2KP2A

Solution structure of the b' domain of thermophilic fungal protein disulfide isomerase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
133
structure length
133
Chain Sequence
GPLGSPLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNLKTDKFPAFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein disulfide-isomerase
publication title Redox-Dependent Domain Rearrangement of Protein Disulfide Isomerase Coupled with Exposure of Its Substrate-Binding Hydrophobic Surface
pubmed doi rcsb
source organism Humicola insolens
molecule tags Isomerase
total genus 30
structure length 133
sequence length 133
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2009-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2kp2A01
3TGZA 1ON4A 1GSYA 5G31A 2LRCA 2H75A 3VPTA 2C0GA 5EL8A 5IMVA 4PQ1A 1KEBA 3VWXA 2B5XA 4MJAA 5G2ZA 2EIRA 4HJMA 3BCIA 1WMJA 4NV2A 1V40A 4LL1B 2E2MA 4O32A 3GFKA 4I2UA 1PX6A 1A0FA 1O85A 2BMXA 3IC4A 3NIVA 3BCKA 5CREA 2VCWA 3GKXA 4HUAA 1JLWA 5JCUA 5DJMA 2I1UA 2H1BA 3F6DA 1PSQA 4F0CA 1FHEA 4KA0A 3GKKA 1YY7A 4TR1B 5GSTA 4EO3A 3F63A 1JZDA 2Z9SA 4IQ1A 5ID2A 2B6MA 2F8FA 1JZOA 2IL3A 1I9DA 2E0QA 2V1MA 2AJQB 1F2EA 1OVNA 1SD8A 1TI3A 3APQA 1EZKA 4NHWA 4PURA 2LJKA 4KUNA 2CX4A 2FD3A 3N5OA 4DSQA 2NBSA 1MD3A 2JZRA 2OE1A 3TOTA 3EE2A 1LBKA 3Q18A 4EKZA 1M2DA 4YQVA 5DQSA 8GSSA 3LXTA 4MJCA 4ACSA 5GSSA 2H74A 3A5WA 2HZFA 2QC7A 1QFNA 5D8IA 4MABA 3FZ5A 5B6MA 3BOAA 3M9KA 4ML1A 4KW6A 1OC9A 1OKTA 4ULXA 4E8HA 4TN8A 4X0XA 1FB6A 3GH6A 2GZYA 2A2RA 3S9FA 4ZB6A 1TRVA 4I6XA 1SYXA 2L6DA 4LMVA 1BEDA 3D22A 1Q4JA 3M0FA 1R4WA 4J57E 2FGXA 3TB2A 3UMAA 4DVCA 2L4CA 4HZ2A 1QUWA 5D9XA 4EF0A 5IOWA 1F37A 5DAKA 5FWGA 3KGKA 1XPVA 2LRTA 3DGQA 2DJ1A 2C3NA 1N8JA 3LYPA 2N5FA 2WJUA 2QKEA 5HR0A 2H1AA 3FR6A 4EDYA 3GIXA 1Z6NA 4WF4A 4F9ZA 1VRSD 3IXRA 3GSTA 2L5OA 5IO0A 2F9SA 4MJEA 4JEDA 3L9UA 3DVXA 4NV5A 1SU9A 2N5AA 1W89A 2IMFA 3LGCA 3APOA 3FHKA 1K3LA 1YEXA 5ECQB 1G7EA 3TDGA 5B8BA 1FOVA 1R5PA 2FLSA 5E59A 4NMUA 11GSA 1WP0A 3ZVJA 4PQHA 4GSSA 3GTUB 1A2LA 4IELA 2IPAA 1A8YA 2MMAA 1RW1A 2HLSA 2E7PA 2DJ3A 5GAND 5KN0A 3EC3A 2FA8A 1OE8A 2O7KA 3KMNA 3ZRDA 2VLTA 1XIYA 3DWVA 5G30A 10GSA 3IRAA 3KJYA 2O87A 4MZBA 4KDXA 3GN3A 3WYWA 2J9HA 4N11A 2FUG2 3US3A 4D73B 4O7HA 1EV4A 1FVKA 2MMZA 5ECRB 2N5BA 5D9TA 1R26A 1F3BA 2WS2A 3KP9A 5HR3A 2HZEA 4MK3A 4L5LA 5HR2A 4KX4A 3F8UA 2O8VB 2YP6A 4EVMA 4JE1A 3U6VA 1GTAA 4TKYA 3GH9A 2H70A 5IOXA 4AJ7A 4IJ3A 1K0NA 3F4TA 3D21A 1OAZA 2YZHA 2C1YA 2HT9A 1YZXA 3APSA 2VCXA 1S3DA 3FZ9A 2YWIA 4FYCA 2C3QA 4POLA 2H19A 6GSUA 2R4VA 2YANA 5IM9A 1DUGA 4RI7A 5J5NA 4F2IA 1GP1A 3E0UA 4ZL8A 1ST9A 3PGTA 2V41A 3VWVA 1K0CA 2HNLA 2H1GA 1K3OA 2RM5A 5B6NA 3FKFA 1PMTA 2R5GA 5ECPB 4ECJA 4Q5FA 3ZTLA 3I9V2 3FZ4A 2EC4A 4TRXA 2ON5A 1M99A 1KNGA 4LA1A 4XS4B 4IHUA 1AQVA 4CHSA 4POBA 2LQOA 3CBUA 4WBJA 2GSQA 1TI1A 4PXOA 1X5EA 1M0UA 4CDOA 2P5RA 1XBSA 4ML6A 3KD0A 2GDRA 4MA9A 3GX8A 4IGJA 5HFGA 2LQQA 3DD3A 1XXUA 3CSJA 4HOJA 1U6TA 3D6IA 4OMVA 2B1LA 4YQMA 4K6XA 4ZXGA 2RUFA 2MMNA 4I5QA 1TRSA 2O89A 5ECSA 2XC2A 3GMFA 3IHQA 4HDEA 1SL2B 1Q98A 3VURA 2AUVA 3HJMA 1LJRA 5FHIA 1MDJA 4K8MA 3LEFA 2P5QA 3ZITA 1DE1A 3QPMA 3FYGA 1ZCPA 2IN3A 1AXDA 1TTZA 4HZ4A 5IMAA 1XVWA 3KH7A 2YV7A 2LRNA 3GV1A 3ZIJA 1SJIA 6GSTA 1NM3A 3DRNA 1G6WA 1K0MA 2WB9A 4I2TA 1IYIA 4OD7A 1O81A 1NHYA 2H6YA 3TRPA 4IVFA 4PQIA 1N2AA 3EU4A 2CAQA 2B7KA 1XWGA 1TK0B 3QAWA 4GCIA 4H86A 1SKSB 4N0ZA 4BL7A 1T7PB 1ERVA 4ZBBA 3HZ4A 5JWOB 1KTEA 4TXOB 1BG5A 1G0TA 4LL4B 4RI6A 1UC7A 4HEA2 1GSSA 4NXIA 1Z3EA 3TKRA 4BPYA 3UEMA 2X8HA 1K0DA 3ME7A 1B9XC 4CW9A 3GNJA 2DJ0A 5D93A 5A4UA 1VF1A 2HSYA 3CXGA 2IJYA 3FR9A 2D2ZA 1MDIA 2X99A 5DDLA 3GKMA 2NTOA 2XPDA 2LJAA 3G7YA 3ZMLA 1XOBA 5D96A 3C73A 2IMEA 4WF5A 1ZMAA 1GSQA 1SYRA 2GTUA 5DQYA 1PD21 3FZAA 4DSSA 1BYEA 3M1GA 2I9HA 4GF0A 3H8QA 5C04A 2R2JA 1S3CA 1EOHA 1Z9HA 2H6ZA 2M80A 1WWJA 2ZCTA 4FH8A 1ZYEA 4MMMA 5KN1A 2K8SA 3HZ8A 5D9WA 5CRWA 3F4RA 4K0GA 3TJKA 4NPBA 3NZNA 1GTBA 2IMDA 4XRAA 2YJHA 4WKWA 1V57A 4MJBA 1FG4A 1HD2A 6GSSA 2YOIA 4L5OA 2WZ9A 1J0FA 3D4TA 2KP2A 1EOGA 4ZBAA 3IPZA 1ZGNA 1PGTA 2CAIA 4K7NA 4WEYA 4P3YB 1B48A 1MTCA 5F06A 3D4MA 1BX9A 2YWOA 5KN2A 1XWBA 3ISOA 2GT5A 1YJ6A 5ABRA 3HHVA 2DSAA 4Z7XA 4YAPA 4KB3A 4O5RA 1FVJA 1VGLA 3W8JA 4K1FA 1YKAA 5EPFA 2LUSA 3FK8A 4ZB8A 2LS5A 4KAEA 4AJ8A 3AY8A 3LSZA 2A2SA 1U88A 2C4JA 3MNGA 2PN8A 5ECMB 2YCDA 1F3AA 5HQPA 2FWHA 2FHEA 12GSA 2O85A 19GSA 2G2QA 4TVEA 4BA7A 2VCQA 3UJ1A 1UN2A 1Y6EA 1ABAA 1FW1A 2ES7A 2OE0A 3ED3A 3GKNA 4JR4A 3WGEA 3EU3A 4F0BA 2YWNA 4BVYA 5CRGA 2WULA 4MF7A 3Q74A 3GRXA 3F0IA 2YV9A 1AQXA 4MPFA 2PU9C 1TDIA 2JU5A 3F6FA 3M3MA 1OE7A 4GQFA 4WR5A 5KEJA 2PVOC 5GZZB 1E6BA 3HKRA 5ID2B 1AW9A 3UBLA 3WD6A 3CRUA 4AJ6A 3GURA 5F8BA 4F03A 2KLXA 2MMOA 1SL0B 3O3TA 4BVXA 4F82A 1GWCA 3BD2A 3L9SA 5J9BA 2TRXA 5ECLB 6GSXA 4RQRA 4TR3A 2LV3A 4MCUA 4KDUA 3KM6A 1SENA 2PWJA 1HNBA 3EYTA 1THOA 2H0HA 2PERA 4ECIA 4YH2A 1GLQA 1A2JA 2DJKA 2GVPA 5HR1A 2PBJA 5CRHA 4V2NA 2AB6A 2JSYA 1R5AA 2GZPA 2CA8A 4KH7A 3TKQA 3O6TA 2XPEA 1OC9B 2FCHA 5ECKB 1JHBA 1TK5B 1ZOFA 1IYHA 4GWRA 1FB0A 5IMFA 4BWQA 2V6OA 3Q6OA 1KBNA 4NHZA 5JCWA 3FRCA 3QMXA 2V32A 3WGDA 2VL9A 1GULA 4JR6A 1AIUA 1ZZYA 2XBQA 17GSA 1J9BA 1PL2A 4XTSA 5DAKB 4V1Ag 5AN1A 5JWRB 2CZ2A 3HCZA 5DBQA 4XIHA 5G5EA 5IPGA 3UBKA 2F3MA 1NSWA 2DJJA 3PH9A 5G1LA 3IK7A 3HVVA 1VF2A 2ON7A 20GSA 4MZWA 2IMIA 2X8CA 3DXBA 5IIZA 3IBHA 1TP9A 5D9VA 1SJZA 3DMLA 4DEJA 2VCZA 3HYPA 3H4KA 3RHCA 3HJPA 3DVWA 2VM1A 4GXZA 3IDVA 2IFQA 1EEJA 4OO4A 1MDKA 1EP7A 2WDUA 1AUCA 5G1KA 3FY7A 3QOUA 5H5SA 3EINA 2K18A 4NAXA 1GSDA 2GSTA 5J9CA 2GLRA 4IN0A 4KCAA 4PNGA 2C8UA 1WRYA 2GQLA 3L9VA 1F9MA 4OFMA 4FO5A 1WIKA 1YF1A 2YPMA 3C8EA 3PR8A 2PPTA 2B5YA 3BJ5A 5ECOB 3TKSC 4IQAA 4WXTA 4L0WA 3VI5A 2YWMA 1M2AA 4O92A 4OWYA 4ECCA 3U5RE 4ZIJA 5L71A 4RQXA 5DALA 1GSEA 2CT6A 2HZEB 2LEGA 4KNDA 1SJ6A 3ZFLA 3KTBA 2WGRA 3RAZA 5AIXA 4K2DA 2YNXA 4PGTA 3ZL5A 2H73A 1EEMA 4ZB9A 1T3BA 3G7JA 1X5CA 1M7TA 2LNSA 1QK8A 4KGIA 3QD9A 3ZREA 3LQ7A 1GH2A 1EP8A 4Q5RA 5FT3A 3W8SA 3H79A 3P7XA 7GSSA 3TKPA 1URMA 2H0GA 5AISA 3UIWA 4N30A 4AGSA 4ECBA 2MBTA 4POMA 2PMTA 4KE3A 2FWEA 3KH9A 1XWAA 1YKCA 3Q19A 5F07A 1SK1A 2X8GA 5ENUA 5CP1A 4XHMA 4Q5QA 2MBSA 1GUMA 1O7UA 4PUFC 1FO5A 3DKSA 3UVTA 5DCHA 4KSMA 2CVKA 4IP1A 5A4WA 1T1VA 1I5GA 3H1NA 1QQ2A 4FIWA 3HA9A 3D0ZA 1O8XA 1MEKA 3TKSE 1V9WA 3LORA 1AAZA 4EDZA 4MZCA 3QR6A 2H1DA 1GRXA 3VI7A 4K7OA 3MAKA 1WE0A 3F3QA 2GS3A 2H01A 4V2LA 1O73A 2L4QA 2YZUA 1X5DA 3ME8A 3KMOA 5JCGA 2IWTA 3A3TA 4J56E 4MH3A 3TKSA 2OADA 3FW2A 1TK8B 5CAXA 3ZZXA 1GL8A 1Z6MA 3DEXA 3EWLA 3BBYA 1GSUA 6GSWA 2XHFA 4OCEA 4G19A 1K0AA 4WETA 2C0FA 3QCPA 1EGOA 3UVHA 1TW9A 2AYTA 5C00A 4EE0A 3SBCA 13GSA 1Z5YE 2DC5A 2I3YA 2ZUPA 3CRTA 1CQHA 5IQYA 3WT1A 4HS1A 4PX1A 3P8WA 1M9AA 3JCML 1B4QA 3IK9A 4HI7A 4GQCA 4WBRD 2F51A 1PX7A 3IA1A 4MH2A 4HJ2A 1HNCA 1XCCA 1A0RP 4IS0A 2TIRA 2LTKA 2P0GA 2H8LA 1AQWA 1J08A 2GZZA 2VAFA 1U87A 1XW5A 1T4YA 4TXVA 4GTUA 3RDWA 4HU9A 3F9UA 5G5FA 5J3RA 5CNWA 3VPQA 3ERFA 2H76A 2H0IA 3HDCA 1MD4A 3G9BA 1X9WB 3FEUA 5E4WA 2VCTA 3KCMA 3A2WA 4PNFA 1TKDB 4GSTA 3SWLA 2OA7A 3TJGA 2QGVA 5IMDA 4DSSB 4G10A 1XWKA 1A8LA 3O76A 4TR1A 1K0OA 3UOMA 1SK2A 1SD9A 3KZQA 4KCEA 1ERTA 4ZL7A 1ZL9A 3VWWA 2KP1A 2FWGA 3GA4A 1U3AA 2OACA 2GGTA 4ZL9A 3MSZA 4V2MA 2P31A 2PGTA 3GX0A 4OO5A 2DBCA 1ML6A 5CO3A 4YQUA 5J4UA 5CYYA 1X9SB 4GRFA 4EUYA 3CTGA 1NW2A 2I81A 2HXKA 3HVSA 4L8EA 5EY6A 4ILFA 2K8VA 4IJIA 4TR0A 3KXOA 2HYXA 4TR4A 3A2VA 1WJKA 2B7JA 3R2QA 2WCIA 4QQ7A 1TU8A 1E2YA 2X64A 2B5EA 2HRNA 2NVLA 5COHA 1T00A 1T8EB 3C1RA 5AIVA 3ZVJD 1Z7PA 5J41A 4N10A 3ERGA 1OC8A 1GTIA 3GYKA 3MWHA 1ZYQB 2IMKA 2I4AA 2OBIA 2H30A 3VWUA 1GLPA 2C0DA 2FNOA 1GNWA 4OCFA 3A2XA 4DSRA 2MZCA 5DCGA 3HXSA 5IPHA 2VCVA 1RK4A 1VF3A 4EL1A 1YDKA 5IMCA 5ECNB 2DMLA 3ERWA 4I8BA 1PKWA 3TJJA 2JACA 3KEBA 2YN1A 2BJXA 3CTFA 4HQZA 5H5QA 1EWXA 2L59A 4GSNA 3LG6A 1B4PA 1RQMA 2V6KA 4XRDA 3UL3A 5ECHB 3IR4A 2JZTA 2NDOA 3IAS2 6GSYA 2RLIA 3IAM2 2C80A 5A4VA 3LFLA 3EMXA 2H72A 2B1KA 3C7MA 3C1SA 1THXA 1AC1A 2BTOT 3P90A 4GLTA 2JZSA 3ZYWA 1B8XA 5LNKe 2VL2C 1TRWA 1UVZA 4K9ZA 4JRRA 1G7OA 1M9BA 3GUSA 1U3IA 5D73A 3QAGA 2NPBA 3ZLPA 2B3SA 3PINA 5GAPD 1XZOA 2REMA 2PUKC 1JFUA 3GTUA 5B7CA 3ZFBA 4OFNA 3M9JA 1K3YA 1ACVA 2EIOA 1A2MA 5F0GA 2CVDA 2V2GA 3RPPA 4XS1A 1C72A 4POKA 3QFAC 3W6GA 1TOFA 2TRCP 1USBA 5IMZA 5F05A 1PL1A 2IIYA 5B8AA 1PQNA 2JL4A 2F8AA 4D73A 3K8NA 2R37A 3TCOA 4ZILA 2R3XA 1SKWB 2MYGA 1GUKA 2C3TA 1LU4A 3CSHA 2RM6A 3CYNA 2A4VA 3F3RA 5JWQB 2HRFA 1ERUA 1YF0A 3V1WA 4TOPA 3TRXA 3I43A 3RPNA 1TU7A 1ERWA 3DIEA 2VLVA 4PUAA 1XW6A 3L0HA 1SL1B 1O8WA 1CQGA 2CVBA 1TXXA 4IKHA 14GSA 22GSA 2HE3A 3N9JA 4NWYA 2GT6A 3J7Yb 3KTLA 4OFTA 1XFLA 3KIJA 1H75A 4ZBDA 4WR4A 1GTUA 3F4SA 18GSA 5CRDA 1A23A 2HSHA 1K0BA 2LJRA 2OBKA 2LNTA 3M8NA 1S3AA 2K9FA 5ELAA 4HQSA 1V2AA 3J7Yk 1OKDA 2AAWA 2AHEA 2OJLA 2HFDA 1SKRB 16GSA 4I97A 1PN9A 2VM2A 1YEPA 3LYKA 1JLVA 2CQ9A 3GHAA 3TJFA 2QSIA 2VL2A 3KP8A 4JU5A 1BAYA 1XWCA 2VIMA 4XS4A 1BQ7A 1V98A 2ALBA 2H66A 2LKUA 1XOAA 2GQMA 3TOUA 1XW9A 1A24A 5DJLA 3FR3A 5LCZA 1VF4A 2OE3A 3RBTA 3TJBA 2IFQB 1DSBA 3UARA 4ID0A 1M2BA 2CV4A 3IE3A 3IV4A 4JBBA 3C71A 4MDCA 5AGYA 1EGRA 4X1UA 2FA4A 1T4ZA 3E3EA 2WFCA 2FWFA 3EMPA 1PKZA 3I6AA 3LJRA 4FYUA 3VK9A 3GL5A 1JZRA 6GSVA 1WOUA 2J23A 3P2AA 3IOSA 1DBYA 4IBPA 2H6XA 3OR5A 2VD1A 2FY6A 3HJOA 4IP6A 4KDYA 4FYBA 1W4VA 3H93A 5DALB 4KSOA 1TRUA 3GSSA 3D5JA 4N0VA 4E8EA 2L6CA 1G6YA 1UA5A 4Q5NA 4HU7A 5HFKA 2EIQA 3WT2A 2DIZA 3VFIA 4X43A 1V58A 3UAPA 1HQOA 2XBIA 5INYA 2DIYA 2GQKA 5ELGA 3CSIA 3DYRA 1OC3A 3CMIA 2ZNMA 5LD0A 5KN3A 3HVXA 1FAAA 2OKAA 1QMVA 5EVOA 4TXOA 1X9MB 4MLYA 3EVIA 4EXJA 3LXZA 5A5KA 3L78A 3EURA 4LLRA 2DLXA 2K6VA 4V1Ap 1QXHA 4K0NA 4L0UA 1SK0A 3L4NA 2JADA 3QFBC 1YQ1A 5H5RA 2CX3A 1EV9A 4MPGA 1Y25A 3WGXA 5ECIB 5IO2A 4MF5A 3VLNA 2VOCA 1BJXA 4K7IA 2KOKA 1HNAA 1Z7RA 1X0RA 4LMWA 1GUHA 3ZIVA 3HD5A 2VO4A 2JSZA 3RHBA 1QGVA 2CZ3A 5DVBA 3QDNA 1DE2A 1F6MC 2DJ2A 3E9JB 4AF2A 1ILOA 2L57A 2HI7A 3NOFA 9GSSA 1OYJA 4G2EA 4QL9A 1GNEA 4XS6A 1TJDA 1NHOA 3MDKA 1H4OA 1B9YC 2VD0A 3I69A 2KUCA 4G9HA 2DMMA 2C0EA 3G7IA 4EC0A 2G0FA 4TW5A 1HYUA 1O6JA 2WRTA 3QAVA 4YAVA 2H71A 1GSFA 3GL3A 4MP4A 4ISDA 1WPIA 1XVQA 2RUEA 2VL3A 2AV4A 4XCSA 5HFIA 2R6KA 2YJ7A 2PVQA 2E2GA 4JZQA 2VLUA 3HY2A 2LSTA 3TUEA 4BWSA 2KHPA 2M46A 4MF6A 3TRQA 2GSSA 3LWAA 1PA3A 2L5LA 4RUVA 2GSRA 4J2FA 2VUPA 4QL7A 3ZMKA 1R7HA 1JZWA 4IW9A 2RIIA 1PRXA 2M72A
chains in the Genus database with same CATH superfamily
3TGZA 1ON4A 1GSYA 5G31A 2LRCA 2H75A 3VPTA 2C0GA 5EL8A 5IMVA 4PQ1A 1KEBA 3VWXA 2B5XA 4MJAA 5G2ZA 2EIRA 4HJMA 3BCIA 1WMJA 4NV2A 1V40A 4LL1B 2E2MA 4O32A 3GFKA 4I2UA 1PX6A 1A0FA 1O85A 2BMXA 3IC4A 3NIVA 4X4JA 3BCKA 5CREA 2VCWA 3GKXA 4HUAA 1JLWA 5JCUA 5DJMA 2I1UA 2H1BA 3F6DA 1PSQA 4F0CA 1FHEA 4KA0A 3GKKA 1YY7A 4TR1B 5GSTA 4EO3A 3F63A 1JZDA 2Z9SA 4IQ1A 5ID2A 2B6MA 2F8FA 1JZOA 2IL3A 1I9DA 2E0QA 2V1MA 2AJQB 1F2EA 2X49A 1OVNA 1SD8A 1TI3A 3APQA 1EZKA 4NHWA 4PURA 2LJKA 4KUNA 2CX4A 2FD3A 3N5OA 4DSQA 2NBSA 1MD3A 2JZRA 2OE1A 3TOTA 3EE2A 1LBKA 3Q18A 4EKZA 1M2DA 4YQVA 5DQSA 8GSSA 3LXTA 3EPTA 4MJCA 4ACSA 5GSSA 2H74A 3A5WA 2HZFA 2QC7A 1QFNA 5D8IA 4MABA 3FZ5A 5B6MA 3BOAA 3M9KA 4ML1A 4KW6A 1OC9A 1OKTA 4ULXA 4E8HA 4TN8A 4X0XA 1FB6A 3GH6A 2GZYA 2A2RA 3S9FA 4ZB6A 1TRVA 4I6XA 1SYXA 2L6DA 4LMVA 1BEDA 3D22A 1Q4JA 3M0FA 1R4WA 4J57E 4Z2UA 2FGXA 3TB2A 3UMAA 4DVCA 2L4CA 4HZ2A 1QUWA 5D9XA 4EF0A 5IOWA 1F37A 5DAKA 5FWGA 3KGKA 1XPVA 2LRTA 3DGQA 2DJ1A 2C3NA 1N8JA 3LYPA 2N5FA 2WJUA 2QKEA 5HR0A 2H1AA 3FR6A 4EDYA 3GIXA 1Z6NA 4WF4A 4F9ZA 1VRSD 3IXRA 3GSTA 2L5OA 5IO0A 2F9SA 4MJEA 4JEDA 3L9UA 3DVXA 3IC8A 4NV5A 1SU9A 2N5AA 1W89A 2IMFA 3A5IA 3LGCA 3APOA 3FHKA 1K3LA 1YEXA 5ECQB 1G7EA 3TDGA 5B8BA 1FOVA 1R5PA 2FLSA 5E59A 4NMUA 11GSA 1WP0A 3ZVJA 4PQHA 4GSSA 2DKIA 3GTUB 1A2LA 4IELA 2IPAA 1A8YA 2MMAA 1RW1A 2HLSA 2E7PA 2DJ3A 5GAND 2R0PA 5KN0A 3EC3A 2FA8A 1OE8A 2O7KA 3KMNA 3ZRDA 4Z2RA 2VLTA 1XIYA 3DWVA 5G30A 10GSA 3IRAA 3KJYA 2O87A 4MZBA 4KDXA 3GN3A 3WYWA 2J9HA 4N11A 2FUG2 3US3A 4D73B 4O7HA 1EV4A 1FVKA 2MMZA 5ECRB 2N5BA 5D9TA 1R26A 1F3BA 2WS2A 3KP9A 5HR3A 2HZEA 4MK3A 4L5LA 5HR2A 4KX4A 3F8UA 2O8VB 2YP6A 4EVMA 4JE1A 3U6VA 1GTAA 4TKYA 3GH9A 2H70A 5IOXA 4AJ7A 1S3RA 4IJ3A 1K0NA 3F4TA 3D21A 1M3IA 1OAZA 2YZHA 2C1YA 2HT9A 1YZXA 3APSA 2VCXA 1S3DA 3FZ9A 2YWIA 4FYCA 2C3QA 4POLA 2H19A 6GSUA 2R4VA 2YANA 5IM9A 1DUGA 4RI7A 5J5NA 4F2IA 1GP1A 3E0UA 4ZL8A 1ST9A 3PGTA 2V41A 3VWVA 1K0CA 2HNLA 2H1GA 1K3OA 2RM5A 5B6NA 3FKFA 4O5UA 1PMTA 1PFOA 2R5GA 5ECPB 4ECJA 4Q5FA 3ZTLA 3I9V2 3FZ4A 2EC4A 4TRXA 2HRAA 2ON5A 1M99A 1KNGA 4LA1A 4XS4B 4IHUA 1AQVA 4CHSA 4POBA 2LQOA 3CBUA 4WBJA 2GSQA 1TI1A 4PXOA 1X5EA 1M0UA 4CDOA 2P5RA 1XBSA 4ML6A 3KD0A 2GDRA 4MA9A 3GX8A 4IGJA 5HFGA 2LQQA 3DD3A 1XXUA 3CSJA 4HOJA 1U6TA 3D6IA 4OMVA 2B1LA 4YQMA 4K6XA 4ZXGA 2RUFA 2MMNA 4I5QA 1TRSA 2O89A 5ECSA 2XC2A 3GMFA 3IHQA 4HDEA 1SL2B 1Q98A 3VURA 2AUVA 3HJMA 1LJRA 5FHIA 1MDJA 4K8MA 3LEFA 4MNNA 4FQUA 2P5QA 3ZITA 1DE1A 3QPMA 3FYGA 1ZCPA 4YKFA 2IN3A 1AXDA 1TTZA 4HZ4A 5IMAA 1XVWA 3KH7A 2YV7A 2LRNA 3GV1A 4EIPA 3ZIJA 1SJIA 6GSTA 1NM3A 3DRNA 1G6WA 1K0MA 3FMWA 2WB9A 4I2TA 1IYIA 4OD7A 1O81A 1NHYA 2H6YA 3TRPA 4IVFA 4PQIA 1N2AA 3EU4A 2CAQA 2B7KA 1XWGA 1TK0B 3QAWA 4GCIA 3PPUA 4H86A 1SKSB 4N0ZA 4BL7A 1T7PB 1ERVA 4ZBBA 3HZ4A 5JWOB 1KTEA 4TXOB 1BG5A 1G0TA 4LL4B 4RI6A 1UC7A 4HEA2 1GSSA 4NXIA 3MYDA 1Z3EA 3TKRA 4BPYA 3UEMA 2X8HA 1K0DA 3ME7A 1B9XC 4CW9A 3GNJA 2DJ0A 5D93A 3HVNA 5A4UA 1VF1A 2HSYA 3CXGA 2IJYA 3FR9A 2D2ZA 1MDIA 2X99A 5DDLA 3GKMA 2NTOA 2XPDA 2LJAA 3G7YA 3ZMLA 1XOBA 5D96A 3C73A 2IMEA 4WF5A 1ZMAA 1GSQA 1SYRA 2GTUA 5DQYA 1PD21 3FZAA 4DSSA 1BYEA 3M1GA 2I9HA 4GF0A 3H8QA 5C04A 2R2JA 1S3CA 1EOHA 1Z9HA 2H6ZA 4USSA 4G0IA 2M80A 1WWJA 2ZCTA 4FH8A 4A5PA 1ZYEA 4MMMA 5KN1A 2K8SA 3HZ8A 4G0LA 5D9WA 5CRWA 3F4RA 4K0GA 3TJKA 4Z2TA 4NPBA 3NZNA 1GTBA 2IMDA 4XRAA 2YJHA 4WKWA 1V57A 4MJBA 1FG4A 1HD2A 6GSSA 2YOIA 4L5OA 2WZ9A 1J0FA 3D4TA 2KP2A 1EOGA 4ZBAA 3IPZA 1ZGNA 1PGTA 2CAIA 4K7NA 4WEYA 4P3YB 1B48A 1MTCA 5F06A 3D4MA 1BX9A 4YKGA 2YWOA 5KN2A 1XWBA 3ISOA 2GT5A 1YJ6A 5ABRA 3HHVA 2DSAA 4Z7XA 4YAPA 4KB3A 4O5RA 1FVJA 1VGLA 3W8JA 4K1FA 1YKAA 5EPFA 2LUSA 3FK8A 4ZB8A 2LS5A 4KAEA 4AJ8A 3AY8A 3LSZA 2A2SA 1U88A 2C4JA 3MNGA 2PN8A 5ECMB 2YCDA 1F3AA 5HQPA 2FWHA 2FHEA 12GSA 2O85A 19GSA 2G2QA 4TVEA 4BA7A 2VCQA 3UJ1A 1UN2A 1Y6EA 1ABAA 1FW1A 2ES7A 2OE0A 3ED3A 3GKNA 4JR4A 3WGEA 3EU3A 4F0BA 2YWNA 4BVYA 5CRGA 2WULA 4MF7A 3Q74A 4G0KA 3GRXA 3F0IA 2YV9A 1AQXA 4MPFA 2PU9C 1TDIA 2JU5A 3F6FA 3M3MA 1OE7A 4GQFA 4WR5A 5KEJA 2PVOC 5GZZB 1E6BA 1ZYNA 3HKRA 5ID2B 1AW9A 3UBLA 3WD6A 3CRUA 4AJ6A 3GURA 5F8BA 4F03A 2KLXA 2MMOA 1SL0B 3O3TA 4BVXA 4F82A 1GWCA 3BD2A 3L9SA 5J9BA 2TRXA 5ECLB 6GSXA 4RQRA 4TR3A 2LV3A 4MCUA 4KDUA 3KM6A 2X4AA 1SENA 2PWJA 1HNBA 3EYTA 1THOA 2H0HA 2PERA 4ECIA 4YH2A 1GLQA 1A2JA 4PTSA 2DJKA 2GVPA 5HR1A 2PBJA 5CRHA 4V2NA 2AB6A 2JSYA 1R5AA 2GZPA 2CA8A 4KH7A 3TKQA 3O6TA 2XPEA 1OC9B 2FCHA 5ECKB 1JHBA 1TK5B 1ZOFA 1IYHA 4GWRA 4K2XA 1FB0A 5IMFA 4BWQA 2V6OA 3Q6OA 1KBNA 4NHZA 5JCWA 3FRCA 3QMXA 2V32A 3WGDA 2VL9A 1GULA 4JR6A 1AIUA 1ZZYA 2XBQA 17GSA 1J9BA 1PL2A 4XTSA 5DAKB 4V1Ag 5AN1A 5JWRB 2CZ2A 3HCZA 5DBQA 4XIHA 2UZ8A 5G5EA 5IPGA 3UBKA 2F3MA 1NSWA 2DJJA 3PH9A 5G1LA 3IK7A 3HVVA 1VF2A 2ON7A 20GSA 1M3JA 4MZWA 2IMIA 2X8CA 3DXBA 5IIZA 3IBHA 1TP9A 5D9VA 1SJZA 3DMLA 4DEJA 2VCZA 3HYPA 3H4KA 3RHCA 3HJPA 3DVWA 2VM1A 4GXZA 2A4HA 3IDVA 2IFQA 1EEJA 4OO4A 1MDKA 1EP7A 2WDUA 1AUCA 5G1KA 3FY7A 3QOUA 5H5SA 3EINA 2K18A 4NAXA 1GSDA 2GSTA 5J9CA 2GLRA 4IN0A 4KCAA 4PNGA 2C8UA 1WRYA 2GQLA 3L9VA 5BRTA 1F9MA 4OFMA 4FO5A 1WIKA 1YF1A 2YPMA 3C8EA 3PR8A 2PPTA 2B5YA 3BJ5A 5ECOB 3TKSC 4IQAA 4WXTA 4L0WA 3VI5A 2YWMA 1M2AA 4O92A 4OWYA 4ECCA 3U5RE 4ZIJA 5L71A 4RQXA 5DALA 1GSEA 2CT6A 2HZEB 2LEGA 4KNDA 1SJ6A 3ZFLA 3KTBA 2WGRA 3RAZA 5AIXA 4K2DA 2YNXA 4PGTA 3ZL5A 2H73A 1EEMA 4ZB9A 1T3BA 3G7JA 1X5CA 1M7TA 2LNSA 1QK8A 4KGIA 3QD9A 3ZREA 3LQ7A 1GH2A 4BIKA 1EP8A 4Q5RA 5FT3A 3W8SA 3H79A 3P7XA 7GSSA 3TKPA 1URMA 2H0GA 5AISA 3UIWA 4N30A 4AGSA 4ECBA 2MBTA 4POMA 2PMTA 4KE3A 2FWEA 3KH9A 1XWAA 1YKCA 3Q19A 5F07A 1SK1A 2X8GA 5ENUA 5CP1A 4XHMA 3MIXA 2DKHA 4Q5QA 2MBSA 1GUMA 1O7UA 4PUFC 1FO5A 3DKSA 3UVTA 5DCHA 4KSMA 2CVKA 4IP1A 5A4WA 1T1VA 1I5GA 3H1NA 1QQ2A 4FIWA 3HA9A 3D0ZA 1O8XA 1MEKA 3TKSE 1V9WA 3LORA 1AAZA 4EDZA 4MZCA 3QR6A 2H1DA 1GRXA 3VI7A 3R3EA 4K7OA 3MAKA 1WE0A 3F3QA 2GS3A 2H01A 4V2LA 1O73A 2L4QA 2YZUA 1X5DA 3ME8A 3KMOA 5JCGA 2IWTA 3A3TA 4J56E 4MH3A 3TKSA 2OADA 3FW2A 1TK8B 5CAXA 3ZZXA 1GL8A 4CY6A 1Z6MA 3DEXA 2R0GA 3EWLA 3BBYA 1GSUA 6GSWA 2XHFA 4OCEA 4G19A 1K0AA 4WETA 2C0FA 3QCPA 1EGOA 4EIQA 3UVHA 1TW9A 2AYTA 5C00A 4EE0A 3SBCA 13GSA 1Z5YE 2DC5A 2I3YA 2ZUPA 3CRTA 1CQHA 5IQYA 3WT1A 4HS1A 4PX1A 3P8WA 1M9AA 3JCML 1B4QA 3IK9A 4HI7A 4GQCA 4WBRD 2F51A 1PX7A 3IA1A 4BL7B 4MH2A 4HJ2A 1HNCA 1XCCA 1A0RP 4IS0A 2TIRA 2LTKA 2P0GA 2H8LA 1AQWA 1J08A 2R0CA 2GZZA 2VAFA 1U87A 1XW5A 1T4YA 4TXVA 4GTUA 3RDWA 4HU9A 3F9UA 5G5FA 5J3RA 5CNWA 3VPQA 3ERFA 2H76A 2H0IA 3HDCA 1MD4A 3G9BA 1X9WB 3FEUA 5E4WA 2VCTA 3KCMA 3A2WA 4PNFA 1TKDB 4GSTA 3SWLA 2OA7A 3TJGA 2QGVA 5IMDA 4DSSB 4G10A 1XWKA 1A8LA 3O76A 4TR1A 1K0OA 3UOMA 1SK2A 1SD9A 3KZQA 4KCEA 1ERTA 4ZL7A 1ZL9A 3VWWA 4ICYA 2KP1A 2FWGA 3GA4A 1U3AA 2OACA 2GGTA 4ZL9A 3MSZA 4V2MA 2P31A 2PGTA 3GX0A 4OO5A 2DBCA 1ML6A 5CO3A 4YQUA 5J4UA 5CYYA 1X9SB 4GRFA 4EUYA 3CTGA 1NW2A 2I81A 2HXKA 3HVSA 4L8EA 1ZYPA 5EY6A 4ILFA 2K8VA 4IJIA 4TR0A 3KXOA 2HYXA 4TR4A 3A2VA 2A2PA 1WJKA 2B7JA 3R2QA 2WCIA 4O5QA 4QQ7A 1TU8A 1E2YA 2X64A 2B5EA 2HRNA 2NVLA 5COHA 1T00A 1T8EB 3C1RA 5AIVA 3ZVJD 1Z7PA 5J41A 4N10A 3ERGA 1PN0A 1OC8A 1GTIA 3GYKA 3MWHA 1ZYQB 2IMKA 2I4AA 2OBIA 2H30A 3VWUA 1GLPA 2C0DA 2FNOA 1GNWA 4OCFA 3A2XA 4DSRA 2MZCA 5DCGA 3HXSA 5IPHA 2VCVA 1RK4A 1VF3A 4EL1A 1YDKA 5IMCA 5ECNB 2DMLA 3ERWA 4I8BA 1PKWA 3TJJA 2JACA 3KEBA 2YN1A 2BJXA 3CTFA 4HQZA 5H5QA 1EWXA 2L59A 4GSNA 3LG6A 1B4PA 1RQMA 2V6KA 4XRDA 3UL3A 5ECHB 3IR4A 2JZTA 2NDOA 3IAS2 3CQFA 6GSYA 2RLIA 3IAM2 2C80A 5A4VA 5BMUA 3LFLA 3EMXA 2H72A 2B1KA 3C7MA 3C1SA 1THXA 1AC1A 2BTOT 3P90A 4GLTA 2JZSA 4BVYB 3ZYWA 4HSCX 1B8XA 5LNKe 2VL2C 1TRWA 1UVZA 4K9ZA 4JRRA 1G7OA 1M9BA 3GUSA 1U3IA 5D73A 3QAGA 2NPBA 3ZLPA 2B3SA 3PINA 5GAPD 1XZOA 2REMA 2PUKC 1JFUA 3GTUA 5B7CA 3ZFBA 4BVXB 4OFNA 3M9JA 1K3YA 1ACVA 2EIOA 1A2MA 5F0GA 2CVDA 2V2GA 3RPPA 4XS1A 1C72A 4POKA 3QFAC 3W6GA 1TOFA 2TRCP 1USBA 5IMZA 5F05A 1PL1A 2IIYA 5B8AA 1PQNA 2JL4A 2F8AA 4D73A 3K8NA 2R37A 3TCOA 4ZILA 2R3XA 1SKWB 2MYGA 1GUKA 2C3TA 1LU4A 3CSHA 2RM6A 3CYNA 2A4VA 3F3RA 5JWQB 2QA1A 2HRFA 1ERUA 1YF0A 3V1WA 4TOPA 3TRXA 3I43A 3RPNA 1TU7A 1ERWA 3DIEA 2VLVA 4PUAA 1XW6A 3L0HA 1SL1B 1O8WA 1CQGA 2CVBA 1TXXA 4IKHA 4K5RA 14GSA 22GSA 2HE3A 3N9JA 4NWYA 2GT6A 3J7Yb 3KTLA 4OFTA 1XFLA 3KIJA 1H75A 4ZBDA 4WR4A 1GTUA 3F4SA 18GSA 5CRDA 1A23A 2HSHA 1K0BA 2LJRA 2OBKA 2LNTA 3M8NA 1S3AA 2K9FA 5ELAA 4HQSA 1V2AA 3J7Yk 1OKDA 2AAWA 2AHEA 2OJLA 2HFDA 1SKRB 16GSA 4I97A 1PN9A 2VM2A 1YEPA 3LYKA 1JLVA 2CQ9A 3GHAA 3TJFA 2QSIA 2VL2A 3KP8A 4JU5A 1BAYA 1XWCA 2VIMA 4XS4A 1BQ7A 1V98A 2ALBA 2H66A 2LKUA 1XOAA 2GQMA 3TOUA 1XW9A 1A24A 5DJLA 3FR3A 5LCZA 1VF4A 2OE3A 3RBTA 3TJBA 2IFQB 1DSBA 3UARA 4ID0A 1M2BA 3LW9A 2CV4A 3IE3A 3IV4A 4JBBA 3C71A 4MDCA 5AGYA 1EGRA 4X1UA 2FA4A 5KOXA 1T4ZA 3E3EA 2WFCA 2FWFA 3EMPA 1PKZA 3I6AA 3LJRA 4FYUA 3VK9A 3GL5A 1JZRA 6GSVA 1WOUA 1FOHA 2J23A 3P2AA 3IOSA 1DBYA 4IBPA 2H6XA 3OR5A 2VD1A 2FY6A 3HJOA 4IP6A 4KDYA 4FYBA 1W4VA 3H93A 5DALB 4KSOA 1TRUA 3GSSA 2HRKA 3D5JA 4N0VA 4E8EA 2L6CA 1G6YA 1UA5A 4Q5NA 4CY8A 4HU7A 5HFKA 2EIQA 4K5SA 3WT2A 2DIZA 3VFIA 4X43A 1V58A 3UAPA 1HQOA 2XBIA 5INYA 2DIYA 2GQKA 5ELGA 3CSIA 3DYRA 1OC3A 3CMIA 1XG8A 2ZNMA 5LD0A 5KN3A 3HVXA 1FAAA 2OKAA 1QMVA 5EVOA 4TXOA 1X9MB 4MLYA 3EVIA 4EXJA 3LXZA 5A5KA 3L78A 4KF9A 3EURA 4LLRA 2DLXA 2K6VA 4V1Ap 3IHGA 1QXHA 4K0NA 4L0UA 1SK0A 3L4NA 2JADA 3QFBC 1YQ1A 5H5RA 2CX3A 1EV9A 4MPGA 1Y25A 3WGXA 5ECIB 5IO2A 4MF5A 3VLNA 2VOCA 1BJXA 4K7IA 2KOKA 1HNAA 1Z7RA 1X0RA 4LMWA 2QA2A 1GUHA 3ZIVA 3HD5A 2VO4A 2JSZA 3RHBA 1QGVA 2CZ3A 5DVBA 3QDNA 1DE2A 1F6MC 2DJ2A 3E9JB 4AF2A 1ILOA 2L57A 2HI7A 3NOFA 9GSSA 1OYJA 4G2EA 4QL9A 1GNEA 4XS6A 1TJDA 1NHOA 3MDKA 1H4OA 1B9YC 2VD0A 3I69A 2KUCA 4G9HA 2DMMA 2C0EA 2HSMA 3G7IA 4EC0A 2G0FA 4TW5A 1HYUA 1O6JA 2WRTA 3QAVA 4YAVA 2H71A 1GSFA 3GL3A 4MP4A 4ISDA 1WPIA 1XVQA 2RUEA 2VL3A 2AV4A 4XCSA 5HFIA 2R6KA 2YJ7A 2PVQA 2E2GA 4JZQA 2VLUA 3HY2A 2LSTA 3TUEA 4BWSA 2KHPA 2M46A 4MF6A 3TRQA 2GSSA 3LWAA 1PA3A 2L5LA 4RUVA 2GSRA 4J2FA 2VUPA 4QL7A 3ZMKA 1R7HA 1JZWA 5KOWA 4IW9A 2RIIA 1PRXA 2M72A
chains in the Genus database with same CATH topology
3TGZA 1ON4A 1GSYA 5G31A 2LRCA 2H75A 3VPTA 2C0GA 5EL8A 5IMVA 4PQ1A 1KEBA 3VWXA 2B5XA 4MJAA 5G2ZA 2EIRA 4HJMA 3BCIA 1WMJA 4NV2A 1V40A 4LL1B 2E2MA 4O32A 3GFKA 4I2UA 1PX6A 1A0FA 1O85A 2BMXA 3IC4A 3NIVA 4X4JA 3BCKA 5CREA 2VCWA 3GKXA 4HUAA 1JLWA 5JCUA 5DJMA 2I1UA 2H1BA 3F6DA 1PSQA 4F0CA 1FHEA 4KA0A 3GKKA 1YY7A 4TR1B 5GSTA 4EO3A 3F63A 1JZDA 2Z9SA 4IQ1A 5ID2A 2B6MA 2F8FA 1JZOA 2IL3A 1I9DA 2E0QA 2V1MA 2AJQB 1F2EA 2X49A 1OVNA 1SD8A 1TI3A 3APQA 1EZKA 4NHWA 4PURA 2LJKA 4KUNA 2CX4A 2FD3A 3N5OA 4DSQA 2NBSA 1MD3A 2JZRA 2OE1A 3TOTA 3EE2A 1LBKA 3Q18A 4EKZA 1M2DA 4YQVA 5DQSA 8GSSA 3LXTA 3EPTA 4MJCA 4ACSA 5GSSA 2H74A 3A5WA 2HZFA 2QC7A 1QFNA 5D8IA 4MABA 3FZ5A 5B6MA 3BOAA 3M9KA 4ML1A 4KW6A 1OC9A 1OKTA 4ULXA 4E8HA 4TN8A 4X0XA 1FB6A 3GH6A 2GZYA 2A2RA 3S9FA 4ZB6A 1TRVA 4I6XA 1SYXA 2L6DA 4LMVA 1BEDA 3D22A 1Q4JA 3M0FA 1R4WA 4J57E 4Z2UA 2FGXA 3TB2A 3UMAA 4DVCA 2L4CA 4HZ2A 1QUWA 5D9XA 4EF0A 5IOWA 1F37A 5DAKA 5FWGA 3KGKA 1XPVA 2LRTA 3DGQA 2DJ1A 2C3NA 1N8JA 3LYPA 2N5FA 2WJUA 2QKEA 5HR0A 2H1AA 3FR6A 4EDYA 3GIXA 1Z6NA 4WF4A 4F9ZA 1VRSD 3IXRA 3GSTA 2L5OA 5IO0A 2F9SA 4MJEA 4JEDA 3L9UA 3DVXA 3IC8A 4NV5A 1SU9A 2N5AA 1W89A 2IMFA 3A5IA 3LGCA 3APOA 3FHKA 1K3LA 1YEXA 5ECQB 1G7EA 3TDGA 5B8BA 1FOVA 1R5PA 2FLSA 5E59A 4NMUA 11GSA 1WP0A 3ZVJA 4PQHA 4GSSA 2DKIA 3GTUB 1A2LA 4IELA 2IPAA 1A8YA 2MMAA 1RW1A 2HLSA 2E7PA 2DJ3A 5GAND 2R0PA 5KN0A 3EC3A 2FA8A 1OE8A 2O7KA 3KMNA 3ZRDA 4Z2RA 2VLTA 1XIYA 3DWVA 5G30A 10GSA 3IRAA 3KJYA 2O87A 4MZBA 4KDXA 3GN3A 3WYWA 2J9HA 4N11A 2FUG2 3US3A 4D73B 4O7HA 1EV4A 1FVKA 2MMZA 5ECRB 2N5BA 5D9TA 1R26A 1F3BA 2WS2A 3KP9A 5HR3A 2HZEA 4MK3A 4L5LA 5HR2A 4KX4A 3F8UA 2O8VB 2YP6A 4EVMA 4JE1A 3U6VA 1GTAA 4TKYA 3GH9A 2H70A 5IOXA 4AJ7A 4IJ3A 1K0NA 3F4TA 3D21A 1OAZA 2YZHA 2C1YA 2HT9A 1YZXA 3APSA 2VCXA 1S3DA 3FZ9A 2YWIA 4FYCA 2C3QA 4POLA 2H19A 6GSUA 2R4VA 2YANA 5IM9A 1DUGA 4RI7A 5J5NA 4F2IA 1GP1A 3E0UA 4ZL8A 1ST9A 3PGTA 2V41A 3VWVA 1K0CA 2HNLA 2H1GA 1K3OA 2RM5A 5B6NA 3FKFA 4O5UA 1PMTA 2R5GA 5ECPB 4ECJA 4Q5FA 3ZTLA 3I9V2 3FZ4A 2EC4A 4TRXA 2HRAA 2ON5A 1M99A 1KNGA 4LA1A 4XS4B 4IHUA 1AQVA 4CHSA 4POBA 2LQOA 3CBUA 4WBJA 2GSQA 1TI1A 4PXOA 1X5EA 1M0UA 4CDOA 2P5RA 1XBSA 4ML6A 3KD0A 2GDRA 4MA9A 3GX8A 4IGJA 5HFGA 2LQQA 3DD3A 1XXUA 3CSJA 4HOJA 1U6TA 3D6IA 4OMVA 2B1LA 4YQMA 4K6XA 4ZXGA 2RUFA 2MMNA 4I5QA 1TRSA 2O89A 5ECSA 2XC2A 3GMFA 3IHQA 4HDEA 1SL2B 1Q98A 3VURA 2AUVA 3HJMA 1LJRA 5FHIA 1MDJA 4K8MA 3LEFA 4MNNA 4FQUA 2P5QA 3ZITA 1DE1A 3QPMA 3FYGA 1ZCPA 4YKFA 2IN3A 1AXDA 1TTZA 4HZ4A 5IMAA 1XVWA 3KH7A 2YV7A 2LRNA 3GV1A 4EIPA 3ZIJA 1SJIA 6GSTA 1NM3A 3DRNA 1G6WA 1K0MA 3FMWA 2WB9A 4I2TA 1IYIA 4OD7A 1O81A 1NHYA 2H6YA 3TRPA 4IVFA 4PQIA 1N2AA 3EU4A 2CAQA 2B7KA 1XWGA 1TK0B 3QAWA 4GCIA 3PPUA 4H86A 1SKSB 4N0ZA 4BL7A 1T7PB 1ERVA 4ZBBA 3HZ4A 5JWOB 1KTEA 4TXOB 1BG5A 1G0TA 4LL4B 4RI6A 1UC7A 4HEA2 1GSSA 4NXIA 3MYDA 1Z3EA 3TKRA 4BPYA 3UEMA 2X8HA 1K0DA 3ME7A 1B9XC 4CW9A 3GNJA 2DJ0A 5D93A 5A4UA 1VF1A 2HSYA 3CXGA 2IJYA 3FR9A 2D2ZA 1MDIA 2X99A 5DDLA 3GKMA 2NTOA 2XPDA 2LJAA 3G7YA 3ZMLA 1XOBA 5D96A 3C73A 2IMEA 4WF5A 1ZMAA 1GSQA 1SYRA 2GTUA 5DQYA 1PD21 3FZAA 4DSSA 1BYEA 3M1GA 2I9HA 4GF0A 3H8QA 5C04A 2R2JA 1S3CA 1EOHA 1Z9HA 2H6ZA 4USSA 4G0IA 2M80A 1WWJA 2ZCTA 4FH8A 4A5PA 1ZYEA 4MMMA 5KN1A 2K8SA 3HZ8A 4G0LA 5D9WA 5CRWA 3F4RA 4K0GA 3TJKA 4Z2TA 4NPBA 3NZNA 1GTBA 2IMDA 4XRAA 2YJHA 4WKWA 1V57A 4MJBA 1FG4A 1HD2A 6GSSA 2YOIA 4L5OA 2WZ9A 1J0FA 3D4TA 2KP2A 1EOGA 4ZBAA 3IPZA 1ZGNA 1PGTA 2CAIA 4K7NA 4WEYA 4P3YB 1B48A 1MTCA 5F06A 3D4MA 1BX9A 4YKGA 2YWOA 5KN2A 1XWBA 3ISOA 2GT5A 1YJ6A 5ABRA 3HHVA 2DSAA 4Z7XA 4YAPA 4KB3A 4O5RA 1FVJA 1VGLA 3W8JA 4K1FA 1YKAA 5EPFA 2LUSA 3FK8A 4ZB8A 2LS5A 4KAEA 4AJ8A 3AY8A 3LSZA 2A2SA 1U88A 2C4JA 3MNGA 2PN8A 5ECMB 2YCDA 1F3AA 5HQPA 2FWHA 2FHEA 12GSA 2O85A 19GSA 2G2QA 4TVEA 4BA7A 2VCQA 3UJ1A 1UN2A 1Y6EA 1ABAA 1FW1A 2ES7A 2OE0A 3ED3A 3GKNA 4JR4A 3WGEA 3EU3A 4F0BA 2YWNA 4BVYA 5CRGA 2WULA 4MF7A 3Q74A 4G0KA 3GRXA 3F0IA 2YV9A 1AQXA 4MPFA 2PU9C 1TDIA 2JU5A 3F6FA 3M3MA 1OE7A 4GQFA 4WR5A 5KEJA 2PVOC 5GZZB 1E6BA 1ZYNA 3HKRA 5ID2B 1AW9A 3UBLA 3WD6A 3CRUA 4AJ6A 3GURA 5F8BA 4F03A 2KLXA 2MMOA 1SL0B 3O3TA 4BVXA 4F82A 1GWCA 3BD2A 3L9SA 5J9BA 2TRXA 5ECLB 6GSXA 4RQRA 4TR3A 2LV3A 4MCUA 4KDUA 3KM6A 2X4AA 1SENA 2PWJA 1HNBA 3EYTA 1THOA 2H0HA 2PERA 4ECIA 4YH2A 1GLQA 1A2JA 4PTSA 2DJKA 2GVPA 5HR1A 2PBJA 5CRHA 4V2NA 2AB6A 2JSYA 1R5AA 2GZPA 2CA8A 4KH7A 3TKQA 3O6TA 2XPEA 1OC9B 2FCHA 5ECKB 1JHBA 1TK5B 1ZOFA 1IYHA 4GWRA 4K2XA 1FB0A 5IMFA 4BWQA 2V6OA 3Q6OA 1KBNA 4NHZA 5JCWA 3FRCA 3QMXA 2V32A 3WGDA 2VL9A 1GULA 4JR6A 1AIUA 1ZZYA 2XBQA 17GSA 1J9BA 1PL2A 4XTSA 5DAKB 4V1Ag 5AN1A 5JWRB 2CZ2A 3HCZA 5DBQA 4XIHA 2UZ8A 5G5EA 5IPGA 3UBKA 2F3MA 1NSWA 2DJJA 3PH9A 5G1LA 3IK7A 3HVVA 1VF2A 2ON7A 20GSA 4MZWA 2IMIA 2X8CA 3DXBA 5IIZA 3IBHA 1TP9A 5D9VA 1SJZA 3DMLA 4DEJA 2VCZA 3HYPA 3H4KA 3RHCA 3HJPA 3DVWA 2VM1A 4GXZA 2A4HA 3IDVA 2IFQA 1EEJA 4OO4A 1MDKA 1EP7A 2WDUA 1AUCA 5G1KA 3FY7A 3QOUA 5H5SA 3EINA 2K18A 4NAXA 1GSDA 2GSTA 5J9CA 2GLRA 4IN0A 4KCAA 4PNGA 2C8UA 1WRYA 2GQLA 3L9VA 5BRTA 1F9MA 4OFMA 4FO5A 1WIKA 1YF1A 2YPMA 3C8EA 3PR8A 2PPTA 2B5YA 3BJ5A 5ECOB 3TKSC 4IQAA 4WXTA 4L0WA 3VI5A 2YWMA 1M2AA 4O92A 4OWYA 4ECCA 3U5RE 4ZIJA 5L71A 4RQXA 5DALA 1GSEA 2CT6A 2HZEB 2LEGA 4KNDA 1SJ6A 3ZFLA 3KTBA 2WGRA 3RAZA 5AIXA 4K2DA 2YNXA 4PGTA 3ZL5A 2H73A 1EEMA 4ZB9A 1T3BA 3G7JA 1X5CA 1M7TA 2LNSA 1QK8A 4KGIA 3QD9A 3ZREA 3LQ7A 1GH2A 1EP8A 4Q5RA 5FT3A 3W8SA 3H79A 3P7XA 7GSSA 3TKPA 1URMA 2H0GA 5AISA 3UIWA 4N30A 4AGSA 4ECBA 2MBTA 4POMA 2PMTA 4KE3A 2FWEA 3KH9A 1XWAA 1YKCA 3Q19A 5F07A 1SK1A 2X8GA 5ENUA 5CP1A 4XHMA 3MIXA 2DKHA 4Q5QA 2MBSA 1GUMA 1O7UA 4PUFC 1FO5A 3DKSA 3UVTA 5DCHA 4KSMA 2CVKA 4IP1A 5A4WA 1T1VA 1I5GA 3H1NA 1QQ2A 4FIWA 3HA9A 3D0ZA 1O8XA 1MEKA 3TKSE 1V9WA 3LORA 1AAZA 4EDZA 4MZCA 3QR6A 2H1DA 1GRXA 3VI7A 3R3EA 4K7OA 3MAKA 1WE0A 3F3QA 2GS3A 2H01A 4V2LA 1O73A 2L4QA 2YZUA 1X5DA 3ME8A 3KMOA 5JCGA 2IWTA 3A3TA 4J56E 4MH3A 3TKSA 2OADA 3FW2A 1TK8B 5CAXA 3ZZXA 1GL8A 4CY6A 1Z6MA 3DEXA 2R0GA 3EWLA 3BBYA 1GSUA 6GSWA 2XHFA 4OCEA 4G19A 1K0AA 4WETA 2C0FA 3QCPA 1EGOA 4EIQA 3UVHA 1TW9A 2AYTA 5C00A 4EE0A 3SBCA 13GSA 1Z5YE 2DC5A 2I3YA 2ZUPA 3CRTA 1CQHA 5IQYA 3WT1A 4HS1A 4PX1A 3P8WA 1M9AA 3JCML 1B4QA 3IK9A 4HI7A 4GQCA 4WBRD 2F51A 1PX7A 3IA1A 4BL7B 4MH2A 4HJ2A 1HNCA 1XCCA 1A0RP 4IS0A 2TIRA 2LTKA 2P0GA 2H8LA 1AQWA 1J08A 2R0CA 2GZZA 2VAFA 1U87A 1XW5A 1T4YA 4TXVA 4GTUA 3RDWA 4HU9A 3F9UA 5G5FA 5J3RA 5CNWA 3VPQA 3ERFA 2H76A 2H0IA 3HDCA 1MD4A 3G9BA 1X9WB 3FEUA 5E4WA 2VCTA 3KCMA 3A2WA 4PNFA 1TKDB 4GSTA 3SWLA 2OA7A 3TJGA 2QGVA 5IMDA 4DSSB 4G10A 1XWKA 1A8LA 3O76A 4TR1A 1K0OA 3UOMA 1SK2A 1SD9A 3KZQA 4KCEA 1ERTA 4ZL7A 1ZL9A 3VWWA 4ICYA 2KP1A 2FWGA 3GA4A 1U3AA 2OACA 2GGTA 4ZL9A 3MSZA 4V2MA 2P31A 2PGTA 3GX0A 4OO5A 2DBCA 1ML6A 5CO3A 4YQUA 5J4UA 5CYYA 1X9SB 4GRFA 4EUYA 3CTGA 1NW2A 2I81A 2HXKA 3HVSA 4L8EA 1ZYPA 5EY6A 4ILFA 2K8VA 4IJIA 4TR0A 3KXOA 2HYXA 4TR4A 3A2VA 2A2PA 1WJKA 2B7JA 3R2QA 2WCIA 4O5QA 4QQ7A 1TU8A 1E2YA 2X64A 2B5EA 2HRNA 2NVLA 5COHA 1T00A 1T8EB 3C1RA 5AIVA 3ZVJD 1Z7PA 5J41A 4N10A 3ERGA 1PN0A 1OC8A 1GTIA 3GYKA 3MWHA 1ZYQB 2IMKA 2I4AA 2OBIA 2H30A 3VWUA 1GLPA 2C0DA 2FNOA 1GNWA 4OCFA 3A2XA 4DSRA 2MZCA 5DCGA 3HXSA 5IPHA 2VCVA 1RK4A 1VF3A 4EL1A 1YDKA 5IMCA 5ECNB 2DMLA 3ERWA 4I8BA 1PKWA 3TJJA 2JACA 3KEBA 2YN1A 2BJXA 3CTFA 4HQZA 5H5QA 1EWXA 2L59A 4GSNA 3LG6A 1B4PA 1RQMA 2V6KA 4XRDA 3UL3A 5ECHB 3IR4A 2JZTA 2NDOA 3IAS2 6GSYA 2RLIA 3IAM2 2C80A 5A4VA 5BMUA 3LFLA 3EMXA 2H72A 2B1KA 3C7MA 3C1SA 1THXA 1AC1A 2BTOT 3P90A 4GLTA 2JZSA 4BVYB 3ZYWA 1B8XA 5LNKe 2VL2C 1TRWA 1UVZA 4K9ZA 4JRRA 1G7OA 1M9BA 3GUSA 1U3IA 5D73A 3QAGA 2NPBA 3ZLPA 2B3SA 3PINA 5GAPD 1XZOA 2REMA 2PUKC 1JFUA 3GTUA 5B7CA 3ZFBA 4BVXB 4OFNA 3M9JA 1K3YA 1ACVA 2EIOA 1A2MA 5F0GA 2CVDA 2V2GA 3RPPA 4XS1A 1C72A 4POKA 3QFAC 3W6GA 1TOFA 2TRCP 1USBA 5IMZA 5F05A 1PL1A 2IIYA 5B8AA 1PQNA 2JL4A 2F8AA 4D73A 3K8NA 2R37A 3TCOA 4ZILA 2R3XA 1SKWB 2MYGA 1GUKA 2C3TA 1LU4A 3CSHA 2RM6A 3CYNA 2A4VA 3F3RA 5JWQB 2QA1A 2HRFA 1ERUA 1YF0A 3V1WA 4TOPA 3TRXA 3I43A 3RPNA 1TU7A 1ERWA 3DIEA 2VLVA 4PUAA 1XW6A 3L0HA 1SL1B 1O8WA 1CQGA 2CVBA 1TXXA 4IKHA 4K5RA 14GSA 22GSA 2HE3A 3N9JA 4NWYA 2GT6A 3J7Yb 3KTLA 4OFTA 1XFLA 3KIJA 1H75A 4ZBDA 4WR4A 1GTUA 3F4SA 18GSA 5CRDA 1A23A 2HSHA 1K0BA 2LJRA 2OBKA 2LNTA 3M8NA 1S3AA 2K9FA 5ELAA 4HQSA 1V2AA 3J7Yk 1OKDA 2AAWA 2AHEA 2OJLA 2HFDA 1SKRB 16GSA 4I97A 1PN9A 2VM2A 1YEPA 3LYKA 1JLVA 2CQ9A 3GHAA 3TJFA 2QSIA 2VL2A 3KP8A 4JU5A 1BAYA 1XWCA 2VIMA 4XS4A 1BQ7A 1V98A 2ALBA 2H66A 2LKUA 1XOAA 2GQMA 3TOUA 1XW9A 1A24A 5DJLA 3FR3A 5LCZA 1VF4A 2OE3A 3RBTA 3TJBA 2IFQB 1DSBA 3UARA 4ID0A 1M2BA 3LW9A 2CV4A 3IE3A 3IV4A 4JBBA 3C71A 4MDCA 5AGYA 1EGRA 4X1UA 2FA4A 5KOXA 1T4ZA 3E3EA 2WFCA 2FWFA 3EMPA 1PKZA 3I6AA 3LJRA 4FYUA 3VK9A 3GL5A 1JZRA 6GSVA 1WOUA 1FOHA 2J23A 3P2AA 3IOSA 1DBYA 4IBPA 2H6XA 3OR5A 2VD1A 2FY6A 3HJOA 4IP6A 4KDYA 4FYBA 1W4VA 3H93A 5DALB 4KSOA 1TRUA 3GSSA 2HRKA 3D5JA 4N0VA 4E8EA 2L6CA 1G6YA 1UA5A 4Q5NA 4CY8A 4HU7A 5HFKA 2EIQA 4K5SA 3WT2A 2DIZA 3VFIA 4X43A 1V58A 3UAPA 1HQOA 2XBIA 5INYA 2DIYA 2GQKA 5ELGA 3CSIA 3DYRA 1OC3A 3CMIA 2ZNMA 5LD0A 5KN3A 3HVXA 1FAAA 2OKAA 1QMVA 5EVOA 4TXOA 1X9MB 4MLYA 3EVIA 4EXJA 3LXZA 5A5KA 3L78A 4KF9A 3EURA 4LLRA 2DLXA 2K6VA 4V1Ap 3IHGA 1QXHA 4K0NA 4L0UA 1SK0A 3L4NA 2JADA 3QFBC 1YQ1A 5H5RA 2CX3A 1EV9A 4MPGA 1Y25A 3WGXA 5ECIB 5IO2A 4MF5A 3VLNA 2VOCA 1BJXA 4K7IA 2KOKA 1HNAA 1Z7RA 1X0RA 4LMWA 2QA2A 1GUHA 3ZIVA 3HD5A 2VO4A 2JSZA 3RHBA 1QGVA 2CZ3A 5DVBA 3QDNA 1DE2A 1F6MC 2DJ2A 3E9JB 4AF2A 1ILOA 2L57A 2HI7A 3NOFA 9GSSA 1OYJA 4G2EA 4QL9A 1GNEA 4XS6A 1TJDA 1NHOA 3MDKA 1H4OA 1B9YC 2VD0A 3I69A 2KUCA 4G9HA 2DMMA 2C0EA 2HSMA 3G7IA 4EC0A 2G0FA 4TW5A 1HYUA 1O6JA 2WRTA 3QAVA 4YAVA 2H71A 1GSFA 3GL3A 4MP4A 4ISDA 1WPIA 1XVQA 2RUEA 2VL3A 2AV4A 4XCSA 5HFIA 2R6KA 2YJ7A 2PVQA 2E2GA 4JZQA 2VLUA 3HY2A 2LSTA 3TUEA 4BWSA 2KHPA 2M46A 4MF6A 3TRQA 2GSSA 3LWAA 1PA3A 2L5LA 4RUVA 2GSRA 4J2FA 2VUPA 4QL7A 3ZMKA 1R7HA 1JZWA 5KOWA 4IW9A 2RIIA 1PRXA 2M72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TGZ A;  1ON4 A;  1GSY A;  5G31 A;  2LRC A;  2H75 A;  3VPT A;  2C0G A;  5EL8 A;  5IMV A;  4PQ1 A;  1KEB A;  3VWX A;  2B5X A;  4MJA A;  5G2Z A;  2EIR A;  4HJM A;  3BCI A;  1WMJ A;  4NV2 A;  1V40 A;  4LL1 B;  2E2M A;  4O32 A;  3GFK A;  4I2U A;  1PX6 A;  1A0F A;  1O85 A;  2BMX A;  3IC4 A;  3NIV A;  3BCK A;  5CRE A;  2VCW A;  3GKX A;  4HUA A;  1JLW A;  5JCU A;  5DJM A;  2I1U A;  2H1B A;  3F6D A;  1PSQ A;  4F0C A;  1FHE A;  4KA0 A;  3GKK A;  1YY7 A;  4TR1 B;  5GST A;  4EO3 A;  3F63 A;  1JZD A;  2Z9S A;  4IQ1 A;  5ID2 A;  2B6M A;  2F8F A;  1JZO A;  2IL3 A;  1I9D A;  2E0Q A;  2V1M A;  2AJQ B;  1F2E A;  1OVN A;  1SD8 A;  1TI3 A;  3APQ A;  1EZK A;  4NHW A;  4PUR A;  2LJK A;  4KUN A;  2CX4 A;  2FD3 A;  3N5O A;  4DSQ A;  2NBS A;  1MD3 A;  2JZR A;  2OE1 A;  3TOT A;  3EE2 A;  1LBK A;  3Q18 A;  4EKZ A;  1M2D A;  4YQV A;  5DQS A;  8GSS A;  3LXT A;  4MJC A;  4ACS A;  5GSS A;  2H74 A;  3A5W A;  2HZF A;  2QC7 A;  1QFN A;  5D8I A;  4MAB A;  3FZ5 A;  5B6M A;  3BOA A;  3M9K A;  4ML1 A;  4KW6 A;  1OC9 A;  1OKT A;  4ULX A;  4E8H A;  4TN8 A;  4X0X A;  1FB6 A;  3GH6 A;  2GZY A;  2A2R A;  3S9F A;  4ZB6 A;  1TRV A;  4I6X A;  1SYX A;  2L6D A;  4LMV A;  1BED A;  3D22 A;  1Q4J A;  3M0F A;  1R4W A;  4J57 E;  2FGX A;  3TB2 A;  3UMA A;  4DVC A;  2L4C A;  4HZ2 A;  1QUW A;  5D9X A;  4EF0 A;  5IOW A;  1F37 A;  5DAK A;  5FWG A;  3KGK A;  1XPV A;  2LRT A;  3DGQ A;  2DJ1 A;  2C3N A;  1N8J A;  3LYP A;  2N5F A;  2WJU A;  2QKE A;  5HR0 A;  2H1A A;  3FR6 A;  4EDY A;  3GIX A;  1Z6N A;  4WF4 A;  4F9Z A;  1VRS D;  3IXR A;  3GST A;  2L5O A;  5IO0 A;  2F9S A;  4MJE A;  4JED A;  3L9U A;  3DVX A;  4NV5 A;  1SU9 A;  2N5A A;  1W89 A;  2IMF A;  3LGC A;  3APO A;  3FHK A;  1K3L A;  1YEX A;  5ECQ B;  1G7E A;  3TDG A;  5B8B A;  1FOV A;  1R5P A;  2FLS A;  5E59 A;  4NMU A;  11GS A;  1WP0 A;  3ZVJ A;  4PQH A;  4GSS A;  3GTU B;  1A2L A;  4IEL A;  2IPA A;  1A8Y A;  2MMA A;  1RW1 A;  2HLS A;  2E7P A;  2DJ3 A;  5GAN D;  5KN0 A;  3EC3 A;  2FA8 A;  1OE8 A;  2O7K A;  3KMN A;  3ZRD A;  2VLT A;  1XIY A;  3DWV A;  5G30 A;  10GS A;  3IRA A;  3KJY A;  2O87 A;  4MZB A;  4KDX A;  3GN3 A;  3WYW A;  2J9H A;  4N11 A;  2FUG 2;  3US3 A;  4D73 B;  4O7H A;  1EV4 A;  1FVK A;  2MMZ A;  5ECR B;  2N5B A;  5D9T A;  1R26 A;  1F3B A;  2WS2 A;  3KP9 A;  5HR3 A;  2HZE A;  4MK3 A;  4L5L A;  5HR2 A;  4KX4 A;  3F8U A;  2O8V B;  2YP6 A;  4EVM A;  4JE1 A;  3U6V A;  1GTA A;  4TKY A;  3GH9 A;  2H70 A;  5IOX A;  4AJ7 A;  4IJ3 A;  1K0N A;  3F4T A;  3D21 A;  1OAZ A;  2YZH A;  2C1Y A;  2HT9 A;  1YZX A;  3APS A;  2VCX A;  1S3D A;  3FZ9 A;  2YWI A;  4FYC A;  2C3Q A;  4POL A;  2H19 A;  6GSU A;  2R4V A;  2YAN A;  5IM9 A;  1DUG A;  4RI7 A;  5J5N A;  4F2I A;  1GP1 A;  3E0U A;  4ZL8 A;  1ST9 A;  3PGT A;  2V41 A;  3VWV A;  1K0C A;  2HNL A;  2H1G A;  1K3O A;  2RM5 A;  5B6N A;  3FKF A;  1PMT A;  2R5G A;  5ECP B;  4ECJ A;  4Q5F A;  3ZTL A;  3I9V 2;  3FZ4 A;  2EC4 A;  4TRX A;  2ON5 A;  1M99 A;  1KNG A;  4LA1 A;  4XS4 B;  4IHU A;  1AQV A;  4CHS A;  4POB A;  2LQO A;  3CBU A;  4WBJ A;  2GSQ A;  1TI1 A;  4PXO A;  1X5E A;  1M0U A;  4CDO A;  2P5R A;  1XBS A;  4ML6 A;  3KD0 A;  2GDR A;  4MA9 A;  3GX8 A;  4IGJ A;  5HFG A;  2LQQ A;  3DD3 A;  1XXU A;  3CSJ A;  4HOJ A;  1U6T A;  3D6I A;  4OMV A;  2B1L A;  4YQM A;  4K6X A;  4ZXG A;  2RUF A;  2MMN A;  4I5Q A;  1TRS A;  2O89 A;  5ECS A;  2XC2 A;  3GMF A;  3IHQ A;  4HDE A;  1SL2 B;  1Q98 A;  3VUR A;  2AUV A;  3HJM A;  1LJR A;  5FHI A;  1MDJ A;  4K8M A;  3LEF A;  2P5Q A;  3ZIT A;  1DE1 A;  3QPM A;  3FYG A;  1ZCP A;  2IN3 A;  1AXD A;  1TTZ A;  4HZ4 A;  5IMA A;  1XVW A;  3KH7 A;  2YV7 A;  2LRN A;  3GV1 A;  3ZIJ A;  1SJI A;  6GST A;  1NM3 A;  3DRN A;  1G6W A;  1K0M A;  2WB9 A;  4I2T A;  1IYI A;  4OD7 A;  1O81 A;  1NHY A;  2H6Y A;  3TRP A;  4IVF A;  4PQI A;  1N2A A;  3EU4 A;  2CAQ A;  2B7K A;  1XWG A;  1TK0 B;  3QAW A;  4GCI A;  4H86 A;  1SKS B;  4N0Z A;  4BL7 A;  1T7P B;  1ERV A;  4ZBB A;  3HZ4 A;  5JWO B;  1KTE A;  4TXO B;  1BG5 A;  1G0T A;  4LL4 B;  4RI6 A;  1UC7 A;  4HEA 2;  1GSS A;  4NXI A;  1Z3E A;  3TKR A;  4BPY A;  3UEM A;  2X8H A;  1K0D A;  3ME7 A;  1B9X C;  4CW9 A;  3GNJ A;  2DJ0 A;  5D93 A;  5A4U A;  1VF1 A;  2HSY A;  3CXG A;  2IJY A;  3FR9 A;  2D2Z A;  1MDI A;  2X99 A;  5DDL A;  3GKM A;  2NTO A;  2XPD A;  2LJA A;  3G7Y A;  3ZML A;  1XOB A;  5D96 A;  3C73 A;  2IME A;  4WF5 A;  1ZMA A;  1GSQ A;  1SYR A;  2GTU A;  5DQY A;  1PD2 1;  3FZA A;  4DSS A;  1BYE A;  3M1G A;  2I9H A;  4GF0 A;  3H8Q A;  5C04 A;  2R2J A;  1S3C A;  1EOH A;  1Z9H A;  2H6Z A;  2M80 A;  1WWJ A;  2ZCT A;  4FH8 A;  1ZYE A;  4MMM A;  5KN1 A;  2K8S A;  3HZ8 A;  5D9W A;  5CRW A;  3F4R A;  4K0G A;  3TJK A;  4NPB A;  3NZN A;  1GTB A;  2IMD A;  4XRA A;  2YJH A;  4WKW A;  1V57 A;  4MJB A;  1FG4 A;  1HD2 A;  6GSS A;  2YOI A;  4L5O A;  2WZ9 A;  1J0F A;  3D4T A;  2KP2 A;  1EOG A;  4ZBA A;  3IPZ A;  1ZGN A;  1PGT A;  2CAI A;  4K7N A;  4WEY A;  4P3Y B;  1B48 A;  1MTC A;  5F06 A;  3D4M A;  1BX9 A;  2YWO A;  5KN2 A;  1XWB A;  3ISO A;  2GT5 A;  1YJ6 A;  5ABR A;  3HHV A;  2DSA A;  4Z7X A;  4YAP A;  4KB3 A;  4O5R A;  1FVJ A;  1VGL A;  3W8J A;  4K1F A;  1YKA A;  5EPF A;  2LUS A;  3FK8 A;  4ZB8 A;  2LS5 A;  4KAE A;  4AJ8 A;  3AY8 A;  3LSZ A;  2A2S A;  1U88 A;  2C4J A;  3MNG A;  2PN8 A;  5ECM B;  2YCD A;  1F3A A;  5HQP A;  2FWH A;  2FHE A;  12GS A;  2O85 A;  19GS A;  2G2Q A;  4TVE A;  4BA7 A;  2VCQ A;  3UJ1 A;  1UN2 A;  1Y6E A;  1ABA A;  1FW1 A;  2ES7 A;  2OE0 A;  3ED3 A;  3GKN A;  4JR4 A;  3WGE A;  3EU3 A;  4F0B A;  2YWN A;  4BVY A;  5CRG A;  2WUL A;  4MF7 A;  3Q74 A;  3GRX A;  3F0I A;  2YV9 A;  1AQX A;  4MPF A;  2PU9 C;  1TDI A;  2JU5 A;  3F6F A;  3M3M A;  1OE7 A;  4GQF A;  4WR5 A;  5KEJ A;  2PVO C;  5GZZ B;  1E6B A;  3HKR A;  5ID2 B;  1AW9 A;  3UBL A;  3WD6 A;  3CRU A;  4AJ6 A;  3GUR A;  5F8B A;  4F03 A;  2KLX A;  2MMO A;  1SL0 B;  3O3T A;  4BVX A;  4F82 A;  1GWC A;  3BD2 A;  3L9S A;  5J9B A;  2TRX A;  5ECL B;  6GSX A;  4RQR A;  4TR3 A;  2LV3 A;  4MCU A;  4KDU A;  3KM6 A;  1SEN A;  2PWJ A;  1HNB A;  3EYT A;  1THO A;  2H0H A;  2PER A;  4ECI A;  4YH2 A;  1GLQ A;  1A2J A;  2DJK A;  2GVP A;  5HR1 A;  2PBJ A;  5CRH A;  4V2N A;  2AB6 A;  2JSY A;  1R5A A;  2GZP A;  2CA8 A;  4KH7 A;  3TKQ A;  3O6T A;  2XPE A;  1OC9 B;  2FCH A;  5ECK B;  1JHB A;  1TK5 B;  1ZOF A;  1IYH A;  4GWR A;  1FB0 A;  5IMF A;  4BWQ A;  2V6O A;  3Q6O A;  1KBN A;  4NHZ A;  5JCW A;  3FRC A;  3QMX A;  2V32 A;  3WGD A;  2VL9 A;  1GUL A;  4JR6 A;  1AIU A;  1ZZY A;  2XBQ A;  17GS A;  1J9B A;  1PL2 A;  4XTS A;  5DAK B;  4V1A g;  5AN1 A;  5JWR B;  2CZ2 A;  3HCZ A;  5DBQ A;  4XIH A;  5G5E A;  5IPG A;  3UBK A;  2F3M A;  1NSW A;  2DJJ A;  3PH9 A;  5G1L A;  3IK7 A;  3HVV A;  1VF2 A;  2ON7 A;  20GS A;  4MZW A;  2IMI A;  2X8C A;  3DXB A;  5IIZ A;  3IBH A;  1TP9 A;  5D9V A;  1SJZ A;  3DML A;  4DEJ A;  2VCZ A;  3HYP A;  3H4K A;  3RHC A;  3HJP A;  3DVW A;  2VM1 A;  4GXZ A;  3IDV A;  2IFQ A;  1EEJ A;  4OO4 A;  1MDK A;  1EP7 A;  2WDU A;  1AUC A;  5G1K A;  3FY7 A;  3QOU A;  5H5S A;  3EIN A;  2K18 A;  4NAX A;  1GSD A;  2GST A;  5J9C A;  2GLR A;  4IN0 A;  4KCA A;  4PNG A;  2C8U A;  1WRY A;  2GQL A;  3L9V A;  1F9M A;  4OFM A;  4FO5 A;  1WIK A;  1YF1 A;  2YPM A;  3C8E A;  3PR8 A;  2PPT A;  2B5Y A;  3BJ5 A;  5ECO B;  3TKS C;  4IQA A;  4WXT A;  4L0W A;  3VI5 A;  2YWM A;  1M2A A;  4O92 A;  4OWY A;  4ECC A;  3U5R E;  4ZIJ A;  5L71 A;  4RQX A;  5DAL A;  1GSE A;  2CT6 A;  2HZE B;  2LEG A;  4KND A;  1SJ6 A;  3ZFL A;  3KTB A;  2WGR A;  3RAZ A;  5AIX A;  4K2D A;  2YNX A;  4PGT A;  3ZL5 A;  2H73 A;  1EEM A;  4ZB9 A;  1T3B A;  3G7J A;  1X5C A;  1M7T A;  2LNS A;  1QK8 A;  4KGI A;  3QD9 A;  3ZRE A;  3LQ7 A;  1GH2 A;  1EP8 A;  4Q5R A;  5FT3 A;  3W8S A;  3H79 A;  3P7X A;  7GSS A;  3TKP A;  1URM A;  2H0G A;  5AIS A;  3UIW A;  4N30 A;  4AGS A;  4ECB A;  2MBT A;  4POM A;  2PMT A;  4KE3 A;  2FWE A;  3KH9 A;  1XWA A;  1YKC A;  3Q19 A;  5F07 A;  1SK1 A;  2X8G A;  5ENU A;  5CP1 A;  4XHM A;  4Q5Q A;  2MBS A;  1GUM A;  1O7U A;  4PUF C;  1FO5 A;  3DKS A;  3UVT A;  5DCH A;  4KSM A;  2CVK A;  4IP1 A;  5A4W A;  1T1V A;  1I5G A;  3H1N A;  1QQ2 A;  4FIW A;  3HA9 A;  3D0Z A;  1O8X A;  1MEK A;  3TKS E;  1V9W A;  3LOR A;  1AAZ A;  4EDZ A;  4MZC A;  3QR6 A;  2H1D A;  1GRX A;  3VI7 A;  4K7O A;  3MAK A;  1WE0 A;  3F3Q A;  2GS3 A;  2H01 A;  4V2L A;  1O73 A;  2L4Q A;  2YZU A;  1X5D A;  3ME8 A;  3KMO A;  5JCG A;  2IWT A;  3A3T A;  4J56 E;  4MH3 A;  3TKS A;  2OAD A;  3FW2 A;  1TK8 B;  5CAX A;  3ZZX A;  1GL8 A;  1Z6M A;  3DEX A;  3EWL A;  3BBY A;  1GSU A;  6GSW A;  2XHF A;  4OCE A;  4G19 A;  1K0A A;  4WET A;  2C0F A;  3QCP A;  1EGO A;  3UVH A;  1TW9 A;  2AYT A;  5C00 A;  4EE0 A;  3SBC A;  13GS A;  1Z5Y E;  2DC5 A;  2I3Y A;  2ZUP A;  3CRT A;  1CQH A;  5IQY A;  3WT1 A;  4HS1 A;  4PX1 A;  3P8W A;  1M9A A;  3JCM L;  1B4Q A;  3IK9 A;  4HI7 A;  4GQC A;  4WBR D;  2F51 A;  1PX7 A;  3IA1 A;  4MH2 A;  4HJ2 A;  1HNC A;  1XCC A;  1A0R P;  4IS0 A;  2TIR A;  2LTK A;  2P0G A;  2H8L A;  1AQW A;  1J08 A;  2GZZ A;  2VAF A;  1U87 A;  1XW5 A;  1T4Y A;  4TXV A;  4GTU A;  3RDW A;  4HU9 A;  3F9U A;  5G5F A;  5J3R A;  5CNW A;  3VPQ A;  3ERF A;  2H76 A;  2H0I A;  3HDC A;  1MD4 A;  3G9B A;  1X9W B;  3FEU A;  5E4W A;  2VCT A;  3KCM A;  3A2W A;  4PNF A;  1TKD B;  4GST A;  3SWL A;  2OA7 A;  3TJG A;  2QGV A;  5IMD A;  4DSS B;  4G10 A;  1XWK A;  1A8L A;  3O76 A;  4TR1 A;  1K0O A;  3UOM A;  1SK2 A;  1SD9 A;  3KZQ A;  4KCE A;  1ERT A;  4ZL7 A;  1ZL9 A;  3VWW A;  2KP1 A;  2FWG A;  3GA4 A;  1U3A A;  2OAC A;  2GGT A;  4ZL9 A;  3MSZ A;  4V2M A;  2P31 A;  2PGT A;  3GX0 A;  4OO5 A;  2DBC A;  1ML6 A;  5CO3 A;  4YQU A;  5J4U A;  5CYY A;  1X9S B;  4GRF A;  4EUY A;  3CTG A;  1NW2 A;  2I81 A;  2HXK A;  3HVS A;  4L8E A;  5EY6 A;  4ILF A;  2K8V A;  4IJI A;  4TR0 A;  3KXO A;  2HYX A;  4TR4 A;  3A2V A;  1WJK A;  2B7J A;  3R2Q A;  2WCI A;  4QQ7 A;  1TU8 A;  1E2Y A;  2X64 A;  2B5E A;  2HRN A;  2NVL A;  5COH A;  1T00 A;  1T8E B;  3C1R A;  5AIV A;  3ZVJ D;  1Z7P A;  5J41 A;  4N10 A;  3ERG A;  1OC8 A;  1GTI A;  3GYK A;  3MWH A;  1ZYQ B;  2IMK A;  2I4A A;  2OBI A;  2H30 A;  3VWU A;  1GLP A;  2C0D A;  2FNO A;  1GNW A;  4OCF A;  3A2X A;  4DSR A;  2MZC A;  5DCG A;  3HXS A;  5IPH A;  2VCV A;  1RK4 A;  1VF3 A;  4EL1 A;  1YDK A;  5IMC A;  5ECN B;  2DML A;  3ERW A;  4I8B A;  1PKW A;  3TJJ A;  2JAC A;  3KEB A;  2YN1 A;  2BJX A;  3CTF A;  4HQZ A;  5H5Q A;  1EWX A;  2L59 A;  4GSN A;  3LG6 A;  1B4P A;  1RQM A;  2V6K A;  4XRD A;  3UL3 A;  5ECH B;  3IR4 A;  2JZT A;  2NDO A;  3IAS 2;  6GSY A;  2RLI A;  3IAM 2;  2C80 A;  5A4V A;  3LFL A;  3EMX A;  2H72 A;  2B1K A;  3C7M A;  3C1S A;  1THX A;  1AC1 A;  2BTO T;  3P90 A;  4GLT A;  2JZS A;  3ZYW A;  1B8X A;  5LNK e;  2VL2 C;  1TRW A;  1UVZ A;  4K9Z A;  4JRR A;  1G7O A;  1M9B A;  3GUS A;  1U3I A;  5D73 A;  3QAG A;  2NPB A;  3ZLP A;  2B3S A;  3PIN A;  5GAP D;  1XZO A;  2REM A;  2PUK C;  1JFU A;  3GTU A;  5B7C A;  3ZFB A;  4OFN A;  3M9J A;  1K3Y A;  1ACV A;  2EIO A;  1A2M A;  5F0G A;  2CVD A;  2V2G A;  3RPP A;  4XS1 A;  1C72 A;  4POK A;  3QFA C;  3W6G A;  1TOF A;  2TRC P;  1USB A;  5IMZ A;  5F05 A;  1PL1 A;  2IIY A;  5B8A A;  1PQN A;  2JL4 A;  2F8A A;  4D73 A;  3K8N A;  2R37 A;  3TCO A;  4ZIL A;  2R3X A;  1SKW B;  2MYG A;  1GUK A;  2C3T A;  1LU4 A;  3CSH A;  2RM6 A;  3CYN A;  2A4V A;  3F3R A;  5JWQ B;  2HRF A;  1ERU A;  1YF0 A;  3V1W A;  4TOP A;  3TRX A;  3I43 A;  3RPN A;  1TU7 A;  1ERW A;  3DIE A;  2VLV A;  4PUA A;  1XW6 A;  3L0H A;  1SL1 B;  1O8W A;  1CQG A;  2CVB A;  1TXX A;  4IKH A;  14GS A;  22GS A;  2HE3 A;  3N9J A;  4NWY A;  2GT6 A;  3J7Y b;  3KTL A;  4OFT A;  1XFL A;  3KIJ A;  1H75 A;  4ZBD A;  4WR4 A;  1GTU A;  3F4S A;  18GS A;  5CRD A;  1A23 A;  2HSH A;  1K0B A;  2LJR A;  2OBK A;  2LNT A;  3M8N A;  1S3A A;  2K9F A;  5ELA A;  4HQS A;  1V2A A;  3J7Y k;  1OKD A;  2AAW A;  2AHE A;  2OJL A;  2HFD A;  1SKR B;  16GS A;  4I97 A;  1PN9 A;  2VM2 A;  1YEP A;  3LYK A;  1JLV A;  2CQ9 A;  3GHA A;  3TJF A;  2QSI A;  2VL2 A;  3KP8 A;  4JU5 A;  1BAY A;  1XWC A;  2VIM A;  4XS4 A;  1BQ7 A;  1V98 A;  2ALB A;  2H66 A;  2LKU A;  1XOA A;  2GQM A;  3TOU A;  1XW9 A;  1A24 A;  5DJL A;  3FR3 A;  5LCZ A;  1VF4 A;  2OE3 A;  3RBT A;  3TJB A;  2IFQ B;  1DSB A;  3UAR A;  4ID0 A;  1M2B A;  2CV4 A;  3IE3 A;  3IV4 A;  4JBB A;  3C71 A;  4MDC A;  5AGY A;  1EGR A;  4X1U A;  2FA4 A;  1T4Z A;  3E3E A;  2WFC A;  2FWF A;  3EMP A;  1PKZ A;  3I6A A;  3LJR A;  4FYU A;  3VK9 A;  3GL5 A;  1JZR A;  6GSV A;  1WOU A;  2J23 A;  3P2A A;  3IOS A;  1DBY A;  4IBP A;  2H6X A;  3OR5 A;  2VD1 A;  2FY6 A;  3HJO A;  4IP6 A;  4KDY A;  4FYB A;  1W4V A;  3H93 A;  5DAL B;  4KSO A;  1TRU A;  3GSS A;  3D5J A;  4N0V A;  4E8E A;  2L6C A;  1G6Y A;  1UA5 A;  4Q5N A;  4HU7 A;  5HFK A;  2EIQ A;  3WT2 A;  2DIZ A;  3VFI A;  4X43 A;  1V58 A;  3UAP A;  1HQO A;  2XBI A;  5INY A;  2DIY A;  2GQK A;  5ELG A;  3CSI A;  3DYR A;  1OC3 A;  3CMI A;  2ZNM A;  5LD0 A;  5KN3 A;  3HVX A;  1FAA A;  2OKA A;  1QMV A;  5EVO A;  4TXO A;  1X9M B;  4MLY A;  3EVI A;  4EXJ A;  3LXZ A;  5A5K A;  3L78 A;  3EUR A;  4LLR A;  2DLX A;  2K6V A;  4V1A p;  1QXH A;  4K0N A;  4L0U A;  1SK0 A;  3L4N A;  2JAD A;  3QFB C;  1YQ1 A;  5H5R A;  2CX3 A;  1EV9 A;  4MPG A;  1Y25 A;  3WGX A;  5ECI B;  5IO2 A;  4MF5 A;  3VLN A;  2VOC A;  1BJX A;  4K7I A;  2KOK A;  1HNA A;  1Z7R A;  1X0R A;  4LMW A;  1GUH A;  3ZIV A;  3HD5 A;  2VO4 A;  2JSZ A;  3RHB A;  1QGV A;  2CZ3 A;  5DVB A;  3QDN A;  1DE2 A;  1F6M C;  2DJ2 A;  3E9J B;  4AF2 A;  1ILO A;  2L57 A;  2HI7 A;  3NOF A;  9GSS A;  1OYJ A;  4G2E A;  4QL9 A;  1GNE A;  4XS6 A;  1TJD A;  1NHO A;  3MDK A;  1H4O A;  1B9Y C;  2VD0 A;  3I69 A;  2KUC A;  4G9H A;  2DMM A;  2C0E A;  3G7I A;  4EC0 A;  2G0F A;  4TW5 A;  1HYU A;  1O6J A;  2WRT A;  3QAV A;  4YAV A;  2H71 A;  1GSF A;  3GL3 A;  4MP4 A;  4ISD A;  1WPI A;  1XVQ A;  2RUE A;  2VL3 A;  2AV4 A;  4XCS A;  5HFI A;  2R6K A;  2YJ7 A;  2PVQ A;  2E2G A;  4JZQ A;  2VLU A;  3HY2 A;  2LST A;  3TUE A;  4BWS A;  2KHP A;  2M46 A;  4MF6 A;  3TRQ A;  2GSS A;  3LWA A;  1PA3 A;  2L5L A;  4RUV A;  2GSR A;  4J2F A;  2VUP A;  4QL7 A;  3ZMK A;  1R7H A;  1JZW A;  4IW9 A;  2RII A;  1PRX A;  2M72 A; 
#chains in the Genus database with same CATH topology
 3TGZ A;  1ON4 A;  1GSY A;  5G31 A;  2LRC A;  2H75 A;  3VPT A;  2C0G A;  5EL8 A;  5IMV A;  4PQ1 A;  1KEB A;  3VWX A;  2B5X A;  4MJA A;  5G2Z A;  2EIR A;  4HJM A;  3BCI A;  1WMJ A;  4NV2 A;  1V40 A;  4LL1 B;  2E2M A;  4O32 A;  3GFK A;  4I2U A;  1PX6 A;  1A0F A;  1O85 A;  2BMX A;  3IC4 A;  3NIV A;  4X4J A;  3BCK A;  5CRE A;  2VCW A;  3GKX A;  4HUA A;  1JLW A;  5JCU A;  5DJM A;  2I1U A;  2H1B A;  3F6D A;  1PSQ A;  4F0C A;  1FHE A;  4KA0 A;  3GKK A;  1YY7 A;  4TR1 B;  5GST A;  4EO3 A;  3F63 A;  1JZD A;  2Z9S A;  4IQ1 A;  5ID2 A;  2B6M A;  2F8F A;  1JZO A;  2IL3 A;  1I9D A;  2E0Q A;  2V1M A;  2AJQ B;  1F2E A;  2X49 A;  1OVN A;  1SD8 A;  1TI3 A;  3APQ A;  1EZK A;  4NHW A;  4PUR A;  2LJK A;  4KUN A;  2CX4 A;  2FD3 A;  3N5O A;  4DSQ A;  2NBS A;  1MD3 A;  2JZR A;  2OE1 A;  3TOT A;  3EE2 A;  1LBK A;  3Q18 A;  4EKZ A;  1M2D A;  4YQV A;  5DQS A;  8GSS A;  3LXT A;  3EPT A;  4MJC A;  4ACS A;  5GSS A;  2H74 A;  3A5W A;  2HZF A;  2QC7 A;  1QFN A;  5D8I A;  4MAB A;  3FZ5 A;  5B6M A;  3BOA A;  3M9K A;  4ML1 A;  4KW6 A;  1OC9 A;  1OKT A;  4ULX A;  4E8H A;  4TN8 A;  4X0X A;  1FB6 A;  3GH6 A;  2GZY A;  2A2R A;  3S9F A;  4ZB6 A;  1TRV A;  4I6X A;  1SYX A;  2L6D A;  4LMV A;  1BED A;  3D22 A;  1Q4J A;  3M0F A;  1R4W A;  4J57 E;  4Z2U A;  2FGX A;  3TB2 A;  3UMA A;  4DVC A;  2L4C A;  4HZ2 A;  1QUW A;  5D9X A;  4EF0 A;  5IOW A;  1F37 A;  5DAK A;  5FWG A;  3KGK A;  1XPV A;  2LRT A;  3DGQ A;  2DJ1 A;  2C3N A;  1N8J A;  3LYP A;  2N5F A;  2WJU A;  2QKE A;  5HR0 A;  2H1A A;  3FR6 A;  4EDY A;  3GIX A;  1Z6N A;  4WF4 A;  4F9Z A;  1VRS D;  3IXR A;  3GST A;  2L5O A;  5IO0 A;  2F9S A;  4MJE A;  4JED A;  3L9U A;  3DVX A;  3IC8 A;  4NV5 A;  1SU9 A;  2N5A A;  1W89 A;  2IMF A;  3A5I A;  3LGC A;  3APO A;  3FHK A;  1K3L A;  1YEX A;  5ECQ B;  1G7E A;  3TDG A;  5B8B A;  1FOV A;  1R5P A;  2FLS A;  5E59 A;  4NMU A;  11GS A;  1WP0 A;  3ZVJ A;  4PQH A;  4GSS A;  2DKI A;  3GTU B;  1A2L A;  4IEL A;  2IPA A;  1A8Y A;  2MMA A;  1RW1 A;  2HLS A;  2E7P A;  2DJ3 A;  5GAN D;  2R0P A;  5KN0 A;  3EC3 A;  2FA8 A;  1OE8 A;  2O7K A;  3KMN A;  3ZRD A;  4Z2R A;  2VLT A;  1XIY A;  3DWV A;  5G30 A;  10GS A;  3IRA A;  3KJY A;  2O87 A;  4MZB A;  4KDX A;  3GN3 A;  3WYW A;  2J9H A;  4N11 A;  2FUG 2;  3US3 A;  4D73 B;  4O7H A;  1EV4 A;  1FVK A;  2MMZ A;  5ECR B;  2N5B A;  5D9T A;  1R26 A;  1F3B A;  2WS2 A;  3KP9 A;  5HR3 A;  2HZE A;  4MK3 A;  4L5L A;  5HR2 A;  4KX4 A;  3F8U A;  2O8V B;  2YP6 A;  4EVM A;  4JE1 A;  3U6V A;  1GTA A;  4TKY A;  3GH9 A;  2H70 A;  5IOX A;  4AJ7 A;  1S3R A;  4IJ3 A;  1K0N A;  3F4T A;  3D21 A;  1M3I A;  1OAZ A;  2YZH A;  2C1Y A;  2HT9 A;  1YZX A;  3APS A;  2VCX A;  1S3D A;  3FZ9 A;  2YWI A;  4FYC A;  2C3Q A;  4POL A;  2H19 A;  6GSU A;  2R4V A;  2YAN A;  5IM9 A;  1DUG A;  4RI7 A;  5J5N A;  4F2I A;  1GP1 A;  3E0U A;  4ZL8 A;  1ST9 A;  3PGT A;  2V41 A;  3VWV A;  1K0C A;  2HNL A;  2H1G A;  1K3O A;  2RM5 A;  5B6N A;  3FKF A;  4O5U A;  1PMT A;  1PFO A;  2R5G A;  5ECP B;  4ECJ A;  4Q5F A;  3ZTL A;  3I9V 2;  3FZ4 A;  2EC4 A;  4TRX A;  2HRA A;  2ON5 A;  1M99 A;  1KNG A;  4LA1 A;  4XS4 B;  4IHU A;  1AQV A;  4CHS A;  4POB A;  2LQO A;  3CBU A;  4WBJ A;  2GSQ A;  1TI1 A;  4PXO A;  1X5E A;  1M0U A;  4CDO A;  2P5R A;  1XBS A;  4ML6 A;  3KD0 A;  2GDR A;  4MA9 A;  3GX8 A;  4IGJ A;  5HFG A;  2LQQ A;  3DD3 A;  1XXU A;  3CSJ A;  4HOJ A;  1U6T A;  3D6I A;  4OMV A;  2B1L A;  4YQM A;  4K6X A;  4ZXG A;  2RUF A;  2MMN A;  4I5Q A;  1TRS A;  2O89 A;  5ECS A;  2XC2 A;  3GMF A;  3IHQ A;  4HDE A;  1SL2 B;  1Q98 A;  3VUR A;  2AUV A;  3HJM A;  1LJR A;  5FHI A;  1MDJ A;  4K8M A;  3LEF A;  4MNN A;  4FQU A;  2P5Q A;  3ZIT A;  1DE1 A;  3QPM A;  3FYG A;  1ZCP A;  4YKF A;  2IN3 A;  1AXD A;  1TTZ A;  4HZ4 A;  5IMA A;  1XVW A;  3KH7 A;  2YV7 A;  2LRN A;  3GV1 A;  4EIP A;  3ZIJ A;  1SJI A;  6GST A;  1NM3 A;  3DRN A;  1G6W A;  1K0M A;  3FMW A;  2WB9 A;  4I2T A;  1IYI A;  4OD7 A;  1O81 A;  1NHY A;  2H6Y A;  3TRP A;  4IVF A;  4PQI A;  1N2A A;  3EU4 A;  2CAQ A;  2B7K A;  1XWG A;  1TK0 B;  3QAW A;  4GCI A;  3PPU A;  4H86 A;  1SKS B;  4N0Z A;  4BL7 A;  1T7P B;  1ERV A;  4ZBB A;  3HZ4 A;  5JWO B;  1KTE A;  4TXO B;  1BG5 A;  1G0T A;  4LL4 B;  4RI6 A;  1UC7 A;  4HEA 2;  1GSS A;  4NXI A;  3MYD A;  1Z3E A;  3TKR A;  4BPY A;  3UEM A;  2X8H A;  1K0D A;  3ME7 A;  1B9X C;  4CW9 A;  3GNJ A;  2DJ0 A;  5D93 A;  3HVN A;  5A4U A;  1VF1 A;  2HSY A;  3CXG A;  2IJY A;  3FR9 A;  2D2Z A;  1MDI A;  2X99 A;  5DDL A;  3GKM A;  2NTO A;  2XPD A;  2LJA A;  3G7Y A;  3ZML A;  1XOB A;  5D96 A;  3C73 A;  2IME A;  4WF5 A;  1ZMA A;  1GSQ A;  1SYR A;  2GTU A;  5DQY A;  1PD2 1;  3FZA A;  4DSS A;  1BYE A;  3M1G A;  2I9H A;  4GF0 A;  3H8Q A;  5C04 A;  2R2J A;  1S3C A;  1EOH A;  1Z9H A;  2H6Z A;  4USS A;  4G0I A;  2M80 A;  1WWJ A;  2ZCT A;  4FH8 A;  4A5P A;  1ZYE A;  4MMM A;  5KN1 A;  2K8S A;  3HZ8 A;  4G0L A;  5D9W A;  5CRW A;  3F4R A;  4K0G A;  3TJK A;  4Z2T A;  4NPB A;  3NZN A;  1GTB A;  2IMD A;  4XRA A;  2YJH A;  4WKW A;  1V57 A;  4MJB A;  1FG4 A;  1HD2 A;  6GSS A;  2YOI A;  4L5O A;  2WZ9 A;  1J0F A;  3D4T A;  2KP2 A;  1EOG A;  4ZBA A;  3IPZ A;  1ZGN A;  1PGT A;  2CAI A;  4K7N A;  4WEY A;  4P3Y B;  1B48 A;  1MTC A;  5F06 A;  3D4M A;  1BX9 A;  4YKG A;  2YWO A;  5KN2 A;  1XWB A;  3ISO A;  2GT5 A;  1YJ6 A;  5ABR A;  3HHV A;  2DSA A;  4Z7X A;  4YAP A;  4KB3 A;  4O5R A;  1FVJ A;  1VGL A;  3W8J A;  4K1F A;  1YKA A;  5EPF A;  2LUS A;  3FK8 A;  4ZB8 A;  2LS5 A;  4KAE A;  4AJ8 A;  3AY8 A;  3LSZ A;  2A2S A;  1U88 A;  2C4J A;  3MNG A;  2PN8 A;  5ECM B;  2YCD A;  1F3A A;  5HQP A;  2FWH A;  2FHE A;  12GS A;  2O85 A;  19GS A;  2G2Q A;  4TVE A;  4BA7 A;  2VCQ A;  3UJ1 A;  1UN2 A;  1Y6E A;  1ABA A;  1FW1 A;  2ES7 A;  2OE0 A;  3ED3 A;  3GKN A;  4JR4 A;  3WGE A;  3EU3 A;  4F0B A;  2YWN A;  4BVY A;  5CRG A;  2WUL A;  4MF7 A;  3Q74 A;  4G0K A;  3GRX A;  3F0I A;  2YV9 A;  1AQX A;  4MPF A;  2PU9 C;  1TDI A;  2JU5 A;  3F6F A;  3M3M A;  1OE7 A;  4GQF A;  4WR5 A;  5KEJ A;  2PVO C;  5GZZ B;  1E6B A;  1ZYN A;  3HKR A;  5ID2 B;  1AW9 A;  3UBL A;  3WD6 A;  3CRU A;  4AJ6 A;  3GUR A;  5F8B A;  4F03 A;  2KLX A;  2MMO A;  1SL0 B;  3O3T A;  4BVX A;  4F82 A;  1GWC A;  3BD2 A;  3L9S A;  5J9B A;  2TRX A;  5ECL B;  6GSX A;  4RQR A;  4TR3 A;  2LV3 A;  4MCU A;  4KDU A;  3KM6 A;  2X4A A;  1SEN A;  2PWJ A;  1HNB A;  3EYT A;  1THO A;  2H0H A;  2PER A;  4ECI A;  4YH2 A;  1GLQ A;  1A2J A;  4PTS A;  2DJK A;  2GVP A;  5HR1 A;  2PBJ A;  5CRH A;  4V2N A;  2AB6 A;  2JSY A;  1R5A A;  2GZP A;  2CA8 A;  4KH7 A;  3TKQ A;  3O6T A;  2XPE A;  1OC9 B;  2FCH A;  5ECK B;  1JHB A;  1TK5 B;  1ZOF A;  1IYH A;  4GWR A;  4K2X A;  1FB0 A;  5IMF A;  4BWQ A;  2V6O A;  3Q6O A;  1KBN A;  4NHZ A;  5JCW A;  3FRC A;  3QMX A;  2V32 A;  3WGD A;  2VL9 A;  1GUL A;  4JR6 A;  1AIU A;  1ZZY A;  2XBQ A;  17GS A;  1J9B A;  1PL2 A;  4XTS A;  5DAK B;  4V1A g;  5AN1 A;  5JWR B;  2CZ2 A;  3HCZ A;  5DBQ A;  4XIH A;  2UZ8 A;  5G5E A;  5IPG A;  3UBK A;  2F3M A;  1NSW A;  2DJJ A;  3PH9 A;  5G1L A;  3IK7 A;  3HVV A;  1VF2 A;  2ON7 A;  20GS A;  1M3J A;  4MZW A;  2IMI A;  2X8C A;  3DXB A;  5IIZ A;  3IBH A;  1TP9 A;  5D9V A;  1SJZ A;  3DML A;  4DEJ A;  2VCZ A;  3HYP A;  3H4K A;  3RHC A;  3HJP A;  3DVW A;  2VM1 A;  4GXZ A;  2A4H A;  3IDV A;  2IFQ A;  1EEJ A;  4OO4 A;  1MDK A;  1EP7 A;  2WDU A;  1AUC A;  5G1K A;  3FY7 A;  3QOU A;  5H5S A;  3EIN A;  2K18 A;  4NAX A;  1GSD A;  2GST A;  5J9C A;  2GLR A;  4IN0 A;  4KCA A;  4PNG A;  2C8U A;  1WRY A;  2GQL A;  3L9V A;  5BRT A;  1F9M A;  4OFM A;  4FO5 A;  1WIK A;  1YF1 A;  2YPM A;  3C8E A;  3PR8 A;  2PPT A;  2B5Y A;  3BJ5 A;  5ECO B;  3TKS C;  4IQA A;  4WXT A;  4L0W A;  3VI5 A;  2YWM A;  1M2A A;  4O92 A;  4OWY A;  4ECC A;  3U5R E;  4ZIJ A;  5L71 A;  4RQX A;  5DAL A;  1GSE A;  2CT6 A;  2HZE B;  2LEG A;  4KND A;  1SJ6 A;  3ZFL A;  3KTB A;  2WGR A;  3RAZ A;  5AIX A;  4K2D A;  2YNX A;  4PGT A;  3ZL5 A;  2H73 A;  1EEM A;  4ZB9 A;  1T3B A;  3G7J A;  1X5C A;  1M7T A;  2LNS A;  1QK8 A;  4KGI A;  3QD9 A;  3ZRE A;  3LQ7 A;  1GH2 A;  4BIK A;  1EP8 A;  4Q5R A;  5FT3 A;  3W8S A;  3H79 A;  3P7X A;  7GSS A;  3TKP A;  1URM A;  2H0G A;  5AIS A;  3UIW A;  4N30 A;  4AGS A;  4ECB A;  2MBT A;  4POM A;  2PMT A;  4KE3 A;  2FWE A;  3KH9 A;  1XWA A;  1YKC A;  3Q19 A;  5F07 A;  1SK1 A;  2X8G A;  5ENU A;  5CP1 A;  4XHM A;  3MIX A;  2DKH A;  4Q5Q A;  2MBS A;  1GUM A;  1O7U A;  4PUF C;  1FO5 A;  3DKS A;  3UVT A;  5DCH A;  4KSM A;  2CVK A;  4IP1 A;  5A4W A;  1T1V A;  1I5G A;  3H1N A;  1QQ2 A;  4FIW A;  3HA9 A;  3D0Z A;  1O8X A;  1MEK A;  3TKS E;  1V9W A;  3LOR A;  1AAZ A;  4EDZ A;  4MZC A;  3QR6 A;  2H1D A;  1GRX A;  3VI7 A;  3R3E A;  4K7O A;  3MAK A;  1WE0 A;  3F3Q A;  2GS3 A;  2H01 A;  4V2L A;  1O73 A;  2L4Q A;  2YZU A;  1X5D A;  3ME8 A;  3KMO A;  5JCG A;  2IWT A;  3A3T A;  4J56 E;  4MH3 A;  3TKS A;  2OAD A;  3FW2 A;  1TK8 B;  5CAX A;  3ZZX A;  1GL8 A;  4CY6 A;  1Z6M A;  3DEX A;  2R0G A;  3EWL A;  3BBY A;  1GSU A;  6GSW A;  2XHF A;  4OCE A;  4G19 A;  1K0A A;  4WET A;  2C0F A;  3QCP A;  1EGO A;  4EIQ A;  3UVH A;  1TW9 A;  2AYT A;  5C00 A;  4EE0 A;  3SBC A;  13GS A;  1Z5Y E;  2DC5 A;  2I3Y A;  2ZUP A;  3CRT A;  1CQH A;  5IQY A;  3WT1 A;  4HS1 A;  4PX1 A;  3P8W A;  1M9A A;  3JCM L;  1B4Q A;  3IK9 A;  4HI7 A;  4GQC A;  4WBR D;  2F51 A;  1PX7 A;  3IA1 A;  4BL7 B;  4MH2 A;  4HJ2 A;  1HNC A;  1XCC A;  1A0R P;  4IS0 A;  2TIR A;  2LTK A;  2P0G A;  2H8L A;  1AQW A;  1J08 A;  2R0C A;  2GZZ A;  2VAF A;  1U87 A;  1XW5 A;  1T4Y A;  4TXV A;  4GTU A;  3RDW A;  4HU9 A;  3F9U A;  5G5F A;  5J3R A;  5CNW A;  3VPQ A;  3ERF A;  2H76 A;  2H0I A;  3HDC A;  1MD4 A;  3G9B A;  1X9W B;  3FEU A;  5E4W A;  2VCT A;  3KCM A;  3A2W A;  4PNF A;  1TKD B;  4GST A;  3SWL A;  2OA7 A;  3TJG A;  2QGV A;  5IMD A;  4DSS B;  4G10 A;  1XWK A;  1A8L A;  3O76 A;  4TR1 A;  1K0O A;  3UOM A;  1SK2 A;  1SD9 A;  3KZQ A;  4KCE A;  1ERT A;  4ZL7 A;  1ZL9 A;  3VWW A;  4ICY A;  2KP1 A;  2FWG A;  3GA4 A;  1U3A A;  2OAC A;  2GGT A;  4ZL9 A;  3MSZ A;  4V2M A;  2P31 A;  2PGT A;  3GX0 A;  4OO5 A;  2DBC A;  1ML6 A;  5CO3 A;  4YQU A;  5J4U A;  5CYY A;  1X9S B;  4GRF A;  4EUY A;  3CTG A;  1NW2 A;  2I81 A;  2HXK A;  3HVS A;  4L8E A;  1ZYP A;  5EY6 A;  4ILF A;  2K8V A;  4IJI A;  4TR0 A;  3KXO A;  2HYX A;  4TR4 A;  3A2V A;  2A2P A;  1WJK A;  2B7J A;  3R2Q A;  2WCI A;  4O5Q A;  4QQ7 A;  1TU8 A;  1E2Y A;  2X64 A;  2B5E A;  2HRN A;  2NVL A;  5COH A;  1T00 A;  1T8E B;  3C1R A;  5AIV A;  3ZVJ D;  1Z7P A;  5J41 A;  4N10 A;  3ERG A;  1PN0 A;  1OC8 A;  1GTI A;  3GYK A;  3MWH A;  1ZYQ B;  2IMK A;  2I4A A;  2OBI A;  2H30 A;  3VWU A;  1GLP A;  2C0D A;  2FNO A;  1GNW A;  4OCF A;  3A2X A;  4DSR A;  2MZC A;  5DCG A;  3HXS A;  5IPH A;  2VCV A;  1RK4 A;  1VF3 A;  4EL1 A;  1YDK A;  5IMC A;  5ECN B;  2DML A;  3ERW A;  4I8B A;  1PKW A;  3TJJ A;  2JAC A;  3KEB A;  2YN1 A;  2BJX A;  3CTF A;  4HQZ A;  5H5Q A;  1EWX A;  2L59 A;  4GSN A;  3LG6 A;  1B4P A;  1RQM A;  2V6K A;  4XRD A;  3UL3 A;  5ECH B;  3IR4 A;  2JZT A;  2NDO A;  3IAS 2;  3CQF A;  6GSY A;  2RLI A;  3IAM 2;  2C80 A;  5A4V A;  5BMU A;  3LFL A;  3EMX A;  2H72 A;  2B1K A;  3C7M A;  3C1S A;  1THX A;  1AC1 A;  2BTO T;  3P90 A;  4GLT A;  2JZS A;  4BVY B;  3ZYW A;  4HSC X;  1B8X A;  5LNK e;  2VL2 C;  1TRW A;  1UVZ A;  4K9Z A;  4JRR A;  1G7O A;  1M9B A;  3GUS A;  1U3I A;  5D73 A;  3QAG A;  2NPB A;  3ZLP A;  2B3S A;  3PIN A;  5GAP D;  1XZO A;  2REM A;  2PUK C;  1JFU A;  3GTU A;  5B7C A;  3ZFB A;  4BVX B;  4OFN A;  3M9J A;  1K3Y A;  1ACV A;  2EIO A;  1A2M A;  5F0G A;  2CVD A;  2V2G A;  3RPP A;  4XS1 A;  1C72 A;  4POK A;  3QFA C;  3W6G A;  1TOF A;  2TRC P;  1USB A;  5IMZ A;  5F05 A;  1PL1 A;  2IIY A;  5B8A A;  1PQN A;  2JL4 A;  2F8A A;  4D73 A;  3K8N A;  2R37 A;  3TCO A;  4ZIL A;  2R3X A;  1SKW B;  2MYG A;  1GUK A;  2C3T A;  1LU4 A;  3CSH A;  2RM6 A;  3CYN A;  2A4V A;  3F3R A;  5JWQ B;  2QA1 A;  2HRF A;  1ERU A;  1YF0 A;  3V1W A;  4TOP A;  3TRX A;  3I43 A;  3RPN A;  1TU7 A;  1ERW A;  3DIE A;  2VLV A;  4PUA A;  1XW6 A;  3L0H A;  1SL1 B;  1O8W A;  1CQG A;  2CVB A;  1TXX A;  4IKH A;  4K5R A;  14GS A;  22GS A;  2HE3 A;  3N9J A;  4NWY A;  2GT6 A;  3J7Y b;  3KTL A;  4OFT A;  1XFL A;  3KIJ A;  1H75 A;  4ZBD A;  4WR4 A;  1GTU A;  3F4S A;  18GS A;  5CRD A;  1A23 A;  2HSH A;  1K0B A;  2LJR A;  2OBK A;  2LNT A;  3M8N A;  1S3A A;  2K9F A;  5ELA A;  4HQS A;  1V2A A;  3J7Y k;  1OKD A;  2AAW A;  2AHE A;  2OJL A;  2HFD A;  1SKR B;  16GS A;  4I97 A;  1PN9 A;  2VM2 A;  1YEP A;  3LYK A;  1JLV A;  2CQ9 A;  3GHA A;  3TJF A;  2QSI A;  2VL2 A;  3KP8 A;  4JU5 A;  1BAY A;  1XWC A;  2VIM A;  4XS4 A;  1BQ7 A;  1V98 A;  2ALB A;  2H66 A;  2LKU A;  1XOA A;  2GQM A;  3TOU A;  1XW9 A;  1A24 A;  5DJL A;  3FR3 A;  5LCZ A;  1VF4 A;  2OE3 A;  3RBT A;  3TJB A;  2IFQ B;  1DSB A;  3UAR A;  4ID0 A;  1M2B A;  3LW9 A;  2CV4 A;  3IE3 A;  3IV4 A;  4JBB A;  3C71 A;  4MDC A;  5AGY A;  1EGR A;  4X1U A;  2FA4 A;  5KOX A;  1T4Z A;  3E3E A;  2WFC A;  2FWF A;  3EMP A;  1PKZ A;  3I6A A;  3LJR A;  4FYU A;  3VK9 A;  3GL5 A;  1JZR A;  6GSV A;  1WOU A;  1FOH A;  2J23 A;  3P2A A;  3IOS A;  1DBY A;  4IBP A;  2H6X A;  3OR5 A;  2VD1 A;  2FY6 A;  3HJO A;  4IP6 A;  4KDY A;  4FYB A;  1W4V A;  3H93 A;  5DAL B;  4KSO A;  1TRU A;  3GSS A;  2HRK A;  3D5J A;  4N0V A;  4E8E A;  2L6C A;  1G6Y A;  1UA5 A;  4Q5N A;  4CY8 A;  4HU7 A;  5HFK A;  2EIQ A;  4K5S A;  3WT2 A;  2DIZ A;  3VFI A;  4X43 A;  1V58 A;  3UAP A;  1HQO A;  2XBI A;  5INY A;  2DIY A;  2GQK A;  5ELG A;  3CSI A;  3DYR A;  1OC3 A;  3CMI A;  1XG8 A;  2ZNM A;  5LD0 A;  5KN3 A;  3HVX A;  1FAA A;  2OKA A;  1QMV A;  5EVO A;  4TXO A;  1X9M B;  4MLY A;  3EVI A;  4EXJ A;  3LXZ A;  5A5K A;  3L78 A;  4KF9 A;  3EUR A;  4LLR A;  2DLX A;  2K6V A;  4V1A p;  3IHG A;  1QXH A;  4K0N A;  4L0U A;  1SK0 A;  3L4N A;  2JAD A;  3QFB C;  1YQ1 A;  5H5R A;  2CX3 A;  1EV9 A;  4MPG A;  1Y25 A;  3WGX A;  5ECI B;  5IO2 A;  4MF5 A;  3VLN A;  2VOC A;  1BJX A;  4K7I A;  2KOK A;  1HNA A;  1Z7R A;  1X0R A;  4LMW A;  2QA2 A;  1GUH A;  3ZIV A;  3HD5 A;  2VO4 A;  2JSZ A;  3RHB A;  1QGV A;  2CZ3 A;  5DVB A;  3QDN A;  1DE2 A;  1F6M C;  2DJ2 A;  3E9J B;  4AF2 A;  1ILO A;  2L57 A;  2HI7 A;  3NOF A;  9GSS A;  1OYJ A;  4G2E A;  4QL9 A;  1GNE A;  4XS6 A;  1TJD A;  1NHO A;  3MDK A;  1H4O A;  1B9Y C;  2VD0 A;  3I69 A;  2KUC A;  4G9H A;  2DMM A;  2C0E A;  2HSM A;  3G7I A;  4EC0 A;  2G0F A;  4TW5 A;  1HYU A;  1O6J A;  2WRT A;  3QAV A;  4YAV A;  2H71 A;  1GSF A;  3GL3 A;  4MP4 A;  4ISD A;  1WPI A;  1XVQ A;  2RUE A;  2VL3 A;  2AV4 A;  4XCS A;  5HFI A;  2R6K A;  2YJ7 A;  2PVQ A;  2E2G A;  4JZQ A;  2VLU A;  3HY2 A;  2LST A;  3TUE A;  4BWS A;  2KHP A;  2M46 A;  4MF6 A;  3TRQ A;  2GSS A;  3LWA A;  1PA3 A;  2L5L A;  4RUV A;  2GSR A;  4J2F A;  2VUP A;  4QL7 A;  3ZMK A;  1R7H A;  1JZW A;  5KOW A;  4IW9 A;  2RII A;  1PRX A;  2M72 A; 
#chains in the Genus database with same CATH homology
 3TGZ A;  1ON4 A;  1GSY A;  5G31 A;  2LRC A;  2H75 A;  3VPT A;  2C0G A;  5EL8 A;  5IMV A;  4PQ1 A;  1KEB A;  3VWX A;  2B5X A;  4MJA A;  5G2Z A;  2EIR A;  4HJM A;  3BCI A;  1WMJ A;  4NV2 A;  1V40 A;  4LL1 B;  2E2M A;  4O32 A;  3GFK A;  4I2U A;  1PX6 A;  1A0F A;  1O85 A;  2BMX A;  3IC4 A;  3NIV A;  4X4J A;  3BCK A;  5CRE A;  2VCW A;  3GKX A;  4HUA A;  1JLW A;  5JCU A;  5DJM A;  2I1U A;  2H1B A;  3F6D A;  1PSQ A;  4F0C A;  1FHE A;  4KA0 A;  3GKK A;  1YY7 A;  4TR1 B;  5GST A;  4EO3 A;  3F63 A;  1JZD A;  2Z9S A;  4IQ1 A;  5ID2 A;  2B6M A;  2F8F A;  1JZO A;  2IL3 A;  1I9D A;  2E0Q A;  2V1M A;  2AJQ B;  1F2E A;  2X49 A;  1OVN A;  1SD8 A;  1TI3 A;  3APQ A;  1EZK A;  4NHW A;  4PUR A;  2LJK A;  4KUN A;  2CX4 A;  2FD3 A;  3N5O A;  4DSQ A;  2NBS A;  1MD3 A;  2JZR A;  2OE1 A;  3TOT A;  3EE2 A;  1LBK A;  3Q18 A;  4EKZ A;  1M2D A;  4YQV A;  5DQS A;  8GSS A;  3LXT A;  3EPT A;  4MJC A;  4ACS A;  5GSS A;  2H74 A;  3A5W A;  2HZF A;  2QC7 A;  1QFN A;  5D8I A;  4MAB A;  3FZ5 A;  5B6M A;  3BOA A;  3M9K A;  4ML1 A;  4KW6 A;  1OC9 A;  1OKT A;  4ULX A;  4E8H A;  4TN8 A;  4X0X A;  1FB6 A;  3GH6 A;  2GZY A;  2A2R A;  3S9F A;  4ZB6 A;  1TRV A;  4I6X A;  1SYX A;  2L6D A;  4LMV A;  1BED A;  3D22 A;  1Q4J A;  3M0F A;  1R4W A;  4J57 E;  4Z2U A;  2FGX A;  3TB2 A;  3UMA A;  4DVC A;  2L4C A;  4HZ2 A;  1QUW A;  5D9X A;  4EF0 A;  5IOW A;  1F37 A;  5DAK A;  5FWG A;  3KGK A;  1XPV A;  2LRT A;  3DGQ A;  2DJ1 A;  2C3N A;  1N8J A;  3LYP A;  2N5F A;  2WJU A;  2QKE A;  5HR0 A;  2H1A A;  3FR6 A;  4EDY A;  3GIX A;  1Z6N A;  4WF4 A;  4F9Z A;  1VRS D;  3IXR A;  3GST A;  2L5O A;  5IO0 A;  2F9S A;  4MJE A;  4JED A;  3L9U A;  3DVX A;  3IC8 A;  4NV5 A;  1SU9 A;  2N5A A;  1W89 A;  2IMF A;  3A5I A;  3LGC A;  3APO A;  3FHK A;  1K3L A;  1YEX A;  5ECQ B;  1G7E A;  3TDG A;  5B8B A;  1FOV A;  1R5P A;  2FLS A;  5E59 A;  4NMU A;  11GS A;  1WP0 A;  3ZVJ A;  4PQH A;  4GSS A;  2DKI A;  3GTU B;  1A2L A;  4IEL A;  2IPA A;  1A8Y A;  2MMA A;  1RW1 A;  2HLS A;  2E7P A;  2DJ3 A;  5GAN D;  2R0P A;  5KN0 A;  3EC3 A;  2FA8 A;  1OE8 A;  2O7K A;  3KMN A;  3ZRD A;  4Z2R A;  2VLT A;  1XIY A;  3DWV A;  5G30 A;  10GS A;  3IRA A;  3KJY A;  2O87 A;  4MZB A;  4KDX A;  3GN3 A;  3WYW A;  2J9H A;  4N11 A;  2FUG 2;  3US3 A;  4D73 B;  4O7H A;  1EV4 A;  1FVK A;  2MMZ A;  5ECR B;  2N5B A;  5D9T A;  1R26 A;  1F3B A;  2WS2 A;  3KP9 A;  5HR3 A;  2HZE A;  4MK3 A;  4L5L A;  5HR2 A;  4KX4 A;  3F8U A;  2O8V B;  2YP6 A;  4EVM A;  4JE1 A;  3U6V A;  1GTA A;  4TKY A;  3GH9 A;  2H70 A;  5IOX A;  4AJ7 A;  4IJ3 A;  1K0N A;  3F4T A;  3D21 A;  1OAZ A;  2YZH A;  2C1Y A;  2HT9 A;  1YZX A;  3APS A;  2VCX A;  1S3D A;  3FZ9 A;  2YWI A;  4FYC A;  2C3Q A;  4POL A;  2H19 A;  6GSU A;  2R4V A;  2YAN A;  5IM9 A;  1DUG A;  4RI7 A;  5J5N A;  4F2I A;  1GP1 A;  3E0U A;  4ZL8 A;  1ST9 A;  3PGT A;  2V41 A;  3VWV A;  1K0C A;  2HNL A;  2H1G A;  1K3O A;  2RM5 A;  5B6N A;  3FKF A;  4O5U A;  1PMT A;  2R5G A;  5ECP B;  4ECJ A;  4Q5F A;  3ZTL A;  3I9V 2;  3FZ4 A;  2EC4 A;  4TRX A;  2HRA A;  2ON5 A;  1M99 A;  1KNG A;  4LA1 A;  4XS4 B;  4IHU A;  1AQV A;  4CHS A;  4POB A;  2LQO A;  3CBU A;  4WBJ A;  2GSQ A;  1TI1 A;  4PXO A;  1X5E A;  1M0U A;  4CDO A;  2P5R A;  1XBS A;  4ML6 A;  3KD0 A;  2GDR A;  4MA9 A;  3GX8 A;  4IGJ A;  5HFG A;  2LQQ A;  3DD3 A;  1XXU A;  3CSJ A;  4HOJ A;  1U6T A;  3D6I A;  4OMV A;  2B1L A;  4YQM A;  4K6X A;  4ZXG A;  2RUF A;  2MMN A;  4I5Q A;  1TRS A;  2O89 A;  5ECS A;  2XC2 A;  3GMF A;  3IHQ A;  4HDE A;  1SL2 B;  1Q98 A;  3VUR A;  2AUV A;  3HJM A;  1LJR A;  5FHI A;  1MDJ A;  4K8M A;  3LEF A;  4MNN A;  4FQU A;  2P5Q A;  3ZIT A;  1DE1 A;  3QPM A;  3FYG A;  1ZCP A;  4YKF A;  2IN3 A;  1AXD A;  1TTZ A;  4HZ4 A;  5IMA A;  1XVW A;  3KH7 A;  2YV7 A;  2LRN A;  3GV1 A;  4EIP A;  3ZIJ A;  1SJI A;  6GST A;  1NM3 A;  3DRN A;  1G6W A;  1K0M A;  3FMW A;  2WB9 A;  4I2T A;  1IYI A;  4OD7 A;  1O81 A;  1NHY A;  2H6Y A;  3TRP A;  4IVF A;  4PQI A;  1N2A A;  3EU4 A;  2CAQ A;  2B7K A;  1XWG A;  1TK0 B;  3QAW A;  4GCI A;  3PPU A;  4H86 A;  1SKS B;  4N0Z A;  4BL7 A;  1T7P B;  1ERV A;  4ZBB A;  3HZ4 A;  5JWO B;  1KTE A;  4TXO B;  1BG5 A;  1G0T A;  4LL4 B;  4RI6 A;  1UC7 A;  4HEA 2;  1GSS A;  4NXI A;  3MYD A;  1Z3E A;  3TKR A;  4BPY A;  3UEM A;  2X8H A;  1K0D A;  3ME7 A;  1B9X C;  4CW9 A;  3GNJ A;  2DJ0 A;  5D93 A;  5A4U A;  1VF1 A;  2HSY A;  3CXG A;  2IJY A;  3FR9 A;  2D2Z A;  1MDI A;  2X99 A;  5DDL A;  3GKM A;  2NTO A;  2XPD A;  2LJA A;  3G7Y A;  3ZML A;  1XOB A;  5D96 A;  3C73 A;  2IME A;  4WF5 A;  1ZMA A;  1GSQ A;  1SYR A;  2GTU A;  5DQY A;  1PD2 1;  3FZA A;  4DSS A;  1BYE A;  3M1G A;  2I9H A;  4GF0 A;  3H8Q A;  5C04 A;  2R2J A;  1S3C A;  1EOH A;  1Z9H A;  2H6Z A;  4USS A;  4G0I A;  2M80 A;  1WWJ A;  2ZCT A;  4FH8 A;  4A5P A;  1ZYE A;  4MMM A;  5KN1 A;  2K8S A;  3HZ8 A;  4G0L A;  5D9W A;  5CRW A;  3F4R A;  4K0G A;  3TJK A;  4Z2T A;  4NPB A;  3NZN A;  1GTB A;  2IMD A;  4XRA A;  2YJH A;  4WKW A;  1V57 A;  4MJB A;  1FG4 A;  1HD2 A;  6GSS A;  2YOI A;  4L5O A;  2WZ9 A;  1J0F A;  3D4T A;  2KP2 A;  1EOG A;  4ZBA A;  3IPZ A;  1ZGN A;  1PGT A;  2CAI A;  4K7N A;  4WEY A;  4P3Y B;  1B48 A;  1MTC A;  5F06 A;  3D4M A;  1BX9 A;  4YKG A;  2YWO A;  5KN2 A;  1XWB A;  3ISO A;  2GT5 A;  1YJ6 A;  5ABR A;  3HHV A;  2DSA A;  4Z7X A;  4YAP A;  4KB3 A;  4O5R A;  1FVJ A;  1VGL A;  3W8J A;  4K1F A;  1YKA A;  5EPF A;  2LUS A;  3FK8 A;  4ZB8 A;  2LS5 A;  4KAE A;  4AJ8 A;  3AY8 A;  3LSZ A;  2A2S A;  1U88 A;  2C4J A;  3MNG A;  2PN8 A;  5ECM B;  2YCD A;  1F3A A;  5HQP A;  2FWH A;  2FHE A;  12GS A;  2O85 A;  19GS A;  2G2Q A;  4TVE A;  4BA7 A;  2VCQ A;  3UJ1 A;  1UN2 A;  1Y6E A;  1ABA A;  1FW1 A;  2ES7 A;  2OE0 A;  3ED3 A;  3GKN A;  4JR4 A;  3WGE A;  3EU3 A;  4F0B A;  2YWN A;  4BVY A;  5CRG A;  2WUL A;  4MF7 A;  3Q74 A;  4G0K A;  3GRX A;  3F0I A;  2YV9 A;  1AQX A;  4MPF A;  2PU9 C;  1TDI A;  2JU5 A;  3F6F A;  3M3M A;  1OE7 A;  4GQF A;  4WR5 A;  5KEJ A;  2PVO C;  5GZZ B;  1E6B A;  1ZYN A;  3HKR A;  5ID2 B;  1AW9 A;  3UBL A;  3WD6 A;  3CRU A;  4AJ6 A;  3GUR A;  5F8B A;  4F03 A;  2KLX A;  2MMO A;  1SL0 B;  3O3T A;  4BVX A;  4F82 A;  1GWC A;  3BD2 A;  3L9S A;  5J9B A;  2TRX A;  5ECL B;  6GSX A;  4RQR A;  4TR3 A;  2LV3 A;  4MCU A;  4KDU A;  3KM6 A;  2X4A A;  1SEN A;  2PWJ A;  1HNB A;  3EYT A;  1THO A;  2H0H A;  2PER A;  4ECI A;  4YH2 A;  1GLQ A;  1A2J A;  4PTS A;  2DJK A;  2GVP A;  5HR1 A;  2PBJ A;  5CRH A;  4V2N A;  2AB6 A;  2JSY A;  1R5A A;  2GZP A;  2CA8 A;  4KH7 A;  3TKQ A;  3O6T A;  2XPE A;  1OC9 B;  2FCH A;  5ECK B;  1JHB A;  1TK5 B;  1ZOF A;  1IYH A;  4GWR A;  4K2X A;  1FB0 A;  5IMF A;  4BWQ A;  2V6O A;  3Q6O A;  1KBN A;  4NHZ A;  5JCW A;  3FRC A;  3QMX A;  2V32 A;  3WGD A;  2VL9 A;  1GUL A;  4JR6 A;  1AIU A;  1ZZY A;  2XBQ A;  17GS A;  1J9B A;  1PL2 A;  4XTS A;  5DAK B;  4V1A g;  5AN1 A;  5JWR B;  2CZ2 A;  3HCZ A;  5DBQ A;  4XIH A;  2UZ8 A;  5G5E A;  5IPG A;  3UBK A;  2F3M A;  1NSW A;  2DJJ A;  3PH9 A;  5G1L A;  3IK7 A;  3HVV A;  1VF2 A;  2ON7 A;  20GS A;  4MZW A;  2IMI A;  2X8C A;  3DXB A;  5IIZ A;  3IBH A;  1TP9 A;  5D9V A;  1SJZ A;  3DML A;  4DEJ A;  2VCZ A;  3HYP A;  3H4K A;  3RHC A;  3HJP A;  3DVW A;  2VM1 A;  4GXZ A;  2A4H A;  3IDV A;  2IFQ A;  1EEJ A;  4OO4 A;  1MDK A;  1EP7 A;  2WDU A;  1AUC A;  5G1K A;  3FY7 A;  3QOU A;  5H5S A;  3EIN A;  2K18 A;  4NAX A;  1GSD A;  2GST A;  5J9C A;  2GLR A;  4IN0 A;  4KCA A;  4PNG A;  2C8U A;  1WRY A;  2GQL A;  3L9V A;  5BRT A;  1F9M A;  4OFM A;  4FO5 A;  1WIK A;  1YF1 A;  2YPM A;  3C8E A;  3PR8 A;  2PPT A;  2B5Y A;  3BJ5 A;  5ECO B;  3TKS C;  4IQA A;  4WXT A;  4L0W A;  3VI5 A;  2YWM A;  1M2A A;  4O92 A;  4OWY A;  4ECC A;  3U5R E;  4ZIJ A;  5L71 A;  4RQX A;  5DAL A;  1GSE A;  2CT6 A;  2HZE B;  2LEG A;  4KND A;  1SJ6 A;  3ZFL A;  3KTB A;  2WGR A;  3RAZ A;  5AIX A;  4K2D A;  2YNX A;  4PGT A;  3ZL5 A;  2H73 A;  1EEM A;  4ZB9 A;  1T3B A;  3G7J A;  1X5C A;  1M7T A;  2LNS A;  1QK8 A;  4KGI A;  3QD9 A;  3ZRE A;  3LQ7 A;  1GH2 A;  1EP8 A;  4Q5R A;  5FT3 A;  3W8S A;  3H79 A;  3P7X A;  7GSS A;  3TKP A;  1URM A;  2H0G A;  5AIS A;  3UIW A;  4N30 A;  4AGS A;  4ECB A;  2MBT A;  4POM A;  2PMT A;  4KE3 A;  2FWE A;  3KH9 A;  1XWA A;  1YKC A;  3Q19 A;  5F07 A;  1SK1 A;  2X8G A;  5ENU A;  5CP1 A;  4XHM A;  3MIX A;  2DKH A;  4Q5Q A;  2MBS A;  1GUM A;  1O7U A;  4PUF C;  1FO5 A;  3DKS A;  3UVT A;  5DCH A;  4KSM A;  2CVK A;  4IP1 A;  5A4W A;  1T1V A;  1I5G A;  3H1N A;  1QQ2 A;  4FIW A;  3HA9 A;  3D0Z A;  1O8X A;  1MEK A;  3TKS E;  1V9W A;  3LOR A;  1AAZ A;  4EDZ A;  4MZC A;  3QR6 A;  2H1D A;  1GRX A;  3VI7 A;  3R3E A;  4K7O A;  3MAK A;  1WE0 A;  3F3Q A;  2GS3 A;  2H01 A;  4V2L A;  1O73 A;  2L4Q A;  2YZU A;  1X5D A;  3ME8 A;  3KMO A;  5JCG A;  2IWT A;  3A3T A;  4J56 E;  4MH3 A;  3TKS A;  2OAD A;  3FW2 A;  1TK8 B;  5CAX A;  3ZZX A;  1GL8 A;  4CY6 A;  1Z6M A;  3DEX A;  2R0G A;  3EWL A;  3BBY A;  1GSU A;  6GSW A;  2XHF A;  4OCE A;  4G19 A;  1K0A A;  4WET A;  2C0F A;  3QCP A;  1EGO A;  4EIQ A;  3UVH A;  1TW9 A;  2AYT A;  5C00 A;  4EE0 A;  3SBC A;  13GS A;  1Z5Y E;  2DC5 A;  2I3Y A;  2ZUP A;  3CRT A;  1CQH A;  5IQY A;  3WT1 A;  4HS1 A;  4PX1 A;  3P8W A;  1M9A A;  3JCM L;  1B4Q A;  3IK9 A;  4HI7 A;  4GQC A;  4WBR D;  2F51 A;  1PX7 A;  3IA1 A;  4BL7 B;  4MH2 A;  4HJ2 A;  1HNC A;  1XCC A;  1A0R P;  4IS0 A;  2TIR A;  2LTK A;  2P0G A;  2H8L A;  1AQW A;  1J08 A;  2R0C A;  2GZZ A;  2VAF A;  1U87 A;  1XW5 A;  1T4Y A;  4TXV A;  4GTU A;  3RDW A;  4HU9 A;  3F9U A;  5G5F A;  5J3R A;  5CNW A;  3VPQ A;  3ERF A;  2H76 A;  2H0I A;  3HDC A;  1MD4 A;  3G9B A;  1X9W B;  3FEU A;  5E4W A;  2VCT A;  3KCM A;  3A2W A;  4PNF A;  1TKD B;  4GST A;  3SWL A;  2OA7 A;  3TJG A;  2QGV A;  5IMD A;  4DSS B;  4G10 A;  1XWK A;  1A8L A;  3O76 A;  4TR1 A;  1K0O A;  3UOM A;  1SK2 A;  1SD9 A;  3KZQ A;  4KCE A;  1ERT A;  4ZL7 A;  1ZL9 A;  3VWW A;  4ICY A;  2KP1 A;  2FWG A;  3GA4 A;  1U3A A;  2OAC A;  2GGT A;  4ZL9 A;  3MSZ A;  4V2M A;  2P31 A;  2PGT A;  3GX0 A;  4OO5 A;  2DBC A;  1ML6 A;  5CO3 A;  4YQU A;  5J4U A;  5CYY A;  1X9S B;  4GRF A;  4EUY A;  3CTG A;  1NW2 A;  2I81 A;  2HXK A;  3HVS A;  4L8E A;  1ZYP A;  5EY6 A;  4ILF A;  2K8V A;  4IJI A;  4TR0 A;  3KXO A;  2HYX A;  4TR4 A;  3A2V A;  2A2P A;  1WJK A;  2B7J A;  3R2Q A;  2WCI A;  4O5Q A;  4QQ7 A;  1TU8 A;  1E2Y A;  2X64 A;  2B5E A;  2HRN A;  2NVL A;  5COH A;  1T00 A;  1T8E B;  3C1R A;  5AIV A;  3ZVJ D;  1Z7P A;  5J41 A;  4N10 A;  3ERG A;  1PN0 A;  1OC8 A;  1GTI A;  3GYK A;  3MWH A;  1ZYQ B;  2IMK A;  2I4A A;  2OBI A;  2H30 A;  3VWU A;  1GLP A;  2C0D A;  2FNO A;  1GNW A;  4OCF A;  3A2X A;  4DSR A;  2MZC A;  5DCG A;  3HXS A;  5IPH A;  2VCV A;  1RK4 A;  1VF3 A;  4EL1 A;  1YDK A;  5IMC A;  5ECN B;  2DML A;  3ERW A;  4I8B A;  1PKW A;  3TJJ A;  2JAC A;  3KEB A;  2YN1 A;  2BJX A;  3CTF A;  4HQZ A;  5H5Q A;  1EWX A;  2L59 A;  4GSN A;  3LG6 A;  1B4P A;  1RQM A;  2V6K A;  4XRD A;  3UL3 A;  5ECH B;  3IR4 A;  2JZT A;  2NDO A;  3IAS 2;  6GSY A;  2RLI A;  3IAM 2;  2C80 A;  5A4V A;  5BMU A;  3LFL A;  3EMX A;  2H72 A;  2B1K A;  3C7M A;  3C1S A;  1THX A;  1AC1 A;  2BTO T;  3P90 A;  4GLT A;  2JZS A;  4BVY B;  3ZYW A;  1B8X A;  5LNK e;  2VL2 C;  1TRW A;  1UVZ A;  4K9Z A;  4JRR A;  1G7O A;  1M9B A;  3GUS A;  1U3I A;  5D73 A;  3QAG A;  2NPB A;  3ZLP A;  2B3S A;  3PIN A;  5GAP D;  1XZO A;  2REM A;  2PUK C;  1JFU A;  3GTU A;  5B7C A;  3ZFB A;  4BVX B;  4OFN A;  3M9J A;  1K3Y A;  1ACV A;  2EIO A;  1A2M A;  5F0G A;  2CVD A;  2V2G A;  3RPP A;  4XS1 A;  1C72 A;  4POK A;  3QFA C;  3W6G A;  1TOF A;  2TRC P;  1USB A;  5IMZ A;  5F05 A;  1PL1 A;  2IIY A;  5B8A A;  1PQN A;  2JL4 A;  2F8A A;  4D73 A;  3K8N A;  2R37 A;  3TCO A;  4ZIL A;  2R3X A;  1SKW B;  2MYG A;  1GUK A;  2C3T A;  1LU4 A;  3CSH A;  2RM6 A;  3CYN A;  2A4V A;  3F3R A;  5JWQ B;  2QA1 A;  2HRF A;  1ERU A;  1YF0 A;  3V1W A;  4TOP A;  3TRX A;  3I43 A;  3RPN A;  1TU7 A;  1ERW A;  3DIE A;  2VLV A;  4PUA A;  1XW6 A;  3L0H A;  1SL1 B;  1O8W A;  1CQG A;  2CVB A;  1TXX A;  4IKH A;  4K5R A;  14GS A;  22GS A;  2HE3 A;  3N9J A;  4NWY A;  2GT6 A;  3J7Y b;  3KTL A;  4OFT A;  1XFL A;  3KIJ A;  1H75 A;  4ZBD A;  4WR4 A;  1GTU A;  3F4S A;  18GS A;  5CRD A;  1A23 A;  2HSH A;  1K0B A;  2LJR A;  2OBK A;  2LNT A;  3M8N A;  1S3A A;  2K9F A;  5ELA A;  4HQS A;  1V2A A;  3J7Y k;  1OKD A;  2AAW A;  2AHE A;  2OJL A;  2HFD A;  1SKR B;  16GS A;  4I97 A;  1PN9 A;  2VM2 A;  1YEP A;  3LYK A;  1JLV A;  2CQ9 A;  3GHA A;  3TJF A;  2QSI A;  2VL2 A;  3KP8 A;  4JU5 A;  1BAY A;  1XWC A;  2VIM A;  4XS4 A;  1BQ7 A;  1V98 A;  2ALB A;  2H66 A;  2LKU A;  1XOA A;  2GQM A;  3TOU A;  1XW9 A;  1A24 A;  5DJL A;  3FR3 A;  5LCZ A;  1VF4 A;  2OE3 A;  3RBT A;  3TJB A;  2IFQ B;  1DSB A;  3UAR A;  4ID0 A;  1M2B A;  3LW9 A;  2CV4 A;  3IE3 A;  3IV4 A;  4JBB A;  3C71 A;  4MDC A;  5AGY A;  1EGR A;  4X1U A;  2FA4 A;  5KOX A;  1T4Z A;  3E3E A;  2WFC A;  2FWF A;  3EMP A;  1PKZ A;  3I6A A;  3LJR A;  4FYU A;  3VK9 A;  3GL5 A;  1JZR A;  6GSV A;  1WOU A;  1FOH A;  2J23 A;  3P2A A;  3IOS A;  1DBY A;  4IBP A;  2H6X A;  3OR5 A;  2VD1 A;  2FY6 A;  3HJO A;  4IP6 A;  4KDY A;  4FYB A;  1W4V A;  3H93 A;  5DAL B;  4KSO A;  1TRU A;  3GSS A;  2HRK A;  3D5J A;  4N0V A;  4E8E A;  2L6C A;  1G6Y A;  1UA5 A;  4Q5N A;  4CY8 A;  4HU7 A;  5HFK A;  2EIQ A;  4K5S A;  3WT2 A;  2DIZ A;  3VFI A;  4X43 A;  1V58 A;  3UAP A;  1HQO A;  2XBI A;  5INY A;  2DIY A;  2GQK A;  5ELG A;  3CSI A;  3DYR A;  1OC3 A;  3CMI A;  2ZNM A;  5LD0 A;  5KN3 A;  3HVX A;  1FAA A;  2OKA A;  1QMV A;  5EVO A;  4TXO A;  1X9M B;  4MLY A;  3EVI A;  4EXJ A;  3LXZ A;  5A5K A;  3L78 A;  4KF9 A;  3EUR A;  4LLR A;  2DLX A;  2K6V A;  4V1A p;  3IHG A;  1QXH A;  4K0N A;  4L0U A;  1SK0 A;  3L4N A;  2JAD A;  3QFB C;  1YQ1 A;  5H5R A;  2CX3 A;  1EV9 A;  4MPG A;  1Y25 A;  3WGX A;  5ECI B;  5IO2 A;  4MF5 A;  3VLN A;  2VOC A;  1BJX A;  4K7I A;  2KOK A;  1HNA A;  1Z7R A;  1X0R A;  4LMW A;  2QA2 A;  1GUH A;  3ZIV A;  3HD5 A;  2VO4 A;  2JSZ A;  3RHB A;  1QGV A;  2CZ3 A;  5DVB A;  3QDN A;  1DE2 A;  1F6M C;  2DJ2 A;  3E9J B;  4AF2 A;  1ILO A;  2L57 A;  2HI7 A;  3NOF A;  9GSS A;  1OYJ A;  4G2E A;  4QL9 A;  1GNE A;  4XS6 A;  1TJD A;  1NHO A;  3MDK A;  1H4O A;  1B9Y C;  2VD0 A;  3I69 A;  2KUC A;  4G9H A;  2DMM A;  2C0E A;  2HSM A;  3G7I A;  4EC0 A;  2G0F A;  4TW5 A;  1HYU A;  1O6J A;  2WRT A;  3QAV A;  4YAV A;  2H71 A;  1GSF A;  3GL3 A;  4MP4 A;  4ISD A;  1WPI A;  1XVQ A;  2RUE A;  2VL3 A;  2AV4 A;  4XCS A;  5HFI A;  2R6K A;  2YJ7 A;  2PVQ A;  2E2G A;  4JZQ A;  2VLU A;  3HY2 A;  2LST A;  3TUE A;  4BWS A;  2KHP A;  2M46 A;  4MF6 A;  3TRQ A;  2GSS A;  3LWA A;  1PA3 A;  2L5L A;  4RUV A;  2GSR A;  4J2F A;  2VUP A;  4QL7 A;  3ZMK A;  1R7H A;  1JZW A;  5KOW A;  4IW9 A;  2RII A;  1PRX A;  2M72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...