2TRCP

Phosducin/transducin beta-gamma complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
EGQATHTGPKGVINDWRKFKLESEDGDSIPPSKKEILRQMSSPQSRDDKDSKERMSRKMSIQEYELIHQDKEDEGCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGEQFLETIEKEQKVTTIVVNIYEDGVRGCDALNSSLECLAAEYPMVKFCKIRASNTGAGDRFSSDVLPTLLVYKGGELISNFISVAEQFAEDFFAADVESFLNEYGLLPER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSDUCIN
publication title Crystal structure at 2.4 angstroms resolution of the complex of transducin betagamma and its regulator, phosducin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Complex (transducer/transduction)
total genus 49
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1997-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.168.10 Mainly Alpha Orthogonal Bundle Phosducin; domain 2 Phosducin, domain 2 2trcP02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2trcP01
4I2TA 2H75A 5CRHA 1O8WA 1WJKA 5H5QA 1RQMA 3FEUA 1C72A 3TJFA 4MZCA 5DJLA 3ED3A 1UA5A 2V1MA 1R5PA 2JACA 1HNCA 1EOHA 1ZGNA 4HJMA 5GZZB 4IW9A 2I81A 2MMOA 1G7EA 11GSA 1T7PB 1FHEA 4N30A 2C0GA 5IPHA 4KX4A 1OE8A 2AB6A 4IKHA 2IWTA 3APQA 4FYCA 2B7KA 5ECQB 2KOKA 1B4PA 3BJ5A 1GL8A 4MK3A 1S3AA 1R5AA 4KGIA 4D73B 4FIWA 1XXUA 2LTKA 8GSSA 4KW6A 1ABAA 4XIHA 3EC3A 1TRVA 1XWCA 3TJKA 4MJAA 3TRXA 3IV4A 1Z7RA 1JFUA 1QK8A 5A4WA 3TKSC 2RM5A 1PL2A 1ZZYA 3L4NA 3TKSE 2F9SA 2Z9SA 4KCAA 1I5GA 2WGRA 5H5RA 1SK2A 2E7PA 3D5JA 4HEA2 1PD21 5EPFA 4XHMA 3ZZXA 1B9YC 1A0FA 4MCUA 4NAXA 3L9VA 4YAVA 1B8XA 2RLIA 1YZXA 3PGTA 2H66A 2GT5A 3FZ4A 3TKPA 3EWLA 1NHOA 4NHWA 1EEJA 4Q5NA 1Y6EA 2DBCA 1O8XA 2MBTA 3UIWA 2I3YA 2B5EA 2FGXA 5J9BA 1ERVA 1TXXA 3MWHA 4N10A 5D8IA 5B6MA 3EVIA 3WT2A 1OC3A 3APOA 3EU4A 5COHA 1JZOA 2CA8A 3GTUB 4GXZA 2YJ7A 4OFMA 4FO5A 1TJDA 5ECOB 3WGXA 3C1RA 1GSYA 4V2NA 4ECJA 2GSTA 2X8GA 2OKAA 3PH9A 2GQMA 3HVSA 2MMAA 4MPFA 1H75A 3C7MA 3IAM2 2R3XA 3DIEA 4YAPA 2BJXA 3GIXA 2GVPA 4LMWA 4YQUA 5CREA 2IMDA 4EF0A 4IN0A 4PGTA 5KN2A 3IRAA 5IIZA 2GZYA 3FZ9A 2A2SA 2AUVA 5G5EA 5LCZA 4HUAA 2V32A 5CO3A 1VF4A 3R2QA 1TDIA 3KD0A 3FW2A 4KDYA 1GSEA 2HXKA 5B6NA 3WGEA 3F4RA 4K7OA 2WULA 5ECNB 2I9HA 3GL3A 3F6DA 2DJ3A 6GSXA 3ZREA 4K0NA 1JLVA 3G9BA 3FKFA 2O7KA 2LSTA 1LBKA 4K7NA 3IA1A 2LUSA 3UVTA 3HD5A 1U6TA 3TCOA 4TRXA 5ELGA 1I9DA 2GSQA 2PPTA 1G6WA 3UBKA 3M8NA 1URMA 4EO3A 2IPAA 5JCUA 3DMLA 4I97A 3H8QA 3BCKA 3US3A 4HS1A 4ZBBA 2PU9C 1XIYA 2FWFA 2B3SA 2E2MA 2HFDA 3UMAA 3S9FA 2H6ZA 2DJKA 2AYTA 3IE3A 1GLPA 2EC4A 2PMTA 1JZRA 1R4WA 5HFGA 2XC2A 9GSSA 3EURA 3GH9A 3RAZA 2GGTA 2NDOA 2LRNA 2YV7A 6GSUA 5INYA 2CVDA 3I6AA 3GMFA 4XS6A 4I5QA 4MJEA 4IGJA 2DJ0A 3M0FA 4F9ZA 4F0CA 1PA3A 4DSSA 1E2YA 4QL9A 1A2JA 1TK8B 2HRFA 2C80A 4ZL7A 4KA0A 4MZBA 1G7OA 4PX1A 1XW6A 1WP0A 4DVCA 1PN9A 3TJBA 1PGTA 2L5OA 4AGSA 1ACVA 1GTIA 3QCPA 2WS2A 4GWRA 1GP1A 4HZ2A 3HYPA 4JR4A 1TKDB 3WT1A 3BCIA 2DLXA 1AQVA 2O89A 1ZMAA 2L5LA 3E9JB 1SENA 4KSOA 1PMTA 3PINA 4TXVA 3TDGA 1UC7A 1MDJA 2YNXA 3MNGA 2R37A 2O87A 3HXSA 2OE1A 3F0IA 1M9BA 2RUFA 5CNWA 2CX3A 3KXOA 4NWYA 1IYHA 3UAPA 5G2ZA 1XVQA 3KTBA 2CT6A 2B7JA 2YCDA 3ZIVA 5JWRB 2L4CA 5D93A 3CRTA 3CTGA 5IMCA 1KNGA 3QAGA 2ON5A 2ZNMA 1T4YA 3KGKA 22GSA 2JSZA 2DC5A 2IN3A 5HQPA 3ISOA 2VD1A 5IO2A 3OR5A 1Z9HA 4KB3A 1W4VA 2MMNA 2EIQA 5GSSA 1CQGA 3F63A 2R4VA 5GAND 5D9TA 3TOUA 1W89A 1BAYA 4PUAA 3KMOA 4ULXA 1M2BA 1J9BA 3VURA 1E6BA 1SD8A 4OFNA 4TW5A 5ECKB 2IMIA 3DD3A 1GSSA 3LWAA 4OO4A 5HR2A 3F3QA 3K8NA 4J56E 3FYGA 3KIJA 4NV2A 1SKRB 2VIMA 4WR4A 4J2FA 1HD2A 1G6YA 2CV4A 3DKSA 3Q18A 3VWUA 3EMPA 4TXOB 3FY7A 2C3NA 4V1Ag 3ZITA 1M99A 2L57A 2TRXA 3LGCA 2GS3A 4BWSA 1V98A 3TB2A 1M7TA 3D21A 4F82A 2N5BA 4ZB9A 1M2AA 4ZL8A 5D9XA 1SL1B 3VK9A 2B5YA 5ECSA 3AY8A 2XBIA 4JR6A 4N11A 3TUEA 2EIOA 3ERWA 5G1LA 3J7Yb 1U3AA 3DGQA 1BEDA 1CQHA 3UJ1A 3E0UA 1GRXA 2L59A 4QL7A 3FZAA 3VWVA 3HZ8A 3ERGA 2KLXA 3KEBA 3V1WA 1V40A 3EE2A 1F9MA 4RUVA 2CAIA 4GF0A 4TR0A 1H4OA 2WRTA 3QAWA 1AXDA 3H93A 1MDIA 1XWAA 3GKNA 2X8HA 2GSSA 4ML6A 4G19A 3FR9A 2LKUA 3O76A 2FA4A 1M9AA 1OKDA 4POLA 12GSA 1YQ1A 4IQ1A 4WF4A 4MZWA 4TN8A 5ECLB 4OWYA 3KP9A 3IAS2 4Q5RA 3GA4A 2H6YA 2YN1A 3P2AA 4EVMA 5E4WA 5CRGA 4F03A 3MDKA 4IBPA 4N0VA 1K3YA 3KTLA 4O32A 4I6XA 4MPGA 3QPMA 5DQYA 2YWIA 4X0XA 1SJZA 3ZL5A 3IPZA 3ME8A 4MF6A 1EEMA 2B1LA 3LXZA 1OAZA 6GSSA 1A23A 1GWCA 2R2JA 4YH2A 4V2MA 2NPBA 2VCQA 4NHZA 2OACA 3NOFA 2KP2A 4JRRA 1T4ZA 2DMLA 1ZL9A 3PR8A 3LYKA 3RHCA 1NHYA 2LNSA 1J0FA 3FR3A 4QQ7A 3HA9A 2HSHA 5AIXA 4TKYA 2WZ9A 4BVXA 4BA7A 1U87A 1A8YA 3EMXA 3SWLA 3GX8A 6GSTA 5EL8A 5IOWA 1GUMA 4WXTA 1FOVA 13GSA 1GTBA 3GYKA 3APSA 3WGDA 1THXA 2VL3A 4PNFA 4MMMA 1JHBA 3LSZA 4NXIA 5H5SA 2RM6A 1WPIA 2V41A 3GNJA 4XCSA 2MBSA 4MJCA 1KEBA 3UL3A 4WR5A 4NV5A 2VCWA 2I1UA 3F6FA 2DSAA 5A4VA 5CRDA 3Q6OA 1FB6A 5GSTA 2EIRA 2C3QA 1X5EA 2IMKA 2ES7A 1X5DA 2QSIA 2P0GA 5DJMA 2JADA 3D22A 3KP8A 3L9UA 3LYPA 3VWWA 2IMEA 1M0UA 3HVVA 4PUFC 2VUPA 3GX0A 20GSA 4EDYA 2ZUPA 1QGVA 4EXJA 3GUSA 1U88A 3MSZA 2V2GA 2V6OA 4TXOA 1FB0A 1O7UA 3A2XA 4GSNA 3C8EA 2C0DA 5JWOB 2PERA 4OD7A 1VF1A 3IOSA 5J3RA 4HJ2A 1OC9B 4MH3A 2FLSA 1K0NA 4I2UA 4ZILA 3KM6A 6GSYA 3IHQA 1T00A 2HT9A 3FR6A 3LORA 4GTUA 3GV1A 3C73A 3WYWA 1Q98A 1SKSB 2B5XA 3D4TA 4EC0A 1SD9A 4MDCA 1T1VA 4ECIA 3SBCA 5DCGA 3IDVA 1AUCA 2OBIA 4X1UA 4FH8A 5F8BA 3I43A 5B8BA 5C00A 3M3MA 5ID2B 1NW2A 2GLRA 1TOFA 3ZFLA 5ENUA 5CAXA 1GSFA 2PBJA 5DALB 4L5LA 3W8SA 2D2ZA 1VF3A 3VFIA 5G5FA 1NM3A 1TTZA 4EUYA 3TGZA 1X9MB 1XPVA 3VPQA 1EV4A 3UVHA 2FY6A 1WE0A 4KDXA 4ISDA 3FZ5A 3GKMA 2VM1A 4IJ3A 2JZRA 3CSJA 2MYGA 3VWXA 5CP1A 5DVBA 1GULA 1R26A 3U5RE 1FVKA 1GNWA 4O7HA 5AIVA 3O6TA 4KDUA 3DYRA 4ECCA 1YJ6A 1WIKA 4MJBA 1TRUA 2I4AA 2QGVA 3W8JA 2KP1A 3FK8A 4OCFA 1AQXA 4JBBA 4L0UA 1V57A 3DXBA 2H0HA 3D6IA 3TKRA 3DRNA 2VL9A 3GH6A 2H19A 1OVNA 3GKKA 2YWMA 4ECBA 4ZB6A 2DJJA 4BWQA 4ZL9A 4CW9A 5ECPB 4F2IA 1ERUA 2HYXA 3EYTA 1TI1A 1Z6MA 1DSBA 4LL4B 3QFAC 4WBRD 4HQZA 4D73A 3RHBA 2KHPA 3A3TA 2BMXA 2H76A 2A2RA 4XRDA 3BD2A 1GTUA 2JSYA 3ZFBA 1G0TA 1XWKA 3A5WA 4HZ4A 1RK4A 1SYRA 3IK7A 2FA8A 1BG5A 2FWGA 2HZEB 19GSA 2L6CA 2LJRA 2MMZA 2IL3A 3N5OA 2X99A 2O85A 4L0WA 2P5RA 2H74A 1YKCA 1VGLA 5J5NA 2H1GA 3U6VA 1K0OA 4KH7A 2GQKA 17GSA 4K1FA 2ALBA 3DEXA 2LEGA 1SU9A 4FYUA 2H30A 4YQVA 1USBA 2PVQA 4XRAA 4OCEA 2GQLA 2YZHA 3ZTLA 2ON7A 3KZQA 1SJIA 1V9WA 4TR1B 2VO4A 2V6KA 2J23A 1TP9A 3A2VA 1GTAA 5AN1A 3IBHA 2IFQB 1EV9A 5D9WA 1VRSD 4RQXA 2CVBA 3J7Yk 2YOIA 4L8EA 3LQ7A 3GTUA 1OC9A 2OBKA 3P90A 4IQAA 5J4UA 5KN0A 2H6XA 5IMVA 4HOJA 2M72A 3ZVJD 3H4KA 1GH2A 3QDNA 4TOPA 3VI5A 1F3AA 5AISA 4K0GA 3HY2A 3D0ZA 2B6MA 3RBTA 4GLTA 1GUHA 3RPPA 4ML1A 2C0EA 3JCML 1ZYEA 4RQRA 4RI6A 4Z7XA 2NBSA 4MLYA 1F37A 3HVXA 2QC7A 4DEJA 4GQFA 4LL1B 2VM2A 4WETA 5JCWA 4X43A 5IMZA 2R5GA 1AAZA 1JZDA 3TJJA 3RDWA 4MP4A 1VF2A 4PXOA 4LMVA 5E59A 2LJKA 2CVKA 1T8EB 3GKXA 2DJ2A 3ZMLA 2TRCP 4PURA 5DCHA 4MH2A 4POKA 3HJMA 4HI7A 3VLNA 2VL2A 2YZUA 4J57E 1F2EA 2K6VA 4ACSA 4K9ZA 1AIUA 1Z6NA 3F4SA 4ZBDA 1QMVA 4IJIA 1EP8A 5KN1A 1TU7A 4FYBA 4IVFA 2C1YA 3F4TA 3GL5A 2JZTA 4WBJA 4ZIJA 1XVWA 1FAAA 3O3TA 4TR4A 5EY6A 1FVJA 2PWJA 4GQCA 6GSVA 2YWOA 4IELA 3FRCA 4E8HA 3ZLPA 5HR3A 1QFNA 1K0CA 3HJPA 1N2AA 1Y25A 2X8CA 3WD6A 3E3EA 5G1KA 5IO0A 2C0FA 1KTEA 4IP1A 4BPYA 3IR4A 1LJRA 3ME7A 3D4MA 1YKAA 3TRQA 3L9SA 1HYUA 4NMUA 2H01A 3RPNA 4BVYA 5CYYA 4AJ6A 3F9UA 1ERTA 2R6KA 1N8JA 1XOBA 2DJ1A 2FCHA 5ECRB 3F3RA 3M1GA 2VAFA 1SL2B 2G0FA 2LQOA 4O5RA 1XW9A 1AW9A 2K8SA 2O8VB 2KUCA 1BX9A 1PQNA 1WRYA 5F07A 1T3BA 3MAKA 2GZPA 1DUGA 4JE1A 4GSTA 2IJYA 5LD0A 1UN2A 4G2EA 2GTUA 1IYIA 2GZZA 3HJOA 4KCEA 1O81A 4TVEA 3GSSA 4EDZA 5ECMB 5IMAA 4TR1A 1EGRA 1X5CA 2CZ3A 4JU5A 1RW1A 14GSA 2IFQA 1ON4A 5IPGA 2XPEA 2WCIA 3A2WA 1HQOA 5A4UA 4DSRA 2LRCA 4EE0A 4E8EA 3M9JA 4DSSB 2YANA 1SYXA 1GNEA 2HSYA 1B4QA 3C71A 3UEMA 1XW5A 3Q74A 2WDUA 2LRTA 1MDKA 2GDRA 1THOA 3P7XA 4AJ7A 4BL7A 3KH7A 2HI7A 2FUG2 1EWXA 3KCMA 5D9VA 1QUWA 3GSTA 1TW9A 3ZMKA 3BOAA 4JEDA 1YF0A 2YJHA 1K0BA 2L6DA 2K18A 5FT3A 1EP7A 1XOAA 3LG6A 1B48A 4YQMA 5G30A 3LJRA 5LNKe 3BBYA 5IMDA 1EZKA 2OJLA 1YDKA 2C8UA 3ZVJA 1OYJA 3UBLA 2LNTA 2MZCA 1YEXA 4ID0A 1TI3A 3CRUA 1Z5YE 2OA7A 2JU5A 2H1BA 4MF7A 2J9HA 2JL4A 5DDLA 1Z7PA 3L78A 2G2QA 1MD4A 2HZFA 2H72A 2NTOA 3GRXA 5B7CA 1O85A 1WWJA 3GFKA 1K3OA 2RIIA 4K8MA 1A2LA 3HZ4A 2H73A 4CDOA 1GLQA 5EVOA 2RUEA 1X9SB 2VLTA 1PKWA 1MEKA 2VCVA 4KNDA 4CHSA 1OKTA 4WF5A 3TKSA 1X0RA 3CSHA 2LS5A 3QFBC 4IHUA 3QAVA 4K6XA 1DBYA 4ILFA 1SL0B 5DQSA 1SJ6A 2BTOT 3LFLA 3ZYWA 5ABRA 2H0GA 3IC4A 2REMA 1GSQA 1ILOA 4Q5FA 1PL1A 5HR1A 2YPMA 2AV4A 3TKQA 3UARA 2VOCA 1NSWA 5KEJA 4PNGA 4IP6A 3CXGA 2CZ2A 3DWVA 3KH9A 3LXTA 2X64A 4ZBAA 2XHFA 3TOTA 2CAQA 1S3DA 1Z3EA 2H70A 2YP6A 2C4JA 3Q19A 2VCZA 3TRPA 5ECHB 5ELAA 1A0RP 1TK5B 1EOGA 3DVXA 3I69A 3P8WA 2PUKC 2VCTA 2VLVA 4K7IA 4I8BA 5J41A 4PQHA 4PQ1A 4F0BA 4V2LA 1KBNA 2E0QA 4WEYA 2AHEA 1A8LA 4HU7A 5JCGA 3H1NA 2FNOA 2VCXA 4G9HA 1ML6A 1SKWB 5F06A 3QOUA 7GSSA 1PSQA 1BYEA 4DSQA 1SK0A 2OE3A 2LJAA 1BJXA 2LQQA 2OE0A 5IQYA 4POMA 4HDEA 3EINA 1LU4A 2DIYA 4OMVA 5GAPD 1TRSA 1FW1A 18GSA 3HCZA 2YWNA 2WFCA 1UVZA 4XS1A 1F6MC 3HHVA 4XTSA 1XWBA 4GSSA 1YY7A 4AF2A 5IOXA 1DE2A 2NVLA 5CRWA 5D96A 2LV3A 2FWHA 4LLRA 2HRNA 2FWEA 1GSDA 4ZB8A 2N5FA 1ERWA 3GN3A 2DIZA 3KMNA 2F3MA 2ZCTA 5DAKB 1U3IA 1FO5A 1AC1A 4XS4B 3VI7A 4MABA 5A5KA 1ZOFA 4KE3A 5F05A 5C04A 4N0ZA 2F8AA 3KJYA 3TJGA 4HU9A 1OC8A 1K0MA 2F51A 2XBQA 1PX6A 3N9JA 4LA1A 6GSWA 1TRWA 3QR6A 3VPTA 4O92A 2L4QA 4MF5A 2P5QA 5ECIB 2IIYA 1EGOA 2HNLA 1J08A 10GSA 16GSA 2JZSA 2HLSA 4KSMA 1GUKA 1V58A 2H1DA 4L5OA 2H71A 4OFTA 1A24A 2WB9A 3W6GA 2CX4A 4Q5QA 1GSUA 2K9FA 4PQIA 4OO5A 4TR3A 2CQ9A 3CSIA 1QXHA 5KN3A 5D73A 2GT6A 3EU3A 1AQWA 1K0AA 4P3YB 1SK1A 3UOMA 1BQ7A 5B8AA 2VL2C 1V2AA 2XPDA 4H86A 1PX7A 5DBQA 5L71A 5G31A 4GRFA 1PRXA 1O6JA 2E2GA 5HR0A 2H1AA 3CYNA 1JLWA 4WKWA 3L0HA 1K3LA 3HDCA 2IMFA 3ERFA 4JZQA 2HE3A 5ID2A 1XFLA 2WJUA 2DMMA 1HNBA 5IM9A 5FWGA 3GURA 2FD3A 2TIRA 1WOUA 2F8FA 4MA9A 2M46A 3QD9A 1R7HA 2VLUA 5DALA 2OADA 1XCCA 1HNAA 2P31A 1ZYQB 3H79A 4POBA 3HKRA 3ZIJA 3C1SA 1MTCA 1TU8A 4NPBA 1X9WB 3G7IA 3GHAA 1TK0B 3G7YA 1DE1A 5JWQB 4ZXGA 1MD3A 4V1Ap 4K2DA 4AJ8A 4KAEA 5HFKA 1Q4JA 1JZWA 2C3TA 3NZNA 4EKZA 1M2DA 3IXRA 2QKEA 5HFIA 2VD0A 1WMJA 1OE7A 4GCIA 5J9CA 4EL1A 3M9KA 3FHKA 1A2MA 3DVWA 3NIVA 2GSRA 1K0DA 3G7JA 1XBSA 3ZRDA 3CBUA 4IS0A 2AJQB 3CTFA 5F0GA 2N5AA 2K8VA 1ST9A 3LEFA 3IK9A 4G10A 1F3BA 1XWGA 1XZOA 2PN8A 2AAWA 1O73A 5IMFA 1QQ2A 2H8LA 1YF1A 4RI7A 2PVOC 2A4VA 2YV9A 4HQSA 3QMXA 2FHEA 1ZCPA 3F8UA 1B9XC 1S3CA 1PKZA 2HZEA 2M80A 2H0IA 2PGTA 5FHIA 1YEPA 5DAKA 1FG4A 4KUNA 3CMIA 2B1KA 4XS4A 5AGYA 3I9V2
chains in the Genus database with same CATH superfamily
4I2TA 2H75A 5CRHA 1O8WA 1WJKA 5H5QA 1RQMA 3FEUA 1C72A 3TJFA 4MZCA 5DJLA 3ED3A 1UA5A 2V1MA 1R5PA 2JACA 1HNCA 1EOHA 1ZGNA 5KOWA 4HJMA 5GZZB 4IW9A 2I81A 2MMOA 1G7EA 11GSA 1T7PB 1FHEA 4N30A 2C0GA 5IPHA 4KX4A 1OE8A 2AB6A 4IKHA 2IWTA 3APQA 4FYCA 2B7KA 5ECQB 2KOKA 4HSCX 1B4PA 3BJ5A 1GL8A 4MK3A 1S3AA 1R5AA 4KGIA 4D73B 4FIWA 1XXUA 3R3EA 2LTKA 4BIKA 8GSSA 4K5RA 4KW6A 1ABAA 4XIHA 3EC3A 1TRVA 1XWCA 3TJKA 4MJAA 3TRXA 3IV4A 1Z7RA 1JFUA 1QK8A 5A4WA 3TKSC 2RM5A 1PL2A 1ZZYA 3L4NA 3TKSE 4EIPA 2F9SA 2Z9SA 4KCAA 1I5GA 2WGRA 5H5RA 1SK2A 2E7PA 3D5JA 4HEA2 1PD21 5EPFA 4XHMA 3ZZXA 1B9YC 1A0FA 4MCUA 2QA1A 4NAXA 3L9VA 4YAVA 1B8XA 2RLIA 1YZXA 3PGTA 3A5IA 2H66A 2GT5A 3FZ4A 4FQUA 3TKPA 3EWLA 1NHOA 4NHWA 1EEJA 4Q5NA 1Y6EA 2DBCA 1O8XA 2MBTA 3UIWA 2I3YA 2B5EA 2FGXA 5J9BA 1ERVA 1TXXA 3MWHA 4N10A 5D8IA 5B6MA 3EVIA 3WT2A 1OC3A 3APOA 3EU4A 5COHA 1JZOA 2CA8A 3GTUB 4GXZA 2YJ7A 4OFMA 4FO5A 1TJDA 5ECOB 3WGXA 3C1RA 1GSYA 4V2NA 4ECJA 2GSTA 2X8GA 2OKAA 3PH9A 2GQMA 3HVSA 2MMAA 4MPFA 1H75A 3C7MA 3IAM2 2R3XA 3DIEA 4YAPA 2BJXA 3GIXA 2GVPA 4LMWA 4YQUA 5CREA 2IMDA 5BMUA 4EF0A 4IN0A 4PGTA 5KN2A 2X49A 3IRAA 5IIZA 2GZYA 3FZ9A 2A2SA 2AUVA 5G5EA 5LCZA 4HUAA 2V32A 5CO3A 1VF4A 3R2QA 1TDIA 3KD0A 3FW2A 4KDYA 1GSEA 2HXKA 5B6NA 3WGEA 3F4RA 4K7OA 2WULA 5ECNB 2I9HA 3GL3A 3F6DA 2DJ3A 6GSXA 3ZREA 4K0NA 1JLVA 3G9BA 3FKFA 2O7KA 2LSTA 1LBKA 4Z2RA 4K7NA 3IA1A 2LUSA 3UVTA 3HD5A 1U6TA 3TCOA 4TRXA 5ELGA 1I9DA 2GSQA 2PPTA 4X4JA 1G6WA 3UBKA 3M8NA 1URMA 4EO3A 2IPAA 5JCUA 3DMLA 4I97A 2UZ8A 3H8QA 3BCKA 3US3A 4HS1A 4ZBBA 2PU9C 1XIYA 2FWFA 2B3SA 2E2MA 2HFDA 3UMAA 3S9FA 2H6ZA 2DJKA 2AYTA 3IE3A 1GLPA 2EC4A 2PMTA 1JZRA 1R4WA 5HFGA 2XC2A 9GSSA 3EURA 3GH9A 3RAZA 2GGTA 2NDOA 2LRNA 2YV7A 6GSUA 5INYA 2CVDA 3I6AA 3GMFA 4XS6A 4I5QA 4MJEA 4IGJA 1S3RA 2DJ0A 3M0FA 4F9ZA 4F0CA 1PA3A 4DSSA 1E2YA 4QL9A 1A2JA 1TK8B 2HRFA 2C80A 4ZL7A 4KA0A 4MZBA 1G7OA 4PX1A 1XW6A 1WP0A 4DVCA 1PN9A 3TJBA 1PGTA 2L5OA 4AGSA 1ACVA 1GTIA 3QCPA 2WS2A 4BVYB 4GWRA 1GP1A 4HZ2A 3HYPA 4JR4A 1TKDB 3WT1A 3BCIA 2DLXA 1AQVA 2O89A 1ZMAA 2L5LA 3E9JB 1SENA 4KSOA 1PMTA 3PINA 4TXVA 3TDGA 1UC7A 1MDJA 2YNXA 3MNGA 2R37A 2O87A 3HXSA 2OE1A 3F0IA 1M9BA 2RUFA 5CNWA 2CX3A 3KXOA 4NWYA 1IYHA 3UAPA 5G2ZA 1XVQA 3KTBA 2CT6A 2B7JA 2YCDA 3ZIVA 5JWRB 2L4CA 5D93A 3CRTA 3CTGA 5IMCA 1KNGA 3QAGA 2ON5A 2ZNMA 1T4YA 3KGKA 22GSA 2JSZA 2DC5A 2IN3A 5HQPA 3ISOA 2VD1A 5IO2A 3OR5A 1Z9HA 4KB3A 1W4VA 2MMNA 2EIQA 4BL7B 2X4AA 5GSSA 1CQGA 3F63A 2R4VA 5GAND 5D9TA 3TOUA 1W89A 1BAYA 4PUAA 3KMOA 4ULXA 1M2BA 1J9BA 3VURA 1E6BA 1SD8A 2R0PA 4OFNA 4TW5A 5ECKB 2IMIA 3DD3A 1GSSA 3LWAA 4OO4A 5HR2A 3F3QA 4YKGA 3K8NA 4EIQA 4J56E 3FYGA 3KIJA 4NV2A 1SKRB 2VIMA 4WR4A 4J2FA 1HD2A 1G6YA 2CV4A 3DKSA 3Q18A 3VWUA 3EMPA 4TXOB 3FY7A 2C3NA 4V1Ag 3ZITA 1M99A 2L57A 2TRXA 3LGCA 2GS3A 4BWSA 1V98A 3TB2A 1M7TA 3D21A 4F82A 2N5BA 4ZB9A 1M2AA 4ZL8A 5D9XA 1SL1B 3VK9A 2B5YA 5ECSA 3AY8A 2XBIA 4JR6A 4N11A 3TUEA 2EIOA 3ERWA 5G1LA 3J7Yb 1U3AA 3DGQA 1BEDA 1CQHA 3UJ1A 3E0UA 1GRXA 2L59A 4QL7A 3FZAA 3VWVA 3HZ8A 5LL6V 3ERGA 2KLXA 3KEBA 3V1WA 1V40A 3EE2A 1F9MA 4RUVA 2CAIA 4GF0A 4TR0A 1H4OA 2WRTA 3QAWA 1AXDA 3H93A 1MDIA 1XWAA 3GKNA 2X8HA 2GSSA 4ML6A 4G19A 3FR9A 2LKUA 3O76A 2FA4A 1M9AA 1OKDA 4POLA 12GSA 1YQ1A 4IQ1A 4WF4A 4MZWA 4TN8A 5ECLB 4OWYA 3KP9A 3IAS2 4Q5RA 3GA4A 2H6YA 2YN1A 3P2AA 4EVMA 5E4WA 5CRGA 4F03A 3MDKA 4IBPA 4N0VA 1K3YA 3KTLA 4O32A 4I6XA 4MPGA 3QPMA 4A5PA 5DQYA 2YWIA 4X0XA 1SJZA 3ZL5A 3IPZA 3ME8A 4MF6A 1EEMA 2B1LA 3LXZA 1OAZA 3EPTA 6GSSA 1A23A 1GWCA 2R2JA 4YH2A 4V2MA 2NPBA 2VCQA 1ZYPA 4NHZA 2OACA 3NOFA 2KP2A 4JRRA 1T4ZA 4CY8A 2DMLA 1ZL9A 3PR8A 3LYKA 3RHCA 1NHYA 2LNSA 1J0FA 3FR3A 4QQ7A 3FMWA 3HA9A 2HSHA 5AIXA 4CY6A 4TKYA 2WZ9A 3LW9A 4BVXA 4BA7A 1U87A 1A8YA 3EMXA 3SWLA 3GX8A 6GSTA 5EL8A 5IOWA 1GUMA 4WXTA 1FOVA 13GSA 1GTBA 3GYKA 3APSA 3WGDA 1THXA 4O5UA 2VL3A 4PNFA 4MMMA 1JHBA 3LSZA 4NXIA 5H5SA 2RM6A 1WPIA 2V41A 3GNJA 4XCSA 2MBSA 4MJCA 1KEBA 3UL3A 4WR5A 4NV5A 5BRTA 2VCWA 2I1UA 3F6FA 2DSAA 5A4VA 5CRDA 3Q6OA 1FB6A 5GSTA 2EIRA 2C3QA 1X5EA 2IMKA 2ES7A 1X5DA 2QSIA 3IHGA 2P0GA 5DJMA 2JADA 3D22A 3KP8A 3L9UA 3LYPA 3VWWA 2IMEA 1M0UA 3HVVA 4PUFC 2VUPA 3GX0A 20GSA 4EDYA 2ZUPA 1QGVA 4EXJA 3GUSA 1U88A 3MSZA 2V2GA 2V6OA 4TXOA 1FB0A 1O7UA 3A2XA 4GSNA 3C8EA 2C0DA 5JWOB 2PERA 4OD7A 1VF1A 3IOSA 5J3RA 4HJ2A 1OC9B 4MH3A 2FLSA 1K0NA 4I2UA 4ZILA 3KM6A 6GSYA 3IHQA 1T00A 2HT9A 3FR6A 3LORA 4GTUA 1M3JA 3GV1A 2QA2A 3C73A 3WYWA 1Q98A 1SKSB 2B5XA 3D4TA 4EC0A 4MNNA 1SD9A 4MDCA 1T1VA 4ECIA 3SBCA 5DCGA 3IDVA 1AUCA 2OBIA 4X1UA 4FH8A 5F8BA 3I43A 5B8BA 5C00A 4G0KA 3MIXA 3M3MA 5ID2B 1NW2A 2GLRA 1TOFA 3ZFLA 5ENUA 5CAXA 1GSFA 2PBJA 5DALB 4L5LA 3W8SA 2D2ZA 1VF3A 3VFIA 5G5FA 1NM3A 1TTZA 4EUYA 3TGZA 1X9MB 1XPVA 3VPQA 1EV4A 3UVHA 2FY6A 1WE0A 4KDXA 4ISDA 3FZ5A 3GKMA 2VM1A 4IJ3A 2JZRA 3CSJA 2MYGA 3VWXA 5CP1A 5DVBA 1GULA 1R26A 3U5RE 1FVKA 1GNWA 4O7HA 5AIVA 3O6TA 4KDUA 3DYRA 4ECCA 1YJ6A 1WIKA 4MJBA 1TRUA 2I4AA 2QGVA 3W8JA 2KP1A 3FK8A 4OCFA 1AQXA 4JBBA 4L0UA 1V57A 3DXBA 2H0HA 3D6IA 3TKRA 3DRNA 2VL9A 3GH6A 2H19A 1OVNA 3GKKA 2YWMA 4ECBA 4ZB6A 2DJJA 4BWQA 4ZL9A 4CW9A 5ECPB 4F2IA 1ERUA 2HYXA 3EYTA 1TI1A 1Z6MA 1DSBA 4LL4B 3QFAC 4WBRD 4HQZA 4D73A 3RHBA 2KHPA 3A3TA 2BMXA 4KF9A 2H76A 2A2RA 4XRDA 3BD2A 1GTUA 2JSYA 3ZFBA 1G0TA 1XWKA 3A5WA 4HZ4A 1RK4A 1SYRA 3IK7A 2FA8A 1BG5A 2FWGA 2HZEB 19GSA 2L6CA 2LJRA 2MMZA 2IL3A 3N5OA 2X99A 2O85A 4L0WA 2P5RA 2H74A 1YKCA 1VGLA 5J5NA 2H1GA 3U6VA 1K0OA 4KH7A 2GQKA 17GSA 4K1FA 2ALBA 3IC8A 3DEXA 1ZYNA 2LEGA 1SU9A 4FYUA 2H30A 4YQVA 2R0CA 1USBA 2PVQA 4XRAA 4OCEA 2GQLA 2YZHA 3ZTLA 2ON7A 3KZQA 1SJIA 1V9WA 4TR1B 2VO4A 2V6KA 2J23A 1TP9A 3A2VA 1GTAA 5AN1A 3IBHA 2IFQB 1M3IA 1EV9A 5D9WA 1VRSD 4RQXA 2CVBA 3J7Yk 2YOIA 4L8EA 3LQ7A 3GTUA 1OC9A 2OBKA 3P90A 4IQAA 5J4UA 5KN0A 2H6XA 5IMVA 4HOJA 2M72A 3ZVJD 3H4KA 1GH2A 3QDNA 4TOPA 3CQFA 3VI5A 1F3AA 5AISA 4K0GA 3HY2A 3D0ZA 2B6MA 3RBTA 4GLTA 1GUHA 3RPPA 4ML1A 2C0EA 3JCML 1ZYEA 4RQRA 4RI6A 4Z7XA 2NBSA 4MLYA 1F37A 3HVXA 2QC7A 4DEJA 4GQFA 4LL1B 2VM2A 4WETA 5JCWA 4X43A 5IMZA 2R5GA 1AAZA 1JZDA 3TJJA 3RDWA 4MP4A 1VF2A 4PXOA 3J81I 4LMVA 5E59A 1PN0A 2LJKA 2CVKA 1T8EB 3GKXA 5FLXI 2DJ2A 3ZMLA 2HSMA 2TRCP 4PURA 5DCHA 4MH2A 4POKA 3HJMA 4HI7A 3VLNA 2VL2A 2YZUA 4J57E 1F2EA 5KOXA 2K6VA 4ACSA 4K9ZA 1AIUA 1Z6NA 3F4SA 4ZBDA 1QMVA 4IJIA 1EP8A 5KN1A 1TU7A 4FYBA 4IVFA 2C1YA 3F4TA 3GL5A 2JZTA 4WBJA 4ZIJA 1XVWA 1FAAA 3O3TA 2HRKA 4TR4A 5EY6A 1FVJA 2PWJA 4GQCA 6GSVA 3JAMI 2YWOA 4IELA 3FRCA 4E8HA 3ZLPA 5HR3A 1QFNA 1K0CA 3HJPA 1N2AA 1Y25A 2X8CA 3WD6A 3E3EA 5G1KA 4Z2TA 5IO0A 2C0FA 1PFOA 1KTEA 4IP1A 4BPYA 3IR4A 1LJRA 3ME7A 3D4MA 1FOHA 2R0GA 1YKAA 3TRQA 3L9SA 1HYUA 4NMUA 2H01A 3RPNA 4BVYA 5CYYA 4AJ6A 3F9UA 1ERTA 2R6KA 1N8JA 1XOBA 2DJ1A 2FCHA 5ECRB 3F3RA 3M1GA 2VAFA 1SL2B 2G0FA 2LQOA 4G0LA 4O5RA 1XW9A 1AW9A 2K8SA 2O8VB 2KUCA 1BX9A 1PQNA 1WRYA 5F07A 1T3BA 3MAKA 2GZPA 1DUGA 4JE1A 4GSTA 2IJYA 5LD0A 1UN2A 4G2EA 2GTUA 1IYIA 2GZZA 3HJOA 4KCEA 1O81A 4TVEA 3GSSA 3MYDA 4EDZA 5ECMB 5IMAA 4TR1A 1EGRA 1X5CA 2CZ3A 4JU5A 1RW1A 14GSA 2IFQA 1ON4A 5IPGA 2XPEA 2WCIA 3A2WA 1HQOA 5A4UA 4DSRA 2LRCA 4EE0A 4E8EA 3M9JA 4DSSB 2YANA 1SYXA 1GNEA 2HSYA 1B4QA 3C71A 3UEMA 1XW5A 3Q74A 2WDUA 5A2QI 1MDKA 2GDRA 2LRTA 4K5SA 1THOA 3P7XA 4AJ7A 4BL7A 3KH7A 2HI7A 2FUG2 1EWXA 3KCMA 5D9VA 1QUWA 3GSTA 1TW9A 3ZMKA 3BOAA 4JEDA 1YF0A 2YJHA 1K0BA 2L6DA 2K18A 5FT3A 1EP7A 1XOAA 3LG6A 1B48A 4YQMA 5G30A 3LJRA 5LNKe 3BBYA 5IMDA 1EZKA 2OJLA 1YDKA 2C8UA 3ZVJA 1OYJA 3UBLA 2LNTA 2MZCA 1YEXA 4ID0A 1TI3A 3CRUA 1Z5YE 2OA7A 2JU5A 2H1BA 4MF7A 2J9HA 2JL4A 5DDLA 1Z7PA 3L78A 2G2QA 1MD4A 2HZFA 2H72A 2NTOA 3GRXA 5B7CA 1O85A 1WWJA 3GFKA 1K3OA 2RIIA 4K8MA 1A2LA 3HZ4A 2H73A 4CDOA 1GLQA 5EVOA 2RUEA 1X9SB 2VLTA 1PKWA 1MEKA 2VCVA 4KNDA 4CHSA 1OKTA 4WF5A 3TKSA 1X0RA 3CSHA 2LS5A 3QFBC 4IHUA 3QAVA 4K6XA 1DBYA 4ILFA 1SL0B 5DQSA 1SJ6A 2BTOT 3LFLA 2DKIA 3ZYWA 5ABRA 2H0GA 3IC4A 2REMA 1GSQA 1ILOA 4YKFA 4Q5FA 1PL1A 5HR1A 2YPMA 2AV4A 3TKQA 3UARA 2VOCA 1NSWA 5KEJA 4USSA 4PNGA 4IP6A 3CXGA 2CZ2A 3DWVA 3KH9A 3LXTA 2X64A 4ZBAA 2XHFA 3TOTA 2CAQA 1S3DA 1Z3EA 2H70A 2YP6A 2C4JA 3Q19A 2VCZA 3TRPA 5ECHB 5ELAA 1A0RP 1TK5B 1EOGA 3DVXA 3I69A 3P8WA 2PUKC 2VCTA 2VLVA 4K7IA 4I8BA 5J41A 4PQHA 4PQ1A 4F0BA 4V2LA 1KBNA 2E0QA 4WEYA 2AHEA 1A8LA 4HU7A 5JCGA 3H1NA 2FNOA 2VCXA 4G9HA 1ML6A 1SKWB 5F06A 3QOUA 7GSSA 1PSQA 1BYEA 4DSQA 1SK0A 2OE3A 2LJAA 1BJXA 2LQQA 2OE0A 5IQYA 4POMA 4HDEA 3EINA 1LU4A 2DIYA 4OMVA 5GAPD 1TRSA 1FW1A 18GSA 3HCZA 2YWNA 2WFCA 1UVZA 4XS1A 4K2XA 1F6MC 3HHVA 4XTSA 1XWBA 4GSSA 1YY7A 4AF2A 5IOXA 1DE2A 2NVLA 5CRWA 5D96A 2LV3A 2FWHA 4LLRA 2HRNA 2FWEA 1GSDA 4ZB8A 2N5FA 1ERWA 3GN3A 2DIZA 2A2PA 3KMNA 2F3MA 2ZCTA 5DAKB 1U3IA 2HRAA 1FO5A 1AC1A 4XS4B 3VI7A 4MABA 5A5KA 1ZOFA 4KE3A 5F05A 5C04A 4N0ZA 2F8AA 3KJYA 3TJGA 4HU9A 1OC8A 1K0MA 2F51A 2XBQA 1PX6A 3N9JA 4LA1A 2A4HA 6GSWA 1XG8A 1TRWA 3QR6A 4Z2UA 3VPTA 4O92A 2L4QA 4MF5A 3HVNA 2P5QA 5ECIB 2IIYA 1EGOA 2HNLA 1J08A 10GSA 16GSA 2JZSA 2HLSA 4KSMA 1GUKA 1V58A 2H1DA 4L5OA 2H71A 4OFTA 1A24A 2WB9A 3W6GA 2CX4A 4Q5QA 1GSUA 2K9FA 4PQIA 4OO5A 4TR3A 4ICYA 4BVXB 2CQ9A 3CSIA 1QXHA 5KN3A 5D73A 4G0IA 2GT6A 3EU3A 1AQWA 1K0AA 4P3YB 1SK1A 3UOMA 1BQ7A 5B8AA 2VL2C 1V2AA 2XPDA 4H86A 1PX7A 5DBQA 5L71A 5G31A 4GRFA 1PRXA 1O6JA 2E2GA 5HR0A 2H1AA 3CYNA 1JLWA 4WKWA 3L0HA 1K3LA 3HDCA 2IMFA 3ERFA 4JZQA 2HE3A 5ID2A 1XFLA 2WJUA 2DMMA 1HNBA 5IM9A 5FWGA 3GURA 2FD3A 2TIRA 1WOUA 2F8FA 4MA9A 2M46A 3QD9A 1R7HA 2VLUA 5DALA 2OADA 1XCCA 1HNAA 2P31A 1ZYQB 3H79A 4POBA 3HKRA 3ZIJA 3C1SA 1MTCA 1TU8A 4NPBA 1X9WB 3G7IA 3GHAA 1TK0B 3G7YA 1DE1A 5JWQB 4ZXGA 1MD3A 4V1Ap 4K2DA 4AJ8A 4KAEA 5HFKA 1Q4JA 1JZWA 2C3TA 3NZNA 4EKZA 1M2DA 3IXRA 2QKEA 5IT9I 5HFIA 2VD0A 1WMJA 1OE7A 4GCIA 5J9CA 4EL1A 3M9KA 3FHKA 1A2MA 3DVWA 3NIVA 2GSRA 1K0DA 3G7JA 1XBSA 3ZRDA 3J80I 2DKHA 3CBUA 4IS0A 2AJQB 4O5QA 3CTFA 5F0GA 2N5AA 2K8VA 1ST9A 3LEFA 3IK9A 4G10A 1F3BA 1XWGA 1XZOA 2PN8A 2AAWA 1O73A 5IMFA 1QQ2A 2H8LA 1YF1A 4RI7A 2PVOC 2A4VA 4PTSA 2YV9A 4HQSA 3QMXA 2FHEA 1ZCPA 3F8UA 1B9XC 1S3CA 1PKZA 2HZEA 2M80A 2H0IA 2PGTA 5FHIA 1YEPA 3PPUA 5DAKA 1FG4A 4KUNA 3CMIA 2B1KA 4XS4A 5AGYA 3I9V2
chains in the Genus database with same CATH topology
4I2TA 2H75A 5CRHA 1O8WA 1WJKA 5H5QA 1RQMA 3FEUA 1C72A 3TJFA 4MZCA 5DJLA 3ED3A 1UA5A 2V1MA 1R5PA 2JACA 1HNCA 1EOHA 1ZGNA 5KOWA 4HJMA 5GZZB 4IW9A 2I81A 2MMOA 1G7EA 11GSA 1T7PB 1FHEA 4N30A 2C0GA 5IPHA 4KX4A 1OE8A 2AB6A 4IKHA 2IWTA 3APQA 4FYCA 2B7KA 5ECQB 2KOKA 1B4PA 3BJ5A 1GL8A 4MK3A 1S3AA 1R5AA 4KGIA 4D73B 4FIWA 1XXUA 3R3EA 2LTKA 8GSSA 4K5RA 4KW6A 1ABAA 4XIHA 3EC3A 1TRVA 1XWCA 3TJKA 4MJAA 3TRXA 3IV4A 1Z7RA 1JFUA 1QK8A 5A4WA 3TKSC 2RM5A 1PL2A 1ZZYA 3L4NA 3TKSE 4EIPA 2F9SA 2Z9SA 4KCAA 1I5GA 2WGRA 5H5RA 1SK2A 2E7PA 3D5JA 4HEA2 1PD21 5EPFA 4XHMA 3ZZXA 1B9YC 1A0FA 4MCUA 2QA1A 4NAXA 3L9VA 4YAVA 1B8XA 2RLIA 1YZXA 3PGTA 3A5IA 2H66A 2GT5A 3FZ4A 4FQUA 3TKPA 3EWLA 1NHOA 4NHWA 1EEJA 4Q5NA 1Y6EA 2DBCA 1O8XA 2MBTA 3UIWA 2I3YA 2B5EA 2FGXA 5J9BA 1ERVA 1TXXA 3MWHA 4N10A 5D8IA 5B6MA 3EVIA 3WT2A 1OC3A 3APOA 3EU4A 5COHA 1JZOA 2CA8A 3GTUB 4GXZA 2YJ7A 4OFMA 4FO5A 1TJDA 5ECOB 3WGXA 3C1RA 1GSYA 4V2NA 4ECJA 2GSTA 2X8GA 2OKAA 3PH9A 2GQMA 3HVSA 2MMAA 4MPFA 1H75A 3C7MA 3IAM2 2R3XA 3DIEA 4YAPA 2BJXA 3GIXA 2GVPA 4LMWA 4YQUA 5CREA 2IMDA 5BMUA 4EF0A 4IN0A 4PGTA 5KN2A 2X49A 3IRAA 5IIZA 2GZYA 3FZ9A 2A2SA 2AUVA 5G5EA 5LCZA 4HUAA 2V32A 5CO3A 1VF4A 3R2QA 1TDIA 3KD0A 3FW2A 4KDYA 1GSEA 2HXKA 5B6NA 3WGEA 3F4RA 4K7OA 2WULA 5ECNB 2I9HA 3GL3A 3F6DA 2DJ3A 6GSXA 3ZREA 4K0NA 1JLVA 3G9BA 3FKFA 2O7KA 2LSTA 1LBKA 4Z2RA 4K7NA 3IA1A 2LUSA 3UVTA 3HD5A 1U6TA 3TCOA 4TRXA 5ELGA 1I9DA 2GSQA 2PPTA 4X4JA 1G6WA 3UBKA 3M8NA 1URMA 4EO3A 2IPAA 5JCUA 3DMLA 4I97A 2UZ8A 3H8QA 3BCKA 3US3A 4HS1A 4ZBBA 2PU9C 1XIYA 2FWFA 2B3SA 2E2MA 2HFDA 3UMAA 3S9FA 2H6ZA 2DJKA 2AYTA 3IE3A 1GLPA 2EC4A 2PMTA 1JZRA 1R4WA 5HFGA 2XC2A 9GSSA 3EURA 3GH9A 3RAZA 2GGTA 2NDOA 2LRNA 2YV7A 6GSUA 5INYA 2CVDA 3I6AA 3GMFA 4XS6A 4I5QA 4MJEA 4IGJA 2DJ0A 3M0FA 4F9ZA 4F0CA 1PA3A 4DSSA 1E2YA 4QL9A 1A2JA 1TK8B 2HRFA 2C80A 4ZL7A 4KA0A 4MZBA 1G7OA 4PX1A 1XW6A 1WP0A 4DVCA 1PN9A 3TJBA 1PGTA 2L5OA 4AGSA 1ACVA 1GTIA 3QCPA 2WS2A 4BVYB 4GWRA 1GP1A 4HZ2A 3HYPA 4JR4A 1TKDB 3WT1A 3BCIA 2DLXA 1AQVA 2O89A 1ZMAA 2L5LA 3E9JB 1SENA 4KSOA 1PMTA 3PINA 4TXVA 3TDGA 1UC7A 1MDJA 2YNXA 3MNGA 2R37A 2O87A 3HXSA 2OE1A 3F0IA 1M9BA 2RUFA 5CNWA 2CX3A 3KXOA 4NWYA 1IYHA 3UAPA 5G2ZA 1XVQA 3KTBA 2CT6A 2B7JA 2YCDA 3ZIVA 5JWRB 2L4CA 5D93A 3CRTA 3CTGA 5IMCA 1KNGA 3QAGA 2ON5A 2ZNMA 1T4YA 3KGKA 22GSA 2JSZA 2DC5A 2IN3A 5HQPA 3ISOA 2VD1A 5IO2A 3OR5A 1Z9HA 4KB3A 1W4VA 2MMNA 2EIQA 4BL7B 2X4AA 5GSSA 1CQGA 3F63A 2R4VA 5GAND 5D9TA 3TOUA 1W89A 1BAYA 4PUAA 3KMOA 4ULXA 1M2BA 1J9BA 3VURA 1E6BA 1SD8A 2R0PA 4OFNA 4TW5A 5ECKB 2IMIA 3DD3A 1GSSA 3LWAA 4OO4A 5HR2A 3F3QA 4YKGA 3K8NA 4EIQA 4J56E 3FYGA 3KIJA 4NV2A 1SKRB 2VIMA 4WR4A 4J2FA 1HD2A 1G6YA 2CV4A 3DKSA 3Q18A 3VWUA 3EMPA 4TXOB 3FY7A 2C3NA 4V1Ag 3ZITA 1M99A 2L57A 2TRXA 3LGCA 2GS3A 4BWSA 1V98A 3TB2A 1M7TA 3D21A 4F82A 2N5BA 4ZB9A 1M2AA 4ZL8A 5D9XA 1SL1B 3VK9A 2B5YA 5ECSA 3AY8A 2XBIA 4JR6A 4N11A 3TUEA 2EIOA 3ERWA 5G1LA 3J7Yb 1U3AA 3DGQA 1BEDA 1CQHA 3UJ1A 3E0UA 1GRXA 2L59A 4QL7A 3FZAA 3VWVA 3HZ8A 3ERGA 2KLXA 3KEBA 3V1WA 1V40A 3EE2A 1F9MA 4RUVA 2CAIA 4GF0A 4TR0A 1H4OA 2WRTA 3QAWA 1AXDA 3H93A 1MDIA 1XWAA 3GKNA 2X8HA 2GSSA 4ML6A 4G19A 3FR9A 2LKUA 3O76A 2FA4A 1M9AA 1OKDA 4POLA 12GSA 1YQ1A 4IQ1A 4WF4A 4MZWA 4TN8A 5ECLB 4OWYA 3KP9A 3IAS2 4Q5RA 3GA4A 2H6YA 2YN1A 3P2AA 4EVMA 5E4WA 5CRGA 4F03A 3MDKA 4IBPA 4N0VA 1K3YA 3KTLA 4O32A 4I6XA 4MPGA 3QPMA 4A5PA 5DQYA 2YWIA 4X0XA 1SJZA 3ZL5A 3IPZA 3ME8A 4MF6A 1EEMA 2B1LA 3LXZA 1OAZA 3EPTA 6GSSA 1A23A 1GWCA 2R2JA 4YH2A 4V2MA 2NPBA 2VCQA 1ZYPA 4NHZA 2OACA 3NOFA 2KP2A 4JRRA 1T4ZA 4CY8A 2DMLA 1ZL9A 3PR8A 3LYKA 3RHCA 1NHYA 2LNSA 1J0FA 3FR3A 4QQ7A 3FMWA 3HA9A 2HSHA 5AIXA 4CY6A 4TKYA 2WZ9A 3LW9A 4BVXA 4BA7A 1U87A 1A8YA 3EMXA 3SWLA 3GX8A 6GSTA 5EL8A 5IOWA 1GUMA 4WXTA 1FOVA 13GSA 1GTBA 3GYKA 3APSA 3WGDA 1THXA 4O5UA 2VL3A 4PNFA 4MMMA 1JHBA 3LSZA 4NXIA 5H5SA 2RM6A 1WPIA 2V41A 3GNJA 4XCSA 2MBSA 4MJCA 1KEBA 3UL3A 4WR5A 4NV5A 5BRTA 2VCWA 2I1UA 3F6FA 2DSAA 5A4VA 5CRDA 3Q6OA 1FB6A 5GSTA 2EIRA 2C3QA 1X5EA 2IMKA 2ES7A 1X5DA 2QSIA 3IHGA 2P0GA 5DJMA 2JADA 3D22A 3KP8A 3L9UA 3LYPA 3VWWA 2IMEA 1M0UA 3HVVA 4PUFC 2VUPA 3GX0A 20GSA 4EDYA 2ZUPA 1QGVA 4EXJA 3GUSA 1U88A 3MSZA 2V2GA 2V6OA 4TXOA 1FB0A 1O7UA 3A2XA 4GSNA 3C8EA 2C0DA 5JWOB 2PERA 4OD7A 1VF1A 3IOSA 5J3RA 4HJ2A 1OC9B 4MH3A 2FLSA 1K0NA 4I2UA 4ZILA 3KM6A 6GSYA 3IHQA 1T00A 2HT9A 3FR6A 3LORA 4GTUA 3GV1A 2QA2A 3C73A 3WYWA 1Q98A 1SKSB 2B5XA 3D4TA 4EC0A 4MNNA 1SD9A 4MDCA 1T1VA 4ECIA 3SBCA 5DCGA 3IDVA 1AUCA 2OBIA 4X1UA 4FH8A 5F8BA 3I43A 5B8BA 5C00A 4G0KA 3MIXA 3M3MA 5ID2B 1NW2A 2GLRA 1TOFA 3ZFLA 5ENUA 5CAXA 1GSFA 2PBJA 5DALB 4L5LA 3W8SA 2D2ZA 1VF3A 3VFIA 5G5FA 1NM3A 1TTZA 4EUYA 3TGZA 1X9MB 1XPVA 3VPQA 1EV4A 3UVHA 2FY6A 1WE0A 4KDXA 4ISDA 3FZ5A 3GKMA 2VM1A 4IJ3A 2JZRA 3CSJA 2MYGA 3VWXA 5CP1A 5DVBA 1GULA 1R26A 3U5RE 1FVKA 1GNWA 4O7HA 5AIVA 3O6TA 4KDUA 3DYRA 4ECCA 1YJ6A 1WIKA 4MJBA 1TRUA 2I4AA 2QGVA 3W8JA 2KP1A 3FK8A 4OCFA 1AQXA 4JBBA 4L0UA 1V57A 3DXBA 2H0HA 3D6IA 3TKRA 3DRNA 2VL9A 3GH6A 2H19A 1OVNA 3GKKA 2YWMA 4ECBA 4ZB6A 2DJJA 4BWQA 4ZL9A 4CW9A 5ECPB 4F2IA 1ERUA 2HYXA 3EYTA 1TI1A 1Z6MA 1DSBA 4LL4B 3QFAC 4WBRD 4HQZA 4D73A 3RHBA 2KHPA 3A3TA 2BMXA 4KF9A 2H76A 2A2RA 4XRDA 3BD2A 1GTUA 2JSYA 3ZFBA 1G0TA 1XWKA 3A5WA 4HZ4A 1RK4A 1SYRA 3IK7A 2FA8A 1BG5A 2FWGA 2HZEB 19GSA 2L6CA 2LJRA 2MMZA 2IL3A 3N5OA 2X99A 2O85A 4L0WA 2P5RA 2H74A 1YKCA 1VGLA 5J5NA 2H1GA 3U6VA 1K0OA 4KH7A 2GQKA 17GSA 4K1FA 2ALBA 3IC8A 3DEXA 1ZYNA 2LEGA 1SU9A 4FYUA 2H30A 4YQVA 2R0CA 1USBA 2PVQA 4XRAA 4OCEA 2GQLA 2YZHA 3ZTLA 2ON7A 3KZQA 1SJIA 1V9WA 4TR1B 2VO4A 2V6KA 2J23A 1TP9A 3A2VA 1GTAA 5AN1A 3IBHA 2IFQB 1EV9A 5D9WA 1VRSD 4RQXA 2CVBA 3J7Yk 2YOIA 4L8EA 3LQ7A 3GTUA 1OC9A 2OBKA 3P90A 4IQAA 5J4UA 5KN0A 2H6XA 5IMVA 4HOJA 2M72A 3ZVJD 3H4KA 1GH2A 3QDNA 4TOPA 3VI5A 1F3AA 5AISA 4K0GA 3HY2A 3D0ZA 2B6MA 3RBTA 4GLTA 1GUHA 3RPPA 4ML1A 2C0EA 3JCML 1ZYEA 4RQRA 4RI6A 4Z7XA 2NBSA 4MLYA 1F37A 3HVXA 2QC7A 4DEJA 4GQFA 4LL1B 2VM2A 4WETA 5JCWA 4X43A 5IMZA 2R5GA 1AAZA 1JZDA 3TJJA 3RDWA 4MP4A 1VF2A 4PXOA 4LMVA 5E59A 1PN0A 2LJKA 2CVKA 1T8EB 3GKXA 2DJ2A 3ZMLA 2HSMA 2TRCP 4PURA 5DCHA 4MH2A 4POKA 3HJMA 4HI7A 3VLNA 2VL2A 2YZUA 4J57E 1F2EA 5KOXA 2K6VA 4ACSA 4K9ZA 1AIUA 1Z6NA 3F4SA 4ZBDA 1QMVA 4IJIA 1EP8A 5KN1A 1TU7A 4FYBA 4IVFA 2C1YA 3F4TA 3GL5A 2JZTA 4WBJA 4ZIJA 1XVWA 1FAAA 3O3TA 2HRKA 4TR4A 5EY6A 1FVJA 2PWJA 4GQCA 6GSVA 2YWOA 4IELA 3FRCA 4E8HA 3ZLPA 5HR3A 1QFNA 1K0CA 3HJPA 1N2AA 1Y25A 2X8CA 3WD6A 3E3EA 5G1KA 4Z2TA 5IO0A 2C0FA 1KTEA 4IP1A 4BPYA 3IR4A 1LJRA 3ME7A 3D4MA 1FOHA 2R0GA 1YKAA 3TRQA 3L9SA 1HYUA 4NMUA 2H01A 3RPNA 4BVYA 5CYYA 4AJ6A 3F9UA 1ERTA 2R6KA 1N8JA 1XOBA 2DJ1A 2FCHA 5ECRB 3F3RA 3M1GA 2VAFA 1SL2B 2G0FA 2LQOA 4G0LA 4O5RA 1XW9A 1AW9A 2K8SA 2O8VB 2KUCA 1BX9A 1PQNA 1WRYA 5F07A 1T3BA 3MAKA 2GZPA 1DUGA 4JE1A 4GSTA 2IJYA 5LD0A 1UN2A 4G2EA 2GTUA 1IYIA 2GZZA 3HJOA 4KCEA 1O81A 4TVEA 3GSSA 3MYDA 4EDZA 5ECMB 5IMAA 4TR1A 1EGRA 1X5CA 2CZ3A 4JU5A 1RW1A 14GSA 2IFQA 1ON4A 5IPGA 2XPEA 2WCIA 3A2WA 1HQOA 5A4UA 4DSRA 2LRCA 4EE0A 4E8EA 3M9JA 4DSSB 2YANA 1SYXA 1GNEA 2HSYA 1B4QA 3C71A 3UEMA 1XW5A 3Q74A 2WDUA 2LRTA 1MDKA 2GDRA 4K5SA 1THOA 3P7XA 4AJ7A 4BL7A 3KH7A 2HI7A 2FUG2 1EWXA 3KCMA 5D9VA 1QUWA 3GSTA 1TW9A 3ZMKA 3BOAA 4JEDA 1YF0A 2YJHA 1K0BA 2L6DA 2K18A 5FT3A 1EP7A 1XOAA 3LG6A 1B48A 4YQMA 5G30A 3LJRA 5LNKe 3BBYA 5IMDA 1EZKA 2OJLA 1YDKA 2C8UA 3ZVJA 1OYJA 3UBLA 2LNTA 2MZCA 1YEXA 4ID0A 1TI3A 3CRUA 1Z5YE 2OA7A 2JU5A 2H1BA 4MF7A 2J9HA 2JL4A 5DDLA 1Z7PA 3L78A 2G2QA 1MD4A 2HZFA 2H72A 2NTOA 3GRXA 5B7CA 1O85A 1WWJA 3GFKA 1K3OA 2RIIA 4K8MA 1A2LA 3HZ4A 2H73A 4CDOA 1GLQA 5EVOA 2RUEA 1X9SB 2VLTA 1PKWA 1MEKA 2VCVA 4KNDA 4CHSA 1OKTA 4WF5A 3TKSA 1X0RA 3CSHA 2LS5A 3QFBC 4IHUA 3QAVA 4K6XA 1DBYA 4ILFA 1SL0B 5DQSA 1SJ6A 2BTOT 3LFLA 2DKIA 3ZYWA 5ABRA 2H0GA 3IC4A 2REMA 1GSQA 1ILOA 4YKFA 4Q5FA 1PL1A 5HR1A 2YPMA 2AV4A 3TKQA 3UARA 2VOCA 1NSWA 5KEJA 4USSA 4PNGA 4IP6A 3CXGA 2CZ2A 3DWVA 3KH9A 3LXTA 2X64A 4ZBAA 2XHFA 3TOTA 2CAQA 1S3DA 1Z3EA 2H70A 2YP6A 2C4JA 3Q19A 2VCZA 3TRPA 5ECHB 5ELAA 1A0RP 1TK5B 1EOGA 3DVXA 3I69A 3P8WA 2PUKC 2VCTA 2VLVA 4K7IA 4I8BA 5J41A 4PQHA 4PQ1A 4F0BA 4V2LA 1KBNA 2E0QA 4WEYA 2AHEA 1A8LA 4HU7A 5JCGA 3H1NA 2FNOA 2VCXA 4G9HA 1ML6A 1SKWB 5F06A 3QOUA 7GSSA 1PSQA 1BYEA 4DSQA 1SK0A 2OE3A 2LJAA 1BJXA 2LQQA 2OE0A 5IQYA 4POMA 4HDEA 3EINA 1LU4A 2DIYA 4OMVA 5GAPD 1TRSA 1FW1A 18GSA 3HCZA 2YWNA 2WFCA 1UVZA 4XS1A 4K2XA 1F6MC 3HHVA 4XTSA 1XWBA 4GSSA 1YY7A 4AF2A 5IOXA 1DE2A 2NVLA 5CRWA 5D96A 2LV3A 2FWHA 4LLRA 2HRNA 2FWEA 1GSDA 4ZB8A 2N5FA 1ERWA 3GN3A 2DIZA 2A2PA 3KMNA 2F3MA 2ZCTA 5DAKB 1U3IA 2HRAA 1FO5A 1AC1A 4XS4B 3VI7A 4MABA 5A5KA 1ZOFA 4KE3A 5F05A 5C04A 4N0ZA 2F8AA 3KJYA 3TJGA 4HU9A 1OC8A 1K0MA 2F51A 2XBQA 1PX6A 3N9JA 4LA1A 2A4HA 6GSWA 1TRWA 3QR6A 4Z2UA 3VPTA 4O92A 2L4QA 4MF5A 2P5QA 5ECIB 2IIYA 1EGOA 2HNLA 1J08A 10GSA 16GSA 2JZSA 2HLSA 4KSMA 1GUKA 1V58A 2H1DA 4L5OA 2H71A 4OFTA 1A24A 2WB9A 3W6GA 2CX4A 4Q5QA 1GSUA 2K9FA 4PQIA 4OO5A 4TR3A 4ICYA 4BVXB 2CQ9A 3CSIA 1QXHA 5KN3A 5D73A 4G0IA 2GT6A 3EU3A 1AQWA 1K0AA 4P3YB 1SK1A 3UOMA 1BQ7A 5B8AA 2VL2C 1V2AA 2XPDA 4H86A 1PX7A 5DBQA 5L71A 5G31A 4GRFA 1PRXA 1O6JA 2E2GA 5HR0A 2H1AA 3CYNA 1JLWA 4WKWA 3L0HA 1K3LA 3HDCA 2IMFA 3ERFA 4JZQA 2HE3A 5ID2A 1XFLA 2WJUA 2DMMA 1HNBA 5IM9A 5FWGA 3GURA 2FD3A 2TIRA 1WOUA 2F8FA 4MA9A 2M46A 3QD9A 1R7HA 2VLUA 5DALA 2OADA 1XCCA 1HNAA 2P31A 1ZYQB 3H79A 4POBA 3HKRA 3ZIJA 3C1SA 1MTCA 1TU8A 4NPBA 1X9WB 3G7IA 3GHAA 1TK0B 3G7YA 1DE1A 5JWQB 4ZXGA 1MD3A 4V1Ap 4K2DA 4AJ8A 4KAEA 5HFKA 1Q4JA 1JZWA 2C3TA 3NZNA 4EKZA 1M2DA 3IXRA 2QKEA 5HFIA 2VD0A 1WMJA 1OE7A 4GCIA 5J9CA 4EL1A 3M9KA 3FHKA 1A2MA 3DVWA 3NIVA 2GSRA 1K0DA 3G7JA 1XBSA 3ZRDA 2DKHA 3CBUA 4IS0A 2AJQB 4O5QA 3CTFA 5F0GA 2N5AA 2K8VA 1ST9A 3LEFA 3IK9A 4G10A 1F3BA 1XWGA 1XZOA 2PN8A 2AAWA 1O73A 5IMFA 1QQ2A 2H8LA 1YF1A 4RI7A 2PVOC 2A4VA 4PTSA 2YV9A 4HQSA 3QMXA 2FHEA 1ZCPA 3F8UA 1B9XC 1S3CA 1PKZA 2HZEA 2M80A 2H0IA 2PGTA 5FHIA 1YEPA 3PPUA 5DAKA 1FG4A 4KUNA 3CMIA 2B1KA 4XS4A 5AGYA 3I9V2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2T A;  2H75 A;  5CRH A;  1O8W A;  1WJK A;  5H5Q A;  1RQM A;  3FEU A;  1C72 A;  3TJF A;  4MZC A;  5DJL A;  3ED3 A;  1UA5 A;  2V1M A;  1R5P A;  2JAC A;  1HNC A;  1EOH A;  1ZGN A;  4HJM A;  5GZZ B;  4IW9 A;  2I81 A;  2MMO A;  1G7E A;  11GS A;  1T7P B;  1FHE A;  4N30 A;  2C0G A;  5IPH A;  4KX4 A;  1OE8 A;  2AB6 A;  4IKH A;  2IWT A;  3APQ A;  4FYC A;  2B7K A;  5ECQ B;  2KOK A;  1B4P A;  3BJ5 A;  1GL8 A;  4MK3 A;  1S3A A;  1R5A A;  4KGI A;  4D73 B;  4FIW A;  1XXU A;  2LTK A;  8GSS A;  4KW6 A;  1ABA A;  4XIH A;  3EC3 A;  1TRV A;  1XWC A;  3TJK A;  4MJA A;  3TRX A;  3IV4 A;  1Z7R A;  1JFU A;  1QK8 A;  5A4W A;  3TKS C;  2RM5 A;  1PL2 A;  1ZZY A;  3L4N A;  3TKS E;  2F9S A;  2Z9S A;  4KCA A;  1I5G A;  2WGR A;  5H5R A;  1SK2 A;  2E7P A;  3D5J A;  4HEA 2;  1PD2 1;  5EPF A;  4XHM A;  3ZZX A;  1B9Y C;  1A0F A;  4MCU A;  4NAX A;  3L9V A;  4YAV A;  1B8X A;  2RLI A;  1YZX A;  3PGT A;  2H66 A;  2GT5 A;  3FZ4 A;  3TKP A;  3EWL A;  1NHO A;  4NHW A;  1EEJ A;  4Q5N A;  1Y6E A;  2DBC A;  1O8X A;  2MBT A;  3UIW A;  2I3Y A;  2B5E A;  2FGX A;  5J9B A;  1ERV A;  1TXX A;  3MWH A;  4N10 A;  5D8I A;  5B6M A;  3EVI A;  3WT2 A;  1OC3 A;  3APO A;  3EU4 A;  5COH A;  1JZO A;  2CA8 A;  3GTU B;  4GXZ A;  2YJ7 A;  4OFM A;  4FO5 A;  1TJD A;  5ECO B;  3WGX A;  3C1R A;  1GSY A;  4V2N A;  4ECJ A;  2GST A;  2X8G A;  2OKA A;  3PH9 A;  2GQM A;  3HVS A;  2MMA A;  4MPF A;  1H75 A;  3C7M A;  3IAM 2;  2R3X A;  3DIE A;  4YAP A;  2BJX A;  3GIX A;  2GVP A;  4LMW A;  4YQU A;  5CRE A;  2IMD A;  4EF0 A;  4IN0 A;  4PGT A;  5KN2 A;  3IRA A;  5IIZ A;  2GZY A;  3FZ9 A;  2A2S A;  2AUV A;  5G5E A;  5LCZ A;  4HUA A;  2V32 A;  5CO3 A;  1VF4 A;  3R2Q A;  1TDI A;  3KD0 A;  3FW2 A;  4KDY A;  1GSE A;  2HXK A;  5B6N A;  3WGE A;  3F4R A;  4K7O A;  2WUL A;  5ECN B;  2I9H A;  3GL3 A;  3F6D A;  2DJ3 A;  6GSX A;  3ZRE A;  4K0N A;  1JLV A;  3G9B A;  3FKF A;  2O7K A;  2LST A;  1LBK A;  4K7N A;  3IA1 A;  2LUS A;  3UVT A;  3HD5 A;  1U6T A;  3TCO A;  4TRX A;  5ELG A;  1I9D A;  2GSQ A;  2PPT A;  1G6W A;  3UBK A;  3M8N A;  1URM A;  4EO3 A;  2IPA A;  5JCU A;  3DML A;  4I97 A;  3H8Q A;  3BCK A;  3US3 A;  4HS1 A;  4ZBB A;  2PU9 C;  1XIY A;  2FWF A;  2B3S A;  2E2M A;  2HFD A;  3UMA A;  3S9F A;  2H6Z A;  2DJK A;  2AYT A;  3IE3 A;  1GLP A;  2EC4 A;  2PMT A;  1JZR A;  1R4W A;  5HFG A;  2XC2 A;  9GSS A;  3EUR A;  3GH9 A;  3RAZ A;  2GGT A;  2NDO A;  2LRN A;  2YV7 A;  6GSU A;  5INY A;  2CVD A;  3I6A A;  3GMF A;  4XS6 A;  4I5Q A;  4MJE A;  4IGJ A;  2DJ0 A;  3M0F A;  4F9Z A;  4F0C A;  1PA3 A;  4DSS A;  1E2Y A;  4QL9 A;  1A2J A;  1TK8 B;  2HRF A;  2C80 A;  4ZL7 A;  4KA0 A;  4MZB A;  1G7O A;  4PX1 A;  1XW6 A;  1WP0 A;  4DVC A;  1PN9 A;  3TJB A;  1PGT A;  2L5O A;  4AGS A;  1ACV A;  1GTI A;  3QCP A;  2WS2 A;  4GWR A;  1GP1 A;  4HZ2 A;  3HYP A;  4JR4 A;  1TKD B;  3WT1 A;  3BCI A;  2DLX A;  1AQV A;  2O89 A;  1ZMA A;  2L5L A;  3E9J B;  1SEN A;  4KSO A;  1PMT A;  3PIN A;  4TXV A;  3TDG A;  1UC7 A;  1MDJ A;  2YNX A;  3MNG A;  2R37 A;  2O87 A;  3HXS A;  2OE1 A;  3F0I A;  1M9B A;  2RUF A;  5CNW A;  2CX3 A;  3KXO A;  4NWY A;  1IYH A;  3UAP A;  5G2Z A;  1XVQ A;  3KTB A;  2CT6 A;  2B7J A;  2YCD A;  3ZIV A;  5JWR B;  2L4C A;  5D93 A;  3CRT A;  3CTG A;  5IMC A;  1KNG A;  3QAG A;  2ON5 A;  2ZNM A;  1T4Y A;  3KGK A;  22GS A;  2JSZ A;  2DC5 A;  2IN3 A;  5HQP A;  3ISO A;  2VD1 A;  5IO2 A;  3OR5 A;  1Z9H A;  4KB3 A;  1W4V A;  2MMN A;  2EIQ A;  5GSS A;  1CQG A;  3F63 A;  2R4V A;  5GAN D;  5D9T A;  3TOU A;  1W89 A;  1BAY A;  4PUA A;  3KMO A;  4ULX A;  1M2B A;  1J9B A;  3VUR A;  1E6B A;  1SD8 A;  4OFN A;  4TW5 A;  5ECK B;  2IMI A;  3DD3 A;  1GSS A;  3LWA A;  4OO4 A;  5HR2 A;  3F3Q A;  3K8N A;  4J56 E;  3FYG A;  3KIJ A;  4NV2 A;  1SKR B;  2VIM A;  4WR4 A;  4J2F A;  1HD2 A;  1G6Y A;  2CV4 A;  3DKS A;  3Q18 A;  3VWU A;  3EMP A;  4TXO B;  3FY7 A;  2C3N A;  4V1A g;  3ZIT A;  1M99 A;  2L57 A;  2TRX A;  3LGC A;  2GS3 A;  4BWS A;  1V98 A;  3TB2 A;  1M7T A;  3D21 A;  4F82 A;  2N5B A;  4ZB9 A;  1M2A A;  4ZL8 A;  5D9X A;  1SL1 B;  3VK9 A;  2B5Y A;  5ECS A;  3AY8 A;  2XBI A;  4JR6 A;  4N11 A;  3TUE A;  2EIO A;  3ERW A;  5G1L A;  3J7Y b;  1U3A A;  3DGQ A;  1BED A;  1CQH A;  3UJ1 A;  3E0U A;  1GRX A;  2L59 A;  4QL7 A;  3FZA A;  3VWV A;  3HZ8 A;  3ERG A;  2KLX A;  3KEB A;  3V1W A;  1V40 A;  3EE2 A;  1F9M A;  4RUV A;  2CAI A;  4GF0 A;  4TR0 A;  1H4O A;  2WRT A;  3QAW A;  1AXD A;  3H93 A;  1MDI A;  1XWA A;  3GKN A;  2X8H A;  2GSS A;  4ML6 A;  4G19 A;  3FR9 A;  2LKU A;  3O76 A;  2FA4 A;  1M9A A;  1OKD A;  4POL A;  12GS A;  1YQ1 A;  4IQ1 A;  4WF4 A;  4MZW A;  4TN8 A;  5ECL B;  4OWY A;  3KP9 A;  3IAS 2;  4Q5R A;  3GA4 A;  2H6Y A;  2YN1 A;  3P2A A;  4EVM A;  5E4W A;  5CRG A;  4F03 A;  3MDK A;  4IBP A;  4N0V A;  1K3Y A;  3KTL A;  4O32 A;  4I6X A;  4MPG A;  3QPM A;  5DQY A;  2YWI A;  4X0X A;  1SJZ A;  3ZL5 A;  3IPZ A;  3ME8 A;  4MF6 A;  1EEM A;  2B1L A;  3LXZ A;  1OAZ A;  6GSS A;  1A23 A;  1GWC A;  2R2J A;  4YH2 A;  4V2M A;  2NPB A;  2VCQ A;  4NHZ A;  2OAC A;  3NOF A;  2KP2 A;  4JRR A;  1T4Z A;  2DML A;  1ZL9 A;  3PR8 A;  3LYK A;  3RHC A;  1NHY A;  2LNS A;  1J0F A;  3FR3 A;  4QQ7 A;  3HA9 A;  2HSH A;  5AIX A;  4TKY A;  2WZ9 A;  4BVX A;  4BA7 A;  1U87 A;  1A8Y A;  3EMX A;  3SWL A;  3GX8 A;  6GST A;  5EL8 A;  5IOW A;  1GUM A;  4WXT A;  1FOV A;  13GS A;  1GTB A;  3GYK A;  3APS A;  3WGD A;  1THX A;  2VL3 A;  4PNF A;  4MMM A;  1JHB A;  3LSZ A;  4NXI A;  5H5S A;  2RM6 A;  1WPI A;  2V41 A;  3GNJ A;  4XCS A;  2MBS A;  4MJC A;  1KEB A;  3UL3 A;  4WR5 A;  4NV5 A;  2VCW A;  2I1U A;  3F6F A;  2DSA A;  5A4V A;  5CRD A;  3Q6O A;  1FB6 A;  5GST A;  2EIR A;  2C3Q A;  1X5E A;  2IMK A;  2ES7 A;  1X5D A;  2QSI A;  2P0G A;  5DJM A;  2JAD A;  3D22 A;  3KP8 A;  3L9U A;  3LYP A;  3VWW A;  2IME A;  1M0U A;  3HVV A;  4PUF C;  2VUP A;  3GX0 A;  20GS A;  4EDY A;  2ZUP A;  1QGV A;  4EXJ A;  3GUS A;  1U88 A;  3MSZ A;  2V2G A;  2V6O A;  4TXO A;  1FB0 A;  1O7U A;  3A2X A;  4GSN A;  3C8E A;  2C0D A;  5JWO B;  2PER A;  4OD7 A;  1VF1 A;  3IOS A;  5J3R A;  4HJ2 A;  1OC9 B;  4MH3 A;  2FLS A;  1K0N A;  4I2U A;  4ZIL A;  3KM6 A;  6GSY A;  3IHQ A;  1T00 A;  2HT9 A;  3FR6 A;  3LOR A;  4GTU A;  3GV1 A;  3C73 A;  3WYW A;  1Q98 A;  1SKS B;  2B5X A;  3D4T A;  4EC0 A;  1SD9 A;  4MDC A;  1T1V A;  4ECI A;  3SBC A;  5DCG A;  3IDV A;  1AUC A;  2OBI A;  4X1U A;  4FH8 A;  5F8B A;  3I43 A;  5B8B A;  5C00 A;  3M3M A;  5ID2 B;  1NW2 A;  2GLR A;  1TOF A;  3ZFL A;  5ENU A;  5CAX A;  1GSF A;  2PBJ A;  5DAL B;  4L5L A;  3W8S A;  2D2Z A;  1VF3 A;  3VFI A;  5G5F A;  1NM3 A;  1TTZ A;  4EUY A;  3TGZ A;  1X9M B;  1XPV A;  3VPQ A;  1EV4 A;  3UVH A;  2FY6 A;  1WE0 A;  4KDX A;  4ISD A;  3FZ5 A;  3GKM A;  2VM1 A;  4IJ3 A;  2JZR A;  3CSJ A;  2MYG A;  3VWX A;  5CP1 A;  5DVB A;  1GUL A;  1R26 A;  3U5R E;  1FVK A;  1GNW A;  4O7H A;  5AIV A;  3O6T A;  4KDU A;  3DYR A;  4ECC A;  1YJ6 A;  1WIK A;  4MJB A;  1TRU A;  2I4A A;  2QGV A;  3W8J A;  2KP1 A;  3FK8 A;  4OCF A;  1AQX A;  4JBB A;  4L0U A;  1V57 A;  3DXB A;  2H0H A;  3D6I A;  3TKR A;  3DRN A;  2VL9 A;  3GH6 A;  2H19 A;  1OVN A;  3GKK A;  2YWM A;  4ECB A;  4ZB6 A;  2DJJ A;  4BWQ A;  4ZL9 A;  4CW9 A;  5ECP B;  4F2I A;  1ERU A;  2HYX A;  3EYT A;  1TI1 A;  1Z6M A;  1DSB A;  4LL4 B;  3QFA C;  4WBR D;  4HQZ A;  4D73 A;  3RHB A;  2KHP A;  3A3T A;  2BMX A;  2H76 A;  2A2R A;  4XRD A;  3BD2 A;  1GTU A;  2JSY A;  3ZFB A;  1G0T A;  1XWK A;  3A5W A;  4HZ4 A;  1RK4 A;  1SYR A;  3IK7 A;  2FA8 A;  1BG5 A;  2FWG A;  2HZE B;  19GS A;  2L6C A;  2LJR A;  2MMZ A;  2IL3 A;  3N5O A;  2X99 A;  2O85 A;  4L0W A;  2P5R A;  2H74 A;  1YKC A;  1VGL A;  5J5N A;  2H1G A;  3U6V A;  1K0O A;  4KH7 A;  2GQK A;  17GS A;  4K1F A;  2ALB A;  3DEX A;  2LEG A;  1SU9 A;  4FYU A;  2H30 A;  4YQV A;  1USB A;  2PVQ A;  4XRA A;  4OCE A;  2GQL A;  2YZH A;  3ZTL A;  2ON7 A;  3KZQ A;  1SJI A;  1V9W A;  4TR1 B;  2VO4 A;  2V6K A;  2J23 A;  1TP9 A;  3A2V A;  1GTA A;  5AN1 A;  3IBH A;  2IFQ B;  1EV9 A;  5D9W A;  1VRS D;  4RQX A;  2CVB A;  3J7Y k;  2YOI A;  4L8E A;  3LQ7 A;  3GTU A;  1OC9 A;  2OBK A;  3P90 A;  4IQA A;  5J4U A;  5KN0 A;  2H6X A;  5IMV A;  4HOJ A;  2M72 A;  3ZVJ D;  3H4K A;  1GH2 A;  3QDN A;  4TOP A;  3VI5 A;  1F3A A;  5AIS A;  4K0G A;  3HY2 A;  3D0Z A;  2B6M A;  3RBT A;  4GLT A;  1GUH A;  3RPP A;  4ML1 A;  2C0E A;  3JCM L;  1ZYE A;  4RQR A;  4RI6 A;  4Z7X A;  2NBS A;  4MLY A;  1F37 A;  3HVX A;  2QC7 A;  4DEJ A;  4GQF A;  4LL1 B;  2VM2 A;  4WET A;  5JCW A;  4X43 A;  5IMZ A;  2R5G A;  1AAZ A;  1JZD A;  3TJJ A;  3RDW A;  4MP4 A;  1VF2 A;  4PXO A;  4LMV A;  5E59 A;  2LJK A;  2CVK A;  1T8E B;  3GKX A;  2DJ2 A;  3ZML A;  2TRC P;  4PUR A;  5DCH A;  4MH2 A;  4POK A;  3HJM A;  4HI7 A;  3VLN A;  2VL2 A;  2YZU A;  4J57 E;  1F2E A;  2K6V A;  4ACS A;  4K9Z A;  1AIU A;  1Z6N A;  3F4S A;  4ZBD A;  1QMV A;  4IJI A;  1EP8 A;  5KN1 A;  1TU7 A;  4FYB A;  4IVF A;  2C1Y A;  3F4T A;  3GL5 A;  2JZT A;  4WBJ A;  4ZIJ A;  1XVW A;  1FAA A;  3O3T A;  4TR4 A;  5EY6 A;  1FVJ A;  2PWJ A;  4GQC A;  6GSV A;  2YWO A;  4IEL A;  3FRC A;  4E8H A;  3ZLP A;  5HR3 A;  1QFN A;  1K0C A;  3HJP A;  1N2A A;  1Y25 A;  2X8C A;  3WD6 A;  3E3E A;  5G1K A;  5IO0 A;  2C0F A;  1KTE A;  4IP1 A;  4BPY A;  3IR4 A;  1LJR A;  3ME7 A;  3D4M A;  1YKA A;  3TRQ A;  3L9S A;  1HYU A;  4NMU A;  2H01 A;  3RPN A;  4BVY A;  5CYY A;  4AJ6 A;  3F9U A;  1ERT A;  2R6K A;  1N8J A;  1XOB A;  2DJ1 A;  2FCH A;  5ECR B;  3F3R A;  3M1G A;  2VAF A;  1SL2 B;  2G0F A;  2LQO A;  4O5R A;  1XW9 A;  1AW9 A;  2K8S A;  2O8V B;  2KUC A;  1BX9 A;  1PQN A;  1WRY A;  5F07 A;  1T3B A;  3MAK A;  2GZP A;  1DUG A;  4JE1 A;  4GST A;  2IJY A;  5LD0 A;  1UN2 A;  4G2E A;  2GTU A;  1IYI A;  2GZZ A;  3HJO A;  4KCE A;  1O81 A;  4TVE A;  3GSS A;  4EDZ A;  5ECM B;  5IMA A;  4TR1 A;  1EGR A;  1X5C A;  2CZ3 A;  4JU5 A;  1RW1 A;  14GS A;  2IFQ A;  1ON4 A;  5IPG A;  2XPE A;  2WCI A;  3A2W A;  1HQO A;  5A4U A;  4DSR A;  2LRC A;  4EE0 A;  4E8E A;  3M9J A;  4DSS B;  2YAN A;  1SYX A;  1GNE A;  2HSY A;  1B4Q A;  3C71 A;  3UEM A;  1XW5 A;  3Q74 A;  2WDU A;  2LRT A;  1MDK A;  2GDR A;  1THO A;  3P7X A;  4AJ7 A;  4BL7 A;  3KH7 A;  2HI7 A;  2FUG 2;  1EWX A;  3KCM A;  5D9V A;  1QUW A;  3GST A;  1TW9 A;  3ZMK A;  3BOA A;  4JED A;  1YF0 A;  2YJH A;  1K0B A;  2L6D A;  2K18 A;  5FT3 A;  1EP7 A;  1XOA A;  3LG6 A;  1B48 A;  4YQM A;  5G30 A;  3LJR A;  5LNK e;  3BBY A;  5IMD A;  1EZK A;  2OJL A;  1YDK A;  2C8U A;  3ZVJ A;  1OYJ A;  3UBL A;  2LNT A;  2MZC A;  1YEX A;  4ID0 A;  1TI3 A;  3CRU A;  1Z5Y E;  2OA7 A;  2JU5 A;  2H1B A;  4MF7 A;  2J9H A;  2JL4 A;  5DDL A;  1Z7P A;  3L78 A;  2G2Q A;  1MD4 A;  2HZF A;  2H72 A;  2NTO A;  3GRX A;  5B7C A;  1O85 A;  1WWJ A;  3GFK A;  1K3O A;  2RII A;  4K8M A;  1A2L A;  3HZ4 A;  2H73 A;  4CDO A;  1GLQ A;  5EVO A;  2RUE A;  1X9S B;  2VLT A;  1PKW A;  1MEK A;  2VCV A;  4KND A;  4CHS A;  1OKT A;  4WF5 A;  3TKS A;  1X0R A;  3CSH A;  2LS5 A;  3QFB C;  4IHU A;  3QAV A;  4K6X A;  1DBY A;  4ILF A;  1SL0 B;  5DQS A;  1SJ6 A;  2BTO T;  3LFL A;  3ZYW A;  5ABR A;  2H0G A;  3IC4 A;  2REM A;  1GSQ A;  1ILO A;  4Q5F A;  1PL1 A;  5HR1 A;  2YPM A;  2AV4 A;  3TKQ A;  3UAR A;  2VOC A;  1NSW A;  5KEJ A;  4PNG A;  4IP6 A;  3CXG A;  2CZ2 A;  3DWV A;  3KH9 A;  3LXT A;  2X64 A;  4ZBA A;  2XHF A;  3TOT A;  2CAQ A;  1S3D A;  1Z3E A;  2H70 A;  2YP6 A;  2C4J A;  3Q19 A;  2VCZ A;  3TRP A;  5ECH B;  5ELA A;  1A0R P;  1TK5 B;  1EOG A;  3DVX A;  3I69 A;  3P8W A;  2PUK C;  2VCT A;  2VLV A;  4K7I A;  4I8B A;  5J41 A;  4PQH A;  4PQ1 A;  4F0B A;  4V2L A;  1KBN A;  2E0Q A;  4WEY A;  2AHE A;  1A8L A;  4HU7 A;  5JCG A;  3H1N A;  2FNO A;  2VCX A;  4G9H A;  1ML6 A;  1SKW B;  5F06 A;  3QOU A;  7GSS A;  1PSQ A;  1BYE A;  4DSQ A;  1SK0 A;  2OE3 A;  2LJA A;  1BJX A;  2LQQ A;  2OE0 A;  5IQY A;  4POM A;  4HDE A;  3EIN A;  1LU4 A;  2DIY A;  4OMV A;  5GAP D;  1TRS A;  1FW1 A;  18GS A;  3HCZ A;  2YWN A;  2WFC A;  1UVZ A;  4XS1 A;  1F6M C;  3HHV A;  4XTS A;  1XWB A;  4GSS A;  1YY7 A;  4AF2 A;  5IOX A;  1DE2 A;  2NVL A;  5CRW A;  5D96 A;  2LV3 A;  2FWH A;  4LLR A;  2HRN A;  2FWE A;  1GSD A;  4ZB8 A;  2N5F A;  1ERW A;  3GN3 A;  2DIZ A;  3KMN A;  2F3M A;  2ZCT A;  5DAK B;  1U3I A;  1FO5 A;  1AC1 A;  4XS4 B;  3VI7 A;  4MAB A;  5A5K A;  1ZOF A;  4KE3 A;  5F05 A;  5C04 A;  4N0Z A;  2F8A A;  3KJY A;  3TJG A;  4HU9 A;  1OC8 A;  1K0M A;  2F51 A;  2XBQ A;  1PX6 A;  3N9J A;  4LA1 A;  6GSW A;  1TRW A;  3QR6 A;  3VPT A;  4O92 A;  2L4Q A;  4MF5 A;  2P5Q A;  5ECI B;  2IIY A;  1EGO A;  2HNL A;  1J08 A;  10GS A;  16GS A;  2JZS A;  2HLS A;  4KSM A;  1GUK A;  1V58 A;  2H1D A;  4L5O A;  2H71 A;  4OFT A;  1A24 A;  2WB9 A;  3W6G A;  2CX4 A;  4Q5Q A;  1GSU A;  2K9F A;  4PQI A;  4OO5 A;  4TR3 A;  2CQ9 A;  3CSI A;  1QXH A;  5KN3 A;  5D73 A;  2GT6 A;  3EU3 A;  1AQW A;  1K0A A;  4P3Y B;  1SK1 A;  3UOM A;  1BQ7 A;  5B8A A;  2VL2 C;  1V2A A;  2XPD A;  4H86 A;  1PX7 A;  5DBQ A;  5L71 A;  5G31 A;  4GRF A;  1PRX A;  1O6J A;  2E2G A;  5HR0 A;  2H1A A;  3CYN A;  1JLW A;  4WKW A;  3L0H A;  1K3L A;  3HDC A;  2IMF A;  3ERF A;  4JZQ A;  2HE3 A;  5ID2 A;  1XFL A;  2WJU A;  2DMM A;  1HNB A;  5IM9 A;  5FWG A;  3GUR A;  2FD3 A;  2TIR A;  1WOU A;  2F8F A;  4MA9 A;  2M46 A;  3QD9 A;  1R7H A;  2VLU A;  5DAL A;  2OAD A;  1XCC A;  1HNA A;  2P31 A;  1ZYQ B;  3H79 A;  4POB A;  3HKR A;  3ZIJ A;  3C1S A;  1MTC A;  1TU8 A;  4NPB A;  1X9W B;  3G7I A;  3GHA A;  1TK0 B;  3G7Y A;  1DE1 A;  5JWQ B;  4ZXG A;  1MD3 A;  4V1A p;  4K2D A;  4AJ8 A;  4KAE A;  5HFK A;  1Q4J A;  1JZW A;  2C3T A;  3NZN A;  4EKZ A;  1M2D A;  3IXR A;  2QKE A;  5HFI A;  2VD0 A;  1WMJ A;  1OE7 A;  4GCI A;  5J9C A;  4EL1 A;  3M9K A;  3FHK A;  1A2M A;  3DVW A;  3NIV A;  2GSR A;  1K0D A;  3G7J A;  1XBS A;  3ZRD A;  3CBU A;  4IS0 A;  2AJQ B;  3CTF A;  5F0G A;  2N5A A;  2K8V A;  1ST9 A;  3LEF A;  3IK9 A;  4G10 A;  1F3B A;  1XWG A;  1XZO A;  2PN8 A;  2AAW A;  1O73 A;  5IMF A;  1QQ2 A;  2H8L A;  1YF1 A;  4RI7 A;  2PVO C;  2A4V A;  2YV9 A;  4HQS A;  3QMX A;  2FHE A;  1ZCP A;  3F8U A;  1B9X C;  1S3C A;  1PKZ A;  2HZE A;  2M80 A;  2H0I A;  2PGT A;  5FHI A;  1YEP A;  5DAK A;  1FG4 A;  4KUN A;  3CMI A;  2B1K A;  4XS4 A;  5AGY A;  3I9V 2; 
#chains in the Genus database with same CATH topology
 4I2T A;  2H75 A;  5CRH A;  1O8W A;  1WJK A;  5H5Q A;  1RQM A;  3FEU A;  1C72 A;  3TJF A;  4MZC A;  5DJL A;  3ED3 A;  1UA5 A;  2V1M A;  1R5P A;  2JAC A;  1HNC A;  1EOH A;  1ZGN A;  5KOW A;  4HJM A;  5GZZ B;  4IW9 A;  2I81 A;  2MMO A;  1G7E A;  11GS A;  1T7P B;  1FHE A;  4N30 A;  2C0G A;  5IPH A;  4KX4 A;  1OE8 A;  2AB6 A;  4IKH A;  2IWT A;  3APQ A;  4FYC A;  2B7K A;  5ECQ B;  2KOK A;  4HSC X;  1B4P A;  3BJ5 A;  1GL8 A;  4MK3 A;  1S3A A;  1R5A A;  4KGI A;  4D73 B;  4FIW A;  1XXU A;  3R3E A;  2LTK A;  4BIK A;  8GSS A;  4K5R A;  4KW6 A;  1ABA A;  4XIH A;  3EC3 A;  1TRV A;  1XWC A;  3TJK A;  4MJA A;  3TRX A;  3IV4 A;  1Z7R A;  1JFU A;  1QK8 A;  5A4W A;  3TKS C;  2RM5 A;  1PL2 A;  1ZZY A;  3L4N A;  3TKS E;  4EIP A;  2F9S A;  2Z9S A;  4KCA A;  1I5G A;  2WGR A;  5H5R A;  1SK2 A;  2E7P A;  3D5J A;  4HEA 2;  1PD2 1;  5EPF A;  4XHM A;  3ZZX A;  1B9Y C;  1A0F A;  4MCU A;  2QA1 A;  4NAX A;  3L9V A;  4YAV A;  1B8X A;  2RLI A;  1YZX A;  3PGT A;  3A5I A;  2H66 A;  2GT5 A;  3FZ4 A;  4FQU A;  3TKP A;  3EWL A;  1NHO A;  4NHW A;  1EEJ A;  4Q5N A;  1Y6E A;  2DBC A;  1O8X A;  2MBT A;  3UIW A;  2I3Y A;  2B5E A;  2FGX A;  5J9B A;  1ERV A;  1TXX A;  3MWH A;  4N10 A;  5D8I A;  5B6M A;  3EVI A;  3WT2 A;  1OC3 A;  3APO A;  3EU4 A;  5COH A;  1JZO A;  2CA8 A;  3GTU B;  4GXZ A;  2YJ7 A;  4OFM A;  4FO5 A;  1TJD A;  5ECO B;  3WGX A;  3C1R A;  1GSY A;  4V2N A;  4ECJ A;  2GST A;  2X8G A;  2OKA A;  3PH9 A;  2GQM A;  3HVS A;  2MMA A;  4MPF A;  1H75 A;  3C7M A;  3IAM 2;  2R3X A;  3DIE A;  4YAP A;  2BJX A;  3GIX A;  2GVP A;  4LMW A;  4YQU A;  5CRE A;  2IMD A;  5BMU A;  4EF0 A;  4IN0 A;  4PGT A;  5KN2 A;  2X49 A;  3IRA A;  5IIZ A;  2GZY A;  3FZ9 A;  2A2S A;  2AUV A;  5G5E A;  5LCZ A;  4HUA A;  2V32 A;  5CO3 A;  1VF4 A;  3R2Q A;  1TDI A;  3KD0 A;  3FW2 A;  4KDY A;  1GSE A;  2HXK A;  5B6N A;  3WGE A;  3F4R A;  4K7O A;  2WUL A;  5ECN B;  2I9H A;  3GL3 A;  3F6D A;  2DJ3 A;  6GSX A;  3ZRE A;  4K0N A;  1JLV A;  3G9B A;  3FKF A;  2O7K A;  2LST A;  1LBK A;  4Z2R A;  4K7N A;  3IA1 A;  2LUS A;  3UVT A;  3HD5 A;  1U6T A;  3TCO A;  4TRX A;  5ELG A;  1I9D A;  2GSQ A;  2PPT A;  4X4J A;  1G6W A;  3UBK A;  3M8N A;  1URM A;  4EO3 A;  2IPA A;  5JCU A;  3DML A;  4I97 A;  2UZ8 A;  3H8Q A;  3BCK A;  3US3 A;  4HS1 A;  4ZBB A;  2PU9 C;  1XIY A;  2FWF A;  2B3S A;  2E2M A;  2HFD A;  3UMA A;  3S9F A;  2H6Z A;  2DJK A;  2AYT A;  3IE3 A;  1GLP A;  2EC4 A;  2PMT A;  1JZR A;  1R4W A;  5HFG A;  2XC2 A;  9GSS A;  3EUR A;  3GH9 A;  3RAZ A;  2GGT A;  2NDO A;  2LRN A;  2YV7 A;  6GSU A;  5INY A;  2CVD A;  3I6A A;  3GMF A;  4XS6 A;  4I5Q A;  4MJE A;  4IGJ A;  1S3R A;  2DJ0 A;  3M0F A;  4F9Z A;  4F0C A;  1PA3 A;  4DSS A;  1E2Y A;  4QL9 A;  1A2J A;  1TK8 B;  2HRF A;  2C80 A;  4ZL7 A;  4KA0 A;  4MZB A;  1G7O A;  4PX1 A;  1XW6 A;  1WP0 A;  4DVC A;  1PN9 A;  3TJB A;  1PGT A;  2L5O A;  4AGS A;  1ACV A;  1GTI A;  3QCP A;  2WS2 A;  4BVY B;  4GWR A;  1GP1 A;  4HZ2 A;  3HYP A;  4JR4 A;  1TKD B;  3WT1 A;  3BCI A;  2DLX A;  1AQV A;  2O89 A;  1ZMA A;  2L5L A;  3E9J B;  1SEN A;  4KSO A;  1PMT A;  3PIN A;  4TXV A;  3TDG A;  1UC7 A;  1MDJ A;  2YNX A;  3MNG A;  2R37 A;  2O87 A;  3HXS A;  2OE1 A;  3F0I A;  1M9B A;  2RUF A;  5CNW A;  2CX3 A;  3KXO A;  4NWY A;  1IYH A;  3UAP A;  5G2Z A;  1XVQ A;  3KTB A;  2CT6 A;  2B7J A;  2YCD A;  3ZIV A;  5JWR B;  2L4C A;  5D93 A;  3CRT A;  3CTG A;  5IMC A;  1KNG A;  3QAG A;  2ON5 A;  2ZNM A;  1T4Y A;  3KGK A;  22GS A;  2JSZ A;  2DC5 A;  2IN3 A;  5HQP A;  3ISO A;  2VD1 A;  5IO2 A;  3OR5 A;  1Z9H A;  4KB3 A;  1W4V A;  2MMN A;  2EIQ A;  4BL7 B;  2X4A A;  5GSS A;  1CQG A;  3F63 A;  2R4V A;  5GAN D;  5D9T A;  3TOU A;  1W89 A;  1BAY A;  4PUA A;  3KMO A;  4ULX A;  1M2B A;  1J9B A;  3VUR A;  1E6B A;  1SD8 A;  2R0P A;  4OFN A;  4TW5 A;  5ECK B;  2IMI A;  3DD3 A;  1GSS A;  3LWA A;  4OO4 A;  5HR2 A;  3F3Q A;  4YKG A;  3K8N A;  4EIQ A;  4J56 E;  3FYG A;  3KIJ A;  4NV2 A;  1SKR B;  2VIM A;  4WR4 A;  4J2F A;  1HD2 A;  1G6Y A;  2CV4 A;  3DKS A;  3Q18 A;  3VWU A;  3EMP A;  4TXO B;  3FY7 A;  2C3N A;  4V1A g;  3ZIT A;  1M99 A;  2L57 A;  2TRX A;  3LGC A;  2GS3 A;  4BWS A;  1V98 A;  3TB2 A;  1M7T A;  3D21 A;  4F82 A;  2N5B A;  4ZB9 A;  1M2A A;  4ZL8 A;  5D9X A;  1SL1 B;  3VK9 A;  2B5Y A;  5ECS A;  3AY8 A;  2XBI A;  4JR6 A;  4N11 A;  3TUE A;  2EIO A;  3ERW A;  5G1L A;  3J7Y b;  1U3A A;  3DGQ A;  1BED A;  1CQH A;  3UJ1 A;  3E0U A;  1GRX A;  2L59 A;  4QL7 A;  3FZA A;  3VWV A;  3HZ8 A;  5LL6 V;  3ERG A;  2KLX A;  3KEB A;  3V1W A;  1V40 A;  3EE2 A;  1F9M A;  4RUV A;  2CAI A;  4GF0 A;  4TR0 A;  1H4O A;  2WRT A;  3QAW A;  1AXD A;  3H93 A;  1MDI A;  1XWA A;  3GKN A;  2X8H A;  2GSS A;  4ML6 A;  4G19 A;  3FR9 A;  2LKU A;  3O76 A;  2FA4 A;  1M9A A;  1OKD A;  4POL A;  12GS A;  1YQ1 A;  4IQ1 A;  4WF4 A;  4MZW A;  4TN8 A;  5ECL B;  4OWY A;  3KP9 A;  3IAS 2;  4Q5R A;  3GA4 A;  2H6Y A;  2YN1 A;  3P2A A;  4EVM A;  5E4W A;  5CRG A;  4F03 A;  3MDK A;  4IBP A;  4N0V A;  1K3Y A;  3KTL A;  4O32 A;  4I6X A;  4MPG A;  3QPM A;  4A5P A;  5DQY A;  2YWI A;  4X0X A;  1SJZ A;  3ZL5 A;  3IPZ A;  3ME8 A;  4MF6 A;  1EEM A;  2B1L A;  3LXZ A;  1OAZ A;  3EPT A;  6GSS A;  1A23 A;  1GWC A;  2R2J A;  4YH2 A;  4V2M A;  2NPB A;  2VCQ A;  1ZYP A;  4NHZ A;  2OAC A;  3NOF A;  2KP2 A;  4JRR A;  1T4Z A;  4CY8 A;  2DML A;  1ZL9 A;  3PR8 A;  3LYK A;  3RHC A;  1NHY A;  2LNS A;  1J0F A;  3FR3 A;  4QQ7 A;  3FMW A;  3HA9 A;  2HSH A;  5AIX A;  4CY6 A;  4TKY A;  2WZ9 A;  3LW9 A;  4BVX A;  4BA7 A;  1U87 A;  1A8Y A;  3EMX A;  3SWL A;  3GX8 A;  6GST A;  5EL8 A;  5IOW A;  1GUM A;  4WXT A;  1FOV A;  13GS A;  1GTB A;  3GYK A;  3APS A;  3WGD A;  1THX A;  4O5U A;  2VL3 A;  4PNF A;  4MMM A;  1JHB A;  3LSZ A;  4NXI A;  5H5S A;  2RM6 A;  1WPI A;  2V41 A;  3GNJ A;  4XCS A;  2MBS A;  4MJC A;  1KEB A;  3UL3 A;  4WR5 A;  4NV5 A;  5BRT A;  2VCW A;  2I1U A;  3F6F A;  2DSA A;  5A4V A;  5CRD A;  3Q6O A;  1FB6 A;  5GST A;  2EIR A;  2C3Q A;  1X5E A;  2IMK A;  2ES7 A;  1X5D A;  2QSI A;  3IHG A;  2P0G A;  5DJM A;  2JAD A;  3D22 A;  3KP8 A;  3L9U A;  3LYP A;  3VWW A;  2IME A;  1M0U A;  3HVV A;  4PUF C;  2VUP A;  3GX0 A;  20GS A;  4EDY A;  2ZUP A;  1QGV A;  4EXJ A;  3GUS A;  1U88 A;  3MSZ A;  2V2G A;  2V6O A;  4TXO A;  1FB0 A;  1O7U A;  3A2X A;  4GSN A;  3C8E A;  2C0D A;  5JWO B;  2PER A;  4OD7 A;  1VF1 A;  3IOS A;  5J3R A;  4HJ2 A;  1OC9 B;  4MH3 A;  2FLS A;  1K0N A;  4I2U A;  4ZIL A;  3KM6 A;  6GSY A;  3IHQ A;  1T00 A;  2HT9 A;  3FR6 A;  3LOR A;  4GTU A;  1M3J A;  3GV1 A;  2QA2 A;  3C73 A;  3WYW A;  1Q98 A;  1SKS B;  2B5X A;  3D4T A;  4EC0 A;  4MNN A;  1SD9 A;  4MDC A;  1T1V A;  4ECI A;  3SBC A;  5DCG A;  3IDV A;  1AUC A;  2OBI A;  4X1U A;  4FH8 A;  5F8B A;  3I43 A;  5B8B A;  5C00 A;  4G0K A;  3MIX A;  3M3M A;  5ID2 B;  1NW2 A;  2GLR A;  1TOF A;  3ZFL A;  5ENU A;  5CAX A;  1GSF A;  2PBJ A;  5DAL B;  4L5L A;  3W8S A;  2D2Z A;  1VF3 A;  3VFI A;  5G5F A;  1NM3 A;  1TTZ A;  4EUY A;  3TGZ A;  1X9M B;  1XPV A;  3VPQ A;  1EV4 A;  3UVH A;  2FY6 A;  1WE0 A;  4KDX A;  4ISD A;  3FZ5 A;  3GKM A;  2VM1 A;  4IJ3 A;  2JZR A;  3CSJ A;  2MYG A;  3VWX A;  5CP1 A;  5DVB A;  1GUL A;  1R26 A;  3U5R E;  1FVK A;  1GNW A;  4O7H A;  5AIV A;  3O6T A;  4KDU A;  3DYR A;  4ECC A;  1YJ6 A;  1WIK A;  4MJB A;  1TRU A;  2I4A A;  2QGV A;  3W8J A;  2KP1 A;  3FK8 A;  4OCF A;  1AQX A;  4JBB A;  4L0U A;  1V57 A;  3DXB A;  2H0H A;  3D6I A;  3TKR A;  3DRN A;  2VL9 A;  3GH6 A;  2H19 A;  1OVN A;  3GKK A;  2YWM A;  4ECB A;  4ZB6 A;  2DJJ A;  4BWQ A;  4ZL9 A;  4CW9 A;  5ECP B;  4F2I A;  1ERU A;  2HYX A;  3EYT A;  1TI1 A;  1Z6M A;  1DSB A;  4LL4 B;  3QFA C;  4WBR D;  4HQZ A;  4D73 A;  3RHB A;  2KHP A;  3A3T A;  2BMX A;  4KF9 A;  2H76 A;  2A2R A;  4XRD A;  3BD2 A;  1GTU A;  2JSY A;  3ZFB A;  1G0T A;  1XWK A;  3A5W A;  4HZ4 A;  1RK4 A;  1SYR A;  3IK7 A;  2FA8 A;  1BG5 A;  2FWG A;  2HZE B;  19GS A;  2L6C A;  2LJR A;  2MMZ A;  2IL3 A;  3N5O A;  2X99 A;  2O85 A;  4L0W A;  2P5R A;  2H74 A;  1YKC A;  1VGL A;  5J5N A;  2H1G A;  3U6V A;  1K0O A;  4KH7 A;  2GQK A;  17GS A;  4K1F A;  2ALB A;  3IC8 A;  3DEX A;  1ZYN A;  2LEG A;  1SU9 A;  4FYU A;  2H30 A;  4YQV A;  2R0C A;  1USB A;  2PVQ A;  4XRA A;  4OCE A;  2GQL A;  2YZH A;  3ZTL A;  2ON7 A;  3KZQ A;  1SJI A;  1V9W A;  4TR1 B;  2VO4 A;  2V6K A;  2J23 A;  1TP9 A;  3A2V A;  1GTA A;  5AN1 A;  3IBH A;  2IFQ B;  1M3I A;  1EV9 A;  5D9W A;  1VRS D;  4RQX A;  2CVB A;  3J7Y k;  2YOI A;  4L8E A;  3LQ7 A;  3GTU A;  1OC9 A;  2OBK A;  3P90 A;  4IQA A;  5J4U A;  5KN0 A;  2H6X A;  5IMV A;  4HOJ A;  2M72 A;  3ZVJ D;  3H4K A;  1GH2 A;  3QDN A;  4TOP A;  3CQF A;  3VI5 A;  1F3A A;  5AIS A;  4K0G A;  3HY2 A;  3D0Z A;  2B6M A;  3RBT A;  4GLT A;  1GUH A;  3RPP A;  4ML1 A;  2C0E A;  3JCM L;  1ZYE A;  4RQR A;  4RI6 A;  4Z7X A;  2NBS A;  4MLY A;  1F37 A;  3HVX A;  2QC7 A;  4DEJ A;  4GQF A;  4LL1 B;  2VM2 A;  4WET A;  5JCW A;  4X43 A;  5IMZ A;  2R5G A;  1AAZ A;  1JZD A;  3TJJ A;  3RDW A;  4MP4 A;  1VF2 A;  4PXO A;  3J81 I;  4LMV A;  5E59 A;  1PN0 A;  2LJK A;  2CVK A;  1T8E B;  3GKX A;  5FLX I;  2DJ2 A;  3ZML A;  2HSM A;  2TRC P;  4PUR A;  5DCH A;  4MH2 A;  4POK A;  3HJM A;  4HI7 A;  3VLN A;  2VL2 A;  2YZU A;  4J57 E;  1F2E A;  5KOX A;  2K6V A;  4ACS A;  4K9Z A;  1AIU A;  1Z6N A;  3F4S A;  4ZBD A;  1QMV A;  4IJI A;  1EP8 A;  5KN1 A;  1TU7 A;  4FYB A;  4IVF A;  2C1Y A;  3F4T A;  3GL5 A;  2JZT A;  4WBJ A;  4ZIJ A;  1XVW A;  1FAA A;  3O3T A;  2HRK A;  4TR4 A;  5EY6 A;  1FVJ A;  2PWJ A;  4GQC A;  6GSV A;  3JAM I;  2YWO A;  4IEL A;  3FRC A;  4E8H A;  3ZLP A;  5HR3 A;  1QFN A;  1K0C A;  3HJP A;  1N2A A;  1Y25 A;  2X8C A;  3WD6 A;  3E3E A;  5G1K A;  4Z2T A;  5IO0 A;  2C0F A;  1PFO A;  1KTE A;  4IP1 A;  4BPY A;  3IR4 A;  1LJR A;  3ME7 A;  3D4M A;  1FOH A;  2R0G A;  1YKA A;  3TRQ A;  3L9S A;  1HYU A;  4NMU A;  2H01 A;  3RPN A;  4BVY A;  5CYY A;  4AJ6 A;  3F9U A;  1ERT A;  2R6K A;  1N8J A;  1XOB A;  2DJ1 A;  2FCH A;  5ECR B;  3F3R A;  3M1G A;  2VAF A;  1SL2 B;  2G0F A;  2LQO A;  4G0L A;  4O5R A;  1XW9 A;  1AW9 A;  2K8S A;  2O8V B;  2KUC A;  1BX9 A;  1PQN A;  1WRY A;  5F07 A;  1T3B A;  3MAK A;  2GZP A;  1DUG A;  4JE1 A;  4GST A;  2IJY A;  5LD0 A;  1UN2 A;  4G2E A;  2GTU A;  1IYI A;  2GZZ A;  3HJO A;  4KCE A;  1O81 A;  4TVE A;  3GSS A;  3MYD A;  4EDZ A;  5ECM B;  5IMA A;  4TR1 A;  1EGR A;  1X5C A;  2CZ3 A;  4JU5 A;  1RW1 A;  14GS A;  2IFQ A;  1ON4 A;  5IPG A;  2XPE A;  2WCI A;  3A2W A;  1HQO A;  5A4U A;  4DSR A;  2LRC A;  4EE0 A;  4E8E A;  3M9J A;  4DSS B;  2YAN A;  1SYX A;  1GNE A;  2HSY A;  1B4Q A;  3C71 A;  3UEM A;  1XW5 A;  3Q74 A;  2WDU A;  5A2Q I;  1MDK A;  2GDR A;  2LRT A;  4K5S A;  1THO A;  3P7X A;  4AJ7 A;  4BL7 A;  3KH7 A;  2HI7 A;  2FUG 2;  1EWX A;  3KCM A;  5D9V A;  1QUW A;  3GST A;  1TW9 A;  3ZMK A;  3BOA A;  4JED A;  1YF0 A;  2YJH A;  1K0B A;  2L6D A;  2K18 A;  5FT3 A;  1EP7 A;  1XOA A;  3LG6 A;  1B48 A;  4YQM A;  5G30 A;  3LJR A;  5LNK e;  3BBY A;  5IMD A;  1EZK A;  2OJL A;  1YDK A;  2C8U A;  3ZVJ A;  1OYJ A;  3UBL A;  2LNT A;  2MZC A;  1YEX A;  4ID0 A;  1TI3 A;  3CRU A;  1Z5Y E;  2OA7 A;  2JU5 A;  2H1B A;  4MF7 A;  2J9H A;  2JL4 A;  5DDL A;  1Z7P A;  3L78 A;  2G2Q A;  1MD4 A;  2HZF A;  2H72 A;  2NTO A;  3GRX A;  5B7C A;  1O85 A;  1WWJ A;  3GFK A;  1K3O A;  2RII A;  4K8M A;  1A2L A;  3HZ4 A;  2H73 A;  4CDO A;  1GLQ A;  5EVO A;  2RUE A;  1X9S B;  2VLT A;  1PKW A;  1MEK A;  2VCV A;  4KND A;  4CHS A;  1OKT A;  4WF5 A;  3TKS A;  1X0R A;  3CSH A;  2LS5 A;  3QFB C;  4IHU A;  3QAV A;  4K6X A;  1DBY A;  4ILF A;  1SL0 B;  5DQS A;  1SJ6 A;  2BTO T;  3LFL A;  2DKI A;  3ZYW A;  5ABR A;  2H0G A;  3IC4 A;  2REM A;  1GSQ A;  1ILO A;  4YKF A;  4Q5F A;  1PL1 A;  5HR1 A;  2YPM A;  2AV4 A;  3TKQ A;  3UAR A;  2VOC A;  1NSW A;  5KEJ A;  4USS A;  4PNG A;  4IP6 A;  3CXG A;  2CZ2 A;  3DWV A;  3KH9 A;  3LXT A;  2X64 A;  4ZBA A;  2XHF A;  3TOT A;  2CAQ A;  1S3D A;  1Z3E A;  2H70 A;  2YP6 A;  2C4J A;  3Q19 A;  2VCZ A;  3TRP A;  5ECH B;  5ELA A;  1A0R P;  1TK5 B;  1EOG A;  3DVX A;  3I69 A;  3P8W A;  2PUK C;  2VCT A;  2VLV A;  4K7I A;  4I8B A;  5J41 A;  4PQH A;  4PQ1 A;  4F0B A;  4V2L A;  1KBN A;  2E0Q A;  4WEY A;  2AHE A;  1A8L A;  4HU7 A;  5JCG A;  3H1N A;  2FNO A;  2VCX A;  4G9H A;  1ML6 A;  1SKW B;  5F06 A;  3QOU A;  7GSS A;  1PSQ A;  1BYE A;  4DSQ A;  1SK0 A;  2OE3 A;  2LJA A;  1BJX A;  2LQQ A;  2OE0 A;  5IQY A;  4POM A;  4HDE A;  3EIN A;  1LU4 A;  2DIY A;  4OMV A;  5GAP D;  1TRS A;  1FW1 A;  18GS A;  3HCZ A;  2YWN A;  2WFC A;  1UVZ A;  4XS1 A;  4K2X A;  1F6M C;  3HHV A;  4XTS A;  1XWB A;  4GSS A;  1YY7 A;  4AF2 A;  5IOX A;  1DE2 A;  2NVL A;  5CRW A;  5D96 A;  2LV3 A;  2FWH A;  4LLR A;  2HRN A;  2FWE A;  1GSD A;  4ZB8 A;  2N5F A;  1ERW A;  3GN3 A;  2DIZ A;  2A2P A;  3KMN A;  2F3M A;  2ZCT A;  5DAK B;  1U3I A;  2HRA A;  1FO5 A;  1AC1 A;  4XS4 B;  3VI7 A;  4MAB A;  5A5K A;  1ZOF A;  4KE3 A;  5F05 A;  5C04 A;  4N0Z A;  2F8A A;  3KJY A;  3TJG A;  4HU9 A;  1OC8 A;  1K0M A;  2F51 A;  2XBQ A;  1PX6 A;  3N9J A;  4LA1 A;  2A4H A;  6GSW A;  1XG8 A;  1TRW A;  3QR6 A;  4Z2U A;  3VPT A;  4O92 A;  2L4Q A;  4MF5 A;  3HVN A;  2P5Q A;  5ECI B;  2IIY A;  1EGO A;  2HNL A;  1J08 A;  10GS A;  16GS A;  2JZS A;  2HLS A;  4KSM A;  1GUK A;  1V58 A;  2H1D A;  4L5O A;  2H71 A;  4OFT A;  1A24 A;  2WB9 A;  3W6G A;  2CX4 A;  4Q5Q A;  1GSU A;  2K9F A;  4PQI A;  4OO5 A;  4TR3 A;  4ICY A;  4BVX B;  2CQ9 A;  3CSI A;  1QXH A;  5KN3 A;  5D73 A;  4G0I A;  2GT6 A;  3EU3 A;  1AQW A;  1K0A A;  4P3Y B;  1SK1 A;  3UOM A;  1BQ7 A;  5B8A A;  2VL2 C;  1V2A A;  2XPD A;  4H86 A;  1PX7 A;  5DBQ A;  5L71 A;  5G31 A;  4GRF A;  1PRX A;  1O6J A;  2E2G A;  5HR0 A;  2H1A A;  3CYN A;  1JLW A;  4WKW A;  3L0H A;  1K3L A;  3HDC A;  2IMF A;  3ERF A;  4JZQ A;  2HE3 A;  5ID2 A;  1XFL A;  2WJU A;  2DMM A;  1HNB A;  5IM9 A;  5FWG A;  3GUR A;  2FD3 A;  2TIR A;  1WOU A;  2F8F A;  4MA9 A;  2M46 A;  3QD9 A;  1R7H A;  2VLU A;  5DAL A;  2OAD A;  1XCC A;  1HNA A;  2P31 A;  1ZYQ B;  3H79 A;  4POB A;  3HKR A;  3ZIJ A;  3C1S A;  1MTC A;  1TU8 A;  4NPB A;  1X9W B;  3G7I A;  3GHA A;  1TK0 B;  3G7Y A;  1DE1 A;  5JWQ B;  4ZXG A;  1MD3 A;  4V1A p;  4K2D A;  4AJ8 A;  4KAE A;  5HFK A;  1Q4J A;  1JZW A;  2C3T A;  3NZN A;  4EKZ A;  1M2D A;  3IXR A;  2QKE A;  5IT9 I;  5HFI A;  2VD0 A;  1WMJ A;  1OE7 A;  4GCI A;  5J9C A;  4EL1 A;  3M9K A;  3FHK A;  1A2M A;  3DVW A;  3NIV A;  2GSR A;  1K0D A;  3G7J A;  1XBS A;  3ZRD A;  3J80 I;  2DKH A;  3CBU A;  4IS0 A;  2AJQ B;  4O5Q A;  3CTF A;  5F0G A;  2N5A A;  2K8V A;  1ST9 A;  3LEF A;  3IK9 A;  4G10 A;  1F3B A;  1XWG A;  1XZO A;  2PN8 A;  2AAW A;  1O73 A;  5IMF A;  1QQ2 A;  2H8L A;  1YF1 A;  4RI7 A;  2PVO C;  2A4V A;  4PTS A;  2YV9 A;  4HQS A;  3QMX A;  2FHE A;  1ZCP A;  3F8U A;  1B9X C;  1S3C A;  1PKZ A;  2HZE A;  2M80 A;  2H0I A;  2PGT A;  5FHI A;  1YEP A;  3PPU A;  5DAK A;  1FG4 A;  4KUN A;  3CMI A;  2B1K A;  4XS4 A;  5AGY A;  3I9V 2; 
#chains in the Genus database with same CATH homology
 4I2T A;  2H75 A;  5CRH A;  1O8W A;  1WJK A;  5H5Q A;  1RQM A;  3FEU A;  1C72 A;  3TJF A;  4MZC A;  5DJL A;  3ED3 A;  1UA5 A;  2V1M A;  1R5P A;  2JAC A;  1HNC A;  1EOH A;  1ZGN A;  5KOW A;  4HJM A;  5GZZ B;  4IW9 A;  2I81 A;  2MMO A;  1G7E A;  11GS A;  1T7P B;  1FHE A;  4N30 A;  2C0G A;  5IPH A;  4KX4 A;  1OE8 A;  2AB6 A;  4IKH A;  2IWT A;  3APQ A;  4FYC A;  2B7K A;  5ECQ B;  2KOK A;  1B4P A;  3BJ5 A;  1GL8 A;  4MK3 A;  1S3A A;  1R5A A;  4KGI A;  4D73 B;  4FIW A;  1XXU A;  3R3E A;  2LTK A;  8GSS A;  4K5R A;  4KW6 A;  1ABA A;  4XIH A;  3EC3 A;  1TRV A;  1XWC A;  3TJK A;  4MJA A;  3TRX A;  3IV4 A;  1Z7R A;  1JFU A;  1QK8 A;  5A4W A;  3TKS C;  2RM5 A;  1PL2 A;  1ZZY A;  3L4N A;  3TKS E;  4EIP A;  2F9S A;  2Z9S A;  4KCA A;  1I5G A;  2WGR A;  5H5R A;  1SK2 A;  2E7P A;  3D5J A;  4HEA 2;  1PD2 1;  5EPF A;  4XHM A;  3ZZX A;  1B9Y C;  1A0F A;  4MCU A;  2QA1 A;  4NAX A;  3L9V A;  4YAV A;  1B8X A;  2RLI A;  1YZX A;  3PGT A;  3A5I A;  2H66 A;  2GT5 A;  3FZ4 A;  4FQU A;  3TKP A;  3EWL A;  1NHO A;  4NHW A;  1EEJ A;  4Q5N A;  1Y6E A;  2DBC A;  1O8X A;  2MBT A;  3UIW A;  2I3Y A;  2B5E A;  2FGX A;  5J9B A;  1ERV A;  1TXX A;  3MWH A;  4N10 A;  5D8I A;  5B6M A;  3EVI A;  3WT2 A;  1OC3 A;  3APO A;  3EU4 A;  5COH A;  1JZO A;  2CA8 A;  3GTU B;  4GXZ A;  2YJ7 A;  4OFM A;  4FO5 A;  1TJD A;  5ECO B;  3WGX A;  3C1R A;  1GSY A;  4V2N A;  4ECJ A;  2GST A;  2X8G A;  2OKA A;  3PH9 A;  2GQM A;  3HVS A;  2MMA A;  4MPF A;  1H75 A;  3C7M A;  3IAM 2;  2R3X A;  3DIE A;  4YAP A;  2BJX A;  3GIX A;  2GVP A;  4LMW A;  4YQU A;  5CRE A;  2IMD A;  5BMU A;  4EF0 A;  4IN0 A;  4PGT A;  5KN2 A;  2X49 A;  3IRA A;  5IIZ A;  2GZY A;  3FZ9 A;  2A2S A;  2AUV A;  5G5E A;  5LCZ A;  4HUA A;  2V32 A;  5CO3 A;  1VF4 A;  3R2Q A;  1TDI A;  3KD0 A;  3FW2 A;  4KDY A;  1GSE A;  2HXK A;  5B6N A;  3WGE A;  3F4R A;  4K7O A;  2WUL A;  5ECN B;  2I9H A;  3GL3 A;  3F6D A;  2DJ3 A;  6GSX A;  3ZRE A;  4K0N A;  1JLV A;  3G9B A;  3FKF A;  2O7K A;  2LST A;  1LBK A;  4Z2R A;  4K7N A;  3IA1 A;  2LUS A;  3UVT A;  3HD5 A;  1U6T A;  3TCO A;  4TRX A;  5ELG A;  1I9D A;  2GSQ A;  2PPT A;  4X4J A;  1G6W A;  3UBK A;  3M8N A;  1URM A;  4EO3 A;  2IPA A;  5JCU A;  3DML A;  4I97 A;  2UZ8 A;  3H8Q A;  3BCK A;  3US3 A;  4HS1 A;  4ZBB A;  2PU9 C;  1XIY A;  2FWF A;  2B3S A;  2E2M A;  2HFD A;  3UMA A;  3S9F A;  2H6Z A;  2DJK A;  2AYT A;  3IE3 A;  1GLP A;  2EC4 A;  2PMT A;  1JZR A;  1R4W A;  5HFG A;  2XC2 A;  9GSS A;  3EUR A;  3GH9 A;  3RAZ A;  2GGT A;  2NDO A;  2LRN A;  2YV7 A;  6GSU A;  5INY A;  2CVD A;  3I6A A;  3GMF A;  4XS6 A;  4I5Q A;  4MJE A;  4IGJ A;  2DJ0 A;  3M0F A;  4F9Z A;  4F0C A;  1PA3 A;  4DSS A;  1E2Y A;  4QL9 A;  1A2J A;  1TK8 B;  2HRF A;  2C80 A;  4ZL7 A;  4KA0 A;  4MZB A;  1G7O A;  4PX1 A;  1XW6 A;  1WP0 A;  4DVC A;  1PN9 A;  3TJB A;  1PGT A;  2L5O A;  4AGS A;  1ACV A;  1GTI A;  3QCP A;  2WS2 A;  4BVY B;  4GWR A;  1GP1 A;  4HZ2 A;  3HYP A;  4JR4 A;  1TKD B;  3WT1 A;  3BCI A;  2DLX A;  1AQV A;  2O89 A;  1ZMA A;  2L5L A;  3E9J B;  1SEN A;  4KSO A;  1PMT A;  3PIN A;  4TXV A;  3TDG A;  1UC7 A;  1MDJ A;  2YNX A;  3MNG A;  2R37 A;  2O87 A;  3HXS A;  2OE1 A;  3F0I A;  1M9B A;  2RUF A;  5CNW A;  2CX3 A;  3KXO A;  4NWY A;  1IYH A;  3UAP A;  5G2Z A;  1XVQ A;  3KTB A;  2CT6 A;  2B7J A;  2YCD A;  3ZIV A;  5JWR B;  2L4C A;  5D93 A;  3CRT A;  3CTG A;  5IMC A;  1KNG A;  3QAG A;  2ON5 A;  2ZNM A;  1T4Y A;  3KGK A;  22GS A;  2JSZ A;  2DC5 A;  2IN3 A;  5HQP A;  3ISO A;  2VD1 A;  5IO2 A;  3OR5 A;  1Z9H A;  4KB3 A;  1W4V A;  2MMN A;  2EIQ A;  4BL7 B;  2X4A A;  5GSS A;  1CQG A;  3F63 A;  2R4V A;  5GAN D;  5D9T A;  3TOU A;  1W89 A;  1BAY A;  4PUA A;  3KMO A;  4ULX A;  1M2B A;  1J9B A;  3VUR A;  1E6B A;  1SD8 A;  2R0P A;  4OFN A;  4TW5 A;  5ECK B;  2IMI A;  3DD3 A;  1GSS A;  3LWA A;  4OO4 A;  5HR2 A;  3F3Q A;  4YKG A;  3K8N A;  4EIQ A;  4J56 E;  3FYG A;  3KIJ A;  4NV2 A;  1SKR B;  2VIM A;  4WR4 A;  4J2F A;  1HD2 A;  1G6Y A;  2CV4 A;  3DKS A;  3Q18 A;  3VWU A;  3EMP A;  4TXO B;  3FY7 A;  2C3N A;  4V1A g;  3ZIT A;  1M99 A;  2L57 A;  2TRX A;  3LGC A;  2GS3 A;  4BWS A;  1V98 A;  3TB2 A;  1M7T A;  3D21 A;  4F82 A;  2N5B A;  4ZB9 A;  1M2A A;  4ZL8 A;  5D9X A;  1SL1 B;  3VK9 A;  2B5Y A;  5ECS A;  3AY8 A;  2XBI A;  4JR6 A;  4N11 A;  3TUE A;  2EIO A;  3ERW A;  5G1L A;  3J7Y b;  1U3A A;  3DGQ A;  1BED A;  1CQH A;  3UJ1 A;  3E0U A;  1GRX A;  2L59 A;  4QL7 A;  3FZA A;  3VWV A;  3HZ8 A;  3ERG A;  2KLX A;  3KEB A;  3V1W A;  1V40 A;  3EE2 A;  1F9M A;  4RUV A;  2CAI A;  4GF0 A;  4TR0 A;  1H4O A;  2WRT A;  3QAW A;  1AXD A;  3H93 A;  1MDI A;  1XWA A;  3GKN A;  2X8H A;  2GSS A;  4ML6 A;  4G19 A;  3FR9 A;  2LKU A;  3O76 A;  2FA4 A;  1M9A A;  1OKD A;  4POL A;  12GS A;  1YQ1 A;  4IQ1 A;  4WF4 A;  4MZW A;  4TN8 A;  5ECL B;  4OWY A;  3KP9 A;  3IAS 2;  4Q5R A;  3GA4 A;  2H6Y A;  2YN1 A;  3P2A A;  4EVM A;  5E4W A;  5CRG A;  4F03 A;  3MDK A;  4IBP A;  4N0V A;  1K3Y A;  3KTL A;  4O32 A;  4I6X A;  4MPG A;  3QPM A;  4A5P A;  5DQY A;  2YWI A;  4X0X A;  1SJZ A;  3ZL5 A;  3IPZ A;  3ME8 A;  4MF6 A;  1EEM A;  2B1L A;  3LXZ A;  1OAZ A;  3EPT A;  6GSS A;  1A23 A;  1GWC A;  2R2J A;  4YH2 A;  4V2M A;  2NPB A;  2VCQ A;  1ZYP A;  4NHZ A;  2OAC A;  3NOF A;  2KP2 A;  4JRR A;  1T4Z A;  4CY8 A;  2DML A;  1ZL9 A;  3PR8 A;  3LYK A;  3RHC A;  1NHY A;  2LNS A;  1J0F A;  3FR3 A;  4QQ7 A;  3FMW A;  3HA9 A;  2HSH A;  5AIX A;  4CY6 A;  4TKY A;  2WZ9 A;  3LW9 A;  4BVX A;  4BA7 A;  1U87 A;  1A8Y A;  3EMX A;  3SWL A;  3GX8 A;  6GST A;  5EL8 A;  5IOW A;  1GUM A;  4WXT A;  1FOV A;  13GS A;  1GTB A;  3GYK A;  3APS A;  3WGD A;  1THX A;  4O5U A;  2VL3 A;  4PNF A;  4MMM A;  1JHB A;  3LSZ A;  4NXI A;  5H5S A;  2RM6 A;  1WPI A;  2V41 A;  3GNJ A;  4XCS A;  2MBS A;  4MJC A;  1KEB A;  3UL3 A;  4WR5 A;  4NV5 A;  5BRT A;  2VCW A;  2I1U A;  3F6F A;  2DSA A;  5A4V A;  5CRD A;  3Q6O A;  1FB6 A;  5GST A;  2EIR A;  2C3Q A;  1X5E A;  2IMK A;  2ES7 A;  1X5D A;  2QSI A;  3IHG A;  2P0G A;  5DJM A;  2JAD A;  3D22 A;  3KP8 A;  3L9U A;  3LYP A;  3VWW A;  2IME A;  1M0U A;  3HVV A;  4PUF C;  2VUP A;  3GX0 A;  20GS A;  4EDY A;  2ZUP A;  1QGV A;  4EXJ A;  3GUS A;  1U88 A;  3MSZ A;  2V2G A;  2V6O A;  4TXO A;  1FB0 A;  1O7U A;  3A2X A;  4GSN A;  3C8E A;  2C0D A;  5JWO B;  2PER A;  4OD7 A;  1VF1 A;  3IOS A;  5J3R A;  4HJ2 A;  1OC9 B;  4MH3 A;  2FLS A;  1K0N A;  4I2U A;  4ZIL A;  3KM6 A;  6GSY A;  3IHQ A;  1T00 A;  2HT9 A;  3FR6 A;  3LOR A;  4GTU A;  3GV1 A;  2QA2 A;  3C73 A;  3WYW A;  1Q98 A;  1SKS B;  2B5X A;  3D4T A;  4EC0 A;  4MNN A;  1SD9 A;  4MDC A;  1T1V A;  4ECI A;  3SBC A;  5DCG A;  3IDV A;  1AUC A;  2OBI A;  4X1U A;  4FH8 A;  5F8B A;  3I43 A;  5B8B A;  5C00 A;  4G0K A;  3MIX A;  3M3M A;  5ID2 B;  1NW2 A;  2GLR A;  1TOF A;  3ZFL A;  5ENU A;  5CAX A;  1GSF A;  2PBJ A;  5DAL B;  4L5L A;  3W8S A;  2D2Z A;  1VF3 A;  3VFI A;  5G5F A;  1NM3 A;  1TTZ A;  4EUY A;  3TGZ A;  1X9M B;  1XPV A;  3VPQ A;  1EV4 A;  3UVH A;  2FY6 A;  1WE0 A;  4KDX A;  4ISD A;  3FZ5 A;  3GKM A;  2VM1 A;  4IJ3 A;  2JZR A;  3CSJ A;  2MYG A;  3VWX A;  5CP1 A;  5DVB A;  1GUL A;  1R26 A;  3U5R E;  1FVK A;  1GNW A;  4O7H A;  5AIV A;  3O6T A;  4KDU A;  3DYR A;  4ECC A;  1YJ6 A;  1WIK A;  4MJB A;  1TRU A;  2I4A A;  2QGV A;  3W8J A;  2KP1 A;  3FK8 A;  4OCF A;  1AQX A;  4JBB A;  4L0U A;  1V57 A;  3DXB A;  2H0H A;  3D6I A;  3TKR A;  3DRN A;  2VL9 A;  3GH6 A;  2H19 A;  1OVN A;  3GKK A;  2YWM A;  4ECB A;  4ZB6 A;  2DJJ A;  4BWQ A;  4ZL9 A;  4CW9 A;  5ECP B;  4F2I A;  1ERU A;  2HYX A;  3EYT A;  1TI1 A;  1Z6M A;  1DSB A;  4LL4 B;  3QFA C;  4WBR D;  4HQZ A;  4D73 A;  3RHB A;  2KHP A;  3A3T A;  2BMX A;  4KF9 A;  2H76 A;  2A2R A;  4XRD A;  3BD2 A;  1GTU A;  2JSY A;  3ZFB A;  1G0T A;  1XWK A;  3A5W A;  4HZ4 A;  1RK4 A;  1SYR A;  3IK7 A;  2FA8 A;  1BG5 A;  2FWG A;  2HZE B;  19GS A;  2L6C A;  2LJR A;  2MMZ A;  2IL3 A;  3N5O A;  2X99 A;  2O85 A;  4L0W A;  2P5R A;  2H74 A;  1YKC A;  1VGL A;  5J5N A;  2H1G A;  3U6V A;  1K0O A;  4KH7 A;  2GQK A;  17GS A;  4K1F A;  2ALB A;  3IC8 A;  3DEX A;  1ZYN A;  2LEG A;  1SU9 A;  4FYU A;  2H30 A;  4YQV A;  2R0C A;  1USB A;  2PVQ A;  4XRA A;  4OCE A;  2GQL A;  2YZH A;  3ZTL A;  2ON7 A;  3KZQ A;  1SJI A;  1V9W A;  4TR1 B;  2VO4 A;  2V6K A;  2J23 A;  1TP9 A;  3A2V A;  1GTA A;  5AN1 A;  3IBH A;  2IFQ B;  1EV9 A;  5D9W A;  1VRS D;  4RQX A;  2CVB A;  3J7Y k;  2YOI A;  4L8E A;  3LQ7 A;  3GTU A;  1OC9 A;  2OBK A;  3P90 A;  4IQA A;  5J4U A;  5KN0 A;  2H6X A;  5IMV A;  4HOJ A;  2M72 A;  3ZVJ D;  3H4K A;  1GH2 A;  3QDN A;  4TOP A;  3VI5 A;  1F3A A;  5AIS A;  4K0G A;  3HY2 A;  3D0Z A;  2B6M A;  3RBT A;  4GLT A;  1GUH A;  3RPP A;  4ML1 A;  2C0E A;  3JCM L;  1ZYE A;  4RQR A;  4RI6 A;  4Z7X A;  2NBS A;  4MLY A;  1F37 A;  3HVX A;  2QC7 A;  4DEJ A;  4GQF A;  4LL1 B;  2VM2 A;  4WET A;  5JCW A;  4X43 A;  5IMZ A;  2R5G A;  1AAZ A;  1JZD A;  3TJJ A;  3RDW A;  4MP4 A;  1VF2 A;  4PXO A;  4LMV A;  5E59 A;  1PN0 A;  2LJK A;  2CVK A;  1T8E B;  3GKX A;  2DJ2 A;  3ZML A;  2HSM A;  2TRC P;  4PUR A;  5DCH A;  4MH2 A;  4POK A;  3HJM A;  4HI7 A;  3VLN A;  2VL2 A;  2YZU A;  4J57 E;  1F2E A;  5KOX A;  2K6V A;  4ACS A;  4K9Z A;  1AIU A;  1Z6N A;  3F4S A;  4ZBD A;  1QMV A;  4IJI A;  1EP8 A;  5KN1 A;  1TU7 A;  4FYB A;  4IVF A;  2C1Y A;  3F4T A;  3GL5 A;  2JZT A;  4WBJ A;  4ZIJ A;  1XVW A;  1FAA A;  3O3T A;  2HRK A;  4TR4 A;  5EY6 A;  1FVJ A;  2PWJ A;  4GQC A;  6GSV A;  2YWO A;  4IEL A;  3FRC A;  4E8H A;  3ZLP A;  5HR3 A;  1QFN A;  1K0C A;  3HJP A;  1N2A A;  1Y25 A;  2X8C A;  3WD6 A;  3E3E A;  5G1K A;  4Z2T A;  5IO0 A;  2C0F A;  1KTE A;  4IP1 A;  4BPY A;  3IR4 A;  1LJR A;  3ME7 A;  3D4M A;  1FOH A;  2R0G A;  1YKA A;  3TRQ A;  3L9S A;  1HYU A;  4NMU A;  2H01 A;  3RPN A;  4BVY A;  5CYY A;  4AJ6 A;  3F9U A;  1ERT A;  2R6K A;  1N8J A;  1XOB A;  2DJ1 A;  2FCH A;  5ECR B;  3F3R A;  3M1G A;  2VAF A;  1SL2 B;  2G0F A;  2LQO A;  4G0L A;  4O5R A;  1XW9 A;  1AW9 A;  2K8S A;  2O8V B;  2KUC A;  1BX9 A;  1PQN A;  1WRY A;  5F07 A;  1T3B A;  3MAK A;  2GZP A;  1DUG A;  4JE1 A;  4GST A;  2IJY A;  5LD0 A;  1UN2 A;  4G2E A;  2GTU A;  1IYI A;  2GZZ A;  3HJO A;  4KCE A;  1O81 A;  4TVE A;  3GSS A;  3MYD A;  4EDZ A;  5ECM B;  5IMA A;  4TR1 A;  1EGR A;  1X5C A;  2CZ3 A;  4JU5 A;  1RW1 A;  14GS A;  2IFQ A;  1ON4 A;  5IPG A;  2XPE A;  2WCI A;  3A2W A;  1HQO A;  5A4U A;  4DSR A;  2LRC A;  4EE0 A;  4E8E A;  3M9J A;  4DSS B;  2YAN A;  1SYX A;  1GNE A;  2HSY A;  1B4Q A;  3C71 A;  3UEM A;  1XW5 A;  3Q74 A;  2WDU A;  2LRT A;  1MDK A;  2GDR A;  4K5S A;  1THO A;  3P7X A;  4AJ7 A;  4BL7 A;  3KH7 A;  2HI7 A;  2FUG 2;  1EWX A;  3KCM A;  5D9V A;  1QUW A;  3GST A;  1TW9 A;  3ZMK A;  3BOA A;  4JED A;  1YF0 A;  2YJH A;  1K0B A;  2L6D A;  2K18 A;  5FT3 A;  1EP7 A;  1XOA A;  3LG6 A;  1B48 A;  4YQM A;  5G30 A;  3LJR A;  5LNK e;  3BBY A;  5IMD A;  1EZK A;  2OJL A;  1YDK A;  2C8U A;  3ZVJ A;  1OYJ A;  3UBL A;  2LNT A;  2MZC A;  1YEX A;  4ID0 A;  1TI3 A;  3CRU A;  1Z5Y E;  2OA7 A;  2JU5 A;  2H1B A;  4MF7 A;  2J9H A;  2JL4 A;  5DDL A;  1Z7P A;  3L78 A;  2G2Q A;  1MD4 A;  2HZF A;  2H72 A;  2NTO A;  3GRX A;  5B7C A;  1O85 A;  1WWJ A;  3GFK A;  1K3O A;  2RII A;  4K8M A;  1A2L A;  3HZ4 A;  2H73 A;  4CDO A;  1GLQ A;  5EVO A;  2RUE A;  1X9S B;  2VLT A;  1PKW A;  1MEK A;  2VCV A;  4KND A;  4CHS A;  1OKT A;  4WF5 A;  3TKS A;  1X0R A;  3CSH A;  2LS5 A;  3QFB C;  4IHU A;  3QAV A;  4K6X A;  1DBY A;  4ILF A;  1SL0 B;  5DQS A;  1SJ6 A;  2BTO T;  3LFL A;  2DKI A;  3ZYW A;  5ABR A;  2H0G A;  3IC4 A;  2REM A;  1GSQ A;  1ILO A;  4YKF A;  4Q5F A;  1PL1 A;  5HR1 A;  2YPM A;  2AV4 A;  3TKQ A;  3UAR A;  2VOC A;  1NSW A;  5KEJ A;  4USS A;  4PNG A;  4IP6 A;  3CXG A;  2CZ2 A;  3DWV A;  3KH9 A;  3LXT A;  2X64 A;  4ZBA A;  2XHF A;  3TOT A;  2CAQ A;  1S3D A;  1Z3E A;  2H70 A;  2YP6 A;  2C4J A;  3Q19 A;  2VCZ A;  3TRP A;  5ECH B;  5ELA A;  1A0R P;  1TK5 B;  1EOG A;  3DVX A;  3I69 A;  3P8W A;  2PUK C;  2VCT A;  2VLV A;  4K7I A;  4I8B A;  5J41 A;  4PQH A;  4PQ1 A;  4F0B A;  4V2L A;  1KBN A;  2E0Q A;  4WEY A;  2AHE A;  1A8L A;  4HU7 A;  5JCG A;  3H1N A;  2FNO A;  2VCX A;  4G9H A;  1ML6 A;  1SKW B;  5F06 A;  3QOU A;  7GSS A;  1PSQ A;  1BYE A;  4DSQ A;  1SK0 A;  2OE3 A;  2LJA A;  1BJX A;  2LQQ A;  2OE0 A;  5IQY A;  4POM A;  4HDE A;  3EIN A;  1LU4 A;  2DIY A;  4OMV A;  5GAP D;  1TRS A;  1FW1 A;  18GS A;  3HCZ A;  2YWN A;  2WFC A;  1UVZ A;  4XS1 A;  4K2X A;  1F6M C;  3HHV A;  4XTS A;  1XWB A;  4GSS A;  1YY7 A;  4AF2 A;  5IOX A;  1DE2 A;  2NVL A;  5CRW A;  5D96 A;  2LV3 A;  2FWH A;  4LLR A;  2HRN A;  2FWE A;  1GSD A;  4ZB8 A;  2N5F A;  1ERW A;  3GN3 A;  2DIZ A;  2A2P A;  3KMN A;  2F3M A;  2ZCT A;  5DAK B;  1U3I A;  2HRA A;  1FO5 A;  1AC1 A;  4XS4 B;  3VI7 A;  4MAB A;  5A5K A;  1ZOF A;  4KE3 A;  5F05 A;  5C04 A;  4N0Z A;  2F8A A;  3KJY A;  3TJG A;  4HU9 A;  1OC8 A;  1K0M A;  2F51 A;  2XBQ A;  1PX6 A;  3N9J A;  4LA1 A;  2A4H A;  6GSW A;  1TRW A;  3QR6 A;  4Z2U A;  3VPT A;  4O92 A;  2L4Q A;  4MF5 A;  2P5Q A;  5ECI B;  2IIY A;  1EGO A;  2HNL A;  1J08 A;  10GS A;  16GS A;  2JZS A;  2HLS A;  4KSM A;  1GUK A;  1V58 A;  2H1D A;  4L5O A;  2H71 A;  4OFT A;  1A24 A;  2WB9 A;  3W6G A;  2CX4 A;  4Q5Q A;  1GSU A;  2K9F A;  4PQI A;  4OO5 A;  4TR3 A;  4ICY A;  4BVX B;  2CQ9 A;  3CSI A;  1QXH A;  5KN3 A;  5D73 A;  4G0I A;  2GT6 A;  3EU3 A;  1AQW A;  1K0A A;  4P3Y B;  1SK1 A;  3UOM A;  1BQ7 A;  5B8A A;  2VL2 C;  1V2A A;  2XPD A;  4H86 A;  1PX7 A;  5DBQ A;  5L71 A;  5G31 A;  4GRF A;  1PRX A;  1O6J A;  2E2G A;  5HR0 A;  2H1A A;  3CYN A;  1JLW A;  4WKW A;  3L0H A;  1K3L A;  3HDC A;  2IMF A;  3ERF A;  4JZQ A;  2HE3 A;  5ID2 A;  1XFL A;  2WJU A;  2DMM A;  1HNB A;  5IM9 A;  5FWG A;  3GUR A;  2FD3 A;  2TIR A;  1WOU A;  2F8F A;  4MA9 A;  2M46 A;  3QD9 A;  1R7H A;  2VLU A;  5DAL A;  2OAD A;  1XCC A;  1HNA A;  2P31 A;  1ZYQ B;  3H79 A;  4POB A;  3HKR A;  3ZIJ A;  3C1S A;  1MTC A;  1TU8 A;  4NPB A;  1X9W B;  3G7I A;  3GHA A;  1TK0 B;  3G7Y A;  1DE1 A;  5JWQ B;  4ZXG A;  1MD3 A;  4V1A p;  4K2D A;  4AJ8 A;  4KAE A;  5HFK A;  1Q4J A;  1JZW A;  2C3T A;  3NZN A;  4EKZ A;  1M2D A;  3IXR A;  2QKE A;  5HFI A;  2VD0 A;  1WMJ A;  1OE7 A;  4GCI A;  5J9C A;  4EL1 A;  3M9K A;  3FHK A;  1A2M A;  3DVW A;  3NIV A;  2GSR A;  1K0D A;  3G7J A;  1XBS A;  3ZRD A;  2DKH A;  3CBU A;  4IS0 A;  2AJQ B;  4O5Q A;  3CTF A;  5F0G A;  2N5A A;  2K8V A;  1ST9 A;  3LEF A;  3IK9 A;  4G10 A;  1F3B A;  1XWG A;  1XZO A;  2PN8 A;  2AAW A;  1O73 A;  5IMF A;  1QQ2 A;  2H8L A;  1YF1 A;  4RI7 A;  2PVO C;  2A4V A;  4PTS A;  2YV9 A;  4HQS A;  3QMX A;  2FHE A;  1ZCP A;  3F8U A;  1B9X C;  1S3C A;  1PKZ A;  2HZE A;  2M80 A;  2H0I A;  2PGT A;  5FHI A;  1YEP A;  3PPU A;  5DAK A;  1FG4 A;  4KUN A;  3CMI A;  2B1K A;  4XS4 A;  5AGY A;  3I9V 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...