4HUA A;  2D2Z A;  1MTC A;  3FY7 A;  3IR4 A;  3TJK A;  5ECK B;  2K6V A;  2IWT A;  3VPT A;  1R7H A;  2XPD A;  1F9M A;  4XIH A;  4MJC A;  1PA3 A;  2XC2 A;  4TR0 A;  1GUM A;  4OFM A;  2AYT A;  4HU7 A;  3F3Q A;  3GX0 A;  2HT9 A;  3K8N A;  1ERV A;  5AIX A;  5EL8 A;  5D9X A;  1SKW B;  1UC7 A;  2CVK A;  1OC8 A;  1ZCP A;  5B6N A;  5ECM B;  1QQ2 A;  1FAA A;  3ZIT A;  2VIM A;  1TP9 A;  1T1V A;  4GQF A;  2P5R A;  3TDG A;  2KOK A;  4EC0 A;  3FZA A;  3IOS A;  1EWX A;  1J9B A;  3RBT A;  5GST A;  1XWK A;  5FWG A;  1LBK A;  1XBS A;  1K3L A;  4LA1 A;  3BCI A;  4MDC A;  4AJ7 A;  1OC3 A;  3TKR A;  3UVT A;  19GS A;  2LQO A;  5AIS A;  1X5E A;  1YKA A;  4XS4 B;  2HNL A;  4KDY A;  1AIU A;  1U3I A;  1QFN A;  3F6F A;  1ZYN A;  2PVO C;  2CA8 A;  2IJY A;  4ECJ A;  2EIO A;  4YKG A;  2LJA A;  4ILF A;  5ECS A;  5E4W A;  3EUR A;  1O8W A;  2IL3 A;  4RI7 A;  1MDI A;  4FIW A;  2HZE A;  5IO2 A;  4YH2 A;  5J4U A;  4EIQ A;  2EC4 A;  1EP8 A;  4TXV A;  1RQM A;  1GLP A;  5IMC A;  4K7O A;  4BWS A;  1XPV A;  3FMW A;  3HXS A;  2L5L A;  4N10 A;  4DEJ A;  1MEK A;  3CRT A;  2FCH A;  3GIX A;  1EOG A;  3IRA A;  4ISD A;  1Z6M A;  3WT2 A;  5GAP D;  4MPG A;  1B9X C;  3E3E A;  3TJB A;  2E0Q A;  4D73 A;  4GQC A;  5L71 A;  3HDC A;  3M9K A;  5IOX A;  3M9J A;  3UMA A;  4HS1 A;  4X0X A;  2ZCT A;  4V2N A;  4K0N A;  2F51 A;  2DJJ A;  4NWY A;  2VL9 A;  5GSS A;  2GVP A;  4DSQ A;  2CAQ A;  4NMU A;  3C7M A;  1OC9 B;  3J7Y k;  1X5C A;  2FWG A;  3IK7 A;  3M3M A;  2RII A;  1I5G A;  4F0C A;  3GX8 A;  2AUV A;  1QMV A;  4F9Z A;  1X9S B;  1V9W A;  4YQM A;  2MMA A;  3NOF A;  2CX4 A;  3GL5 A;  1GRX A;  1XWA A;  4GCI A;  4EUY A;  2GST A;  4YAV A;  4KDX A;  5KOW A;  2C4J A;  2YPM A;  2ALB A;  3IDV A;  3QMX A;  1G7E A;  4DSR A;  3DIE A;  3F4T A;  4WF5 A;  1SYR A;  1DE1 A;  1B4P A;  2A2S A;  2P0G A;  3F9U A;  4K5R A;  4ICY A;  3TCO A;  2C0E A;  1TI1 A;  2FNO A;  1XVQ A;  4K6X A;  2DMM A;  3SBC A;  1WE0 A;  4OO5 A;  3R3E A;  3FZ4 A;  3KH7 A;  1EEJ A;  2VOC A;  1A23 A;  1TRS A;  1XIY A;  1X9M B;  4MJB A;  1XWG A;  3F63 A;  2LV3 A;  1PN9 A;  3BOA A;  4V1A g;  4I8B A;  2JAC A;  3L9U A;  5DJM A;  1GP1 A;  5EY6 A;  2JAD A;  3ZMK A;  4GRF A;  4X4J A;  2RUF A;  2C0F A;  3TKP A;  5CYY A;  2OA7 A;  2OKA A;  5G5F A;  2GT5 A;  2FA4 A;  3QAW A;  1A24 A;  4ZXG A;  2B1K A;  3M8N A;  2PUK C;  5IOW A;  2H01 A;  3GHA A;  11GS A;  4GSS A;  1V40 A;  2GSR A;  3IV4 A;  1VF4 A;  4ULX A;  3O6T A;  2VL3 A;  1PQN A;  1FO5 A;  3W8S A;  4G19 A;  1PL1 A;  2X64 A;  1ST9 A;  3KMO A;  2PGT A;  1WWJ A;  1R26 A;  2YV7 A;  4IQA A;  3EPT A;  4NPB A;  5KN0 A;  1TOF A;  3FHK A;  1XOA A;  1G7O A;  4EIP A;  3EIN A;  4NV2 A;  1SK2 A;  5HR1 A;  5HR2 A;  1KNG A;  2DJ1 A;  4MJE A;  2FWF A;  3DVW A;  4ZB6 A;  4AJ6 A;  4JZQ A;  1Q98 A;  2GQK A;  2GZY A;  2FUG 2;  5JWO B;  4PXO A;  4K7I A;  3O3T A;  2I81 A;  4OMV A;  2K18 A;  1O7U A;  2GZZ A;  1ZYP A;  5ECH B;  3C1S A;  3C71 A;  1LJR A;  5D73 A;  2IME A;  3RPP A;  4TKY A;  1WOU A;  4MZB A;  4HZ4 A;  1Y6E A;  2CVB A;  2QA2 A;  22GS A;  17GS A;  1O6J A;  3LYP A;  4IP6 A;  1YJ6 A;  1GTI A;  3KJY A;  2KP1 A;  3GUR A;  1BED A;  4O5Q A;  5A4W A;  1PKW A;  1VRS D;  3LEF A;  1RW1 A;  2OBK A;  1CQH A;  1Y25 A;  7GSS A;  1JHB A;  2O89 A;  3GKX A;  5ECI B;  2LRT A;  1HD2 A;  3IK9 A;  1ZMA A;  3P7X A;  1A2L A;  5ID2 B;  2YJ7 A;  2JSZ A;  4O5R A;  2K8V A;  2PER A;  4HJ2 A;  1ABA A;  1G0T A;  3FYG A;  5G1K A;  4LL4 B;  3HZ8 A;  1I9D A;  2X8C A;  2MMZ A;  3D6I A;  1AC1 A;  4GXZ A;  3VWW A;  5F8B A;  4O5U A;  4X1U A;  5DBQ A;  4L8E A;  2DJK A;  4I2U A;  2H1G A;  2G2Q A;  4TXO A;  2O85 A;  4G10 A;  2YNX A;  1E2Y A;  4BL7 A;  1U6T A;  3GA4 A;  3CYN A;  2LST A;  2CVD A;  4ML6 A;  4BVY B;  3VWV A;  5HFI A;  2L4C A;  1ZYE A;  4KAE A;  2GQL A;  3ZFB A;  1SKS B;  2M80 A;  4QQ7 A;  4ZBD A;  3D21 A;  6GSY A;  3RHB A;  4MJA A;  5ELA A;  5FHI A;  1DSB A;  1XZO A;  3US3 A;  3ZRD A;  3N5O A;  1T7P B;  2NDO A;  1TU8 A;  2GGT A;  2F8A A;  2IMF A;  2MMN A;  3GNJ A;  3KIJ A;  3MSZ A;  4BA7 A;  2HRF A;  3HVV A;  3HY2 A;  5HQP A;  3TUE A;  3NZN A;  1BQ7 A;  5ECN B;  2MZC A;  4GSN A;  1O85 A;  3I9V 2;  1O73 A;  1SD8 A;  4EVM A;  2CX3 A;  3PR8 A;  2VLV A;  1Z6N A;  2GSS A;  3A5W A;  2JZS A;  3DVX A;  1M2D A;  5F0G A;  3IPZ A;  4KB3 A;  4TR1 A;  1AXD A;  1K0M A;  4J57 E;  3LWA A;  1U3A A;  4K2D A;  2IN3 A;  4PUR A;  3DWV A;  1OVN A;  3R2Q A;  3KP8 A;  4TR3 A;  2BJX A;  1XFL A;  1ERU A;  4XS6 A;  2C8U A;  2VCZ A;  1K0C A;  1WPI A;  1B8X A;  1YKC A;  3ED3 A;  1S3D A;  3TOT A;  1R5A A;  4KDU A;  3H93 A;  4PGT A;  4WR5 A;  2HRN A;  3G7I A;  2FA8 A;  4CHS A;  2DLX A;  4AGS A;  5HR3 A;  1FOH A;  5B8B A;  1XCC A;  1MDJ A;  2JZR A;  3FRC A;  4LL1 B;  3QD9 A;  4DVC A;  2FWE A;  3F0I A;  4HI7 A;  5EPF A;  5KN3 A;  3A2V A;  1VF1 A;  1K3O A;  4L0W A;  2C0G A;  4ECI A;  1HNC A;  3DRN A;  3L78 A;  4CW9 A;  4KW6 A;  5HFG A;  1N2A A;  4FQU A;  3DKS A;  2IFQ A;  3A5I A;  1ZZY A;  4L0U A;  3KCM A;  4Z2R A;  3KXO A;  2LTK A;  1OYJ A;  4EKZ A;  1TK0 B;  2JSY A;  1XWC A;  5C00 A;  2YN1 A;  1PL2 A;  4BPY A;  2H0G A;  5J5N A;  16GS A;  3FEU A;  4V1A p;  1BG5 A;  2CAI A;  3TRP A;  4KCA A;  1K0B A;  4IJI A;  4RI6 A;  3HYP A;  4GF0 A;  2K8S A;  3GKM A;  5H5R A;  2DIZ A;  4D73 B;  5DQY A;  2WJU A;  5G5E A;  3TOU A;  1SKR B;  3JCM L;  2GLR A;  3CSI A;  2VLU A;  3CRU A;  4OFT A;  3HZ4 A;  4L5O A;  3IC4 A;  3QAV A;  2MMO A;  1JZO A;  1Z5Y E;  5F05 A;  5CRE A;  1V57 A;  1VGL A;  2CZ3 A;  3ZRE A;  3QFB C;  4Q5R A;  2GSQ A;  2H1A A;  1R5P A;  3H79 A;  2E2G A;  1OKT A;  3HD5 A;  1T4Z A;  2GQM A;  4PX1 A;  4IHU A;  1DE2 A;  3QPM A;  3GL3 A;  5CP1 A;  2EIQ A;  3LXZ A;  4KH7 A;  3D22 A;  1NW2 A;  2LUS A;  2F3M A;  1M2B A;  1GSE A;  3GV1 A;  5CRH A;  3PH9 A;  2VUP A;  2FHE A;  2OBI A;  4HEA 2;  1EOH A;  3HVS A;  1EGO A;  5ECR B;  3UL3 A;  5IMD A;  1GLQ A;  1XW5 A;  3GKK A;  3N9J A;  2H30 A;  3ME7 A;  3MWH A;  2ZNM A;  3A2W A;  5F06 A;  5LCZ A;  2PVQ A;  3TJJ A;  3HJO A;  4RQX A;  3VLN A;  1OE7 A;  2V2G A;  4WXT A;  4EE0 A;  2VL2 A;  1U88 A;  2H6Y A;  2TRC P;  1THO A;  1Z7R A;  3GRX A;  1SU9 A;  5CNW A;  1J08 A;  3EMX A;  2IMI A;  1PD2 1;  1FHE A;  1A8L A;  3ME8 A;  2N5A A;  2YV9 A;  3CTF A;  2V6K A;  2H70 A;  4RQR A;  1GH2 A;  5HFK A;  4K9Z A;  4MLY A;  1V2A A;  3V1W A;  5A4U A;  2IIY A;  3SWL A;  4ZB9 A;  4Q5F A;  3LJR A;  2XHF A;  5GZZ B;  2REM A;  3BD2 A;  4V2M A;  2B6M A;  2R4V A;  4QL9 A;  4AF2 A;  2YWN A;  5ECO B;  4ZBB A;  3TJG A;  3KMN A;  6GSU A;  1WP0 A;  3ZML A;  4KCE A;  3QAG A;  1K0N A;  2O8V B;  3ZL5 A;  5IIZ A;  1FG4 A;  5JCU A;  5IO0 A;  2YZU A;  2KP2 A;  1W89 A;  3G7J A;  2B5X A;  3U6V A;  1BAY A;  2RLI A;  3UAR A;  3P90 A;  4HQZ A;  3LQ7 A;  2DML A;  3DGQ A;  4EDZ A;  1SL0 B;  3S9F A;  2KLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...