1M7TA

Solution structure and dynamics of the human-escherichia coli thioredoxin chimera: insights into thermodynamic stability
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Chimera of Human and E. coli thioredoxin
publication title Solution Structure and Dynamics of the Human-Escherichia coli Thioredoxin Chimera: Insights into Thermodynamic Stability
pubmed doi rcsb
source organism Homo sapiens, escherichia coli
total genus 20
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2002-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1m7tA00
4HDEA 3TJGA 1TP9A 1SL0B 2PPTA 2F3MA 6GSTA 4ECBA 1FB0A 4NV5A 4EDYA 1BJXA 2LUSA 2C0FA 5AIVA 3L9SA 4XS4B 4GCIA 3BCKA 3P2AA 1K0BA 2O85A 5F8BA 1SKWB 3DWVA 2OE1A 2VIMA 4HZ2A 4RI6A 2F51A 4OFMA 2FHEA 6GSVA 1TRWA 2H30A 3IDVA 3O76A 3MAKA 1ZZYA 1M2AA 2CAIA 1KEBA 3DKSA 2O87A 3ZREA 3LXZA 1VF4A 2YWOA 4PURA 4NV2A 3KGKA 4Q5NA 3QFAC 1QUWA 5G1KA 1WIKA 4HS1A 1LJRA 1SD8A 3C1RA 4TR3A 2QGVA 4DVCA 3VK9A 3IOSA 4RQRA 2PWJA 4L0WA 2AJQB 3DEXA 3EMXA 4POBA 5HFIA 1M2BA 1GUHA 3HXSA 4TR1B 4WF4A 5DAKA 3CRUA 3Q6OA 1XW9A 1R26A 2C3TA 3CSIA 1PKZA 5ECNB 1YEPA 3F9UA 1I9DA 4I2TA 3ZFBA 1OVNA 1A0FA 3QMXA 2KUCA 2O89A 1A2MA 4V1Ag 2PU9C 4JE1A 4JRRA 4KCAA 1Y6EA 5F06A 2AYTA 1QK8A 4L0UA 2XPDA 1KTEA 5IPGA 4I8BA 2HNLA 1HYUA 4EF0A 1SJIA 2IPAA 1K0CA 1LBKA 4PGTA 5G1LA 4ECJA 5J5NA 1EOGA 2HZFA 1GLQA 1QQ2A 1R7HA 4POMA 1O8XA 2B7KA 3PH9A 4OCEA 1EGRA 5HR3A 5EY6A 5IMVA 3QAVA 1GTIA 5DJMA 2MBSA 1URMA 5ECOB 2FD3A 4OWYA 5J3RA 2MZCA 4KB3A 4HEA2 4EKZA 2GQMA 2HZEB 1ST9A 5C00A 1OKDA 3FW2A 1QGVA 2VCQA 2H73A 4GF0A 2OE3A 1XWBA 2MMAA 1F3BA 3TCOA 2FA8A 4WKWA 1BQ7A 2IMKA 4NHWA 4WBRD 5HR0A 2JZSA 5EVOA 1XIYA 2VAFA 1FVKA 5B8BA 2DJJA 1BG5A 3QD9A 2CV4A 2C8UA 3SBCA 3PINA 1YDKA 4ID0A 3RPPA 5KN2A 3HKRA 2BTOT 2IFQB 4Z7XA 4PQ1A 2X99A 1FAAA 2WULA 1K0NA 5INYA 1HNBA 1T1VA 4ZIJA 2P5QA 2RUEA 3D4MA 3ZZXA 4DSQA 5IMDA 2B5XA 5G5FA 3UBKA 1G7OA 2JADA 1S3AA 3C8EA 3C1SA 1PSQA 2CX4A 1PD21 5G2ZA 3P8WA 1GLPA 4G9HA 2CAQA 4OO5A 2JZRA 5CRGA 4KDUA 3D22A 3LWAA 3M3MA 1YQ1A 4PX1A 1TK0B 1M9AA 4KGIA 2OE0A 1BEDA 1Z5YE 3ZIVA 3L78A 1V9WA 5B6NA 3EU4A 1EWXA 2H6XA 1TKDB 1JFUA 1JZDA 3DRNA 1HD2A 4POKA 2XHFA 4JBBA 2ES7A 1J9BA 3HVSA 1R4WA 2E2MA 3GKNA 2C0EA 3UJ1A 1M0UA 2N5AA 2CZ3A 4G19A 3RHCA 5AN1A 4JR6A 3IR4A 4GWRA 3GV1A 3P90A 3UARA 2BJXA 3FY7A 3IPZA 2RIIA 1JHBA 3I9V2 3QAWA 3GKKA 2DC5A 4WXTA 1OE7A 3A5WA 1EOHA 1NM3A 2AAWA 5E4WA 3ZMLA 3O6TA 2H1BA 2B3SA 2LNTA 1XVWA 3F63A 2RLIA 3CTFA 1V40A 3VI7A 1M9BA 5H5QA 3Q19A 2YZHA 3HYPA 1YJ6A 3FZAA 4ILFA 3HA9A 3BD2A 4HI7A 2IMFA 3US3A 3WYWA 2PUKC 3KM6A 1DSBA 2GZYA 2R3XA 2PGTA 3GX0A 3DVWA 4K1FA 5KN1A 2YWMA 3E3EA 5GAPD 4KNDA 1QXHA 2I1UA 3TJKA 3ZVJA 2CT6A 2WJUA 1NW2A 3TKSA 2GZPA 5FWGA 3DIEA 5ID2B 2NTOA 1B8XA 2HYXA 1XXUA 2J9HA 2PVQA 4GRFA 3FKFA 3CXGA 1OYJA 5C04A 4KCEA 3HD5A 2C4JA 4AGSA 2L6DA 3A2XA 1V2AA 3LXTA 2H75A 4WF5A 2WDUA 11GSA 1GSDA 2LKUA 2VOCA 2GQKA 2FWHA 3F4RA 3H1NA 2CVKA 4L8EA 2LJKA 2H6YA 1EP8A 2VCZA 1X9SB 4MMMA 3N5OA 3TDGA 3J7Yb 1YF1A 3TKSC 2F8AA 2MMZA 2JSZA 1WWJA 5FHIA 1V57A 2OBKA 3KEBA 2C1YA 1H4OA 2FA4A 16GSA 2PBJA 5B6MA 4YH2A 3F6FA 3F3QA 1AQXA 5H5SA 5B7CA 3WGXA 2D2ZA 2HT9A 3EVIA 4MPFA 3GL3A 4NPBA 2FNOA 4Q5RA 5A4WA 2VL2A 4JU5A 1O73A 4V1Ap 1A23A 2GZZA 2GQLA 1TJDA 3UMAA 4KDYA 3IRAA 4IS0A 2H19A 4FYUA 2YJHA 3GH6A 2H1DA 2JU5A 1PL1A 1XW6A 3FZ9A 1VRSD 5DJLA 19GSA 2RM5A 2B7JA 12GSA 3IBHA 4I97A 1ZGNA 4QL7A 2PVOC 4XS4A 3D0ZA 4LMWA 6GSSA 4MJBA 1GP1A 4MZCA 2H0GA 1IYHA 5J9BA 2VL2C 3VWWA 2H6ZA 3PR8A 4NXIA 4ML6A 2AHEA 2K18A 2O8VB 4MABA 1O85A 3GTUB 2XC2A 1E6BA 3EYTA 1W89A 3HJOA 2XBIA 5D8IA 3TJBA 1EP7A 1YZXA 3GX8A 1GTUA 2VO4A 4RQXA 3UVHA 2ALBA 22GSA 1Z9HA 4HZ4A 1UN2A 4BVXA 4TR1A 4CW9A 2E7PA 1JZOA 3QCPA 3VI5A 3ZTLA 5JCGA 3NZNA 4LA1A 3F4TA 1ACVA 1XW5A 1XWKA 3EINA 2GVPA 2YNXA 1T8EB 2V1MA 4TXOB 1G6YA 2GLRA 2MBTA 4KAEA 4Q5QA 4E8HA 4HJ2A 1GSYA 1K3YA 4AJ7A 4ZBBA 4MLYA 2VCXA 3EE2A 2L4CA 3ERFA 1Y25A 4EO3A 2A2RA 4K8MA 3M1GA 1WOUA 1LU4A 4MPGA 1GSUA 4GTUA 2OKAA 2H1GA 1XOAA 3GNJA 1U6TA 1HNCA 10GSA 1PX7A 3N9JA 3HVXA 1OC9B 2GGTA 4KW6A 5G30A 4ECCA 1W4VA 3ERWA 1B9XC 1G0TA 1N2AA 2JZTA 5D73A 2TRXA 4EC0A 4D73B 2HZEA 1SK2A 3FZ4A 3ZL5A 1OC8A 2FWEA 3BJ5A 3L0HA 2VM2A 4V2MA 4ECIA 2A2SA 3ZVJD 5J9CA 3A2WA 1A8LA 2R2JA 4ZL7A 4MF7A 5KEJA 2H71A 2VLVA 4KA0A 2VCTA 3GN3A 4N0VA 1QMVA 2LSTA 1EEJA 4GSTA 5DCGA 5G5EA 5IM9A 2IFQA 1BAYA 3GHAA 2DJKA 4LMVA 3AY8A 4FH8A 1TOFA 5D96A 2YWNA 3GMFA 4P3YB 1TRSA 1XFLA 3VWXA 4N11A 3M8NA 3EWLA 5IQYA 4KH7A 3HJMA 4K6XA 2CA8A 1EV4A 4MZBA 3H79A 4BA7A 2KP1A 2LQQA 2AB6A 5IIZA 4K7OA 4O5RA 4FO5A 1E2YA 3UIWA 3QFBC 1XVQA 2HXKA 4ZB6A 3TOUA 1SK1A 3VPTA 5IMCA 4N0ZA 3GSSA 5DDLA 3LFLA 1NHYA 2DSAA 3IXRA 3VFIA 1CQGA 1X5EA 1Z7PA 5IPHA 3G9BA 3F8UA 3ISOA 2GT6A 2B5EA 1TXXA 2HFDA 2VD1A 3GRXA 2L5LA 1BYEA 1V98A 1X0RA 4BWSA 2GT5A 3I43A 4WEYA 3FYGA 3PGTA 5AGYA 4I5QA 2N5FA 4ISDA 3FHKA 3M9KA 1GUKA 4XRAA 1ERTA 1ML6A 3D4TA 4IHUA 1F9MA 3KXOA 4BPYA 1IYIA 1I5GA 2I4AA 2IL3A 4HOJA 2YANA 3TUEA 4GSSA 3CTGA 4TKYA 2WFCA 2YJ7A 3KZQA 4OFNA 3KH9A 5D9XA 1C72A 4MJEA 3WGEA 1VF1A 3RAZA 2GTUA 4JEDA 4TOPA 4G10A 4DSSB 2IMDA 3TJJA 5LNKe 5F07A 2GDRA 1M2DA 1T4YA 4QL9A 3ZLPA 4E8EA 1RK4A 2K6VA 3APQA 3J7Yk 3TJFA 2GSTA 3GFKA 1PMTA 1Q4JA 3ZITA 4MP4A 3LEFA 1ZMAA 4O32A 2HRNA 1S3CA 1FVJA 4IJ3A 4N30A 3TKQA 3KP8A 4EDZA 2LRCA 3E9JB 3MNGA 2L5OA 2LQOA 4AJ6A 3FR9A 4WBJA 4MA9A 1K0DA 2H66A 5ECHB 4TW5A 2A4VA 3HZ4A 4K9ZA 1SL1B 2VCWA 1AXDA 2NDOA 5ID2A 1T3BA 2PMTA 3CRTA 4KX4A 4CDOA 4JR4A 3M9JA 2OA7A 20GSA 3G7JA 3KJYA 2YOIA 1YKAA 1ERVA 3D21A 5F0GA 4IN0A 4XCSA 1XWCA 2VM1A 3KTBA 2H0IA 5CRDA 1WMJA 1K3LA 2RUFA 3ZYWA 5IO0A 3VWUA 2XBQA 3ZRDA 1TK5B 3ED3A 13GSA 2F9SA 4BVYA 3GH9A 1WRYA 2YV7A 2O7KA 5H5RA 1GSSA 5IMAA 5LCZA 4L5OA 3GURA 4O92A 2X8GA 1XBSA 4HQSA 2IJYA 4TR4A 1Z3EA 1A2LA 5JWQB 1FOVA 4XIHA 2R6KA 1B9YC 3D6IA 3DXBA 5DQSA 4ZXGA 1EGOA 4MJCA 4IELA 3VWVA 2EIOA 3HDCA 2IMEA 4FYCA 4XS1A 5HR2A 5ECMB 3GKMA 3HJPA 5FT3A 1DUGA 1F3AA 3TRQA 1F37A 5A5KA 3UL3A 2WB9A 1AIUA 3CBUA 1NHOA 2I81A 4TVEA 3CYNA 1FHEA 1MTCA 4MCUA 1TU8A 3L9UA 4MH2A 2C0GA 3TKPA 3LG6A 4WR4A 4K0GA 2B1KA 1TRUA 2OJLA 2P31A 1YEXA 1G7EA 1F6MC 3W8SA 2VLTA 4IW9A 1XWAA 2IN3A 2HE3A 1SYXA 1MDIA 2YCDA 2C3NA 4IP1A 1SKSB 3U6VA 2JL4A 3GSTA 4ZB9A 4OD7A 3LGCA 5JWRB 5IMZA 3DYRA 1OKTA 2KHPA 2MYGA 4IKHA 3S9FA 2OADA 4GQFA 2HSHA 4MDCA 4H86A 1FW1A 1XCCA 4LL4B 1Z6MA 1TU7A 5IOXA 1SJZA 3EMPA 4PNGA 3RDWA 3F3RA 2LRNA 5IO2A 4GXZA 4F9ZA 3GTUA 1MD4A 5DALB 2V6OA 5KN0A 5EPFA 1FG4A 4ZL8A 1GSQA 4ZILA 1X5DA 5GAND 7GSSA 3CMIA 3GKXA 1EZKA 1G6WA 2FGXA 3W8JA 3RPNA 5IMFA 2QC7A 5ECRB 4IP6A 4NMUA 2H1AA 1ZOFA 3LYKA 5JCWA 3KCMA 2YV9A 4EUYA 2L4QA 5E59A 1OE8A 3F4SA 2H01A 3D5JA 3IHQA 4POLA 3TRXA 5JWOB 4TXOA 3FR6A 4IQAA 1VGLA 4L5LA 4N10A 1M99A 1XZOA 1X9WB 3M0FA 4YAPA 3UAPA 4F2IA 3K8NA 1ZCPA 1NSWA 2QSIA 2H8LA 1TTZA 2BMXA 4K7NA 3LSZA 3U5RE 1GTBA 2NVLA 3APOA 3KMOA 2WCIA 3QDNA 1PN9A 1SD9A 5COHA 3IK9A 2R4VA 3UOMA 3IAM2 1OC9A 2EC4A 2WRTA 3IC4A 2FLSA 5D9VA 1EV9A 2R37A 3HY2A 1X9MB 5D9WA 4D73A 4FYBA 2VCVA 3CSJA 3WT1A 1TI3A 3DMLA 2OACA 2X8HA 1GL8A 1YF0A 3APSA 3G7YA 2IMIA 2AUVA 4PQHA 4YAVA 1MD3A 4OO4A 1HQOA 1RW1A 1Z6NA 3A2VA 1AQWA 3Q18A 5CO3A 2TRCP 3I69A 1SKRB 1VF3A 1DE2A 1T00A 4G2EA 3L4NA 3MWHA 2DBCA 2DMMA 14GSA 4GSNA 3UVTA 4HJMA 2KP2A 5ECSA 4XS6A 1AW9A 1PA3A 3IE3A 1PQNA 2LEGA 1GWCA 3NIVA 2DMLA 3ZMKA 3DVXA 2FWGA 1A24A 17GSA 3QOUA 3UBLA 4MJAA 3O3TA 3WT2A 3FRCA 4X43A 2DJ2A 4HU9A 3TKSE 1UA5A 4X0XA 4K0NA 4MH3A 3TGZA 4IBPA 4Q5FA 3L9VA 1EEMA 5F05A 5AIXA 2DIYA 5CAXA 3HVVA 5KN3A 5ENUA 3QR6A 3H8QA 1MDKA 1TDIA 3BBYA 2C3QA 1SYRA 3DD3A 3RHBA 3TKRA 1TRVA 2L59A 5HFKA 1M7TA 1UVZA 4KE3A 1H75A 4PXOA 2H72A 5ECPB 2YP6A 1AUCA 1A0RP 3G7IA 4I6XA 2N5BA 2NPBA 5DVBA 1THOA 1VF2A 1K0AA 1U3AA 1HNAA 6GSUA 1PKWA 4PUAA 5DQYA 3ZFLA 1J0FA 2MMNA 4HUAA 1ABAA 2G0FA 4NHZA 4DSSA 1UC7A 3FK8A 1PX6A 4EL1A 4YQVA 3C7MA 3Q74A 1ZYEA 5DAKB 3EURA 4PQIA 1FO5A 2REMA 5DBQA 3TOTA 1GNWA 4J57E 1U3IA 1ERUA 5A4UA 1ZYQB 1K0OA 1YY7A 1N8JA 3LORA 1JZWA 2HSYA 3E0UA 1QFNA 1GH2A 5ECLB 2C80A 2ZCTA 4IGJA 4PUFC 3GL5A 4XTSA 2HI7A 1GRXA 1O7UA 5J4UA 18GSA 3R2QA 6GSYA 3MDKA 4ML1A 5D9TA 2ON5A 3KIJA 2FCHA 2Z9SA 1B4QA 4KSMA 3P7XA 2CQ9A 1GUMA 1GSFA 1SK0A 2P0GA 2K8VA 4ULXA 2B1LA 1SU9A 1JZRA 4YQMA 1A2JA 1F2EA 2FY6A 5DCHA 2J23A 1ERWA 5GZZB 1T4ZA 4KSOA 1DE1A 5CYYA 1USBA 2CVBA 2LRTA 1O6JA 3WGDA 2VL3A 4GQCA 2YPMA 5G31A 1WJKA 4F03A 1AC1A 1AQVA 5IOWA 2CX3A 2FUG2 4LLRA 1S3DA 4BL7A 2VLUA 1GSEA 2LS5A 1U87A 2QKEA 5HFGA 1AAZA 1J08A 4TXVA 2FWFA 3GA4A 1SJ6A 2GSQA 4ZB8A 4CHSA 2ZNMA 1XPVA 3VPQA 4YQUA 3KP9A 3TB2A 5ELAA 2YN1A 2IIYA 1TI1A 3HHVA 4KUNA 3I6AA 4IQ1A 2VD0A 4WETA 1DBYA 1FB6A 1X5CA 1XOBA 1THXA 2DIZA 3VURA 4WR5A 2EIRA 3F0IA 4XRDA 2IWTA 2YWIA 2V6KA 2B5YA 5CRHA 5A4VA 5CP1A 2H70A 1WPIA 4IJIA 1BX9A 2H76A 2ON7A 4OCFA 3IV4A 1O8WA 3W6GA 3BOAA 4F0BA 2V32A 2NBSA 5GSTA 4EVMA 2V2GA 2LTKA 3QPMA 5HR1A 3C71A 3A3TA 2GSSA 2E0QA 2P5RA 4MK3A 1OAZA 5CNWA 2LJRA 3H4KA 1O81A 5EL8A 1ILOA 1ZL9A 2X8CA 2L57A 2ZUPA 3UEMA 2X64A 4XHMA 3LYPA 1SENA 1U88A 5GSSA 2LV3A 4OFTA 2H74A 4DSRA 1YKCA 4TN8A 1K3OA 4JZQA 2JACA 4BWQA 2AV4A 2K9FA 1PGTA 3FZ5A 4J56E 5ELGA 2DJ1A 1SL2B 3KD0A 5DALA 2WS2A 6GSXA 1GULA 2B6MA 5ABRA 4MF5A 2H0HA 2KOKA 2I9HA 3IAS2 1XWGA 1V58A 3JCML 5D93A 3MSZA 1R5PA 2M80A 2XPEA 1KBNA 2VUPA 5LD0A 1GTAA 2GS3A 4TRXA 4AJ8A 1JLWA 2HRFA 3KH7A 1B4PA 3HCZA 2WGRA 1OC3A 4HQZA 4J2FA 2TIRA 4F82A 3V1WA 3GIXA 2M72A 1B48A 4LL1B 3H93A 4NAXA 4X1UA 2PERA 1WP0A 1Z7RA 2V41A 3FEUA 2HLSA 2KLXA 2M46A 1PRXA 2CZ2A 4AF2A 4KDXA 1GNEA 4MF6A 1TW9A 4IVFA 2LNSA 1MEKA 5HQPA 3F6DA 2R5GA 5J41A 2YZUA 5ECQB 3LJRA 3TRPA 2VL9A 2C0DA 1JLVA 1K0MA 3BCIA 4QQ7A 3KTLA 1CQHA 3IA1A 2LJAA 1WE0A 8GSSA 2RM6A 1TK8B 1KNGA 4PNFA 3EU3A 4RI7A 3LQ7A 4I2UA 2G2QA 3DGQA 1RQMA 4ZBAA 4RUVA 5B8AA 4ZL9A 5L71A 2MMOA 1R5AA 4V2LA 3GUSA 2E2GA 4EE0A 4F0CA 3EC3A 4TR0A 5ECKB 1T7PB 5ECIB 5AISA 3WD6A 2EIQA 1A8YA 6GSWA 1PL2A 5CREA 4GLTA 3CSHA 3ERGA 4K7IA 3NOFA 3ME8A 1Q98A 2WZ9A 3OR5A 2L6CA 4NWYA 4DEJA 2I3YA 4V2NA 5JCUA 3KMNA 4MZWA 3C73A 9GSSA 1ON4A 4HU7A 3SWLA 5CRWA 3HZ8A 3RBTA 2JSYA 2DJ3A 4K2DA 3GYKA 2GSRA 2OBIA 1MDJA 2F8FA 3FR3A 4FIWA 3VLNA 2DJ0A 3ME7A 3ZIJA 4OMVA 2CVDA 3IK7A 2K8SA 3QAGA 4ACSA 4EXJA 4O7HA 2PN8A 2DLXA 4ZBDA
chains in the Genus database with same CATH superfamily
4HDEA 3TJGA 1TP9A 1SL0B 2PPTA 2F3MA 6GSTA 4ECBA 4ICYA 1FB0A 4NV5A 4EDYA 1BJXA 2LUSA 2C0FA 5AIVA 3L9SA 4G0LA 4XS4B 4GCIA 3BCKA 3P2AA 1K0BA 2O85A 5F8BA 1SKWB 3DWVA 2OE1A 2VIMA 4HZ2A 4RI6A 2F51A 4OFMA 2FHEA 6GSVA 1TRWA 2H30A 3IDVA 3O76A 3MAKA 1ZZYA 1M2AA 2CAIA 1KEBA 3DKSA 2O87A 3ZREA 3LXZA 1VF4A 2YWOA 4PURA 4NV2A 3KGKA 4Q5NA 3QFAC 1QUWA 5G1KA 1WIKA 4HS1A 1LJRA 1SD8A 3C1RA 4TR3A 2QGVA 4O5UA 4DVCA 3VK9A 3IOSA 4RQRA 2PWJA 1M3JA 4L0WA 2AJQB 3DEXA 4EIPA 3EMXA 4POBA 5HFIA 1M2BA 1GUHA 4BVXB 3HXSA 4TR1B 4WF4A 5DAKA 3CRUA 3Q6OA 1XW9A 1R26A 2C3TA 3CSIA 1PKZA 5ECNB 1YEPA 3F9UA 1I9DA 4I2TA 3ZFBA 1OVNA 1A0FA 3MYDA 3QMXA 2KUCA 1M3IA 2O89A 1A2MA 4V1Ag 2PU9C 4JE1A 4JRRA 4KCAA 1Y6EA 5F06A 2AYTA 1QK8A 4L0UA 2XPDA 1KTEA 5IPGA 4I8BA 2HNLA 1HYUA 4EF0A 1SJIA 2IPAA 1K0CA 1LBKA 4PGTA 5G1LA 4ECJA 5J5NA 1EOGA 2HZFA 1GLQA 1QQ2A 1R7HA 4POMA 1O8XA 2B7KA 3PH9A 4OCEA 1EGRA 5HR3A 5EY6A 5IMVA 3QAVA 1GTIA 5DJMA 2MBSA 1URMA 5ECOB 2FD3A 4OWYA 5J3RA 2MZCA 4KB3A 4HEA2 4EKZA 2GQMA 2HZEB 1ST9A 5C00A 1OKDA 3FW2A 1QGVA 2VCQA 2H73A 4GF0A 2OE3A 1XWBA 2MMAA 1F3BA 3TCOA 2FA8A 4WKWA 1BQ7A 2IMKA 4NHWA 4BIKA 4WBRD 5HR0A 2JZSA 5EVOA 1XIYA 2VAFA 1FVKA 5B8BA 2DJJA 1BG5A 3QD9A 2CV4A 2C8UA 2UZ8A 3SBCA 3PINA 1YDKA 4ID0A 3RPPA 5KN2A 3HKRA 2BTOT 2IFQB 4Z7XA 4PQ1A 2X99A 1FAAA 2WULA 1K0NA 3LW9A 5INYA 1HNBA 1T1VA 4ZIJA 2P5QA 2RUEA 4CY6A 3D4MA 4G0IA 3ZZXA 4DSQA 5IMDA 2B5XA 5G5FA 3UBKA 1G7OA 2JADA 1S3AA 3C8EA 3C1SA 1PSQA 2CX4A 1PD21 5G2ZA 3P8WA 1GLPA 4G9HA 2CAQA 1PN0A 4OO5A 2JZRA 5CRGA 4KDUA 3D22A 3LWAA 3M3MA 1YQ1A 4PX1A 1TK0B 1M9AA 4KGIA 2OE0A 1BEDA 1Z5YE 3ZIVA 3L78A 1V9WA 5B6NA 3EU4A 1EWXA 2H6XA 2A4HA 1TKDB 1JFUA 1JZDA 3DRNA 1HD2A 4POKA 2XHFA 4JBBA 2ES7A 1J9BA 3HVSA 1R4WA 2E2MA 3GKNA 2C0EA 3UJ1A 1M0UA 2N5AA 2CZ3A 4G19A 3RHCA 5AN1A 4JR6A 3IR4A 4GWRA 3GV1A 3P90A 3UARA 2BJXA 3FY7A 3IPZA 2RIIA 1JHBA 3I9V2 3QAWA 3GKKA 2DC5A 4WXTA 1OE7A 2HSMA 3A5WA 1EOHA 1NM3A 2AAWA 5E4WA 3ZMLA 3O6TA 2H1BA 2B3SA 2LNTA 1XVWA 3F63A 2RLIA 3CTFA 1V40A 3VI7A 1M9BA 5H5QA 3Q19A 2YZHA 3HYPA 1YJ6A 3FZAA 4ILFA 3HA9A 3BD2A 4HI7A 2IMFA 3US3A 3WYWA 2PUKC 3KM6A 1DSBA 2GZYA 2R3XA 2PGTA 3GX0A 3DVWA 4K1FA 5KN1A 2YWMA 5BRTA 3E3EA 5GAPD 4KNDA 1QXHA 2I1UA 3TJKA 3ZVJA 2CT6A 2WJUA 1NW2A 3TKSA 2GZPA 5FWGA 3DIEA 5ID2B 2NTOA 1B8XA 2HYXA 1XXUA 2J9HA 2PVQA 4GRFA 3FKFA 3CXGA 1OYJA 5C04A 4KCEA 3HD5A 2C4JA 4AGSA 2L6DA 3A2XA 1V2AA 3LXTA 2H75A 4WF5A 2WDUA 11GSA 4YKGA 1GSDA 2LKUA 2VOCA 2GQKA 2FWHA 3F4RA 3H1NA 2CVKA 4L8EA 2LJKA 2H6YA 4BVYB 1EP8A 2VCZA 1X9SB 4MMMA 3N5OA 3TDGA 3J7Yb 1YF1A 3TKSC 2F8AA 2MMZA 2JSZA 1WWJA 5FHIA 1V57A 2OBKA 3KEBA 2C1YA 1H4OA 2FA4A 16GSA 2PBJA 5B6MA 4YH2A 3F6FA 3F3QA 1AQXA 5H5SA 5B7CA 3WGXA 2D2ZA 2HT9A 3EVIA 4MPFA 3GL3A 4NPBA 2FNOA 4Q5RA 5A4WA 2VL2A 4JU5A 1O73A 4V1Ap 1A23A 2GZZA 2GQLA 1TJDA 3UMAA 4KDYA 3IRAA 4IS0A 2H19A 4FYUA 2YJHA 3GH6A 4Z2RA 2H1DA 2JU5A 1PL1A 1XW6A 3FZ9A 1VRSD 5DJLA 19GSA 2RM5A 2B7JA 12GSA 3IBHA 4I97A 1ZGNA 4QL7A 2PVOC 4XS4A 3D0ZA 4LMWA 6GSSA 4MJBA 1GP1A 4MZCA 2H0GA 1IYHA 5J9BA 2VL2C 3VWWA 2H6ZA 3PR8A 4NXIA 4ML6A 2AHEA 2K18A 2O8VB 4MABA 1O85A 3GTUB 2XC2A 1E6BA 3EYTA 1W89A 3HJOA 2XBIA 5D8IA 3TJBA 1EP7A 1YZXA 3GX8A 1GTUA 2VO4A 4RQXA 3UVHA 2ALBA 22GSA 1Z9HA 4HZ4A 1UN2A 4BVXA 4TR1A 4CW9A 2E7PA 1JZOA 3QCPA 3VI5A 3ZTLA 5JCGA 3NZNA 4LA1A 3F4TA 1ACVA 1ZYPA 1XW5A 1XWKA 3EINA 2GVPA 2YNXA 1T8EB 2R0PA 2V1MA 4TXOB 1G6YA 2GLRA 1FOHA 2MBTA 4KAEA 4Q5QA 4E8HA 4HJ2A 1GSYA 1K3YA 4AJ7A 4ZBBA 4MLYA 2VCXA 3EE2A 2L4CA 3ERFA 1Y25A 4EO3A 2A2RA 4K8MA 3M1GA 1WOUA 1LU4A 4MPGA 1GSUA 4GTUA 2OKAA 2H1GA 1XOAA 3GNJA 1U6TA 1HNCA 10GSA 1S3RA 1PX7A 3N9JA 3HVXA 1OC9B 2GGTA 4KW6A 5G30A 4ECCA 1W4VA 3ERWA 1B9XC 1G0TA 1N2AA 2JZTA 5D73A 2TRXA 4EC0A 4D73B 2HZEA 1SK2A 3FZ4A 4O5QA 3ZL5A 5KOWA 1OC8A 2FWEA 3BJ5A 3L0HA 2VM2A 4V2MA 4ECIA 2A2SA 3ZVJD 5J9CA 3A2WA 1A8LA 2R2JA 4ZL7A 4MF7A 5KEJA 2H71A 4X4JA 2VLVA 4KA0A 2VCTA 3GN3A 4N0VA 1QMVA 2LSTA 1EEJA 4GSTA 5DCGA 5G5EA 5IM9A 2IFQA 1BAYA 3GHAA 2DJKA 4LMVA 3AY8A 4FH8A 1TOFA 5D96A 2YWNA 3GMFA 4P3YB 1TRSA 1XFLA 3VWXA 4N11A 3M8NA 3EWLA 5IQYA 4KH7A 3HJMA 4K6XA 2CA8A 1EV4A 4MZBA 3H79A 4BA7A 2KP1A 2LQQA 2AB6A 5IIZA 4K7OA 4O5RA 4FO5A 1E2YA 3UIWA 3QFBC 1XVQA 2HXKA 4ZB6A 3TOUA 1SK1A 3VPTA 4PTSA 5IMCA 4N0ZA 3GSSA 5DDLA 3LFLA 1NHYA 2DSAA 3IXRA 3VFIA 1CQGA 1X5EA 1Z7PA 5IPHA 3G9BA 3F8UA 3ISOA 2GT6A 2B5EA 1TXXA 2HFDA 2VD1A 3GRXA 2L5LA 1BYEA 1V98A 1X0RA 4BWSA 2GT5A 3I43A 4WEYA 3FYGA 3PGTA 5AGYA 4I5QA 2N5FA 4ISDA 3FHKA 3M9KA 1GUKA 4XRAA 1ERTA 1ML6A 3D4TA 4IHUA 1F9MA 3KXOA 4BPYA 1IYIA 1I5GA 2I4AA 2IL3A 4HOJA 2YANA 3TUEA 4GSSA 3CTGA 4TKYA 2QA1A 2WFCA 2YJ7A 3KZQA 4OFNA 3KH9A 5D9XA 1C72A 4MJEA 3WGEA 1VF1A 3RAZA 2GTUA 4JEDA 4TOPA 4G10A 4DSSB 2IMDA 3TJJA 5LNKe 5F07A 2GDRA 1M2DA 4EIQA 1T4YA 4QL9A 3ZLPA 4E8EA 3A5IA 1RK4A 2K6VA 3APQA 3J7Yk 3TJFA 2GSTA 3GFKA 1PMTA 1Q4JA 3ZITA 4MP4A 3LEFA 1ZMAA 2R0GA 4O32A 2HRNA 1S3CA 1FVJA 4IJ3A 4N30A 3TKQA 3KP8A 4EDZA 2LRCA 3E9JB 3MNGA 2L5OA 2LQOA 4AJ6A 3FR9A 4WBJA 4MA9A 1K0DA 2H66A 5ECHB 4TW5A 2A4VA 3HZ4A 4K9ZA 1SL1B 2VCWA 1AXDA 2NDOA 5ID2A 1T3BA 2PMTA 3IC8A 3CRTA 4KX4A 4CDOA 4JR4A 3M9JA 2OA7A 20GSA 3G7JA 3KJYA 3EPTA 2YOIA 1YKAA 1ERVA 3D21A 5F0GA 4IN0A 4XCSA 1XWCA 2VM1A 3KTBA 4HSCX 2H0IA 5CRDA 1WMJA 1K3LA 2RUFA 3ZYWA 5IO0A 3VWUA 2XBQA 3ZRDA 1TK5B 3ED3A 13GSA 2F9SA 4BVYA 3GH9A 1WRYA 2YV7A 2O7KA 5H5RA 1GSSA 5IMAA 5LCZA 4L5OA 3GURA 4O92A 2X8GA 1XBSA 4HQSA 2IJYA 4TR4A 1Z3EA 1A2LA 5JWQB 1FOVA 4XIHA 4BL7B 2R6KA 1B9YC 3D6IA 3DXBA 5DQSA 4ZXGA 1EGOA 4MJCA 4IELA 3VWVA 2EIOA 3HDCA 2IMEA 4FYCA 4XS1A 5HR2A 5ECMB 3GKMA 3HJPA 5FT3A 1DUGA 1F3AA 3TRQA 1F37A 5A5KA 3UL3A 2WB9A 1AIUA 3CBUA 1NHOA 4K5SA 2I81A 4TVEA 3CYNA 1FHEA 1MTCA 4MCUA 4CY8A 1TU8A 3L9UA 4MH2A 2C0GA 3TKPA 3LG6A 4WR4A 4K0GA 2B1KA 1TRUA 2OJLA 2P31A 1YEXA 1G7EA 1F6MC 5KOXA 3W8SA 2VLTA 4IW9A 1PFOA 1XWAA 2IN3A 2HE3A 1SYXA 1MDIA 2YCDA 2C3NA 4IP1A 1SKSB 3U6VA 4Z2TA 2JL4A 3GSTA 4ZB9A 4OD7A 3LGCA 5JWRB 5IMZA 3DYRA 1OKTA 2KHPA 2MYGA 4IKHA 3S9FA 2OADA 4GQFA 2HSHA 4MDCA 4H86A 1FW1A 1XCCA 4LL4B 1Z6MA 1TU7A 5IOXA 1SJZA 3EMPA 4PNGA 3RDWA 3F3RA 2LRNA 5IO2A 4GXZA 4F9ZA 3GTUA 1MD4A 5DALB 2V6OA 5KN0A 5EPFA 1FG4A 4ZL8A 1GSQA 4ZILA 1X5DA 5GAND 7GSSA 3CMIA 3GKXA 1EZKA 1G6WA 2FGXA 3W8JA 3RPNA 5IMFA 2QC7A 5ECRB 4IP6A 4NMUA 4K2XA 2H1AA 1ZOFA 3LYKA 5JCWA 3KCMA 2YV9A 4EUYA 2L4QA 5E59A 1OE8A 3F4SA 2H01A 3D5JA 3IHQA 4POLA 3TRXA 5JWOB 4TXOA 3FR6A 4IQAA 1VGLA 4L5LA 4N10A 1M99A 1XZOA 1X9WB 3M0FA 4YAPA 3UAPA 4F2IA 3K8NA 1ZCPA 1NSWA 2QSIA 2H8LA 1TTZA 2BMXA 3CQFA 4K7NA 3LSZA 3U5RE 1GTBA 2NVLA 3APOA 3KMOA 2WCIA 3QDNA 1PN9A 1SD9A 5COHA 3IK9A 2R4VA 3UOMA 3IAM2 1OC9A 2EC4A 2WRTA 3IC4A 2FLSA 5D9VA 1EV9A 2R37A 3HY2A 1X9MB 5D9WA 4D73A 4FYBA 2VCVA 3CSJA 3WT1A 1TI3A 3DMLA 2OACA 2X8HA 1GL8A 1YF0A 3APSA 3G7YA 2IMIA 2AUVA 4PQHA 4YAVA 1MD3A 4OO4A 1HQOA 1RW1A 1Z6NA 3A2VA 1AQWA 3Q18A 5CO3A 2TRCP 3I69A 1SKRB 2R0CA 1VF3A 1DE2A 1T00A 4G2EA 3L4NA 3MWHA 2DBCA 2DMMA 14GSA 4GSNA 3UVTA 4HJMA 2KP2A 5ECSA 4XS6A 1AW9A 1PA3A 3IE3A 1PQNA 2LEGA 1GWCA 4K5RA 2HRAA 3NIVA 2DMLA 3ZMKA 3DVXA 2FWGA 1A24A 17GSA 3QOUA 3UBLA 4MJAA 3O3TA 3WT2A 3FRCA 4X43A 2DJ2A 4HU9A 3TKSE 1UA5A 4X0XA 4K0NA 4MH3A 3TGZA 4IBPA 4Q5FA 3L9VA 1EEMA 5F05A 5AIXA 2DIYA 5CAXA 3HVVA 5KN3A 5ENUA 3QR6A 3H8QA 1MDKA 1TDIA 3BBYA 2C3QA 1SYRA 3DD3A 3RHBA 3TKRA 1TRVA 2L59A 5HFKA 1M7TA 1UVZA 4KE3A 1H75A 4PXOA 2H72A 5ECPB 2YP6A 1AUCA 1A0RP 3FMWA 3G7IA 4I6XA 2N5BA 2NPBA 5DVBA 1THOA 1VF2A 1K0AA 1U3AA 1HNAA 6GSUA 1PKWA 4PUAA 5DQYA 3ZFLA 1J0FA 4KF9A 2MMNA 4HUAA 1ABAA 2G0FA 4NHZA 4DSSA 1UC7A 3FK8A 1PX6A 4EL1A 4YQVA 3C7MA 3Q74A 1ZYEA 5DAKB 3EURA 4PQIA 1FO5A 2REMA 5DBQA 3TOTA 1GNWA 4FQUA 4J57E 1U3IA 1ERUA 5A4UA 1ZYQB 1K0OA 1YY7A 1N8JA 3LORA 1JZWA 2HSYA 3E0UA 2DKIA 1QFNA 1GH2A 5ECLB 2C80A 2HRKA 2ZCTA 4IGJA 4PUFC 1ZYNA 3GL5A 4XTSA 2HI7A 1GRXA 1O7UA 5J4UA 18GSA 3R2QA 6GSYA 3MDKA 3HVNA 4ML1A 5D9TA 2ON5A 4A5PA 3KIJA 2FCHA 2Z9SA 1B4QA 4KSMA 3P7XA 2CQ9A 1GUMA 1GSFA 1SK0A 2P0GA 2K8VA 3PPUA 4ULXA 2B1LA 1SU9A 1JZRA 4YQMA 1A2JA 1F2EA 2FY6A 5DCHA 2J23A 1ERWA 5GZZB 1T4ZA 4KSOA 1DE1A 5CYYA 1USBA 2CVBA 2LRTA 1O6JA 3WGDA 2VL3A 4GQCA 2YPMA 4YKFA 5G31A 1WJKA 4F03A 1AC1A 1AQVA 5IOWA 2CX3A 2FUG2 4LLRA 1S3DA 4BL7A 2VLUA 1GSEA 2LS5A 1U87A 2QKEA 5HFGA 1AAZA 1J08A 4TXVA 2FWFA 4G0KA 4MNNA 3GA4A 1SJ6A 2GSQA 4ZB8A 4CHSA 2ZNMA 1XPVA 3VPQA 4YQUA 2X49A 3KP9A 3TB2A 5ELAA 2YN1A 2IIYA 1TI1A 3HHVA 4KUNA 3I6AA 4IQ1A 2VD0A 4WETA 1DBYA 1FB6A 1X5CA 1XOBA 1THXA 2DIZA 3VURA 4WR5A 2EIRA 3F0IA 4XRDA 2IWTA 2YWIA 2V6KA 2B5YA 5CRHA 5A4VA 5CP1A 2H70A 1WPIA 4IJIA 1BX9A 2H76A 2ON7A 4OCFA 3IV4A 1O8WA 3W6GA 3BOAA 4F0BA 2V32A 2NBSA 3R3EA 5GSTA 4EVMA 2V2GA 2LTKA 3QPMA 5HR1A 3C71A 3A3TA 2GSSA 2E0QA 2P5RA 4MK3A 1OAZA 5CNWA 2LJRA 3H4KA 1O81A 5EL8A 1ILOA 1ZL9A 2X8CA 2L57A 2ZUPA 3UEMA 2X64A 4XHMA 3LYPA 1SENA 1U88A 5GSSA 2LV3A 4OFTA 2H74A 4DSRA 1YKCA 4TN8A 1K3OA 4JZQA 2JACA 4BWQA 2AV4A 2K9FA 1PGTA 3FZ5A 4J56E 5ELGA 2DJ1A 1SL2B 3KD0A 5DALA 2WS2A 6GSXA 1GULA 2B6MA 5ABRA 4MF5A 2H0HA 2KOKA 2I9HA 3IAS2 1XWGA 1V58A 3JCML 5D93A 3MSZA 1R5PA 4Z2UA 2M80A 2XPEA 1KBNA 2VUPA 5LD0A 1GTAA 2GS3A 4TRXA 4AJ8A 1JLWA 2HRFA 3KH7A 1B4PA 3HCZA 2WGRA 1OC3A 4HQZA 4J2FA 2TIRA 4F82A 2X4AA 3V1WA 3GIXA 2M72A 3IHGA 1B48A 4LL1B 3H93A 4NAXA 4X1UA 1XG8A 2PERA 1WP0A 1Z7RA 2V41A 3FEUA 2HLSA 2KLXA 2M46A 1PRXA 2CZ2A 4AF2A 4KDXA 1GNEA 4MF6A 1TW9A 4IVFA 2LNSA 1MEKA 5HQPA 3F6DA 2R5GA 5J41A 2YZUA 5ECQB 3LJRA 3TRPA 2QA2A 2VL9A 2C0DA 1JLVA 1K0MA 3BCIA 4QQ7A 3KTLA 1CQHA 3IA1A 2LJAA 1WE0A 8GSSA 2RM6A 1TK8B 4RI7A 1KNGA 3EU3A 4PNFA 3LQ7A 4I2UA 2G2QA 3DGQA 1RQMA 5BMUA 4ZBAA 4RUVA 5B8AA 4ZL9A 5L71A 2MMOA 1R5AA 4V2LA 3GUSA 2E2GA 4EE0A 4F0CA 3EC3A 2A2PA 4TR0A 5ECKB 1T7PB 5ECIB 5AISA 3WD6A 2EIQA 1A8YA 6GSWA 4USSA 1PL2A 2DKHA 5CREA 4GLTA 3CSHA 3ERGA 4K7IA 3NOFA 3ME8A 1Q98A 2WZ9A 3OR5A 2L6CA 4NWYA 4DEJA 2I3YA 4V2NA 5JCUA 3KMNA 4MZWA 3C73A 9GSSA 1ON4A 4HU7A 3MIXA 3SWLA 5CRWA 3HZ8A 3RBTA 2JSYA 2DJ3A 4K2DA 3GYKA 2GSRA 2OBIA 1MDJA 2F8FA 3FR3A 4FIWA 3VLNA 2DJ0A 3ME7A 3ZIJA 4OMVA 2CVDA 3IK7A 2K8SA 3QAGA 4ACSA 4EXJA 4O7HA 2PN8A 2DLXA 4ZBDA
chains in the Genus database with same CATH topology
4HDEA 3TJGA 1TP9A 1SL0B 2PPTA 2F3MA 6GSTA 4ECBA 4ICYA 1FB0A 4NV5A 4EDYA 1BJXA 2LUSA 2C0FA 5AIVA 3L9SA 4G0LA 4XS4B 4GCIA 3BCKA 3P2AA 1K0BA 2O85A 5F8BA 1SKWB 3DWVA 2OE1A 2VIMA 4HZ2A 4RI6A 2F51A 4OFMA 2FHEA 6GSVA 1TRWA 2H30A 3IDVA 3O76A 3MAKA 1ZZYA 1M2AA 2CAIA 1KEBA 3DKSA 2O87A 3ZREA 3LXZA 1VF4A 2YWOA 4PURA 4NV2A 3KGKA 4Q5NA 3QFAC 1QUWA 5G1KA 1WIKA 4HS1A 1LJRA 1SD8A 3C1RA 4TR3A 2QGVA 4O5UA 4DVCA 3VK9A 3IOSA 4RQRA 2PWJA 4L0WA 2AJQB 3DEXA 4EIPA 3EMXA 4POBA 5HFIA 1M2BA 1GUHA 4BVXB 3HXSA 4TR1B 4WF4A 5DAKA 3CRUA 3Q6OA 1XW9A 1R26A 2C3TA 3CSIA 1PKZA 5ECNB 1YEPA 3F9UA 1I9DA 4I2TA 3ZFBA 1OVNA 1A0FA 3MYDA 3QMXA 2KUCA 2O89A 1A2MA 4V1Ag 2PU9C 4JE1A 4JRRA 4KCAA 1Y6EA 5F06A 2AYTA 1QK8A 4L0UA 2XPDA 1KTEA 5IPGA 4I8BA 2HNLA 1HYUA 4EF0A 1SJIA 2IPAA 1K0CA 1LBKA 4PGTA 5G1LA 4ECJA 5J5NA 1EOGA 2HZFA 1GLQA 1QQ2A 1R7HA 4POMA 1O8XA 2B7KA 3PH9A 4OCEA 1EGRA 5HR3A 5EY6A 5IMVA 3QAVA 1GTIA 5DJMA 2MBSA 1URMA 5ECOB 2FD3A 4OWYA 5J3RA 2MZCA 4KB3A 4HEA2 4EKZA 2GQMA 2HZEB 1ST9A 5C00A 1OKDA 3FW2A 1QGVA 2VCQA 2H73A 4GF0A 2OE3A 1XWBA 2MMAA 1F3BA 3TCOA 2FA8A 4WKWA 1BQ7A 2IMKA 4NHWA 4WBRD 5HR0A 2JZSA 5EVOA 1XIYA 2VAFA 1FVKA 5B8BA 2DJJA 1BG5A 3QD9A 2CV4A 2C8UA 2UZ8A 3SBCA 3PINA 1YDKA 4ID0A 3RPPA 5KN2A 3HKRA 2BTOT 2IFQB 4Z7XA 4PQ1A 2X99A 1FAAA 2WULA 1K0NA 3LW9A 5INYA 1HNBA 1T1VA 4ZIJA 2P5QA 2RUEA 4CY6A 3D4MA 4G0IA 3ZZXA 4DSQA 5IMDA 2B5XA 5G5FA 3UBKA 1G7OA 2JADA 1S3AA 3C8EA 3C1SA 1PSQA 2CX4A 1PD21 5G2ZA 3P8WA 1GLPA 4G9HA 2CAQA 1PN0A 4OO5A 2JZRA 5CRGA 4KDUA 3D22A 3LWAA 3M3MA 1YQ1A 4PX1A 1TK0B 1M9AA 4KGIA 2OE0A 1BEDA 1Z5YE 3ZIVA 3L78A 1V9WA 5B6NA 3EU4A 1EWXA 2H6XA 2A4HA 1TKDB 1JFUA 1JZDA 3DRNA 1HD2A 4POKA 2XHFA 4JBBA 2ES7A 1J9BA 3HVSA 1R4WA 2E2MA 3GKNA 2C0EA 3UJ1A 1M0UA 2N5AA 2CZ3A 4G19A 3RHCA 5AN1A 4JR6A 3IR4A 4GWRA 3GV1A 3P90A 3UARA 2BJXA 3FY7A 3IPZA 2RIIA 1JHBA 3I9V2 3QAWA 3GKKA 2DC5A 4WXTA 1OE7A 2HSMA 3A5WA 1EOHA 1NM3A 2AAWA 5E4WA 3ZMLA 3O6TA 2H1BA 2B3SA 2LNTA 1XVWA 3F63A 2RLIA 3CTFA 1V40A 3VI7A 1M9BA 5H5QA 3Q19A 2YZHA 3HYPA 1YJ6A 3FZAA 4ILFA 3HA9A 3BD2A 4HI7A 2IMFA 3US3A 3WYWA 2PUKC 3KM6A 1DSBA 2GZYA 2R3XA 2PGTA 3GX0A 3DVWA 4K1FA 5KN1A 2YWMA 5BRTA 3E3EA 5GAPD 4KNDA 1QXHA 2I1UA 3TJKA 3ZVJA 2CT6A 2WJUA 1NW2A 3TKSA 2GZPA 5FWGA 3DIEA 5ID2B 2NTOA 1B8XA 2HYXA 1XXUA 2J9HA 2PVQA 4GRFA 3FKFA 3CXGA 1OYJA 5C04A 4KCEA 3HD5A 2C4JA 4AGSA 2L6DA 3A2XA 1V2AA 3LXTA 2H75A 4WF5A 2WDUA 11GSA 4YKGA 1GSDA 2LKUA 2VOCA 2GQKA 2FWHA 3F4RA 3H1NA 2CVKA 4L8EA 2LJKA 2H6YA 4BVYB 1EP8A 2VCZA 1X9SB 4MMMA 3N5OA 3TDGA 3J7Yb 1YF1A 3TKSC 2F8AA 2MMZA 2JSZA 1WWJA 5FHIA 1V57A 2OBKA 3KEBA 2C1YA 1H4OA 2FA4A 16GSA 2PBJA 5B6MA 4YH2A 3F6FA 3F3QA 1AQXA 5H5SA 5B7CA 3WGXA 2D2ZA 2HT9A 3EVIA 4MPFA 3GL3A 4NPBA 2FNOA 4Q5RA 5A4WA 2VL2A 4JU5A 1O73A 4V1Ap 1A23A 2GZZA 2GQLA 1TJDA 3UMAA 4KDYA 3IRAA 4IS0A 2H19A 4FYUA 2YJHA 3GH6A 4Z2RA 2H1DA 2JU5A 1PL1A 1XW6A 3FZ9A 1VRSD 5DJLA 19GSA 2RM5A 2B7JA 12GSA 3IBHA 4I97A 1ZGNA 4QL7A 2PVOC 4XS4A 3D0ZA 4LMWA 6GSSA 4MJBA 1GP1A 4MZCA 2H0GA 1IYHA 5J9BA 2VL2C 3VWWA 2H6ZA 3PR8A 4NXIA 4ML6A 2AHEA 2K18A 2O8VB 4MABA 1O85A 3GTUB 2XC2A 1E6BA 3EYTA 1W89A 3HJOA 2XBIA 5D8IA 3TJBA 1EP7A 1YZXA 3GX8A 1GTUA 2VO4A 4RQXA 3UVHA 2ALBA 22GSA 1Z9HA 4HZ4A 1UN2A 4BVXA 4TR1A 4CW9A 2E7PA 1JZOA 3QCPA 3VI5A 3ZTLA 5JCGA 3NZNA 4LA1A 3F4TA 1ACVA 1ZYPA 1XW5A 1XWKA 3EINA 2GVPA 2YNXA 1T8EB 2R0PA 2V1MA 4TXOB 1G6YA 2GLRA 1FOHA 2MBTA 4KAEA 4Q5QA 4E8HA 4HJ2A 1GSYA 1K3YA 4AJ7A 4ZBBA 4MLYA 2VCXA 3EE2A 2L4CA 3ERFA 1Y25A 4EO3A 2A2RA 4K8MA 3M1GA 1WOUA 1LU4A 4MPGA 1GSUA 4GTUA 2OKAA 2H1GA 1XOAA 3GNJA 1U6TA 1HNCA 10GSA 1PX7A 3N9JA 3HVXA 1OC9B 2GGTA 4KW6A 5G30A 4ECCA 1W4VA 3ERWA 1B9XC 1G0TA 1N2AA 2JZTA 5D73A 2TRXA 4EC0A 4D73B 2HZEA 1SK2A 3FZ4A 4O5QA 3ZL5A 5KOWA 1OC8A 2FWEA 3BJ5A 3L0HA 2VM2A 4V2MA 4ECIA 2A2SA 3ZVJD 5J9CA 3A2WA 1A8LA 2R2JA 4ZL7A 4MF7A 5KEJA 2H71A 4X4JA 2VLVA 4KA0A 2VCTA 3GN3A 4N0VA 1QMVA 2LSTA 1EEJA 4GSTA 5DCGA 5G5EA 5IM9A 2IFQA 1BAYA 3GHAA 2DJKA 4LMVA 3AY8A 4FH8A 1TOFA 5D96A 2YWNA 3GMFA 4P3YB 1TRSA 1XFLA 3VWXA 4N11A 3M8NA 3EWLA 5IQYA 4KH7A 3HJMA 4K6XA 2CA8A 1EV4A 4MZBA 3H79A 4BA7A 2KP1A 2LQQA 2AB6A 5IIZA 4K7OA 4O5RA 4FO5A 1E2YA 3UIWA 3QFBC 1XVQA 2HXKA 4ZB6A 3TOUA 1SK1A 3VPTA 4PTSA 5IMCA 4N0ZA 3GSSA 5DDLA 3LFLA 1NHYA 2DSAA 3IXRA 3VFIA 1CQGA 1X5EA 1Z7PA 5IPHA 3G9BA 3F8UA 3ISOA 2GT6A 2B5EA 1TXXA 2HFDA 2VD1A 3GRXA 2L5LA 1BYEA 1V98A 1X0RA 4BWSA 2GT5A 3I43A 4WEYA 3FYGA 3PGTA 5AGYA 4I5QA 2N5FA 4ISDA 3FHKA 3M9KA 1GUKA 4XRAA 1ERTA 1ML6A 3D4TA 4IHUA 1F9MA 3KXOA 4BPYA 1IYIA 1I5GA 2I4AA 2IL3A 4HOJA 2YANA 3TUEA 4GSSA 3CTGA 4TKYA 2QA1A 2WFCA 2YJ7A 3KZQA 4OFNA 3KH9A 5D9XA 1C72A 4MJEA 3WGEA 1VF1A 3RAZA 2GTUA 4JEDA 4TOPA 4G10A 4DSSB 2IMDA 3TJJA 5LNKe 5F07A 2GDRA 1M2DA 4EIQA 1T4YA 4QL9A 3ZLPA 4E8EA 3A5IA 1RK4A 2K6VA 3APQA 3J7Yk 3TJFA 2GSTA 3GFKA 1PMTA 1Q4JA 3ZITA 4MP4A 3LEFA 1ZMAA 2R0GA 4O32A 2HRNA 1S3CA 1FVJA 4IJ3A 4N30A 3TKQA 3KP8A 4EDZA 2LRCA 3E9JB 3MNGA 2L5OA 2LQOA 4AJ6A 3FR9A 4WBJA 4MA9A 1K0DA 2H66A 5ECHB 4TW5A 2A4VA 3HZ4A 4K9ZA 1SL1B 2VCWA 1AXDA 2NDOA 5ID2A 1T3BA 2PMTA 3IC8A 3CRTA 4KX4A 4CDOA 4JR4A 3M9JA 2OA7A 20GSA 3G7JA 3KJYA 3EPTA 2YOIA 1YKAA 1ERVA 3D21A 5F0GA 4IN0A 4XCSA 1XWCA 2VM1A 3KTBA 2H0IA 5CRDA 1WMJA 1K3LA 2RUFA 3ZYWA 5IO0A 3VWUA 2XBQA 3ZRDA 1TK5B 3ED3A 13GSA 2F9SA 4BVYA 3GH9A 1WRYA 2YV7A 2O7KA 5H5RA 1GSSA 5IMAA 5LCZA 4L5OA 3GURA 4O92A 2X8GA 1XBSA 4HQSA 2IJYA 4TR4A 1Z3EA 1A2LA 5JWQB 1FOVA 4XIHA 4BL7B 2R6KA 1B9YC 3D6IA 3DXBA 5DQSA 4ZXGA 1EGOA 4MJCA 4IELA 3VWVA 2EIOA 3HDCA 2IMEA 4FYCA 4XS1A 5HR2A 5ECMB 3GKMA 3HJPA 5FT3A 1DUGA 1F3AA 3TRQA 1F37A 5A5KA 3UL3A 2WB9A 1AIUA 3CBUA 1NHOA 4K5SA 2I81A 4TVEA 3CYNA 1FHEA 1MTCA 4MCUA 4CY8A 1TU8A 3L9UA 4MH2A 2C0GA 3TKPA 3LG6A 4WR4A 4K0GA 2B1KA 1TRUA 2OJLA 2P31A 1YEXA 1G7EA 1F6MC 5KOXA 3W8SA 2VLTA 4IW9A 1XWAA 2IN3A 2HE3A 1SYXA 1MDIA 2YCDA 2C3NA 4IP1A 1SKSB 3U6VA 4Z2TA 2JL4A 3GSTA 4ZB9A 4OD7A 3LGCA 5JWRB 5IMZA 3DYRA 1OKTA 2KHPA 2MYGA 4IKHA 3S9FA 2OADA 4GQFA 2HSHA 4MDCA 4H86A 1FW1A 1XCCA 4LL4B 1Z6MA 1TU7A 5IOXA 1SJZA 3EMPA 4PNGA 3RDWA 3F3RA 2LRNA 5IO2A 4GXZA 4F9ZA 3GTUA 1MD4A 5DALB 2V6OA 5KN0A 5EPFA 1FG4A 4ZL8A 1GSQA 4ZILA 1X5DA 5GAND 7GSSA 3CMIA 3GKXA 1EZKA 1G6WA 2FGXA 3W8JA 3RPNA 5IMFA 2QC7A 5ECRB 4IP6A 4NMUA 4K2XA 2H1AA 1ZOFA 3LYKA 5JCWA 3KCMA 2YV9A 4EUYA 2L4QA 5E59A 1OE8A 3F4SA 2H01A 3D5JA 3IHQA 4POLA 3TRXA 5JWOB 4TXOA 3FR6A 4IQAA 1VGLA 4L5LA 4N10A 1M99A 1XZOA 1X9WB 3M0FA 4YAPA 3UAPA 4F2IA 3K8NA 1ZCPA 1NSWA 2QSIA 2H8LA 1TTZA 2BMXA 4K7NA 3LSZA 3U5RE 1GTBA 2NVLA 3APOA 3KMOA 2WCIA 3QDNA 1PN9A 1SD9A 5COHA 3IK9A 2R4VA 3UOMA 3IAM2 1OC9A 2EC4A 2WRTA 3IC4A 2FLSA 5D9VA 1EV9A 2R37A 3HY2A 1X9MB 5D9WA 4D73A 4FYBA 2VCVA 3CSJA 3WT1A 1TI3A 3DMLA 2OACA 2X8HA 1GL8A 1YF0A 3APSA 3G7YA 2IMIA 2AUVA 4PQHA 4YAVA 1MD3A 4OO4A 1HQOA 1RW1A 1Z6NA 3A2VA 1AQWA 3Q18A 5CO3A 2TRCP 3I69A 1SKRB 2R0CA 1VF3A 1DE2A 1T00A 4G2EA 3L4NA 3MWHA 2DBCA 2DMMA 14GSA 4GSNA 3UVTA 4HJMA 2KP2A 5ECSA 4XS6A 1AW9A 1PA3A 3IE3A 1PQNA 2LEGA 1GWCA 4K5RA 2HRAA 3NIVA 2DMLA 3ZMKA 3DVXA 2FWGA 1A24A 17GSA 3QOUA 3UBLA 4MJAA 3O3TA 3WT2A 3FRCA 4X43A 2DJ2A 4HU9A 3TKSE 1UA5A 4X0XA 4K0NA 4MH3A 3TGZA 4IBPA 4Q5FA 3L9VA 1EEMA 5F05A 5AIXA 2DIYA 5CAXA 3HVVA 5KN3A 5ENUA 3QR6A 3H8QA 1MDKA 1TDIA 3BBYA 2C3QA 1SYRA 3DD3A 3RHBA 3TKRA 1TRVA 2L59A 5HFKA 1M7TA 1UVZA 4KE3A 1H75A 4PXOA 2H72A 5ECPB 2YP6A 1AUCA 1A0RP 3FMWA 3G7IA 4I6XA 2N5BA 2NPBA 5DVBA 1THOA 1VF2A 1K0AA 1U3AA 1HNAA 6GSUA 1PKWA 4PUAA 5DQYA 3ZFLA 1J0FA 4KF9A 2MMNA 4HUAA 1ABAA 2G0FA 4NHZA 4DSSA 1UC7A 3FK8A 1PX6A 4EL1A 4YQVA 3C7MA 3Q74A 1ZYEA 5DAKB 3EURA 4PQIA 1FO5A 2REMA 5DBQA 3TOTA 1GNWA 4FQUA 4J57E 1U3IA 1ERUA 5A4UA 1ZYQB 1K0OA 1YY7A 1N8JA 3LORA 1JZWA 2HSYA 3E0UA 2DKIA 1QFNA 1GH2A 5ECLB 2C80A 2HRKA 2ZCTA 4IGJA 4PUFC 1ZYNA 3GL5A 4XTSA 2HI7A 1GRXA 1O7UA 5J4UA 18GSA 3R2QA 6GSYA 3MDKA 4ML1A 5D9TA 2ON5A 4A5PA 3KIJA 2FCHA 2Z9SA 1B4QA 4KSMA 3P7XA 2CQ9A 1GUMA 1GSFA 1SK0A 2P0GA 2K8VA 3PPUA 4ULXA 2B1LA 1SU9A 1JZRA 4YQMA 1A2JA 1F2EA 2FY6A 5DCHA 2J23A 1ERWA 5GZZB 1T4ZA 4KSOA 1DE1A 5CYYA 1USBA 2CVBA 2LRTA 1O6JA 3WGDA 2VL3A 4GQCA 2YPMA 4YKFA 5G31A 1WJKA 4F03A 1AC1A 1AQVA 5IOWA 2CX3A 2FUG2 4LLRA 1S3DA 4BL7A 2VLUA 1GSEA 2LS5A 1U87A 2QKEA 5HFGA 1AAZA 1J08A 4TXVA 2FWFA 4G0KA 4MNNA 3GA4A 1SJ6A 2GSQA 4ZB8A 4CHSA 2ZNMA 1XPVA 3VPQA 4YQUA 2X49A 3KP9A 3TB2A 5ELAA 2YN1A 2IIYA 1TI1A 3HHVA 4KUNA 3I6AA 4IQ1A 2VD0A 4WETA 1DBYA 1FB6A 1X5CA 1XOBA 1THXA 2DIZA 3VURA 4WR5A 2EIRA 3F0IA 4XRDA 2IWTA 2YWIA 2V6KA 2B5YA 5CRHA 5A4VA 5CP1A 2H70A 1WPIA 4IJIA 1BX9A 2H76A 2ON7A 4OCFA 3IV4A 1O8WA 3W6GA 3BOAA 4F0BA 2V32A 2NBSA 3R3EA 5GSTA 4EVMA 2V2GA 2LTKA 3QPMA 5HR1A 3C71A 3A3TA 2GSSA 2E0QA 2P5RA 4MK3A 1OAZA 5CNWA 2LJRA 3H4KA 1O81A 5EL8A 1ILOA 1ZL9A 2X8CA 2L57A 2ZUPA 3UEMA 2X64A 4XHMA 3LYPA 1SENA 1U88A 5GSSA 2LV3A 4OFTA 2H74A 4DSRA 1YKCA 4TN8A 1K3OA 4JZQA 2JACA 4BWQA 2AV4A 2K9FA 1PGTA 3FZ5A 4J56E 5ELGA 2DJ1A 1SL2B 3KD0A 5DALA 2WS2A 6GSXA 1GULA 2B6MA 5ABRA 4MF5A 2H0HA 2KOKA 2I9HA 3IAS2 1XWGA 1V58A 3JCML 5D93A 3MSZA 1R5PA 4Z2UA 2M80A 2XPEA 1KBNA 2VUPA 5LD0A 1GTAA 2GS3A 4TRXA 4AJ8A 1JLWA 2HRFA 3KH7A 1B4PA 3HCZA 2WGRA 1OC3A 4HQZA 4J2FA 2TIRA 4F82A 2X4AA 3V1WA 3GIXA 2M72A 3IHGA 1B48A 4LL1B 3H93A 4NAXA 4X1UA 2PERA 1WP0A 1Z7RA 2V41A 3FEUA 2HLSA 2KLXA 2M46A 1PRXA 2CZ2A 4AF2A 4KDXA 1GNEA 4MF6A 1TW9A 4IVFA 2LNSA 1MEKA 5HQPA 3F6DA 2R5GA 5J41A 2YZUA 5ECQB 3LJRA 3TRPA 2QA2A 2VL9A 2C0DA 1JLVA 1K0MA 3BCIA 4QQ7A 3KTLA 1CQHA 3IA1A 2LJAA 1WE0A 8GSSA 2RM6A 1TK8B 4RI7A 1KNGA 3EU3A 4PNFA 3LQ7A 4I2UA 2G2QA 3DGQA 1RQMA 5BMUA 4ZBAA 4RUVA 5B8AA 4ZL9A 5L71A 2MMOA 1R5AA 4V2LA 3GUSA 2E2GA 4EE0A 4F0CA 3EC3A 2A2PA 4TR0A 5ECKB 1T7PB 5ECIB 5AISA 3WD6A 2EIQA 1A8YA 6GSWA 4USSA 1PL2A 2DKHA 5CREA 4GLTA 3CSHA 3ERGA 4K7IA 3NOFA 3ME8A 1Q98A 2WZ9A 3OR5A 2L6CA 4NWYA 4DEJA 2I3YA 4V2NA 5JCUA 3KMNA 4MZWA 3C73A 9GSSA 1ON4A 4HU7A 3MIXA 3SWLA 5CRWA 3HZ8A 3RBTA 2JSYA 2DJ3A 4K2DA 3GYKA 2GSRA 2OBIA 1MDJA 2F8FA 3FR3A 4FIWA 3VLNA 2DJ0A 3ME7A 3ZIJA 4OMVA 2CVDA 3IK7A 2K8SA 3QAGA 4ACSA 4EXJA 4O7HA 2PN8A 2DLXA 4ZBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDE A;  3TJG A;  1TP9 A;  1SL0 B;  2PPT A;  2F3M A;  6GST A;  4ECB A;  1FB0 A;  4NV5 A;  4EDY A;  1BJX A;  2LUS A;  2C0F A;  5AIV A;  3L9S A;  4XS4 B;  4GCI A;  3BCK A;  3P2A A;  1K0B A;  2O85 A;  5F8B A;  1SKW B;  3DWV A;  2OE1 A;  2VIM A;  4HZ2 A;  4RI6 A;  2F51 A;  4OFM A;  2FHE A;  6GSV A;  1TRW A;  2H30 A;  3IDV A;  3O76 A;  3MAK A;  1ZZY A;  1M2A A;  2CAI A;  1KEB A;  3DKS A;  2O87 A;  3ZRE A;  3LXZ A;  1VF4 A;  2YWO A;  4PUR A;  4NV2 A;  3KGK A;  4Q5N A;  3QFA C;  1QUW A;  5G1K A;  1WIK A;  4HS1 A;  1LJR A;  1SD8 A;  3C1R A;  4TR3 A;  2QGV A;  4DVC A;  3VK9 A;  3IOS A;  4RQR A;  2PWJ A;  4L0W A;  2AJQ B;  3DEX A;  3EMX A;  4POB A;  5HFI A;  1M2B A;  1GUH A;  3HXS A;  4TR1 B;  4WF4 A;  5DAK A;  3CRU A;  3Q6O A;  1XW9 A;  1R26 A;  2C3T A;  3CSI A;  1PKZ A;  5ECN B;  1YEP A;  3F9U A;  1I9D A;  4I2T A;  3ZFB A;  1OVN A;  1A0F A;  3QMX A;  2KUC A;  2O89 A;  1A2M A;  4V1A g;  2PU9 C;  4JE1 A;  4JRR A;  4KCA A;  1Y6E A;  5F06 A;  2AYT A;  1QK8 A;  4L0U A;  2XPD A;  1KTE A;  5IPG A;  4I8B A;  2HNL A;  1HYU A;  4EF0 A;  1SJI A;  2IPA A;  1K0C A;  1LBK A;  4PGT A;  5G1L A;  4ECJ A;  5J5N A;  1EOG A;  2HZF A;  1GLQ A;  1QQ2 A;  1R7H A;  4POM A;  1O8X A;  2B7K A;  3PH9 A;  4OCE A;  1EGR A;  5HR3 A;  5EY6 A;  5IMV A;  3QAV A;  1GTI A;  5DJM A;  2MBS A;  1URM A;  5ECO B;  2FD3 A;  4OWY A;  5J3R A;  2MZC A;  4KB3 A;  4HEA 2;  4EKZ A;  2GQM A;  2HZE B;  1ST9 A;  5C00 A;  1OKD A;  3FW2 A;  1QGV A;  2VCQ A;  2H73 A;  4GF0 A;  2OE3 A;  1XWB A;  2MMA A;  1F3B A;  3TCO A;  2FA8 A;  4WKW A;  1BQ7 A;  2IMK A;  4NHW A;  4WBR D;  5HR0 A;  2JZS A;  5EVO A;  1XIY A;  2VAF A;  1FVK A;  5B8B A;  2DJJ A;  1BG5 A;  3QD9 A;  2CV4 A;  2C8U A;  3SBC A;  3PIN A;  1YDK A;  4ID0 A;  3RPP A;  5KN2 A;  3HKR A;  2BTO T;  2IFQ B;  4Z7X A;  4PQ1 A;  2X99 A;  1FAA A;  2WUL A;  1K0N A;  5INY A;  1HNB A;  1T1V A;  4ZIJ A;  2P5Q A;  2RUE A;  3D4M A;  3ZZX A;  4DSQ A;  5IMD A;  2B5X A;  5G5F A;  3UBK A;  1G7O A;  2JAD A;  1S3A A;  3C8E A;  3C1S A;  1PSQ A;  2CX4 A;  1PD2 1;  5G2Z A;  3P8W A;  1GLP A;  4G9H A;  2CAQ A;  4OO5 A;  2JZR A;  5CRG A;  4KDU A;  3D22 A;  3LWA A;  3M3M A;  1YQ1 A;  4PX1 A;  1TK0 B;  1M9A A;  4KGI A;  2OE0 A;  1BED A;  1Z5Y E;  3ZIV A;  3L78 A;  1V9W A;  5B6N A;  3EU4 A;  1EWX A;  2H6X A;  1TKD B;  1JFU A;  1JZD A;  3DRN A;  1HD2 A;  4POK A;  2XHF A;  4JBB A;  2ES7 A;  1J9B A;  3HVS A;  1R4W A;  2E2M A;  3GKN A;  2C0E A;  3UJ1 A;  1M0U A;  2N5A A;  2CZ3 A;  4G19 A;  3RHC A;  5AN1 A;  4JR6 A;  3IR4 A;  4GWR A;  3GV1 A;  3P90 A;  3UAR A;  2BJX A;  3FY7 A;  3IPZ A;  2RII A;  1JHB A;  3I9V 2;  3QAW A;  3GKK A;  2DC5 A;  4WXT A;  1OE7 A;  3A5W A;  1EOH A;  1NM3 A;  2AAW A;  5E4W A;  3ZML A;  3O6T A;  2H1B A;  2B3S A;  2LNT A;  1XVW A;  3F63 A;  2RLI A;  3CTF A;  1V40 A;  3VI7 A;  1M9B A;  5H5Q A;  3Q19 A;  2YZH A;  3HYP A;  1YJ6 A;  3FZA A;  4ILF A;  3HA9 A;  3BD2 A;  4HI7 A;  2IMF A;  3US3 A;  3WYW A;  2PUK C;  3KM6 A;  1DSB A;  2GZY A;  2R3X A;  2PGT A;  3GX0 A;  3DVW A;  4K1F A;  5KN1 A;  2YWM A;  3E3E A;  5GAP D;  4KND A;  1QXH A;  2I1U A;  3TJK A;  3ZVJ A;  2CT6 A;  2WJU A;  1NW2 A;  3TKS A;  2GZP A;  5FWG A;  3DIE A;  5ID2 B;  2NTO A;  1B8X A;  2HYX A;  1XXU A;  2J9H A;  2PVQ A;  4GRF A;  3FKF A;  3CXG A;  1OYJ A;  5C04 A;  4KCE A;  3HD5 A;  2C4J A;  4AGS A;  2L6D A;  3A2X A;  1V2A A;  3LXT A;  2H75 A;  4WF5 A;  2WDU A;  11GS A;  1GSD A;  2LKU A;  2VOC A;  2GQK A;  2FWH A;  3F4R A;  3H1N A;  2CVK A;  4L8E A;  2LJK A;  2H6Y A;  1EP8 A;  2VCZ A;  1X9S B;  4MMM A;  3N5O A;  3TDG A;  3J7Y b;  1YF1 A;  3TKS C;  2F8A A;  2MMZ A;  2JSZ A;  1WWJ A;  5FHI A;  1V57 A;  2OBK A;  3KEB A;  2C1Y A;  1H4O A;  2FA4 A;  16GS A;  2PBJ A;  5B6M A;  4YH2 A;  3F6F A;  3F3Q A;  1AQX A;  5H5S A;  5B7C A;  3WGX A;  2D2Z A;  2HT9 A;  3EVI A;  4MPF A;  3GL3 A;  4NPB A;  2FNO A;  4Q5R A;  5A4W A;  2VL2 A;  4JU5 A;  1O73 A;  4V1A p;  1A23 A;  2GZZ A;  2GQL A;  1TJD A;  3UMA A;  4KDY A;  3IRA A;  4IS0 A;  2H19 A;  4FYU A;  2YJH A;  3GH6 A;  2H1D A;  2JU5 A;  1PL1 A;  1XW6 A;  3FZ9 A;  1VRS D;  5DJL A;  19GS A;  2RM5 A;  2B7J A;  12GS A;  3IBH A;  4I97 A;  1ZGN A;  4QL7 A;  2PVO C;  4XS4 A;  3D0Z A;  4LMW A;  6GSS A;  4MJB A;  1GP1 A;  4MZC A;  2H0G A;  1IYH A;  5J9B A;  2VL2 C;  3VWW A;  2H6Z A;  3PR8 A;  4NXI A;  4ML6 A;  2AHE A;  2K18 A;  2O8V B;  4MAB A;  1O85 A;  3GTU B;  2XC2 A;  1E6B A;  3EYT A;  1W89 A;  3HJO A;  2XBI A;  5D8I A;  3TJB A;  1EP7 A;  1YZX A;  3GX8 A;  1GTU A;  2VO4 A;  4RQX A;  3UVH A;  2ALB A;  22GS A;  1Z9H A;  4HZ4 A;  1UN2 A;  4BVX A;  4TR1 A;  4CW9 A;  2E7P A;  1JZO A;  3QCP A;  3VI5 A;  3ZTL A;  5JCG A;  3NZN A;  4LA1 A;  3F4T A;  1ACV A;  1XW5 A;  1XWK A;  3EIN A;  2GVP A;  2YNX A;  1T8E B;  2V1M A;  4TXO B;  1G6Y A;  2GLR A;  2MBT A;  4KAE A;  4Q5Q A;  4E8H A;  4HJ2 A;  1GSY A;  1K3Y A;  4AJ7 A;  4ZBB A;  4MLY A;  2VCX A;  3EE2 A;  2L4C A;  3ERF A;  1Y25 A;  4EO3 A;  2A2R A;  4K8M A;  3M1G A;  1WOU A;  1LU4 A;  4MPG A;  1GSU A;  4GTU A;  2OKA A;  2H1G A;  1XOA A;  3GNJ A;  1U6T A;  1HNC A;  10GS A;  1PX7 A;  3N9J A;  3HVX A;  1OC9 B;  2GGT A;  4KW6 A;  5G30 A;  4ECC A;  1W4V A;  3ERW A;  1B9X C;  1G0T A;  1N2A A;  2JZT A;  5D73 A;  2TRX A;  4EC0 A;  4D73 B;  2HZE A;  1SK2 A;  3FZ4 A;  3ZL5 A;  1OC8 A;  2FWE A;  3BJ5 A;  3L0H A;  2VM2 A;  4V2M A;  4ECI A;  2A2S A;  3ZVJ D;  5J9C A;  3A2W A;  1A8L A;  2R2J A;  4ZL7 A;  4MF7 A;  5KEJ A;  2H71 A;  2VLV A;  4KA0 A;  2VCT A;  3GN3 A;  4N0V A;  1QMV A;  2LST A;  1EEJ A;  4GST A;  5DCG A;  5G5E A;  5IM9 A;  2IFQ A;  1BAY A;  3GHA A;  2DJK A;  4LMV A;  3AY8 A;  4FH8 A;  1TOF A;  5D96 A;  2YWN A;  3GMF A;  4P3Y B;  1TRS A;  1XFL A;  3VWX A;  4N11 A;  3M8N A;  3EWL A;  5IQY A;  4KH7 A;  3HJM A;  4K6X A;  2CA8 A;  1EV4 A;  4MZB A;  3H79 A;  4BA7 A;  2KP1 A;  2LQQ A;  2AB6 A;  5IIZ A;  4K7O A;  4O5R A;  4FO5 A;  1E2Y A;  3UIW A;  3QFB C;  1XVQ A;  2HXK A;  4ZB6 A;  3TOU A;  1SK1 A;  3VPT A;  5IMC A;  4N0Z A;  3GSS A;  5DDL A;  3LFL A;  1NHY A;  2DSA A;  3IXR A;  3VFI A;  1CQG A;  1X5E A;  1Z7P A;  5IPH A;  3G9B A;  3F8U A;  3ISO A;  2GT6 A;  2B5E A;  1TXX A;  2HFD A;  2VD1 A;  3GRX A;  2L5L A;  1BYE A;  1V98 A;  1X0R A;  4BWS A;  2GT5 A;  3I43 A;  4WEY A;  3FYG A;  3PGT A;  5AGY A;  4I5Q A;  2N5F A;  4ISD A;  3FHK A;  3M9K A;  1GUK A;  4XRA A;  1ERT A;  1ML6 A;  3D4T A;  4IHU A;  1F9M A;  3KXO A;  4BPY A;  1IYI A;  1I5G A;  2I4A A;  2IL3 A;  4HOJ A;  2YAN A;  3TUE A;  4GSS A;  3CTG A;  4TKY A;  2WFC A;  2YJ7 A;  3KZQ A;  4OFN A;  3KH9 A;  5D9X A;  1C72 A;  4MJE A;  3WGE A;  1VF1 A;  3RAZ A;  2GTU A;  4JED A;  4TOP A;  4G10 A;  4DSS B;  2IMD A;  3TJJ A;  5LNK e;  5F07 A;  2GDR A;  1M2D A;  1T4Y A;  4QL9 A;  3ZLP A;  4E8E A;  1RK4 A;  2K6V A;  3APQ A;  3J7Y k;  3TJF A;  2GST A;  3GFK A;  1PMT A;  1Q4J A;  3ZIT A;  4MP4 A;  3LEF A;  1ZMA A;  4O32 A;  2HRN A;  1S3C A;  1FVJ A;  4IJ3 A;  4N30 A;  3TKQ A;  3KP8 A;  4EDZ A;  2LRC A;  3E9J B;  3MNG A;  2L5O A;  2LQO A;  4AJ6 A;  3FR9 A;  4WBJ A;  4MA9 A;  1K0D A;  2H66 A;  5ECH B;  4TW5 A;  2A4V A;  3HZ4 A;  4K9Z A;  1SL1 B;  2VCW A;  1AXD A;  2NDO A;  5ID2 A;  1T3B A;  2PMT A;  3CRT A;  4KX4 A;  4CDO A;  4JR4 A;  3M9J A;  2OA7 A;  20GS A;  3G7J A;  3KJY A;  2YOI A;  1YKA A;  1ERV A;  3D21 A;  5F0G A;  4IN0 A;  4XCS A;  1XWC A;  2VM1 A;  3KTB A;  2H0I A;  5CRD A;  1WMJ A;  1K3L A;  2RUF A;  3ZYW A;  5IO0 A;  3VWU A;  2XBQ A;  3ZRD A;  1TK5 B;  3ED3 A;  13GS A;  2F9S A;  4BVY A;  3GH9 A;  1WRY A;  2YV7 A;  2O7K A;  5H5R A;  1GSS A;  5IMA A;  5LCZ A;  4L5O A;  3GUR A;  4O92 A;  2X8G A;  1XBS A;  4HQS A;  2IJY A;  4TR4 A;  1Z3E A;  1A2L A;  5JWQ B;  1FOV A;  4XIH A;  2R6K A;  1B9Y C;  3D6I A;  3DXB A;  5DQS A;  4ZXG A;  1EGO A;  4MJC A;  4IEL A;  3VWV A;  2EIO A;  3HDC A;  2IME A;  4FYC A;  4XS1 A;  5HR2 A;  5ECM B;  3GKM A;  3HJP A;  5FT3 A;  1DUG A;  1F3A A;  3TRQ A;  1F37 A;  5A5K A;  3UL3 A;  2WB9 A;  1AIU A;  3CBU A;  1NHO A;  2I81 A;  4TVE A;  3CYN A;  1FHE A;  1MTC A;  4MCU A;  1TU8 A;  3L9U A;  4MH2 A;  2C0G A;  3TKP A;  3LG6 A;  4WR4 A;  4K0G A;  2B1K A;  1TRU A;  2OJL A;  2P31 A;  1YEX A;  1G7E A;  1F6M C;  3W8S A;  2VLT A;  4IW9 A;  1XWA A;  2IN3 A;  2HE3 A;  1SYX A;  1MDI A;  2YCD A;  2C3N A;  4IP1 A;  1SKS B;  3U6V A;  2JL4 A;  3GST A;  4ZB9 A;  4OD7 A;  3LGC A;  5JWR B;  5IMZ A;  3DYR A;  1OKT A;  2KHP A;  2MYG A;  4IKH A;  3S9F A;  2OAD A;  4GQF A;  2HSH A;  4MDC A;  4H86 A;  1FW1 A;  1XCC A;  4LL4 B;  1Z6M A;  1TU7 A;  5IOX A;  1SJZ A;  3EMP A;  4PNG A;  3RDW A;  3F3R A;  2LRN A;  5IO2 A;  4GXZ A;  4F9Z A;  3GTU A;  1MD4 A;  5DAL B;  2V6O A;  5KN0 A;  5EPF A;  1FG4 A;  4ZL8 A;  1GSQ A;  4ZIL A;  1X5D A;  5GAN D;  7GSS A;  3CMI A;  3GKX A;  1EZK A;  1G6W A;  2FGX A;  3W8J A;  3RPN A;  5IMF A;  2QC7 A;  5ECR B;  4IP6 A;  4NMU A;  2H1A A;  1ZOF A;  3LYK A;  5JCW A;  3KCM A;  2YV9 A;  4EUY A;  2L4Q A;  5E59 A;  1OE8 A;  3F4S A;  2H01 A;  3D5J A;  3IHQ A;  4POL A;  3TRX A;  5JWO B;  4TXO A;  3FR6 A;  4IQA A;  1VGL A;  4L5L A;  4N10 A;  1M99 A;  1XZO A;  1X9W B;  3M0F A;  4YAP A;  3UAP A;  4F2I A;  3K8N A;  1ZCP A;  1NSW A;  2QSI A;  2H8L A;  1TTZ A;  2BMX A;  4K7N A;  3LSZ A;  3U5R E;  1GTB A;  2NVL A;  3APO A;  3KMO A;  2WCI A;  3QDN A;  1PN9 A;  1SD9 A;  5COH A;  3IK9 A;  2R4V A;  3UOM A;  3IAM 2;  1OC9 A;  2EC4 A;  2WRT A;  3IC4 A;  2FLS A;  5D9V A;  1EV9 A;  2R37 A;  3HY2 A;  1X9M B;  5D9W A;  4D73 A;  4FYB A;  2VCV A;  3CSJ A;  3WT1 A;  1TI3 A;  3DML A;  2OAC A;  2X8H A;  1GL8 A;  1YF0 A;  3APS A;  3G7Y A;  2IMI A;  2AUV A;  4PQH A;  4YAV A;  1MD3 A;  4OO4 A;  1HQO A;  1RW1 A;  1Z6N A;  3A2V A;  1AQW A;  3Q18 A;  5CO3 A;  2TRC P;  3I69 A;  1SKR B;  1VF3 A;  1DE2 A;  1T00 A;  4G2E A;  3L4N A;  3MWH A;  2DBC A;  2DMM A;  14GS A;  4GSN A;  3UVT A;  4HJM A;  2KP2 A;  5ECS A;  4XS6 A;  1AW9 A;  1PA3 A;  3IE3 A;  1PQN A;  2LEG A;  1GWC A;  3NIV A;  2DML A;  3ZMK A;  3DVX A;  2FWG A;  1A24 A;  17GS A;  3QOU A;  3UBL A;  4MJA A;  3O3T A;  3WT2 A;  3FRC A;  4X43 A;  2DJ2 A;  4HU9 A;  3TKS E;  1UA5 A;  4X0X A;  4K0N A;  4MH3 A;  3TGZ A;  4IBP A;  4Q5F A;  3L9V A;  1EEM A;  5F05 A;  5AIX A;  2DIY A;  5CAX A;  3HVV A;  5KN3 A;  5ENU A;  3QR6 A;  3H8Q A;  1MDK A;  1TDI A;  3BBY A;  2C3Q A;  1SYR A;  3DD3 A;  3RHB A;  3TKR A;  1TRV A;  2L59 A;  5HFK A;  1M7T A;  1UVZ A;  4KE3 A;  1H75 A;  4PXO A;  2H72 A;  5ECP B;  2YP6 A;  1AUC A;  1A0R P;  3G7I A;  4I6X A;  2N5B A;  2NPB A;  5DVB A;  1THO A;  1VF2 A;  1K0A A;  1U3A A;  1HNA A;  6GSU A;  1PKW A;  4PUA A;  5DQY A;  3ZFL A;  1J0F A;  2MMN A;  4HUA A;  1ABA A;  2G0F A;  4NHZ A;  4DSS A;  1UC7 A;  3FK8 A;  1PX6 A;  4EL1 A;  4YQV A;  3C7M A;  3Q74 A;  1ZYE A;  5DAK B;  3EUR A;  4PQI A;  1FO5 A;  2REM A;  5DBQ A;  3TOT A;  1GNW A;  4J57 E;  1U3I A;  1ERU A;  5A4U A;  1ZYQ B;  1K0O A;  1YY7 A;  1N8J A;  3LOR A;  1JZW A;  2HSY A;  3E0U A;  1QFN A;  1GH2 A;  5ECL B;  2C80 A;  2ZCT A;  4IGJ A;  4PUF C;  3GL5 A;  4XTS A;  2HI7 A;  1GRX A;  1O7U A;  5J4U A;  18GS A;  3R2Q A;  6GSY A;  3MDK A;  4ML1 A;  5D9T A;  2ON5 A;  3KIJ A;  2FCH A;  2Z9S A;  1B4Q A;  4KSM A;  3P7X A;  2CQ9 A;  1GUM A;  1GSF A;  1SK0 A;  2P0G A;  2K8V A;  4ULX A;  2B1L A;  1SU9 A;  1JZR A;  4YQM A;  1A2J A;  1F2E A;  2FY6 A;  5DCH A;  2J23 A;  1ERW A;  5GZZ B;  1T4Z A;  4KSO A;  1DE1 A;  5CYY A;  1USB A;  2CVB A;  2LRT A;  1O6J A;  3WGD A;  2VL3 A;  4GQC A;  2YPM A;  5G31 A;  1WJK A;  4F03 A;  1AC1 A;  1AQV A;  5IOW A;  2CX3 A;  2FUG 2;  4LLR A;  1S3D A;  4BL7 A;  2VLU A;  1GSE A;  2LS5 A;  1U87 A;  2QKE A;  5HFG A;  1AAZ A;  1J08 A;  4TXV A;  2FWF A;  3GA4 A;  1SJ6 A;  2GSQ A;  4ZB8 A;  4CHS A;  2ZNM A;  1XPV A;  3VPQ A;  4YQU A;  3KP9 A;  3TB2 A;  5ELA A;  2YN1 A;  2IIY A;  1TI1 A;  3HHV A;  4KUN A;  3I6A A;  4IQ1 A;  2VD0 A;  4WET A;  1DBY A;  1FB6 A;  1X5C A;  1XOB A;  1THX A;  2DIZ A;  3VUR A;  4WR5 A;  2EIR A;  3F0I A;  4XRD A;  2IWT A;  2YWI A;  2V6K A;  2B5Y A;  5CRH A;  5A4V A;  5CP1 A;  2H70 A;  1WPI A;  4IJI A;  1BX9 A;  2H76 A;  2ON7 A;  4OCF A;  3IV4 A;  1O8W A;  3W6G A;  3BOA A;  4F0B A;  2V32 A;  2NBS A;  5GST A;  4EVM A;  2V2G A;  2LTK A;  3QPM A;  5HR1 A;  3C71 A;  3A3T A;  2GSS A;  2E0Q A;  2P5R A;  4MK3 A;  1OAZ A;  5CNW A;  2LJR A;  3H4K A;  1O81 A;  5EL8 A;  1ILO A;  1ZL9 A;  2X8C A;  2L57 A;  2ZUP A;  3UEM A;  2X64 A;  4XHM A;  3LYP A;  1SEN A;  1U88 A;  5GSS A;  2LV3 A;  4OFT A;  2H74 A;  4DSR A;  1YKC A;  4TN8 A;  1K3O A;  4JZQ A;  2JAC A;  4BWQ A;  2AV4 A;  2K9F A;  1PGT A;  3FZ5 A;  4J56 E;  5ELG A;  2DJ1 A;  1SL2 B;  3KD0 A;  5DAL A;  2WS2 A;  6GSX A;  1GUL A;  2B6M A;  5ABR A;  4MF5 A;  2H0H A;  2KOK A;  2I9H A;  3IAS 2;  1XWG A;  1V58 A;  3JCM L;  5D93 A;  3MSZ A;  1R5P A;  2M80 A;  2XPE A;  1KBN A;  2VUP A;  5LD0 A;  1GTA A;  2GS3 A;  4TRX A;  4AJ8 A;  1JLW A;  2HRF A;  3KH7 A;  1B4P A;  3HCZ A;  2WGR A;  1OC3 A;  4HQZ A;  4J2F A;  2TIR A;  4F82 A;  3V1W A;  3GIX A;  2M72 A;  1B48 A;  4LL1 B;  3H93 A;  4NAX A;  4X1U A;  2PER A;  1WP0 A;  1Z7R A;  2V41 A;  3FEU A;  2HLS A;  2KLX A;  2M46 A;  1PRX A;  2CZ2 A;  4AF2 A;  4KDX A;  1GNE A;  4MF6 A;  1TW9 A;  4IVF A;  2LNS A;  1MEK A;  5HQP A;  3F6D A;  2R5G A;  5J41 A;  2YZU A;  5ECQ B;  3LJR A;  3TRP A;  2VL9 A;  2C0D A;  1JLV A;  1K0M A;  3BCI A;  4QQ7 A;  3KTL A;  1CQH A;  3IA1 A;  2LJA A;  1WE0 A;  8GSS A;  2RM6 A;  1TK8 B;  1KNG A;  4PNF A;  3EU3 A;  4RI7 A;  3LQ7 A;  4I2U A;  2G2Q A;  3DGQ A;  1RQM A;  4ZBA A;  4RUV A;  5B8A A;  4ZL9 A;  5L71 A;  2MMO A;  1R5A A;  4V2L A;  3GUS A;  2E2G A;  4EE0 A;  4F0C A;  3EC3 A;  4TR0 A;  5ECK B;  1T7P B;  5ECI B;  5AIS A;  3WD6 A;  2EIQ A;  1A8Y A;  6GSW A;  1PL2 A;  5CRE A;  4GLT A;  3CSH A;  3ERG A;  4K7I A;  3NOF A;  3ME8 A;  1Q98 A;  2WZ9 A;  3OR5 A;  2L6C A;  4NWY A;  4DEJ A;  2I3Y A;  4V2N A;  5JCU A;  3KMN A;  4MZW A;  3C73 A;  9GSS A;  1ON4 A;  4HU7 A;  3SWL A;  5CRW A;  3HZ8 A;  3RBT A;  2JSY A;  2DJ3 A;  4K2D A;  3GYK A;  2GSR A;  2OBI A;  1MDJ A;  2F8F A;  3FR3 A;  4FIW A;  3VLN A;  2DJ0 A;  3ME7 A;  3ZIJ A;  4OMV A;  2CVD A;  3IK7 A;  2K8S A;  3QAG A;  4ACS A;  4EXJ A;  4O7H A;  2PN8 A;  2DLX A;  4ZBD A; 
#chains in the Genus database with same CATH topology
 4HDE A;  3TJG A;  1TP9 A;  1SL0 B;  2PPT A;  2F3M A;  6GST A;  4ECB A;  4ICY A;  1FB0 A;  4NV5 A;  4EDY A;  1BJX A;  2LUS A;  2C0F A;  5AIV A;  3L9S A;  4G0L A;  4XS4 B;  4GCI A;  3BCK A;  3P2A A;  1K0B A;  2O85 A;  5F8B A;  1SKW B;  3DWV A;  2OE1 A;  2VIM A;  4HZ2 A;  4RI6 A;  2F51 A;  4OFM A;  2FHE A;  6GSV A;  1TRW A;  2H30 A;  3IDV A;  3O76 A;  3MAK A;  1ZZY A;  1M2A A;  2CAI A;  1KEB A;  3DKS A;  2O87 A;  3ZRE A;  3LXZ A;  1VF4 A;  2YWO A;  4PUR A;  4NV2 A;  3KGK A;  4Q5N A;  3QFA C;  1QUW A;  5G1K A;  1WIK A;  4HS1 A;  1LJR A;  1SD8 A;  3C1R A;  4TR3 A;  2QGV A;  4O5U A;  4DVC A;  3VK9 A;  3IOS A;  4RQR A;  2PWJ A;  1M3J A;  4L0W A;  2AJQ B;  3DEX A;  4EIP A;  3EMX A;  4POB A;  5HFI A;  1M2B A;  1GUH A;  4BVX B;  3HXS A;  4TR1 B;  4WF4 A;  5DAK A;  3CRU A;  3Q6O A;  1XW9 A;  1R26 A;  2C3T A;  3CSI A;  1PKZ A;  5ECN B;  1YEP A;  3F9U A;  1I9D A;  4I2T A;  3ZFB A;  1OVN A;  1A0F A;  3MYD A;  3QMX A;  2KUC A;  1M3I A;  2O89 A;  1A2M A;  4V1A g;  2PU9 C;  4JE1 A;  4JRR A;  4KCA A;  1Y6E A;  5F06 A;  2AYT A;  1QK8 A;  4L0U A;  2XPD A;  1KTE A;  5IPG A;  4I8B A;  2HNL A;  1HYU A;  4EF0 A;  1SJI A;  2IPA A;  1K0C A;  1LBK A;  4PGT A;  5G1L A;  4ECJ A;  5J5N A;  1EOG A;  2HZF A;  1GLQ A;  1QQ2 A;  1R7H A;  4POM A;  1O8X A;  2B7K A;  3PH9 A;  4OCE A;  1EGR A;  5HR3 A;  5EY6 A;  5IMV A;  3QAV A;  1GTI A;  5DJM A;  2MBS A;  1URM A;  5ECO B;  2FD3 A;  4OWY A;  5J3R A;  2MZC A;  4KB3 A;  4HEA 2;  4EKZ A;  2GQM A;  2HZE B;  1ST9 A;  5C00 A;  1OKD A;  3FW2 A;  1QGV A;  2VCQ A;  2H73 A;  4GF0 A;  2OE3 A;  1XWB A;  2MMA A;  1F3B A;  3TCO A;  2FA8 A;  4WKW A;  1BQ7 A;  2IMK A;  4NHW A;  4BIK A;  4WBR D;  5HR0 A;  2JZS A;  5EVO A;  1XIY A;  2VAF A;  1FVK A;  5B8B A;  2DJJ A;  1BG5 A;  3QD9 A;  2CV4 A;  2C8U A;  2UZ8 A;  3SBC A;  3PIN A;  1YDK A;  4ID0 A;  3RPP A;  5KN2 A;  3HKR A;  2BTO T;  2IFQ B;  4Z7X A;  4PQ1 A;  2X99 A;  1FAA A;  2WUL A;  1K0N A;  3LW9 A;  5INY A;  1HNB A;  1T1V A;  4ZIJ A;  2P5Q A;  2RUE A;  4CY6 A;  3D4M A;  4G0I A;  3ZZX A;  4DSQ A;  5IMD A;  2B5X A;  5G5F A;  3UBK A;  1G7O A;  2JAD A;  1S3A A;  3C8E A;  3C1S A;  1PSQ A;  2CX4 A;  1PD2 1;  5G2Z A;  3P8W A;  1GLP A;  4G9H A;  2CAQ A;  1PN0 A;  4OO5 A;  2JZR A;  5CRG A;  4KDU A;  3D22 A;  3LWA A;  3M3M A;  1YQ1 A;  4PX1 A;  1TK0 B;  1M9A A;  4KGI A;  2OE0 A;  1BED A;  1Z5Y E;  3ZIV A;  3L78 A;  1V9W A;  5B6N A;  3EU4 A;  1EWX A;  2H6X A;  2A4H A;  1TKD B;  1JFU A;  1JZD A;  3DRN A;  1HD2 A;  4POK A;  2XHF A;  4JBB A;  2ES7 A;  1J9B A;  3HVS A;  1R4W A;  2E2M A;  3GKN A;  2C0E A;  3UJ1 A;  1M0U A;  2N5A A;  2CZ3 A;  4G19 A;  3RHC A;  5AN1 A;  4JR6 A;  3IR4 A;  4GWR A;  3GV1 A;  3P90 A;  3UAR A;  2BJX A;  3FY7 A;  3IPZ A;  2RII A;  1JHB A;  3I9V 2;  3QAW A;  3GKK A;  2DC5 A;  4WXT A;  1OE7 A;  2HSM A;  3A5W A;  1EOH A;  1NM3 A;  2AAW A;  5E4W A;  3ZML A;  3O6T A;  2H1B A;  2B3S A;  2LNT A;  1XVW A;  3F63 A;  2RLI A;  3CTF A;  1V40 A;  3VI7 A;  1M9B A;  5H5Q A;  3Q19 A;  2YZH A;  3HYP A;  1YJ6 A;  3FZA A;  4ILF A;  3HA9 A;  3BD2 A;  4HI7 A;  2IMF A;  3US3 A;  3WYW A;  2PUK C;  3KM6 A;  1DSB A;  2GZY A;  2R3X A;  2PGT A;  3GX0 A;  3DVW A;  4K1F A;  5KN1 A;  2YWM A;  5BRT A;  3E3E A;  5GAP D;  4KND A;  1QXH A;  2I1U A;  3TJK A;  3ZVJ A;  2CT6 A;  2WJU A;  1NW2 A;  3TKS A;  2GZP A;  5FWG A;  3DIE A;  5ID2 B;  2NTO A;  1B8X A;  2HYX A;  1XXU A;  2J9H A;  2PVQ A;  4GRF A;  3FKF A;  3CXG A;  1OYJ A;  5C04 A;  4KCE A;  3HD5 A;  2C4J A;  4AGS A;  2L6D A;  3A2X A;  1V2A A;  3LXT A;  2H75 A;  4WF5 A;  2WDU A;  11GS A;  4YKG A;  1GSD A;  2LKU A;  2VOC A;  2GQK A;  2FWH A;  3F4R A;  3H1N A;  2CVK A;  4L8E A;  2LJK A;  2H6Y A;  4BVY B;  1EP8 A;  2VCZ A;  1X9S B;  4MMM A;  3N5O A;  3TDG A;  3J7Y b;  1YF1 A;  3TKS C;  2F8A A;  2MMZ A;  2JSZ A;  1WWJ A;  5FHI A;  1V57 A;  2OBK A;  3KEB A;  2C1Y A;  1H4O A;  2FA4 A;  16GS A;  2PBJ A;  5B6M A;  4YH2 A;  3F6F A;  3F3Q A;  1AQX A;  5H5S A;  5B7C A;  3WGX A;  2D2Z A;  2HT9 A;  3EVI A;  4MPF A;  3GL3 A;  4NPB A;  2FNO A;  4Q5R A;  5A4W A;  2VL2 A;  4JU5 A;  1O73 A;  4V1A p;  1A23 A;  2GZZ A;  2GQL A;  1TJD A;  3UMA A;  4KDY A;  3IRA A;  4IS0 A;  2H19 A;  4FYU A;  2YJH A;  3GH6 A;  4Z2R A;  2H1D A;  2JU5 A;  1PL1 A;  1XW6 A;  3FZ9 A;  1VRS D;  5DJL A;  19GS A;  2RM5 A;  2B7J A;  12GS A;  3IBH A;  4I97 A;  1ZGN A;  4QL7 A;  2PVO C;  4XS4 A;  3D0Z A;  4LMW A;  6GSS A;  4MJB A;  1GP1 A;  4MZC A;  2H0G A;  1IYH A;  5J9B A;  2VL2 C;  3VWW A;  2H6Z A;  3PR8 A;  4NXI A;  4ML6 A;  2AHE A;  2K18 A;  2O8V B;  4MAB A;  1O85 A;  3GTU B;  2XC2 A;  1E6B A;  3EYT A;  1W89 A;  3HJO A;  2XBI A;  5D8I A;  3TJB A;  1EP7 A;  1YZX A;  3GX8 A;  1GTU A;  2VO4 A;  4RQX A;  3UVH A;  2ALB A;  22GS A;  1Z9H A;  4HZ4 A;  1UN2 A;  4BVX A;  4TR1 A;  4CW9 A;  2E7P A;  1JZO A;  3QCP A;  3VI5 A;  3ZTL A;  5JCG A;  3NZN A;  4LA1 A;  3F4T A;  1ACV A;  1ZYP A;  1XW5 A;  1XWK A;  3EIN A;  2GVP A;  2YNX A;  1T8E B;  2R0P A;  2V1M A;  4TXO B;  1G6Y A;  2GLR A;  1FOH A;  2MBT A;  4KAE A;  4Q5Q A;  4E8H A;  4HJ2 A;  1GSY A;  1K3Y A;  4AJ7 A;  4ZBB A;  4MLY A;  2VCX A;  3EE2 A;  2L4C A;  3ERF A;  1Y25 A;  4EO3 A;  2A2R A;  4K8M A;  3M1G A;  1WOU A;  1LU4 A;  4MPG A;  1GSU A;  4GTU A;  2OKA A;  2H1G A;  1XOA A;  3GNJ A;  1U6T A;  1HNC A;  10GS A;  1S3R A;  1PX7 A;  3N9J A;  3HVX A;  1OC9 B;  2GGT A;  4KW6 A;  5G30 A;  4ECC A;  1W4V A;  3ERW A;  1B9X C;  1G0T A;  1N2A A;  2JZT A;  5D73 A;  2TRX A;  4EC0 A;  4D73 B;  2HZE A;  1SK2 A;  3FZ4 A;  4O5Q A;  3ZL5 A;  5KOW A;  1OC8 A;  2FWE A;  3BJ5 A;  3L0H A;  2VM2 A;  4V2M A;  4ECI A;  2A2S A;  3ZVJ D;  5J9C A;  3A2W A;  1A8L A;  2R2J A;  4ZL7 A;  4MF7 A;  5KEJ A;  2H71 A;  4X4J A;  2VLV A;  4KA0 A;  2VCT A;  3GN3 A;  4N0V A;  1QMV A;  2LST A;  1EEJ A;  4GST A;  5DCG A;  5G5E A;  5IM9 A;  2IFQ A;  1BAY A;  3GHA A;  2DJK A;  4LMV A;  3AY8 A;  4FH8 A;  1TOF A;  5D96 A;  2YWN A;  3GMF A;  4P3Y B;  1TRS A;  1XFL A;  3VWX A;  4N11 A;  3M8N A;  3EWL A;  5IQY A;  4KH7 A;  3HJM A;  4K6X A;  2CA8 A;  1EV4 A;  4MZB A;  3H79 A;  4BA7 A;  2KP1 A;  2LQQ A;  2AB6 A;  5IIZ A;  4K7O A;  4O5R A;  4FO5 A;  1E2Y A;  3UIW A;  3QFB C;  1XVQ A;  2HXK A;  4ZB6 A;  3TOU A;  1SK1 A;  3VPT A;  4PTS A;  5IMC A;  4N0Z A;  3GSS A;  5DDL A;  3LFL A;  1NHY A;  2DSA A;  3IXR A;  3VFI A;  1CQG A;  1X5E A;  1Z7P A;  5IPH A;  3G9B A;  3F8U A;  3ISO A;  2GT6 A;  2B5E A;  1TXX A;  2HFD A;  2VD1 A;  3GRX A;  2L5L A;  1BYE A;  1V98 A;  1X0R A;  4BWS A;  2GT5 A;  3I43 A;  4WEY A;  3FYG A;  3PGT A;  5AGY A;  4I5Q A;  2N5F A;  4ISD A;  3FHK A;  3M9K A;  1GUK A;  4XRA A;  1ERT A;  1ML6 A;  3D4T A;  4IHU A;  1F9M A;  3KXO A;  4BPY A;  1IYI A;  1I5G A;  2I4A A;  2IL3 A;  4HOJ A;  2YAN A;  3TUE A;  4GSS A;  3CTG A;  4TKY A;  2QA1 A;  2WFC A;  2YJ7 A;  3KZQ A;  4OFN A;  3KH9 A;  5D9X A;  1C72 A;  4MJE A;  3WGE A;  1VF1 A;  3RAZ A;  2GTU A;  4JED A;  4TOP A;  4G10 A;  4DSS B;  2IMD A;  3TJJ A;  5LNK e;  5F07 A;  2GDR A;  1M2D A;  4EIQ A;  1T4Y A;  4QL9 A;  3ZLP A;  4E8E A;  3A5I A;  1RK4 A;  2K6V A;  3APQ A;  3J7Y k;  3TJF A;  2GST A;  3GFK A;  1PMT A;  1Q4J A;  3ZIT A;  4MP4 A;  3LEF A;  1ZMA A;  2R0G A;  4O32 A;  2HRN A;  1S3C A;  1FVJ A;  4IJ3 A;  4N30 A;  3TKQ A;  3KP8 A;  4EDZ A;  2LRC A;  3E9J B;  3MNG A;  2L5O A;  2LQO A;  4AJ6 A;  3FR9 A;  4WBJ A;  4MA9 A;  1K0D A;  2H66 A;  5ECH B;  4TW5 A;  2A4V A;  3HZ4 A;  4K9Z A;  1SL1 B;  2VCW A;  1AXD A;  2NDO A;  5ID2 A;  1T3B A;  2PMT A;  3IC8 A;  3CRT A;  4KX4 A;  4CDO A;  4JR4 A;  3M9J A;  2OA7 A;  20GS A;  3G7J A;  3KJY A;  3EPT A;  2YOI A;  1YKA A;  1ERV A;  3D21 A;  5F0G A;  4IN0 A;  4XCS A;  1XWC A;  2VM1 A;  3KTB A;  4HSC X;  2H0I A;  5CRD A;  1WMJ A;  1K3L A;  2RUF A;  3ZYW A;  5IO0 A;  3VWU A;  2XBQ A;  3ZRD A;  1TK5 B;  3ED3 A;  13GS A;  2F9S A;  4BVY A;  3GH9 A;  1WRY A;  2YV7 A;  2O7K A;  5H5R A;  1GSS A;  5IMA A;  5LCZ A;  4L5O A;  3GUR A;  4O92 A;  2X8G A;  1XBS A;  4HQS A;  2IJY A;  4TR4 A;  1Z3E A;  1A2L A;  5JWQ B;  1FOV A;  4XIH A;  4BL7 B;  2R6K A;  1B9Y C;  3D6I A;  3DXB A;  5DQS A;  4ZXG A;  1EGO A;  4MJC A;  4IEL A;  3VWV A;  2EIO A;  3HDC A;  2IME A;  4FYC A;  4XS1 A;  5HR2 A;  5ECM B;  3GKM A;  3HJP A;  5FT3 A;  1DUG A;  1F3A A;  3TRQ A;  1F37 A;  5A5K A;  3UL3 A;  2WB9 A;  1AIU A;  3CBU A;  1NHO A;  4K5S A;  2I81 A;  4TVE A;  3CYN A;  1FHE A;  1MTC A;  4MCU A;  4CY8 A;  1TU8 A;  3L9U A;  4MH2 A;  2C0G A;  3TKP A;  3LG6 A;  4WR4 A;  4K0G A;  2B1K A;  1TRU A;  2OJL A;  2P31 A;  1YEX A;  1G7E A;  1F6M C;  5KOX A;  3W8S A;  2VLT A;  4IW9 A;  1PFO A;  1XWA A;  2IN3 A;  2HE3 A;  1SYX A;  1MDI A;  2YCD A;  2C3N A;  4IP1 A;  1SKS B;  3U6V A;  4Z2T A;  2JL4 A;  3GST A;  4ZB9 A;  4OD7 A;  3LGC A;  5JWR B;  5IMZ A;  3DYR A;  1OKT A;  2KHP A;  2MYG A;  4IKH A;  3S9F A;  2OAD A;  4GQF A;  2HSH A;  4MDC A;  4H86 A;  1FW1 A;  1XCC A;  4LL4 B;  1Z6M A;  1TU7 A;  5IOX A;  1SJZ A;  3EMP A;  4PNG A;  3RDW A;  3F3R A;  2LRN A;  5IO2 A;  4GXZ A;  4F9Z A;  3GTU A;  1MD4 A;  5DAL B;  2V6O A;  5KN0 A;  5EPF A;  1FG4 A;  4ZL8 A;  1GSQ A;  4ZIL A;  1X5D A;  5GAN D;  7GSS A;  3CMI A;  3GKX A;  1EZK A;  1G6W A;  2FGX A;  3W8J A;  3RPN A;  5IMF A;  2QC7 A;  5ECR B;  4IP6 A;  4NMU A;  4K2X A;  2H1A A;  1ZOF A;  3LYK A;  5JCW A;  3KCM A;  2YV9 A;  4EUY A;  2L4Q A;  5E59 A;  1OE8 A;  3F4S A;  2H01 A;  3D5J A;  3IHQ A;  4POL A;  3TRX A;  5JWO B;  4TXO A;  3FR6 A;  4IQA A;  1VGL A;  4L5L A;  4N10 A;  1M99 A;  1XZO A;  1X9W B;  3M0F A;  4YAP A;  3UAP A;  4F2I A;  3K8N A;  1ZCP A;  1NSW A;  2QSI A;  2H8L A;  1TTZ A;  2BMX A;  3CQF A;  4K7N A;  3LSZ A;  3U5R E;  1GTB A;  2NVL A;  3APO A;  3KMO A;  2WCI A;  3QDN A;  1PN9 A;  1SD9 A;  5COH A;  3IK9 A;  2R4V A;  3UOM A;  3IAM 2;  1OC9 A;  2EC4 A;  2WRT A;  3IC4 A;  2FLS A;  5D9V A;  1EV9 A;  2R37 A;  3HY2 A;  1X9M B;  5D9W A;  4D73 A;  4FYB A;  2VCV A;  3CSJ A;  3WT1 A;  1TI3 A;  3DML A;  2OAC A;  2X8H A;  1GL8 A;  1YF0 A;  3APS A;  3G7Y A;  2IMI A;  2AUV A;  4PQH A;  4YAV A;  1MD3 A;  4OO4 A;  1HQO A;  1RW1 A;  1Z6N A;  3A2V A;  1AQW A;  3Q18 A;  5CO3 A;  2TRC P;  3I69 A;  1SKR B;  2R0C A;  1VF3 A;  1DE2 A;  1T00 A;  4G2E A;  3L4N A;  3MWH A;  2DBC A;  2DMM A;  14GS A;  4GSN A;  3UVT A;  4HJM A;  2KP2 A;  5ECS A;  4XS6 A;  1AW9 A;  1PA3 A;  3IE3 A;  1PQN A;  2LEG A;  1GWC A;  4K5R A;  2HRA A;  3NIV A;  2DML A;  3ZMK A;  3DVX A;  2FWG A;  1A24 A;  17GS A;  3QOU A;  3UBL A;  4MJA A;  3O3T A;  3WT2 A;  3FRC A;  4X43 A;  2DJ2 A;  4HU9 A;  3TKS E;  1UA5 A;  4X0X A;  4K0N A;  4MH3 A;  3TGZ A;  4IBP A;  4Q5F A;  3L9V A;  1EEM A;  5F05 A;  5AIX A;  2DIY A;  5CAX A;  3HVV A;  5KN3 A;  5ENU A;  3QR6 A;  3H8Q A;  1MDK A;  1TDI A;  3BBY A;  2C3Q A;  1SYR A;  3DD3 A;  3RHB A;  3TKR A;  1TRV A;  2L59 A;  5HFK A;  1M7T A;  1UVZ A;  4KE3 A;  1H75 A;  4PXO A;  2H72 A;  5ECP B;  2YP6 A;  1AUC A;  1A0R P;  3FMW A;  3G7I A;  4I6X A;  2N5B A;  2NPB A;  5DVB A;  1THO A;  1VF2 A;  1K0A A;  1U3A A;  1HNA A;  6GSU A;  1PKW A;  4PUA A;  5DQY A;  3ZFL A;  1J0F A;  4KF9 A;  2MMN A;  4HUA A;  1ABA A;  2G0F A;  4NHZ A;  4DSS A;  1UC7 A;  3FK8 A;  1PX6 A;  4EL1 A;  4YQV A;  3C7M A;  3Q74 A;  1ZYE A;  5DAK B;  3EUR A;  4PQI A;  1FO5 A;  2REM A;  5DBQ A;  3TOT A;  1GNW A;  4FQU A;  4J57 E;  1U3I A;  1ERU A;  5A4U A;  1ZYQ B;  1K0O A;  1YY7 A;  1N8J A;  3LOR A;  1JZW A;  2HSY A;  3E0U A;  2DKI A;  1QFN A;  1GH2 A;  5ECL B;  2C80 A;  2HRK A;  2ZCT A;  4IGJ A;  4PUF C;  1ZYN A;  3GL5 A;  4XTS A;  2HI7 A;  1GRX A;  1O7U A;  5J4U A;  18GS A;  3R2Q A;  6GSY A;  3MDK A;  3HVN A;  4ML1 A;  5D9T A;  2ON5 A;  4A5P A;  3KIJ A;  2FCH A;  2Z9S A;  1B4Q A;  4KSM A;  3P7X A;  2CQ9 A;  1GUM A;  1GSF A;  1SK0 A;  2P0G A;  2K8V A;  3PPU A;  4ULX A;  2B1L A;  1SU9 A;  1JZR A;  4YQM A;  1A2J A;  1F2E A;  2FY6 A;  5DCH A;  2J23 A;  1ERW A;  5GZZ B;  1T4Z A;  4KSO A;  1DE1 A;  5CYY A;  1USB A;  2CVB A;  2LRT A;  1O6J A;  3WGD A;  2VL3 A;  4GQC A;  2YPM A;  4YKF A;  5G31 A;  1WJK A;  4F03 A;  1AC1 A;  1AQV A;  5IOW A;  2CX3 A;  2FUG 2;  4LLR A;  1S3D A;  4BL7 A;  2VLU A;  1GSE A;  2LS5 A;  1U87 A;  2QKE A;  5HFG A;  1AAZ A;  1J08 A;  4TXV A;  2FWF A;  4G0K A;  4MNN A;  3GA4 A;  1SJ6 A;  2GSQ A;  4ZB8 A;  4CHS A;  2ZNM A;  1XPV A;  3VPQ A;  4YQU A;  2X49 A;  3KP9 A;  3TB2 A;  5ELA A;  2YN1 A;  2IIY A;  1TI1 A;  3HHV A;  4KUN A;  3I6A A;  4IQ1 A;  2VD0 A;  4WET A;  1DBY A;  1FB6 A;  1X5C A;  1XOB A;  1THX A;  2DIZ A;  3VUR A;  4WR5 A;  2EIR A;  3F0I A;  4XRD A;  2IWT A;  2YWI A;  2V6K A;  2B5Y A;  5CRH A;  5A4V A;  5CP1 A;  2H70 A;  1WPI A;  4IJI A;  1BX9 A;  2H76 A;  2ON7 A;  4OCF A;  3IV4 A;  1O8W A;  3W6G A;  3BOA A;  4F0B A;  2V32 A;  2NBS A;  3R3E A;  5GST A;  4EVM A;  2V2G A;  2LTK A;  3QPM A;  5HR1 A;  3C71 A;  3A3T A;  2GSS A;  2E0Q A;  2P5R A;  4MK3 A;  1OAZ A;  5CNW A;  2LJR A;  3H4K A;  1O81 A;  5EL8 A;  1ILO A;  1ZL9 A;  2X8C A;  2L57 A;  2ZUP A;  3UEM A;  2X64 A;  4XHM A;  3LYP A;  1SEN A;  1U88 A;  5GSS A;  2LV3 A;  4OFT A;  2H74 A;  4DSR A;  1YKC A;  4TN8 A;  1K3O A;  4JZQ A;  2JAC A;  4BWQ A;  2AV4 A;  2K9F A;  1PGT A;  3FZ5 A;  4J56 E;  5ELG A;  2DJ1 A;  1SL2 B;  3KD0 A;  5DAL A;  2WS2 A;  6GSX A;  1GUL A;  2B6M A;  5ABR A;  4MF5 A;  2H0H A;  2KOK A;  2I9H A;  3IAS 2;  1XWG A;  1V58 A;  3JCM L;  5D93 A;  3MSZ A;  1R5P A;  4Z2U A;  2M80 A;  2XPE A;  1KBN A;  2VUP A;  5LD0 A;  1GTA A;  2GS3 A;  4TRX A;  4AJ8 A;  1JLW A;  2HRF A;  3KH7 A;  1B4P A;  3HCZ A;  2WGR A;  1OC3 A;  4HQZ A;  4J2F A;  2TIR A;  4F82 A;  2X4A A;  3V1W A;  3GIX A;  2M72 A;  3IHG A;  1B48 A;  4LL1 B;  3H93 A;  4NAX A;  4X1U A;  1XG8 A;  2PER A;  1WP0 A;  1Z7R A;  2V41 A;  3FEU A;  2HLS A;  2KLX A;  2M46 A;  1PRX A;  2CZ2 A;  4AF2 A;  4KDX A;  1GNE A;  4MF6 A;  1TW9 A;  4IVF A;  2LNS A;  1MEK A;  5HQP A;  3F6D A;  2R5G A;  5J41 A;  2YZU A;  5ECQ B;  3LJR A;  3TRP A;  2QA2 A;  2VL9 A;  2C0D A;  1JLV A;  1K0M A;  3BCI A;  4QQ7 A;  3KTL A;  1CQH A;  3IA1 A;  2LJA A;  1WE0 A;  8GSS A;  2RM6 A;  1TK8 B;  4RI7 A;  1KNG A;  3EU3 A;  4PNF A;  3LQ7 A;  4I2U A;  2G2Q A;  3DGQ A;  1RQM A;  5BMU A;  4ZBA A;  4RUV A;  5B8A A;  4ZL9 A;  5L71 A;  2MMO A;  1R5A A;  4V2L A;  3GUS A;  2E2G A;  4EE0 A;  4F0C A;  3EC3 A;  2A2P A;  4TR0 A;  5ECK B;  1T7P B;  5ECI B;  5AIS A;  3WD6 A;  2EIQ A;  1A8Y A;  6GSW A;  4USS A;  1PL2 A;  2DKH A;  5CRE A;  4GLT A;  3CSH A;  3ERG A;  4K7I A;  3NOF A;  3ME8 A;  1Q98 A;  2WZ9 A;  3OR5 A;  2L6C A;  4NWY A;  4DEJ A;  2I3Y A;  4V2N A;  5JCU A;  3KMN A;  4MZW A;  3C73 A;  9GSS A;  1ON4 A;  4HU7 A;  3MIX A;  3SWL A;  5CRW A;  3HZ8 A;  3RBT A;  2JSY A;  2DJ3 A;  4K2D A;  3GYK A;  2GSR A;  2OBI A;  1MDJ A;  2F8F A;  3FR3 A;  4FIW A;  3VLN A;  2DJ0 A;  3ME7 A;  3ZIJ A;  4OMV A;  2CVD A;  3IK7 A;  2K8S A;  3QAG A;  4ACS A;  4EXJ A;  4O7H A;  2PN8 A;  2DLX A;  4ZBD A; 
#chains in the Genus database with same CATH homology
 4HDE A;  3TJG A;  1TP9 A;  1SL0 B;  2PPT A;  2F3M A;  6GST A;  4ECB A;  4ICY A;  1FB0 A;  4NV5 A;  4EDY A;  1BJX A;  2LUS A;  2C0F A;  5AIV A;  3L9S A;  4G0L A;  4XS4 B;  4GCI A;  3BCK A;  3P2A A;  1K0B A;  2O85 A;  5F8B A;  1SKW B;  3DWV A;  2OE1 A;  2VIM A;  4HZ2 A;  4RI6 A;  2F51 A;  4OFM A;  2FHE A;  6GSV A;  1TRW A;  2H30 A;  3IDV A;  3O76 A;  3MAK A;  1ZZY A;  1M2A A;  2CAI A;  1KEB A;  3DKS A;  2O87 A;  3ZRE A;  3LXZ A;  1VF4 A;  2YWO A;  4PUR A;  4NV2 A;  3KGK A;  4Q5N A;  3QFA C;  1QUW A;  5G1K A;  1WIK A;  4HS1 A;  1LJR A;  1SD8 A;  3C1R A;  4TR3 A;  2QGV A;  4O5U A;  4DVC A;  3VK9 A;  3IOS A;  4RQR A;  2PWJ A;  4L0W A;  2AJQ B;  3DEX A;  4EIP A;  3EMX A;  4POB A;  5HFI A;  1M2B A;  1GUH A;  4BVX B;  3HXS A;  4TR1 B;  4WF4 A;  5DAK A;  3CRU A;  3Q6O A;  1XW9 A;  1R26 A;  2C3T A;  3CSI A;  1PKZ A;  5ECN B;  1YEP A;  3F9U A;  1I9D A;  4I2T A;  3ZFB A;  1OVN A;  1A0F A;  3MYD A;  3QMX A;  2KUC A;  2O89 A;  1A2M A;  4V1A g;  2PU9 C;  4JE1 A;  4JRR A;  4KCA A;  1Y6E A;  5F06 A;  2AYT A;  1QK8 A;  4L0U A;  2XPD A;  1KTE A;  5IPG A;  4I8B A;  2HNL A;  1HYU A;  4EF0 A;  1SJI A;  2IPA A;  1K0C A;  1LBK A;  4PGT A;  5G1L A;  4ECJ A;  5J5N A;  1EOG A;  2HZF A;  1GLQ A;  1QQ2 A;  1R7H A;  4POM A;  1O8X A;  2B7K A;  3PH9 A;  4OCE A;  1EGR A;  5HR3 A;  5EY6 A;  5IMV A;  3QAV A;  1GTI A;  5DJM A;  2MBS A;  1URM A;  5ECO B;  2FD3 A;  4OWY A;  5J3R A;  2MZC A;  4KB3 A;  4HEA 2;  4EKZ A;  2GQM A;  2HZE B;  1ST9 A;  5C00 A;  1OKD A;  3FW2 A;  1QGV A;  2VCQ A;  2H73 A;  4GF0 A;  2OE3 A;  1XWB A;  2MMA A;  1F3B A;  3TCO A;  2FA8 A;  4WKW A;  1BQ7 A;  2IMK A;  4NHW A;  4WBR D;  5HR0 A;  2JZS A;  5EVO A;  1XIY A;  2VAF A;  1FVK A;  5B8B A;  2DJJ A;  1BG5 A;  3QD9 A;  2CV4 A;  2C8U A;  2UZ8 A;  3SBC A;  3PIN A;  1YDK A;  4ID0 A;  3RPP A;  5KN2 A;  3HKR A;  2BTO T;  2IFQ B;  4Z7X A;  4PQ1 A;  2X99 A;  1FAA A;  2WUL A;  1K0N A;  3LW9 A;  5INY A;  1HNB A;  1T1V A;  4ZIJ A;  2P5Q A;  2RUE A;  4CY6 A;  3D4M A;  4G0I A;  3ZZX A;  4DSQ A;  5IMD A;  2B5X A;  5G5F A;  3UBK A;  1G7O A;  2JAD A;  1S3A A;  3C8E A;  3C1S A;  1PSQ A;  2CX4 A;  1PD2 1;  5G2Z A;  3P8W A;  1GLP A;  4G9H A;  2CAQ A;  1PN0 A;  4OO5 A;  2JZR A;  5CRG A;  4KDU A;  3D22 A;  3LWA A;  3M3M A;  1YQ1 A;  4PX1 A;  1TK0 B;  1M9A A;  4KGI A;  2OE0 A;  1BED A;  1Z5Y E;  3ZIV A;  3L78 A;  1V9W A;  5B6N A;  3EU4 A;  1EWX A;  2H6X A;  2A4H A;  1TKD B;  1JFU A;  1JZD A;  3DRN A;  1HD2 A;  4POK A;  2XHF A;  4JBB A;  2ES7 A;  1J9B A;  3HVS A;  1R4W A;  2E2M A;  3GKN A;  2C0E A;  3UJ1 A;  1M0U A;  2N5A A;  2CZ3 A;  4G19 A;  3RHC A;  5AN1 A;  4JR6 A;  3IR4 A;  4GWR A;  3GV1 A;  3P90 A;  3UAR A;  2BJX A;  3FY7 A;  3IPZ A;  2RII A;  1JHB A;  3I9V 2;  3QAW A;  3GKK A;  2DC5 A;  4WXT A;  1OE7 A;  2HSM A;  3A5W A;  1EOH A;  1NM3 A;  2AAW A;  5E4W A;  3ZML A;  3O6T A;  2H1B A;  2B3S A;  2LNT A;  1XVW A;  3F63 A;  2RLI A;  3CTF A;  1V40 A;  3VI7 A;  1M9B A;  5H5Q A;  3Q19 A;  2YZH A;  3HYP A;  1YJ6 A;  3FZA A;  4ILF A;  3HA9 A;  3BD2 A;  4HI7 A;  2IMF A;  3US3 A;  3WYW A;  2PUK C;  3KM6 A;  1DSB A;  2GZY A;  2R3X A;  2PGT A;  3GX0 A;  3DVW A;  4K1F A;  5KN1 A;  2YWM A;  5BRT A;  3E3E A;  5GAP D;  4KND A;  1QXH A;  2I1U A;  3TJK A;  3ZVJ A;  2CT6 A;  2WJU A;  1NW2 A;  3TKS A;  2GZP A;  5FWG A;  3DIE A;  5ID2 B;  2NTO A;  1B8X A;  2HYX A;  1XXU A;  2J9H A;  2PVQ A;  4GRF A;  3FKF A;  3CXG A;  1OYJ A;  5C04 A;  4KCE A;  3HD5 A;  2C4J A;  4AGS A;  2L6D A;  3A2X A;  1V2A A;  3LXT A;  2H75 A;  4WF5 A;  2WDU A;  11GS A;  4YKG A;  1GSD A;  2LKU A;  2VOC A;  2GQK A;  2FWH A;  3F4R A;  3H1N A;  2CVK A;  4L8E A;  2LJK A;  2H6Y A;  4BVY B;  1EP8 A;  2VCZ A;  1X9S B;  4MMM A;  3N5O A;  3TDG A;  3J7Y b;  1YF1 A;  3TKS C;  2F8A A;  2MMZ A;  2JSZ A;  1WWJ A;  5FHI A;  1V57 A;  2OBK A;  3KEB A;  2C1Y A;  1H4O A;  2FA4 A;  16GS A;  2PBJ A;  5B6M A;  4YH2 A;  3F6F A;  3F3Q A;  1AQX A;  5H5S A;  5B7C A;  3WGX A;  2D2Z A;  2HT9 A;  3EVI A;  4MPF A;  3GL3 A;  4NPB A;  2FNO A;  4Q5R A;  5A4W A;  2VL2 A;  4JU5 A;  1O73 A;  4V1A p;  1A23 A;  2GZZ A;  2GQL A;  1TJD A;  3UMA A;  4KDY A;  3IRA A;  4IS0 A;  2H19 A;  4FYU A;  2YJH A;  3GH6 A;  4Z2R A;  2H1D A;  2JU5 A;  1PL1 A;  1XW6 A;  3FZ9 A;  1VRS D;  5DJL A;  19GS A;  2RM5 A;  2B7J A;  12GS A;  3IBH A;  4I97 A;  1ZGN A;  4QL7 A;  2PVO C;  4XS4 A;  3D0Z A;  4LMW A;  6GSS A;  4MJB A;  1GP1 A;  4MZC A;  2H0G A;  1IYH A;  5J9B A;  2VL2 C;  3VWW A;  2H6Z A;  3PR8 A;  4NXI A;  4ML6 A;  2AHE A;  2K18 A;  2O8V B;  4MAB A;  1O85 A;  3GTU B;  2XC2 A;  1E6B A;  3EYT A;  1W89 A;  3HJO A;  2XBI A;  5D8I A;  3TJB A;  1EP7 A;  1YZX A;  3GX8 A;  1GTU A;  2VO4 A;  4RQX A;  3UVH A;  2ALB A;  22GS A;  1Z9H A;  4HZ4 A;  1UN2 A;  4BVX A;  4TR1 A;  4CW9 A;  2E7P A;  1JZO A;  3QCP A;  3VI5 A;  3ZTL A;  5JCG A;  3NZN A;  4LA1 A;  3F4T A;  1ACV A;  1ZYP A;  1XW5 A;  1XWK A;  3EIN A;  2GVP A;  2YNX A;  1T8E B;  2R0P A;  2V1M A;  4TXO B;  1G6Y A;  2GLR A;  1FOH A;  2MBT A;  4KAE A;  4Q5Q A;  4E8H A;  4HJ2 A;  1GSY A;  1K3Y A;  4AJ7 A;  4ZBB A;  4MLY A;  2VCX A;  3EE2 A;  2L4C A;  3ERF A;  1Y25 A;  4EO3 A;  2A2R A;  4K8M A;  3M1G A;  1WOU A;  1LU4 A;  4MPG A;  1GSU A;  4GTU A;  2OKA A;  2H1G A;  1XOA A;  3GNJ A;  1U6T A;  1HNC A;  10GS A;  1PX7 A;  3N9J A;  3HVX A;  1OC9 B;  2GGT A;  4KW6 A;  5G30 A;  4ECC A;  1W4V A;  3ERW A;  1B9X C;  1G0T A;  1N2A A;  2JZT A;  5D73 A;  2TRX A;  4EC0 A;  4D73 B;  2HZE A;  1SK2 A;  3FZ4 A;  4O5Q A;  3ZL5 A;  5KOW A;  1OC8 A;  2FWE A;  3BJ5 A;  3L0H A;  2VM2 A;  4V2M A;  4ECI A;  2A2S A;  3ZVJ D;  5J9C A;  3A2W A;  1A8L A;  2R2J A;  4ZL7 A;  4MF7 A;  5KEJ A;  2H71 A;  4X4J A;  2VLV A;  4KA0 A;  2VCT A;  3GN3 A;  4N0V A;  1QMV A;  2LST A;  1EEJ A;  4GST A;  5DCG A;  5G5E A;  5IM9 A;  2IFQ A;  1BAY A;  3GHA A;  2DJK A;  4LMV A;  3AY8 A;  4FH8 A;  1TOF A;  5D96 A;  2YWN A;  3GMF A;  4P3Y B;  1TRS A;  1XFL A;  3VWX A;  4N11 A;  3M8N A;  3EWL A;  5IQY A;  4KH7 A;  3HJM A;  4K6X A;  2CA8 A;  1EV4 A;  4MZB A;  3H79 A;  4BA7 A;  2KP1 A;  2LQQ A;  2AB6 A;  5IIZ A;  4K7O A;  4O5R A;  4FO5 A;  1E2Y A;  3UIW A;  3QFB C;  1XVQ A;  2HXK A;  4ZB6 A;  3TOU A;  1SK1 A;  3VPT A;  4PTS A;  5IMC A;  4N0Z A;  3GSS A;  5DDL A;  3LFL A;  1NHY A;  2DSA A;  3IXR A;  3VFI A;  1CQG A;  1X5E A;  1Z7P A;  5IPH A;  3G9B A;  3F8U A;  3ISO A;  2GT6 A;  2B5E A;  1TXX A;  2HFD A;  2VD1 A;  3GRX A;  2L5L A;  1BYE A;  1V98 A;  1X0R A;  4BWS A;  2GT5 A;  3I43 A;  4WEY A;  3FYG A;  3PGT A;  5AGY A;  4I5Q A;  2N5F A;  4ISD A;  3FHK A;  3M9K A;  1GUK A;  4XRA A;  1ERT A;  1ML6 A;  3D4T A;  4IHU A;  1F9M A;  3KXO A;  4BPY A;  1IYI A;  1I5G A;  2I4A A;  2IL3 A;  4HOJ A;  2YAN A;  3TUE A;  4GSS A;  3CTG A;  4TKY A;  2QA1 A;  2WFC A;  2YJ7 A;  3KZQ A;  4OFN A;  3KH9 A;  5D9X A;  1C72 A;  4MJE A;  3WGE A;  1VF1 A;  3RAZ A;  2GTU A;  4JED A;  4TOP A;  4G10 A;  4DSS B;  2IMD A;  3TJJ A;  5LNK e;  5F07 A;  2GDR A;  1M2D A;  4EIQ A;  1T4Y A;  4QL9 A;  3ZLP A;  4E8E A;  3A5I A;  1RK4 A;  2K6V A;  3APQ A;  3J7Y k;  3TJF A;  2GST A;  3GFK A;  1PMT A;  1Q4J A;  3ZIT A;  4MP4 A;  3LEF A;  1ZMA A;  2R0G A;  4O32 A;  2HRN A;  1S3C A;  1FVJ A;  4IJ3 A;  4N30 A;  3TKQ A;  3KP8 A;  4EDZ A;  2LRC A;  3E9J B;  3MNG A;  2L5O A;  2LQO A;  4AJ6 A;  3FR9 A;  4WBJ A;  4MA9 A;  1K0D A;  2H66 A;  5ECH B;  4TW5 A;  2A4V A;  3HZ4 A;  4K9Z A;  1SL1 B;  2VCW A;  1AXD A;  2NDO A;  5ID2 A;  1T3B A;  2PMT A;  3IC8 A;  3CRT A;  4KX4 A;  4CDO A;  4JR4 A;  3M9J A;  2OA7 A;  20GS A;  3G7J A;  3KJY A;  3EPT A;  2YOI A;  1YKA A;  1ERV A;  3D21 A;  5F0G A;  4IN0 A;  4XCS A;  1XWC A;  2VM1 A;  3KTB A;  2H0I A;  5CRD A;  1WMJ A;  1K3L A;  2RUF A;  3ZYW A;  5IO0 A;  3VWU A;  2XBQ A;  3ZRD A;  1TK5 B;  3ED3 A;  13GS A;  2F9S A;  4BVY A;  3GH9 A;  1WRY A;  2YV7 A;  2O7K A;  5H5R A;  1GSS A;  5IMA A;  5LCZ A;  4L5O A;  3GUR A;  4O92 A;  2X8G A;  1XBS A;  4HQS A;  2IJY A;  4TR4 A;  1Z3E A;  1A2L A;  5JWQ B;  1FOV A;  4XIH A;  4BL7 B;  2R6K A;  1B9Y C;  3D6I A;  3DXB A;  5DQS A;  4ZXG A;  1EGO A;  4MJC A;  4IEL A;  3VWV A;  2EIO A;  3HDC A;  2IME A;  4FYC A;  4XS1 A;  5HR2 A;  5ECM B;  3GKM A;  3HJP A;  5FT3 A;  1DUG A;  1F3A A;  3TRQ A;  1F37 A;  5A5K A;  3UL3 A;  2WB9 A;  1AIU A;  3CBU A;  1NHO A;  4K5S A;  2I81 A;  4TVE A;  3CYN A;  1FHE A;  1MTC A;  4MCU A;  4CY8 A;  1TU8 A;  3L9U A;  4MH2 A;  2C0G A;  3TKP A;  3LG6 A;  4WR4 A;  4K0G A;  2B1K A;  1TRU A;  2OJL A;  2P31 A;  1YEX A;  1G7E A;  1F6M C;  5KOX A;  3W8S A;  2VLT A;  4IW9 A;  1XWA A;  2IN3 A;  2HE3 A;  1SYX A;  1MDI A;  2YCD A;  2C3N A;  4IP1 A;  1SKS B;  3U6V A;  4Z2T A;  2JL4 A;  3GST A;  4ZB9 A;  4OD7 A;  3LGC A;  5JWR B;  5IMZ A;  3DYR A;  1OKT A;  2KHP A;  2MYG A;  4IKH A;  3S9F A;  2OAD A;  4GQF A;  2HSH A;  4MDC A;  4H86 A;  1FW1 A;  1XCC A;  4LL4 B;  1Z6M A;  1TU7 A;  5IOX A;  1SJZ A;  3EMP A;  4PNG A;  3RDW A;  3F3R A;  2LRN A;  5IO2 A;  4GXZ A;  4F9Z A;  3GTU A;  1MD4 A;  5DAL B;  2V6O A;  5KN0 A;  5EPF A;  1FG4 A;  4ZL8 A;  1GSQ A;  4ZIL A;  1X5D A;  5GAN D;  7GSS A;  3CMI A;  3GKX A;  1EZK A;  1G6W A;  2FGX A;  3W8J A;  3RPN A;  5IMF A;  2QC7 A;  5ECR B;  4IP6 A;  4NMU A;  4K2X A;  2H1A A;  1ZOF A;  3LYK A;  5JCW A;  3KCM A;  2YV9 A;  4EUY A;  2L4Q A;  5E59 A;  1OE8 A;  3F4S A;  2H01 A;  3D5J A;  3IHQ A;  4POL A;  3TRX A;  5JWO B;  4TXO A;  3FR6 A;  4IQA A;  1VGL A;  4L5L A;  4N10 A;  1M99 A;  1XZO A;  1X9W B;  3M0F A;  4YAP A;  3UAP A;  4F2I A;  3K8N A;  1ZCP A;  1NSW A;  2QSI A;  2H8L A;  1TTZ A;  2BMX A;  4K7N A;  3LSZ A;  3U5R E;  1GTB A;  2NVL A;  3APO A;  3KMO A;  2WCI A;  3QDN A;  1PN9 A;  1SD9 A;  5COH A;  3IK9 A;  2R4V A;  3UOM A;  3IAM 2;  1OC9 A;  2EC4 A;  2WRT A;  3IC4 A;  2FLS A;  5D9V A;  1EV9 A;  2R37 A;  3HY2 A;  1X9M B;  5D9W A;  4D73 A;  4FYB A;  2VCV A;  3CSJ A;  3WT1 A;  1TI3 A;  3DML A;  2OAC A;  2X8H A;  1GL8 A;  1YF0 A;  3APS A;  3G7Y A;  2IMI A;  2AUV A;  4PQH A;  4YAV A;  1MD3 A;  4OO4 A;  1HQO A;  1RW1 A;  1Z6N A;  3A2V A;  1AQW A;  3Q18 A;  5CO3 A;  2TRC P;  3I69 A;  1SKR B;  2R0C A;  1VF3 A;  1DE2 A;  1T00 A;  4G2E A;  3L4N A;  3MWH A;  2DBC A;  2DMM A;  14GS A;  4GSN A;  3UVT A;  4HJM A;  2KP2 A;  5ECS A;  4XS6 A;  1AW9 A;  1PA3 A;  3IE3 A;  1PQN A;  2LEG A;  1GWC A;  4K5R A;  2HRA A;  3NIV A;  2DML A;  3ZMK A;  3DVX A;  2FWG A;  1A24 A;  17GS A;  3QOU A;  3UBL A;  4MJA A;  3O3T A;  3WT2 A;  3FRC A;  4X43 A;  2DJ2 A;  4HU9 A;  3TKS E;  1UA5 A;  4X0X A;  4K0N A;  4MH3 A;  3TGZ A;  4IBP A;  4Q5F A;  3L9V A;  1EEM A;  5F05 A;  5AIX A;  2DIY A;  5CAX A;  3HVV A;  5KN3 A;  5ENU A;  3QR6 A;  3H8Q A;  1MDK A;  1TDI A;  3BBY A;  2C3Q A;  1SYR A;  3DD3 A;  3RHB A;  3TKR A;  1TRV A;  2L59 A;  5HFK A;  1M7T A;  1UVZ A;  4KE3 A;  1H75 A;  4PXO A;  2H72 A;  5ECP B;  2YP6 A;  1AUC A;  1A0R P;  3FMW A;  3G7I A;  4I6X A;  2N5B A;  2NPB A;  5DVB A;  1THO A;  1VF2 A;  1K0A A;  1U3A A;  1HNA A;  6GSU A;  1PKW A;  4PUA A;  5DQY A;  3ZFL A;  1J0F A;  4KF9 A;  2MMN A;  4HUA A;  1ABA A;  2G0F A;  4NHZ A;  4DSS A;  1UC7 A;  3FK8 A;  1PX6 A;  4EL1 A;  4YQV A;  3C7M A;  3Q74 A;  1ZYE A;  5DAK B;  3EUR A;  4PQI A;  1FO5 A;  2REM A;  5DBQ A;  3TOT A;  1GNW A;  4FQU A;  4J57 E;  1U3I A;  1ERU A;  5A4U A;  1ZYQ B;  1K0O A;  1YY7 A;  1N8J A;  3LOR A;  1JZW A;  2HSY A;  3E0U A;  2DKI A;  1QFN A;  1GH2 A;  5ECL B;  2C80 A;  2HRK A;  2ZCT A;  4IGJ A;  4PUF C;  1ZYN A;  3GL5 A;  4XTS A;  2HI7 A;  1GRX A;  1O7U A;  5J4U A;  18GS A;  3R2Q A;  6GSY A;  3MDK A;  4ML1 A;  5D9T A;  2ON5 A;  4A5P A;  3KIJ A;  2FCH A;  2Z9S A;  1B4Q A;  4KSM A;  3P7X A;  2CQ9 A;  1GUM A;  1GSF A;  1SK0 A;  2P0G A;  2K8V A;  3PPU A;  4ULX A;  2B1L A;  1SU9 A;  1JZR A;  4YQM A;  1A2J A;  1F2E A;  2FY6 A;  5DCH A;  2J23 A;  1ERW A;  5GZZ B;  1T4Z A;  4KSO A;  1DE1 A;  5CYY A;  1USB A;  2CVB A;  2LRT A;  1O6J A;  3WGD A;  2VL3 A;  4GQC A;  2YPM A;  4YKF A;  5G31 A;  1WJK A;  4F03 A;  1AC1 A;  1AQV A;  5IOW A;  2CX3 A;  2FUG 2;  4LLR A;  1S3D A;  4BL7 A;  2VLU A;  1GSE A;  2LS5 A;  1U87 A;  2QKE A;  5HFG A;  1AAZ A;  1J08 A;  4TXV A;  2FWF A;  4G0K A;  4MNN A;  3GA4 A;  1SJ6 A;  2GSQ A;  4ZB8 A;  4CHS A;  2ZNM A;  1XPV A;  3VPQ A;  4YQU A;  2X49 A;  3KP9 A;  3TB2 A;  5ELA A;  2YN1 A;  2IIY A;  1TI1 A;  3HHV A;  4KUN A;  3I6A A;  4IQ1 A;  2VD0 A;  4WET A;  1DBY A;  1FB6 A;  1X5C A;  1XOB A;  1THX A;  2DIZ A;  3VUR A;  4WR5 A;  2EIR A;  3F0I A;  4XRD A;  2IWT A;  2YWI A;  2V6K A;  2B5Y A;  5CRH A;  5A4V A;  5CP1 A;  2H70 A;  1WPI A;  4IJI A;  1BX9 A;  2H76 A;  2ON7 A;  4OCF A;  3IV4 A;  1O8W A;  3W6G A;  3BOA A;  4F0B A;  2V32 A;  2NBS A;  3R3E A;  5GST A;  4EVM A;  2V2G A;  2LTK A;  3QPM A;  5HR1 A;  3C71 A;  3A3T A;  2GSS A;  2E0Q A;  2P5R A;  4MK3 A;  1OAZ A;  5CNW A;  2LJR A;  3H4K A;  1O81 A;  5EL8 A;  1ILO A;  1ZL9 A;  2X8C A;  2L57 A;  2ZUP A;  3UEM A;  2X64 A;  4XHM A;  3LYP A;  1SEN A;  1U88 A;  5GSS A;  2LV3 A;  4OFT A;  2H74 A;  4DSR A;  1YKC A;  4TN8 A;  1K3O A;  4JZQ A;  2JAC A;  4BWQ A;  2AV4 A;  2K9F A;  1PGT A;  3FZ5 A;  4J56 E;  5ELG A;  2DJ1 A;  1SL2 B;  3KD0 A;  5DAL A;  2WS2 A;  6GSX A;  1GUL A;  2B6M A;  5ABR A;  4MF5 A;  2H0H A;  2KOK A;  2I9H A;  3IAS 2;  1XWG A;  1V58 A;  3JCM L;  5D93 A;  3MSZ A;  1R5P A;  4Z2U A;  2M80 A;  2XPE A;  1KBN A;  2VUP A;  5LD0 A;  1GTA A;  2GS3 A;  4TRX A;  4AJ8 A;  1JLW A;  2HRF A;  3KH7 A;  1B4P A;  3HCZ A;  2WGR A;  1OC3 A;  4HQZ A;  4J2F A;  2TIR A;  4F82 A;  2X4A A;  3V1W A;  3GIX A;  2M72 A;  3IHG A;  1B48 A;  4LL1 B;  3H93 A;  4NAX A;  4X1U A;  2PER A;  1WP0 A;  1Z7R A;  2V41 A;  3FEU A;  2HLS A;  2KLX A;  2M46 A;  1PRX A;  2CZ2 A;  4AF2 A;  4KDX A;  1GNE A;  4MF6 A;  1TW9 A;  4IVF A;  2LNS A;  1MEK A;  5HQP A;  3F6D A;  2R5G A;  5J41 A;  2YZU A;  5ECQ B;  3LJR A;  3TRP A;  2QA2 A;  2VL9 A;  2C0D A;  1JLV A;  1K0M A;  3BCI A;  4QQ7 A;  3KTL A;  1CQH A;  3IA1 A;  2LJA A;  1WE0 A;  8GSS A;  2RM6 A;  1TK8 B;  4RI7 A;  1KNG A;  3EU3 A;  4PNF A;  3LQ7 A;  4I2U A;  2G2Q A;  3DGQ A;  1RQM A;  5BMU A;  4ZBA A;  4RUV A;  5B8A A;  4ZL9 A;  5L71 A;  2MMO A;  1R5A A;  4V2L A;  3GUS A;  2E2G A;  4EE0 A;  4F0C A;  3EC3 A;  2A2P A;  4TR0 A;  5ECK B;  1T7P B;  5ECI B;  5AIS A;  3WD6 A;  2EIQ A;  1A8Y A;  6GSW A;  4USS A;  1PL2 A;  2DKH A;  5CRE A;  4GLT A;  3CSH A;  3ERG A;  4K7I A;  3NOF A;  3ME8 A;  1Q98 A;  2WZ9 A;  3OR5 A;  2L6C A;  4NWY A;  4DEJ A;  2I3Y A;  4V2N A;  5JCU A;  3KMN A;  4MZW A;  3C73 A;  9GSS A;  1ON4 A;  4HU7 A;  3MIX A;  3SWL A;  5CRW A;  3HZ8 A;  3RBT A;  2JSY A;  2DJ3 A;  4K2D A;  3GYK A;  2GSR A;  2OBI A;  1MDJ A;  2F8F A;  3FR3 A;  4FIW A;  3VLN A;  2DJ0 A;  3ME7 A;  3ZIJ A;  4OMV A;  2CVD A;  3IK7 A;  2K8S A;  3QAG A;  4ACS A;  4EXJ A;  4O7H A;  2PN8 A;  2DLX A;  4ZBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...