2OBIA

Crystal structure of the selenocysteine to cysteine mutant of human phospholipid hydroperoxide glutathione peroxidase (gpx4)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
165
structure length
165
Chain Sequence
DDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Phospholipid hydroperoxide glutathione peroxidase (GPX4)
publication title Structural basis for catalytic activity and enzyme polymerization of phospholipid hydroperoxide glutathione peroxidase-4 (GPx4).
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 165
sequence length 165
ec nomenclature ec 1.11.1.12: Phospholipid-hydroperoxide glutathione peroxidase.
pdb deposition date 2006-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2obiA00
5ECOB 3TKSE 1JLVA 2K8VA 1PQNA 2DJ1A 3LORA 4IVFA 4KDUA 3PH9A 3TJKA 6GSVA 4MDCA 4ISDA 3EC3A 4ECJA 2H8LA 4KDXA 3TGZA 1I5GA 1U88A 3FZ5A 5CP1A 2VD0A 2WGRA 2DLXA 3DGQA 2E7PA 3FEUA 2R2JA 1DSBA 2AUVA 3UJ1A 1O85A 4G10A 5A4WA 2VLTA 2PVOC 4G2EA 4JR4A 4PNFA 1ERWA 1MD3A 4KUNA 2WCIA 4MF7A 2VLUA 3HJPA 1WJKA 3J7Yk 3ZIJA 2PPTA 4ECIA 1FAAA 2C8UA 2HLSA 1ACVA 4XCSA 3G7JA 2CZ3A 1YF1A 2H6ZA 1EWXA 4MCUA 1OVNA 2M72A 2M46A 1WPIA 1NHOA 1FO5A 4OCFA 1M0UA 2OADA 1YDKA 2J9HA 2K18A 3V1WA 2I3YA 4RI7A 1NSWA 3M8NA 3IOSA 3CSHA 2YCDA 1QK8A 3BBYA 4Q5RA 4NMUA 1WWJA 5AIVA 4KW6A 4XTSA 4XS6A 3K8NA 4NV5A 1PX7A 3HVSA 4MJAA 2P31A 2ON7A 3TDGA 1XPVA 1ERUA 1IYHA 3G7IA 2JADA 4TR1B 3TKPA 4HJ2A 2C1YA 2WULA 2FGXA 5IMVA 3ERFA 1B48A 3GL3A 5AGYA 1T00A 2HNLA 3Q6OA 3ZRDA 2CVKA 3IE3A 1JHBA 1NHYA 3ME8A 2DIYA 3IDVA 2R5GA 4IJIA 3ERGA 4DVCA 3ED3A 2LKUA 2PMTA 4J2FA 2NDOA 5DALA 4D73A 2LNTA 3DVXA 3FW2A 1K0OA 2B5EA 2YWOA 2LRNA 3GSSA 2NBSA 2RIIA 4HZ2A 2HSYA 3DIEA 4K2DA 2ZUPA 2MYGA 4NHZA 1GTUA 1T8EB 2OKAA 3LG6A 1FHEA 3APSA 2F8AA 3C7MA 3TJFA 4Q5QA 1EP7A 2JZSA 4ZL9A 2GT5A 2MBSA 2H75A 11GSA 1SK2A 3I69A 1Z6NA 2VUPA 4TOPA 2KOKA 4TXOA 1MDJA 4G19A 3IV4A 1F37A 3ISOA 2DMMA 3TB2A 1F6MC 3FZAA 4HI7A 4WKWA 2K9FA 3CSJA 1RK4A 2O87A 2DJ0A 1ZGNA 1YKAA 1QXHA 4ZL7A 2MMNA 2JZRA 3FR3A 2C0FA 1QMVA 3D5JA 3F63A 3APQA 5C00A 4KDYA 1A23A 4K7NA 4BL7A 3ERWA 1WIKA 1V58A 1VF2A 3KCMA 2GZZA 1JZRA 3H79A 4K0GA 4KB3A 5ECLB 1LJRA 4OFTA 2LRTA 4NV2A 3WGXA 1J0FA 2I9HA 2VIMA 3E0UA 3TOTA 4MABA 2JL4A 4NPBA 4V2LA 3PR8A 3QDNA 3MNGA 2KP2A 4ZL8A 5DJLA 1VRSD 2FY6A 3GV1A 3W8JA 1XIYA 3IHQA 2CX3A 5ECNB 1DUGA 3GHAA 3LFLA 3TKQA 2V6KA 4GTUA 1PX6A 1TRSA 6GSXA 1AQXA 5ECIB 2XBQA 4HJMA 3BD2A 1O8WA 4XRAA 2LTKA 1MTCA 4F03A 2B7KA 4BWQA 1XZOA 4K9ZA 3FK8A 2I81A 3F3QA 6GSUA 4N10A 4ZB6A 3GUSA 3O6TA 3ZL5A 5LNKe 2IJYA 5ID2A 1Z9HA 2MMOA 5JCWA 2V32A 3M1GA 4MZBA 2GVPA 3E9JB 2AAWA 1T1VA 4IN0A 4TKYA 2MMAA 4HQSA 1BEDA 1JZWA 1J9BA 2A2SA 2EIOA 3NZNA 1RQMA 1SYXA 4NWYA 4DSQA 1GUMA 1UN2A 1MDKA 1F2EA 1SKWB 8GSSA 1G6YA 4PURA 4RQXA 5D93A 2C4JA 1R4WA 5J41A 3FZ9A 1EOHA 2LS5A 4OWYA 3VPTA 3KEBA 1XVQA 2H1AA 2IIYA 1KTEA 2VCQA 4EUYA 4TR4A 4CW9A 4O92A 4EL1A 4TN8A 1O73A 4K1FA 1HNCA 1SJ6A 2OBIA 3GMFA 1SJIA 1K0BA 1UA5A 5AN1A 1XW5A 3D6IA 3O76A 4POLA 2L4QA 1THXA 1WRYA 4JE1A 4Q5NA 4ZILA 2DIZA 4JRRA 2IFQB 1EGOA 2CVDA 4PX1A 1OKDA 2F9SA 1TK8B 3HVVA 1MD4A 2V6OA 5D9VA 4L0WA 3GTUA 4FIWA 3QOUA 4IP6A 4GWRA 2CT6A 1A2MA 1TJDA 2CV4A 1U3IA 5IMDA 4BA7A 2GT6A 3EE2A 5IIZA 2OBKA 3HKRA 4HQZA 3Q19A 5C04A 3GIXA 1DE2A 2GQLA 4QQ7A 1XWAA 2H6XA 2DSAA 2BMXA 2GSRA 1OKTA 1X0RA 4EF0A 5A4UA 1W89A 2DBCA 3IR4A 4N0VA 4ECBA 1GULA 3A2WA 3KTBA 2X64A 4MZWA 4P3YB 3DYRA 4MZCA 1B4QA 1AC1A 4EKZA 4EC0A 1A2LA 4GXZA 1XOAA 3ZITA 3G9BA 2CVBA 3EU3A 2YJ7A 1JFUA 3HJMA 4KNDA 1QFNA 4MH3A 1A8LA 4BPYA 1WE0A 2L6DA 3UAPA 1W4VA 1EV4A 3LYKA 1Z5YE 3LSZA 3D0ZA 1GLQA 3HHVA 5F0GA 2YZHA 3KJYA 1CQGA 4ILFA 2FHEA 5HQPA 4IHUA 3EMXA 1FOVA 1I9DA 3KMNA 2ON5A 3RAZA 3VK9A 3LJRA 2D2ZA 2FUG2 2VCTA 4GLTA 5HFGA 4MF6A 3TJBA 2M80A 1WMJA 1OC9B 4DSRA 4BWSA 1ZMAA 4AJ6A 5J9BA 1QUWA 5B6MA 1J08A 2DJ3A 5EL8A 2CX4A 1ZCPA 1QQ2A 2FLSA 2F51A 4TVEA 1A0RP 2LV3A 4YQVA 4L5OA 2LJAA 3DMLA 3JCML 3TUEA 4GSTA 3QFAC 1F9MA 4K7OA 3KZQA 3C1RA 2VD1A 1ABAA 5GSTA 3GKXA 1PN9A 2F3MA 2VLVA 5FHIA 2AJQB 5ECMB 4F2IA 1TOFA 1FG4A 3BOAA 2B3SA 4GCIA 5HR0A 1B8XA 3IAM2 3IBHA 1A24A 1PRXA 1BG5A 2WB9A 2B5YA 3GX8A 3LYPA 19GSA 4MLYA 3RBTA 3RDWA 3ME7A 4GQCA 4XS4A 1EEJA 1FVKA 2C3TA 6GSTA 2GLRA 1ZOFA 4HOJA 2MMZA 4ZBBA 4ZBDA 3IRAA 1M9AA 1F3AA 4FH8A 5F06A 1GSQA 1H4OA 2H0HA 4GRFA 1GUKA 1PGTA 1GWCA 3GKMA 5G1KA 1GTAA 2FA4A 4MP4A 5HFIA 2CAIA 3L9VA 4AF2A 4JBBA 3TRXA 3ZYWA 3F4SA 4PNGA 2AYTA 2OJLA 4PGTA 2QC7A 3WGEA 3VI7A 2LNSA 5B8AA 1V9WA 4KSMA 3KP8A 3KXOA 2XHFA 3VLNA 1TW9A 2XPEA 3F8UA 2H1BA 4Z7XA 3L9UA 3HA9A 4X0XA 2HZEB 3WGDA 2WRTA 4WF4A 1T7PB 2JU5A 3D22A 2FCHA 4KA0A 5IOWA 3U5RE 4KAEA 1O8XA 4EXJA 1K3YA 4OCEA 2ZNMA 1HNBA 1BJXA 5HFKA 3HCZA 3LXTA 3QMXA 4DSSB 3EWLA 2H30A 3U6VA 5ECHB 1ZYEA 1TU7A 1TTZA 5D9TA 4NXIA 3HXSA 1OC8A 4PQHA 1SD8A 4J57E 3HZ8A 5G2ZA 2H01A 2H76A 4ECCA 3QCPA 3GN3A 1Q4JA 3L78A 3MDKA 1SKSB 2OE0A 4OFNA 1Z7RA 5DAKB 3UOMA 3G7YA 5F05A 3UVTA 3R2QA 3MSZA 3CSIA 3A2XA 3GKKA 2K6VA 3DKSA 4HU9A 3Q18A 3VFIA 5KN3A 4GF0A 1HQOA 1O7UA 1OE8A 1M9BA 1OE7A 5IPHA 1XWKA 3TKSC 3LXZA 2C0DA 4ML1A 5DBQA 2MZCA 3EMPA 4IS0A 3M9JA 4N0ZA 4LMWA 1T4YA 1LBKA 2FWHA 4FYBA 2GGTA 5DCHA 3S9FA 1ZYQB 3DVWA 2HSHA 2VL3A 1MDIA 1V98A 4OD7A 1RW1A 1V57A 1WOUA 2H72A 1Y25A 4MA9A 3VWXA 2GSSA 4MF5A 2PWJA 2YOIA 2PU9C 4TR3A 3IA1A 1GNEA 3TKSA 2LJKA 3KTLA 4HS1A 4XRDA 4G9HA 3KIJA 4X1UA 1B9YC 3ZZXA 3F4TA 4XHMA 2BTOT 1E2YA 3C73A 5G31A 2CZ2A 5IO0A 1TXXA 2OACA 2V41A 1PL2A 2N5BA 3FY7A 1G0TA 3CTGA 2C3NA 1F3BA 1K0MA 5DVBA 2A4VA 5JWRB 1K3OA 5CO3A 2H74A 3UARA 2IWTA 2TRXA 1K0NA 2IL3A 3H8QA 2YNXA 4I6XA 2GDRA 3N5OA 1OC9A 3HYPA 1HYUA 2LQQA 4IELA 1URMA 4BVYA 4POKA 5J9CA 1G7EA 4FYUA 3QAWA 2OE3A 2HRNA 3ZREA 5IQYA 5ECRB 4NAXA 1FVJA 3UMAA 3LQ7A 2H73A 2C0EA 1KEBA 4V1Ap 4KX4A 5KEJA 1Y6EA 1AAZA 4POBA 1S3DA 2H0GA 4WEYA 3IPZA 5JCGA 4IBPA 3ZFLA 2VCXA 2IMDA 2HXKA 3F0IA 5INYA 3VWUA 1ILOA 1G7OA 2AHEA 1B4PA 3KD0A 2V1MA 4QL7A 4N30A 4ID0A 5IMZA 3EU4A 3M0FA 2H70A 13GSA 1ERVA 1TI1A 3VWVA 4WR4A 2DJ2A 1JZOA 1AXDA 2Z9SA 2PUKC 5IOXA 2JACA 3DD3A 5KN0A 1BQ7A 4EDYA 4GQFA 2PGTA 3HDCA 3UIWA 1XWCA 3GURA 1XWBA 4RUVA 3WT2A 6GSSA 3L9SA 4F0CA 1S3AA 1PKWA 3SBCA 2EIQA 1ZL9A 4MMMA 1TK0B 3LGCA 5IMFA 3RPPA 5ABRA 1USBA 3MAKA 2E0QA 3VI5A 5AISA 5ENUA 1X5DA 1ZZYA 3HVXA 3P2AA 3L0HA 1VF3A 3C8EA 4TXOB 4TRXA 2WS2A 1OC3A 2PERA 4ZB8A 3F6FA 1UVZA 5IPGA 3QAVA 1FB0A 3HY2A 1KBNA 3C1SA 5J5NA 4TR1A 2REMA 4XIHA 4HU7A 3QD9A 4H86A 2CAQA 3E3EA 4F0BA 5CRWA 1VF4A 3EVIA 2B5XA 4JZQA 1TRUA 1YY7A 3IK7A 2HYXA 1YJ6A 1C72A 2P5RA 3H1NA 5D9WA 2ZCTA 3EYTA 2FWFA 18GSA 2GTUA 5ECQB 1B9XC 1YKCA 2HZFA 3D4TA 1TRWA 4ZB9A 4AGSA 4JU5A 2YJHA 2G2QA 16GSA 1YQ1A 4ULXA 4F9ZA 3KH7A 4PUAA 10GSA 4FYCA 2XPDA 3CTFA 2RLIA 2WFCA 3F9UA 3TRQA 2IMKA 4JR6A 2XC2A 5EY6A 4AJ8A 5JWQB 2VCZA 3AY8A 3SWLA 4O5RA 3APOA 4PQIA 1WP0A 2B7JA 3D4MA 2KUCA 1EOGA 4E8HA 3N9JA 2LUSA 1GL8A 1O81A 5LCZA 5JWOB 3A5WA 1Q98A 6GSYA 3GA4A 4BVXA 1X5CA 2EIRA 2NVLA 4ACSA 2F8FA 5CNWA 4RI6A 4YQUA 2JSYA 2VOCA 4Q5FA 2PN8A 5ECSA 2RM6A 3ZFBA 1QGVA 1R26A 2IMIA 2QSIA 2VAFA 5ID2B 5DQYA 4EO3A 3CMIA 1GLPA 1YF0A 5HR2A 1SJZA 2QGVA 3FRCA 3DWVA 3CXGA 4IQ1A 2L57A 2LEGA 3HD5A 2AB6A 4I2TA 1ON4A 5CYYA 2A2RA 2NPBA 2X99A 5ELGA 5EVOA 2RM5A 2N5AA 3UEMA 3BCKA 5CAXA 17GSA 1AW9A 4YH2A 1M7TA 2GSQA 4IGJA 3Q74A 1GTIA 1GP1A 1TI3A 3PGTA 2H1DA 1DBYA 4MPFA 2LQOA 3TJGA 1K3LA 3CYNA 1OAZA 1A2JA 1H75A 1JZDA 1SENA 2X8CA 1XWGA 2VCWA 2C3QA 4CDOA 2DJKA 4KSOA 5DJMA 2I4AA 1V2AA 2EC4A 3TJJA 7GSSA 4HDEA 4L5LA 1HD2A 1Z7PA 1FW1A 5ECKB 1N2AA 5G5FA 1FB6A 2FWEA 4X43A 3GKNA 2PBJA 4KCEA 4JEDA 4WR5A 4KGIA 5L71A 1X9MB 3F6DA 2G0FA 2LJRA 4WF5A 4CHSA 1YZXA 3GYKA 5F07A 2H66A 1R5PA 3GTUB 2AV4A 4OFMA 4J56E 2V2GA 1XW9A 3FHKA 3KH9A 1GTBA 5J4UA 4EDZA 2BJXA 22GSA 2L59A 2LSTA 5D8IA 5ELAA 1VGLA 2HI7A 3CRUA 3F3RA 5HR3A 1YEXA 3GNJA 3GSTA 2YWMA 4OO5A 2R37A 2RUEA 4RQRA 4K8MA 2OE1A 4TR0A 4GSNA 1ST9A 1SL1B 1BAYA 2DMLA 1GH2A 2MBTA 3IAS2 3QAGA 3CRTA 1E6BA 1PA3A 4ZIJA 2H6YA 1X9SB 2YWIA 5D73A 3TRPA 3RPNA 3WD6A 2H0IA 3UBLA 4IKHA 1U3AA 5J3RA 4POMA 4IQAA 1JLWA 1EV9A 2XBIA 4ML6A 4L0UA 1T4ZA 4OO4A 1A8YA 1BYEA 2L5LA 4ZXGA 1SU9A 1GRXA 3NIVA 5A5KA 4KH7A 2HRFA 1SD9A 2HT9A 3TKRA 1SL0B 1THOA 5JCUA 2R4VA 2YZUA 1XCCA 1GSFA 4K0NA 3D21A 3P8WA 3KP9A 2YN1A 1SKRB 3W8SA 2B1KA 5GAPD 3J7Yb 12GSA 5IO2A 2IFQA 2H71A 1EZKA 4O7HA 2VL2C 1TDIA 2PVQA 2FWGA 5H5SA 3ZMLA 9GSSA 2L4CA 2CQ9A 2O7KA 1M99A 1S3CA 1AIUA 5D9XA 3WT1A 2K8SA 1LU4A 2R3XA 3W6GA 3HJOA 3EINA 3QFBC 4XS1A 3A3TA 1X5EA 2GSTA 4LMVA 1U6TA 1G6WA 3BCIA 3FR9A 3KM6A 2VL2A 4TW5A 1SK0A 2HE3A 2X8GA 5KN2A 1AQVA 2NTOA 2YPMA 1XFLA 3TOUA 3M9KA 3UL3A 2FD3A 3HZ4A 5H5QA 1XOBA 2JZTA 2QKEA 1GSSA 5D96A 1KNGA 1M2DA 3H4KA 3I43A 4HEA2 5G5EA 3EURA 2RUFA 4V2MA 2P5QA 1PSQA 1TKDB 4LA1A 3C71A 2GZYA 1GSYA 1PD21 4PXOA 4MJEA 3ZMKA 5F8BA 2O8VB 3US3A 2B6MA 1AUCA 1R7HA 4XS4B 2YV7A 3GFKA 3NOFA 4MJCA 5IM9A 4WXTA 1Z3EA 14GSA 3DRNA 1K0DA 1BX9A 1YEPA 1ML6A 3VPQA 2YANA 4QL9A 3RHCA 2YV9A 1R5AA 5B6NA 1TK5B 5CRHA 6GSWA 3VWWA 1SYRA 4HZ4A 2I1UA 5B7CA 2FNOA 1PMTA 4V1Ag 5A4VA 4AJ7A 2J23A 2L6CA 2IMFA 1GSDA 5B8BA 3DEXA 5IMAA 2ES7A 5GSSA 3P7XA 4IW9A 2O89A 2DJJA 4DEJA 3IXRA 3LWAA 4MK3A 4WBRD 2VCVA 4I8BA 4IJ3A 2OA7A 5ECPB 1NM3A 4TXVA 5CRDA 1GSUA 5FT3A 2C0GA 1TRVA 3GRXA 4WETA 4MH2A 1MEKA 3QR6A 5DALB 1U87A 4D73B 5GAND 1IYIA 5LD0A 3FZ4A 3H93A 4NHWA 5DCGA 1GSEA 2IN3A 3OR5A 2GS3A 1O6JA 3I6AA 2B1LA 3IK9A 2WDUA 3A2VA 1XBSA 3ZTLA 4F82A 2KLXA 5E4WA 4FO5A 1V40A 4I5QA 2DC5A 1TP9A 5IMCA 1DE1A 3FR6A 5DQSA 4YAVA 4K6XA 3WYWA 3RHBA 2VM2A 5CRGA 1K0CA 1EP8A 3CBUA 3FKFA 2TRCP 4N11A 2O85A 1AQWA 1HNAA 2KHPA 5HR1A 3PINA 3VURA 4MJBA 4O32A 4I2UA 1UC7A 5FWGA 4V2NA 1EEMA 4HUAA 3ZLPA 3UVHA 1M2BA 1PL1A 1XVWA 1VF1A 1XW6A 2KP1A 4I97A 2H19A 2H1GA 2P0GA 2HZEA 2GQKA 4OMVA 4WBJA 1N8JA 5CREA 4EVMA 4E8EA 2CA8A 3UBKA 1M2AA 4EE0A 3ZIVA 2WJUA 2TIRA 2VM1A 1GNWA 4LL4B 1T3BA 4PQ1A 3TCOA 5G1LA 3GH6A 1GUHA 2VL9A 1SK1A 3BJ5A 4K7IA 2IPAA 3MWHA 4GSSA 4KCAA 2IMEA 2HFDA 1CQHA 3L4NA 3I9V2 1EGRA 3KMOA 2LRCA 1TU8A 1K0AA 5G30A 1OYJA 4DSSA 1A0FA 2FA8A 4L8EA 5E59A 3DXBA 3FYGA 3GL5A 3P90A 4KE3A 1XXUA 1ERTA 4PUFC 5H5RA 1PKZA 3KGKA 1NW2A 3O3TA 1Z6MA 2C80A 2VO4A 3IC4A 4MPGA 2ALBA 1X9WB 5KN1A 3GX0A 3LEFA 4YAPA 5DAKA 2GZPA 4LLRA 2E2GA 2N5FA 5COHA 2L5OA 1SL2B 3ZVJA 3GH9A 5AIXA 5GZZB 3QPMA 2R6KA 20GSA 4IP1A 2X8HA 3F4RA 5DDLA 2E2MA 4YQMA 2YP6A 4ZBAA 2GQMA 2JSZA 4LL1B 3ZVJD 2WZ9A 2YWNA 3M3MA 5EPFA
chains in the Genus database with same CATH superfamily
5ECOB 3TKSE 1JLVA 2K8VA 1PQNA 2DJ1A 3LORA 4IVFA 4KDUA 3PH9A 3TJKA 6GSVA 4MDCA 4ISDA 3EC3A 4ECJA 2H8LA 4KDXA 3TGZA 1I5GA 1U88A 3FZ5A 5CP1A 2VD0A 2WGRA 2DLXA 3DGQA 1FOHA 2E7PA 3FEUA 2R2JA 1DSBA 2AUVA 3UJ1A 1O85A 4G10A 5A4WA 2VLTA 2PVOC 4G2EA 4JR4A 4PNFA 1ERWA 1MD3A 4KUNA 2WCIA 4MF7A 2VLUA 3HJPA 1WJKA 3J7Yk 3ZIJA 2PPTA 4ECIA 1FAAA 2C8UA 2HLSA 1ACVA 4XCSA 4KF9A 3G7JA 2CZ3A 1YF1A 2H6ZA 1EWXA 4MCUA 1OVNA 2M72A 2M46A 1WPIA 1NHOA 1FO5A 4OCFA 1M0UA 2OADA 1YDKA 2J9HA 2K18A 3V1WA 2I3YA 4RI7A 1NSWA 3M8NA 3IOSA 3CSHA 2YCDA 1QK8A 3BBYA 4Q5RA 4NMUA 1WWJA 5AIVA 4KW6A 4XTSA 3IHGA 4XS6A 3K8NA 4NV5A 1PX7A 3HVSA 4MJAA 2P31A 2ON7A 3TDGA 1XPVA 1ERUA 1IYHA 3G7IA 2JADA 4TR1B 3TKPA 4HJ2A 2C1YA 2WULA 2FGXA 5IMVA 3ERFA 1B48A 3GL3A 5AGYA 5KOWA 1T00A 2HNLA 3Q6OA 3ZRDA 2CVKA 3IE3A 1JHBA 1NHYA 3ME8A 2DIYA 3IDVA 2R5GA 4IJIA 3ERGA 4DVCA 3ED3A 2LKUA 2PMTA 4J2FA 2NDOA 5DALA 4D73A 2LNTA 3DVXA 3FW2A 1K0OA 2B5EA 2YWOA 2LRNA 3GSSA 2NBSA 2RIIA 4HZ2A 2HSYA 3DIEA 4K2DA 2ZUPA 2MYGA 4NHZA 1GTUA 1T8EB 2OKAA 3LG6A 1FHEA 3APSA 2F8AA 3C7MA 3TJFA 4Q5QA 1EP7A 2JZSA 4BVXB 4ZL9A 2GT5A 2MBSA 2H75A 11GSA 1SK2A 3I69A 1Z6NA 2VUPA 4TOPA 2KOKA 4TXOA 1MDJA 4G19A 3IV4A 1F37A 3ISOA 2DMMA 3TB2A 1PN0A 1F6MC 3FZAA 4HI7A 4WKWA 2K9FA 3CSJA 1RK4A 2O87A 2DJ0A 1ZGNA 1YKAA 1QXHA 4ZL7A 2MMNA 2JZRA 3FR3A 2C0FA 1QMVA 3D5JA 3F63A 3APQA 2HSMA 5C00A 4KDYA 1A23A 4K7NA 4BL7A 3ERWA 1WIKA 1V58A 2X49A 1VF2A 3KCMA 2GZZA 1JZRA 3H79A 4K0GA 4KB3A 5ECLB 1LJRA 4OFTA 2LRTA 4NV2A 3WGXA 1J0FA 2I9HA 2VIMA 3E0UA 3TOTA 4MABA 2JL4A 4NPBA 4V2LA 3PR8A 3QDNA 3MNGA 2KP2A 4ZL8A 5DJLA 1VRSD 2FY6A 3GV1A 3W8JA 1XIYA 3IHQA 2CX3A 5ECNB 1DUGA 3GHAA 3LFLA 3TKQA 2V6KA 4GTUA 1PX6A 1TRSA 6GSXA 1AQXA 5ECIB 2XBQA 4HJMA 3BD2A 1O8WA 3LW9A 4XRAA 2LTKA 1MTCA 4F03A 2B7KA 4BWQA 1XZOA 4K9ZA 4X4JA 3FK8A 2I81A 3F3QA 6GSUA 4N10A 4ZB6A 3GUSA 3O6TA 3ZL5A 5LNKe 2IJYA 5ID2A 1Z9HA 2R0CA 4YKGA 2MMOA 5JCWA 2V32A 2HRKA 3M1GA 4MZBA 2GVPA 3E9JB 2AAWA 1T1VA 4IN0A 4TKYA 2MMAA 4HQSA 1BEDA 1JZWA 1J9BA 2A2SA 2EIOA 3NZNA 4FQUA 1RQMA 1SYXA 4NWYA 4DSQA 1GUMA 1UN2A 1MDKA 1F2EA 1SKWB 8GSSA 1G6YA 4PURA 4RQXA 5D93A 2C4JA 1R4WA 5J41A 3FZ9A 1EOHA 2LS5A 4OWYA 3VPTA 3KEBA 1XVQA 2H1AA 2IIYA 1KTEA 2VCQA 2A4HA 4O5UA 4EUYA 4TR4A 4CW9A 4O92A 4EL1A 4TN8A 1O73A 4K1FA 1HNCA 1SJ6A 2OBIA 3GMFA 1SJIA 1K0BA 1UA5A 5AN1A 1XW5A 3D6IA 3O76A 4POLA 2L4QA 1THXA 1WRYA 4JE1A 4Q5NA 4ZILA 2DIZA 4JRRA 2IFQB 1EGOA 2CVDA 4PX1A 1OKDA 2F9SA 1TK8B 3HVVA 1MD4A 2V6OA 5D9VA 4L0WA 3GTUA 4FIWA 3QOUA 4IP6A 4GWRA 2CT6A 1A2MA 1TJDA 2QA2A 2CV4A 1U3IA 5IMDA 4BA7A 2GT6A 3EE2A 5IIZA 2OBKA 3HKRA 4HQZA 3Q19A 5C04A 3GIXA 1DE2A 2GQLA 4QQ7A 1XWAA 2H6XA 2DSAA 2BMXA 2GSRA 1OKTA 1X0RA 1ZYPA 4EF0A 5A4UA 1W89A 2DBCA 3IR4A 4N0VA 4ECBA 1GULA 3A2WA 3KTBA 2X64A 4MZWA 4P3YB 4EIPA 3DYRA 4MZCA 1B4QA 1AC1A 4EKZA 4EC0A 1A2LA 4GXZA 1XOAA 3ZITA 3G9BA 2CVBA 3EU3A 2YJ7A 1JFUA 3HJMA 4KNDA 1ZYNA 1QFNA 4MH3A 1A8LA 4BPYA 1WE0A 2L6DA 3UAPA 1W4VA 1EV4A 3LYKA 1Z5YE 3LSZA 3D0ZA 1GLQA 3HHVA 5F0GA 2YZHA 3KJYA 1CQGA 4ILFA 2FHEA 5HQPA 4IHUA 3EMXA 1FOVA 1I9DA 3KMNA 2ON5A 3RAZA 3VK9A 3LJRA 2D2ZA 2FUG2 2VCTA 4GLTA 5HFGA 4MF6A 3TJBA 2M80A 4Z2TA 1WMJA 1OC9B 4DSRA 4BWSA 1ZMAA 4AJ6A 5J9BA 1QUWA 5B6MA 1J08A 2DJ3A 5EL8A 2CX4A 1ZCPA 1QQ2A 2FLSA 2F51A 4TVEA 1A0RP 2LV3A 4YQVA 4L5OA 2LJAA 3DMLA 3JCML 3TUEA 4GSTA 3QFAC 1F9MA 4K7OA 3KZQA 3C1RA 2VD1A 1ABAA 5GSTA 3GKXA 1PN9A 2F3MA 2VLVA 5FHIA 2AJQB 5ECMB 4F2IA 1TOFA 1FG4A 3BOAA 2B3SA 4GCIA 5HR0A 1B8XA 3IAM2 3IBHA 1A24A 1PRXA 1BG5A 2WB9A 2B5YA 3GX8A 3LYPA 19GSA 4MLYA 3RBTA 3RDWA 3ME7A 4GQCA 4XS4A 1EEJA 1FVKA 2C3TA 6GSTA 2GLRA 1ZOFA 4HOJA 2MMZA 4ZBBA 4ZBDA 3IRAA 1M9AA 1F3AA 4FH8A 5F06A 1GSQA 1H4OA 2H0HA 4GRFA 1GUKA 1PGTA 1GWCA 3GKMA 5G1KA 1GTAA 2FA4A 4MP4A 5HFIA 2CAIA 3L9VA 4AF2A 4JBBA 3TRXA 3ZYWA 3F4SA 4PNGA 2AYTA 2OJLA 4PGTA 2QC7A 3WGEA 3VI7A 2LNSA 5B8AA 1V9WA 4KSMA 3KP8A 3KXOA 2XHFA 3VLNA 1TW9A 2XPEA 3F8UA 2H1BA 4Z7XA 3L9UA 3HA9A 4X0XA 2HZEB 3WGDA 2WRTA 4WF4A 1T7PB 2JU5A 3D22A 2FCHA 4KA0A 5IOWA 3U5RE 4KAEA 1O8XA 4EXJA 1K3YA 4OCEA 2ZNMA 1HNBA 1BJXA 5HFKA 3HCZA 3LXTA 3QMXA 4DSSB 3EWLA 2H30A 3U6VA 5ECHB 1ZYEA 1TU7A 1TTZA 5D9TA 4NXIA 3HXSA 1OC8A 4PQHA 1SD8A 4J57E 3HZ8A 5G2ZA 2H01A 2H76A 4ECCA 2DKIA 3QCPA 3GN3A 1Q4JA 3L78A 3MDKA 1SKSB 2OE0A 4OFNA 1Z7RA 5DAKB 3UOMA 3G7YA 4CY8A 5F05A 3UVTA 3R2QA 3MSZA 3CSIA 3A2XA 3GKKA 2K6VA 3DKSA 4HU9A 3Q18A 3VFIA 5KN3A 4GF0A 1HQOA 1O7UA 1OE8A 1M9BA 1OE7A 5IPHA 1XWKA 1M3IA 3TKSC 3LXZA 2C0DA 4ML1A 5DBQA 2MZCA 3EMPA 4IS0A 3M9JA 4N0ZA 4LMWA 1T4YA 1LBKA 2FWHA 4FYBA 2GGTA 5DCHA 3S9FA 1ZYQB 3DVWA 2HSHA 2VL3A 1MDIA 1V98A 4OD7A 4YKFA 1RW1A 1V57A 1WOUA 2H72A 1Y25A 4MA9A 3VWXA 4G0KA 4MF5A 2GSSA 2PWJA 2YOIA 2PU9C 4TR3A 3IA1A 1GNEA 3TKSA 2LJKA 3KTLA 4HS1A 4XRDA 4G9HA 3KIJA 4X1UA 1B9YC 4K5SA 3ZZXA 3F4TA 4XHMA 2BTOT 1E2YA 3C73A 5G31A 2CZ2A 5IO0A 1TXXA 2OACA 2V41A 1PL2A 2N5BA 3FY7A 1G0TA 3CTGA 2C3NA 1F3BA 1K0MA 5DVBA 2A4VA 5JWRB 1K3OA 5CO3A 2H74A 3UARA 2IWTA 2TRXA 3MIXA 1K0NA 2IL3A 3H8QA 2YNXA 4I6XA 2GDRA 3N5OA 1OC9A 3HYPA 1HYUA 2LQQA 4IELA 1URMA 4BVYA 4POKA 5J9CA 1G7EA 4FYUA 3QAWA 2OE3A 2HRNA 3ZREA 5IQYA 5ECRB 4NAXA 1FVJA 3UMAA 3LQ7A 2H73A 2C0EA 1KEBA 4V1Ap 4KX4A 5KEJA 1Y6EA 1AAZA 4POBA 1S3DA 2H0GA 4WEYA 3IPZA 5JCGA 4IBPA 3ZFLA 2VCXA 2IMDA 2HXKA 3F0IA 5INYA 3VWUA 1ILOA 1G7OA 2AHEA 3IC8A 1B4PA 3KD0A 2V1MA 4QL7A 4N30A 4ID0A 5IMZA 3EU4A 3M0FA 2H70A 13GSA 1ERVA 1TI1A 3VWVA 1PFOA 4WR4A 2DJ2A 1JZOA 1AXDA 2Z9SA 2PUKC 5IOXA 2JACA 3DD3A 5KN0A 1BQ7A 4EDYA 4GQFA 2PGTA 3HDCA 3UIWA 1XWCA 3GURA 1XWBA 4RUVA 3WT2A 6GSSA 3L9SA 4F0CA 1S3AA 1PKWA 3SBCA 2EIQA 1ZL9A 4MMMA 1TK0B 3LGCA 5IMFA 3RPPA 5ABRA 1USBA 3MAKA 2E0QA 3VI5A 5AISA 5ENUA 1X5DA 1ZZYA 3HVXA 3P2AA 3L0HA 1VF3A 3C8EA 4TXOB 4TRXA 2WS2A 1OC3A 2PERA 4ZB8A 3F6FA 1UVZA 5IPGA 3QAVA 1FB0A 3HY2A 1KBNA 3C1SA 5J5NA 4TR1A 2REMA 4XIHA 4HU7A 3QD9A 4H86A 2CAQA 3E3EA 4F0BA 5CRWA 1VF4A 3EVIA 2B5XA 4JZQA 1TRUA 1YY7A 3IK7A 2HYXA 1YJ6A 5KOXA 1C72A 2P5RA 4G0LA 3H1NA 5D9WA 2ZCTA 3EYTA 2FWFA 18GSA 2GTUA 5ECQB 1B9XC 1YKCA 2HZFA 3D4TA 1TRWA 3A5IA 4ZB9A 4AGSA 4JU5A 2YJHA 2G2QA 16GSA 1YQ1A 4ULXA 4F9ZA 3KH7A 4PUAA 10GSA 4FYCA 2XPDA 3CTFA 2RLIA 2WFCA 3F9UA 3TRQA 2IMKA 4JR6A 2XC2A 5EY6A 4AJ8A 5JWQB 2VCZA 3AY8A 3SWLA 4O5RA 3APOA 4PQIA 1WP0A 2B7JA 3D4MA 2KUCA 1EOGA 4E8HA 3N9JA 2LUSA 1GL8A 1O81A 2A2PA 5LCZA 5JWOB 3A5WA 1Q98A 6GSYA 4HSCX 3GA4A 4BVXA 1X5CA 2EIRA 2NVLA 4ACSA 2F8FA 5CNWA 4RI6A 4YQUA 2JSYA 3HVNA 2VOCA 4Q5FA 2PN8A 5ECSA 2RM6A 3ZFBA 1QGVA 1R26A 2IMIA 2QSIA 2VAFA 5ID2B 5DQYA 4EO3A 3CMIA 1GLPA 1YF0A 5HR2A 1SJZA 2QGVA 3FRCA 3DWVA 3CXGA 4IQ1A 2L57A 2LEGA 3HD5A 2AB6A 4I2TA 1ON4A 4O5QA 4CY6A 5CYYA 2A2RA 2NPBA 2X99A 5ELGA 5EVOA 2RM5A 2N5AA 3UEMA 3BCKA 5CAXA 17GSA 1AW9A 4YH2A 1M7TA 2GSQA 4IGJA 3Q74A 1GTIA 1GP1A 1TI3A 3PGTA 2H1DA 1DBYA 4MPFA 2LQOA 3TJGA 1K3LA 3CYNA 1OAZA 1A2JA 1H75A 1JZDA 1SENA 2X8CA 1XWGA 2VCWA 2C3QA 4CDOA 2DJKA 4KSOA 5DJMA 2I4AA 1V2AA 2EC4A 3TJJA 7GSSA 4HDEA 4USSA 4L5LA 1HD2A 1Z7PA 1FW1A 5ECKB 1N2AA 5G5FA 1FB6A 2FWEA 4X43A 3GKNA 2PBJA 4KCEA 4JEDA 4WR5A 4KGIA 5L71A 1X9MB 3F6DA 2G0FA 2LJRA 4WF5A 4CHSA 1YZXA 3GYKA 5F07A 2H66A 1R5PA 3GTUB 2AV4A 4OFMA 4J56E 2V2GA 1XW9A 3FHKA 3KH9A 1GTBA 5J4UA 4EDZA 2BJXA 22GSA 2L59A 2LSTA 5D8IA 5ELAA 1VGLA 2HI7A 3CRUA 3F3RA 5HR3A 1YEXA 3GNJA 3GSTA 2YWMA 4OO5A 4PTSA 2R37A 2RUEA 4RQRA 4K8MA 2OE1A 4TR0A 4GSNA 1ST9A 1SL1B 1BAYA 2DMLA 1GH2A 2MBTA 2R0PA 3IAS2 3CRTA 3QAGA 1E6BA 1PA3A 4ZIJA 2H6YA 1X9SB 2YWIA 5D73A 3TRPA 3RPNA 3WD6A 2H0IA 3UBLA 4IKHA 1U3AA 5J3RA 3MYDA 4POMA 4IQAA 1JLWA 1EV9A 2XBIA 4ML6A 4L0UA 1T4ZA 4OO4A 1A8YA 1BYEA 2L5LA 4ZXGA 1SU9A 1GRXA 3NIVA 5A5KA 4KH7A 4Z2RA 2HRFA 1SD9A 2HT9A 3TKRA 1SL0B 1THOA 5JCUA 2R4VA 2YZUA 1XCCA 1GSFA 4K0NA 3D21A 3P8WA 3KP9A 5BRTA 2YN1A 1SKRB 3W8SA 2B1KA 5GAPD 3J7Yb 12GSA 5IO2A 2IFQA 2H71A 4MNNA 1EZKA 4O7HA 2VL2C 1TDIA 2PVQA 2FWGA 5H5SA 3ZMLA 2DKHA 9GSSA 2L4CA 2CQ9A 2O7KA 1M99A 1S3CA 1AIUA 5D9XA 3WT1A 2K8SA 1LU4A 2R3XA 3W6GA 3HJOA 3EINA 3QFBC 4XS1A 3A3TA 1X5EA 2X4AA 2GSTA 2R0GA 4LMVA 4EIQA 1U6TA 1G6WA 3KM6A 3BCIA 3FR9A 2VL2A 4TW5A 1SK0A 2HE3A 2X8GA 5KN2A 1AQVA 2NTOA 2YPMA 1XFLA 3TOUA 3M9KA 3UL3A 2FD3A 3HZ4A 5H5QA 1XOBA 2JZTA 2QKEA 1GSSA 5D96A 1KNGA 1M2DA 3H4KA 3I43A 4HEA2 5G5EA 3PPUA 3EURA 2RUFA 4V2MA 2P5QA 1PSQA 1TKDB 4LA1A 3C71A 2GZYA 1GSYA 1PD21 4PXOA 4MJEA 3ZMKA 5F8BA 2O8VB 3US3A 2B6MA 1AUCA 1R7HA 4XS4B 2YV7A 3GFKA 3NOFA 4MJCA 5IM9A 4WXTA 1Z3EA 14GSA 3DRNA 1K0DA 1BX9A 1YEPA 1ML6A 3VPQA 2YANA 4QL9A 3RHCA 2YV9A 1R5AA 5B6NA 1TK5B 5CRHA 6GSWA 3VWWA 1SYRA 4HZ4A 2I1UA 5B7CA 2FNOA 1PMTA 4V1Ag 5A4VA 4AJ7A 1M3JA 2J23A 2L6CA 2IMFA 1GSDA 5B8BA 3DEXA 5IMAA 2ES7A 5GSSA 3P7XA 4IW9A 2O89A 2DJJA 4DEJA 3IXRA 3LWAA 2HRAA 4MK3A 4WBRD 2VCVA 4I8BA 4IJ3A 2OA7A 5ECPB 1NM3A 4TXVA 5CRDA 1GSUA 5FT3A 2C0GA 1TRVA 2UZ8A 3GRXA 4WETA 4MH2A 1MEKA 3QR6A 5DALB 1U87A 4D73B 5GAND 1IYIA 5LD0A 3FZ4A 3H93A 4NHWA 5DCGA 1GSEA 2IN3A 3OR5A 2GS3A 1O6JA 3I6AA 2B1LA 3IK9A 2WDUA 3A2VA 1XBSA 3ZTLA 4F82A 2KLXA 5E4WA 4FO5A 1V40A 4I5QA 2DC5A 1TP9A 5IMCA 1DE1A 3FR6A 3FMWA 5DQSA 4YAVA 4K6XA 1XG8A 3WYWA 2QA1A 3RHBA 2VM2A 5CRGA 4K2XA 1K0CA 1EP8A 3CBUA 3FKFA 2TRCP 4N11A 2O85A 1AQWA 1HNAA 2KHPA 5HR1A 3PINA 3VURA 4MJBA 4O32A 5BMUA 4I2UA 1UC7A 5FWGA 4V2NA 1EEMA 4HUAA 3ZLPA 3UVHA 1M2BA 1PL1A 1XVWA 1VF1A 1XW6A 2KP1A 4I97A 2H19A 4K5RA 2H1GA 3CQFA 2P0GA 2HZEA 2GQKA 4OMVA 4WBJA 4BL7B 1N8JA 5CREA 4EVMA 3EPTA 4E8EA 2CA8A 3UBKA 1M2AA 4EE0A 3ZIVA 2WJUA 2TIRA 2VM1A 1GNWA 4LL4B 1T3BA 4PQ1A 3TCOA 5G1LA 3GH6A 1GUHA 2VL9A 1SK1A 3BJ5A 4K7IA 2IPAA 3MWHA 4Z2UA 4GSSA 4KCAA 4ICYA 2IMEA 2HFDA 1CQHA 3L4NA 3I9V2 1EGRA 3KMOA 2LRCA 1TU8A 1K0AA 5G30A 1OYJA 4DSSA 1A0FA 2FA8A 4L8EA 5E59A 3DXBA 3FYGA 3GL5A 3P90A 4KE3A 1XXUA 1ERTA 4PUFC 5H5RA 1PKZA 3KGKA 1NW2A 3O3TA 1Z6MA 2C80A 2VO4A 3IC4A 4MPGA 4A5PA 2ALBA 1X9WB 5KN1A 3GX0A 3LEFA 4YAPA 5DAKA 4BIKA 2GZPA 4LLRA 2E2GA 2N5FA 4G0IA 1S3RA 3R3EA 5COHA 2L5OA 1SL2B 3ZVJA 3GH9A 5AIXA 5GZZB 3QPMA 2R6KA 20GSA 4BVYB 4IP1A 2X8HA 3F4RA 2E2MA 2YP6A 4YQMA 5DDLA 4ZBAA 2GQMA 2JSZA 4LL1B 3ZVJD 2WZ9A 2YWNA 3M3MA 5EPFA
chains in the Genus database with same CATH topology
5ECOB 3TKSE 1JLVA 2K8VA 1PQNA 2DJ1A 3LORA 4IVFA 4KDUA 3PH9A 3TJKA 6GSVA 4MDCA 4ISDA 3EC3A 4ECJA 2H8LA 4KDXA 3TGZA 1I5GA 1U88A 3FZ5A 5CP1A 2VD0A 2WGRA 2DLXA 3DGQA 1FOHA 2E7PA 3FEUA 2R2JA 1DSBA 2AUVA 3UJ1A 1O85A 4G10A 5A4WA 2VLTA 2PVOC 4G2EA 4JR4A 4PNFA 1ERWA 1MD3A 4KUNA 2WCIA 4MF7A 2VLUA 3HJPA 1WJKA 3J7Yk 3ZIJA 2PPTA 4ECIA 1FAAA 2C8UA 2HLSA 1ACVA 4XCSA 4KF9A 3G7JA 2CZ3A 1YF1A 2H6ZA 1EWXA 4MCUA 1OVNA 2M72A 2M46A 1WPIA 1NHOA 1FO5A 4OCFA 1M0UA 2OADA 1YDKA 2J9HA 2K18A 3V1WA 2I3YA 4RI7A 1NSWA 3M8NA 3IOSA 3CSHA 2YCDA 1QK8A 3BBYA 4Q5RA 4NMUA 1WWJA 5AIVA 4KW6A 4XTSA 3IHGA 4XS6A 3K8NA 4NV5A 1PX7A 3HVSA 4MJAA 2P31A 2ON7A 3TDGA 1XPVA 1ERUA 1IYHA 3G7IA 2JADA 4TR1B 3TKPA 4HJ2A 2C1YA 2WULA 2FGXA 5IMVA 3ERFA 1B48A 3GL3A 5AGYA 5KOWA 1T00A 2HNLA 3Q6OA 3ZRDA 2CVKA 3IE3A 1JHBA 1NHYA 3ME8A 2DIYA 3IDVA 2R5GA 4IJIA 3ERGA 4DVCA 3ED3A 2LKUA 2PMTA 4J2FA 2NDOA 5DALA 4D73A 2LNTA 3DVXA 3FW2A 1K0OA 2B5EA 2YWOA 2LRNA 3GSSA 2NBSA 2RIIA 4HZ2A 2HSYA 3DIEA 4K2DA 2ZUPA 2MYGA 4NHZA 1GTUA 1T8EB 2OKAA 3LG6A 1FHEA 3APSA 2F8AA 3C7MA 3TJFA 4Q5QA 1EP7A 2JZSA 4BVXB 4ZL9A 2GT5A 2MBSA 2H75A 11GSA 1SK2A 3I69A 1Z6NA 2VUPA 4TOPA 2KOKA 4TXOA 1MDJA 4G19A 3IV4A 1F37A 3ISOA 2DMMA 3TB2A 1PN0A 1F6MC 3FZAA 4HI7A 4WKWA 2K9FA 3CSJA 1RK4A 2O87A 2DJ0A 1ZGNA 1YKAA 1QXHA 4ZL7A 2MMNA 2JZRA 3FR3A 2C0FA 1QMVA 3D5JA 3F63A 3APQA 2HSMA 5C00A 4KDYA 1A23A 4K7NA 4BL7A 3ERWA 1WIKA 1V58A 2X49A 1VF2A 3KCMA 2GZZA 1JZRA 3H79A 4K0GA 4KB3A 5ECLB 1LJRA 4OFTA 2LRTA 4NV2A 3WGXA 1J0FA 2I9HA 2VIMA 3E0UA 3TOTA 4MABA 2JL4A 4NPBA 4V2LA 3PR8A 3QDNA 3MNGA 2KP2A 4ZL8A 5DJLA 1VRSD 2FY6A 3GV1A 3W8JA 1XIYA 3IHQA 2CX3A 5ECNB 1DUGA 3GHAA 3LFLA 3TKQA 2V6KA 4GTUA 1PX6A 1TRSA 6GSXA 1AQXA 5ECIB 2XBQA 4HJMA 3BD2A 1O8WA 3LW9A 4XRAA 2LTKA 1MTCA 4F03A 2B7KA 4BWQA 1XZOA 4K9ZA 4X4JA 3FK8A 2I81A 3F3QA 6GSUA 4N10A 4ZB6A 3GUSA 3O6TA 3ZL5A 5LNKe 2IJYA 5ID2A 1Z9HA 2R0CA 4YKGA 2MMOA 5JCWA 2V32A 2HRKA 3M1GA 4MZBA 2GVPA 3E9JB 2AAWA 1T1VA 4IN0A 4TKYA 2MMAA 4HQSA 1BEDA 1JZWA 1J9BA 2A2SA 2EIOA 3NZNA 4FQUA 1RQMA 1SYXA 4NWYA 4DSQA 1GUMA 1UN2A 1MDKA 1F2EA 1SKWB 8GSSA 1G6YA 4PURA 4RQXA 5D93A 2C4JA 1R4WA 5J41A 3FZ9A 1EOHA 2LS5A 4OWYA 3VPTA 3KEBA 1XVQA 2H1AA 2IIYA 1KTEA 2VCQA 2A4HA 4O5UA 4EUYA 4TR4A 4CW9A 4O92A 4EL1A 4TN8A 1O73A 4K1FA 1HNCA 1SJ6A 2OBIA 3GMFA 1SJIA 1K0BA 1UA5A 5AN1A 1XW5A 3D6IA 3O76A 4POLA 2L4QA 1THXA 1WRYA 4JE1A 4Q5NA 4ZILA 2DIZA 4JRRA 2IFQB 1EGOA 2CVDA 4PX1A 1OKDA 2F9SA 1TK8B 3HVVA 1MD4A 2V6OA 5D9VA 4L0WA 3GTUA 4FIWA 3QOUA 4IP6A 4GWRA 2CT6A 1A2MA 1TJDA 2QA2A 2CV4A 1U3IA 5IMDA 4BA7A 2GT6A 3EE2A 5IIZA 2OBKA 3HKRA 4HQZA 3Q19A 5C04A 3GIXA 1DE2A 2GQLA 4QQ7A 1XWAA 2H6XA 2DSAA 2BMXA 2GSRA 1OKTA 1X0RA 1ZYPA 4EF0A 5A4UA 1W89A 2DBCA 3IR4A 4N0VA 4ECBA 1GULA 3A2WA 3KTBA 2X64A 4MZWA 4P3YB 4EIPA 3DYRA 4MZCA 1B4QA 1AC1A 4EKZA 4EC0A 1A2LA 4GXZA 1XOAA 3ZITA 3G9BA 2CVBA 3EU3A 2YJ7A 1JFUA 3HJMA 4KNDA 1ZYNA 1QFNA 4MH3A 1A8LA 4BPYA 1WE0A 2L6DA 3UAPA 1W4VA 1EV4A 3LYKA 1Z5YE 3LSZA 3D0ZA 1GLQA 3HHVA 5F0GA 2YZHA 3KJYA 1CQGA 4ILFA 2FHEA 5HQPA 4IHUA 3EMXA 1FOVA 1I9DA 3KMNA 2ON5A 3RAZA 3VK9A 3LJRA 2D2ZA 2FUG2 2VCTA 4GLTA 5HFGA 4MF6A 3TJBA 2M80A 4Z2TA 1WMJA 1OC9B 4DSRA 4BWSA 1ZMAA 4AJ6A 5J9BA 1QUWA 5B6MA 1J08A 2DJ3A 5EL8A 2CX4A 1ZCPA 1QQ2A 2FLSA 2F51A 4TVEA 1A0RP 2LV3A 4YQVA 4L5OA 2LJAA 3DMLA 3JCML 3TUEA 4GSTA 3QFAC 1F9MA 4K7OA 3KZQA 3C1RA 2VD1A 1ABAA 5GSTA 3GKXA 1PN9A 2F3MA 2VLVA 5FHIA 2AJQB 5ECMB 4F2IA 1TOFA 1FG4A 3BOAA 2B3SA 4GCIA 5HR0A 1B8XA 3IAM2 3IBHA 1A24A 1PRXA 1BG5A 2WB9A 2B5YA 3GX8A 3LYPA 19GSA 4MLYA 3RBTA 3RDWA 3ME7A 4GQCA 4XS4A 1EEJA 1FVKA 2C3TA 6GSTA 2GLRA 1ZOFA 4HOJA 2MMZA 4ZBBA 4ZBDA 3IRAA 1M9AA 1F3AA 4FH8A 5F06A 1GSQA 1H4OA 2H0HA 4GRFA 1GUKA 1PGTA 1GWCA 3GKMA 5G1KA 1GTAA 2FA4A 4MP4A 5HFIA 2CAIA 3L9VA 4AF2A 4JBBA 3TRXA 3ZYWA 3F4SA 4PNGA 2AYTA 2OJLA 4PGTA 2QC7A 3WGEA 3VI7A 2LNSA 5B8AA 1V9WA 4KSMA 3KP8A 3KXOA 2XHFA 3VLNA 1TW9A 2XPEA 3F8UA 2H1BA 4Z7XA 3L9UA 3HA9A 4X0XA 2HZEB 3WGDA 2WRTA 4WF4A 1T7PB 2JU5A 3D22A 2FCHA 4KA0A 5IOWA 3U5RE 4KAEA 1O8XA 4EXJA 1K3YA 4OCEA 2ZNMA 1HNBA 1BJXA 5HFKA 3HCZA 3LXTA 3QMXA 4DSSB 3EWLA 2H30A 3U6VA 5ECHB 1ZYEA 1TU7A 1TTZA 5D9TA 4NXIA 3HXSA 1OC8A 4PQHA 1SD8A 4J57E 3HZ8A 5G2ZA 2H01A 2H76A 4ECCA 2DKIA 3QCPA 3GN3A 1Q4JA 3L78A 3MDKA 1SKSB 2OE0A 4OFNA 1Z7RA 5DAKB 3UOMA 3G7YA 4CY8A 5F05A 3UVTA 3R2QA 3MSZA 3CSIA 3A2XA 3GKKA 2K6VA 3DKSA 4HU9A 3Q18A 3VFIA 5KN3A 4GF0A 1HQOA 1O7UA 1OE8A 1M9BA 1OE7A 5IPHA 1XWKA 3TKSC 3LXZA 2C0DA 4ML1A 5DBQA 2MZCA 3EMPA 4IS0A 3M9JA 4N0ZA 4LMWA 1T4YA 1LBKA 2FWHA 4FYBA 2GGTA 5DCHA 3S9FA 1ZYQB 3DVWA 2HSHA 2VL3A 1MDIA 1V98A 4OD7A 4YKFA 1RW1A 1V57A 1WOUA 2H72A 1Y25A 4MA9A 3VWXA 4G0KA 4MF5A 2GSSA 2PWJA 2YOIA 2PU9C 4TR3A 3IA1A 1GNEA 3TKSA 2LJKA 3KTLA 4HS1A 4XRDA 4G9HA 3KIJA 4X1UA 1B9YC 4K5SA 3ZZXA 3F4TA 4XHMA 2BTOT 1E2YA 3C73A 5G31A 2CZ2A 5IO0A 1TXXA 2OACA 2V41A 1PL2A 2N5BA 3FY7A 1G0TA 3CTGA 2C3NA 1F3BA 1K0MA 5DVBA 2A4VA 5JWRB 1K3OA 5CO3A 2H74A 3UARA 2IWTA 2TRXA 3MIXA 1K0NA 2IL3A 3H8QA 2YNXA 4I6XA 2GDRA 3N5OA 1OC9A 3HYPA 1HYUA 2LQQA 4IELA 1URMA 4BVYA 4POKA 5J9CA 1G7EA 4FYUA 3QAWA 2OE3A 2HRNA 3ZREA 5IQYA 5ECRB 4NAXA 1FVJA 3UMAA 3LQ7A 2H73A 2C0EA 1KEBA 4V1Ap 4KX4A 5KEJA 1Y6EA 1AAZA 4POBA 1S3DA 2H0GA 4WEYA 3IPZA 5JCGA 4IBPA 3ZFLA 2VCXA 2IMDA 2HXKA 3F0IA 5INYA 3VWUA 1ILOA 1G7OA 2AHEA 3IC8A 1B4PA 3KD0A 2V1MA 4QL7A 4N30A 4ID0A 5IMZA 3EU4A 3M0FA 2H70A 13GSA 1ERVA 1TI1A 3VWVA 4WR4A 2DJ2A 1JZOA 1AXDA 2Z9SA 2PUKC 5IOXA 2JACA 3DD3A 5KN0A 1BQ7A 4EDYA 4GQFA 2PGTA 3HDCA 3UIWA 1XWCA 3GURA 1XWBA 4RUVA 3WT2A 6GSSA 3L9SA 4F0CA 1S3AA 1PKWA 3SBCA 2EIQA 1ZL9A 4MMMA 1TK0B 3LGCA 5IMFA 3RPPA 5ABRA 1USBA 3MAKA 2E0QA 3VI5A 5AISA 5ENUA 1X5DA 1ZZYA 3HVXA 3P2AA 3L0HA 1VF3A 3C8EA 4TXOB 4TRXA 2WS2A 1OC3A 2PERA 4ZB8A 3F6FA 1UVZA 5IPGA 3QAVA 1FB0A 3HY2A 1KBNA 3C1SA 5J5NA 4TR1A 2REMA 4XIHA 4HU7A 3QD9A 4H86A 2CAQA 3E3EA 4F0BA 5CRWA 1VF4A 3EVIA 2B5XA 4JZQA 1TRUA 1YY7A 3IK7A 2HYXA 1YJ6A 5KOXA 1C72A 2P5RA 4G0LA 3H1NA 5D9WA 2ZCTA 3EYTA 2FWFA 18GSA 2GTUA 5ECQB 1B9XC 1YKCA 2HZFA 3D4TA 1TRWA 3A5IA 4ZB9A 4AGSA 4JU5A 2YJHA 2G2QA 16GSA 1YQ1A 4ULXA 4F9ZA 3KH7A 4PUAA 10GSA 4FYCA 2XPDA 3CTFA 2RLIA 2WFCA 3F9UA 3TRQA 2IMKA 4JR6A 2XC2A 5EY6A 4AJ8A 5JWQB 2VCZA 3AY8A 3SWLA 4O5RA 3APOA 4PQIA 1WP0A 2B7JA 3D4MA 2KUCA 1EOGA 4E8HA 3N9JA 2LUSA 1GL8A 1O81A 2A2PA 5LCZA 5JWOB 3A5WA 1Q98A 6GSYA 3GA4A 4BVXA 1X5CA 2EIRA 2NVLA 4ACSA 2F8FA 5CNWA 4RI6A 4YQUA 2JSYA 2VOCA 4Q5FA 2PN8A 5ECSA 2RM6A 3ZFBA 1QGVA 1R26A 2IMIA 2QSIA 2VAFA 5ID2B 5DQYA 4EO3A 3CMIA 1GLPA 1YF0A 5HR2A 1SJZA 2QGVA 3FRCA 3DWVA 3CXGA 4IQ1A 2L57A 2LEGA 3HD5A 2AB6A 4I2TA 1ON4A 4O5QA 4CY6A 5CYYA 2A2RA 2NPBA 2X99A 5ELGA 5EVOA 2RM5A 2N5AA 3UEMA 3BCKA 5CAXA 17GSA 1AW9A 4YH2A 1M7TA 2GSQA 4IGJA 3Q74A 1GTIA 1GP1A 1TI3A 3PGTA 2H1DA 1DBYA 4MPFA 2LQOA 3TJGA 1K3LA 3CYNA 1OAZA 1A2JA 1H75A 1JZDA 1SENA 2X8CA 1XWGA 2VCWA 2C3QA 4CDOA 2DJKA 4KSOA 5DJMA 2I4AA 1V2AA 2EC4A 3TJJA 7GSSA 4HDEA 4USSA 4L5LA 1HD2A 1Z7PA 1FW1A 5ECKB 1N2AA 5G5FA 1FB6A 2FWEA 4X43A 3GKNA 2PBJA 4KCEA 4JEDA 4WR5A 4KGIA 5L71A 1X9MB 3F6DA 2G0FA 2LJRA 4WF5A 4CHSA 1YZXA 3GYKA 5F07A 2H66A 1R5PA 3GTUB 2AV4A 4OFMA 4J56E 2V2GA 1XW9A 3FHKA 3KH9A 1GTBA 5J4UA 4EDZA 2BJXA 22GSA 2L59A 2LSTA 5D8IA 5ELAA 1VGLA 2HI7A 3CRUA 3F3RA 5HR3A 1YEXA 3GNJA 3GSTA 2YWMA 4OO5A 4PTSA 2R37A 2RUEA 4RQRA 4K8MA 2OE1A 4TR0A 4GSNA 1ST9A 1SL1B 1BAYA 2DMLA 1GH2A 2MBTA 2R0PA 3IAS2 3CRTA 3QAGA 1E6BA 1PA3A 4ZIJA 2H6YA 1X9SB 2YWIA 5D73A 3TRPA 3RPNA 3WD6A 2H0IA 3UBLA 4IKHA 1U3AA 5J3RA 3MYDA 4POMA 4IQAA 1JLWA 1EV9A 2XBIA 4ML6A 4L0UA 1T4ZA 4OO4A 1A8YA 1BYEA 2L5LA 4ZXGA 1SU9A 1GRXA 3NIVA 5A5KA 4KH7A 4Z2RA 2HRFA 1SD9A 2HT9A 3TKRA 1SL0B 1THOA 5JCUA 2R4VA 2YZUA 1XCCA 1GSFA 4K0NA 3D21A 3P8WA 3KP9A 5BRTA 2YN1A 1SKRB 3W8SA 2B1KA 5GAPD 3J7Yb 12GSA 5IO2A 2IFQA 2H71A 4MNNA 1EZKA 4O7HA 2VL2C 1TDIA 2PVQA 2FWGA 5H5SA 3ZMLA 2DKHA 9GSSA 2L4CA 2CQ9A 2O7KA 1M99A 1S3CA 1AIUA 5D9XA 3WT1A 2K8SA 1LU4A 2R3XA 3W6GA 3HJOA 3EINA 3QFBC 4XS1A 3A3TA 1X5EA 2X4AA 2GSTA 2R0GA 4LMVA 4EIQA 1U6TA 1G6WA 3KM6A 3BCIA 3FR9A 2VL2A 4TW5A 1SK0A 2HE3A 2X8GA 5KN2A 1AQVA 2NTOA 2YPMA 1XFLA 3TOUA 3M9KA 3UL3A 2FD3A 3HZ4A 5H5QA 1XOBA 2JZTA 2QKEA 1GSSA 5D96A 1KNGA 1M2DA 3H4KA 3I43A 4HEA2 5G5EA 3PPUA 3EURA 2RUFA 4V2MA 2P5QA 1PSQA 1TKDB 4LA1A 3C71A 2GZYA 1GSYA 1PD21 4PXOA 4MJEA 3ZMKA 5F8BA 2O8VB 3US3A 2B6MA 1AUCA 1R7HA 4XS4B 2YV7A 3GFKA 3NOFA 4MJCA 5IM9A 4WXTA 1Z3EA 14GSA 3DRNA 1K0DA 1BX9A 1YEPA 1ML6A 3VPQA 2YANA 4QL9A 3RHCA 2YV9A 1R5AA 5B6NA 1TK5B 5CRHA 6GSWA 3VWWA 1SYRA 4HZ4A 2I1UA 5B7CA 2FNOA 1PMTA 4V1Ag 5A4VA 4AJ7A 2J23A 2L6CA 2IMFA 1GSDA 5B8BA 3DEXA 5IMAA 2ES7A 5GSSA 3P7XA 4IW9A 2O89A 2DJJA 4DEJA 3IXRA 3LWAA 2HRAA 4MK3A 4WBRD 2VCVA 4I8BA 4IJ3A 2OA7A 5ECPB 1NM3A 4TXVA 5CRDA 1GSUA 5FT3A 2C0GA 1TRVA 2UZ8A 3GRXA 4WETA 4MH2A 1MEKA 3QR6A 5DALB 1U87A 4D73B 5GAND 1IYIA 5LD0A 3FZ4A 3H93A 4NHWA 5DCGA 1GSEA 2IN3A 3OR5A 2GS3A 1O6JA 3I6AA 2B1LA 3IK9A 2WDUA 3A2VA 1XBSA 3ZTLA 4F82A 2KLXA 5E4WA 4FO5A 1V40A 4I5QA 2DC5A 1TP9A 5IMCA 1DE1A 3FR6A 3FMWA 5DQSA 4YAVA 4K6XA 3WYWA 2QA1A 3RHBA 2VM2A 5CRGA 4K2XA 1K0CA 1EP8A 3CBUA 3FKFA 2TRCP 4N11A 2O85A 1AQWA 1HNAA 2KHPA 5HR1A 3PINA 3VURA 4MJBA 4O32A 5BMUA 4I2UA 1UC7A 5FWGA 4V2NA 1EEMA 4HUAA 3ZLPA 3UVHA 1M2BA 1PL1A 1XVWA 1VF1A 1XW6A 2KP1A 4I97A 2H19A 4K5RA 2H1GA 2P0GA 2HZEA 2GQKA 4OMVA 4WBJA 4BL7B 1N8JA 5CREA 4EVMA 3EPTA 4E8EA 2CA8A 3UBKA 1M2AA 4EE0A 3ZIVA 2WJUA 2TIRA 2VM1A 1GNWA 4LL4B 1T3BA 4PQ1A 3TCOA 5G1LA 3GH6A 1GUHA 2VL9A 1SK1A 3BJ5A 4K7IA 2IPAA 3MWHA 4Z2UA 4GSSA 4KCAA 4ICYA 2IMEA 2HFDA 1CQHA 3L4NA 3I9V2 1EGRA 3KMOA 2LRCA 1TU8A 1K0AA 5G30A 1OYJA 4DSSA 1A0FA 2FA8A 4L8EA 5E59A 3DXBA 3FYGA 3GL5A 3P90A 4KE3A 1XXUA 1ERTA 4PUFC 5H5RA 1PKZA 3KGKA 1NW2A 3O3TA 1Z6MA 2C80A 2VO4A 3IC4A 4MPGA 4A5PA 2ALBA 1X9WB 5KN1A 3GX0A 3LEFA 4YAPA 5DAKA 2GZPA 4LLRA 2E2GA 2N5FA 4G0IA 3R3EA 5COHA 2L5OA 1SL2B 3ZVJA 3GH9A 5AIXA 5GZZB 3QPMA 2R6KA 20GSA 4BVYB 4IP1A 2X8HA 3F4RA 2E2MA 2YP6A 4YQMA 5DDLA 4ZBAA 2GQMA 2JSZA 4LL1B 3ZVJD 2WZ9A 2YWNA 3M3MA 5EPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECO B;  3TKS E;  1JLV A;  2K8V A;  1PQN A;  2DJ1 A;  3LOR A;  4IVF A;  4KDU A;  3PH9 A;  3TJK A;  6GSV A;  4MDC A;  4ISD A;  3EC3 A;  4ECJ A;  2H8L A;  4KDX A;  3TGZ A;  1I5G A;  1U88 A;  3FZ5 A;  5CP1 A;  2VD0 A;  2WGR A;  2DLX A;  3DGQ A;  2E7P A;  3FEU A;  2R2J A;  1DSB A;  2AUV A;  3UJ1 A;  1O85 A;  4G10 A;  5A4W A;  2VLT A;  2PVO C;  4G2E A;  4JR4 A;  4PNF A;  1ERW A;  1MD3 A;  4KUN A;  2WCI A;  4MF7 A;  2VLU A;  3HJP A;  1WJK A;  3J7Y k;  3ZIJ A;  2PPT A;  4ECI A;  1FAA A;  2C8U A;  2HLS A;  1ACV A;  4XCS A;  3G7J A;  2CZ3 A;  1YF1 A;  2H6Z A;  1EWX A;  4MCU A;  1OVN A;  2M72 A;  2M46 A;  1WPI A;  1NHO A;  1FO5 A;  4OCF A;  1M0U A;  2OAD A;  1YDK A;  2J9H A;  2K18 A;  3V1W A;  2I3Y A;  4RI7 A;  1NSW A;  3M8N A;  3IOS A;  3CSH A;  2YCD A;  1QK8 A;  3BBY A;  4Q5R A;  4NMU A;  1WWJ A;  5AIV A;  4KW6 A;  4XTS A;  4XS6 A;  3K8N A;  4NV5 A;  1PX7 A;  3HVS A;  4MJA A;  2P31 A;  2ON7 A;  3TDG A;  1XPV A;  1ERU A;  1IYH A;  3G7I A;  2JAD A;  4TR1 B;  3TKP A;  4HJ2 A;  2C1Y A;  2WUL A;  2FGX A;  5IMV A;  3ERF A;  1B48 A;  3GL3 A;  5AGY A;  1T00 A;  2HNL A;  3Q6O A;  3ZRD A;  2CVK A;  3IE3 A;  1JHB A;  1NHY A;  3ME8 A;  2DIY A;  3IDV A;  2R5G A;  4IJI A;  3ERG A;  4DVC A;  3ED3 A;  2LKU A;  2PMT A;  4J2F A;  2NDO A;  5DAL A;  4D73 A;  2LNT A;  3DVX A;  3FW2 A;  1K0O A;  2B5E A;  2YWO A;  2LRN A;  3GSS A;  2NBS A;  2RII A;  4HZ2 A;  2HSY A;  3DIE A;  4K2D A;  2ZUP A;  2MYG A;  4NHZ A;  1GTU A;  1T8E B;  2OKA A;  3LG6 A;  1FHE A;  3APS A;  2F8A A;  3C7M A;  3TJF A;  4Q5Q A;  1EP7 A;  2JZS A;  4ZL9 A;  2GT5 A;  2MBS A;  2H75 A;  11GS A;  1SK2 A;  3I69 A;  1Z6N A;  2VUP A;  4TOP A;  2KOK A;  4TXO A;  1MDJ A;  4G19 A;  3IV4 A;  1F37 A;  3ISO A;  2DMM A;  3TB2 A;  1F6M C;  3FZA A;  4HI7 A;  4WKW A;  2K9F A;  3CSJ A;  1RK4 A;  2O87 A;  2DJ0 A;  1ZGN A;  1YKA A;  1QXH A;  4ZL7 A;  2MMN A;  2JZR A;  3FR3 A;  2C0F A;  1QMV A;  3D5J A;  3F63 A;  3APQ A;  5C00 A;  4KDY A;  1A23 A;  4K7N A;  4BL7 A;  3ERW A;  1WIK A;  1V58 A;  1VF2 A;  3KCM A;  2GZZ A;  1JZR A;  3H79 A;  4K0G A;  4KB3 A;  5ECL B;  1LJR A;  4OFT A;  2LRT A;  4NV2 A;  3WGX A;  1J0F A;  2I9H A;  2VIM A;  3E0U A;  3TOT A;  4MAB A;  2JL4 A;  4NPB A;  4V2L A;  3PR8 A;  3QDN A;  3MNG A;  2KP2 A;  4ZL8 A;  5DJL A;  1VRS D;  2FY6 A;  3GV1 A;  3W8J A;  1XIY A;  3IHQ A;  2CX3 A;  5ECN B;  1DUG A;  3GHA A;  3LFL A;  3TKQ A;  2V6K A;  4GTU A;  1PX6 A;  1TRS A;  6GSX A;  1AQX A;  5ECI B;  2XBQ A;  4HJM A;  3BD2 A;  1O8W A;  4XRA A;  2LTK A;  1MTC A;  4F03 A;  2B7K A;  4BWQ A;  1XZO A;  4K9Z A;  3FK8 A;  2I81 A;  3F3Q A;  6GSU A;  4N10 A;  4ZB6 A;  3GUS A;  3O6T A;  3ZL5 A;  5LNK e;  2IJY A;  5ID2 A;  1Z9H A;  2MMO A;  5JCW A;  2V32 A;  3M1G A;  4MZB A;  2GVP A;  3E9J B;  2AAW A;  1T1V A;  4IN0 A;  4TKY A;  2MMA A;  4HQS A;  1BED A;  1JZW A;  1J9B A;  2A2S A;  2EIO A;  3NZN A;  1RQM A;  1SYX A;  4NWY A;  4DSQ A;  1GUM A;  1UN2 A;  1MDK A;  1F2E A;  1SKW B;  8GSS A;  1G6Y A;  4PUR A;  4RQX A;  5D93 A;  2C4J A;  1R4W A;  5J41 A;  3FZ9 A;  1EOH A;  2LS5 A;  4OWY A;  3VPT A;  3KEB A;  1XVQ A;  2H1A A;  2IIY A;  1KTE A;  2VCQ A;  4EUY A;  4TR4 A;  4CW9 A;  4O92 A;  4EL1 A;  4TN8 A;  1O73 A;  4K1F A;  1HNC A;  1SJ6 A;  2OBI A;  3GMF A;  1SJI A;  1K0B A;  1UA5 A;  5AN1 A;  1XW5 A;  3D6I A;  3O76 A;  4POL A;  2L4Q A;  1THX A;  1WRY A;  4JE1 A;  4Q5N A;  4ZIL A;  2DIZ A;  4JRR A;  2IFQ B;  1EGO A;  2CVD A;  4PX1 A;  1OKD A;  2F9S A;  1TK8 B;  3HVV A;  1MD4 A;  2V6O A;  5D9V A;  4L0W A;  3GTU A;  4FIW A;  3QOU A;  4IP6 A;  4GWR A;  2CT6 A;  1A2M A;  1TJD A;  2CV4 A;  1U3I A;  5IMD A;  4BA7 A;  2GT6 A;  3EE2 A;  5IIZ A;  2OBK A;  3HKR A;  4HQZ A;  3Q19 A;  5C04 A;  3GIX A;  1DE2 A;  2GQL A;  4QQ7 A;  1XWA A;  2H6X A;  2DSA A;  2BMX A;  2GSR A;  1OKT A;  1X0R A;  4EF0 A;  5A4U A;  1W89 A;  2DBC A;  3IR4 A;  4N0V A;  4ECB A;  1GUL A;  3A2W A;  3KTB A;  2X64 A;  4MZW A;  4P3Y B;  3DYR A;  4MZC A;  1B4Q A;  1AC1 A;  4EKZ A;  4EC0 A;  1A2L A;  4GXZ A;  1XOA A;  3ZIT A;  3G9B A;  2CVB A;  3EU3 A;  2YJ7 A;  1JFU A;  3HJM A;  4KND A;  1QFN A;  4MH3 A;  1A8L A;  4BPY A;  1WE0 A;  2L6D A;  3UAP A;  1W4V A;  1EV4 A;  3LYK A;  1Z5Y E;  3LSZ A;  3D0Z A;  1GLQ A;  3HHV A;  5F0G A;  2YZH A;  3KJY A;  1CQG A;  4ILF A;  2FHE A;  5HQP A;  4IHU A;  3EMX A;  1FOV A;  1I9D A;  3KMN A;  2ON5 A;  3RAZ A;  3VK9 A;  3LJR A;  2D2Z A;  2FUG 2;  2VCT A;  4GLT A;  5HFG A;  4MF6 A;  3TJB A;  2M80 A;  1WMJ A;  1OC9 B;  4DSR A;  4BWS A;  1ZMA A;  4AJ6 A;  5J9B A;  1QUW A;  5B6M A;  1J08 A;  2DJ3 A;  5EL8 A;  2CX4 A;  1ZCP A;  1QQ2 A;  2FLS A;  2F51 A;  4TVE A;  1A0R P;  2LV3 A;  4YQV A;  4L5O A;  2LJA A;  3DML A;  3JCM L;  3TUE A;  4GST A;  3QFA C;  1F9M A;  4K7O A;  3KZQ A;  3C1R A;  2VD1 A;  1ABA A;  5GST A;  3GKX A;  1PN9 A;  2F3M A;  2VLV A;  5FHI A;  2AJQ B;  5ECM B;  4F2I A;  1TOF A;  1FG4 A;  3BOA A;  2B3S A;  4GCI A;  5HR0 A;  1B8X A;  3IAM 2;  3IBH A;  1A24 A;  1PRX A;  1BG5 A;  2WB9 A;  2B5Y A;  3GX8 A;  3LYP A;  19GS A;  4MLY A;  3RBT A;  3RDW A;  3ME7 A;  4GQC A;  4XS4 A;  1EEJ A;  1FVK A;  2C3T A;  6GST A;  2GLR A;  1ZOF A;  4HOJ A;  2MMZ A;  4ZBB A;  4ZBD A;  3IRA A;  1M9A A;  1F3A A;  4FH8 A;  5F06 A;  1GSQ A;  1H4O A;  2H0H A;  4GRF A;  1GUK A;  1PGT A;  1GWC A;  3GKM A;  5G1K A;  1GTA A;  2FA4 A;  4MP4 A;  5HFI A;  2CAI A;  3L9V A;  4AF2 A;  4JBB A;  3TRX A;  3ZYW A;  3F4S A;  4PNG A;  2AYT A;  2OJL A;  4PGT A;  2QC7 A;  3WGE A;  3VI7 A;  2LNS A;  5B8A A;  1V9W A;  4KSM A;  3KP8 A;  3KXO A;  2XHF A;  3VLN A;  1TW9 A;  2XPE A;  3F8U A;  2H1B A;  4Z7X A;  3L9U A;  3HA9 A;  4X0X A;  2HZE B;  3WGD A;  2WRT A;  4WF4 A;  1T7P B;  2JU5 A;  3D22 A;  2FCH A;  4KA0 A;  5IOW A;  3U5R E;  4KAE A;  1O8X A;  4EXJ A;  1K3Y A;  4OCE A;  2ZNM A;  1HNB A;  1BJX A;  5HFK A;  3HCZ A;  3LXT A;  3QMX A;  4DSS B;  3EWL A;  2H30 A;  3U6V A;  5ECH B;  1ZYE A;  1TU7 A;  1TTZ A;  5D9T A;  4NXI A;  3HXS A;  1OC8 A;  4PQH A;  1SD8 A;  4J57 E;  3HZ8 A;  5G2Z A;  2H01 A;  2H76 A;  4ECC A;  3QCP A;  3GN3 A;  1Q4J A;  3L78 A;  3MDK A;  1SKS B;  2OE0 A;  4OFN A;  1Z7R A;  5DAK B;  3UOM A;  3G7Y A;  5F05 A;  3UVT A;  3R2Q A;  3MSZ A;  3CSI A;  3A2X A;  3GKK A;  2K6V A;  3DKS A;  4HU9 A;  3Q18 A;  3VFI A;  5KN3 A;  4GF0 A;  1HQO A;  1O7U A;  1OE8 A;  1M9B A;  1OE7 A;  5IPH A;  1XWK A;  3TKS C;  3LXZ A;  2C0D A;  4ML1 A;  5DBQ A;  2MZC A;  3EMP A;  4IS0 A;  3M9J A;  4N0Z A;  4LMW A;  1T4Y A;  1LBK A;  2FWH A;  4FYB A;  2GGT A;  5DCH A;  3S9F A;  1ZYQ B;  3DVW A;  2HSH A;  2VL3 A;  1MDI A;  1V98 A;  4OD7 A;  1RW1 A;  1V57 A;  1WOU A;  2H72 A;  1Y25 A;  4MA9 A;  3VWX A;  2GSS A;  4MF5 A;  2PWJ A;  2YOI A;  2PU9 C;  4TR3 A;  3IA1 A;  1GNE A;  3TKS A;  2LJK A;  3KTL A;  4HS1 A;  4XRD A;  4G9H A;  3KIJ A;  4X1U A;  1B9Y C;  3ZZX A;  3F4T A;  4XHM A;  2BTO T;  1E2Y A;  3C73 A;  5G31 A;  2CZ2 A;  5IO0 A;  1TXX A;  2OAC A;  2V41 A;  1PL2 A;  2N5B A;  3FY7 A;  1G0T A;  3CTG A;  2C3N A;  1F3B A;  1K0M A;  5DVB A;  2A4V A;  5JWR B;  1K3O A;  5CO3 A;  2H74 A;  3UAR A;  2IWT A;  2TRX A;  1K0N A;  2IL3 A;  3H8Q A;  2YNX A;  4I6X A;  2GDR A;  3N5O A;  1OC9 A;  3HYP A;  1HYU A;  2LQQ A;  4IEL A;  1URM A;  4BVY A;  4POK A;  5J9C A;  1G7E A;  4FYU A;  3QAW A;  2OE3 A;  2HRN A;  3ZRE A;  5IQY A;  5ECR B;  4NAX A;  1FVJ A;  3UMA A;  3LQ7 A;  2H73 A;  2C0E A;  1KEB A;  4V1A p;  4KX4 A;  5KEJ A;  1Y6E A;  1AAZ A;  4POB A;  1S3D A;  2H0G A;  4WEY A;  3IPZ A;  5JCG A;  4IBP A;  3ZFL A;  2VCX A;  2IMD A;  2HXK A;  3F0I A;  5INY A;  3VWU A;  1ILO A;  1G7O A;  2AHE A;  1B4P A;  3KD0 A;  2V1M A;  4QL7 A;  4N30 A;  4ID0 A;  5IMZ A;  3EU4 A;  3M0F A;  2H70 A;  13GS A;  1ERV A;  1TI1 A;  3VWV A;  4WR4 A;  2DJ2 A;  1JZO A;  1AXD A;  2Z9S A;  2PUK C;  5IOX A;  2JAC A;  3DD3 A;  5KN0 A;  1BQ7 A;  4EDY A;  4GQF A;  2PGT A;  3HDC A;  3UIW A;  1XWC A;  3GUR A;  1XWB A;  4RUV A;  3WT2 A;  6GSS A;  3L9S A;  4F0C A;  1S3A A;  1PKW A;  3SBC A;  2EIQ A;  1ZL9 A;  4MMM A;  1TK0 B;  3LGC A;  5IMF A;  3RPP A;  5ABR A;  1USB A;  3MAK A;  2E0Q A;  3VI5 A;  5AIS A;  5ENU A;  1X5D A;  1ZZY A;  3HVX A;  3P2A A;  3L0H A;  1VF3 A;  3C8E A;  4TXO B;  4TRX A;  2WS2 A;  1OC3 A;  2PER A;  4ZB8 A;  3F6F A;  1UVZ A;  5IPG A;  3QAV A;  1FB0 A;  3HY2 A;  1KBN A;  3C1S A;  5J5N A;  4TR1 A;  2REM A;  4XIH A;  4HU7 A;  3QD9 A;  4H86 A;  2CAQ A;  3E3E A;  4F0B A;  5CRW A;  1VF4 A;  3EVI A;  2B5X A;  4JZQ A;  1TRU A;  1YY7 A;  3IK7 A;  2HYX A;  1YJ6 A;  1C72 A;  2P5R A;  3H1N A;  5D9W A;  2ZCT A;  3EYT A;  2FWF A;  18GS A;  2GTU A;  5ECQ B;  1B9X C;  1YKC A;  2HZF A;  3D4T A;  1TRW A;  4ZB9 A;  4AGS A;  4JU5 A;  2YJH A;  2G2Q A;  16GS A;  1YQ1 A;  4ULX A;  4F9Z A;  3KH7 A;  4PUA A;  10GS A;  4FYC A;  2XPD A;  3CTF A;  2RLI A;  2WFC A;  3F9U A;  3TRQ A;  2IMK A;  4JR6 A;  2XC2 A;  5EY6 A;  4AJ8 A;  5JWQ B;  2VCZ A;  3AY8 A;  3SWL A;  4O5R A;  3APO A;  4PQI A;  1WP0 A;  2B7J A;  3D4M A;  2KUC A;  1EOG A;  4E8H A;  3N9J A;  2LUS A;  1GL8 A;  1O81 A;  5LCZ A;  5JWO B;  3A5W A;  1Q98 A;  6GSY A;  3GA4 A;  4BVX A;  1X5C A;  2EIR A;  2NVL A;  4ACS A;  2F8F A;  5CNW A;  4RI6 A;  4YQU A;  2JSY A;  2VOC A;  4Q5F A;  2PN8 A;  5ECS A;  2RM6 A;  3ZFB A;  1QGV A;  1R26 A;  2IMI A;  2QSI A;  2VAF A;  5ID2 B;  5DQY A;  4EO3 A;  3CMI A;  1GLP A;  1YF0 A;  5HR2 A;  1SJZ A;  2QGV A;  3FRC A;  3DWV A;  3CXG A;  4IQ1 A;  2L57 A;  2LEG A;  3HD5 A;  2AB6 A;  4I2T A;  1ON4 A;  5CYY A;  2A2R A;  2NPB A;  2X99 A;  5ELG A;  5EVO A;  2RM5 A;  2N5A A;  3UEM A;  3BCK A;  5CAX A;  17GS A;  1AW9 A;  4YH2 A;  1M7T A;  2GSQ A;  4IGJ A;  3Q74 A;  1GTI A;  1GP1 A;  1TI3 A;  3PGT A;  2H1D A;  1DBY A;  4MPF A;  2LQO A;  3TJG A;  1K3L A;  3CYN A;  1OAZ A;  1A2J A;  1H75 A;  1JZD A;  1SEN A;  2X8C A;  1XWG A;  2VCW A;  2C3Q A;  4CDO A;  2DJK A;  4KSO A;  5DJM A;  2I4A A;  1V2A A;  2EC4 A;  3TJJ A;  7GSS A;  4HDE A;  4L5L A;  1HD2 A;  1Z7P A;  1FW1 A;  5ECK B;  1N2A A;  5G5F A;  1FB6 A;  2FWE A;  4X43 A;  3GKN A;  2PBJ A;  4KCE A;  4JED A;  4WR5 A;  4KGI A;  5L71 A;  1X9M B;  3F6D A;  2G0F A;  2LJR A;  4WF5 A;  4CHS A;  1YZX A;  3GYK A;  5F07 A;  2H66 A;  1R5P A;  3GTU B;  2AV4 A;  4OFM A;  4J56 E;  2V2G A;  1XW9 A;  3FHK A;  3KH9 A;  1GTB A;  5J4U A;  4EDZ A;  2BJX A;  22GS A;  2L59 A;  2LST A;  5D8I A;  5ELA A;  1VGL A;  2HI7 A;  3CRU A;  3F3R A;  5HR3 A;  1YEX A;  3GNJ A;  3GST A;  2YWM A;  4OO5 A;  2R37 A;  2RUE A;  4RQR A;  4K8M A;  2OE1 A;  4TR0 A;  4GSN A;  1ST9 A;  1SL1 B;  1BAY A;  2DML A;  1GH2 A;  2MBT A;  3IAS 2;  3QAG A;  3CRT A;  1E6B A;  1PA3 A;  4ZIJ A;  2H6Y A;  1X9S B;  2YWI A;  5D73 A;  3TRP A;  3RPN A;  3WD6 A;  2H0I A;  3UBL A;  4IKH A;  1U3A A;  5J3R A;  4POM A;  4IQA A;  1JLW A;  1EV9 A;  2XBI A;  4ML6 A;  4L0U A;  1T4Z A;  4OO4 A;  1A8Y A;  1BYE A;  2L5L A;  4ZXG A;  1SU9 A;  1GRX A;  3NIV A;  5A5K A;  4KH7 A;  2HRF A;  1SD9 A;  2HT9 A;  3TKR A;  1SL0 B;  1THO A;  5JCU A;  2R4V A;  2YZU A;  1XCC A;  1GSF A;  4K0N A;  3D21 A;  3P8W A;  3KP9 A;  2YN1 A;  1SKR B;  3W8S A;  2B1K A;  5GAP D;  3J7Y b;  12GS A;  5IO2 A;  2IFQ A;  2H71 A;  1EZK A;  4O7H A;  2VL2 C;  1TDI A;  2PVQ A;  2FWG A;  5H5S A;  3ZML A;  9GSS A;  2L4C A;  2CQ9 A;  2O7K A;  1M99 A;  1S3C A;  1AIU A;  5D9X A;  3WT1 A;  2K8S A;  1LU4 A;  2R3X A;  3W6G A;  3HJO A;  3EIN A;  3QFB C;  4XS1 A;  3A3T A;  1X5E A;  2GST A;  4LMV A;  1U6T A;  1G6W A;  3BCI A;  3FR9 A;  3KM6 A;  2VL2 A;  4TW5 A;  1SK0 A;  2HE3 A;  2X8G A;  5KN2 A;  1AQV A;  2NTO A;  2YPM A;  1XFL A;  3TOU A;  3M9K A;  3UL3 A;  2FD3 A;  3HZ4 A;  5H5Q A;  1XOB A;  2JZT A;  2QKE A;  1GSS A;  5D96 A;  1KNG A;  1M2D A;  3H4K A;  3I43 A;  4HEA 2;  5G5E A;  3EUR A;  2RUF A;  4V2M A;  2P5Q A;  1PSQ A;  1TKD B;  4LA1 A;  3C71 A;  2GZY A;  1GSY A;  1PD2 1;  4PXO A;  4MJE A;  3ZMK A;  5F8B A;  2O8V B;  3US3 A;  2B6M A;  1AUC A;  1R7H A;  4XS4 B;  2YV7 A;  3GFK A;  3NOF A;  4MJC A;  5IM9 A;  4WXT A;  1Z3E A;  14GS A;  3DRN A;  1K0D A;  1BX9 A;  1YEP A;  1ML6 A;  3VPQ A;  2YAN A;  4QL9 A;  3RHC A;  2YV9 A;  1R5A A;  5B6N A;  1TK5 B;  5CRH A;  6GSW A;  3VWW A;  1SYR A;  4HZ4 A;  2I1U A;  5B7C A;  2FNO A;  1PMT A;  4V1A g;  5A4V A;  4AJ7 A;  2J23 A;  2L6C A;  2IMF A;  1GSD A;  5B8B A;  3DEX A;  5IMA A;  2ES7 A;  5GSS A;  3P7X A;  4IW9 A;  2O89 A;  2DJJ A;  4DEJ A;  3IXR A;  3LWA A;  4MK3 A;  4WBR D;  2VCV A;  4I8B A;  4IJ3 A;  2OA7 A;  5ECP B;  1NM3 A;  4TXV A;  5CRD A;  1GSU A;  5FT3 A;  2C0G A;  1TRV A;  3GRX A;  4WET A;  4MH2 A;  1MEK A;  3QR6 A;  5DAL B;  1U87 A;  4D73 B;  5GAN D;  1IYI A;  5LD0 A;  3FZ4 A;  3H93 A;  4NHW A;  5DCG A;  1GSE A;  2IN3 A;  3OR5 A;  2GS3 A;  1O6J A;  3I6A A;  2B1L A;  3IK9 A;  2WDU A;  3A2V A;  1XBS A;  3ZTL A;  4F82 A;  2KLX A;  5E4W A;  4FO5 A;  1V40 A;  4I5Q A;  2DC5 A;  1TP9 A;  5IMC A;  1DE1 A;  3FR6 A;  5DQS A;  4YAV A;  4K6X A;  3WYW A;  3RHB A;  2VM2 A;  5CRG A;  1K0C A;  1EP8 A;  3CBU A;  3FKF A;  2TRC P;  4N11 A;  2O85 A;  1AQW A;  1HNA A;  2KHP A;  5HR1 A;  3PIN A;  3VUR A;  4MJB A;  4O32 A;  4I2U A;  1UC7 A;  5FWG A;  4V2N A;  1EEM A;  4HUA A;  3ZLP A;  3UVH A;  1M2B A;  1PL1 A;  1XVW A;  1VF1 A;  1XW6 A;  2KP1 A;  4I97 A;  2H19 A;  2H1G A;  2P0G A;  2HZE A;  2GQK A;  4OMV A;  4WBJ A;  1N8J A;  5CRE A;  4EVM A;  4E8E A;  2CA8 A;  3UBK A;  1M2A A;  4EE0 A;  3ZIV A;  2WJU A;  2TIR A;  2VM1 A;  1GNW A;  4LL4 B;  1T3B A;  4PQ1 A;  3TCO A;  5G1L A;  3GH6 A;  1GUH A;  2VL9 A;  1SK1 A;  3BJ5 A;  4K7I A;  2IPA A;  3MWH A;  4GSS A;  4KCA A;  2IME A;  2HFD A;  1CQH A;  3L4N A;  3I9V 2;  1EGR A;  3KMO A;  2LRC A;  1TU8 A;  1K0A A;  5G30 A;  1OYJ A;  4DSS A;  1A0F A;  2FA8 A;  4L8E A;  5E59 A;  3DXB A;  3FYG A;  3GL5 A;  3P90 A;  4KE3 A;  1XXU A;  1ERT A;  4PUF C;  5H5R A;  1PKZ A;  3KGK A;  1NW2 A;  3O3T A;  1Z6M A;  2C80 A;  2VO4 A;  3IC4 A;  4MPG A;  2ALB A;  1X9W B;  5KN1 A;  3GX0 A;  3LEF A;  4YAP A;  5DAK A;  2GZP A;  4LLR A;  2E2G A;  2N5F A;  5COH A;  2L5O A;  1SL2 B;  3ZVJ A;  3GH9 A;  5AIX A;  5GZZ B;  3QPM A;  2R6K A;  20GS A;  4IP1 A;  2X8H A;  3F4R A;  5DDL A;  2E2M A;  4YQM A;  2YP6 A;  4ZBA A;  2GQM A;  2JSZ A;  4LL1 B;  3ZVJ D;  2WZ9 A;  2YWN A;  3M3M A;  5EPF A; 
#chains in the Genus database with same CATH topology
 5ECO B;  3TKS E;  1JLV A;  2K8V A;  1PQN A;  2DJ1 A;  3LOR A;  4IVF A;  4KDU A;  3PH9 A;  3TJK A;  6GSV A;  4MDC A;  4ISD A;  3EC3 A;  4ECJ A;  2H8L A;  4KDX A;  3TGZ A;  1I5G A;  1U88 A;  3FZ5 A;  5CP1 A;  2VD0 A;  2WGR A;  2DLX A;  3DGQ A;  1FOH A;  2E7P A;  3FEU A;  2R2J A;  1DSB A;  2AUV A;  3UJ1 A;  1O85 A;  4G10 A;  5A4W A;  2VLT A;  2PVO C;  4G2E A;  4JR4 A;  4PNF A;  1ERW A;  1MD3 A;  4KUN A;  2WCI A;  4MF7 A;  2VLU A;  3HJP A;  1WJK A;  3J7Y k;  3ZIJ A;  2PPT A;  4ECI A;  1FAA A;  2C8U A;  2HLS A;  1ACV A;  4XCS A;  4KF9 A;  3G7J A;  2CZ3 A;  1YF1 A;  2H6Z A;  1EWX A;  4MCU A;  1OVN A;  2M72 A;  2M46 A;  1WPI A;  1NHO A;  1FO5 A;  4OCF A;  1M0U A;  2OAD A;  1YDK A;  2J9H A;  2K18 A;  3V1W A;  2I3Y A;  4RI7 A;  1NSW A;  3M8N A;  3IOS A;  3CSH A;  2YCD A;  1QK8 A;  3BBY A;  4Q5R A;  4NMU A;  1WWJ A;  5AIV A;  4KW6 A;  4XTS A;  3IHG A;  4XS6 A;  3K8N A;  4NV5 A;  1PX7 A;  3HVS A;  4MJA A;  2P31 A;  2ON7 A;  3TDG A;  1XPV A;  1ERU A;  1IYH A;  3G7I A;  2JAD A;  4TR1 B;  3TKP A;  4HJ2 A;  2C1Y A;  2WUL A;  2FGX A;  5IMV A;  3ERF A;  1B48 A;  3GL3 A;  5AGY A;  5KOW A;  1T00 A;  2HNL A;  3Q6O A;  3ZRD A;  2CVK A;  3IE3 A;  1JHB A;  1NHY A;  3ME8 A;  2DIY A;  3IDV A;  2R5G A;  4IJI A;  3ERG A;  4DVC A;  3ED3 A;  2LKU A;  2PMT A;  4J2F A;  2NDO A;  5DAL A;  4D73 A;  2LNT A;  3DVX A;  3FW2 A;  1K0O A;  2B5E A;  2YWO A;  2LRN A;  3GSS A;  2NBS A;  2RII A;  4HZ2 A;  2HSY A;  3DIE A;  4K2D A;  2ZUP A;  2MYG A;  4NHZ A;  1GTU A;  1T8E B;  2OKA A;  3LG6 A;  1FHE A;  3APS A;  2F8A A;  3C7M A;  3TJF A;  4Q5Q A;  1EP7 A;  2JZS A;  4BVX B;  4ZL9 A;  2GT5 A;  2MBS A;  2H75 A;  11GS A;  1SK2 A;  3I69 A;  1Z6N A;  2VUP A;  4TOP A;  2KOK A;  4TXO A;  1MDJ A;  4G19 A;  3IV4 A;  1F37 A;  3ISO A;  2DMM A;  3TB2 A;  1PN0 A;  1F6M C;  3FZA A;  4HI7 A;  4WKW A;  2K9F A;  3CSJ A;  1RK4 A;  2O87 A;  2DJ0 A;  1ZGN A;  1YKA A;  1QXH A;  4ZL7 A;  2MMN A;  2JZR A;  3FR3 A;  2C0F A;  1QMV A;  3D5J A;  3F63 A;  3APQ A;  2HSM A;  5C00 A;  4KDY A;  1A23 A;  4K7N A;  4BL7 A;  3ERW A;  1WIK A;  1V58 A;  2X49 A;  1VF2 A;  3KCM A;  2GZZ A;  1JZR A;  3H79 A;  4K0G A;  4KB3 A;  5ECL B;  1LJR A;  4OFT A;  2LRT A;  4NV2 A;  3WGX A;  1J0F A;  2I9H A;  2VIM A;  3E0U A;  3TOT A;  4MAB A;  2JL4 A;  4NPB A;  4V2L A;  3PR8 A;  3QDN A;  3MNG A;  2KP2 A;  4ZL8 A;  5DJL A;  1VRS D;  2FY6 A;  3GV1 A;  3W8J A;  1XIY A;  3IHQ A;  2CX3 A;  5ECN B;  1DUG A;  3GHA A;  3LFL A;  3TKQ A;  2V6K A;  4GTU A;  1PX6 A;  1TRS A;  6GSX A;  1AQX A;  5ECI B;  2XBQ A;  4HJM A;  3BD2 A;  1O8W A;  3LW9 A;  4XRA A;  2LTK A;  1MTC A;  4F03 A;  2B7K A;  4BWQ A;  1XZO A;  4K9Z A;  4X4J A;  3FK8 A;  2I81 A;  3F3Q A;  6GSU A;  4N10 A;  4ZB6 A;  3GUS A;  3O6T A;  3ZL5 A;  5LNK e;  2IJY A;  5ID2 A;  1Z9H A;  2R0C A;  4YKG A;  2MMO A;  5JCW A;  2V32 A;  2HRK A;  3M1G A;  4MZB A;  2GVP A;  3E9J B;  2AAW A;  1T1V A;  4IN0 A;  4TKY A;  2MMA A;  4HQS A;  1BED A;  1JZW A;  1J9B A;  2A2S A;  2EIO A;  3NZN A;  4FQU A;  1RQM A;  1SYX A;  4NWY A;  4DSQ A;  1GUM A;  1UN2 A;  1MDK A;  1F2E A;  1SKW B;  8GSS A;  1G6Y A;  4PUR A;  4RQX A;  5D93 A;  2C4J A;  1R4W A;  5J41 A;  3FZ9 A;  1EOH A;  2LS5 A;  4OWY A;  3VPT A;  3KEB A;  1XVQ A;  2H1A A;  2IIY A;  1KTE A;  2VCQ A;  2A4H A;  4O5U A;  4EUY A;  4TR4 A;  4CW9 A;  4O92 A;  4EL1 A;  4TN8 A;  1O73 A;  4K1F A;  1HNC A;  1SJ6 A;  2OBI A;  3GMF A;  1SJI A;  1K0B A;  1UA5 A;  5AN1 A;  1XW5 A;  3D6I A;  3O76 A;  4POL A;  2L4Q A;  1THX A;  1WRY A;  4JE1 A;  4Q5N A;  4ZIL A;  2DIZ A;  4JRR A;  2IFQ B;  1EGO A;  2CVD A;  4PX1 A;  1OKD A;  2F9S A;  1TK8 B;  3HVV A;  1MD4 A;  2V6O A;  5D9V A;  4L0W A;  3GTU A;  4FIW A;  3QOU A;  4IP6 A;  4GWR A;  2CT6 A;  1A2M A;  1TJD A;  2QA2 A;  2CV4 A;  1U3I A;  5IMD A;  4BA7 A;  2GT6 A;  3EE2 A;  5IIZ A;  2OBK A;  3HKR A;  4HQZ A;  3Q19 A;  5C04 A;  3GIX A;  1DE2 A;  2GQL A;  4QQ7 A;  1XWA A;  2H6X A;  2DSA A;  2BMX A;  2GSR A;  1OKT A;  1X0R A;  1ZYP A;  4EF0 A;  5A4U A;  1W89 A;  2DBC A;  3IR4 A;  4N0V A;  4ECB A;  1GUL A;  3A2W A;  3KTB A;  2X64 A;  4MZW A;  4P3Y B;  4EIP A;  3DYR A;  4MZC A;  1B4Q A;  1AC1 A;  4EKZ A;  4EC0 A;  1A2L A;  4GXZ A;  1XOA A;  3ZIT A;  3G9B A;  2CVB A;  3EU3 A;  2YJ7 A;  1JFU A;  3HJM A;  4KND A;  1ZYN A;  1QFN A;  4MH3 A;  1A8L A;  4BPY A;  1WE0 A;  2L6D A;  3UAP A;  1W4V A;  1EV4 A;  3LYK A;  1Z5Y E;  3LSZ A;  3D0Z A;  1GLQ A;  3HHV A;  5F0G A;  2YZH A;  3KJY A;  1CQG A;  4ILF A;  2FHE A;  5HQP A;  4IHU A;  3EMX A;  1FOV A;  1I9D A;  3KMN A;  2ON5 A;  3RAZ A;  3VK9 A;  3LJR A;  2D2Z A;  2FUG 2;  2VCT A;  4GLT A;  5HFG A;  4MF6 A;  3TJB A;  2M80 A;  4Z2T A;  1WMJ A;  1OC9 B;  4DSR A;  4BWS A;  1ZMA A;  4AJ6 A;  5J9B A;  1QUW A;  5B6M A;  1J08 A;  2DJ3 A;  5EL8 A;  2CX4 A;  1ZCP A;  1QQ2 A;  2FLS A;  2F51 A;  4TVE A;  1A0R P;  2LV3 A;  4YQV A;  4L5O A;  2LJA A;  3DML A;  3JCM L;  3TUE A;  4GST A;  3QFA C;  1F9M A;  4K7O A;  3KZQ A;  3C1R A;  2VD1 A;  1ABA A;  5GST A;  3GKX A;  1PN9 A;  2F3M A;  2VLV A;  5FHI A;  2AJQ B;  5ECM B;  4F2I A;  1TOF A;  1FG4 A;  3BOA A;  2B3S A;  4GCI A;  5HR0 A;  1B8X A;  3IAM 2;  3IBH A;  1A24 A;  1PRX A;  1BG5 A;  2WB9 A;  2B5Y A;  3GX8 A;  3LYP A;  19GS A;  4MLY A;  3RBT A;  3RDW A;  3ME7 A;  4GQC A;  4XS4 A;  1EEJ A;  1FVK A;  2C3T A;  6GST A;  2GLR A;  1ZOF A;  4HOJ A;  2MMZ A;  4ZBB A;  4ZBD A;  3IRA A;  1M9A A;  1F3A A;  4FH8 A;  5F06 A;  1GSQ A;  1H4O A;  2H0H A;  4GRF A;  1GUK A;  1PGT A;  1GWC A;  3GKM A;  5G1K A;  1GTA A;  2FA4 A;  4MP4 A;  5HFI A;  2CAI A;  3L9V A;  4AF2 A;  4JBB A;  3TRX A;  3ZYW A;  3F4S A;  4PNG A;  2AYT A;  2OJL A;  4PGT A;  2QC7 A;  3WGE A;  3VI7 A;  2LNS A;  5B8A A;  1V9W A;  4KSM A;  3KP8 A;  3KXO A;  2XHF A;  3VLN A;  1TW9 A;  2XPE A;  3F8U A;  2H1B A;  4Z7X A;  3L9U A;  3HA9 A;  4X0X A;  2HZE B;  3WGD A;  2WRT A;  4WF4 A;  1T7P B;  2JU5 A;  3D22 A;  2FCH A;  4KA0 A;  5IOW A;  3U5R E;  4KAE A;  1O8X A;  4EXJ A;  1K3Y A;  4OCE A;  2ZNM A;  1HNB A;  1BJX A;  5HFK A;  3HCZ A;  3LXT A;  3QMX A;  4DSS B;  3EWL A;  2H30 A;  3U6V A;  5ECH B;  1ZYE A;  1TU7 A;  1TTZ A;  5D9T A;  4NXI A;  3HXS A;  1OC8 A;  4PQH A;  1SD8 A;  4J57 E;  3HZ8 A;  5G2Z A;  2H01 A;  2H76 A;  4ECC A;  2DKI A;  3QCP A;  3GN3 A;  1Q4J A;  3L78 A;  3MDK A;  1SKS B;  2OE0 A;  4OFN A;  1Z7R A;  5DAK B;  3UOM A;  3G7Y A;  4CY8 A;  5F05 A;  3UVT A;  3R2Q A;  3MSZ A;  3CSI A;  3A2X A;  3GKK A;  2K6V A;  3DKS A;  4HU9 A;  3Q18 A;  3VFI A;  5KN3 A;  4GF0 A;  1HQO A;  1O7U A;  1OE8 A;  1M9B A;  1OE7 A;  5IPH A;  1XWK A;  1M3I A;  3TKS C;  3LXZ A;  2C0D A;  4ML1 A;  5DBQ A;  2MZC A;  3EMP A;  4IS0 A;  3M9J A;  4N0Z A;  4LMW A;  1T4Y A;  1LBK A;  2FWH A;  4FYB A;  2GGT A;  5DCH A;  3S9F A;  1ZYQ B;  3DVW A;  2HSH A;  2VL3 A;  1MDI A;  1V98 A;  4OD7 A;  4YKF A;  1RW1 A;  1V57 A;  1WOU A;  2H72 A;  1Y25 A;  4MA9 A;  3VWX A;  4G0K A;  4MF5 A;  2GSS A;  2PWJ A;  2YOI A;  2PU9 C;  4TR3 A;  3IA1 A;  1GNE A;  3TKS A;  2LJK A;  3KTL A;  4HS1 A;  4XRD A;  4G9H A;  3KIJ A;  4X1U A;  1B9Y C;  4K5S A;  3ZZX A;  3F4T A;  4XHM A;  2BTO T;  1E2Y A;  3C73 A;  5G31 A;  2CZ2 A;  5IO0 A;  1TXX A;  2OAC A;  2V41 A;  1PL2 A;  2N5B A;  3FY7 A;  1G0T A;  3CTG A;  2C3N A;  1F3B A;  1K0M A;  5DVB A;  2A4V A;  5JWR B;  1K3O A;  5CO3 A;  2H74 A;  3UAR A;  2IWT A;  2TRX A;  3MIX A;  1K0N A;  2IL3 A;  3H8Q A;  2YNX A;  4I6X A;  2GDR A;  3N5O A;  1OC9 A;  3HYP A;  1HYU A;  2LQQ A;  4IEL A;  1URM A;  4BVY A;  4POK A;  5J9C A;  1G7E A;  4FYU A;  3QAW A;  2OE3 A;  2HRN A;  3ZRE A;  5IQY A;  5ECR B;  4NAX A;  1FVJ A;  3UMA A;  3LQ7 A;  2H73 A;  2C0E A;  1KEB A;  4V1A p;  4KX4 A;  5KEJ A;  1Y6E A;  1AAZ A;  4POB A;  1S3D A;  2H0G A;  4WEY A;  3IPZ A;  5JCG A;  4IBP A;  3ZFL A;  2VCX A;  2IMD A;  2HXK A;  3F0I A;  5INY A;  3VWU A;  1ILO A;  1G7O A;  2AHE A;  3IC8 A;  1B4P A;  3KD0 A;  2V1M A;  4QL7 A;  4N30 A;  4ID0 A;  5IMZ A;  3EU4 A;  3M0F A;  2H70 A;  13GS A;  1ERV A;  1TI1 A;  3VWV A;  1PFO A;  4WR4 A;  2DJ2 A;  1JZO A;  1AXD A;  2Z9S A;  2PUK C;  5IOX A;  2JAC A;  3DD3 A;  5KN0 A;  1BQ7 A;  4EDY A;  4GQF A;  2PGT A;  3HDC A;  3UIW A;  1XWC A;  3GUR A;  1XWB A;  4RUV A;  3WT2 A;  6GSS A;  3L9S A;  4F0C A;  1S3A A;  1PKW A;  3SBC A;  2EIQ A;  1ZL9 A;  4MMM A;  1TK0 B;  3LGC A;  5IMF A;  3RPP A;  5ABR A;  1USB A;  3MAK A;  2E0Q A;  3VI5 A;  5AIS A;  5ENU A;  1X5D A;  1ZZY A;  3HVX A;  3P2A A;  3L0H A;  1VF3 A;  3C8E A;  4TXO B;  4TRX A;  2WS2 A;  1OC3 A;  2PER A;  4ZB8 A;  3F6F A;  1UVZ A;  5IPG A;  3QAV A;  1FB0 A;  3HY2 A;  1KBN A;  3C1S A;  5J5N A;  4TR1 A;  2REM A;  4XIH A;  4HU7 A;  3QD9 A;  4H86 A;  2CAQ A;  3E3E A;  4F0B A;  5CRW A;  1VF4 A;  3EVI A;  2B5X A;  4JZQ A;  1TRU A;  1YY7 A;  3IK7 A;  2HYX A;  1YJ6 A;  5KOX A;  1C72 A;  2P5R A;  4G0L A;  3H1N A;  5D9W A;  2ZCT A;  3EYT A;  2FWF A;  18GS A;  2GTU A;  5ECQ B;  1B9X C;  1YKC A;  2HZF A;  3D4T A;  1TRW A;  3A5I A;  4ZB9 A;  4AGS A;  4JU5 A;  2YJH A;  2G2Q A;  16GS A;  1YQ1 A;  4ULX A;  4F9Z A;  3KH7 A;  4PUA A;  10GS A;  4FYC A;  2XPD A;  3CTF A;  2RLI A;  2WFC A;  3F9U A;  3TRQ A;  2IMK A;  4JR6 A;  2XC2 A;  5EY6 A;  4AJ8 A;  5JWQ B;  2VCZ A;  3AY8 A;  3SWL A;  4O5R A;  3APO A;  4PQI A;  1WP0 A;  2B7J A;  3D4M A;  2KUC A;  1EOG A;  4E8H A;  3N9J A;  2LUS A;  1GL8 A;  1O81 A;  2A2P A;  5LCZ A;  5JWO B;  3A5W A;  1Q98 A;  6GSY A;  4HSC X;  3GA4 A;  4BVX A;  1X5C A;  2EIR A;  2NVL A;  4ACS A;  2F8F A;  5CNW A;  4RI6 A;  4YQU A;  2JSY A;  3HVN A;  2VOC A;  4Q5F A;  2PN8 A;  5ECS A;  2RM6 A;  3ZFB A;  1QGV A;  1R26 A;  2IMI A;  2QSI A;  2VAF A;  5ID2 B;  5DQY A;  4EO3 A;  3CMI A;  1GLP A;  1YF0 A;  5HR2 A;  1SJZ A;  2QGV A;  3FRC A;  3DWV A;  3CXG A;  4IQ1 A;  2L57 A;  2LEG A;  3HD5 A;  2AB6 A;  4I2T A;  1ON4 A;  4O5Q A;  4CY6 A;  5CYY A;  2A2R A;  2NPB A;  2X99 A;  5ELG A;  5EVO A;  2RM5 A;  2N5A A;  3UEM A;  3BCK A;  5CAX A;  17GS A;  1AW9 A;  4YH2 A;  1M7T A;  2GSQ A;  4IGJ A;  3Q74 A;  1GTI A;  1GP1 A;  1TI3 A;  3PGT A;  2H1D A;  1DBY A;  4MPF A;  2LQO A;  3TJG A;  1K3L A;  3CYN A;  1OAZ A;  1A2J A;  1H75 A;  1JZD A;  1SEN A;  2X8C A;  1XWG A;  2VCW A;  2C3Q A;  4CDO A;  2DJK A;  4KSO A;  5DJM A;  2I4A A;  1V2A A;  2EC4 A;  3TJJ A;  7GSS A;  4HDE A;  4USS A;  4L5L A;  1HD2 A;  1Z7P A;  1FW1 A;  5ECK B;  1N2A A;  5G5F A;  1FB6 A;  2FWE A;  4X43 A;  3GKN A;  2PBJ A;  4KCE A;  4JED A;  4WR5 A;  4KGI A;  5L71 A;  1X9M B;  3F6D A;  2G0F A;  2LJR A;  4WF5 A;  4CHS A;  1YZX A;  3GYK A;  5F07 A;  2H66 A;  1R5P A;  3GTU B;  2AV4 A;  4OFM A;  4J56 E;  2V2G A;  1XW9 A;  3FHK A;  3KH9 A;  1GTB A;  5J4U A;  4EDZ A;  2BJX A;  22GS A;  2L59 A;  2LST A;  5D8I A;  5ELA A;  1VGL A;  2HI7 A;  3CRU A;  3F3R A;  5HR3 A;  1YEX A;  3GNJ A;  3GST A;  2YWM A;  4OO5 A;  4PTS A;  2R37 A;  2RUE A;  4RQR A;  4K8M A;  2OE1 A;  4TR0 A;  4GSN A;  1ST9 A;  1SL1 B;  1BAY A;  2DML A;  1GH2 A;  2MBT A;  2R0P A;  3IAS 2;  3CRT A;  3QAG A;  1E6B A;  1PA3 A;  4ZIJ A;  2H6Y A;  1X9S B;  2YWI A;  5D73 A;  3TRP A;  3RPN A;  3WD6 A;  2H0I A;  3UBL A;  4IKH A;  1U3A A;  5J3R A;  3MYD A;  4POM A;  4IQA A;  1JLW A;  1EV9 A;  2XBI A;  4ML6 A;  4L0U A;  1T4Z A;  4OO4 A;  1A8Y A;  1BYE A;  2L5L A;  4ZXG A;  1SU9 A;  1GRX A;  3NIV A;  5A5K A;  4KH7 A;  4Z2R A;  2HRF A;  1SD9 A;  2HT9 A;  3TKR A;  1SL0 B;  1THO A;  5JCU A;  2R4V A;  2YZU A;  1XCC A;  1GSF A;  4K0N A;  3D21 A;  3P8W A;  3KP9 A;  5BRT A;  2YN1 A;  1SKR B;  3W8S A;  2B1K A;  5GAP D;  3J7Y b;  12GS A;  5IO2 A;  2IFQ A;  2H71 A;  4MNN A;  1EZK A;  4O7H A;  2VL2 C;  1TDI A;  2PVQ A;  2FWG A;  5H5S A;  3ZML A;  2DKH A;  9GSS A;  2L4C A;  2CQ9 A;  2O7K A;  1M99 A;  1S3C A;  1AIU A;  5D9X A;  3WT1 A;  2K8S A;  1LU4 A;  2R3X A;  3W6G A;  3HJO A;  3EIN A;  3QFB C;  4XS1 A;  3A3T A;  1X5E A;  2X4A A;  2GST A;  2R0G A;  4LMV A;  4EIQ A;  1U6T A;  1G6W A;  3KM6 A;  3BCI A;  3FR9 A;  2VL2 A;  4TW5 A;  1SK0 A;  2HE3 A;  2X8G A;  5KN2 A;  1AQV A;  2NTO A;  2YPM A;  1XFL A;  3TOU A;  3M9K A;  3UL3 A;  2FD3 A;  3HZ4 A;  5H5Q A;  1XOB A;  2JZT A;  2QKE A;  1GSS A;  5D96 A;  1KNG A;  1M2D A;  3H4K A;  3I43 A;  4HEA 2;  5G5E A;  3PPU A;  3EUR A;  2RUF A;  4V2M A;  2P5Q A;  1PSQ A;  1TKD B;  4LA1 A;  3C71 A;  2GZY A;  1GSY A;  1PD2 1;  4PXO A;  4MJE A;  3ZMK A;  5F8B A;  2O8V B;  3US3 A;  2B6M A;  1AUC A;  1R7H A;  4XS4 B;  2YV7 A;  3GFK A;  3NOF A;  4MJC A;  5IM9 A;  4WXT A;  1Z3E A;  14GS A;  3DRN A;  1K0D A;  1BX9 A;  1YEP A;  1ML6 A;  3VPQ A;  2YAN A;  4QL9 A;  3RHC A;  2YV9 A;  1R5A A;  5B6N A;  1TK5 B;  5CRH A;  6GSW A;  3VWW A;  1SYR A;  4HZ4 A;  2I1U A;  5B7C A;  2FNO A;  1PMT A;  4V1A g;  5A4V A;  4AJ7 A;  1M3J A;  2J23 A;  2L6C A;  2IMF A;  1GSD A;  5B8B A;  3DEX A;  5IMA A;  2ES7 A;  5GSS A;  3P7X A;  4IW9 A;  2O89 A;  2DJJ A;  4DEJ A;  3IXR A;  3LWA A;  2HRA A;  4MK3 A;  4WBR D;  2VCV A;  4I8B A;  4IJ3 A;  2OA7 A;  5ECP B;  1NM3 A;  4TXV A;  5CRD A;  1GSU A;  5FT3 A;  2C0G A;  1TRV A;  2UZ8 A;  3GRX A;  4WET A;  4MH2 A;  1MEK A;  3QR6 A;  5DAL B;  1U87 A;  4D73 B;  5GAN D;  1IYI A;  5LD0 A;  3FZ4 A;  3H93 A;  4NHW A;  5DCG A;  1GSE A;  2IN3 A;  3OR5 A;  2GS3 A;  1O6J A;  3I6A A;  2B1L A;  3IK9 A;  2WDU A;  3A2V A;  1XBS A;  3ZTL A;  4F82 A;  2KLX A;  5E4W A;  4FO5 A;  1V40 A;  4I5Q A;  2DC5 A;  1TP9 A;  5IMC A;  1DE1 A;  3FR6 A;  3FMW A;  5DQS A;  4YAV A;  4K6X A;  1XG8 A;  3WYW A;  2QA1 A;  3RHB A;  2VM2 A;  5CRG A;  4K2X A;  1K0C A;  1EP8 A;  3CBU A;  3FKF A;  2TRC P;  4N11 A;  2O85 A;  1AQW A;  1HNA A;  2KHP A;  5HR1 A;  3PIN A;  3VUR A;  4MJB A;  4O32 A;  5BMU A;  4I2U A;  1UC7 A;  5FWG A;  4V2N A;  1EEM A;  4HUA A;  3ZLP A;  3UVH A;  1M2B A;  1PL1 A;  1XVW A;  1VF1 A;  1XW6 A;  2KP1 A;  4I97 A;  2H19 A;  4K5R A;  2H1G A;  3CQF A;  2P0G A;  2HZE A;  2GQK A;  4OMV A;  4WBJ A;  4BL7 B;  1N8J A;  5CRE A;  4EVM A;  3EPT A;  4E8E A;  2CA8 A;  3UBK A;  1M2A A;  4EE0 A;  3ZIV A;  2WJU A;  2TIR A;  2VM1 A;  1GNW A;  4LL4 B;  1T3B A;  4PQ1 A;  3TCO A;  5G1L A;  3GH6 A;  1GUH A;  2VL9 A;  1SK1 A;  3BJ5 A;  4K7I A;  2IPA A;  3MWH A;  4Z2U A;  4GSS A;  4KCA A;  4ICY A;  2IME A;  2HFD A;  1CQH A;  3L4N A;  3I9V 2;  1EGR A;  3KMO A;  2LRC A;  1TU8 A;  1K0A A;  5G30 A;  1OYJ A;  4DSS A;  1A0F A;  2FA8 A;  4L8E A;  5E59 A;  3DXB A;  3FYG A;  3GL5 A;  3P90 A;  4KE3 A;  1XXU A;  1ERT A;  4PUF C;  5H5R A;  1PKZ A;  3KGK A;  1NW2 A;  3O3T A;  1Z6M A;  2C80 A;  2VO4 A;  3IC4 A;  4MPG A;  4A5P A;  2ALB A;  1X9W B;  5KN1 A;  3GX0 A;  3LEF A;  4YAP A;  5DAK A;  4BIK A;  2GZP A;  4LLR A;  2E2G A;  2N5F A;  4G0I A;  1S3R A;  3R3E A;  5COH A;  2L5O A;  1SL2 B;  3ZVJ A;  3GH9 A;  5AIX A;  5GZZ B;  3QPM A;  2R6K A;  20GS A;  4BVY B;  4IP1 A;  2X8H A;  3F4R A;  2E2M A;  2YP6 A;  4YQM A;  5DDL A;  4ZBA A;  2GQM A;  2JSZ A;  4LL1 B;  3ZVJ D;  2WZ9 A;  2YWN A;  3M3M A;  5EPF A; 
#chains in the Genus database with same CATH homology
 5ECO B;  3TKS E;  1JLV A;  2K8V A;  1PQN A;  2DJ1 A;  3LOR A;  4IVF A;  4KDU A;  3PH9 A;  3TJK A;  6GSV A;  4MDC A;  4ISD A;  3EC3 A;  4ECJ A;  2H8L A;  4KDX A;  3TGZ A;  1I5G A;  1U88 A;  3FZ5 A;  5CP1 A;  2VD0 A;  2WGR A;  2DLX A;  3DGQ A;  1FOH A;  2E7P A;  3FEU A;  2R2J A;  1DSB A;  2AUV A;  3UJ1 A;  1O85 A;  4G10 A;  5A4W A;  2VLT A;  2PVO C;  4G2E A;  4JR4 A;  4PNF A;  1ERW A;  1MD3 A;  4KUN A;  2WCI A;  4MF7 A;  2VLU A;  3HJP A;  1WJK A;  3J7Y k;  3ZIJ A;  2PPT A;  4ECI A;  1FAA A;  2C8U A;  2HLS A;  1ACV A;  4XCS A;  4KF9 A;  3G7J A;  2CZ3 A;  1YF1 A;  2H6Z A;  1EWX A;  4MCU A;  1OVN A;  2M72 A;  2M46 A;  1WPI A;  1NHO A;  1FO5 A;  4OCF A;  1M0U A;  2OAD A;  1YDK A;  2J9H A;  2K18 A;  3V1W A;  2I3Y A;  4RI7 A;  1NSW A;  3M8N A;  3IOS A;  3CSH A;  2YCD A;  1QK8 A;  3BBY A;  4Q5R A;  4NMU A;  1WWJ A;  5AIV A;  4KW6 A;  4XTS A;  3IHG A;  4XS6 A;  3K8N A;  4NV5 A;  1PX7 A;  3HVS A;  4MJA A;  2P31 A;  2ON7 A;  3TDG A;  1XPV A;  1ERU A;  1IYH A;  3G7I A;  2JAD A;  4TR1 B;  3TKP A;  4HJ2 A;  2C1Y A;  2WUL A;  2FGX A;  5IMV A;  3ERF A;  1B48 A;  3GL3 A;  5AGY A;  5KOW A;  1T00 A;  2HNL A;  3Q6O A;  3ZRD A;  2CVK A;  3IE3 A;  1JHB A;  1NHY A;  3ME8 A;  2DIY A;  3IDV A;  2R5G A;  4IJI A;  3ERG A;  4DVC A;  3ED3 A;  2LKU A;  2PMT A;  4J2F A;  2NDO A;  5DAL A;  4D73 A;  2LNT A;  3DVX A;  3FW2 A;  1K0O A;  2B5E A;  2YWO A;  2LRN A;  3GSS A;  2NBS A;  2RII A;  4HZ2 A;  2HSY A;  3DIE A;  4K2D A;  2ZUP A;  2MYG A;  4NHZ A;  1GTU A;  1T8E B;  2OKA A;  3LG6 A;  1FHE A;  3APS A;  2F8A A;  3C7M A;  3TJF A;  4Q5Q A;  1EP7 A;  2JZS A;  4BVX B;  4ZL9 A;  2GT5 A;  2MBS A;  2H75 A;  11GS A;  1SK2 A;  3I69 A;  1Z6N A;  2VUP A;  4TOP A;  2KOK A;  4TXO A;  1MDJ A;  4G19 A;  3IV4 A;  1F37 A;  3ISO A;  2DMM A;  3TB2 A;  1PN0 A;  1F6M C;  3FZA A;  4HI7 A;  4WKW A;  2K9F A;  3CSJ A;  1RK4 A;  2O87 A;  2DJ0 A;  1ZGN A;  1YKA A;  1QXH A;  4ZL7 A;  2MMN A;  2JZR A;  3FR3 A;  2C0F A;  1QMV A;  3D5J A;  3F63 A;  3APQ A;  2HSM A;  5C00 A;  4KDY A;  1A23 A;  4K7N A;  4BL7 A;  3ERW A;  1WIK A;  1V58 A;  2X49 A;  1VF2 A;  3KCM A;  2GZZ A;  1JZR A;  3H79 A;  4K0G A;  4KB3 A;  5ECL B;  1LJR A;  4OFT A;  2LRT A;  4NV2 A;  3WGX A;  1J0F A;  2I9H A;  2VIM A;  3E0U A;  3TOT A;  4MAB A;  2JL4 A;  4NPB A;  4V2L A;  3PR8 A;  3QDN A;  3MNG A;  2KP2 A;  4ZL8 A;  5DJL A;  1VRS D;  2FY6 A;  3GV1 A;  3W8J A;  1XIY A;  3IHQ A;  2CX3 A;  5ECN B;  1DUG A;  3GHA A;  3LFL A;  3TKQ A;  2V6K A;  4GTU A;  1PX6 A;  1TRS A;  6GSX A;  1AQX A;  5ECI B;  2XBQ A;  4HJM A;  3BD2 A;  1O8W A;  3LW9 A;  4XRA A;  2LTK A;  1MTC A;  4F03 A;  2B7K A;  4BWQ A;  1XZO A;  4K9Z A;  4X4J A;  3FK8 A;  2I81 A;  3F3Q A;  6GSU A;  4N10 A;  4ZB6 A;  3GUS A;  3O6T A;  3ZL5 A;  5LNK e;  2IJY A;  5ID2 A;  1Z9H A;  2R0C A;  4YKG A;  2MMO A;  5JCW A;  2V32 A;  2HRK A;  3M1G A;  4MZB A;  2GVP A;  3E9J B;  2AAW A;  1T1V A;  4IN0 A;  4TKY A;  2MMA A;  4HQS A;  1BED A;  1JZW A;  1J9B A;  2A2S A;  2EIO A;  3NZN A;  4FQU A;  1RQM A;  1SYX A;  4NWY A;  4DSQ A;  1GUM A;  1UN2 A;  1MDK A;  1F2E A;  1SKW B;  8GSS A;  1G6Y A;  4PUR A;  4RQX A;  5D93 A;  2C4J A;  1R4W A;  5J41 A;  3FZ9 A;  1EOH A;  2LS5 A;  4OWY A;  3VPT A;  3KEB A;  1XVQ A;  2H1A A;  2IIY A;  1KTE A;  2VCQ A;  2A4H A;  4O5U A;  4EUY A;  4TR4 A;  4CW9 A;  4O92 A;  4EL1 A;  4TN8 A;  1O73 A;  4K1F A;  1HNC A;  1SJ6 A;  2OBI A;  3GMF A;  1SJI A;  1K0B A;  1UA5 A;  5AN1 A;  1XW5 A;  3D6I A;  3O76 A;  4POL A;  2L4Q A;  1THX A;  1WRY A;  4JE1 A;  4Q5N A;  4ZIL A;  2DIZ A;  4JRR A;  2IFQ B;  1EGO A;  2CVD A;  4PX1 A;  1OKD A;  2F9S A;  1TK8 B;  3HVV A;  1MD4 A;  2V6O A;  5D9V A;  4L0W A;  3GTU A;  4FIW A;  3QOU A;  4IP6 A;  4GWR A;  2CT6 A;  1A2M A;  1TJD A;  2QA2 A;  2CV4 A;  1U3I A;  5IMD A;  4BA7 A;  2GT6 A;  3EE2 A;  5IIZ A;  2OBK A;  3HKR A;  4HQZ A;  3Q19 A;  5C04 A;  3GIX A;  1DE2 A;  2GQL A;  4QQ7 A;  1XWA A;  2H6X A;  2DSA A;  2BMX A;  2GSR A;  1OKT A;  1X0R A;  1ZYP A;  4EF0 A;  5A4U A;  1W89 A;  2DBC A;  3IR4 A;  4N0V A;  4ECB A;  1GUL A;  3A2W A;  3KTB A;  2X64 A;  4MZW A;  4P3Y B;  4EIP A;  3DYR A;  4MZC A;  1B4Q A;  1AC1 A;  4EKZ A;  4EC0 A;  1A2L A;  4GXZ A;  1XOA A;  3ZIT A;  3G9B A;  2CVB A;  3EU3 A;  2YJ7 A;  1JFU A;  3HJM A;  4KND A;  1ZYN A;  1QFN A;  4MH3 A;  1A8L A;  4BPY A;  1WE0 A;  2L6D A;  3UAP A;  1W4V A;  1EV4 A;  3LYK A;  1Z5Y E;  3LSZ A;  3D0Z A;  1GLQ A;  3HHV A;  5F0G A;  2YZH A;  3KJY A;  1CQG A;  4ILF A;  2FHE A;  5HQP A;  4IHU A;  3EMX A;  1FOV A;  1I9D A;  3KMN A;  2ON5 A;  3RAZ A;  3VK9 A;  3LJR A;  2D2Z A;  2FUG 2;  2VCT A;  4GLT A;  5HFG A;  4MF6 A;  3TJB A;  2M80 A;  4Z2T A;  1WMJ A;  1OC9 B;  4DSR A;  4BWS A;  1ZMA A;  4AJ6 A;  5J9B A;  1QUW A;  5B6M A;  1J08 A;  2DJ3 A;  5EL8 A;  2CX4 A;  1ZCP A;  1QQ2 A;  2FLS A;  2F51 A;  4TVE A;  1A0R P;  2LV3 A;  4YQV A;  4L5O A;  2LJA A;  3DML A;  3JCM L;  3TUE A;  4GST A;  3QFA C;  1F9M A;  4K7O A;  3KZQ A;  3C1R A;  2VD1 A;  1ABA A;  5GST A;  3GKX A;  1PN9 A;  2F3M A;  2VLV A;  5FHI A;  2AJQ B;  5ECM B;  4F2I A;  1TOF A;  1FG4 A;  3BOA A;  2B3S A;  4GCI A;  5HR0 A;  1B8X A;  3IAM 2;  3IBH A;  1A24 A;  1PRX A;  1BG5 A;  2WB9 A;  2B5Y A;  3GX8 A;  3LYP A;  19GS A;  4MLY A;  3RBT A;  3RDW A;  3ME7 A;  4GQC A;  4XS4 A;  1EEJ A;  1FVK A;  2C3T A;  6GST A;  2GLR A;  1ZOF A;  4HOJ A;  2MMZ A;  4ZBB A;  4ZBD A;  3IRA A;  1M9A A;  1F3A A;  4FH8 A;  5F06 A;  1GSQ A;  1H4O A;  2H0H A;  4GRF A;  1GUK A;  1PGT A;  1GWC A;  3GKM A;  5G1K A;  1GTA A;  2FA4 A;  4MP4 A;  5HFI A;  2CAI A;  3L9V A;  4AF2 A;  4JBB A;  3TRX A;  3ZYW A;  3F4S A;  4PNG A;  2AYT A;  2OJL A;  4PGT A;  2QC7 A;  3WGE A;  3VI7 A;  2LNS A;  5B8A A;  1V9W A;  4KSM A;  3KP8 A;  3KXO A;  2XHF A;  3VLN A;  1TW9 A;  2XPE A;  3F8U A;  2H1B A;  4Z7X A;  3L9U A;  3HA9 A;  4X0X A;  2HZE B;  3WGD A;  2WRT A;  4WF4 A;  1T7P B;  2JU5 A;  3D22 A;  2FCH A;  4KA0 A;  5IOW A;  3U5R E;  4KAE A;  1O8X A;  4EXJ A;  1K3Y A;  4OCE A;  2ZNM A;  1HNB A;  1BJX A;  5HFK A;  3HCZ A;  3LXT A;  3QMX A;  4DSS B;  3EWL A;  2H30 A;  3U6V A;  5ECH B;  1ZYE A;  1TU7 A;  1TTZ A;  5D9T A;  4NXI A;  3HXS A;  1OC8 A;  4PQH A;  1SD8 A;  4J57 E;  3HZ8 A;  5G2Z A;  2H01 A;  2H76 A;  4ECC A;  2DKI A;  3QCP A;  3GN3 A;  1Q4J A;  3L78 A;  3MDK A;  1SKS B;  2OE0 A;  4OFN A;  1Z7R A;  5DAK B;  3UOM A;  3G7Y A;  4CY8 A;  5F05 A;  3UVT A;  3R2Q A;  3MSZ A;  3CSI A;  3A2X A;  3GKK A;  2K6V A;  3DKS A;  4HU9 A;  3Q18 A;  3VFI A;  5KN3 A;  4GF0 A;  1HQO A;  1O7U A;  1OE8 A;  1M9B A;  1OE7 A;  5IPH A;  1XWK A;  3TKS C;  3LXZ A;  2C0D A;  4ML1 A;  5DBQ A;  2MZC A;  3EMP A;  4IS0 A;  3M9J A;  4N0Z A;  4LMW A;  1T4Y A;  1LBK A;  2FWH A;  4FYB A;  2GGT A;  5DCH A;  3S9F A;  1ZYQ B;  3DVW A;  2HSH A;  2VL3 A;  1MDI A;  1V98 A;  4OD7 A;  4YKF A;  1RW1 A;  1V57 A;  1WOU A;  2H72 A;  1Y25 A;  4MA9 A;  3VWX A;  4G0K A;  4MF5 A;  2GSS A;  2PWJ A;  2YOI A;  2PU9 C;  4TR3 A;  3IA1 A;  1GNE A;  3TKS A;  2LJK A;  3KTL A;  4HS1 A;  4XRD A;  4G9H A;  3KIJ A;  4X1U A;  1B9Y C;  4K5S A;  3ZZX A;  3F4T A;  4XHM A;  2BTO T;  1E2Y A;  3C73 A;  5G31 A;  2CZ2 A;  5IO0 A;  1TXX A;  2OAC A;  2V41 A;  1PL2 A;  2N5B A;  3FY7 A;  1G0T A;  3CTG A;  2C3N A;  1F3B A;  1K0M A;  5DVB A;  2A4V A;  5JWR B;  1K3O A;  5CO3 A;  2H74 A;  3UAR A;  2IWT A;  2TRX A;  3MIX A;  1K0N A;  2IL3 A;  3H8Q A;  2YNX A;  4I6X A;  2GDR A;  3N5O A;  1OC9 A;  3HYP A;  1HYU A;  2LQQ A;  4IEL A;  1URM A;  4BVY A;  4POK A;  5J9C A;  1G7E A;  4FYU A;  3QAW A;  2OE3 A;  2HRN A;  3ZRE A;  5IQY A;  5ECR B;  4NAX A;  1FVJ A;  3UMA A;  3LQ7 A;  2H73 A;  2C0E A;  1KEB A;  4V1A p;  4KX4 A;  5KEJ A;  1Y6E A;  1AAZ A;  4POB A;  1S3D A;  2H0G A;  4WEY A;  3IPZ A;  5JCG A;  4IBP A;  3ZFL A;  2VCX A;  2IMD A;  2HXK A;  3F0I A;  5INY A;  3VWU A;  1ILO A;  1G7O A;  2AHE A;  3IC8 A;  1B4P A;  3KD0 A;  2V1M A;  4QL7 A;  4N30 A;  4ID0 A;  5IMZ A;  3EU4 A;  3M0F A;  2H70 A;  13GS A;  1ERV A;  1TI1 A;  3VWV A;  4WR4 A;  2DJ2 A;  1JZO A;  1AXD A;  2Z9S A;  2PUK C;  5IOX A;  2JAC A;  3DD3 A;  5KN0 A;  1BQ7 A;  4EDY A;  4GQF A;  2PGT A;  3HDC A;  3UIW A;  1XWC A;  3GUR A;  1XWB A;  4RUV A;  3WT2 A;  6GSS A;  3L9S A;  4F0C A;  1S3A A;  1PKW A;  3SBC A;  2EIQ A;  1ZL9 A;  4MMM A;  1TK0 B;  3LGC A;  5IMF A;  3RPP A;  5ABR A;  1USB A;  3MAK A;  2E0Q A;  3VI5 A;  5AIS A;  5ENU A;  1X5D A;  1ZZY A;  3HVX A;  3P2A A;  3L0H A;  1VF3 A;  3C8E A;  4TXO B;  4TRX A;  2WS2 A;  1OC3 A;  2PER A;  4ZB8 A;  3F6F A;  1UVZ A;  5IPG A;  3QAV A;  1FB0 A;  3HY2 A;  1KBN A;  3C1S A;  5J5N A;  4TR1 A;  2REM A;  4XIH A;  4HU7 A;  3QD9 A;  4H86 A;  2CAQ A;  3E3E A;  4F0B A;  5CRW A;  1VF4 A;  3EVI A;  2B5X A;  4JZQ A;  1TRU A;  1YY7 A;  3IK7 A;  2HYX A;  1YJ6 A;  5KOX A;  1C72 A;  2P5R A;  4G0L A;  3H1N A;  5D9W A;  2ZCT A;  3EYT A;  2FWF A;  18GS A;  2GTU A;  5ECQ B;  1B9X C;  1YKC A;  2HZF A;  3D4T A;  1TRW A;  3A5I A;  4ZB9 A;  4AGS A;  4JU5 A;  2YJH A;  2G2Q A;  16GS A;  1YQ1 A;  4ULX A;  4F9Z A;  3KH7 A;  4PUA A;  10GS A;  4FYC A;  2XPD A;  3CTF A;  2RLI A;  2WFC A;  3F9U A;  3TRQ A;  2IMK A;  4JR6 A;  2XC2 A;  5EY6 A;  4AJ8 A;  5JWQ B;  2VCZ A;  3AY8 A;  3SWL A;  4O5R A;  3APO A;  4PQI A;  1WP0 A;  2B7J A;  3D4M A;  2KUC A;  1EOG A;  4E8H A;  3N9J A;  2LUS A;  1GL8 A;  1O81 A;  2A2P A;  5LCZ A;  5JWO B;  3A5W A;  1Q98 A;  6GSY A;  3GA4 A;  4BVX A;  1X5C A;  2EIR A;  2NVL A;  4ACS A;  2F8F A;  5CNW A;  4RI6 A;  4YQU A;  2JSY A;  2VOC A;  4Q5F A;  2PN8 A;  5ECS A;  2RM6 A;  3ZFB A;  1QGV A;  1R26 A;  2IMI A;  2QSI A;  2VAF A;  5ID2 B;  5DQY A;  4EO3 A;  3CMI A;  1GLP A;  1YF0 A;  5HR2 A;  1SJZ A;  2QGV A;  3FRC A;  3DWV A;  3CXG A;  4IQ1 A;  2L57 A;  2LEG A;  3HD5 A;  2AB6 A;  4I2T A;  1ON4 A;  4O5Q A;  4CY6 A;  5CYY A;  2A2R A;  2NPB A;  2X99 A;  5ELG A;  5EVO A;  2RM5 A;  2N5A A;  3UEM A;  3BCK A;  5CAX A;  17GS A;  1AW9 A;  4YH2 A;  1M7T A;  2GSQ A;  4IGJ A;  3Q74 A;  1GTI A;  1GP1 A;  1TI3 A;  3PGT A;  2H1D A;  1DBY A;  4MPF A;  2LQO A;  3TJG A;  1K3L A;  3CYN A;  1OAZ A;  1A2J A;  1H75 A;  1JZD A;  1SEN A;  2X8C A;  1XWG A;  2VCW A;  2C3Q A;  4CDO A;  2DJK A;  4KSO A;  5DJM A;  2I4A A;  1V2A A;  2EC4 A;  3TJJ A;  7GSS A;  4HDE A;  4USS A;  4L5L A;  1HD2 A;  1Z7P A;  1FW1 A;  5ECK B;  1N2A A;  5G5F A;  1FB6 A;  2FWE A;  4X43 A;  3GKN A;  2PBJ A;  4KCE A;  4JED A;  4WR5 A;  4KGI A;  5L71 A;  1X9M B;  3F6D A;  2G0F A;  2LJR A;  4WF5 A;  4CHS A;  1YZX A;  3GYK A;  5F07 A;  2H66 A;  1R5P A;  3GTU B;  2AV4 A;  4OFM A;  4J56 E;  2V2G A;  1XW9 A;  3FHK A;  3KH9 A;  1GTB A;  5J4U A;  4EDZ A;  2BJX A;  22GS A;  2L59 A;  2LST A;  5D8I A;  5ELA A;  1VGL A;  2HI7 A;  3CRU A;  3F3R A;  5HR3 A;  1YEX A;  3GNJ A;  3GST A;  2YWM A;  4OO5 A;  4PTS A;  2R37 A;  2RUE A;  4RQR A;  4K8M A;  2OE1 A;  4TR0 A;  4GSN A;  1ST9 A;  1SL1 B;  1BAY A;  2DML A;  1GH2 A;  2MBT A;  2R0P A;  3IAS 2;  3CRT A;  3QAG A;  1E6B A;  1PA3 A;  4ZIJ A;  2H6Y A;  1X9S B;  2YWI A;  5D73 A;  3TRP A;  3RPN A;  3WD6 A;  2H0I A;  3UBL A;  4IKH A;  1U3A A;  5J3R A;  3MYD A;  4POM A;  4IQA A;  1JLW A;  1EV9 A;  2XBI A;  4ML6 A;  4L0U A;  1T4Z A;  4OO4 A;  1A8Y A;  1BYE A;  2L5L A;  4ZXG A;  1SU9 A;  1GRX A;  3NIV A;  5A5K A;  4KH7 A;  4Z2R A;  2HRF A;  1SD9 A;  2HT9 A;  3TKR A;  1SL0 B;  1THO A;  5JCU A;  2R4V A;  2YZU A;  1XCC A;  1GSF A;  4K0N A;  3D21 A;  3P8W A;  3KP9 A;  5BRT A;  2YN1 A;  1SKR B;  3W8S A;  2B1K A;  5GAP D;  3J7Y b;  12GS A;  5IO2 A;  2IFQ A;  2H71 A;  4MNN A;  1EZK A;  4O7H A;  2VL2 C;  1TDI A;  2PVQ A;  2FWG A;  5H5S A;  3ZML A;  2DKH A;  9GSS A;  2L4C A;  2CQ9 A;  2O7K A;  1M99 A;  1S3C A;  1AIU A;  5D9X A;  3WT1 A;  2K8S A;  1LU4 A;  2R3X A;  3W6G A;  3HJO A;  3EIN A;  3QFB C;  4XS1 A;  3A3T A;  1X5E A;  2X4A A;  2GST A;  2R0G A;  4LMV A;  4EIQ A;  1U6T A;  1G6W A;  3KM6 A;  3BCI A;  3FR9 A;  2VL2 A;  4TW5 A;  1SK0 A;  2HE3 A;  2X8G A;  5KN2 A;  1AQV A;  2NTO A;  2YPM A;  1XFL A;  3TOU A;  3M9K A;  3UL3 A;  2FD3 A;  3HZ4 A;  5H5Q A;  1XOB A;  2JZT A;  2QKE A;  1GSS A;  5D96 A;  1KNG A;  1M2D A;  3H4K A;  3I43 A;  4HEA 2;  5G5E A;  3PPU A;  3EUR A;  2RUF A;  4V2M A;  2P5Q A;  1PSQ A;  1TKD B;  4LA1 A;  3C71 A;  2GZY A;  1GSY A;  1PD2 1;  4PXO A;  4MJE A;  3ZMK A;  5F8B A;  2O8V B;  3US3 A;  2B6M A;  1AUC A;  1R7H A;  4XS4 B;  2YV7 A;  3GFK A;  3NOF A;  4MJC A;  5IM9 A;  4WXT A;  1Z3E A;  14GS A;  3DRN A;  1K0D A;  1BX9 A;  1YEP A;  1ML6 A;  3VPQ A;  2YAN A;  4QL9 A;  3RHC A;  2YV9 A;  1R5A A;  5B6N A;  1TK5 B;  5CRH A;  6GSW A;  3VWW A;  1SYR A;  4HZ4 A;  2I1U A;  5B7C A;  2FNO A;  1PMT A;  4V1A g;  5A4V A;  4AJ7 A;  2J23 A;  2L6C A;  2IMF A;  1GSD A;  5B8B A;  3DEX A;  5IMA A;  2ES7 A;  5GSS A;  3P7X A;  4IW9 A;  2O89 A;  2DJJ A;  4DEJ A;  3IXR A;  3LWA A;  2HRA A;  4MK3 A;  4WBR D;  2VCV A;  4I8B A;  4IJ3 A;  2OA7 A;  5ECP B;  1NM3 A;  4TXV A;  5CRD A;  1GSU A;  5FT3 A;  2C0G A;  1TRV A;  2UZ8 A;  3GRX A;  4WET A;  4MH2 A;  1MEK A;  3QR6 A;  5DAL B;  1U87 A;  4D73 B;  5GAN D;  1IYI A;  5LD0 A;  3FZ4 A;  3H93 A;  4NHW A;  5DCG A;  1GSE A;  2IN3 A;  3OR5 A;  2GS3 A;  1O6J A;  3I6A A;  2B1L A;  3IK9 A;  2WDU A;  3A2V A;  1XBS A;  3ZTL A;  4F82 A;  2KLX A;  5E4W A;  4FO5 A;  1V40 A;  4I5Q A;  2DC5 A;  1TP9 A;  5IMC A;  1DE1 A;  3FR6 A;  3FMW A;  5DQS A;  4YAV A;  4K6X A;  3WYW A;  2QA1 A;  3RHB A;  2VM2 A;  5CRG A;  4K2X A;  1K0C A;  1EP8 A;  3CBU A;  3FKF A;  2TRC P;  4N11 A;  2O85 A;  1AQW A;  1HNA A;  2KHP A;  5HR1 A;  3PIN A;  3VUR A;  4MJB A;  4O32 A;  5BMU A;  4I2U A;  1UC7 A;  5FWG A;  4V2N A;  1EEM A;  4HUA A;  3ZLP A;  3UVH A;  1M2B A;  1PL1 A;  1XVW A;  1VF1 A;  1XW6 A;  2KP1 A;  4I97 A;  2H19 A;  4K5R A;  2H1G A;  2P0G A;  2HZE A;  2GQK A;  4OMV A;  4WBJ A;  4BL7 B;  1N8J A;  5CRE A;  4EVM A;  3EPT A;  4E8E A;  2CA8 A;  3UBK A;  1M2A A;  4EE0 A;  3ZIV A;  2WJU A;  2TIR A;  2VM1 A;  1GNW A;  4LL4 B;  1T3B A;  4PQ1 A;  3TCO A;  5G1L A;  3GH6 A;  1GUH A;  2VL9 A;  1SK1 A;  3BJ5 A;  4K7I A;  2IPA A;  3MWH A;  4Z2U A;  4GSS A;  4KCA A;  4ICY A;  2IME A;  2HFD A;  1CQH A;  3L4N A;  3I9V 2;  1EGR A;  3KMO A;  2LRC A;  1TU8 A;  1K0A A;  5G30 A;  1OYJ A;  4DSS A;  1A0F A;  2FA8 A;  4L8E A;  5E59 A;  3DXB A;  3FYG A;  3GL5 A;  3P90 A;  4KE3 A;  1XXU A;  1ERT A;  4PUF C;  5H5R A;  1PKZ A;  3KGK A;  1NW2 A;  3O3T A;  1Z6M A;  2C80 A;  2VO4 A;  3IC4 A;  4MPG A;  4A5P A;  2ALB A;  1X9W B;  5KN1 A;  3GX0 A;  3LEF A;  4YAP A;  5DAK A;  2GZP A;  4LLR A;  2E2G A;  2N5F A;  4G0I A;  3R3E A;  5COH A;  2L5O A;  1SL2 B;  3ZVJ A;  3GH9 A;  5AIX A;  5GZZ B;  3QPM A;  2R6K A;  20GS A;  4BVY B;  4IP1 A;  2X8H A;  3F4R A;  2E2M A;  2YP6 A;  4YQM A;  5DDL A;  4ZBA A;  2GQM A;  2JSZ A;  4LL1 B;  3ZVJ D;  2WZ9 A;  2YWN A;  3M3M A;  5EPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...