1M7TA

Solution structure and dynamics of the human-escherichia coli thioredoxin chimera: insights into thermodynamic stability
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chimera of Human and E. coli thioredoxin
publication title Solution Structure and Dynamics of the Human-Escherichia coli Thioredoxin Chimera: Insights into Thermodynamic Stability
pubmed doi rcsb
source organism Homo sapiens, escherichia coli
molecule tags Electron transport
total genus 20
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2002-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1m7tA00
3WD6A 1O81A 2PVOC 1MTCA 3M9KA 2JSZA 2O89A 1N8JA 4ZL9A 2GQLA 5AIVA 1RK4A 3I9V2 4IELA 1X9MB 4EO3A 1TW9A 1YF1A 1BX9A 2YWIA 1PKZA 2B7KA 3CSJA 3HJMA 5CRHA 4POMA 2O7KA 2N5FA 1WP0A 4HUAA 5D8IA 4BWSA 5IMDA 1TU7A 1C72A 5AIXA 2DJKA 2DJJA 1VRSD 5ELAA 4K7OA 3QFAC 5DCHA 4EUYA 2AYTA 4XRDA 3DXBA 1ZL9A 2CQ9A 1SJZA 2VAFA 2B5EA 2GLRA 4ZL8A 3FZAA 2C4JA 5DAKA 4WETA 3IK9A 4F0BA 1EOGA 5JCWA 2DJ2A 1ZZYA 1T4ZA 2R3XA 2L59A 2FNOA 2YNXA 1RQMA 5CP1A 5LNKe 3F9UA 2DIZA 3GX0A 4ZB6A 3TKQA 1XWAA 3KMOA 5EVOA 5CRGA 3EC3A 3H8QA 4IJ3A 4GWRA 4HDEA 4PNFA 2C0EA 4ECJA 1ZGNA 2DMLA 2RIIA 1G7OA 1W4VA 1TI1A 1K3OA 1SD9A 4ILFA 1XVWA 5J9BA 1HNCA 4WF5A 1Y25A 2REMA 3P7XA 2Z9SA 2FD3A 3GL3A 5JWQB 3Q74A 4OFNA 3KZQA 6GSWA 2OBKA 1R7HA 3AY8A 3KEBA 4AJ6A 4RUVA 3IXRA 1GLQA 2VUPA 3I69A 1FB0A 3TRXA 2VCXA 2P5QA 2XC2A 2H0HA 2L5OA 4OCEA 4HQSA 1M9BA 1XOBA 5JCUA 1GSUA 1TI3A 3VWXA 5J4UA 1Z6MA 5DQSA 5J9CA 4O92A 2KUCA 3EU4A 2DMMA 3IPZA 4ZL7A 3O6TA 1JZOA 1NHOA 2JSYA 5IM9A 18GSA 4AF2A 1G6YA 3QAVA 1EOHA 2FA4A 2VL2C 2YJ7A 5EY6A 3RPPA 4X1UA 3EVIA 3KXOA 4EC0A 4L0WA 4RQXA 3M8NA 4IN0A 4KCAA 1G7EA 2WJUA 3P8WA 3FR9A 2IJYA 2YOIA 4JR4A 1VF3A 2B5XA 3QR6A 1TOFA 3TOTA 2HXKA 4OD7A 4K8MA 4TXOB 1AW9A 1T3BA 2M72A 4TR1B 2TRXA 1A8YA 4FYCA 4XRAA 5H5SA 3MNGA 1SK2A 3H4KA 1S3DA 4IP6A 4V2MA 4K2DA 2B5YA 6GSSA 2HT9A 3CBUA 2HZEB 5G1LA 5KN0A 3EMXA 4G9HA 4XIHA 2ON7A 2GSRA 2VCVA 4KA0A 3ERFA 3DRNA 5IMVA 1AIUA 2F8AA 4YH2A 5G5EA 1ST9A 1IYHA 3TRPA 4DSQA 1PSQA 1V98A 1CQGA 3LORA 1WWJA 3GL5A 3MDKA 3N9JA 3EU3A 3WYWA 2A2SA 1T8EB 1TP9A 3PINA 4TOPA 4JR6A 4BVYA 2ON5A 4F9ZA 2C1YA 2LKUA 5IQYA 3C71A 1J0FA 1CQHA 1ABAA 1KTEA 4HJMA 2FA8A 4FYUA 1K0OA 4OO5A 5F8BA 2X8CA 3F4RA 3PH9A 1E2YA 6GSVA 1ON4A 1SYXA 2VL3A 2HSYA 3UVHA 1MDJA 2DJ3A 1X9WB 2OKAA 5C00A 4PNGA 3WT2A 1A0FA 1ERUA 4EE0A 1DUGA 4N0VA 3H93A 2JZSA 1GSSA 3FEUA 5AN1A 3ZITA 2DJ0A 2GT5A 2NBSA 4IQ1A 3RBTA 3VPTA 5KN2A 2CVDA 2QC7A 3GH6A 1B4PA 4YQVA 3K8NA 1OKTA 5CAXA 4KDYA 4K9ZA 4X43A 1R4WA 1GTUA 2MMAA 5J3RA 2F9SA 5IMZA 3LEFA 2NTOA 2V41A 3M3MA 3R2QA 2OE1A 3TJFA 2YCDA 2FWHA 3IHQA 2MBTA 2PU9C 1PKWA 2H1GA 3VI5A 4AJ7A 3O76A 4I8BA 4QL7A 3TRQA 2I4AA 3GYKA 1K0BA 3IAS2 1X0RA 2O8VB 3F4TA 3TKRA 1WJKA 3TKSA 1K0DA 1QFNA 4XS4A 2H19A 2JL4A 1Z7PA 4N0ZA 3E3EA 1SKWB 1M2DA 4JE1A 4CHSA 2AB6A 1PQNA 3IBHA 1YY7A 10GSA 3C1RA 4GTUA 5J41A 4O32A 1LJRA 4GSSA 1PMTA 2RUFA 9GSSA 1SL0B 4O7HA 1NM3A 2H0IA 4GSTA 4L5OA 3LXZA 1DE2A 4TKYA 4J57E 3ZYWA 5JWOB 2H75A 4LL4B 4K0GA 4KX4A 2RLIA 4IHUA 4OFMA 1F37A 3DKSA 3GX8A 5DALB 3VK9A 2L57A 2VCWA 2KLXA 3ZIJA 4I97A 4F82A 3ZIVA 1YZXA 2PWJA 2VLVA 3WGXA 5IMFA 2LUSA 1M7TA 3Q19A 2M46A 2KHPA 2H1BA 4KGIA 1GNEA 1MD4A 4GCIA 4D73A 1K3YA 1U6TA 1ERWA 4BPYA 2H1DA 2MMNA 3W8JA 2IFQA 1PN9A 2R37A 1PGTA 2P5RA 3FYGA 2ZNMA 3VWVA 4QL9A 1G6WA 2EIQA 3QDNA 2P0GA 5ECSA 3M9JA 3GKNA 5A4VA 3HVVA 3D4MA 4NAXA 1TK8B 5CYYA 4PUAA 14GSA 4EVMA 5ID2B 2K8SA 5LD0A 2ALBA 1F6MC 3EE2A 3GTUB 4MZCA 2CX4A 2OA7A 3BCKA 2I1UA 4GRFA 3MWHA 1O8WA 2IL3A 1OVNA 2AHEA 4DSSB 2CVBA 4KW6A 3TKPA 4HZ4A 1OC8A 4ML1A 4KCEA 2CVKA 1YDKA 3FK8A 4PQ1A 2FWEA 2ZUPA 5ECQB 3HVSA 4MA9A 5CRDA 2CZ3A 1Z6NA 1UN2A 2PGTA 3GA4A 2HE3A 2LNTA 2NDOA 3ZREA 4G2EA 1TRSA 2CAIA 1U87A 5A4UA 4HEA2 4DEJA 3RAZA 2FUG2 1PL2A 3WT1A 2JACA 4IS0A 2H6YA 2V2GA 1XW9A 3F6DA 2KP1A 2B7JA 2YJHA 4NPBA 3HJOA 2C8UA 4PGTA 4MJEA 1TJDA 2L4CA 1OC9B 2CA8A 2R5GA 1GSQA 1YKAA 2VCZA 2LJKA 3ZLPA 5D9VA 3W6GA 3H79A 1GUHA 1B48A 5KN3A 1XWKA 3VURA 3TJBA 1TK5B 4LMVA 3GMFA 2YANA 4I2UA 3F63A 2MMOA 4N11A 1X5CA 2LTKA 11GSA 3LQ7A 3GN3A 4TR3A 1O6JA 4FH8A 3UL3A 5G2ZA 1R26A 2RM6A 2IIYA 2GVPA 1AUCA 1JZDA 4NV5A 2L6CA 4MH2A 2CX3A 1GRXA 4POLA 4ZBBA 4KSOA 3TDGA 1KBNA 1A24A 1GNWA 2OE3A 1R5AA 4V2LA 4GSNA 2IN3A 4NHWA 3APQA 5F0GA 5GSSA 2YP6A 4NV2A 3FW2A 2E7PA 3GRXA 5D9TA 3HDCA 5B6NA 3CTGA 4MP4A 2CT6A 3U5RE 4L5LA 1T00A 3QOUA 1Y6EA 1BAYA 2V32A 5A5KA 1YQ1A 3CTFA 2FWGA 5IIZA 3JCML 1O7UA 3E9JB 1TU8A 2M80A 3GUSA 2VLTA 3MSZA 2PN8A 1TKDB 1ERTA 12GSA 1QGVA 4GQFA 4E8HA 1K0MA 2HFDA 3BOAA 5COHA 2HRFA 3IA1A 1XW6A 1JZWA 2YWMA 5C04A 3L9UA 1LBKA 3FZ4A 1UA5A 5ECIB 1M99A 4KUNA 2C0GA 2CZ2A 5F06A 2QKEA 1THXA 5B8AA 4NXIA 2C3NA 2YV9A 5HR2A 2FY6A 2VCQA 3IDVA 5IPHA 2AUVA 3LXTA 1U3IA 3M1GA 3QMXA 3I6AA 3QAWA 4F03A 17GSA 4AJ8A 4TRXA 8GSSA 2FWFA 5CNWA 2R6KA 1SK0A 5H5QA 4N30A 4PX1A 4DSRA 4F0CA 5B7CA 2BJXA 4ULXA 2D2ZA 3VPQA 2OACA 3PR8A 1XCCA 5A4WA 3D4TA 4EDYA 2MMZA 5DCGA 3SBCA 2IMKA 2GGTA 7GSSA 2XBIA 4HZ2A 4Q5QA 2IWTA 5ECLB 1HYUA 2GSQA 3LSZA 4EL1A 5E4WA 4IVFA 4NWYA 1ACVA 3W8SA 1SENA 1ZMAA 2LV3A 2B1KA 1FOVA 1ML6A 2I81A 3UJ1A 1OE7A 2VO4A 1EP7A 1GUMA 4PXOA 5ECHB 3DGQA 3UBKA 2O87A 3EYTA 1OYJA 1V57A 4IP1A 5FWGA 1WIKA 2A4VA 5GSTA 1EGRA 1OKDA 3MAKA 4FYBA 2HSHA 3O3TA 1J08A 1GWCA 4TR1A 1K0NA 1IYIA 4IQAA 4IGJA 3TB2A 1JLWA 4ZBDA 2WDUA 4AGSA 1Z7RA 5HFKA 1YEPA 5CO3A 2ES7A 5FHIA 4RI6A 3UBLA 1WOUA 4EKZA 22GSA 4HU7A 3F8UA 1GSDA 3IE3A 4IKHA 2TIRA 3TCOA 5GAPD 2H1AA 4ECCA 4GQCA 5DQYA 3SWLA 3TKSE 1GSYA 1HNBA 4TR4A 3ZZXA 2K9FA 1PX7A 3IV4A 2WB9A 4XS4B 1ZOFA 3RPNA 4ZB8A 3N5OA 4ZB9A 1QUWA 1NW2A 3DMLA 4XS6A 5D93A 2FCHA 2VD0A 1DBYA 4IW9A 3D21A 2L5LA 2HRNA 3BBYA 3US3A 1XXUA 2AJQB 1ZYQB 1HNAA 3CMIA 4L0UA 2TRCP 6GSXA 2PPTA 1FB6A 1PRXA 4WKWA 3CSHA 4E8EA 3D22A 2O85A 1A0RP 2E2GA 1WRYA 1I5GA 2I3YA 1K3LA 3KH9A 1XZOA 3CXGA 1XIYA 2X8HA 1SJ6A 2F51A 4OFTA 20GSA 3ZVJA 4ZXGA 1V2AA 2NVLA 4JRRA 3ZVJD 4I5QA 5B8BA 4ACSA 1W89A 1Z5YE 2H76A 3APOA 1V40A 5B6MA 3HJPA 5G31A 3DWVA 4JBBA 1GLPA 1EWXA 2A2RA 4BVXA 2L6DA 3WGEA 1OC3A 2VCTA 2YPMA 2N5BA 1Z3EA 3ZRDA 1M0UA 1MEKA 2DIYA 1O85A 2XBQA 3F3RA 2GZZA 2JU5A 3NZNA 5G30A 1UVZA 2QGVA 4MZBA 1M2AA 4P3YB 1XFLA 1FVJA 4KNDA 1OE8A 3VLNA 3KP9A 1WPIA 3GHAA 1SYRA 5ECRB 4TW5A 2H74A 3HVXA 3LJRA 4Q5NA 1T1VA 1B9YC 2VM2A 5D73A 3TUEA 1YJ6A 1MDIA 3ERWA 2LSTA 4MJAA 2GDRA 2H0GA 4MPFA 5DJLA 1YKCA 1JFUA 3F3QA 3ZMLA 2KP2A 3L0HA 2VL2A 4WBRD 4KAEA 1WMJA 3A3TA 3CSIA 4NMUA 2DLXA 4CW9A 1NHYA 2PVQA 5KEJA 1EV4A 3L9SA 3QPMA 1XW5A 3GFKA 1JZRA 5F07A 4WEYA 3LWAA 4I2TA 4EXJA 2VL9A 3ERGA 3LFLA 1A23A 3KM6A 2CAQA 3UEMA 3KTLA 19GSA 4XHMA 1E6BA 4KSMA 1U88A 5DALA 4WR4A 3EWLA 2VD1A 2LS5A 5LCZA 4KDUA 1AAZA 4HU9A 2QSIA 5IMCA 3F0IA 4GLTA 3DD3A 1SU9A 1H75A 2I9HA 3FZ5A 1I9DA 1TRVA 5IPGA 1XPVA 1ZYEA 5ECKB 3LYKA 3G7YA 4V1Ap 1X9SB 6GSTA 2X99A 3UARA 2H66A 5DAKB 4EF0A 1Z9HA 3HA9A 2OADA 1M2BA 3UIWA 4OMVA 4O5RA 2MZCA 1TK0B 4LL1B 4NHZA 1KNGA 1A2MA 5ID2A 2EC4A 3HZ4A 2C3TA 1K0AA 3A2WA 3GTUA 2KOKA 3BD2A 1Q4JA 3IOSA 4LLRA 4RI7A 3L4NA 4HQZA 3D0ZA 2LQQA 1MDKA 3UOMA 2WS2A 2B1LA 5INYA 5ENUA 2DSAA 3EINA 4GF0A 5DJMA 4DSSA 1YEXA 1AQVA 4N10A 3TJKA 4K7IA 5H5RA 3IAM2 3FKFA 4KE3A 1MD3A 1TRWA 3GKKA 5ELGA 3C8EA 4MJBA 4K1FA 1HQOA 4PQIA 3GSSA 3J7Yb 3HD5A 4XS1A 3GV1A 2LNSA 4OCFA 4KDXA 2J23A 3FR3A 2GSSA 2IMFA 2GSTA 2V6OA 3ME8A 1V58A 3DYRA 3ME7A 3KTBA 2B3SA 2YN1A 5CREA 5HFGA 1QXHA 3TKSC 2IMEA 2VM1A 5GZZB 4PUFC 1XWGA 4RQRA 2HI7A 1GL8A 4Q5FA 1B9XC 4MZWA 1USBA 3FHKA 1VF4A 4KB3A 1GTBA 5D9XA 3KIJA 1OC9A 4ECBA 2J9HA 2YV7A 4I6XA 2XPDA 3QFBC 1EZKA 2H6ZA 3L78A 4PURA 2AAWA 2VOCA 4MH3A 4MF7A 1GUKA 3ZTLA 1AC1A 3TGZA 2LEGA 1WE0A 4K6XA 3VFIA 2DJ1A 4OWYA 5HR0A 4YQUA 1TXXA 1VF2A 3UVTA 1EV9A 3HXSA 3HZ8A 4TR0A 2JZRA 4V1Ag 2YZHA 1R5PA 3QAGA 2PERA 4TVEA 3A5WA 2BMXA 1X5DA 2G2QA 2OE0A 3ZL5A 2PBJA 1GP1A 5AISA 2IPAA 5IO2A 2K8VA 4MMMA 2GT6A 1K0CA 3IC4A 3WGDA 5D9WA 3C1SA 1LU4A 3RDWA 1XOAA 4K0NA 5AGYA 4DVCA 4HOJA 2JZTA 2V6KA 4MF5A 5JWRB 4MABA 1N2AA 1AXDA 2PMTA 4H86A 3VWUA 1JHBA 3FY7A 2OBIA 2EIRA 1DSBA 1PD21 2C0FA 3QCPA 4J2FA 4ID0A 3H1NA 1AQWA 4BA7A 3V1WA 3GKXA 5IMAA 1KEBA 3KGKA 1PL1A 1XVQA 1T4YA 1QK8A 3CRTA 3GSTA 1TDIA 3F6FA 2GS3A 1M9AA 5IOXA 1XWCA 1NSWA 4HJ2A 4YQMA 3Q6OA 4V2NA 5DVBA 2B6MA 3D5JA 4JU5A 4BL7A 1BG5A 4HI7A 4ZIJA 2RM5A 3LGCA 3LYPA 1A2JA 1PX6A 2H72A 2VLUA 5E59A 4Z7XA 3OR5A 2WCIA 3RHCA 3NOFA 5L71A 4IBPA 3FR6A 4TXOA 2H71A 1EP8A 4TN8A 2CV4A 3I43A 1VGLA 3TJGA 2H30A 2YWOA 2DBCA 4MK3A 4YAPA 3UMAA 3ISOA 3PGTA 2LJRA 2YZUA 4G19A 1RW1A 4LMWA 1FVKA 3KJYA 2IMDA 3C7MA 4X0XA 1XWBA 2HZEA 3KD0A 3E0UA 5DDLA 2HZFA 4LA1A 4ISDA 1G0TA 1SJIA 5HR1A 4CDOA 2HYXA 3TOUA 1JLVA 1FG4A 1SKSB 5JCGA 1SKRB 3VI7A 4PQHA 2MBSA 1ERVA 1Q98A 4MPGA 1EEJA 2N5AA 3HCZA 3RHBA 4J56E 3IK7A 3NIVA 4WR5A 3P2AA 16GSA 4ZBAA 1SD8A 1BYEA 4K7NA 1J9BA 3D6IA 2FLSA 3C73A 1F9MA 1S3AA 2C80A 3ZFBA 2P31A 3KH7A 3IR4A 3GURA 3L9VA 2LRCA 2E0QA 1THOA 3U6VA 2WULA 1S3CA 1O8XA 2FGXA 2V1MA 3ZFLA 3A2VA 2K6VA 2LRNA 1B8XA 2LJAA 3DEXA 1XBSA 3DIEA 4WXTA 3GIXA 3GH9A 3QD9A 3M0FA 5EL8A 1X5EA 1TTZA 4IJIA 1SK1A 1BQ7A 1VF1A 2H8LA 4BWQA 1AQXA 2GQKA 1GULA 4KH7A 1H4OA 2WGRA 4JZQA 3DVWA 1QQ2A 2F3MA 2GZPA 1FHEA 6GSUA 2E2MA 2DC5A 2H6XA 4G10A 1A2LA 3CYNA 2GZYA 5EPFA 5IOWA 3BJ5A 4HS1A 2C0DA 2PUKC 2XHFA 3KP8A 2BTOT 2H73A 3EURA 3P90A 4JEDA 5HR3A 2AV4A 3HYPA 4D73B 1HD2A 5KN1A 1B4QA 3G9BA 1PA3A 3BCIA 2G0FA 2IFQB 1FO5A 1V9WA 5ECMB 4WF4A 2YWNA 3FZ9A 2WFCA 2K18A 3UAPA 3Q18A 5ECOB 2HLSA 4QQ7A 1FAAA 3GKMA 3J7Yk 4TXVA 5GAND 1GTAA 3EMPA 2GQMA 3ED3A 3HY2A 1BEDA 1YF0A 5HFIA 2F8FA 5DBQA 4WBJA 4MLYA 5G1KA 2OJLA 3HHVA 2R2JA 4POKA 5IO0A 4MJCA 1QMVA 2H70A 5G5FA 1T7PB 3GNJA 1F3BA 3S9FA 1GSFA 1ILOA 2RUEA 2EIOA 1ZCPA 3G7JA 4POBA 5F05A 3APSA 5D96A 4OO4A 4YAVA 4XTSA 1SL2B 4FO5A 4L8EA 1GTIA 4EDZA 5CRWA 4F2IA 1O73A 1OAZA 3F4SA 2IMIA 3CRUA 6GSYA 13GSA 2L4QA 2ZCTA 3KCMA 1DE1A 4XCSA 3VWWA 4ECIA 2XPEA 3IRAA 2VIMA 1GH2A 5FT3A 2JADA 2MYGA 4ZILA 2X64A 5ECNB 2WZ9A 1F2EA 2FHEA 3A2XA 3TJJA 2X8GA 2H01A 1EEMA 2C3QA 4FIWA 2WRTA 1UC7A 4MDCA 1TRUA 3KMNA 2NPBA 1A8LA 5ECPB 1FW1A 2LRTA 4MCUA 3HKRA 2HNLA 5HQPA 3LG6A 1GSEA 3FRCA 3DVXA 1F3AA 2GTUA 2LQOA 1EGOA 2R4VA 3ZMKA 4GXZA 5ABRA 4MF6A 1URMA 3G7IA 1SL1B 1BJXA 4Q5RA 4ML6A 5J5NA 1U3AA
chains in the Genus database with same CATH superfamily
3WD6A 3IHGA 1O81A 2PVOC 1MTCA 3M9KA 2JSZA 2O89A 1N8JA 4ZL9A 2GQLA 5AIVA 1RK4A 3I9V2 4IELA 1X9MB 4EO3A 1TW9A 1YF1A 1BX9A 2YWIA 1PKZA 4MNNA 2B7KA 3CSJA 3HJMA 5CRHA 4POMA 2O7KA 2N5FA 1WP0A 4HUAA 5D8IA 2QA2A 1FOHA 4BWSA 5IMDA 1TU7A 1C72A 2HRAA 5AIXA 2DJKA 2DJJA 1VRSD 5ELAA 4K7OA 3QFAC 5DCHA 4EUYA 2AYTA 4XRDA 3DXBA 1ZL9A 2CQ9A 1SJZA 2VAFA 2B5EA 2GLRA 4ZL8A 3FZAA 2C4JA 5DAKA 4WETA 3IK9A 4F0BA 1EOGA 5JCWA 2DJ2A 1ZZYA 1T4ZA 2R3XA 2L59A 1PFOA 2FNOA 2HSMA 2YNXA 1RQMA 5CP1A 5LNKe 3F9UA 2DIZA 3GX0A 4ZB6A 3TKQA 1XWAA 3KMOA 5EVOA 5CRGA 3EC3A 3H8QA 4IJ3A 4GWRA 4HDEA 4PNFA 2C0EA 4ECJA 1ZGNA 2DMLA 2RIIA 1G7OA 1W4VA 1TI1A 1K3OA 1SD9A 4ILFA 1XVWA 5J9BA 1HNCA 4WF5A 1Y25A 2REMA 3P7XA 2Z9SA 2FD3A 3GL3A 5JWQB 3Q74A 4OFNA 3KZQA 6GSWA 2OBKA 1R7HA 3AY8A 3KEBA 4AJ6A 4RUVA 3IXRA 1GLQA 2VUPA 3I69A 1FB0A 3TRXA 2VCXA 2P5QA 2XC2A 2H0HA 2L5OA 4OCEA 4HQSA 1M9BA 1XOBA 5JCUA 1GSUA 1TI3A 3VWXA 4EIQA 5J4UA 1Z6MA 5DQSA 5J9CA 4O92A 2KUCA 3EU4A 2DMMA 3IPZA 4ZL7A 3O6TA 1JZOA 1NHOA 2JSYA 5IM9A 18GSA 4AF2A 1G6YA 3QAVA 1EOHA 2FA4A 2VL2C 2YJ7A 5EY6A 3RPPA 4X1UA 3EVIA 3KXOA 4EC0A 4K2XA 4L0WA 4RQXA 3M8NA 4IN0A 4KCAA 1G7EA 2WJUA 3P8WA 3FR9A 2IJYA 2YOIA 4JR4A 1VF3A 2B5XA 3QR6A 1TOFA 3TOTA 2HXKA 4OD7A 4K8MA 4TXOB 1AW9A 1T3BA 2M72A 4TR1B 2TRXA 1A8YA 4FYCA 3PPUA 4XRAA 5H5SA 3MNGA 1SK2A 3IC8A 3H4KA 1S3DA 4IP6A 4V2MA 4K2DA 2B5YA 6GSSA 2HT9A 3CBUA 2HZEB 5G1LA 5KN0A 3EMXA 2DKHA 4G9HA 4XIHA 2ON7A 2GSRA 2VCVA 4KA0A 3ERFA 3DRNA 5IMVA 1AIUA 2F8AA 4YH2A 5G5EA 1ST9A 1IYHA 3TRPA 4DSQA 1PSQA 1V98A 1CQGA 3LORA 1WWJA 3GL5A 3MDKA 3N9JA 3EU3A 3WYWA 2A2SA 1T8EB 1TP9A 3PINA 4TOPA 4JR6A 4BVYA 2ON5A 4F9ZA 4YKGA 2C1YA 2LKUA 5IQYA 3C71A 1J0FA 1CQHA 1ABAA 1KTEA 4HJMA 2FA8A 4FYUA 1K0OA 4OO5A 5F8BA 2X8CA 3F4RA 3PH9A 1E2YA 6GSVA 1ON4A 1SYXA 2VL3A 2HSYA 3UVHA 1MDJA 2DJ3A 1ZYNA 1X9WB 2OKAA 5C00A 4PNGA 3WT2A 1A0FA 1ERUA 4EE0A 1DUGA 4N0VA 3H93A 2JZSA 1GSSA 3FEUA 5AN1A 3ZITA 2DJ0A 2GT5A 2NBSA 4IQ1A 3RBTA 3VPTA 5KN2A 2CVDA 2QC7A 3GH6A 1B4PA 4YQVA 3K8NA 1OKTA 5CAXA 4KDYA 4K9ZA 2UZ8A 4X43A 1R4WA 1GTUA 2MMAA 5J3RA 2F9SA 4BVXB 5IMZA 3LEFA 4Z2RA 2NTOA 2V41A 3M3MA 3R2QA 2OE1A 3TJFA 2YCDA 2FWHA 3IHQA 2MBTA 2PU9C 1PKWA 2H1GA 3VI5A 4AJ7A 2A2PA 3O76A 4I8BA 4QL7A 3TRQA 2I4AA 3GYKA 1K0BA 3IAS2 1X0RA 2O8VB 3F4TA 3TKRA 1WJKA 3TKSA 1K0DA 1QFNA 4XS4A 2H19A 2JL4A 1Z7PA 4N0ZA 3E3EA 1SKWB 1M2DA 4JE1A 4CHSA 2AB6A 1PQNA 3IBHA 1YY7A 10GSA 3C1RA 4GTUA 5J41A 4O32A 1LJRA 2A4HA 1PMTA 2RUFA 4GSSA 9GSSA 1SL0B 4O7HA 1NM3A 2H0IA 4GSTA 4L5OA 3LXZA 1DE2A 4TKYA 4J57E 3ZYWA 5JWOB 2H75A 4LL4B 5BMUA 4K0GA 2R0CA 4KX4A 2RLIA 4IHUA 4OFMA 1F37A 3DKSA 3GX8A 5DALB 3VK9A 2L57A 2VCWA 2KLXA 3ZIJA 4I97A 4F82A 3ZIVA 1YZXA 2PWJA 2VLVA 3WGXA 5IMFA 2LUSA 1M7TA 3Q19A 2M46A 2KHPA 2H1BA 4KGIA 1GNEA 1MD4A 4GCIA 4D73A 1K3YA 1U6TA 1ERWA 4BPYA 2H1DA 2MMNA 3W8JA 2IFQA 1PN9A 2R37A 1PGTA 2P5RA 3FYGA 2ZNMA 3VWVA 4QL9A 1G6WA 2EIQA 3QDNA 2P0GA 5ECSA 3M9JA 3GKNA 5A4VA 3HVVA 3D4MA 4NAXA 1TK8B 5CYYA 4PUAA 14GSA 4EVMA 5ID2B 2K8SA 5LD0A 2ALBA 1F6MC 3EE2A 3GTUB 4MZCA 2CX4A 2OA7A 3BCKA 2I1UA 4GRFA 3MWHA 1O8WA 2IL3A 1OVNA 2AHEA 4DSSB 2CVBA 4KW6A 3TKPA 4HZ4A 1OC8A 4ML1A 4KCEA 2CVKA 1YDKA 3FK8A 4PQ1A 2FWEA 2ZUPA 5ECQB 3HVSA 4MA9A 5CRDA 2CZ3A 1Z6NA 1UN2A 2PGTA 3GA4A 2HE3A 2LNTA 2NDOA 3ZREA 4G2EA 1TRSA 2CAIA 1U87A 5A4UA 4HEA2 4DEJA 3RAZA 2FUG2 1PL2A 3WT1A 2JACA 4IS0A 2H6YA 2V2GA 1XW9A 3F6DA 2KP1A 2B7JA 2YJHA 4NPBA 3HJOA 2C8UA 4PGTA 4MJEA 1TJDA 2L4CA 1OC9B 2CA8A 2R5GA 1GSQA 1YKAA 2VCZA 2LJKA 3ZLPA 5D9VA 3W6GA 3H79A 1GUHA 1B48A 5KN3A 1XWKA 3VURA 3TJBA 1TK5B 4LMVA 3GMFA 2YANA 4I2UA 4A5PA 3F63A 1XG8A 2MMOA 4N11A 1X5CA 2LTKA 11GSA 3LQ7A 3GN3A 4TR3A 1O6JA 4FH8A 4PTSA 3UL3A 5G2ZA 1R26A 2RM6A 2IIYA 2GVPA 1AUCA 1JZDA 4NV5A 2L6CA 4MH2A 2CX3A 1GRXA 4POLA 4ZBBA 4KSOA 3TDGA 1KBNA 1A24A 1GNWA 2OE3A 1R5AA 4V2LA 4GSNA 4Z2UA 2IN3A 4NHWA 3APQA 5F0GA 5GSSA 2YP6A 4NV2A 3FW2A 2E7PA 3GRXA 4YKFA 5D9TA 3HDCA 5B6NA 4Z2TA 3CTGA 4MP4A 2CT6A 3U5RE 4L5LA 1T00A 3QOUA 1Y6EA 1BAYA 2V32A 5A5KA 1YQ1A 3CTFA 2FWGA 5IIZA 3JCML 1O7UA 3E9JB 1TU8A 2M80A 3GUSA 2VLTA 3MSZA 2PN8A 1TKDB 1ERTA 12GSA 1QGVA 4O5QA 4GQFA 4E8HA 1K0MA 2HFDA 3BOAA 5COHA 2HRFA 3IA1A 1XW6A 1JZWA 2YWMA 5C04A 3L9UA 1LBKA 3FZ4A 1UA5A 5ECIB 1M99A 4KUNA 2C0GA 2CZ2A 5F06A 2QKEA 1THXA 5B8AA 4NXIA 2C3NA 2YV9A 5HR2A 4BL7B 4KF9A 2FY6A 2VCQA 3IDVA 5IPHA 2AUVA 3LXTA 1U3IA 3M1GA 3QMXA 3I6AA 3QAWA 4F03A 17GSA 4AJ8A 4TRXA 8GSSA 2FWFA 5CNWA 2R6KA 1SK0A 5H5QA 4N30A 4PX1A 4DSRA 4F0CA 5B7CA 2BJXA 4ULXA 2R0PA 2D2ZA 3VPQA 2OACA 3PR8A 1XCCA 5A4WA 4BVYB 3D4TA 4EDYA 2MMZA 5DCGA 3SBCA 2IMKA 2GGTA 7GSSA 2XBIA 4HZ2A 4Q5QA 2IWTA 5ECLB 1HYUA 2GSQA 3LSZA 4G0LA 4EL1A 5E4WA 4IVFA 4NWYA 1ACVA 3W8SA 1SENA 1ZMAA 2LV3A 2B1KA 1FOVA 1ML6A 2I81A 3UJ1A 1OE7A 2VO4A 1EP7A 3HVNA 1GUMA 4PXOA 5ECHB 3DGQA 2X49A 3UBKA 2O87A 3EYTA 1OYJA 1V57A 4IP1A 5FWGA 1WIKA 2A4VA 5GSTA 1EGRA 1OKDA 3MAKA 3LW9A 4FYBA 2HSHA 3O3TA 1J08A 1GWCA 4TR1A 1K0NA 1IYIA 4IQAA 4IGJA 3TB2A 1JLWA 4ZBDA 2WDUA 4AGSA 1Z7RA 5HFKA 1YEPA 5CO3A 2ES7A 5FHIA 4RI6A 3UBLA 1WOUA 4EKZA 22GSA 4HU7A 3F8UA 1GSDA 3IE3A 4IKHA 2TIRA 3TCOA 5GAPD 2H1AA 4ECCA 4GQCA 5DQYA 3SWLA 3TKSE 1GSYA 3FMWA 1HNBA 4TR4A 3ZZXA 2K9FA 1PX7A 3IV4A 2WB9A 4XS4B 1ZOFA 3RPNA 4ZB8A 3N5OA 4ZB9A 1QUWA 1NW2A 3DMLA 4XS6A 5D93A 2FCHA 2VD0A 4G0KA 1DBYA 4IW9A 3D21A 2L5LA 2HRNA 5KOXA 3BBYA 3US3A 1XXUA 2AJQB 1ZYQB 1HNAA 3CMIA 4L0UA 2TRCP 6GSXA 2PPTA 1FB6A 1PRXA 4WKWA 3CSHA 4E8EA 3D22A 2O85A 1A0RP 2E2GA 1WRYA 1I5GA 2I3YA 1K3LA 3KH9A 1XZOA 3CXGA 1XIYA 2X8HA 1SJ6A 2F51A 4OFTA 20GSA 3ZVJA 4ZXGA 1V2AA 3A5IA 2NVLA 4JRRA 3ZVJD 4I5QA 5B8BA 4ACSA 1W89A 1Z5YE 2H76A 3APOA 1V40A 5B6MA 3HJPA 5G31A 3DWVA 4JBBA 1GLPA 1EWXA 2A2RA 4BVXA 2L6DA 3WGEA 1OC3A 2VCTA 2YPMA 2N5BA 1Z3EA 3ZRDA 1M0UA 1MEKA 2DIYA 1O85A 2XBQA 3F3RA 2GZZA 2JU5A 3NZNA 5G30A 1UVZA 2QGVA 4MZBA 1M2AA 4P3YB 1XFLA 1FVJA 4KNDA 1OE8A 3VLNA 3KP9A 1WPIA 3GHAA 1SYRA 5ECRB 4TW5A 2H74A 3HVXA 3LJRA 4Q5NA 1T1VA 1B9YC 2VM2A 5D73A 3TUEA 1YJ6A 1MDIA 3ERWA 2LSTA 4MJAA 2GDRA 2H0GA 4MPFA 5DJLA 1YKCA 1JFUA 3F3QA 3ZMLA 2KP2A 3L0HA 2VL2A 3EPTA 4WBRD 4KAEA 1WMJA 3A3TA 3CSIA 4NMUA 2DLXA 4CW9A 1NHYA 2PVQA 5KEJA 1EV4A 3L9SA 3QPMA 1XW5A 3GFKA 1JZRA 5F07A 4WEYA 3LWAA 4I2TA 4EXJA 2VL9A 3ERGA 3LFLA 1A23A 3KM6A 2CAQA 3UEMA 3KTLA 19GSA 4XHMA 1E6BA 4KSMA 1U88A 5DALA 4WR4A 3EWLA 2VD1A 2LS5A 5LCZA 4KDUA 1AAZA 4HU9A 2QSIA 5IMCA 3F0IA 4GLTA 3MYDA 3DD3A 1SU9A 1H75A 4CY6A 2I9HA 3FZ5A 1I9DA 1TRVA 5IPGA 1XPVA 1ZYEA 5ECKB 3LYKA 3G7YA 4V1Ap 1X9SB 6GSTA 2X99A 3UARA 2H66A 5DAKB 4EF0A 1Z9HA 3HA9A 2OADA 1M2BA 3UIWA 4OMVA 4O5RA 2MZCA 1TK0B 4LL1B 4NHZA 1KNGA 1A2MA 5ID2A 2EC4A 3HZ4A 2C3TA 1K0AA 3A2WA 3GTUA 2KOKA 3BD2A 1Q4JA 3IOSA 4LLRA 4RI7A 3L4NA 4HQZA 3D0ZA 2LQQA 1MDKA 3UOMA 2WS2A 2B1LA 5INYA 5ENUA 2DSAA 3EINA 4GF0A 5DJMA 4DSSA 1YEXA 1AQVA 4N10A 3TJKA 4K7IA 5H5RA 3IAM2 3FKFA 1PN0A 4KE3A 1MD3A 1TRWA 3GKKA 4BIKA 5ELGA 3C8EA 4MJBA 4K1FA 1HQOA 4PQIA 3GSSA 3J7Yb 3HD5A 4XS1A 3GV1A 2LNSA 4OCFA 4KDXA 2J23A 3FR3A 2GSSA 2IMFA 2GSTA 2V6OA 3ME8A 1V58A 3DYRA 3ME7A 3KTBA 2B3SA 2YN1A 5CREA 5HFGA 1QXHA 3TKSC 2IMEA 2VM1A 5GZZB 4PUFC 1XWGA 4RQRA 2HI7A 1GL8A 4CY8A 4Q5FA 1B9XC 4MZWA 1USBA 3FHKA 1VF4A 4KB3A 1GTBA 5D9XA 3KIJA 1OC9A 4ECBA 2J9HA 2YV7A 3CQFA 4I6XA 2XPDA 3QFBC 1EZKA 2H6ZA 4PURA 3L78A 2R0GA 2AAWA 2VOCA 4MH3A 4MF7A 1GUKA 3ZTLA 1AC1A 3TGZA 2LEGA 1WE0A 4K6XA 3VFIA 2DJ1A 4OWYA 5HR0A 4YQUA 1TXXA 1VF2A 3UVTA 1EV9A 3HXSA 3HZ8A 4TR0A 2JZRA 4V1Ag 2YZHA 1R5PA 3QAGA 2PERA 4TVEA 3A5WA 2BMXA 4ICYA 1X5DA 2G2QA 2OE0A 3ZL5A 2PBJA 1GP1A 5AISA 2IPAA 5IO2A 2K8VA 4MMMA 2GT6A 1K0CA 3IC4A 3WGDA 5D9WA 3C1SA 1LU4A 3RDWA 1XOAA 4K0NA 5AGYA 4DVCA 4HOJA 2JZTA 2V6KA 4MF5A 5JWRB 4MABA 1N2AA 1AXDA 2PMTA 4H86A 3VWUA 1JHBA 3FY7A 2OBIA 2EIRA 1DSBA 1PD21 2C0FA 3QCPA 4J2FA 4EIPA 4ID0A 3H1NA 4FQUA 1AQWA 4BA7A 3V1WA 4HSCX 3GKXA 5IMAA 1KEBA 3KGKA 1PL1A 1XVQA 1T4YA 1QK8A 3CRTA 3GSTA 1TDIA 3F6FA 2GS3A 1M9AA 5IOXA 1XWCA 1NSWA 4HJ2A 4YQMA 3Q6OA 4V2NA 5DVBA 2B6MA 3D5JA 4JU5A 4BL7A 1BG5A 4HI7A 4ZIJA 2RM5A 3LGCA 3LYPA 1A2JA 1PX6A 2H72A 2VLUA 2HRKA 5E59A 4Z7XA 3OR5A 2WCIA 3RHCA 3NOFA 5L71A 4K5SA 4IBPA 3FR6A 4TXOA 2H71A 1EP8A 4TN8A 2CV4A 3I43A 1VGLA 3TJGA 2H30A 2YWOA 2DBCA 4MK3A 4YAPA 3UMAA 3ISOA 3PGTA 2LJRA 2YZUA 4G19A 1RW1A 4LMWA 1FVKA 3KJYA 2IMDA 3C7MA 4X0XA 1XWBA 2HZEA 3KD0A 3E0UA 5DDLA 2HZFA 4LA1A 4ISDA 1G0TA 1SJIA 5HR1A 4CDOA 2HYXA 3TOUA 1JLVA 1FG4A 1SKSB 5JCGA 1SKRB 3VI7A 4PQHA 2MBSA 1ERVA 1Q98A 4USSA 4MPGA 1EEJA 5KOWA 2N5AA 3HCZA 3RHBA 4J56E 3IK7A 3NIVA 4WR5A 3P2AA 16GSA 4ZBAA 1SD8A 1BYEA 4K7NA 1J9BA 3D6IA 2FLSA 1M3JA 3C73A 1F9MA 1S3AA 2C80A 3ZFBA 2P31A 3KH7A 3IR4A 3GURA 3L9VA 5BRTA 2LRCA 2E0QA 1THOA 3U6VA 2WULA 1S3CA 1O8XA 2FGXA 2V1MA 3ZFLA 3A2VA 2K6VA 2LRNA 1B8XA 2LJAA 3DEXA 1XBSA 3DIEA 4WXTA 3GIXA 3GH9A 3QD9A 3M0FA 5EL8A 1X5EA 1M3IA 1TTZA 4IJIA 1SK1A 1BQ7A 1VF1A 2H8LA 4BWQA 1AQXA 2GQKA 1GULA 4KH7A 1H4OA 2WGRA 4JZQA 3DVWA 1QQ2A 2F3MA 3MIXA 2GZPA 1FHEA 6GSUA 2E2MA 4X4JA 2DC5A 2H6XA 4G10A 1A2LA 3CYNA 2GZYA 5EPFA 5IOWA 3BJ5A 4HS1A 2C0DA 2PUKC 2XHFA 3KP8A 2BTOT 2H73A 3EURA 3P90A 4JEDA 5HR3A 2AV4A 3HYPA 4D73B 2QA1A 1HD2A 5KN1A 1B4QA 3G9BA 1PA3A 3BCIA 2G0FA 2IFQB 1FO5A 1V9WA 5ECMB 4WF4A 2YWNA 3FZ9A 2WFCA 2K18A 3UAPA 3Q18A 5ECOB 2HLSA 4QQ7A 1FAAA 3GKMA 3J7Yk 4TXVA 5GAND 1GTAA 4O5UA 3EMPA 2GQMA 3R3EA 3ED3A 3HY2A 1BEDA 1YF0A 4K5RA 5HFIA 2F8FA 4MLYA 4WBJA 1S3RA 5DBQA 5G1KA 4G0IA 2OJLA 3HHVA 2R2JA 4POKA 1ZYPA 5IO0A 4MJCA 1QMVA 2H70A 5G5FA 1T7PB 3GNJA 1F3BA 3S9FA 1GSFA 1ILOA 2RUEA 2EIOA 1ZCPA 3G7JA 4POBA 5F05A 3APSA 5D96A 4OO4A 4YAVA 4XTSA 1SL2B 4FO5A 4L8EA 1GTIA 4EDZA 5CRWA 4F2IA 1O73A 1OAZA 3F4SA 2IMIA 3CRUA 6GSYA 13GSA 2L4QA 2ZCTA 3KCMA 1DE1A 4XCSA 3VWWA 4ECIA 2XPEA 3IRAA 2VIMA 1GH2A 2X4AA 2JADA 2MYGA 5FT3A 2X64A 4ZILA 5ECNB 2WZ9A 1F2EA 2FHEA 3A2XA 3TJJA 2DKIA 2X8GA 2H01A 1EEMA 2C3QA 4FIWA 2WRTA 4MDCA 1UC7A 1TRUA 3KMNA 2NPBA 1A8LA 5ECPB 1FW1A 2LRTA 4MCUA 3HKRA 2HNLA 5HQPA 3LG6A 1GSEA 3FRCA 3DVXA 1F3AA 2GTUA 2LQOA 1EGOA 2R4VA 3ZMKA 4GXZA 5ABRA 4MF6A 1URMA 3G7IA 1SL1B 1BJXA 4Q5RA 4ML6A 5J5NA 1U3AA
chains in the Genus database with same CATH topology
3WD6A 3IHGA 1O81A 2PVOC 1MTCA 3M9KA 2JSZA 2O89A 1N8JA 4ZL9A 2GQLA 5AIVA 1RK4A 3I9V2 4IELA 1X9MB 4EO3A 1TW9A 1YF1A 1BX9A 2YWIA 1PKZA 4MNNA 2B7KA 3CSJA 3HJMA 5CRHA 4POMA 2O7KA 2N5FA 1WP0A 4HUAA 5D8IA 2QA2A 1FOHA 4BWSA 5IMDA 1TU7A 1C72A 2HRAA 5AIXA 2DJKA 2DJJA 1VRSD 5ELAA 4K7OA 3QFAC 5DCHA 4EUYA 2AYTA 4XRDA 3DXBA 1ZL9A 2CQ9A 1SJZA 2VAFA 2B5EA 2GLRA 4ZL8A 3FZAA 2C4JA 5DAKA 4WETA 3IK9A 4F0BA 1EOGA 5JCWA 2DJ2A 1ZZYA 1T4ZA 2R3XA 2L59A 2FNOA 2HSMA 2YNXA 1RQMA 5CP1A 5LNKe 3F9UA 2DIZA 3GX0A 4ZB6A 3TKQA 1XWAA 3KMOA 5EVOA 5CRGA 3EC3A 3H8QA 4IJ3A 4GWRA 4HDEA 4PNFA 2C0EA 4ECJA 1ZGNA 2DMLA 2RIIA 1G7OA 1W4VA 1TI1A 1K3OA 1SD9A 4ILFA 1XVWA 5J9BA 1HNCA 4WF5A 1Y25A 2REMA 3P7XA 2Z9SA 2FD3A 3GL3A 5JWQB 3Q74A 4OFNA 3KZQA 6GSWA 2OBKA 1R7HA 3AY8A 3KEBA 4AJ6A 4RUVA 3IXRA 1GLQA 2VUPA 3I69A 1FB0A 3TRXA 2VCXA 2P5QA 2XC2A 2H0HA 2L5OA 4OCEA 4HQSA 1M9BA 1XOBA 5JCUA 1GSUA 1TI3A 3VWXA 4EIQA 5J4UA 1Z6MA 5DQSA 5J9CA 4O92A 2KUCA 3EU4A 2DMMA 3IPZA 4ZL7A 3O6TA 1JZOA 1NHOA 2JSYA 5IM9A 18GSA 4AF2A 1G6YA 3QAVA 1EOHA 2FA4A 2VL2C 2YJ7A 5EY6A 3RPPA 4X1UA 3EVIA 3KXOA 4EC0A 4K2XA 4L0WA 4RQXA 3M8NA 4IN0A 4KCAA 1G7EA 2WJUA 3P8WA 3FR9A 2IJYA 2YOIA 4JR4A 1VF3A 2B5XA 3QR6A 1TOFA 3TOTA 2HXKA 4OD7A 4K8MA 4TXOB 1AW9A 1T3BA 2M72A 4TR1B 2TRXA 1A8YA 4FYCA 3PPUA 4XRAA 5H5SA 3MNGA 1SK2A 3IC8A 3H4KA 1S3DA 4IP6A 4V2MA 4K2DA 2B5YA 6GSSA 2HT9A 3CBUA 2HZEB 5G1LA 5KN0A 3EMXA 2DKHA 4G9HA 4XIHA 2ON7A 2GSRA 2VCVA 4KA0A 3ERFA 3DRNA 5IMVA 1AIUA 2F8AA 4YH2A 5G5EA 1ST9A 1IYHA 3TRPA 4DSQA 1PSQA 1V98A 1CQGA 3LORA 1WWJA 3GL5A 3MDKA 3N9JA 3EU3A 3WYWA 2A2SA 1T8EB 1TP9A 3PINA 4TOPA 4JR6A 4BVYA 2ON5A 4F9ZA 4YKGA 2C1YA 2LKUA 5IQYA 3C71A 1J0FA 1CQHA 1ABAA 1KTEA 4HJMA 2FA8A 4FYUA 1K0OA 4OO5A 5F8BA 2X8CA 3F4RA 3PH9A 1E2YA 6GSVA 1ON4A 1SYXA 2VL3A 2HSYA 3UVHA 1MDJA 2DJ3A 1ZYNA 1X9WB 2OKAA 5C00A 4PNGA 3WT2A 1A0FA 1ERUA 4EE0A 1DUGA 4N0VA 3H93A 2JZSA 1GSSA 3FEUA 5AN1A 3ZITA 2DJ0A 2GT5A 2NBSA 4IQ1A 3RBTA 3VPTA 5KN2A 2CVDA 2QC7A 3GH6A 1B4PA 4YQVA 3K8NA 1OKTA 5CAXA 4KDYA 4K9ZA 2UZ8A 4X43A 1R4WA 1GTUA 2MMAA 5J3RA 2F9SA 4BVXB 5IMZA 3LEFA 4Z2RA 2NTOA 2V41A 3M3MA 3R2QA 2OE1A 3TJFA 2YCDA 2FWHA 3IHQA 2MBTA 2PU9C 1PKWA 2H1GA 3VI5A 4AJ7A 2A2PA 3O76A 4I8BA 4QL7A 3TRQA 2I4AA 3GYKA 1K0BA 3IAS2 1X0RA 2O8VB 3F4TA 3TKRA 1WJKA 3TKSA 1K0DA 1QFNA 4XS4A 2H19A 2JL4A 1Z7PA 4N0ZA 3E3EA 1SKWB 1M2DA 4JE1A 4CHSA 2AB6A 1PQNA 3IBHA 1YY7A 10GSA 3C1RA 4GTUA 5J41A 4O32A 1LJRA 2A4HA 1PMTA 2RUFA 4GSSA 9GSSA 1SL0B 4O7HA 1NM3A 2H0IA 4GSTA 4L5OA 3LXZA 1DE2A 4TKYA 4J57E 3ZYWA 5JWOB 2H75A 4LL4B 5BMUA 4K0GA 2R0CA 4KX4A 2RLIA 4IHUA 4OFMA 1F37A 3DKSA 3GX8A 5DALB 3VK9A 2L57A 2VCWA 2KLXA 3ZIJA 4I97A 4F82A 3ZIVA 1YZXA 2PWJA 2VLVA 3WGXA 5IMFA 2LUSA 1M7TA 3Q19A 2M46A 2KHPA 2H1BA 4KGIA 1GNEA 1MD4A 4GCIA 4D73A 1K3YA 1U6TA 1ERWA 4BPYA 2H1DA 2MMNA 3W8JA 2IFQA 1PN9A 2R37A 1PGTA 2P5RA 3FYGA 2ZNMA 3VWVA 4QL9A 1G6WA 2EIQA 3QDNA 2P0GA 5ECSA 3M9JA 3GKNA 5A4VA 3HVVA 3D4MA 4NAXA 1TK8B 5CYYA 4PUAA 14GSA 4EVMA 5ID2B 2K8SA 5LD0A 2ALBA 1F6MC 3EE2A 3GTUB 4MZCA 2CX4A 2OA7A 3BCKA 2I1UA 4GRFA 3MWHA 1O8WA 2IL3A 1OVNA 2AHEA 4DSSB 2CVBA 4KW6A 3TKPA 4HZ4A 1OC8A 4ML1A 4KCEA 2CVKA 1YDKA 3FK8A 4PQ1A 2FWEA 2ZUPA 5ECQB 3HVSA 4MA9A 5CRDA 2CZ3A 1Z6NA 1UN2A 2PGTA 3GA4A 2HE3A 2LNTA 2NDOA 3ZREA 4G2EA 1TRSA 2CAIA 1U87A 5A4UA 4HEA2 4DEJA 3RAZA 2FUG2 1PL2A 3WT1A 2JACA 4IS0A 2H6YA 2V2GA 1XW9A 3F6DA 2KP1A 2B7JA 2YJHA 4NPBA 3HJOA 2C8UA 4PGTA 4MJEA 1TJDA 2L4CA 1OC9B 2CA8A 2R5GA 1GSQA 1YKAA 2VCZA 2LJKA 3ZLPA 5D9VA 3W6GA 3H79A 1GUHA 1B48A 5KN3A 1XWKA 3VURA 3TJBA 1TK5B 4LMVA 3GMFA 2YANA 4I2UA 4A5PA 3F63A 2MMOA 4N11A 1X5CA 2LTKA 11GSA 3LQ7A 3GN3A 4TR3A 1O6JA 4FH8A 4PTSA 3UL3A 5G2ZA 1R26A 2RM6A 2IIYA 2GVPA 1AUCA 1JZDA 4NV5A 2L6CA 4MH2A 2CX3A 1GRXA 4POLA 4ZBBA 4KSOA 3TDGA 1KBNA 1A24A 1GNWA 2OE3A 1R5AA 4V2LA 4GSNA 4Z2UA 2IN3A 4NHWA 3APQA 5F0GA 5GSSA 2YP6A 4NV2A 3FW2A 2E7PA 3GRXA 4YKFA 5D9TA 3HDCA 5B6NA 4Z2TA 3CTGA 4MP4A 2CT6A 3U5RE 4L5LA 1T00A 3QOUA 1Y6EA 1BAYA 2V32A 5A5KA 1YQ1A 3CTFA 2FWGA 5IIZA 3JCML 1O7UA 3E9JB 1TU8A 2M80A 3GUSA 2VLTA 3MSZA 2PN8A 1TKDB 1ERTA 12GSA 1QGVA 4O5QA 4GQFA 4E8HA 1K0MA 2HFDA 3BOAA 5COHA 2HRFA 3IA1A 1XW6A 1JZWA 2YWMA 5C04A 3L9UA 1LBKA 3FZ4A 1UA5A 5ECIB 1M99A 4KUNA 2C0GA 2CZ2A 5F06A 2QKEA 1THXA 5B8AA 4NXIA 2C3NA 2YV9A 5HR2A 4BL7B 4KF9A 2FY6A 2VCQA 3IDVA 5IPHA 2AUVA 3LXTA 1U3IA 3M1GA 3QMXA 3I6AA 3QAWA 4F03A 17GSA 4AJ8A 4TRXA 8GSSA 2FWFA 5CNWA 2R6KA 1SK0A 5H5QA 4N30A 4PX1A 4DSRA 4F0CA 5B7CA 2BJXA 4ULXA 2R0PA 2D2ZA 3VPQA 2OACA 3PR8A 1XCCA 5A4WA 4BVYB 3D4TA 4EDYA 2MMZA 5DCGA 3SBCA 2IMKA 2GGTA 7GSSA 2XBIA 4HZ2A 4Q5QA 2IWTA 5ECLB 1HYUA 2GSQA 3LSZA 4G0LA 4EL1A 5E4WA 4IVFA 4NWYA 1ACVA 3W8SA 1SENA 1ZMAA 2LV3A 2B1KA 1FOVA 1ML6A 2I81A 3UJ1A 1OE7A 2VO4A 1EP7A 1GUMA 4PXOA 5ECHB 3DGQA 2X49A 3UBKA 2O87A 3EYTA 1OYJA 1V57A 4IP1A 5FWGA 1WIKA 2A4VA 5GSTA 1EGRA 1OKDA 3MAKA 3LW9A 4FYBA 2HSHA 3O3TA 1J08A 1GWCA 4TR1A 1K0NA 1IYIA 4IQAA 4IGJA 3TB2A 1JLWA 4ZBDA 2WDUA 4AGSA 1Z7RA 5HFKA 1YEPA 5CO3A 2ES7A 5FHIA 4RI6A 3UBLA 1WOUA 4EKZA 22GSA 4HU7A 3F8UA 1GSDA 3IE3A 4IKHA 2TIRA 3TCOA 5GAPD 2H1AA 4ECCA 4GQCA 5DQYA 3SWLA 3TKSE 1GSYA 3FMWA 1HNBA 4TR4A 3ZZXA 2K9FA 1PX7A 3IV4A 2WB9A 4XS4B 1ZOFA 3RPNA 4ZB8A 3N5OA 4ZB9A 1QUWA 1NW2A 3DMLA 4XS6A 5D93A 2FCHA 2VD0A 4G0KA 1DBYA 4IW9A 3D21A 2L5LA 2HRNA 5KOXA 3BBYA 3US3A 1XXUA 2AJQB 1ZYQB 1HNAA 3CMIA 4L0UA 2TRCP 6GSXA 2PPTA 1FB6A 1PRXA 4WKWA 3CSHA 4E8EA 3D22A 2O85A 1A0RP 2E2GA 1WRYA 1I5GA 2I3YA 1K3LA 3KH9A 1XZOA 3CXGA 1XIYA 2X8HA 1SJ6A 2F51A 4OFTA 20GSA 3ZVJA 4ZXGA 1V2AA 3A5IA 2NVLA 4JRRA 3ZVJD 4I5QA 5B8BA 4ACSA 1W89A 1Z5YE 2H76A 3APOA 1V40A 5B6MA 3HJPA 5G31A 3DWVA 4JBBA 1GLPA 1EWXA 2A2RA 4BVXA 2L6DA 3WGEA 1OC3A 2VCTA 2YPMA 2N5BA 1Z3EA 3ZRDA 1M0UA 1MEKA 2DIYA 1O85A 2XBQA 3F3RA 2GZZA 2JU5A 3NZNA 5G30A 1UVZA 2QGVA 4MZBA 1M2AA 4P3YB 1XFLA 1FVJA 4KNDA 1OE8A 3VLNA 3KP9A 1WPIA 3GHAA 1SYRA 5ECRB 4TW5A 2H74A 3HVXA 3LJRA 4Q5NA 1T1VA 1B9YC 2VM2A 5D73A 3TUEA 1YJ6A 1MDIA 3ERWA 2LSTA 4MJAA 2GDRA 2H0GA 4MPFA 5DJLA 1YKCA 1JFUA 3F3QA 3ZMLA 2KP2A 3L0HA 2VL2A 3EPTA 4WBRD 4KAEA 1WMJA 3A3TA 3CSIA 4NMUA 2DLXA 4CW9A 1NHYA 2PVQA 5KEJA 1EV4A 3L9SA 3QPMA 1XW5A 3GFKA 1JZRA 5F07A 4WEYA 3LWAA 4I2TA 4EXJA 2VL9A 3ERGA 3LFLA 1A23A 3KM6A 2CAQA 3UEMA 3KTLA 19GSA 4XHMA 1E6BA 4KSMA 1U88A 5DALA 4WR4A 3EWLA 2VD1A 2LS5A 5LCZA 4KDUA 1AAZA 4HU9A 2QSIA 5IMCA 3F0IA 4GLTA 3MYDA 3DD3A 1SU9A 1H75A 4CY6A 2I9HA 3FZ5A 1I9DA 1TRVA 5IPGA 1XPVA 1ZYEA 5ECKB 3LYKA 3G7YA 4V1Ap 1X9SB 6GSTA 2X99A 3UARA 2H66A 5DAKB 4EF0A 1Z9HA 3HA9A 2OADA 1M2BA 3UIWA 4OMVA 4O5RA 2MZCA 1TK0B 4LL1B 4NHZA 1KNGA 1A2MA 5ID2A 2EC4A 3HZ4A 2C3TA 1K0AA 3A2WA 3GTUA 2KOKA 3BD2A 1Q4JA 3IOSA 4LLRA 4RI7A 3L4NA 4HQZA 3D0ZA 2LQQA 1MDKA 3UOMA 2WS2A 2B1LA 5INYA 5ENUA 2DSAA 3EINA 4GF0A 5DJMA 4DSSA 1YEXA 1AQVA 4N10A 3TJKA 4K7IA 5H5RA 3IAM2 3FKFA 1PN0A 4KE3A 1MD3A 1TRWA 3GKKA 5ELGA 3C8EA 4MJBA 4K1FA 1HQOA 4PQIA 3GSSA 3J7Yb 3HD5A 4XS1A 3GV1A 2LNSA 4OCFA 4KDXA 2J23A 3FR3A 2GSSA 2IMFA 2GSTA 2V6OA 3ME8A 1V58A 3DYRA 3ME7A 3KTBA 2B3SA 2YN1A 5CREA 5HFGA 1QXHA 3TKSC 2IMEA 2VM1A 5GZZB 4PUFC 1XWGA 4RQRA 2HI7A 1GL8A 4CY8A 4Q5FA 1B9XC 4MZWA 1USBA 3FHKA 1VF4A 4KB3A 1GTBA 5D9XA 3KIJA 1OC9A 4ECBA 2J9HA 2YV7A 4I6XA 2XPDA 3QFBC 1EZKA 2H6ZA 3L78A 4PURA 2R0GA 2AAWA 2VOCA 4MH3A 4MF7A 1GUKA 3ZTLA 1AC1A 3TGZA 2LEGA 1WE0A 4K6XA 3VFIA 2DJ1A 4OWYA 5HR0A 4YQUA 1TXXA 1VF2A 3UVTA 1EV9A 3HXSA 3HZ8A 4TR0A 2JZRA 4V1Ag 2YZHA 1R5PA 3QAGA 2PERA 4TVEA 3A5WA 2BMXA 4ICYA 1X5DA 2G2QA 2OE0A 3ZL5A 2PBJA 1GP1A 5AISA 2IPAA 5IO2A 2K8VA 4MMMA 2GT6A 1K0CA 3IC4A 3WGDA 5D9WA 3C1SA 1LU4A 3RDWA 1XOAA 4K0NA 5AGYA 4DVCA 4HOJA 2JZTA 2V6KA 4MF5A 5JWRB 4MABA 1N2AA 1AXDA 2PMTA 4H86A 3VWUA 1JHBA 3FY7A 2OBIA 2EIRA 1DSBA 1PD21 2C0FA 3QCPA 4J2FA 4EIPA 4ID0A 3H1NA 4FQUA 1AQWA 4BA7A 3V1WA 3GKXA 5IMAA 1KEBA 3KGKA 1PL1A 1XVQA 1T4YA 1QK8A 3CRTA 3GSTA 1TDIA 3F6FA 2GS3A 1M9AA 5IOXA 1XWCA 1NSWA 4HJ2A 4YQMA 3Q6OA 4V2NA 5DVBA 2B6MA 3D5JA 4JU5A 4BL7A 1BG5A 4HI7A 4ZIJA 2RM5A 3LGCA 3LYPA 1A2JA 1PX6A 2H72A 2VLUA 2HRKA 5E59A 4Z7XA 3OR5A 2WCIA 3RHCA 3NOFA 5L71A 4K5SA 4IBPA 3FR6A 4TXOA 2H71A 1EP8A 4TN8A 2CV4A 3I43A 1VGLA 3TJGA 2H30A 2YWOA 2DBCA 4MK3A 4YAPA 3UMAA 3ISOA 3PGTA 2LJRA 2YZUA 4G19A 1RW1A 4LMWA 1FVKA 3KJYA 2IMDA 3C7MA 4X0XA 1XWBA 2HZEA 3KD0A 3E0UA 5DDLA 2HZFA 4LA1A 4ISDA 1G0TA 1SJIA 5HR1A 4CDOA 2HYXA 3TOUA 1JLVA 1FG4A 1SKSB 5JCGA 1SKRB 3VI7A 4PQHA 2MBSA 1ERVA 1Q98A 4USSA 4MPGA 1EEJA 5KOWA 2N5AA 3HCZA 3RHBA 4J56E 3IK7A 3NIVA 4WR5A 3P2AA 16GSA 4ZBAA 1SD8A 1BYEA 4K7NA 1J9BA 3D6IA 2FLSA 3C73A 1F9MA 1S3AA 2C80A 3ZFBA 2P31A 3KH7A 3IR4A 3GURA 3L9VA 5BRTA 2LRCA 2E0QA 1THOA 3U6VA 2WULA 1S3CA 1O8XA 2FGXA 2V1MA 3ZFLA 3A2VA 2K6VA 2LRNA 1B8XA 2LJAA 3DEXA 1XBSA 3DIEA 4WXTA 3GIXA 3GH9A 3QD9A 3M0FA 5EL8A 1X5EA 1TTZA 4IJIA 1SK1A 1BQ7A 1VF1A 2H8LA 4BWQA 1AQXA 2GQKA 1GULA 4KH7A 1H4OA 2WGRA 4JZQA 3DVWA 1QQ2A 2F3MA 3MIXA 2GZPA 1FHEA 6GSUA 2E2MA 4X4JA 2DC5A 2H6XA 4G10A 1A2LA 3CYNA 2GZYA 5EPFA 5IOWA 3BJ5A 4HS1A 2C0DA 2PUKC 2XHFA 3KP8A 2BTOT 2H73A 3EURA 3P90A 4JEDA 5HR3A 2AV4A 3HYPA 4D73B 2QA1A 1HD2A 5KN1A 1B4QA 3G9BA 1PA3A 3BCIA 2G0FA 2IFQB 1FO5A 1V9WA 5ECMB 4WF4A 2YWNA 3FZ9A 2WFCA 2K18A 3UAPA 3Q18A 5ECOB 2HLSA 4QQ7A 1FAAA 3GKMA 3J7Yk 4TXVA 5GAND 1GTAA 4O5UA 3EMPA 2GQMA 3R3EA 3ED3A 3HY2A 1BEDA 1YF0A 4K5RA 5HFIA 2F8FA 4WBJA 4MLYA 5DBQA 5G1KA 4G0IA 2OJLA 3HHVA 2R2JA 4POKA 1ZYPA 5IO0A 4MJCA 1QMVA 2H70A 5G5FA 1T7PB 3GNJA 1F3BA 3S9FA 1GSFA 1ILOA 2RUEA 2EIOA 1ZCPA 3G7JA 4POBA 5F05A 3APSA 5D96A 4OO4A 4YAVA 4XTSA 1SL2B 4FO5A 4L8EA 1GTIA 4EDZA 5CRWA 4F2IA 1O73A 1OAZA 3F4SA 2IMIA 3CRUA 6GSYA 13GSA 2L4QA 2ZCTA 3KCMA 1DE1A 4XCSA 3VWWA 4ECIA 2XPEA 3IRAA 2VIMA 1GH2A 2X4AA 2JADA 2MYGA 5FT3A 2X64A 4ZILA 5ECNB 2WZ9A 1F2EA 2FHEA 3A2XA 3TJJA 2DKIA 2X8GA 2H01A 1EEMA 2C3QA 4FIWA 2WRTA 1UC7A 4MDCA 1TRUA 3KMNA 2NPBA 1A8LA 5ECPB 1FW1A 2LRTA 4MCUA 3HKRA 2HNLA 5HQPA 3LG6A 1GSEA 3FRCA 3DVXA 1F3AA 2GTUA 2LQOA 1EGOA 2R4VA 3ZMKA 4GXZA 5ABRA 4MF6A 1URMA 3G7IA 1SL1B 1BJXA 4Q5RA 4ML6A 5J5NA 1U3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WD6 A;  1O81 A;  2PVO C;  1MTC A;  3M9K A;  2JSZ A;  2O89 A;  1N8J A;  4ZL9 A;  2GQL A;  5AIV A;  1RK4 A;  3I9V 2;  4IEL A;  1X9M B;  4EO3 A;  1TW9 A;  1YF1 A;  1BX9 A;  2YWI A;  1PKZ A;  2B7K A;  3CSJ A;  3HJM A;  5CRH A;  4POM A;  2O7K A;  2N5F A;  1WP0 A;  4HUA A;  5D8I A;  4BWS A;  5IMD A;  1TU7 A;  1C72 A;  5AIX A;  2DJK A;  2DJJ A;  1VRS D;  5ELA A;  4K7O A;  3QFA C;  5DCH A;  4EUY A;  2AYT A;  4XRD A;  3DXB A;  1ZL9 A;  2CQ9 A;  1SJZ A;  2VAF A;  2B5E A;  2GLR A;  4ZL8 A;  3FZA A;  2C4J A;  5DAK A;  4WET A;  3IK9 A;  4F0B A;  1EOG A;  5JCW A;  2DJ2 A;  1ZZY A;  1T4Z A;  2R3X A;  2L59 A;  2FNO A;  2YNX A;  1RQM A;  5CP1 A;  5LNK e;  3F9U A;  2DIZ A;  3GX0 A;  4ZB6 A;  3TKQ A;  1XWA A;  3KMO A;  5EVO A;  5CRG A;  3EC3 A;  3H8Q A;  4IJ3 A;  4GWR A;  4HDE A;  4PNF A;  2C0E A;  4ECJ A;  1ZGN A;  2DML A;  2RII A;  1G7O A;  1W4V A;  1TI1 A;  1K3O A;  1SD9 A;  4ILF A;  1XVW A;  5J9B A;  1HNC A;  4WF5 A;  1Y25 A;  2REM A;  3P7X A;  2Z9S A;  2FD3 A;  3GL3 A;  5JWQ B;  3Q74 A;  4OFN A;  3KZQ A;  6GSW A;  2OBK A;  1R7H A;  3AY8 A;  3KEB A;  4AJ6 A;  4RUV A;  3IXR A;  1GLQ A;  2VUP A;  3I69 A;  1FB0 A;  3TRX A;  2VCX A;  2P5Q A;  2XC2 A;  2H0H A;  2L5O A;  4OCE A;  4HQS A;  1M9B A;  1XOB A;  5JCU A;  1GSU A;  1TI3 A;  3VWX A;  5J4U A;  1Z6M A;  5DQS A;  5J9C A;  4O92 A;  2KUC A;  3EU4 A;  2DMM A;  3IPZ A;  4ZL7 A;  3O6T A;  1JZO A;  1NHO A;  2JSY A;  5IM9 A;  18GS A;  4AF2 A;  1G6Y A;  3QAV A;  1EOH A;  2FA4 A;  2VL2 C;  2YJ7 A;  5EY6 A;  3RPP A;  4X1U A;  3EVI A;  3KXO A;  4EC0 A;  4L0W A;  4RQX A;  3M8N A;  4IN0 A;  4KCA A;  1G7E A;  2WJU A;  3P8W A;  3FR9 A;  2IJY A;  2YOI A;  4JR4 A;  1VF3 A;  2B5X A;  3QR6 A;  1TOF A;  3TOT A;  2HXK A;  4OD7 A;  4K8M A;  4TXO B;  1AW9 A;  1T3B A;  2M72 A;  4TR1 B;  2TRX A;  1A8Y A;  4FYC A;  4XRA A;  5H5S A;  3MNG A;  1SK2 A;  3H4K A;  1S3D A;  4IP6 A;  4V2M A;  4K2D A;  2B5Y A;  6GSS A;  2HT9 A;  3CBU A;  2HZE B;  5G1L A;  5KN0 A;  3EMX A;  4G9H A;  4XIH A;  2ON7 A;  2GSR A;  2VCV A;  4KA0 A;  3ERF A;  3DRN A;  5IMV A;  1AIU A;  2F8A A;  4YH2 A;  5G5E A;  1ST9 A;  1IYH A;  3TRP A;  4DSQ A;  1PSQ A;  1V98 A;  1CQG A;  3LOR A;  1WWJ A;  3GL5 A;  3MDK A;  3N9J A;  3EU3 A;  3WYW A;  2A2S A;  1T8E B;  1TP9 A;  3PIN A;  4TOP A;  4JR6 A;  4BVY A;  2ON5 A;  4F9Z A;  2C1Y A;  2LKU A;  5IQY A;  3C71 A;  1J0F A;  1CQH A;  1ABA A;  1KTE A;  4HJM A;  2FA8 A;  4FYU A;  1K0O A;  4OO5 A;  5F8B A;  2X8C A;  3F4R A;  3PH9 A;  1E2Y A;  6GSV A;  1ON4 A;  1SYX A;  2VL3 A;  2HSY A;  3UVH A;  1MDJ A;  2DJ3 A;  1X9W B;  2OKA A;  5C00 A;  4PNG A;  3WT2 A;  1A0F A;  1ERU A;  4EE0 A;  1DUG A;  4N0V A;  3H93 A;  2JZS A;  1GSS A;  3FEU A;  5AN1 A;  3ZIT A;  2DJ0 A;  2GT5 A;  2NBS A;  4IQ1 A;  3RBT A;  3VPT A;  5KN2 A;  2CVD A;  2QC7 A;  3GH6 A;  1B4P A;  4YQV A;  3K8N A;  1OKT A;  5CAX A;  4KDY A;  4K9Z A;  4X43 A;  1R4W A;  1GTU A;  2MMA A;  5J3R A;  2F9S A;  5IMZ A;  3LEF A;  2NTO A;  2V41 A;  3M3M A;  3R2Q A;  2OE1 A;  3TJF A;  2YCD A;  2FWH A;  3IHQ A;  2MBT A;  2PU9 C;  1PKW A;  2H1G A;  3VI5 A;  4AJ7 A;  3O76 A;  4I8B A;  4QL7 A;  3TRQ A;  2I4A A;  3GYK A;  1K0B A;  3IAS 2;  1X0R A;  2O8V B;  3F4T A;  3TKR A;  1WJK A;  3TKS A;  1K0D A;  1QFN A;  4XS4 A;  2H19 A;  2JL4 A;  1Z7P A;  4N0Z A;  3E3E A;  1SKW B;  1M2D A;  4JE1 A;  4CHS A;  2AB6 A;  1PQN A;  3IBH A;  1YY7 A;  10GS A;  3C1R A;  4GTU A;  5J41 A;  4O32 A;  1LJR A;  4GSS A;  1PMT A;  2RUF A;  9GSS A;  1SL0 B;  4O7H A;  1NM3 A;  2H0I A;  4GST A;  4L5O A;  3LXZ A;  1DE2 A;  4TKY A;  4J57 E;  3ZYW A;  5JWO B;  2H75 A;  4LL4 B;  4K0G A;  4KX4 A;  2RLI A;  4IHU A;  4OFM A;  1F37 A;  3DKS A;  3GX8 A;  5DAL B;  3VK9 A;  2L57 A;  2VCW A;  2KLX A;  3ZIJ A;  4I97 A;  4F82 A;  3ZIV A;  1YZX A;  2PWJ A;  2VLV A;  3WGX A;  5IMF A;  2LUS A;  1M7T A;  3Q19 A;  2M46 A;  2KHP A;  2H1B A;  4KGI A;  1GNE A;  1MD4 A;  4GCI A;  4D73 A;  1K3Y A;  1U6T A;  1ERW A;  4BPY A;  2H1D A;  2MMN A;  3W8J A;  2IFQ A;  1PN9 A;  2R37 A;  1PGT A;  2P5R A;  3FYG A;  2ZNM A;  3VWV A;  4QL9 A;  1G6W A;  2EIQ A;  3QDN A;  2P0G A;  5ECS A;  3M9J A;  3GKN A;  5A4V A;  3HVV A;  3D4M A;  4NAX A;  1TK8 B;  5CYY A;  4PUA A;  14GS A;  4EVM A;  5ID2 B;  2K8S A;  5LD0 A;  2ALB A;  1F6M C;  3EE2 A;  3GTU B;  4MZC A;  2CX4 A;  2OA7 A;  3BCK A;  2I1U A;  4GRF A;  3MWH A;  1O8W A;  2IL3 A;  1OVN A;  2AHE A;  4DSS B;  2CVB A;  4KW6 A;  3TKP A;  4HZ4 A;  1OC8 A;  4ML1 A;  4KCE A;  2CVK A;  1YDK A;  3FK8 A;  4PQ1 A;  2FWE A;  2ZUP A;  5ECQ B;  3HVS A;  4MA9 A;  5CRD A;  2CZ3 A;  1Z6N A;  1UN2 A;  2PGT A;  3GA4 A;  2HE3 A;  2LNT A;  2NDO A;  3ZRE A;  4G2E A;  1TRS A;  2CAI A;  1U87 A;  5A4U A;  4HEA 2;  4DEJ A;  3RAZ A;  2FUG 2;  1PL2 A;  3WT1 A;  2JAC A;  4IS0 A;  2H6Y A;  2V2G A;  1XW9 A;  3F6D A;  2KP1 A;  2B7J A;  2YJH A;  4NPB A;  3HJO A;  2C8U A;  4PGT A;  4MJE A;  1TJD A;  2L4C A;  1OC9 B;  2CA8 A;  2R5G A;  1GSQ A;  1YKA A;  2VCZ A;  2LJK A;  3ZLP A;  5D9V A;  3W6G A;  3H79 A;  1GUH A;  1B48 A;  5KN3 A;  1XWK A;  3VUR A;  3TJB A;  1TK5 B;  4LMV A;  3GMF A;  2YAN A;  4I2U A;  3F63 A;  2MMO A;  4N11 A;  1X5C A;  2LTK A;  11GS A;  3LQ7 A;  3GN3 A;  4TR3 A;  1O6J A;  4FH8 A;  3UL3 A;  5G2Z A;  1R26 A;  2RM6 A;  2IIY A;  2GVP A;  1AUC A;  1JZD A;  4NV5 A;  2L6C A;  4MH2 A;  2CX3 A;  1GRX A;  4POL A;  4ZBB A;  4KSO A;  3TDG A;  1KBN A;  1A24 A;  1GNW A;  2OE3 A;  1R5A A;  4V2L A;  4GSN A;  2IN3 A;  4NHW A;  3APQ A;  5F0G A;  5GSS A;  2YP6 A;  4NV2 A;  3FW2 A;  2E7P A;  3GRX A;  5D9T A;  3HDC A;  5B6N A;  3CTG A;  4MP4 A;  2CT6 A;  3U5R E;  4L5L A;  1T00 A;  3QOU A;  1Y6E A;  1BAY A;  2V32 A;  5A5K A;  1YQ1 A;  3CTF A;  2FWG A;  5IIZ A;  3JCM L;  1O7U A;  3E9J B;  1TU8 A;  2M80 A;  3GUS A;  2VLT A;  3MSZ A;  2PN8 A;  1TKD B;  1ERT A;  12GS A;  1QGV A;  4GQF A;  4E8H A;  1K0M A;  2HFD A;  3BOA A;  5COH A;  2HRF A;  3IA1 A;  1XW6 A;  1JZW A;  2YWM A;  5C04 A;  3L9U A;  1LBK A;  3FZ4 A;  1UA5 A;  5ECI B;  1M99 A;  4KUN A;  2C0G A;  2CZ2 A;  5F06 A;  2QKE A;  1THX A;  5B8A A;  4NXI A;  2C3N A;  2YV9 A;  5HR2 A;  2FY6 A;  2VCQ A;  3IDV A;  5IPH A;  2AUV A;  3LXT A;  1U3I A;  3M1G A;  3QMX A;  3I6A A;  3QAW A;  4F03 A;  17GS A;  4AJ8 A;  4TRX A;  8GSS A;  2FWF A;  5CNW A;  2R6K A;  1SK0 A;  5H5Q A;  4N30 A;  4PX1 A;  4DSR A;  4F0C A;  5B7C A;  2BJX A;  4ULX A;  2D2Z A;  3VPQ A;  2OAC A;  3PR8 A;  1XCC A;  5A4W A;  3D4T A;  4EDY A;  2MMZ A;  5DCG A;  3SBC A;  2IMK A;  2GGT A;  7GSS A;  2XBI A;  4HZ2 A;  4Q5Q A;  2IWT A;  5ECL B;  1HYU A;  2GSQ A;  3LSZ A;  4EL1 A;  5E4W A;  4IVF A;  4NWY A;  1ACV A;  3W8S A;  1SEN A;  1ZMA A;  2LV3 A;  2B1K A;  1FOV A;  1ML6 A;  2I81 A;  3UJ1 A;  1OE7 A;  2VO4 A;  1EP7 A;  1GUM A;  4PXO A;  5ECH B;  3DGQ A;  3UBK A;  2O87 A;  3EYT A;  1OYJ A;  1V57 A;  4IP1 A;  5FWG A;  1WIK A;  2A4V A;  5GST A;  1EGR A;  1OKD A;  3MAK A;  4FYB A;  2HSH A;  3O3T A;  1J08 A;  1GWC A;  4TR1 A;  1K0N A;  1IYI A;  4IQA A;  4IGJ A;  3TB2 A;  1JLW A;  4ZBD A;  2WDU A;  4AGS A;  1Z7R A;  5HFK A;  1YEP A;  5CO3 A;  2ES7 A;  5FHI A;  4RI6 A;  3UBL A;  1WOU A;  4EKZ A;  22GS A;  4HU7 A;  3F8U A;  1GSD A;  3IE3 A;  4IKH A;  2TIR A;  3TCO A;  5GAP D;  2H1A A;  4ECC A;  4GQC A;  5DQY A;  3SWL A;  3TKS E;  1GSY A;  1HNB A;  4TR4 A;  3ZZX A;  2K9F A;  1PX7 A;  3IV4 A;  2WB9 A;  4XS4 B;  1ZOF A;  3RPN A;  4ZB8 A;  3N5O A;  4ZB9 A;  1QUW A;  1NW2 A;  3DML A;  4XS6 A;  5D93 A;  2FCH A;  2VD0 A;  1DBY A;  4IW9 A;  3D21 A;  2L5L A;  2HRN A;  3BBY A;  3US3 A;  1XXU A;  2AJQ B;  1ZYQ B;  1HNA A;  3CMI A;  4L0U A;  2TRC P;  6GSX A;  2PPT A;  1FB6 A;  1PRX A;  4WKW A;  3CSH A;  4E8E A;  3D22 A;  2O85 A;  1A0R P;  2E2G A;  1WRY A;  1I5G A;  2I3Y A;  1K3L A;  3KH9 A;  1XZO A;  3CXG A;  1XIY A;  2X8H A;  1SJ6 A;  2F51 A;  4OFT A;  20GS A;  3ZVJ A;  4ZXG A;  1V2A A;  2NVL A;  4JRR A;  3ZVJ D;  4I5Q A;  5B8B A;  4ACS A;  1W89 A;  1Z5Y E;  2H76 A;  3APO A;  1V40 A;  5B6M A;  3HJP A;  5G31 A;  3DWV A;  4JBB A;  1GLP A;  1EWX A;  2A2R A;  4BVX A;  2L6D A;  3WGE A;  1OC3 A;  2VCT A;  2YPM A;  2N5B A;  1Z3E A;  3ZRD A;  1M0U A;  1MEK A;  2DIY A;  1O85 A;  2XBQ A;  3F3R A;  2GZZ A;  2JU5 A;  3NZN A;  5G30 A;  1UVZ A;  2QGV A;  4MZB A;  1M2A A;  4P3Y B;  1XFL A;  1FVJ A;  4KND A;  1OE8 A;  3VLN A;  3KP9 A;  1WPI A;  3GHA A;  1SYR A;  5ECR B;  4TW5 A;  2H74 A;  3HVX A;  3LJR A;  4Q5N A;  1T1V A;  1B9Y C;  2VM2 A;  5D73 A;  3TUE A;  1YJ6 A;  1MDI A;  3ERW A;  2LST A;  4MJA A;  2GDR A;  2H0G A;  4MPF A;  5DJL A;  1YKC A;  1JFU A;  3F3Q A;  3ZML A;  2KP2 A;  3L0H A;  2VL2 A;  4WBR D;  4KAE A;  1WMJ A;  3A3T A;  3CSI A;  4NMU A;  2DLX A;  4CW9 A;  1NHY A;  2PVQ A;  5KEJ A;  1EV4 A;  3L9S A;  3QPM A;  1XW5 A;  3GFK A;  1JZR A;  5F07 A;  4WEY A;  3LWA A;  4I2T A;  4EXJ A;  2VL9 A;  3ERG A;  3LFL A;  1A23 A;  3KM6 A;  2CAQ A;  3UEM A;  3KTL A;  19GS A;  4XHM A;  1E6B A;  4KSM A;  1U88 A;  5DAL A;  4WR4 A;  3EWL A;  2VD1 A;  2LS5 A;  5LCZ A;  4KDU A;  1AAZ A;  4HU9 A;  2QSI A;  5IMC A;  3F0I A;  4GLT A;  3DD3 A;  1SU9 A;  1H75 A;  2I9H A;  3FZ5 A;  1I9D A;  1TRV A;  5IPG A;  1XPV A;  1ZYE A;  5ECK B;  3LYK A;  3G7Y A;  4V1A p;  1X9S B;  6GST A;  2X99 A;  3UAR A;  2H66 A;  5DAK B;  4EF0 A;  1Z9H A;  3HA9 A;  2OAD A;  1M2B A;  3UIW A;  4OMV A;  4O5R A;  2MZC A;  1TK0 B;  4LL1 B;  4NHZ A;  1KNG A;  1A2M A;  5ID2 A;  2EC4 A;  3HZ4 A;  2C3T A;  1K0A A;  3A2W A;  3GTU A;  2KOK A;  3BD2 A;  1Q4J A;  3IOS A;  4LLR A;  4RI7 A;  3L4N A;  4HQZ A;  3D0Z A;  2LQQ A;  1MDK A;  3UOM A;  2WS2 A;  2B1L A;  5INY A;  5ENU A;  2DSA A;  3EIN A;  4GF0 A;  5DJM A;  4DSS A;  1YEX A;  1AQV A;  4N10 A;  3TJK A;  4K7I A;  5H5R A;  3IAM 2;  3FKF A;  4KE3 A;  1MD3 A;  1TRW A;  3GKK A;  5ELG A;  3C8E A;  4MJB A;  4K1F A;  1HQO A;  4PQI A;  3GSS A;  3J7Y b;  3HD5 A;  4XS1 A;  3GV1 A;  2LNS A;  4OCF A;  4KDX A;  2J23 A;  3FR3 A;  2GSS A;  2IMF A;  2GST A;  2V6O A;  3ME8 A;  1V58 A;  3DYR A;  3ME7 A;  3KTB A;  2B3S A;  2YN1 A;  5CRE A;  5HFG A;  1QXH A;  3TKS C;  2IME A;  2VM1 A;  5GZZ B;  4PUF C;  1XWG A;  4RQR A;  2HI7 A;  1GL8 A;  4Q5F A;  1B9X C;  4MZW A;  1USB A;  3FHK A;  1VF4 A;  4KB3 A;  1GTB A;  5D9X A;  3KIJ A;  1OC9 A;  4ECB A;  2J9H A;  2YV7 A;  4I6X A;  2XPD A;  3QFB C;  1EZK A;  2H6Z A;  3L78 A;  4PUR A;  2AAW A;  2VOC A;  4MH3 A;  4MF7 A;  1GUK A;  3ZTL A;  1AC1 A;  3TGZ A;  2LEG A;  1WE0 A;  4K6X A;  3VFI A;  2DJ1 A;  4OWY A;  5HR0 A;  4YQU A;  1TXX A;  1VF2 A;  3UVT A;  1EV9 A;  3HXS A;  3HZ8 A;  4TR0 A;  2JZR A;  4V1A g;  2YZH A;  1R5P A;  3QAG A;  2PER A;  4TVE A;  3A5W A;  2BMX A;  1X5D A;  2G2Q A;  2OE0 A;  3ZL5 A;  2PBJ A;  1GP1 A;  5AIS A;  2IPA A;  5IO2 A;  2K8V A;  4MMM A;  2GT6 A;  1K0C A;  3IC4 A;  3WGD A;  5D9W A;  3C1S A;  1LU4 A;  3RDW A;  1XOA A;  4K0N A;  5AGY A;  4DVC A;  4HOJ A;  2JZT A;  2V6K A;  4MF5 A;  5JWR B;  4MAB A;  1N2A A;  1AXD A;  2PMT A;  4H86 A;  3VWU A;  1JHB A;  3FY7 A;  2OBI A;  2EIR A;  1DSB A;  1PD2 1;  2C0F A;  3QCP A;  4J2F A;  4ID0 A;  3H1N A;  1AQW A;  4BA7 A;  3V1W A;  3GKX A;  5IMA A;  1KEB A;  3KGK A;  1PL1 A;  1XVQ A;  1T4Y A;  1QK8 A;  3CRT A;  3GST A;  1TDI A;  3F6F A;  2GS3 A;  1M9A A;  5IOX A;  1XWC A;  1NSW A;  4HJ2 A;  4YQM A;  3Q6O A;  4V2N A;  5DVB A;  2B6M A;  3D5J A;  4JU5 A;  4BL7 A;  1BG5 A;  4HI7 A;  4ZIJ A;  2RM5 A;  3LGC A;  3LYP A;  1A2J A;  1PX6 A;  2H72 A;  2VLU A;  5E59 A;  4Z7X A;  3OR5 A;  2WCI A;  3RHC A;  3NOF A;  5L71 A;  4IBP A;  3FR6 A;  4TXO A;  2H71 A;  1EP8 A;  4TN8 A;  2CV4 A;  3I43 A;  1VGL A;  3TJG A;  2H30 A;  2YWO A;  2DBC A;  4MK3 A;  4YAP A;  3UMA A;  3ISO A;  3PGT A;  2LJR A;  2YZU A;  4G19 A;  1RW1 A;  4LMW A;  1FVK A;  3KJY A;  2IMD A;  3C7M A;  4X0X A;  1XWB A;  2HZE A;  3KD0 A;  3E0U A;  5DDL A;  2HZF A;  4LA1 A;  4ISD A;  1G0T A;  1SJI A;  5HR1 A;  4CDO A;  2HYX A;  3TOU A;  1JLV A;  1FG4 A;  1SKS B;  5JCG A;  1SKR B;  3VI7 A;  4PQH A;  2MBS A;  1ERV A;  1Q98 A;  4MPG A;  1EEJ A;  2N5A A;  3HCZ A;  3RHB A;  4J56 E;  3IK7 A;  3NIV A;  4WR5 A;  3P2A A;  16GS A;  4ZBA A;  1SD8 A;  1BYE A;  4K7N A;  1J9B A;  3D6I A;  2FLS A;  3C73 A;  1F9M A;  1S3A A;  2C80 A;  3ZFB A;  2P31 A;  3KH7 A;  3IR4 A;  3GUR A;  3L9V A;  2LRC A;  2E0Q A;  1THO A;  3U6V A;  2WUL A;  1S3C A;  1O8X A;  2FGX A;  2V1M A;  3ZFL A;  3A2V A;  2K6V A;  2LRN A;  1B8X A;  2LJA A;  3DEX A;  1XBS A;  3DIE A;  4WXT A;  3GIX A;  3GH9 A;  3QD9 A;  3M0F A;  5EL8 A;  1X5E A;  1TTZ A;  4IJI A;  1SK1 A;  1BQ7 A;  1VF1 A;  2H8L A;  4BWQ A;  1AQX A;  2GQK A;  1GUL A;  4KH7 A;  1H4O A;  2WGR A;  4JZQ A;  3DVW A;  1QQ2 A;  2F3M A;  2GZP A;  1FHE A;  6GSU A;  2E2M A;  2DC5 A;  2H6X A;  4G10 A;  1A2L A;  3CYN A;  2GZY A;  5EPF A;  5IOW A;  3BJ5 A;  4HS1 A;  2C0D A;  2PUK C;  2XHF A;  3KP8 A;  2BTO T;  2H73 A;  3EUR A;  3P90 A;  4JED A;  5HR3 A;  2AV4 A;  3HYP A;  4D73 B;  1HD2 A;  5KN1 A;  1B4Q A;  3G9B A;  1PA3 A;  3BCI A;  2G0F A;  2IFQ B;  1FO5 A;  1V9W A;  5ECM B;  4WF4 A;  2YWN A;  3FZ9 A;  2WFC A;  2K18 A;  3UAP A;  3Q18 A;  5ECO B;  2HLS A;  4QQ7 A;  1FAA A;  3GKM A;  3J7Y k;  4TXV A;  5GAN D;  1GTA A;  3EMP A;  2GQM A;  3ED3 A;  3HY2 A;  1BED A;  1YF0 A;  5HFI A;  2F8F A;  5DBQ A;  4WBJ A;  4MLY A;  5G1K A;  2OJL A;  3HHV A;  2R2J A;  4POK A;  5IO0 A;  4MJC A;  1QMV A;  2H70 A;  5G5F A;  1T7P B;  3GNJ A;  1F3B A;  3S9F A;  1GSF A;  1ILO A;  2RUE A;  2EIO A;  1ZCP A;  3G7J A;  4POB A;  5F05 A;  3APS A;  5D96 A;  4OO4 A;  4YAV A;  4XTS A;  1SL2 B;  4FO5 A;  4L8E A;  1GTI A;  4EDZ A;  5CRW A;  4F2I A;  1O73 A;  1OAZ A;  3F4S A;  2IMI A;  3CRU A;  6GSY A;  13GS A;  2L4Q A;  2ZCT A;  3KCM A;  1DE1 A;  4XCS A;  3VWW A;  4ECI A;  2XPE A;  3IRA A;  2VIM A;  1GH2 A;  5FT3 A;  2JAD A;  2MYG A;  4ZIL A;  2X64 A;  5ECN B;  2WZ9 A;  1F2E A;  2FHE A;  3A2X A;  3TJJ A;  2X8G A;  2H01 A;  1EEM A;  2C3Q A;  4FIW A;  2WRT A;  1UC7 A;  4MDC A;  1TRU A;  3KMN A;  2NPB A;  1A8L A;  5ECP B;  1FW1 A;  2LRT A;  4MCU A;  3HKR A;  2HNL A;  5HQP A;  3LG6 A;  1GSE A;  3FRC A;  3DVX A;  1F3A A;  2GTU A;  2LQO A;  1EGO A;  2R4V A;  3ZMK A;  4GXZ A;  5ABR A;  4MF6 A;  1URM A;  3G7I A;  1SL1 B;  1BJX A;  4Q5R A;  4ML6 A;  5J5N A;  1U3A A; 
#chains in the Genus database with same CATH topology
 3WD6 A;  3IHG A;  1O81 A;  2PVO C;  1MTC A;  3M9K A;  2JSZ A;  2O89 A;  1N8J A;  4ZL9 A;  2GQL A;  5AIV A;  1RK4 A;  3I9V 2;  4IEL A;  1X9M B;  4EO3 A;  1TW9 A;  1YF1 A;  1BX9 A;  2YWI A;  1PKZ A;  4MNN A;  2B7K A;  3CSJ A;  3HJM A;  5CRH A;  4POM A;  2O7K A;  2N5F A;  1WP0 A;  4HUA A;  5D8I A;  2QA2 A;  1FOH A;  4BWS A;  5IMD A;  1TU7 A;  1C72 A;  2HRA A;  5AIX A;  2DJK A;  2DJJ A;  1VRS D;  5ELA A;  4K7O A;  3QFA C;  5DCH A;  4EUY A;  2AYT A;  4XRD A;  3DXB A;  1ZL9 A;  2CQ9 A;  1SJZ A;  2VAF A;  2B5E A;  2GLR A;  4ZL8 A;  3FZA A;  2C4J A;  5DAK A;  4WET A;  3IK9 A;  4F0B A;  1EOG A;  5JCW A;  2DJ2 A;  1ZZY A;  1T4Z A;  2R3X A;  2L59 A;  1PFO A;  2FNO A;  2HSM A;  2YNX A;  1RQM A;  5CP1 A;  5LNK e;  3F9U A;  2DIZ A;  3GX0 A;  4ZB6 A;  3TKQ A;  1XWA A;  3KMO A;  5EVO A;  5CRG A;  3EC3 A;  3H8Q A;  4IJ3 A;  4GWR A;  4HDE A;  4PNF A;  2C0E A;  4ECJ A;  1ZGN A;  2DML A;  2RII A;  1G7O A;  1W4V A;  1TI1 A;  1K3O A;  1SD9 A;  4ILF A;  1XVW A;  5J9B A;  1HNC A;  4WF5 A;  1Y25 A;  2REM A;  3P7X A;  2Z9S A;  2FD3 A;  3GL3 A;  5JWQ B;  3Q74 A;  4OFN A;  3KZQ A;  6GSW A;  2OBK A;  1R7H A;  3AY8 A;  3KEB A;  4AJ6 A;  4RUV A;  3IXR A;  1GLQ A;  2VUP A;  3I69 A;  1FB0 A;  3TRX A;  2VCX A;  2P5Q A;  2XC2 A;  2H0H A;  2L5O A;  4OCE A;  4HQS A;  1M9B A;  1XOB A;  5JCU A;  1GSU A;  1TI3 A;  3VWX A;  4EIQ A;  5J4U A;  1Z6M A;  5DQS A;  5J9C A;  4O92 A;  2KUC A;  3EU4 A;  2DMM A;  3IPZ A;  4ZL7 A;  3O6T A;  1JZO A;  1NHO A;  2JSY A;  5IM9 A;  18GS A;  4AF2 A;  1G6Y A;  3QAV A;  1EOH A;  2FA4 A;  2VL2 C;  2YJ7 A;  5EY6 A;  3RPP A;  4X1U A;  3EVI A;  3KXO A;  4EC0 A;  4K2X A;  4L0W A;  4RQX A;  3M8N A;  4IN0 A;  4KCA A;  1G7E A;  2WJU A;  3P8W A;  3FR9 A;  2IJY A;  2YOI A;  4JR4 A;  1VF3 A;  2B5X A;  3QR6 A;  1TOF A;  3TOT A;  2HXK A;  4OD7 A;  4K8M A;  4TXO B;  1AW9 A;  1T3B A;  2M72 A;  4TR1 B;  2TRX A;  1A8Y A;  4FYC A;  3PPU A;  4XRA A;  5H5S A;  3MNG A;  1SK2 A;  3IC8 A;  3H4K A;  1S3D A;  4IP6 A;  4V2M A;  4K2D A;  2B5Y A;  6GSS A;  2HT9 A;  3CBU A;  2HZE B;  5G1L A;  5KN0 A;  3EMX A;  2DKH A;  4G9H A;  4XIH A;  2ON7 A;  2GSR A;  2VCV A;  4KA0 A;  3ERF A;  3DRN A;  5IMV A;  1AIU A;  2F8A A;  4YH2 A;  5G5E A;  1ST9 A;  1IYH A;  3TRP A;  4DSQ A;  1PSQ A;  1V98 A;  1CQG A;  3LOR A;  1WWJ A;  3GL5 A;  3MDK A;  3N9J A;  3EU3 A;  3WYW A;  2A2S A;  1T8E B;  1TP9 A;  3PIN A;  4TOP A;  4JR6 A;  4BVY A;  2ON5 A;  4F9Z A;  4YKG A;  2C1Y A;  2LKU A;  5IQY A;  3C71 A;  1J0F A;  1CQH A;  1ABA A;  1KTE A;  4HJM A;  2FA8 A;  4FYU A;  1K0O A;  4OO5 A;  5F8B A;  2X8C A;  3F4R A;  3PH9 A;  1E2Y A;  6GSV A;  1ON4 A;  1SYX A;  2VL3 A;  2HSY A;  3UVH A;  1MDJ A;  2DJ3 A;  1ZYN A;  1X9W B;  2OKA A;  5C00 A;  4PNG A;  3WT2 A;  1A0F A;  1ERU A;  4EE0 A;  1DUG A;  4N0V A;  3H93 A;  2JZS A;  1GSS A;  3FEU A;  5AN1 A;  3ZIT A;  2DJ0 A;  2GT5 A;  2NBS A;  4IQ1 A;  3RBT A;  3VPT A;  5KN2 A;  2CVD A;  2QC7 A;  3GH6 A;  1B4P A;  4YQV A;  3K8N A;  1OKT A;  5CAX A;  4KDY A;  4K9Z A;  2UZ8 A;  4X43 A;  1R4W A;  1GTU A;  2MMA A;  5J3R A;  2F9S A;  4BVX B;  5IMZ A;  3LEF A;  4Z2R A;  2NTO A;  2V41 A;  3M3M A;  3R2Q A;  2OE1 A;  3TJF A;  2YCD A;  2FWH A;  3IHQ A;  2MBT A;  2PU9 C;  1PKW A;  2H1G A;  3VI5 A;  4AJ7 A;  2A2P A;  3O76 A;  4I8B A;  4QL7 A;  3TRQ A;  2I4A A;  3GYK A;  1K0B A;  3IAS 2;  1X0R A;  2O8V B;  3F4T A;  3TKR A;  1WJK A;  3TKS A;  1K0D A;  1QFN A;  4XS4 A;  2H19 A;  2JL4 A;  1Z7P A;  4N0Z A;  3E3E A;  1SKW B;  1M2D A;  4JE1 A;  4CHS A;  2AB6 A;  1PQN A;  3IBH A;  1YY7 A;  10GS A;  3C1R A;  4GTU A;  5J41 A;  4O32 A;  1LJR A;  2A4H A;  1PMT A;  2RUF A;  4GSS A;  9GSS A;  1SL0 B;  4O7H A;  1NM3 A;  2H0I A;  4GST A;  4L5O A;  3LXZ A;  1DE2 A;  4TKY A;  4J57 E;  3ZYW A;  5JWO B;  2H75 A;  4LL4 B;  5BMU A;  4K0G A;  2R0C A;  4KX4 A;  2RLI A;  4IHU A;  4OFM A;  1F37 A;  3DKS A;  3GX8 A;  5DAL B;  3VK9 A;  2L57 A;  2VCW A;  2KLX A;  3ZIJ A;  4I97 A;  4F82 A;  3ZIV A;  1YZX A;  2PWJ A;  2VLV A;  3WGX A;  5IMF A;  2LUS A;  1M7T A;  3Q19 A;  2M46 A;  2KHP A;  2H1B A;  4KGI A;  1GNE A;  1MD4 A;  4GCI A;  4D73 A;  1K3Y A;  1U6T A;  1ERW A;  4BPY A;  2H1D A;  2MMN A;  3W8J A;  2IFQ A;  1PN9 A;  2R37 A;  1PGT A;  2P5R A;  3FYG A;  2ZNM A;  3VWV A;  4QL9 A;  1G6W A;  2EIQ A;  3QDN A;  2P0G A;  5ECS A;  3M9J A;  3GKN A;  5A4V A;  3HVV A;  3D4M A;  4NAX A;  1TK8 B;  5CYY A;  4PUA A;  14GS A;  4EVM A;  5ID2 B;  2K8S A;  5LD0 A;  2ALB A;  1F6M C;  3EE2 A;  3GTU B;  4MZC A;  2CX4 A;  2OA7 A;  3BCK A;  2I1U A;  4GRF A;  3MWH A;  1O8W A;  2IL3 A;  1OVN A;  2AHE A;  4DSS B;  2CVB A;  4KW6 A;  3TKP A;  4HZ4 A;  1OC8 A;  4ML1 A;  4KCE A;  2CVK A;  1YDK A;  3FK8 A;  4PQ1 A;  2FWE A;  2ZUP A;  5ECQ B;  3HVS A;  4MA9 A;  5CRD A;  2CZ3 A;  1Z6N A;  1UN2 A;  2PGT A;  3GA4 A;  2HE3 A;  2LNT A;  2NDO A;  3ZRE A;  4G2E A;  1TRS A;  2CAI A;  1U87 A;  5A4U A;  4HEA 2;  4DEJ A;  3RAZ A;  2FUG 2;  1PL2 A;  3WT1 A;  2JAC A;  4IS0 A;  2H6Y A;  2V2G A;  1XW9 A;  3F6D A;  2KP1 A;  2B7J A;  2YJH A;  4NPB A;  3HJO A;  2C8U A;  4PGT A;  4MJE A;  1TJD A;  2L4C A;  1OC9 B;  2CA8 A;  2R5G A;  1GSQ A;  1YKA A;  2VCZ A;  2LJK A;  3ZLP A;  5D9V A;  3W6G A;  3H79 A;  1GUH A;  1B48 A;  5KN3 A;  1XWK A;  3VUR A;  3TJB A;  1TK5 B;  4LMV A;  3GMF A;  2YAN A;  4I2U A;  4A5P A;  3F63 A;  1XG8 A;  2MMO A;  4N11 A;  1X5C A;  2LTK A;  11GS A;  3LQ7 A;  3GN3 A;  4TR3 A;  1O6J A;  4FH8 A;  4PTS A;  3UL3 A;  5G2Z A;  1R26 A;  2RM6 A;  2IIY A;  2GVP A;  1AUC A;  1JZD A;  4NV5 A;  2L6C A;  4MH2 A;  2CX3 A;  1GRX A;  4POL A;  4ZBB A;  4KSO A;  3TDG A;  1KBN A;  1A24 A;  1GNW A;  2OE3 A;  1R5A A;  4V2L A;  4GSN A;  4Z2U A;  2IN3 A;  4NHW A;  3APQ A;  5F0G A;  5GSS A;  2YP6 A;  4NV2 A;  3FW2 A;  2E7P A;  3GRX A;  4YKF A;  5D9T A;  3HDC A;  5B6N A;  4Z2T A;  3CTG A;  4MP4 A;  2CT6 A;  3U5R E;  4L5L A;  1T00 A;  3QOU A;  1Y6E A;  1BAY A;  2V32 A;  5A5K A;  1YQ1 A;  3CTF A;  2FWG A;  5IIZ A;  3JCM L;  1O7U A;  3E9J B;  1TU8 A;  2M80 A;  3GUS A;  2VLT A;  3MSZ A;  2PN8 A;  1TKD B;  1ERT A;  12GS A;  1QGV A;  4O5Q A;  4GQF A;  4E8H A;  1K0M A;  2HFD A;  3BOA A;  5COH A;  2HRF A;  3IA1 A;  1XW6 A;  1JZW A;  2YWM A;  5C04 A;  3L9U A;  1LBK A;  3FZ4 A;  1UA5 A;  5ECI B;  1M99 A;  4KUN A;  2C0G A;  2CZ2 A;  5F06 A;  2QKE A;  1THX A;  5B8A A;  4NXI A;  2C3N A;  2YV9 A;  5HR2 A;  4BL7 B;  4KF9 A;  2FY6 A;  2VCQ A;  3IDV A;  5IPH A;  2AUV A;  3LXT A;  1U3I A;  3M1G A;  3QMX A;  3I6A A;  3QAW A;  4F03 A;  17GS A;  4AJ8 A;  4TRX A;  8GSS A;  2FWF A;  5CNW A;  2R6K A;  1SK0 A;  5H5Q A;  4N30 A;  4PX1 A;  4DSR A;  4F0C A;  5B7C A;  2BJX A;  4ULX A;  2R0P A;  2D2Z A;  3VPQ A;  2OAC A;  3PR8 A;  1XCC A;  5A4W A;  4BVY B;  3D4T A;  4EDY A;  2MMZ A;  5DCG A;  3SBC A;  2IMK A;  2GGT A;  7GSS A;  2XBI A;  4HZ2 A;  4Q5Q A;  2IWT A;  5ECL B;  1HYU A;  2GSQ A;  3LSZ A;  4G0L A;  4EL1 A;  5E4W A;  4IVF A;  4NWY A;  1ACV A;  3W8S A;  1SEN A;  1ZMA A;  2LV3 A;  2B1K A;  1FOV A;  1ML6 A;  2I81 A;  3UJ1 A;  1OE7 A;  2VO4 A;  1EP7 A;  3HVN A;  1GUM A;  4PXO A;  5ECH B;  3DGQ A;  2X49 A;  3UBK A;  2O87 A;  3EYT A;  1OYJ A;  1V57 A;  4IP1 A;  5FWG A;  1WIK A;  2A4V A;  5GST A;  1EGR A;  1OKD A;  3MAK A;  3LW9 A;  4FYB A;  2HSH A;  3O3T A;  1J08 A;  1GWC A;  4TR1 A;  1K0N A;  1IYI A;  4IQA A;  4IGJ A;  3TB2 A;  1JLW A;  4ZBD A;  2WDU A;  4AGS A;  1Z7R A;  5HFK A;  1YEP A;  5CO3 A;  2ES7 A;  5FHI A;  4RI6 A;  3UBL A;  1WOU A;  4EKZ A;  22GS A;  4HU7 A;  3F8U A;  1GSD A;  3IE3 A;  4IKH A;  2TIR A;  3TCO A;  5GAP D;  2H1A A;  4ECC A;  4GQC A;  5DQY A;  3SWL A;  3TKS E;  1GSY A;  3FMW A;  1HNB A;  4TR4 A;  3ZZX A;  2K9F A;  1PX7 A;  3IV4 A;  2WB9 A;  4XS4 B;  1ZOF A;  3RPN A;  4ZB8 A;  3N5O A;  4ZB9 A;  1QUW A;  1NW2 A;  3DML A;  4XS6 A;  5D93 A;  2FCH A;  2VD0 A;  4G0K A;  1DBY A;  4IW9 A;  3D21 A;  2L5L A;  2HRN A;  5KOX A;  3BBY A;  3US3 A;  1XXU A;  2AJQ B;  1ZYQ B;  1HNA A;  3CMI A;  4L0U A;  2TRC P;  6GSX A;  2PPT A;  1FB6 A;  1PRX A;  4WKW A;  3CSH A;  4E8E A;  3D22 A;  2O85 A;  1A0R P;  2E2G A;  1WRY A;  1I5G A;  2I3Y A;  1K3L A;  3KH9 A;  1XZO A;  3CXG A;  1XIY A;  2X8H A;  1SJ6 A;  2F51 A;  4OFT A;  20GS A;  3ZVJ A;  4ZXG A;  1V2A A;  3A5I A;  2NVL A;  4JRR A;  3ZVJ D;  4I5Q A;  5B8B A;  4ACS A;  1W89 A;  1Z5Y E;  2H76 A;  3APO A;  1V40 A;  5B6M A;  3HJP A;  5G31 A;  3DWV A;  4JBB A;  1GLP A;  1EWX A;  2A2R A;  4BVX A;  2L6D A;  3WGE A;  1OC3 A;  2VCT A;  2YPM A;  2N5B A;  1Z3E A;  3ZRD A;  1M0U A;  1MEK A;  2DIY A;  1O85 A;  2XBQ A;  3F3R A;  2GZZ A;  2JU5 A;  3NZN A;  5G30 A;  1UVZ A;  2QGV A;  4MZB A;  1M2A A;  4P3Y B;  1XFL A;  1FVJ A;  4KND A;  1OE8 A;  3VLN A;  3KP9 A;  1WPI A;  3GHA A;  1SYR A;  5ECR B;  4TW5 A;  2H74 A;  3HVX A;  3LJR A;  4Q5N A;  1T1V A;  1B9Y C;  2VM2 A;  5D73 A;  3TUE A;  1YJ6 A;  1MDI A;  3ERW A;  2LST A;  4MJA A;  2GDR A;  2H0G A;  4MPF A;  5DJL A;  1YKC A;  1JFU A;  3F3Q A;  3ZML A;  2KP2 A;  3L0H A;  2VL2 A;  3EPT A;  4WBR D;  4KAE A;  1WMJ A;  3A3T A;  3CSI A;  4NMU A;  2DLX A;  4CW9 A;  1NHY A;  2PVQ A;  5KEJ A;  1EV4 A;  3L9S A;  3QPM A;  1XW5 A;  3GFK A;  1JZR A;  5F07 A;  4WEY A;  3LWA A;  4I2T A;  4EXJ A;  2VL9 A;  3ERG A;  3LFL A;  1A23 A;  3KM6 A;  2CAQ A;  3UEM A;  3KTL A;  19GS A;  4XHM A;  1E6B A;  4KSM A;  1U88 A;  5DAL A;  4WR4 A;  3EWL A;  2VD1 A;  2LS5 A;  5LCZ A;  4KDU A;  1AAZ A;  4HU9 A;  2QSI A;  5IMC A;  3F0I A;  4GLT A;  3MYD A;  3DD3 A;  1SU9 A;  1H75 A;  4CY6 A;  2I9H A;  3FZ5 A;  1I9D A;  1TRV A;  5IPG A;  1XPV A;  1ZYE A;  5ECK B;  3LYK A;  3G7Y A;  4V1A p;  1X9S B;  6GST A;  2X99 A;  3UAR A;  2H66 A;  5DAK B;  4EF0 A;  1Z9H A;  3HA9 A;  2OAD A;  1M2B A;  3UIW A;  4OMV A;  4O5R A;  2MZC A;  1TK0 B;  4LL1 B;  4NHZ A;  1KNG A;  1A2M A;  5ID2 A;  2EC4 A;  3HZ4 A;  2C3T A;  1K0A A;  3A2W A;  3GTU A;  2KOK A;  3BD2 A;  1Q4J A;  3IOS A;  4LLR A;  4RI7 A;  3L4N A;  4HQZ A;  3D0Z A;  2LQQ A;  1MDK A;  3UOM A;  2WS2 A;  2B1L A;  5INY A;  5ENU A;  2DSA A;  3EIN A;  4GF0 A;  5DJM A;  4DSS A;  1YEX A;  1AQV A;  4N10 A;  3TJK A;  4K7I A;  5H5R A;  3IAM 2;  3FKF A;  1PN0 A;  4KE3 A;  1MD3 A;  1TRW A;  3GKK A;  4BIK A;  5ELG A;  3C8E A;  4MJB A;  4K1F A;  1HQO A;  4PQI A;  3GSS A;  3J7Y b;  3HD5 A;  4XS1 A;  3GV1 A;  2LNS A;  4OCF A;  4KDX A;  2J23 A;  3FR3 A;  2GSS A;  2IMF A;  2GST A;  2V6O A;  3ME8 A;  1V58 A;  3DYR A;  3ME7 A;  3KTB A;  2B3S A;  2YN1 A;  5CRE A;  5HFG A;  1QXH A;  3TKS C;  2IME A;  2VM1 A;  5GZZ B;  4PUF C;  1XWG A;  4RQR A;  2HI7 A;  1GL8 A;  4CY8 A;  4Q5F A;  1B9X C;  4MZW A;  1USB A;  3FHK A;  1VF4 A;  4KB3 A;  1GTB A;  5D9X A;  3KIJ A;  1OC9 A;  4ECB A;  2J9H A;  2YV7 A;  3CQF A;  4I6X A;  2XPD A;  3QFB C;  1EZK A;  2H6Z A;  4PUR A;  3L78 A;  2R0G A;  2AAW A;  2VOC A;  4MH3 A;  4MF7 A;  1GUK A;  3ZTL A;  1AC1 A;  3TGZ A;  2LEG A;  1WE0 A;  4K6X A;  3VFI A;  2DJ1 A;  4OWY A;  5HR0 A;  4YQU A;  1TXX A;  1VF2 A;  3UVT A;  1EV9 A;  3HXS A;  3HZ8 A;  4TR0 A;  2JZR A;  4V1A g;  2YZH A;  1R5P A;  3QAG A;  2PER A;  4TVE A;  3A5W A;  2BMX A;  4ICY A;  1X5D A;  2G2Q A;  2OE0 A;  3ZL5 A;  2PBJ A;  1GP1 A;  5AIS A;  2IPA A;  5IO2 A;  2K8V A;  4MMM A;  2GT6 A;  1K0C A;  3IC4 A;  3WGD A;  5D9W A;  3C1S A;  1LU4 A;  3RDW A;  1XOA A;  4K0N A;  5AGY A;  4DVC A;  4HOJ A;  2JZT A;  2V6K A;  4MF5 A;  5JWR B;  4MAB A;  1N2A A;  1AXD A;  2PMT A;  4H86 A;  3VWU A;  1JHB A;  3FY7 A;  2OBI A;  2EIR A;  1DSB A;  1PD2 1;  2C0F A;  3QCP A;  4J2F A;  4EIP A;  4ID0 A;  3H1N A;  4FQU A;  1AQW A;  4BA7 A;  3V1W A;  4HSC X;  3GKX A;  5IMA A;  1KEB A;  3KGK A;  1PL1 A;  1XVQ A;  1T4Y A;  1QK8 A;  3CRT A;  3GST A;  1TDI A;  3F6F A;  2GS3 A;  1M9A A;  5IOX A;  1XWC A;  1NSW A;  4HJ2 A;  4YQM A;  3Q6O A;  4V2N A;  5DVB A;  2B6M A;  3D5J A;  4JU5 A;  4BL7 A;  1BG5 A;  4HI7 A;  4ZIJ A;  2RM5 A;  3LGC A;  3LYP A;  1A2J A;  1PX6 A;  2H72 A;  2VLU A;  2HRK A;  5E59 A;  4Z7X A;  3OR5 A;  2WCI A;  3RHC A;  3NOF A;  5L71 A;  4K5S A;  4IBP A;  3FR6 A;  4TXO A;  2H71 A;  1EP8 A;  4TN8 A;  2CV4 A;  3I43 A;  1VGL A;  3TJG A;  2H30 A;  2YWO A;  2DBC A;  4MK3 A;  4YAP A;  3UMA A;  3ISO A;  3PGT A;  2LJR A;  2YZU A;  4G19 A;  1RW1 A;  4LMW A;  1FVK A;  3KJY A;  2IMD A;  3C7M A;  4X0X A;  1XWB A;  2HZE A;  3KD0 A;  3E0U A;  5DDL A;  2HZF A;  4LA1 A;  4ISD A;  1G0T A;  1SJI A;  5HR1 A;  4CDO A;  2HYX A;  3TOU A;  1JLV A;  1FG4 A;  1SKS B;  5JCG A;  1SKR B;  3VI7 A;  4PQH A;  2MBS A;  1ERV A;  1Q98 A;  4USS A;  4MPG A;  1EEJ A;  5KOW A;  2N5A A;  3HCZ A;  3RHB A;  4J56 E;  3IK7 A;  3NIV A;  4WR5 A;  3P2A A;  16GS A;  4ZBA A;  1SD8 A;  1BYE A;  4K7N A;  1J9B A;  3D6I A;  2FLS A;  1M3J A;  3C73 A;  1F9M A;  1S3A A;  2C80 A;  3ZFB A;  2P31 A;  3KH7 A;  3IR4 A;  3GUR A;  3L9V A;  5BRT A;  2LRC A;  2E0Q A;  1THO A;  3U6V A;  2WUL A;  1S3C A;  1O8X A;  2FGX A;  2V1M A;  3ZFL A;  3A2V A;  2K6V A;  2LRN A;  1B8X A;  2LJA A;  3DEX A;  1XBS A;  3DIE A;  4WXT A;  3GIX A;  3GH9 A;  3QD9 A;  3M0F A;  5EL8 A;  1X5E A;  1M3I A;  1TTZ A;  4IJI A;  1SK1 A;  1BQ7 A;  1VF1 A;  2H8L A;  4BWQ A;  1AQX A;  2GQK A;  1GUL A;  4KH7 A;  1H4O A;  2WGR A;  4JZQ A;  3DVW A;  1QQ2 A;  2F3M A;  3MIX A;  2GZP A;  1FHE A;  6GSU A;  2E2M A;  4X4J A;  2DC5 A;  2H6X A;  4G10 A;  1A2L A;  3CYN A;  2GZY A;  5EPF A;  5IOW A;  3BJ5 A;  4HS1 A;  2C0D A;  2PUK C;  2XHF A;  3KP8 A;  2BTO T;  2H73 A;  3EUR A;  3P90 A;  4JED A;  5HR3 A;  2AV4 A;  3HYP A;  4D73 B;  2QA1 A;  1HD2 A;  5KN1 A;  1B4Q A;  3G9B A;  1PA3 A;  3BCI A;  2G0F A;  2IFQ B;  1FO5 A;  1V9W A;  5ECM B;  4WF4 A;  2YWN A;  3FZ9 A;  2WFC A;  2K18 A;  3UAP A;  3Q18 A;  5ECO B;  2HLS A;  4QQ7 A;  1FAA A;  3GKM A;  3J7Y k;  4TXV A;  5GAN D;  1GTA A;  4O5U A;  3EMP A;  2GQM A;  3R3E A;  3ED3 A;  3HY2 A;  1BED A;  1YF0 A;  4K5R A;  5HFI A;  2F8F A;  4MLY A;  4WBJ A;  1S3R A;  5DBQ A;  5G1K A;  4G0I A;  2OJL A;  3HHV A;  2R2J A;  4POK A;  1ZYP A;  5IO0 A;  4MJC A;  1QMV A;  2H70 A;  5G5F A;  1T7P B;  3GNJ A;  1F3B A;  3S9F A;  1GSF A;  1ILO A;  2RUE A;  2EIO A;  1ZCP A;  3G7J A;  4POB A;  5F05 A;  3APS A;  5D96 A;  4OO4 A;  4YAV A;  4XTS A;  1SL2 B;  4FO5 A;  4L8E A;  1GTI A;  4EDZ A;  5CRW A;  4F2I A;  1O73 A;  1OAZ A;  3F4S A;  2IMI A;  3CRU A;  6GSY A;  13GS A;  2L4Q A;  2ZCT A;  3KCM A;  1DE1 A;  4XCS A;  3VWW A;  4ECI A;  2XPE A;  3IRA A;  2VIM A;  1GH2 A;  2X4A A;  2JAD A;  2MYG A;  5FT3 A;  2X64 A;  4ZIL A;  5ECN B;  2WZ9 A;  1F2E A;  2FHE A;  3A2X A;  3TJJ A;  2DKI A;  2X8G A;  2H01 A;  1EEM A;  2C3Q A;  4FIW A;  2WRT A;  4MDC A;  1UC7 A;  1TRU A;  3KMN A;  2NPB A;  1A8L A;  5ECP B;  1FW1 A;  2LRT A;  4MCU A;  3HKR A;  2HNL A;  5HQP A;  3LG6 A;  1GSE A;  3FRC A;  3DVX A;  1F3A A;  2GTU A;  2LQO A;  1EGO A;  2R4V A;  3ZMK A;  4GXZ A;  5ABR A;  4MF6 A;  1URM A;  3G7I A;  1SL1 B;  1BJX A;  4Q5R A;  4ML6 A;  5J5N A;  1U3A A; 
#chains in the Genus database with same CATH homology
 3WD6 A;  3IHG A;  1O81 A;  2PVO C;  1MTC A;  3M9K A;  2JSZ A;  2O89 A;  1N8J A;  4ZL9 A;  2GQL A;  5AIV A;  1RK4 A;  3I9V 2;  4IEL A;  1X9M B;  4EO3 A;  1TW9 A;  1YF1 A;  1BX9 A;  2YWI A;  1PKZ A;  4MNN A;  2B7K A;  3CSJ A;  3HJM A;  5CRH A;  4POM A;  2O7K A;  2N5F A;  1WP0 A;  4HUA A;  5D8I A;  2QA2 A;  1FOH A;  4BWS A;  5IMD A;  1TU7 A;  1C72 A;  2HRA A;  5AIX A;  2DJK A;  2DJJ A;  1VRS D;  5ELA A;  4K7O A;  3QFA C;  5DCH A;  4EUY A;  2AYT A;  4XRD A;  3DXB A;  1ZL9 A;  2CQ9 A;  1SJZ A;  2VAF A;  2B5E A;  2GLR A;  4ZL8 A;  3FZA A;  2C4J A;  5DAK A;  4WET A;  3IK9 A;  4F0B A;  1EOG A;  5JCW A;  2DJ2 A;  1ZZY A;  1T4Z A;  2R3X A;  2L59 A;  2FNO A;  2HSM A;  2YNX A;  1RQM A;  5CP1 A;  5LNK e;  3F9U A;  2DIZ A;  3GX0 A;  4ZB6 A;  3TKQ A;  1XWA A;  3KMO A;  5EVO A;  5CRG A;  3EC3 A;  3H8Q A;  4IJ3 A;  4GWR A;  4HDE A;  4PNF A;  2C0E A;  4ECJ A;  1ZGN A;  2DML A;  2RII A;  1G7O A;  1W4V A;  1TI1 A;  1K3O A;  1SD9 A;  4ILF A;  1XVW A;  5J9B A;  1HNC A;  4WF5 A;  1Y25 A;  2REM A;  3P7X A;  2Z9S A;  2FD3 A;  3GL3 A;  5JWQ B;  3Q74 A;  4OFN A;  3KZQ A;  6GSW A;  2OBK A;  1R7H A;  3AY8 A;  3KEB A;  4AJ6 A;  4RUV A;  3IXR A;  1GLQ A;  2VUP A;  3I69 A;  1FB0 A;  3TRX A;  2VCX A;  2P5Q A;  2XC2 A;  2H0H A;  2L5O A;  4OCE A;  4HQS A;  1M9B A;  1XOB A;  5JCU A;  1GSU A;  1TI3 A;  3VWX A;  4EIQ A;  5J4U A;  1Z6M A;  5DQS A;  5J9C A;  4O92 A;  2KUC A;  3EU4 A;  2DMM A;  3IPZ A;  4ZL7 A;  3O6T A;  1JZO A;  1NHO A;  2JSY A;  5IM9 A;  18GS A;  4AF2 A;  1G6Y A;  3QAV A;  1EOH A;  2FA4 A;  2VL2 C;  2YJ7 A;  5EY6 A;  3RPP A;  4X1U A;  3EVI A;  3KXO A;  4EC0 A;  4K2X A;  4L0W A;  4RQX A;  3M8N A;  4IN0 A;  4KCA A;  1G7E A;  2WJU A;  3P8W A;  3FR9 A;  2IJY A;  2YOI A;  4JR4 A;  1VF3 A;  2B5X A;  3QR6 A;  1TOF A;  3TOT A;  2HXK A;  4OD7 A;  4K8M A;  4TXO B;  1AW9 A;  1T3B A;  2M72 A;  4TR1 B;  2TRX A;  1A8Y A;  4FYC A;  3PPU A;  4XRA A;  5H5S A;  3MNG A;  1SK2 A;  3IC8 A;  3H4K A;  1S3D A;  4IP6 A;  4V2M A;  4K2D A;  2B5Y A;  6GSS A;  2HT9 A;  3CBU A;  2HZE B;  5G1L A;  5KN0 A;  3EMX A;  2DKH A;  4G9H A;  4XIH A;  2ON7 A;  2GSR A;  2VCV A;  4KA0 A;  3ERF A;  3DRN A;  5IMV A;  1AIU A;  2F8A A;  4YH2 A;  5G5E A;  1ST9 A;  1IYH A;  3TRP A;  4DSQ A;  1PSQ A;  1V98 A;  1CQG A;  3LOR A;  1WWJ A;  3GL5 A;  3MDK A;  3N9J A;  3EU3 A;  3WYW A;  2A2S A;  1T8E B;  1TP9 A;  3PIN A;  4TOP A;  4JR6 A;  4BVY A;  2ON5 A;  4F9Z A;  4YKG A;  2C1Y A;  2LKU A;  5IQY A;  3C71 A;  1J0F A;  1CQH A;  1ABA A;  1KTE A;  4HJM A;  2FA8 A;  4FYU A;  1K0O A;  4OO5 A;  5F8B A;  2X8C A;  3F4R A;  3PH9 A;  1E2Y A;  6GSV A;  1ON4 A;  1SYX A;  2VL3 A;  2HSY A;  3UVH A;  1MDJ A;  2DJ3 A;  1ZYN A;  1X9W B;  2OKA A;  5C00 A;  4PNG A;  3WT2 A;  1A0F A;  1ERU A;  4EE0 A;  1DUG A;  4N0V A;  3H93 A;  2JZS A;  1GSS A;  3FEU A;  5AN1 A;  3ZIT A;  2DJ0 A;  2GT5 A;  2NBS A;  4IQ1 A;  3RBT A;  3VPT A;  5KN2 A;  2CVD A;  2QC7 A;  3GH6 A;  1B4P A;  4YQV A;  3K8N A;  1OKT A;  5CAX A;  4KDY A;  4K9Z A;  2UZ8 A;  4X43 A;  1R4W A;  1GTU A;  2MMA A;  5J3R A;  2F9S A;  4BVX B;  5IMZ A;  3LEF A;  4Z2R A;  2NTO A;  2V41 A;  3M3M A;  3R2Q A;  2OE1 A;  3TJF A;  2YCD A;  2FWH A;  3IHQ A;  2MBT A;  2PU9 C;  1PKW A;  2H1G A;  3VI5 A;  4AJ7 A;  2A2P A;  3O76 A;  4I8B A;  4QL7 A;  3TRQ A;  2I4A A;  3GYK A;  1K0B A;  3IAS 2;  1X0R A;  2O8V B;  3F4T A;  3TKR A;  1WJK A;  3TKS A;  1K0D A;  1QFN A;  4XS4 A;  2H19 A;  2JL4 A;  1Z7P A;  4N0Z A;  3E3E A;  1SKW B;  1M2D A;  4JE1 A;  4CHS A;  2AB6 A;  1PQN A;  3IBH A;  1YY7 A;  10GS A;  3C1R A;  4GTU A;  5J41 A;  4O32 A;  1LJR A;  2A4H A;  1PMT A;  2RUF A;  4GSS A;  9GSS A;  1SL0 B;  4O7H A;  1NM3 A;  2H0I A;  4GST A;  4L5O A;  3LXZ A;  1DE2 A;  4TKY A;  4J57 E;  3ZYW A;  5JWO B;  2H75 A;  4LL4 B;  5BMU A;  4K0G A;  2R0C A;  4KX4 A;  2RLI A;  4IHU A;  4OFM A;  1F37 A;  3DKS A;  3GX8 A;  5DAL B;  3VK9 A;  2L57 A;  2VCW A;  2KLX A;  3ZIJ A;  4I97 A;  4F82 A;  3ZIV A;  1YZX A;  2PWJ A;  2VLV A;  3WGX A;  5IMF A;  2LUS A;  1M7T A;  3Q19 A;  2M46 A;  2KHP A;  2H1B A;  4KGI A;  1GNE A;  1MD4 A;  4GCI A;  4D73 A;  1K3Y A;  1U6T A;  1ERW A;  4BPY A;  2H1D A;  2MMN A;  3W8J A;  2IFQ A;  1PN9 A;  2R37 A;  1PGT A;  2P5R A;  3FYG A;  2ZNM A;  3VWV A;  4QL9 A;  1G6W A;  2EIQ A;  3QDN A;  2P0G A;  5ECS A;  3M9J A;  3GKN A;  5A4V A;  3HVV A;  3D4M A;  4NAX A;  1TK8 B;  5CYY A;  4PUA A;  14GS A;  4EVM A;  5ID2 B;  2K8S A;  5LD0 A;  2ALB A;  1F6M C;  3EE2 A;  3GTU B;  4MZC A;  2CX4 A;  2OA7 A;  3BCK A;  2I1U A;  4GRF A;  3MWH A;  1O8W A;  2IL3 A;  1OVN A;  2AHE A;  4DSS B;  2CVB A;  4KW6 A;  3TKP A;  4HZ4 A;  1OC8 A;  4ML1 A;  4KCE A;  2CVK A;  1YDK A;  3FK8 A;  4PQ1 A;  2FWE A;  2ZUP A;  5ECQ B;  3HVS A;  4MA9 A;  5CRD A;  2CZ3 A;  1Z6N A;  1UN2 A;  2PGT A;  3GA4 A;  2HE3 A;  2LNT A;  2NDO A;  3ZRE A;  4G2E A;  1TRS A;  2CAI A;  1U87 A;  5A4U A;  4HEA 2;  4DEJ A;  3RAZ A;  2FUG 2;  1PL2 A;  3WT1 A;  2JAC A;  4IS0 A;  2H6Y A;  2V2G A;  1XW9 A;  3F6D A;  2KP1 A;  2B7J A;  2YJH A;  4NPB A;  3HJO A;  2C8U A;  4PGT A;  4MJE A;  1TJD A;  2L4C A;  1OC9 B;  2CA8 A;  2R5G A;  1GSQ A;  1YKA A;  2VCZ A;  2LJK A;  3ZLP A;  5D9V A;  3W6G A;  3H79 A;  1GUH A;  1B48 A;  5KN3 A;  1XWK A;  3VUR A;  3TJB A;  1TK5 B;  4LMV A;  3GMF A;  2YAN A;  4I2U A;  4A5P A;  3F63 A;  2MMO A;  4N11 A;  1X5C A;  2LTK A;  11GS A;  3LQ7 A;  3GN3 A;  4TR3 A;  1O6J A;  4FH8 A;  4PTS A;  3UL3 A;  5G2Z A;  1R26 A;  2RM6 A;  2IIY A;  2GVP A;  1AUC A;  1JZD A;  4NV5 A;  2L6C A;  4MH2 A;  2CX3 A;  1GRX A;  4POL A;  4ZBB A;  4KSO A;  3TDG A;  1KBN A;  1A24 A;  1GNW A;  2OE3 A;  1R5A A;  4V2L A;  4GSN A;  4Z2U A;  2IN3 A;  4NHW A;  3APQ A;  5F0G A;  5GSS A;  2YP6 A;  4NV2 A;  3FW2 A;  2E7P A;  3GRX A;  4YKF A;  5D9T A;  3HDC A;  5B6N A;  4Z2T A;  3CTG A;  4MP4 A;  2CT6 A;  3U5R E;  4L5L A;  1T00 A;  3QOU A;  1Y6E A;  1BAY A;  2V32 A;  5A5K A;  1YQ1 A;  3CTF A;  2FWG A;  5IIZ A;  3JCM L;  1O7U A;  3E9J B;  1TU8 A;  2M80 A;  3GUS A;  2VLT A;  3MSZ A;  2PN8 A;  1TKD B;  1ERT A;  12GS A;  1QGV A;  4O5Q A;  4GQF A;  4E8H A;  1K0M A;  2HFD A;  3BOA A;  5COH A;  2HRF A;  3IA1 A;  1XW6 A;  1JZW A;  2YWM A;  5C04 A;  3L9U A;  1LBK A;  3FZ4 A;  1UA5 A;  5ECI B;  1M99 A;  4KUN A;  2C0G A;  2CZ2 A;  5F06 A;  2QKE A;  1THX A;  5B8A A;  4NXI A;  2C3N A;  2YV9 A;  5HR2 A;  4BL7 B;  4KF9 A;  2FY6 A;  2VCQ A;  3IDV A;  5IPH A;  2AUV A;  3LXT A;  1U3I A;  3M1G A;  3QMX A;  3I6A A;  3QAW A;  4F03 A;  17GS A;  4AJ8 A;  4TRX A;  8GSS A;  2FWF A;  5CNW A;  2R6K A;  1SK0 A;  5H5Q A;  4N30 A;  4PX1 A;  4DSR A;  4F0C A;  5B7C A;  2BJX A;  4ULX A;  2R0P A;  2D2Z A;  3VPQ A;  2OAC A;  3PR8 A;  1XCC A;  5A4W A;  4BVY B;  3D4T A;  4EDY A;  2MMZ A;  5DCG A;  3SBC A;  2IMK A;  2GGT A;  7GSS A;  2XBI A;  4HZ2 A;  4Q5Q A;  2IWT A;  5ECL B;  1HYU A;  2GSQ A;  3LSZ A;  4G0L A;  4EL1 A;  5E4W A;  4IVF A;  4NWY A;  1ACV A;  3W8S A;  1SEN A;  1ZMA A;  2LV3 A;  2B1K A;  1FOV A;  1ML6 A;  2I81 A;  3UJ1 A;  1OE7 A;  2VO4 A;  1EP7 A;  1GUM A;  4PXO A;  5ECH B;  3DGQ A;  2X49 A;  3UBK A;  2O87 A;  3EYT A;  1OYJ A;  1V57 A;  4IP1 A;  5FWG A;  1WIK A;  2A4V A;  5GST A;  1EGR A;  1OKD A;  3MAK A;  3LW9 A;  4FYB A;  2HSH A;  3O3T A;  1J08 A;  1GWC A;  4TR1 A;  1K0N A;  1IYI A;  4IQA A;  4IGJ A;  3TB2 A;  1JLW A;  4ZBD A;  2WDU A;  4AGS A;  1Z7R A;  5HFK A;  1YEP A;  5CO3 A;  2ES7 A;  5FHI A;  4RI6 A;  3UBL A;  1WOU A;  4EKZ A;  22GS A;  4HU7 A;  3F8U A;  1GSD A;  3IE3 A;  4IKH A;  2TIR A;  3TCO A;  5GAP D;  2H1A A;  4ECC A;  4GQC A;  5DQY A;  3SWL A;  3TKS E;  1GSY A;  3FMW A;  1HNB A;  4TR4 A;  3ZZX A;  2K9F A;  1PX7 A;  3IV4 A;  2WB9 A;  4XS4 B;  1ZOF A;  3RPN A;  4ZB8 A;  3N5O A;  4ZB9 A;  1QUW A;  1NW2 A;  3DML A;  4XS6 A;  5D93 A;  2FCH A;  2VD0 A;  4G0K A;  1DBY A;  4IW9 A;  3D21 A;  2L5L A;  2HRN A;  5KOX A;  3BBY A;  3US3 A;  1XXU A;  2AJQ B;  1ZYQ B;  1HNA A;  3CMI A;  4L0U A;  2TRC P;  6GSX A;  2PPT A;  1FB6 A;  1PRX A;  4WKW A;  3CSH A;  4E8E A;  3D22 A;  2O85 A;  1A0R P;  2E2G A;  1WRY A;  1I5G A;  2I3Y A;  1K3L A;  3KH9 A;  1XZO A;  3CXG A;  1XIY A;  2X8H A;  1SJ6 A;  2F51 A;  4OFT A;  20GS A;  3ZVJ A;  4ZXG A;  1V2A A;  3A5I A;  2NVL A;  4JRR A;  3ZVJ D;  4I5Q A;  5B8B A;  4ACS A;  1W89 A;  1Z5Y E;  2H76 A;  3APO A;  1V40 A;  5B6M A;  3HJP A;  5G31 A;  3DWV A;  4JBB A;  1GLP A;  1EWX A;  2A2R A;  4BVX A;  2L6D A;  3WGE A;  1OC3 A;  2VCT A;  2YPM A;  2N5B A;  1Z3E A;  3ZRD A;  1M0U A;  1MEK A;  2DIY A;  1O85 A;  2XBQ A;  3F3R A;  2GZZ A;  2JU5 A;  3NZN A;  5G30 A;  1UVZ A;  2QGV A;  4MZB A;  1M2A A;  4P3Y B;  1XFL A;  1FVJ A;  4KND A;  1OE8 A;  3VLN A;  3KP9 A;  1WPI A;  3GHA A;  1SYR A;  5ECR B;  4TW5 A;  2H74 A;  3HVX A;  3LJR A;  4Q5N A;  1T1V A;  1B9Y C;  2VM2 A;  5D73 A;  3TUE A;  1YJ6 A;  1MDI A;  3ERW A;  2LST A;  4MJA A;  2GDR A;  2H0G A;  4MPF A;  5DJL A;  1YKC A;  1JFU A;  3F3Q A;  3ZML A;  2KP2 A;  3L0H A;  2VL2 A;  3EPT A;  4WBR D;  4KAE A;  1WMJ A;  3A3T A;  3CSI A;  4NMU A;  2DLX A;  4CW9 A;  1NHY A;  2PVQ A;  5KEJ A;  1EV4 A;  3L9S A;  3QPM A;  1XW5 A;  3GFK A;  1JZR A;  5F07 A;  4WEY A;  3LWA A;  4I2T A;  4EXJ A;  2VL9 A;  3ERG A;  3LFL A;  1A23 A;  3KM6 A;  2CAQ A;  3UEM A;  3KTL A;  19GS A;  4XHM A;  1E6B A;  4KSM A;  1U88 A;  5DAL A;  4WR4 A;  3EWL A;  2VD1 A;  2LS5 A;  5LCZ A;  4KDU A;  1AAZ A;  4HU9 A;  2QSI A;  5IMC A;  3F0I A;  4GLT A;  3MYD A;  3DD3 A;  1SU9 A;  1H75 A;  4CY6 A;  2I9H A;  3FZ5 A;  1I9D A;  1TRV A;  5IPG A;  1XPV A;  1ZYE A;  5ECK B;  3LYK A;  3G7Y A;  4V1A p;  1X9S B;  6GST A;  2X99 A;  3UAR A;  2H66 A;  5DAK B;  4EF0 A;  1Z9H A;  3HA9 A;  2OAD A;  1M2B A;  3UIW A;  4OMV A;  4O5R A;  2MZC A;  1TK0 B;  4LL1 B;  4NHZ A;  1KNG A;  1A2M A;  5ID2 A;  2EC4 A;  3HZ4 A;  2C3T A;  1K0A A;  3A2W A;  3GTU A;  2KOK A;  3BD2 A;  1Q4J A;  3IOS A;  4LLR A;  4RI7 A;  3L4N A;  4HQZ A;  3D0Z A;  2LQQ A;  1MDK A;  3UOM A;  2WS2 A;  2B1L A;  5INY A;  5ENU A;  2DSA A;  3EIN A;  4GF0 A;  5DJM A;  4DSS A;  1YEX A;  1AQV A;  4N10 A;  3TJK A;  4K7I A;  5H5R A;  3IAM 2;  3FKF A;  1PN0 A;  4KE3 A;  1MD3 A;  1TRW A;  3GKK A;  5ELG A;  3C8E A;  4MJB A;  4K1F A;  1HQO A;  4PQI A;  3GSS A;  3J7Y b;  3HD5 A;  4XS1 A;  3GV1 A;  2LNS A;  4OCF A;  4KDX A;  2J23 A;  3FR3 A;  2GSS A;  2IMF A;  2GST A;  2V6O A;  3ME8 A;  1V58 A;  3DYR A;  3ME7 A;  3KTB A;  2B3S A;  2YN1 A;  5CRE A;  5HFG A;  1QXH A;  3TKS C;  2IME A;  2VM1 A;  5GZZ B;  4PUF C;  1XWG A;  4RQR A;  2HI7 A;  1GL8 A;  4CY8 A;  4Q5F A;  1B9X C;  4MZW A;  1USB A;  3FHK A;  1VF4 A;  4KB3 A;  1GTB A;  5D9X A;  3KIJ A;  1OC9 A;  4ECB A;  2J9H A;  2YV7 A;  4I6X A;  2XPD A;  3QFB C;  1EZK A;  2H6Z A;  3L78 A;  4PUR A;  2R0G A;  2AAW A;  2VOC A;  4MH3 A;  4MF7 A;  1GUK A;  3ZTL A;  1AC1 A;  3TGZ A;  2LEG A;  1WE0 A;  4K6X A;  3VFI A;  2DJ1 A;  4OWY A;  5HR0 A;  4YQU A;  1TXX A;  1VF2 A;  3UVT A;  1EV9 A;  3HXS A;  3HZ8 A;  4TR0 A;  2JZR A;  4V1A g;  2YZH A;  1R5P A;  3QAG A;  2PER A;  4TVE A;  3A5W A;  2BMX A;  4ICY A;  1X5D A;  2G2Q A;  2OE0 A;  3ZL5 A;  2PBJ A;  1GP1 A;  5AIS A;  2IPA A;  5IO2 A;  2K8V A;  4MMM A;  2GT6 A;  1K0C A;  3IC4 A;  3WGD A;  5D9W A;  3C1S A;  1LU4 A;  3RDW A;  1XOA A;  4K0N A;  5AGY A;  4DVC A;  4HOJ A;  2JZT A;  2V6K A;  4MF5 A;  5JWR B;  4MAB A;  1N2A A;  1AXD A;  2PMT A;  4H86 A;  3VWU A;  1JHB A;  3FY7 A;  2OBI A;  2EIR A;  1DSB A;  1PD2 1;  2C0F A;  3QCP A;  4J2F A;  4EIP A;  4ID0 A;  3H1N A;  4FQU A;  1AQW A;  4BA7 A;  3V1W A;  3GKX A;  5IMA A;  1KEB A;  3KGK A;  1PL1 A;  1XVQ A;  1T4Y A;  1QK8 A;  3CRT A;  3GST A;  1TDI A;  3F6F A;  2GS3 A;  1M9A A;  5IOX A;  1XWC A;  1NSW A;  4HJ2 A;  4YQM A;  3Q6O A;  4V2N A;  5DVB A;  2B6M A;  3D5J A;  4JU5 A;  4BL7 A;  1BG5 A;  4HI7 A;  4ZIJ A;  2RM5 A;  3LGC A;  3LYP A;  1A2J A;  1PX6 A;  2H72 A;  2VLU A;  2HRK A;  5E59 A;  4Z7X A;  3OR5 A;  2WCI A;  3RHC A;  3NOF A;  5L71 A;  4K5S A;  4IBP A;  3FR6 A;  4TXO A;  2H71 A;  1EP8 A;  4TN8 A;  2CV4 A;  3I43 A;  1VGL A;  3TJG A;  2H30 A;  2YWO A;  2DBC A;  4MK3 A;  4YAP A;  3UMA A;  3ISO A;  3PGT A;  2LJR A;  2YZU A;  4G19 A;  1RW1 A;  4LMW A;  1FVK A;  3KJY A;  2IMD A;  3C7M A;  4X0X A;  1XWB A;  2HZE A;  3KD0 A;  3E0U A;  5DDL A;  2HZF A;  4LA1 A;  4ISD A;  1G0T A;  1SJI A;  5HR1 A;  4CDO A;  2HYX A;  3TOU A;  1JLV A;  1FG4 A;  1SKS B;  5JCG A;  1SKR B;  3VI7 A;  4PQH A;  2MBS A;  1ERV A;  1Q98 A;  4USS A;  4MPG A;  1EEJ A;  5KOW A;  2N5A A;  3HCZ A;  3RHB A;  4J56 E;  3IK7 A;  3NIV A;  4WR5 A;  3P2A A;  16GS A;  4ZBA A;  1SD8 A;  1BYE A;  4K7N A;  1J9B A;  3D6I A;  2FLS A;  3C73 A;  1F9M A;  1S3A A;  2C80 A;  3ZFB A;  2P31 A;  3KH7 A;  3IR4 A;  3GUR A;  3L9V A;  5BRT A;  2LRC A;  2E0Q A;  1THO A;  3U6V A;  2WUL A;  1S3C A;  1O8X A;  2FGX A;  2V1M A;  3ZFL A;  3A2V A;  2K6V A;  2LRN A;  1B8X A;  2LJA A;  3DEX A;  1XBS A;  3DIE A;  4WXT A;  3GIX A;  3GH9 A;  3QD9 A;  3M0F A;  5EL8 A;  1X5E A;  1TTZ A;  4IJI A;  1SK1 A;  1BQ7 A;  1VF1 A;  2H8L A;  4BWQ A;  1AQX A;  2GQK A;  1GUL A;  4KH7 A;  1H4O A;  2WGR A;  4JZQ A;  3DVW A;  1QQ2 A;  2F3M A;  3MIX A;  2GZP A;  1FHE A;  6GSU A;  2E2M A;  4X4J A;  2DC5 A;  2H6X A;  4G10 A;  1A2L A;  3CYN A;  2GZY A;  5EPF A;  5IOW A;  3BJ5 A;  4HS1 A;  2C0D A;  2PUK C;  2XHF A;  3KP8 A;  2BTO T;  2H73 A;  3EUR A;  3P90 A;  4JED A;  5HR3 A;  2AV4 A;  3HYP A;  4D73 B;  2QA1 A;  1HD2 A;  5KN1 A;  1B4Q A;  3G9B A;  1PA3 A;  3BCI A;  2G0F A;  2IFQ B;  1FO5 A;  1V9W A;  5ECM B;  4WF4 A;  2YWN A;  3FZ9 A;  2WFC A;  2K18 A;  3UAP A;  3Q18 A;  5ECO B;  2HLS A;  4QQ7 A;  1FAA A;  3GKM A;  3J7Y k;  4TXV A;  5GAN D;  1GTA A;  4O5U A;  3EMP A;  2GQM A;  3R3E A;  3ED3 A;  3HY2 A;  1BED A;  1YF0 A;  4K5R A;  5HFI A;  2F8F A;  4WBJ A;  4MLY A;  5DBQ A;  5G1K A;  4G0I A;  2OJL A;  3HHV A;  2R2J A;  4POK A;  1ZYP A;  5IO0 A;  4MJC A;  1QMV A;  2H70 A;  5G5F A;  1T7P B;  3GNJ A;  1F3B A;  3S9F A;  1GSF A;  1ILO A;  2RUE A;  2EIO A;  1ZCP A;  3G7J A;  4POB A;  5F05 A;  3APS A;  5D96 A;  4OO4 A;  4YAV A;  4XTS A;  1SL2 B;  4FO5 A;  4L8E A;  1GTI A;  4EDZ A;  5CRW A;  4F2I A;  1O73 A;  1OAZ A;  3F4S A;  2IMI A;  3CRU A;  6GSY A;  13GS A;  2L4Q A;  2ZCT A;  3KCM A;  1DE1 A;  4XCS A;  3VWW A;  4ECI A;  2XPE A;  3IRA A;  2VIM A;  1GH2 A;  2X4A A;  2JAD A;  2MYG A;  5FT3 A;  2X64 A;  4ZIL A;  5ECN B;  2WZ9 A;  1F2E A;  2FHE A;  3A2X A;  3TJJ A;  2DKI A;  2X8G A;  2H01 A;  1EEM A;  2C3Q A;  4FIW A;  2WRT A;  1UC7 A;  4MDC A;  1TRU A;  3KMN A;  2NPB A;  1A8L A;  5ECP B;  1FW1 A;  2LRT A;  4MCU A;  3HKR A;  2HNL A;  5HQP A;  3LG6 A;  1GSE A;  3FRC A;  3DVX A;  1F3A A;  2GTU A;  2LQO A;  1EGO A;  2R4V A;  3ZMK A;  4GXZ A;  5ABR A;  4MF6 A;  1URM A;  3G7I A;  1SL1 B;  1BJX A;  4Q5R A;  4ML6 A;  5J5N A;  1U3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...