2TRCP

Phosducin/transducin beta-gamma complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
EGQATHTGPKGVINDWRKFKLESEDGDSIPPSKKEILRQMSSPQSRDDKDSKERMSRKMSIQEYELIHQDKEDEGCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGEQFLETIEKEQKVTTIVVNIYEDGVRGCDALNSSLECLAAEYPMVKFCKIRASNTGAGDRFSSDVLPTLLVYKGGELISNFISVAEQFAEDFFAADVESFLNEYGLLPER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (transducer/transduction)
molecule keywords TRANSDUCIN
publication title Crystal structure at 2.4 angstroms resolution of the complex of transducin betagamma and its regulator, phosducin.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 49
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1997-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.168.10 Mainly Alpha Orthogonal Bundle Phosducin; domain 2 Phosducin, domain 2 2trcP02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2trcP01
3BCIA 1GRXA 1EP8A 2OBKA 3L78A 6GSTA 5LCZA 2B6MA 3GX8A 4F03A 3SWLA 2C0EA 2L5OA 3UBLA 2JU5A 3ZFLA 3KD0A 1VF2A 3V1WA 2C0FA 1B4PA 2DLXA 1Z6NA 5JWOB 4D73A 2WCIA 1SJZA 2K6VA 4ZL9A 4MZWA 2HNLA 4IJ3A 1PSQA 1M2DA 3DIEA 1WRYA 3QAWA 3ZZXA 3F3QA 2ON5A 3D4MA 1W89A 3I43A 3KIJA 1K3OA 2QC7A 4XRDA 2OA7A 1EZKA 1U87A 5G30A 1SKSB 2MMOA 3G7YA 2LQOA 1SYRA 2OACA 3GYKA 2VIMA 5IQYA 3CSIA 2FUG2 1DE1A 1BQ7A 4TRXA 3KXOA 4P3YB 2CAIA 3GTUB 3FY7A 1TW9A 3GNJA 1X5EA 1CQGA 1R7HA 2H01A 2TRXA 3DVXA 3P2AA 1F6MC 4JRRA 4K0GA 1Q4JA 4XS4A 4K2DA 1OC8A 4MJAA 5DJMA 2F51A 1N8JA 2LJAA 4K7NA 1XIYA 4IQ1A 3LXZA 1QK8A 2DJ1A 4KCEA 2PU9C 1R5PA 1M0UA 2CVKA 1A0RP 3FR9A 1AW9A 2JZSA 3M8NA 5A4UA 4POKA 1JZWA 5GSSA 1BYEA 3KMOA 5H5RA 3NOFA 1G0TA 4TXOA 1X5DA 3KTBA 5COHA 3DMLA 1TU7A 2H1GA 5ECNB 2TRCP 5LD0A 4F2IA 1O8WA 2E2GA 5CRGA 1U3IA 3TJBA 3G7JA 4HU7A 2C3NA 1Z7PA 2FA4A 1TRVA 1B8XA 2P5RA 1FOVA 3IA1A 5ABRA 4OFMA 3CRUA 5EVOA 3WT1A 3QAGA 4TR4A 1LBKA 1GUHA 2GQMA 3GIXA 5ECSA 3E9JB 3L9UA 2CVBA 4IHUA 2WZ9A 4K6XA 4QL9A 1I5GA 1M7TA 3ZRDA 4NV2A 3VFIA 1PKWA 4WR4A 1GTUA 3UMAA 3MAKA 1WPIA 2B1KA 1MTCA 4L5OA 3F8UA 2WB9A 3C1SA 4TR3A 1T3BA 3IBHA 1O81A 5JWQB 14GSA 5INYA 4NHZA 1GH2A 2LEGA 5CO3A 4HJ2A 2MZCA 3QMXA 5IMDA 1MD4A 1AC1A 2V2GA 5HFGA 4N11A 1JZDA 4WF4A 2GSQA 3VWXA 3TJFA 1BX9A 4YQUA 4EE0A 2GQKA 3FZAA 3DGQA 4I6XA 4ZL8A 4IVFA 2LJRA 4MZCA 4PNGA 5JCWA 4X43A 2JZTA 4AF2A 4WF5A 1EP7A 5CP1A 4L0WA 5CYYA 2E7PA 5GAPD 1ERWA 5DCGA 4ZXGA 3D21A 3KH7A 2H75A 2IIYA 3HZ4A 4EO3A 3DXBA 4KDYA 3LXTA 1NHOA 1FO5A 4WBRD 5DBQA 1NHYA 4LMWA 4KDXA 5IIZA 3TRPA 4FO5A 2P5QA 5IM9A 5IOWA 4MMMA 3TOTA 2AJQB 5EPFA 3HDCA 2EIQA 4BPYA 3W8SA 1G7EA 1K0BA 4F0CA 2LS5A 9GSSA 3FR3A 1TI3A 1XWAA 19GSA 2LRTA 4KCAA 2I1UA 1T1VA 4OCEA 4HI7A 2A2SA 2P31A 4IN0A 1BJXA 3QAVA 3EE2A 4JR4A 2L4QA 6GSVA 1H75A 4O92A 3LYPA 18GSA 1FHEA 4O5RA 1ILOA 3QOUA 2OE3A 2IPAA 1XWGA 2N5AA 3CTFA 1A23A 1TOFA 1QQ2A 4G10A 2HZFA 3H93A 3H4KA 1IYHA 1M2BA 5J5NA 4JEDA 2XPDA 3BCKA 4O7HA 4JZQA 2AHEA 4FIWA 1UA5A 4I2UA 2OADA 2PVOC 1X9MB 2VM2A 2KP2A 2IFQB 2IMKA 4KNDA 5CRDA 3HCZA 3IHQA 2HRNA 2XC2A 1SK0A 3H79A 1V9WA 4HEA2 2HSHA 1GLPA 3WGXA 1JFUA 4MLYA 3FKFA 2IMEA 2KUCA 4OD7A 2B7KA 2M80A 2LQQA 5HR0A 2H19A 1SJIA 4RUVA 1X0RA 2HYXA 4IBPA 4RI7A 4MF5A 3RHBA 2YOIA 1T8EB 4DSSB 5E4WA 4NPBA 1PGTA 5G5EA 4HQZA 3L4NA 2OJLA 1V58A 6GSWA 3EU4A 5DALA 3C1RA 1ON4A 2B5EA 5AGYA 2DJ3A 1EV9A 4OO5A 1DE2A 5CREA 5HFIA 2CX3A 1AUCA 4LA1A 2YWOA 4JU5A 3ED3A 3E0UA 1A0FA 3HD5A 4KSMA 1E2YA 1XZOA 3GTUA 4XTSA 3O76A 3KZQA 3EVIA 5DCHA 2P0GA 2IN3A 3EURA 3ZYWA 3VWVA 1F3BA 4ML1A 1K0OA 4GLTA 4OMVA 2HSYA 1AXDA 4TKYA 4FYUA 4XS1A 1YDKA 4XIHA 5A5KA 2ZCTA 3JCML 4X1UA 3A2WA 3GL3A 1XWCA 1KEBA 2D2ZA 2H6ZA 4H86A 3GFKA 1TU8A 2H71A 1WE0A 4GQCA 5ID2A 4K7OA 3MSZA 2JSYA 3P8WA 4V2NA 2C8UA 3F4TA 3IR4A 1SL1B 1O85A 2H6XA 3GRXA 2GLRA 4EDZA 3H1NA 4PQIA 1OVNA 3P90A 1OAZA 2EC4A 1OC9B 5A4VA 2XHFA 1HNAA 1T7PB 2FWEA 2YWMA 4ZB6A 1XXUA 3GKNA 1EEJA 2VCWA 3HJMA 5DQYA 1PMTA 2WS2A 3A3TA 2BMXA 1XWBA 1EGRA 3ZL5A 1SU9A 2MMNA 5EL8A 4KUNA 3UVHA 12GSA 2AB6A 3GSTA 3FEUA 1MEKA 3PH9A 4HJMA 2F8FA 1X9WB 2GS3A 3N9JA 1G6WA 5ELAA 2VCXA 4MA9A 4KSOA 3TCOA 3ISOA 4EL1A 2C3QA 5IMFA 2IMIA 2RIIA 2KOKA 4POMA 2VCTA 3G7IA 2B1LA 2H74A 3IK7A 4WXTA 5D93A 5GAND 4ZBDA 3LG6A 5ECHB 1GSDA 4RI6A 4PGTA 2GSSA 2YZUA 3APQA 2R6KA 4BL7A 2VO4A 3WD6A 4PUFC 2GGTA 2X8HA 2GZPA 2JZRA 1N2AA 3KTLA 2CZ2A 2DSAA 1BAYA 2QGVA 4PQ1A 1VGLA 4MF6A 3VWWA 3F3RA 1VF1A 5AN1A 2YJHA 5ENUA 3DWVA 4DVCA 5B8AA 1XOBA 1ZOFA 2MMAA 1WMJA 4EXJA 2IJYA 2V6KA 1FAAA 2L4CA 4LLRA 2K18A 2VL3A 3EWLA 3IDVA 5D9XA 1FB6A 2AYTA 4PXOA 2LSTA 1V98A 5FHIA 2H66A 4HOJA 3CSJA 3G9BA 2VCQA 2DBCA 5KN1A 2DJKA 1O73A 2VLTA 2ZNMA 3VLNA 3Q19A 1PN9A 3CRTA 3GH9A 5J3RA 4L5LA 3F6DA 5D9WA 2PVQA 5IMVA 1YF1A 4PX1A 2B5YA 3IAS2 1EWXA 3TKSA 1PA3A 3FZ5A 3HJPA 3QFAC 4PNFA 1GP1A 1HD2A 1PL1A 1YKAA 1ZCPA 4JR6A 3SBCA 1F9MA 2H0GA 1KTEA 5F07A 3O3TA 1T4YA 2GZYA 5L71A 4TOPA 3M9KA 4ZL7A 4IW9A 22GSA 2E2MA 3HJOA 5IPHA 5J4UA 2AV4A 2H72A 1NM3A 2H73A 1UVZA 2VLVA 1FB0A 4NMUA 1A2LA 3VI5A 3R2QA 2IWTA 3DKSA 1GTAA 1WJKA 4Z7XA 1X5CA 2K8VA 3EMPA 3UL3A 17GSA 4MJBA 4GF0A 1TI1A 1M99A 4G9HA 1XVQA 1QMVA 2H8LA 3CXGA 3ZIVA 2BJXA 4EDYA 4ZIJA 3DVWA 1GULA 2GQLA 4MPFA 1ML6A 3VWUA 2KLXA 1PL2A 4V1Ap 2VUPA 5C00A 2LV3A 5G1LA 4FH8A 1ZZYA 2GTUA 3D22A 1EOGA 2H6YA 2WFCA 4POLA 5E59A 4GXZA 1SENA 5JCGA 4DSSA 2G0FA 2WJUA 3M0FA 3TKSC 1BG5A 2E0QA 3DYRA 4KX4A 2RUFA 3U6VA 2K9FA 4YAVA 4L0UA 4K1FA 2A4VA 3RBTA 3NIVA 4NAXA 5FT3A 2F8AA 1A8YA 3HY2A 2LNTA 4RQXA 5FWGA 2MMZA 5IO2A 1CQHA 6GSUA 4KH7A 2XBIA 1K0CA 4I5QA 3DEXA 5ECIB 4ACSA 4MPGA 5DQSA 1YF0A 4WR5A 4ECIA 1OKTA 1PKZA 1GWCA 4AJ8A 5H5SA 1A24A 4BWSA 1TK8B 1NW2A 3HHVA 4D73B 5EY6A 2VL9A 4FYCA 1V57A 1SL2B 5C04A 4F82A 4MABA 3HKRA 2GT6A 3MNGA 1LJRA 2B3SA 2RUEA 1H4OA 3ME7A 4OWYA 1JZRA 4MZBA 1ABAA 1GSSA 3QFBC 6GSSA 2HRFA 3FK8A 2GSRA 4GSNA 3MWHA 4F0BA 2LTKA 3L9VA 3RHCA 2JADA 1R26A 4GTUA 1K3YA 3UVTA 1SD8A 2VM1A 10GSA 5DVBA 5B7CA 2PPTA 2YANA 4ULXA 1TDIA 4G19A 1J9BA 4O32A 3GA4A 4NWYA 1THXA 1DUGA 3I69A 1ERUA 1M9AA 4FYBA 2N5FA 2QSIA 1K0NA 4EF0A 2GSTA 1TK5B 1SD9A 1K0MA 2M46A 2I9HA 2WGRA 3GSSA 3ZMKA 3IXRA 4XS6A 1URMA 2C3TA 2CA8A 2H0IA 1LU4A 4I2TA 3TDGA 4Q5RA 3APOA 1OE8A 4E8HA 2MBSA 4EVMA 3DRNA 1DSBA 4JE1A 4LMVA 2OE1A 1B9XC 4OFTA 4WETA 5AISA 4IS0A 2WULA 1K3LA 1V40A 3M3MA 2B7JA 2ALBA 2DIZA 3EU3A 3KJYA 2DJ0A 7GSSA 3DD3A 1M2AA 3C73A 3FZ9A 3GX0A 1TRUA 4MJEA 2K8SA 2REMA 5F0GA 3LJRA 5HR2A 4ZILA 3GH6A 4IKHA 2J23A 1ZL9A 20GSA 1Q98A 1KNGA 1NSWA 4N0VA 3M9JA 2OE0A 3O6TA 2R4VA 5IMCA 4GQFA 3UARA 1Z6MA 4MH2A 1FVKA 1PRXA 2VL2A 5ECKB 1S3CA 2X8GA 11GSA 1W4VA 3F4SA 2YJ7A 2O8VB 2H0HA 1XW6A 3FHKA 2IL3A 4K9ZA 4RQRA 3QD9A 1VRSD 1Y6EA 4ZBAA 3D0ZA 1MDKA 1GSUA 2YCDA 5ELGA 1B48A 2VD1A 2FGXA 1A2JA 5KEJA 5IMZA 3I6AA 2KP1A 3VPQA 1ACVA 1WWJA 5G5FA 3EYTA 3IV4A 3VURA 1OYJA 4IP1A 1O7UA 1Z9HA 4J56E 3TKPA 1GLQA 3QCPA 1AIUA 2C1YA 1HNCA 3ZLPA 4BA7A 3HVXA 1DBYA 3LYKA 3P7XA 2N5BA 2XPEA 3RPPA 4Q5FA 3CSHA 1GNWA 5CNWA 4I97A 4LL1B 1SK1A 2C4JA 1G6YA 1U3AA 4TXVA 2RM5A 1AQVA 1OE7A 3I9V2 3NZNA 1FG4A 4N10A 4ID0A 1WOUA 5ECOB 3F6FA 1RQMA 4KAEA 2VD0A 2ZUPA 2NBSA 2VL2C 3IOSA 3F63A 3L9SA 3HA9A 3TKSE 2X64A 5IOXA 2L57A 4F9ZA 3IK9A 3C8EA 1OKDA 2FNOA 4GRFA 3TRXA 1PX6A 1ERTA 2NTOA 2J9HA 3ZREA 3K8NA 3IAM2 4HZ2A 3GN3A 4OFNA 4EKZA 5B8BA 1Z7RA 4N30A 4DEJA 1KBNA 4K7IA 3HVSA 1C72A 1EEMA 4KW6A 2VOCA 4MJCA 1USBA 4CDOA 3D5JA 1M9BA 2PUKC 3ZTLA 3KMNA 2PN8A 1Y25A 3CYNA 2I4AA 2HZEB 5D8IA 3BOAA 3UIWA 6GSYA 1UC7A 1S3AA 4V2MA 2OKAA 2ON7A 1GTIA 3QPMA 1QXHA 1TTZA 1XWKA 3W8JA 3IC4A 4XCSA 3FRCA 2WRTA 3BJ5A 5B6MA 2F9SA 1SKWB 4IJIA 1J0FA 1XOAA 4YQVA 1U6TA 3U5RE 6GSXA 5D9TA 1GSYA 4X0XA 3ERGA 5DAKB 1O6JA 4G2EA 4GCIA 5F05A 4TR0A 3US3A 2H30A 4Q5QA 5DALB 3AY8A 1PQNA 2C80A 2O87A 1ZMAA 5IO0A 2C0DA 4CW9A 4ECJA 4TR1B 3GKMA 3GUSA 3ZVJA 2RM6A 4WKWA 4HQSA 1Z3EA 1YY7A 2LKUA 1HQOA 2VCZA 4MDCA 5IPGA 1R5AA 1X9SB 2H1BA 2H70A 2YZHA 3GKKA 2I81A 1SL0B 5DJLA 1RW1A 3ME8A 1MDJA 1XPVA 3TGZA 1AQXA 3TJGA 4NV5A 4V2LA 3KH9A 4ECCA 2H76A 2YV7A 5HR1A 2VCVA 3LEFA 3UEMA 1A2MA 1PD21 2X99A 4KA0A 2DMMA 3KCMA 2PGTA 5ID2B 3LORA 5LNKe 3F9UA 4I8BA 2V1MA 2H1DA 1A8LA 2PERA 3ZIJA 5F8BA 3ZFBA 1XVWA 4MCUA 2IFQA 4J2FA 1TK0B 2PBJA 4KGIA 3ZMLA 3TUEA 2AUVA 2NDOA 4GSSA 2LRCA 1TRWA 3EMXA 3IRAA 3VPTA 2YWNA 4K8MA 2O89A 4AJ7A 1EOHA 4JBBA 16GSA 2PWJA 1WP0A 4HDEA 3L0HA 2R37A 2QKEA 4ZB9A 1O8XA 5KN2A 2MYGA 2KHPA 3APSA 4IQAA 2RLIA 2EIOA 3C71A 2FHEA 2JSZA 4WBJA 2R3XA 4N0ZA 3C7MA 5ECMB 5HQPA 4ISDA 3W6GA 1QFNA 5HFKA 2CV4A 2CZ3A 4OCFA 1HNBA 1OC3A 5ECRB 5B6NA 3RAZA 3GV1A 4TN8A 8GSSA 4PURA 2O85A 2YV9A 5CRWA 1UN2A 4K0NA 4L8EA 2L5LA 4NHWA 1FVJA 4ML6A 1EV4A 1GSFA 2TIRA 3M1GA 1T00A 3J7Yk 3FR6A 2AAWA 1GUMA 1ZGNA 3KP9A 5AIXA 3GURA 4ZBBA 5A4WA 1U88A 4CHSA 1GNEA 1VF3A 2FA8A 2DC5A 4PUAA 2GDRA 2HFDA 3N5OA 2HT9A 2V6OA 1T4ZA 2V32A 2FY6A 4LL4B 2CVDA 3CTGA 1THOA 2X8CA 2NVLA 1SKRB 1TXXA 1F3AA 3A2XA 2CT6A 5CRHA 3WT2A 2I3YA 4PQHA 1JZOA 2OBIA 1EGOA 1AAZA 3HZ8A 4KB3A 3TKQA 4IGJA 5GZZB 2IMDA 1JLVA 4GWRA 5ECPB 4TW5A 1HYUA 3HVVA 3VI7A 3ERWA 3IPZA 4OO4A 3TJJA 3Q74A 1BEDA 1JLWA 2HXKA 4GSTA 1QUWA 1S3DA 2DIYA 4HUAA 2B5XA 2HI7A 1OC9A 3H8QA 5AIVA 1RK4A 2YP6A 1TKDB 4J57E 2O7KA 4YAPA 2F3MA 3TRQA 3HYPA 1SYXA 4XS4B 1FW1A 4IP6A 4MK3A 5D73A 3RDWA 3UAPA 2YNXA 2BTOT 5G2ZA 3VK9A 3WGDA 1R4WA 2Z9SA 2GT5A 2L6CA 3KGKA 1YJ6A 3TB2A 3UJ1A 2YPMA 2A2RA 1IYIA 3PINA 3UBKA 4BVYA 4Q5NA 4WEYA 5ECLB 4E8EA 5KN3A 3LWAA 3S9FA 1V2AA 2WDUA 4TXOB 2JL4A 3CMIA 4XHMA 3PR8A 2C0GA 2HZEA 3FW2A 1GUKA 1XBSA 3WYWA 1JHBA 2M72A 5H5QA 2JACA 3EC3A 1XFLA 4AGSA 3QR6A 2HE3A 3LGCA 3ERFA 3MDKA 2YWIA 4HZ4A 3GKXA 5J9CA 5ECQB 5CAXA 1SJ6A 1K0AA 3HXSA 2LJKA 1MD3A 5GSTA 1Z5YE 2FWGA 1YQ1A 4YQMA 3QDNA 4IELA 3ZITA 2DJJA 1YKCA 2L6DA 5JCUA 5G1KA 3EINA 2LRNA 5DAKA 1XCCA 4YH2A 4ILFA 2CX4A 5DDLA 2LUSA 3BBYA 3D4TA 2IMFA 3KP8A 5JWRB 4V1Ag 2R5GA 2GVPA 5D96A 2XBQA 4TR1A 2VLUA 1XW9A 4TVEA 3OR5A 4BWQA 1J08A 3IE3A 2GZZA 3J7Yb 2LNSA 3GHAA 4ECBA 3GMFA 3WGEA 4MH3A 1GSQA 4POBA 13GSA 4HU9A 5IMAA 1GSEA 2HLSA 3F4RA 2FWHA 4HS1A 2R2JA 1MDIA 3E3EA 3Q6OA 1ERVA 3TJKA 3Q18A 3F0IA 3A2VA 4XRAA 1YZXA 2V41A 4QQ7A 4KDUA 3KEBA 1E6BA 3TKRA 3UOMA 1B9YC 2G2QA 4AJ6A 1GL8A 1AQWA 1K0DA 1YEPA 1XW5A 2FD3A 4DSQA 1I9DA 3ZVJD 4KE3A 2YN1A 1WIKA 4EC0A 2CQ9A 2DJ2A 4EUYA 4BVXA 5J41A 3A5WA 1F37A 2VAFA 3TOUA 1G7OA 1SK2A 1ZYEA 1ZYQB 3KM6A 3D6IA 2NPBA 3BD2A 3CBUA 1YEXA 2PMTA 5G31A 1F2EA 4MP4A 3RPNA 3PGTA 5D9VA 1GTBA 5J9BA 4QL7A 2MBTA 4NXIA 3FYGA 2DMLA 2H1AA 3LSZA 1QGVA 5HR3A 4MF7A 1ST9A 3GL5A 1VF4A 5F06A 2FLSA 1TRSA 1PX7A 2ES7A 3LQ7A 2FWFA 2L59A 3LFLA 2FCHA 4ZB8A 1TJDA 1TP9A 4DSRA 3FZ4A 1B4QA 5KN0A 2EIRA 2CAQA
chains in the Genus database with same CATH superfamily
3BCIA 1GRXA 1EP8A 2OBKA 1PN0A 3L78A 6GSTA 5LCZA 2B6MA 3GX8A 4F03A 3SWLA 2C0EA 2L5OA 3UBLA 2JU5A 3ZFLA 3KD0A 1VF2A 3V1WA 2C0FA 1B4PA 2DLXA 1Z6NA 2HRKA 5JWOB 4D73A 3IHGA 2WCIA 1SJZA 2K6VA 4ZL9A 4MZWA 2HNLA 4IJ3A 1PSQA 1M2DA 3DIEA 1WRYA 3QAWA 3ZZXA 3F3QA 2ON5A 3D4MA 1W89A 3I43A 3KIJA 1K3OA 2QC7A 4XRDA 2OA7A 1EZKA 1U87A 5G30A 1SKSB 2MMOA 4O5UA 3G7YA 2LQOA 1SYRA 2OACA 3GYKA 2VIMA 5IQYA 3CSIA 2FUG2 1DE1A 1BQ7A 4TRXA 3KXOA 4P3YB 2CAIA 3GTUB 3FY7A 1TW9A 3GNJA 1X5EA 1CQGA 1R7HA 2H01A 2TRXA 3DVXA 3P2AA 1F6MC 4JRRA 4K0GA 1Q4JA 4XS4A 4K2DA 1OC8A 4MJAA 5DJMA 2F51A 1N8JA 5KOXA 5KOWA 2LJAA 4K7NA 1XIYA 4IQ1A 3LXZA 1QK8A 2DJ1A 4KCEA 2PU9C 1R5PA 1M0UA 2CVKA 1A0RP 3FR9A 1AW9A 2JZSA 3M8NA 5A4UA 4POKA 1JZWA 5GSSA 1BYEA 3KMOA 5H5RA 3NOFA 1G0TA 4TXOA 1X5DA 3KTBA 5COHA 3DMLA 1TU7A 2H1GA 5ECNB 2TRCP 5LD0A 4F2IA 1O8WA 2E2GA 5CRGA 1U3IA 3TJBA 3G7JA 4HU7A 2C3NA 4X4JA 1Z7PA 2FA4A 1TRVA 1B8XA 2P5RA 1FOVA 3IA1A 5ABRA 4OFMA 3CRUA 5EVOA 3WT1A 3QAGA 4TR4A 1LBKA 1GUHA 2HSMA 2GQMA 3GIXA 5ECSA 3E9JB 3L9UA 2CVBA 4IHUA 2WZ9A 4K6XA 4QL9A 1I5GA 1M7TA 3ZRDA 4NV2A 3VFIA 1PKWA 4WR4A 1GTUA 3UMAA 3MAKA 4G0LA 1WPIA 2B1KA 1MTCA 4L5OA 3F8UA 2WB9A 3C1SA 4TR3A 1T3BA 3IBHA 1O81A 5JWQB 14GSA 5INYA 4NHZA 1GH2A 2LEGA 5CO3A 4HJ2A 2MZCA 3QMXA 5IMDA 4BIKA 1MD4A 1AC1A 2V2GA 5HFGA 4N11A 1JZDA 4WF4A 2GSQA 3VWXA 3TJFA 1BX9A 4YQUA 1M3IA 4EE0A 2GQKA 3FZAA 3DGQA 4I6XA 4KF9A 4ZL8A 4IVFA 2LJRA 4MZCA 4PNGA 5JCWA 4X43A 2JZTA 4AF2A 4WF5A 1EP7A 5CP1A 4L0WA 5CYYA 2E7PA 5GAPD 1ERWA 5DCGA 4ZXGA 3D21A 3KH7A 2H75A 4K2XA 2IIYA 3HZ4A 4EO3A 3DXBA 4KDYA 3LXTA 1NHOA 4EIQA 4WBRD 5DBQA 1FO5A 1NHYA 4LMWA 4KDXA 5IIZA 3TRPA 4FO5A 2P5QA 5IM9A 5IOWA 4MMMA 3TOTA 2AJQB 5EPFA 3HDCA 2EIQA 4BPYA 3W8SA 1G7EA 1K0BA 4F0CA 4YKGA 2LS5A 9GSSA 3FR3A 1TI3A 1XWAA 19GSA 2LRTA 4KCAA 2I1UA 1T1VA 4OCEA 4HI7A 2A2SA 2P31A 4IN0A 1BJXA 3QAVA 3EE2A 4JR4A 2L4QA 6GSVA 1H75A 4O92A 3LYPA 18GSA 1FHEA 4O5RA 1ILOA 3QOUA 2OE3A 2IPAA 1XWGA 2N5AA 3CTFA 1A23A 1TOFA 1QQ2A 4G10A 2HZFA 3H93A 3H4KA 2HRAA 1IYHA 1M2BA 5J5NA 4JEDA 2XPDA 3BCKA 4O7HA 4JZQA 2AHEA 4FIWA 1UA5A 4I2UA 2OADA 2PVOC 1X9MB 2VM2A 2KP2A 2IFQB 2IMKA 4KNDA 4A5PA 5CRDA 3HCZA 3IHQA 2HRNA 2XC2A 1SK0A 3H79A 1V9WA 4HEA2 2HSHA 1GLPA 3WGXA 1JFUA 4MLYA 3FKFA 2IMEA 2KUCA 4OD7A 2B7KA 2M80A 2LQQA 5HR0A 2H19A 1SJIA 4RUVA 1X0RA 2HYXA 4IBPA 4RI7A 4MF5A 3RHBA 2YOIA 1T8EB 4DSSB 1FOHA 5E4WA 4NPBA 1PGTA 5G5EA 4HQZA 3L4NA 2OJLA 1V58A 6GSWA 3EU4A 5DALA 3C1RA 1ON4A 3CQFA 2B5EA 5AGYA 2DJ3A 1EV9A 4OO5A 1DE2A 5CREA 5HFIA 2CX3A 1AUCA 4LA1A 2YWOA 4JU5A 3ED3A 3E0UA 1A0FA 3HD5A 4KSMA 1E2YA 1XZOA 3GTUA 4XTSA 3O76A 3KZQA 3EVIA 5DCHA 2P0GA 2IN3A 3EURA 3ZYWA 3VWVA 1F3BA 4Z2UA 4ML1A 1K0OA 4GLTA 4OMVA 2HSYA 1AXDA 4TKYA 4FYUA 4XS1A 1YDKA 4XIHA 5A5KA 2ZCTA 3JCML 4X1UA 3A2WA 3IC8A 3GL3A 1XWCA 1KEBA 2D2ZA 2H6ZA 4G0IA 4H86A 3GFKA 1TU8A 2H71A 1WE0A 4GQCA 5ID2A 4K7OA 3MSZA 2JSYA 3P8WA 4V2NA 2C8UA 3F4TA 3IR4A 1SL1B 1O85A 2H6XA 3GRXA 2GLRA 4EDZA 3H1NA 4PQIA 1OVNA 3P90A 1OAZA 2EC4A 1OC9B 5A4VA 2XHFA 1HNAA 1T7PB 2FWEA 2YWMA 4ZB6A 1XXUA 3GKNA 1EEJA 2VCWA 3HJMA 5DQYA 1PMTA 2WS2A 3A3TA 2BMXA 1XWBA 1EGRA 3ZL5A 1SU9A 2MMNA 5EL8A 4KUNA 4HSCX 3UVHA 12GSA 2AB6A 3GSTA 3FEUA 1MEKA 3PH9A 4HJMA 2F8FA 1X9WB 2GS3A 3N9JA 1G6WA 5ELAA 2VCXA 4MA9A 4KSOA 3TCOA 3ISOA 4EL1A 2C3QA 5IMFA 2IMIA 2RIIA 2KOKA 4POMA 2VCTA 3G7IA 2B1LA 2H74A 3IK7A 4WXTA 4BVYB 5D93A 5GAND 4ZBDA 3LG6A 5ECHB 1GSDA 4RI6A 4PGTA 2QA2A 2GSSA 2YZUA 3APQA 2R6KA 4BL7A 2VO4A 3WD6A 4PUFC 2GGTA 2X8HA 2GZPA 2JZRA 1N2AA 3KTLA 2CZ2A 2DSAA 3MIXA 1BAYA 2QGVA 4PQ1A 1VGLA 4MF6A 3VWWA 3F3RA 1VF1A 5AN1A 2YJHA 5ENUA 3DWVA 4DVCA 5B8AA 1XOBA 1ZOFA 2MMAA 1WMJA 4EXJA 2IJYA 2V6KA 1FAAA 2L4CA 4LLRA 2K18A 2VL3A 3EWLA 3IDVA 5D9XA 1FB6A 2AYTA 4PXOA 2LSTA 1V98A 5FHIA 2H66A 4HOJA 3CSJA 3G9BA 2VCQA 5BMUA 2DBCA 2X4AA 5KN1A 2DJKA 1O73A 2VLTA 2ZNMA 3VLNA 3Q19A 1PN9A 3CRTA 3GH9A 5J3RA 4L5LA 3F6DA 5D9WA 2PVQA 5IMVA 1YF1A 4PX1A 2B5YA 3IAS2 1EWXA 3TKSA 1PA3A 3FZ5A 3HJPA 2R0CA 3QFAC 4PNFA 1GP1A 1HD2A 1PL1A 1YKAA 1ZCPA 4JR6A 3SBCA 1F9MA 2H0GA 1KTEA 5F07A 3O3TA 1T4YA 2GZYA 5L71A 4TOPA 3M9KA 4ZL7A 4IW9A 22GSA 2E2MA 3HJOA 5IPHA 5J4UA 2AV4A 2H72A 1NM3A 2H73A 1UVZA 2VLVA 1FB0A 4NMUA 1A2LA 3VI5A 3R2QA 2IWTA 3DKSA 1GTAA 1WJKA 4Z7XA 1X5CA 2K8VA 3EMPA 3UL3A 17GSA 4MJBA 4GF0A 1TI1A 1M99A 4G9HA 1XVQA 1QMVA 2H8LA 3CXGA 3ZIVA 2BJXA 4EDYA 4ZIJA 3DVWA 1GULA 2GQLA 4MPFA 1ML6A 3VWUA 2KLXA 1PL2A 4V1Ap 4BVXB 2VUPA 5C00A 2LV3A 5G1LA 4FH8A 1ZZYA 2GTUA 3D22A 1EOGA 2H6YA 2WFCA 4POLA 5E59A 5A2QI 1PFOA 4GXZA 1SENA 5JCGA 4DSSA 2G0FA 2WJUA 3M0FA 3TKSC 1BG5A 2E0QA 3DYRA 4KX4A 2RUFA 3U6VA 2K9FA 4YAVA 4L0UA 4K1FA 2A4VA 3RBTA 3NIVA 4NAXA 5FT3A 2F8AA 2A4HA 1A8YA 3HY2A 2LNTA 4RQXA 5FWGA 2MMZA 5IO2A 1CQHA 6GSUA 4KH7A 2XBIA 1K0CA 4I5QA 3DEXA 5ECIB 4ACSA 4MPGA 5DQSA 5FLXI 1YF0A 4WR5A 4ECIA 1OKTA 1PKZA 1GWCA 4AJ8A 5H5SA 1A24A 4BWSA 1TK8B 1NW2A 3HHVA 4D73B 5EY6A 2VL9A 4FYCA 1V57A 1SL2B 5C04A 4F82A 4MABA 3HKRA 2GT6A 3MNGA 1LJRA 2B3SA 2RUEA 1H4OA 3ME7A 4OWYA 1JZRA 4MZBA 1ABAA 1GSSA 3QFBC 6GSSA 2HRFA 3A5IA 3FK8A 2GSRA 4GSNA 3MWHA 4F0BA 2LTKA 3L9VA 4FQUA 3RHCA 2JADA 1R26A 4GTUA 1K3YA 3UVTA 1SD8A 2VM1A 10GSA 5DVBA 5B7CA 2PPTA 2YANA 4ULXA 1TDIA 4G19A 1J9BA 4O32A 3GA4A 4NWYA 1THXA 1DUGA 3I69A 1ERUA 1M9AA 4FYBA 2N5FA 2QSIA 1K0NA 4EF0A 2GSTA 1TK5B 1SD9A 1K0MA 2M46A 2I9HA 2WGRA 3GSSA 3ZMKA 3IXRA 4XS6A 1URMA 2C3TA 2CA8A 2H0IA 1LU4A 4I2TA 4K5RA 3TDGA 4Q5RA 3APOA 1OE8A 4E8HA 2MBSA 4EVMA 3DRNA 1DSBA 4JE1A 4LMVA 2OE1A 1B9XC 4OFTA 4WETA 5AISA 4IS0A 2WULA 1K3LA 3J81I 1V40A 3M3MA 2B7JA 2ALBA 2DIZA 3EU3A 3KJYA 2DJ0A 7GSSA 3DD3A 1M2AA 3C73A 3FZ9A 3GX0A 1ZYPA 1TRUA 4MJEA 2K8SA 2REMA 5F0GA 5IT9I 3LJRA 5HR2A 4ZILA 3GH6A 4IKHA 2J23A 1ZL9A 20GSA 1Q98A 1KNGA 1NSWA 4N0VA 3M9JA 2OE0A 3O6TA 2R4VA 5IMCA 4GQFA 3UARA 1Z6MA 4MH2A 1FVKA 1PRXA 4MNNA 4CY6A 2VL2A 5ECKB 1S3CA 2X8GA 11GSA 1W4VA 3F4SA 2YJ7A 3HVNA 2O8VB 2H0HA 1XW6A 3FHKA 2IL3A 4K9ZA 4RQRA 3QD9A 1VRSD 1Y6EA 4ZBAA 3D0ZA 1MDKA 1GSUA 2YCDA 5ELGA 1B48A 2VD1A 2FGXA 1A2JA 5KEJA 5IMZA 3I6AA 2KP1A 3VPQA 1ACVA 1WWJA 5G5FA 3EYTA 1S3RA 3IV4A 3VURA 1OYJA 3MYDA 4IP1A 1O7UA 1Z9HA 4J56E 3TKPA 1GLQA 3QCPA 1AIUA 2C1YA 1HNCA 3ZLPA 4BA7A 3HVXA 1DBYA 2X49A 3LYKA 3P7XA 2N5BA 2DKIA 2XPEA 3RPPA 4Q5FA 3CSHA 1GNWA 5CNWA 4I97A 4LL1B 1SK1A 2C4JA 1G6YA 1U3AA 4TXVA 2RM5A 1AQVA 1OE7A 3I9V2 4YKFA 3NZNA 1FG4A 4N10A 4ID0A 1WOUA 5ECOB 3F6FA 1RQMA 4KAEA 2VD0A 4PTSA 2ZUPA 2NBSA 4K5SA 2VL2C 3IOSA 3F63A 3L9SA 3HA9A 3TKSE 2X64A 5IOXA 2L57A 4F9ZA 3IK9A 3C8EA 1OKDA 2FNOA 4GRFA 3TRXA 1PX6A 1ERTA 2NTOA 2J9HA 3ZREA 3K8NA 3IAM2 4HZ2A 3GN3A 4OFNA 4EKZA 5B8BA 1Z7RA 4N30A 4DEJA 1KBNA 4K7IA 3HVSA 1C72A 1EEMA 4KW6A 2VOCA 4MJCA 1USBA 4CDOA 3D5JA 1M9BA 2PUKC 3ZTLA 3KMNA 3R3EA 2PN8A 1Y25A 3CYNA 2I4AA 2HZEB 5D8IA 3BOAA 3UIWA 6GSYA 1UC7A 1S3AA 4V2MA 2OKAA 5BRTA 2ON7A 1GTIA 3QPMA 1QXHA 1TTZA 1XWKA 3W8JA 3IC4A 4XCSA 3FRCA 2WRTA 3BJ5A 5B6MA 2F9SA 1SKWB 4IJIA 1J0FA 1XOAA 4YQVA 1U6TA 3U5RE 6GSXA 5D9TA 1GSYA 4X0XA 3ERGA 5DAKB 1O6JA 4G2EA 4GCIA 2R0GA 5F05A 4G0KA 4TR0A 3US3A 2H30A 4Q5QA 5DALB 4EIPA 3AY8A 1PQNA 2C80A 2O87A 1ZMAA 5IO0A 2C0DA 4CW9A 4ECJA 4TR1B 3GKMA 3GUSA 3ZVJA 2RM6A 4WKWA 4HQSA 1Z3EA 1YY7A 2LKUA 1HQOA 2VCZA 4MDCA 5IPGA 1R5AA 1X9SB 2H1BA 2H70A 2YZHA 3GKKA 2I81A 1SL0B 5DJLA 1RW1A 3ME8A 1MDJA 1XPVA 3FMWA 3TGZA 1AQXA 3TJGA 4NV5A 4V2LA 3KH9A 2A2PA 4ECCA 2H76A 2YV7A 3PPUA 5HR1A 2VCVA 3LEFA 3UEMA 1A2MA 1PD21 2X99A 4KA0A 2DMMA 3KCMA 2PGTA 5ID2B 3LORA 5LNKe 3F9UA 4I8BA 2V1MA 2H1DA 4Z2RA 1A8LA 2PERA 3ZIJA 5F8BA 3LW9A 3ZFBA 1XVWA 4MCUA 2IFQA 4J2FA 1TK0B 2PBJA 4KGIA 3ZMLA 3TUEA 2AUVA 3JAMI 2NDOA 4GSSA 2LRCA 1TRWA 3EMXA 3IRAA 3VPTA 2YWNA 4K8MA 2O89A 4AJ7A 1EOHA 4JBBA 16GSA 2PWJA 1WP0A 4HDEA 3L0HA 2R37A 2QKEA 4ZB9A 1O8XA 5KN2A 2MYGA 2KHPA 3APSA 4IQAA 2RLIA 2EIOA 3C71A 2FHEA 2JSZA 4WBJA 2R3XA 4N0ZA 3C7MA 5ECMB 5HQPA 4ISDA 3W6GA 1QFNA 5HFKA 2CV4A 2QA1A 2CZ3A 4OCFA 1ZYNA 1HNBA 1OC3A 5ECRB 5B6NA 3RAZA 3GV1A 4TN8A 8GSSA 4PURA 2O85A 2YV9A 5CRWA 1UN2A 4K0NA 3J80I 4L8EA 2L5LA 4NHWA 1FVJA 4ML6A 1EV4A 4BL7B 1GSFA 2TIRA 3M1GA 1T00A 3J7Yk 3FR6A 2AAWA 1GUMA 1ZGNA 3KP9A 5AIXA 3GURA 4ZBBA 5A4WA 1U88A 4CHSA 1GNEA 1VF3A 2FA8A 2DC5A 4PUAA 2GDRA 2HFDA 3N5OA 2HT9A 2V6OA 1T4ZA 2V32A 2FY6A 4LL4B 2CVDA 3CTGA 1THOA 2X8CA 2NVLA 1SKRB 1TXXA 1F3AA 3A2XA 2CT6A 5CRHA 3WT2A 2I3YA 4PQHA 2DKHA 1JZOA 2OBIA 1EGOA 1AAZA 3HZ8A 4KB3A 3TKQA 4IGJA 5GZZB 2IMDA 1JLVA 4GWRA 5ECPB 4TW5A 1HYUA 3HVVA 3VI7A 3ERWA 3IPZA 4OO4A 3TJJA 3Q74A 1BEDA 1JLWA 2HXKA 4GSTA 1QUWA 1S3DA 2DIYA 4HUAA 2B5XA 2HI7A 1OC9A 3H8QA 5AIVA 1RK4A 2YP6A 1XG8A 1TKDB 4J57E 2O7KA 4YAPA 2F3MA 3TRQA 3HYPA 1SYXA 4XS4B 1FW1A 4IP6A 4MK3A 1M3JA 5D73A 3RDWA 3UAPA 2YNXA 2BTOT 5G2ZA 3VK9A 3WGDA 1R4WA 2Z9SA 2GT5A 2L6CA 3KGKA 1YJ6A 3TB2A 3UJ1A 2UZ8A 2YPMA 2A2RA 1IYIA 3PINA 3UBKA 4BVYA 4Q5NA 4WEYA 5ECLB 4E8EA 5KN3A 3LWAA 3S9FA 3EPTA 1V2AA 2WDUA 4TXOB 2JL4A 3CMIA 4XHMA 3PR8A 2C0GA 2HZEA 3FW2A 1GUKA 1XBSA 3WYWA 1JHBA 2M72A 5H5QA 2JACA 3EC3A 4USSA 1XFLA 4AGSA 3QR6A 2HE3A 3LGCA 3ERFA 3MDKA 2YWIA 4HZ4A 3GKXA 5J9CA 5ECQB 5CAXA 1SJ6A 1K0AA 3HXSA 2LJKA 1MD3A 5GSTA 1Z5YE 2FWGA 1YQ1A 4YQMA 3QDNA 4IELA 2R0PA 3ZITA 2DJJA 1YKCA 2L6DA 5JCUA 5G1KA 5LL6V 3EINA 2LRNA 5DAKA 1XCCA 4YH2A 4ILFA 2CX4A 5DDLA 2LUSA 3BBYA 3D4TA 2IMFA 3KP8A 5JWRB 4V1Ag 2R5GA 2GVPA 4ICYA 5D96A 2XBQA 4CY8A 4TR1A 2VLUA 1XW9A 4TVEA 4Z2TA 3OR5A 4O5QA 4BWQA 1J08A 3IE3A 2GZZA 3J7Yb 2LNSA 3GHAA 4ECBA 3GMFA 3WGEA 4MH3A 1GSQA 4POBA 13GSA 4HU9A 5IMAA 1GSEA 2HLSA 3F4RA 2FWHA 4HS1A 2R2JA 1MDIA 3E3EA 3Q6OA 1ERVA 3TJKA 3Q18A 3F0IA 3A2VA 4XRAA 1YZXA 2V41A 4QQ7A 4KDUA 3KEBA 1E6BA 3TKRA 3UOMA 1B9YC 2G2QA 4AJ6A 1GL8A 1AQWA 1K0DA 1YEPA 1XW5A 2FD3A 4DSQA 1I9DA 3ZVJD 4KE3A 2YN1A 1WIKA 4EC0A 2CQ9A 2DJ2A 4EUYA 4BVXA 5J41A 3A5WA 1F37A 2VAFA 3TOUA 1G7OA 1SK2A 1ZYEA 1ZYQB 3KM6A 3D6IA 2NPBA 3BD2A 3CBUA 1YEXA 2PMTA 5G31A 1F2EA 4MP4A 3RPNA 3PGTA 5D9VA 1GTBA 5J9BA 4QL7A 2MBTA 4NXIA 3FYGA 2DMLA 2H1AA 3LSZA 1QGVA 5HR3A 4MF7A 1ST9A 3GL5A 1VF4A 5F06A 2FLSA 1TRSA 1PX7A 2ES7A 3LQ7A 2FWFA 2L59A 3LFLA 2FCHA 4ZB8A 1TJDA 1TP9A 4DSRA 3FZ4A 1B4QA 5KN0A 2EIRA 2CAQA
chains in the Genus database with same CATH topology
3BCIA 1GRXA 1EP8A 2OBKA 1PN0A 3L78A 6GSTA 5LCZA 2B6MA 3GX8A 4F03A 3SWLA 2C0EA 2L5OA 3UBLA 2JU5A 3ZFLA 3KD0A 1VF2A 3V1WA 2C0FA 1B4PA 2DLXA 1Z6NA 2HRKA 5JWOB 4D73A 3IHGA 2WCIA 1SJZA 2K6VA 4ZL9A 4MZWA 2HNLA 4IJ3A 1PSQA 1M2DA 3DIEA 1WRYA 3QAWA 3ZZXA 3F3QA 2ON5A 3D4MA 1W89A 3I43A 3KIJA 1K3OA 2QC7A 4XRDA 2OA7A 1EZKA 1U87A 5G30A 1SKSB 2MMOA 4O5UA 3G7YA 2LQOA 1SYRA 2OACA 3GYKA 2VIMA 5IQYA 3CSIA 2FUG2 1DE1A 1BQ7A 4TRXA 3KXOA 4P3YB 2CAIA 3GTUB 3FY7A 1TW9A 3GNJA 1X5EA 1CQGA 1R7HA 2H01A 2TRXA 3DVXA 3P2AA 1F6MC 4JRRA 4K0GA 1Q4JA 4XS4A 4K2DA 1OC8A 4MJAA 5DJMA 2F51A 1N8JA 5KOXA 5KOWA 2LJAA 4K7NA 1XIYA 4IQ1A 3LXZA 1QK8A 2DJ1A 4KCEA 2PU9C 1R5PA 1M0UA 2CVKA 1A0RP 3FR9A 1AW9A 2JZSA 3M8NA 5A4UA 4POKA 1JZWA 5GSSA 1BYEA 3KMOA 5H5RA 3NOFA 1G0TA 4TXOA 1X5DA 3KTBA 5COHA 3DMLA 1TU7A 2H1GA 5ECNB 2TRCP 5LD0A 4F2IA 1O8WA 2E2GA 5CRGA 1U3IA 3TJBA 3G7JA 4HU7A 2C3NA 4X4JA 1Z7PA 2FA4A 1TRVA 1B8XA 2P5RA 1FOVA 3IA1A 5ABRA 4OFMA 3CRUA 5EVOA 3WT1A 3QAGA 4TR4A 1LBKA 1GUHA 2HSMA 2GQMA 3GIXA 5ECSA 3E9JB 3L9UA 2CVBA 4IHUA 2WZ9A 4K6XA 4QL9A 1I5GA 1M7TA 3ZRDA 4NV2A 3VFIA 1PKWA 4WR4A 1GTUA 3UMAA 3MAKA 4G0LA 1WPIA 2B1KA 1MTCA 4L5OA 3F8UA 2WB9A 3C1SA 4TR3A 1T3BA 3IBHA 1O81A 5JWQB 14GSA 5INYA 4NHZA 1GH2A 2LEGA 5CO3A 4HJ2A 2MZCA 3QMXA 5IMDA 1MD4A 1AC1A 2V2GA 5HFGA 4N11A 1JZDA 4WF4A 2GSQA 3VWXA 3TJFA 1BX9A 4YQUA 4EE0A 2GQKA 3FZAA 3DGQA 4I6XA 4KF9A 4ZL8A 4IVFA 2LJRA 4MZCA 4PNGA 5JCWA 4X43A 2JZTA 4AF2A 4WF5A 1EP7A 5CP1A 4L0WA 5CYYA 2E7PA 5GAPD 1ERWA 5DCGA 4ZXGA 3D21A 3KH7A 2H75A 4K2XA 2IIYA 3HZ4A 4EO3A 3DXBA 4KDYA 3LXTA 1NHOA 4EIQA 4WBRD 5DBQA 1FO5A 1NHYA 4LMWA 4KDXA 5IIZA 3TRPA 4FO5A 2P5QA 5IM9A 5IOWA 4MMMA 3TOTA 2AJQB 5EPFA 3HDCA 2EIQA 4BPYA 3W8SA 1G7EA 1K0BA 4F0CA 4YKGA 2LS5A 9GSSA 3FR3A 1TI3A 1XWAA 19GSA 2LRTA 4KCAA 2I1UA 1T1VA 4OCEA 4HI7A 2A2SA 2P31A 4IN0A 1BJXA 3QAVA 3EE2A 4JR4A 2L4QA 6GSVA 1H75A 4O92A 3LYPA 18GSA 1FHEA 4O5RA 1ILOA 3QOUA 2OE3A 2IPAA 1XWGA 2N5AA 3CTFA 1A23A 1TOFA 1QQ2A 4G10A 2HZFA 3H93A 3H4KA 2HRAA 1IYHA 1M2BA 5J5NA 4JEDA 2XPDA 3BCKA 4O7HA 4JZQA 2AHEA 4FIWA 1UA5A 4I2UA 2OADA 2PVOC 1X9MB 2VM2A 2KP2A 2IFQB 2IMKA 4KNDA 4A5PA 5CRDA 3HCZA 3IHQA 2HRNA 2XC2A 1SK0A 3H79A 1V9WA 4HEA2 2HSHA 1GLPA 3WGXA 1JFUA 4MLYA 3FKFA 2IMEA 2KUCA 4OD7A 2B7KA 2M80A 2LQQA 5HR0A 2H19A 1SJIA 4RUVA 1X0RA 2HYXA 4IBPA 4RI7A 4MF5A 3RHBA 2YOIA 1T8EB 4DSSB 1FOHA 5E4WA 4NPBA 1PGTA 5G5EA 4HQZA 3L4NA 2OJLA 1V58A 6GSWA 3EU4A 5DALA 3C1RA 1ON4A 2B5EA 5AGYA 2DJ3A 1EV9A 4OO5A 1DE2A 5CREA 5HFIA 2CX3A 1AUCA 4LA1A 2YWOA 4JU5A 3ED3A 3E0UA 1A0FA 3HD5A 4KSMA 1E2YA 1XZOA 3GTUA 4XTSA 3O76A 3KZQA 3EVIA 5DCHA 2P0GA 2IN3A 3EURA 3ZYWA 3VWVA 1F3BA 4Z2UA 4ML1A 1K0OA 4GLTA 4OMVA 2HSYA 1AXDA 4TKYA 4FYUA 4XS1A 1YDKA 4XIHA 5A5KA 2ZCTA 3JCML 4X1UA 3A2WA 3IC8A 3GL3A 1XWCA 1KEBA 2D2ZA 2H6ZA 4G0IA 4H86A 3GFKA 1TU8A 2H71A 1WE0A 4GQCA 5ID2A 4K7OA 3MSZA 2JSYA 3P8WA 4V2NA 2C8UA 3F4TA 3IR4A 1SL1B 1O85A 2H6XA 3GRXA 2GLRA 4EDZA 3H1NA 4PQIA 1OVNA 3P90A 1OAZA 2EC4A 1OC9B 5A4VA 2XHFA 1HNAA 1T7PB 2FWEA 2YWMA 4ZB6A 1XXUA 3GKNA 1EEJA 2VCWA 3HJMA 5DQYA 1PMTA 2WS2A 3A3TA 2BMXA 1XWBA 1EGRA 3ZL5A 1SU9A 2MMNA 5EL8A 4KUNA 3UVHA 12GSA 2AB6A 3GSTA 3FEUA 1MEKA 3PH9A 4HJMA 2F8FA 1X9WB 2GS3A 3N9JA 1G6WA 5ELAA 2VCXA 4MA9A 4KSOA 3TCOA 3ISOA 4EL1A 2C3QA 5IMFA 2IMIA 2RIIA 2KOKA 4POMA 2VCTA 3G7IA 2B1LA 2H74A 3IK7A 4WXTA 4BVYB 5D93A 5GAND 4ZBDA 3LG6A 5ECHB 1GSDA 4RI6A 4PGTA 2QA2A 2GSSA 2YZUA 3APQA 2R6KA 4BL7A 2VO4A 3WD6A 4PUFC 2GGTA 2X8HA 2GZPA 2JZRA 1N2AA 3KTLA 2CZ2A 2DSAA 3MIXA 1BAYA 2QGVA 4PQ1A 1VGLA 4MF6A 3VWWA 3F3RA 1VF1A 5AN1A 2YJHA 5ENUA 3DWVA 4DVCA 5B8AA 1XOBA 1ZOFA 2MMAA 1WMJA 4EXJA 2IJYA 2V6KA 1FAAA 2L4CA 4LLRA 2K18A 2VL3A 3EWLA 3IDVA 5D9XA 1FB6A 2AYTA 4PXOA 2LSTA 1V98A 5FHIA 2H66A 4HOJA 3CSJA 3G9BA 2VCQA 5BMUA 2DBCA 2X4AA 5KN1A 2DJKA 1O73A 2VLTA 2ZNMA 3VLNA 3Q19A 1PN9A 3CRTA 3GH9A 5J3RA 4L5LA 3F6DA 5D9WA 2PVQA 5IMVA 1YF1A 4PX1A 2B5YA 3IAS2 1EWXA 3TKSA 1PA3A 3FZ5A 3HJPA 2R0CA 3QFAC 4PNFA 1GP1A 1HD2A 1PL1A 1YKAA 1ZCPA 4JR6A 3SBCA 1F9MA 2H0GA 1KTEA 5F07A 3O3TA 1T4YA 2GZYA 5L71A 4TOPA 3M9KA 4ZL7A 4IW9A 22GSA 2E2MA 3HJOA 5IPHA 5J4UA 2AV4A 2H72A 1NM3A 2H73A 1UVZA 2VLVA 1FB0A 4NMUA 1A2LA 3VI5A 3R2QA 2IWTA 3DKSA 1GTAA 1WJKA 4Z7XA 1X5CA 2K8VA 3EMPA 3UL3A 17GSA 4MJBA 4GF0A 1TI1A 1M99A 4G9HA 1XVQA 1QMVA 2H8LA 3CXGA 3ZIVA 2BJXA 4EDYA 4ZIJA 3DVWA 1GULA 2GQLA 4MPFA 1ML6A 3VWUA 2KLXA 1PL2A 4V1Ap 4BVXB 2VUPA 5C00A 2LV3A 5G1LA 4FH8A 1ZZYA 2GTUA 3D22A 1EOGA 2H6YA 2WFCA 4POLA 5E59A 4GXZA 1SENA 5JCGA 4DSSA 2G0FA 2WJUA 3M0FA 3TKSC 1BG5A 2E0QA 3DYRA 4KX4A 2RUFA 3U6VA 2K9FA 4YAVA 4L0UA 4K1FA 2A4VA 3RBTA 3NIVA 4NAXA 5FT3A 2F8AA 2A4HA 1A8YA 3HY2A 2LNTA 4RQXA 5FWGA 2MMZA 5IO2A 1CQHA 6GSUA 4KH7A 2XBIA 1K0CA 4I5QA 3DEXA 5ECIB 4ACSA 4MPGA 5DQSA 1YF0A 4WR5A 4ECIA 1OKTA 1PKZA 1GWCA 4AJ8A 5H5SA 1A24A 4BWSA 1TK8B 1NW2A 3HHVA 4D73B 5EY6A 2VL9A 4FYCA 1V57A 1SL2B 5C04A 4F82A 4MABA 3HKRA 2GT6A 3MNGA 1LJRA 2B3SA 2RUEA 1H4OA 3ME7A 4OWYA 1JZRA 4MZBA 1ABAA 1GSSA 3QFBC 6GSSA 2HRFA 3A5IA 3FK8A 2GSRA 4GSNA 3MWHA 4F0BA 2LTKA 3L9VA 4FQUA 3RHCA 2JADA 1R26A 4GTUA 1K3YA 3UVTA 1SD8A 2VM1A 10GSA 5DVBA 5B7CA 2PPTA 2YANA 4ULXA 1TDIA 4G19A 1J9BA 4O32A 3GA4A 4NWYA 1THXA 1DUGA 3I69A 1ERUA 1M9AA 4FYBA 2N5FA 2QSIA 1K0NA 4EF0A 2GSTA 1TK5B 1SD9A 1K0MA 2M46A 2I9HA 2WGRA 3GSSA 3ZMKA 3IXRA 4XS6A 1URMA 2C3TA 2CA8A 2H0IA 1LU4A 4I2TA 4K5RA 3TDGA 4Q5RA 3APOA 1OE8A 4E8HA 2MBSA 4EVMA 3DRNA 1DSBA 4JE1A 4LMVA 2OE1A 1B9XC 4OFTA 4WETA 5AISA 4IS0A 2WULA 1K3LA 1V40A 3M3MA 2B7JA 2ALBA 2DIZA 3EU3A 3KJYA 2DJ0A 7GSSA 3DD3A 1M2AA 3C73A 3FZ9A 3GX0A 1ZYPA 1TRUA 4MJEA 2K8SA 2REMA 5F0GA 3LJRA 5HR2A 4ZILA 3GH6A 4IKHA 2J23A 1ZL9A 20GSA 1Q98A 1KNGA 1NSWA 4N0VA 3M9JA 2OE0A 3O6TA 2R4VA 5IMCA 4GQFA 3UARA 1Z6MA 4MH2A 1FVKA 1PRXA 4MNNA 4CY6A 2VL2A 5ECKB 1S3CA 2X8GA 11GSA 1W4VA 3F4SA 2YJ7A 2O8VB 2H0HA 1XW6A 3FHKA 2IL3A 4K9ZA 4RQRA 3QD9A 1VRSD 1Y6EA 4ZBAA 3D0ZA 1MDKA 1GSUA 2YCDA 5ELGA 1B48A 2VD1A 2FGXA 1A2JA 5KEJA 5IMZA 3I6AA 2KP1A 3VPQA 1ACVA 1WWJA 5G5FA 3EYTA 3IV4A 3VURA 1OYJA 3MYDA 4IP1A 1O7UA 1Z9HA 4J56E 3TKPA 1GLQA 3QCPA 1AIUA 2C1YA 1HNCA 3ZLPA 4BA7A 3HVXA 1DBYA 2X49A 3LYKA 3P7XA 2N5BA 2DKIA 2XPEA 3RPPA 4Q5FA 3CSHA 1GNWA 5CNWA 4I97A 4LL1B 1SK1A 2C4JA 1G6YA 1U3AA 4TXVA 2RM5A 1AQVA 1OE7A 3I9V2 4YKFA 3NZNA 1FG4A 4N10A 4ID0A 1WOUA 5ECOB 3F6FA 1RQMA 4KAEA 2VD0A 4PTSA 2ZUPA 2NBSA 4K5SA 2VL2C 3IOSA 3F63A 3L9SA 3HA9A 3TKSE 2X64A 5IOXA 2L57A 4F9ZA 3IK9A 3C8EA 1OKDA 2FNOA 4GRFA 3TRXA 1PX6A 1ERTA 2NTOA 2J9HA 3ZREA 3K8NA 3IAM2 4HZ2A 3GN3A 4OFNA 4EKZA 5B8BA 1Z7RA 4N30A 4DEJA 1KBNA 4K7IA 3HVSA 1C72A 1EEMA 4KW6A 2VOCA 4MJCA 1USBA 4CDOA 3D5JA 1M9BA 2PUKC 3ZTLA 3KMNA 3R3EA 2PN8A 1Y25A 3CYNA 2I4AA 2HZEB 5D8IA 3BOAA 3UIWA 6GSYA 1UC7A 1S3AA 4V2MA 2OKAA 5BRTA 2ON7A 1GTIA 3QPMA 1QXHA 1TTZA 1XWKA 3W8JA 3IC4A 4XCSA 3FRCA 2WRTA 3BJ5A 5B6MA 2F9SA 1SKWB 4IJIA 1J0FA 1XOAA 4YQVA 1U6TA 3U5RE 6GSXA 5D9TA 1GSYA 4X0XA 3ERGA 5DAKB 1O6JA 4G2EA 4GCIA 2R0GA 5F05A 4G0KA 4TR0A 3US3A 2H30A 4Q5QA 5DALB 4EIPA 3AY8A 1PQNA 2C80A 2O87A 1ZMAA 5IO0A 2C0DA 4CW9A 4ECJA 4TR1B 3GKMA 3GUSA 3ZVJA 2RM6A 4WKWA 4HQSA 1Z3EA 1YY7A 2LKUA 1HQOA 2VCZA 4MDCA 5IPGA 1R5AA 1X9SB 2H1BA 2H70A 2YZHA 3GKKA 2I81A 1SL0B 5DJLA 1RW1A 3ME8A 1MDJA 1XPVA 3FMWA 3TGZA 1AQXA 3TJGA 4NV5A 4V2LA 3KH9A 2A2PA 4ECCA 2H76A 2YV7A 3PPUA 5HR1A 2VCVA 3LEFA 3UEMA 1A2MA 1PD21 2X99A 4KA0A 2DMMA 3KCMA 2PGTA 5ID2B 3LORA 5LNKe 3F9UA 4I8BA 2V1MA 2H1DA 4Z2RA 1A8LA 2PERA 3ZIJA 5F8BA 3LW9A 3ZFBA 1XVWA 4MCUA 2IFQA 4J2FA 1TK0B 2PBJA 4KGIA 3ZMLA 3TUEA 2AUVA 2NDOA 4GSSA 2LRCA 1TRWA 3EMXA 3IRAA 3VPTA 2YWNA 4K8MA 2O89A 4AJ7A 1EOHA 4JBBA 16GSA 2PWJA 1WP0A 4HDEA 3L0HA 2R37A 2QKEA 4ZB9A 1O8XA 5KN2A 2MYGA 2KHPA 3APSA 4IQAA 2RLIA 2EIOA 3C71A 2FHEA 2JSZA 4WBJA 2R3XA 4N0ZA 3C7MA 5ECMB 5HQPA 4ISDA 3W6GA 1QFNA 5HFKA 2CV4A 2QA1A 2CZ3A 4OCFA 1ZYNA 1HNBA 1OC3A 5ECRB 5B6NA 3RAZA 3GV1A 4TN8A 8GSSA 4PURA 2O85A 2YV9A 5CRWA 1UN2A 4K0NA 4L8EA 2L5LA 4NHWA 1FVJA 4ML6A 1EV4A 4BL7B 1GSFA 2TIRA 3M1GA 1T00A 3J7Yk 3FR6A 2AAWA 1GUMA 1ZGNA 3KP9A 5AIXA 3GURA 4ZBBA 5A4WA 1U88A 4CHSA 1GNEA 1VF3A 2FA8A 2DC5A 4PUAA 2GDRA 2HFDA 3N5OA 2HT9A 2V6OA 1T4ZA 2V32A 2FY6A 4LL4B 2CVDA 3CTGA 1THOA 2X8CA 2NVLA 1SKRB 1TXXA 1F3AA 3A2XA 2CT6A 5CRHA 3WT2A 2I3YA 4PQHA 2DKHA 1JZOA 2OBIA 1EGOA 1AAZA 3HZ8A 4KB3A 3TKQA 4IGJA 5GZZB 2IMDA 1JLVA 4GWRA 5ECPB 4TW5A 1HYUA 3HVVA 3VI7A 3ERWA 3IPZA 4OO4A 3TJJA 3Q74A 1BEDA 1JLWA 2HXKA 4GSTA 1QUWA 1S3DA 2DIYA 4HUAA 2B5XA 2HI7A 1OC9A 3H8QA 5AIVA 1RK4A 2YP6A 1TKDB 4J57E 2O7KA 4YAPA 2F3MA 3TRQA 3HYPA 1SYXA 4XS4B 1FW1A 4IP6A 4MK3A 5D73A 3RDWA 3UAPA 2YNXA 2BTOT 5G2ZA 3VK9A 3WGDA 1R4WA 2Z9SA 2GT5A 2L6CA 3KGKA 1YJ6A 3TB2A 3UJ1A 2UZ8A 2YPMA 2A2RA 1IYIA 3PINA 3UBKA 4BVYA 4Q5NA 4WEYA 5ECLB 4E8EA 5KN3A 3LWAA 3S9FA 3EPTA 1V2AA 2WDUA 4TXOB 2JL4A 3CMIA 4XHMA 3PR8A 2C0GA 2HZEA 3FW2A 1GUKA 1XBSA 3WYWA 1JHBA 2M72A 5H5QA 2JACA 3EC3A 4USSA 1XFLA 4AGSA 3QR6A 2HE3A 3LGCA 3ERFA 3MDKA 2YWIA 4HZ4A 3GKXA 5J9CA 5ECQB 5CAXA 1SJ6A 1K0AA 3HXSA 2LJKA 1MD3A 5GSTA 1Z5YE 2FWGA 1YQ1A 4YQMA 3QDNA 4IELA 2R0PA 3ZITA 2DJJA 1YKCA 2L6DA 5JCUA 5G1KA 3EINA 2LRNA 5DAKA 1XCCA 4YH2A 4ILFA 2CX4A 5DDLA 2LUSA 3BBYA 3D4TA 2IMFA 3KP8A 5JWRB 4V1Ag 2R5GA 2GVPA 4ICYA 5D96A 2XBQA 4CY8A 4TR1A 2VLUA 1XW9A 4TVEA 4Z2TA 3OR5A 4O5QA 4BWQA 1J08A 3IE3A 2GZZA 3J7Yb 2LNSA 3GHAA 4ECBA 3GMFA 3WGEA 4MH3A 1GSQA 4POBA 13GSA 4HU9A 5IMAA 1GSEA 2HLSA 3F4RA 2FWHA 4HS1A 2R2JA 1MDIA 3E3EA 3Q6OA 1ERVA 3TJKA 3Q18A 3F0IA 3A2VA 4XRAA 1YZXA 2V41A 4QQ7A 4KDUA 3KEBA 1E6BA 3TKRA 3UOMA 1B9YC 2G2QA 4AJ6A 1GL8A 1AQWA 1K0DA 1YEPA 1XW5A 2FD3A 4DSQA 1I9DA 3ZVJD 4KE3A 2YN1A 1WIKA 4EC0A 2CQ9A 2DJ2A 4EUYA 4BVXA 5J41A 3A5WA 1F37A 2VAFA 3TOUA 1G7OA 1SK2A 1ZYEA 1ZYQB 3KM6A 3D6IA 2NPBA 3BD2A 3CBUA 1YEXA 2PMTA 5G31A 1F2EA 4MP4A 3RPNA 3PGTA 5D9VA 1GTBA 5J9BA 4QL7A 2MBTA 4NXIA 3FYGA 2DMLA 2H1AA 3LSZA 1QGVA 5HR3A 4MF7A 1ST9A 3GL5A 1VF4A 5F06A 2FLSA 1TRSA 1PX7A 2ES7A 3LQ7A 2FWFA 2L59A 3LFLA 2FCHA 4ZB8A 1TJDA 1TP9A 4DSRA 3FZ4A 1B4QA 5KN0A 2EIRA 2CAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCI A;  1GRX A;  1EP8 A;  2OBK A;  3L78 A;  6GST A;  5LCZ A;  2B6M A;  3GX8 A;  4F03 A;  3SWL A;  2C0E A;  2L5O A;  3UBL A;  2JU5 A;  3ZFL A;  3KD0 A;  1VF2 A;  3V1W A;  2C0F A;  1B4P A;  2DLX A;  1Z6N A;  5JWO B;  4D73 A;  2WCI A;  1SJZ A;  2K6V A;  4ZL9 A;  4MZW A;  2HNL A;  4IJ3 A;  1PSQ A;  1M2D A;  3DIE A;  1WRY A;  3QAW A;  3ZZX A;  3F3Q A;  2ON5 A;  3D4M A;  1W89 A;  3I43 A;  3KIJ A;  1K3O A;  2QC7 A;  4XRD A;  2OA7 A;  1EZK A;  1U87 A;  5G30 A;  1SKS B;  2MMO A;  3G7Y A;  2LQO A;  1SYR A;  2OAC A;  3GYK A;  2VIM A;  5IQY A;  3CSI A;  2FUG 2;  1DE1 A;  1BQ7 A;  4TRX A;  3KXO A;  4P3Y B;  2CAI A;  3GTU B;  3FY7 A;  1TW9 A;  3GNJ A;  1X5E A;  1CQG A;  1R7H A;  2H01 A;  2TRX A;  3DVX A;  3P2A A;  1F6M C;  4JRR A;  4K0G A;  1Q4J A;  4XS4 A;  4K2D A;  1OC8 A;  4MJA A;  5DJM A;  2F51 A;  1N8J A;  2LJA A;  4K7N A;  1XIY A;  4IQ1 A;  3LXZ A;  1QK8 A;  2DJ1 A;  4KCE A;  2PU9 C;  1R5P A;  1M0U A;  2CVK A;  1A0R P;  3FR9 A;  1AW9 A;  2JZS A;  3M8N A;  5A4U A;  4POK A;  1JZW A;  5GSS A;  1BYE A;  3KMO A;  5H5R A;  3NOF A;  1G0T A;  4TXO A;  1X5D A;  3KTB A;  5COH A;  3DML A;  1TU7 A;  2H1G A;  5ECN B;  2TRC P;  5LD0 A;  4F2I A;  1O8W A;  2E2G A;  5CRG A;  1U3I A;  3TJB A;  3G7J A;  4HU7 A;  2C3N A;  1Z7P A;  2FA4 A;  1TRV A;  1B8X A;  2P5R A;  1FOV A;  3IA1 A;  5ABR A;  4OFM A;  3CRU A;  5EVO A;  3WT1 A;  3QAG A;  4TR4 A;  1LBK A;  1GUH A;  2GQM A;  3GIX A;  5ECS A;  3E9J B;  3L9U A;  2CVB A;  4IHU A;  2WZ9 A;  4K6X A;  4QL9 A;  1I5G A;  1M7T A;  3ZRD A;  4NV2 A;  3VFI A;  1PKW A;  4WR4 A;  1GTU A;  3UMA A;  3MAK A;  1WPI A;  2B1K A;  1MTC A;  4L5O A;  3F8U A;  2WB9 A;  3C1S A;  4TR3 A;  1T3B A;  3IBH A;  1O81 A;  5JWQ B;  14GS A;  5INY A;  4NHZ A;  1GH2 A;  2LEG A;  5CO3 A;  4HJ2 A;  2MZC A;  3QMX A;  5IMD A;  1MD4 A;  1AC1 A;  2V2G A;  5HFG A;  4N11 A;  1JZD A;  4WF4 A;  2GSQ A;  3VWX A;  3TJF A;  1BX9 A;  4YQU A;  4EE0 A;  2GQK A;  3FZA A;  3DGQ A;  4I6X A;  4ZL8 A;  4IVF A;  2LJR A;  4MZC A;  4PNG A;  5JCW A;  4X43 A;  2JZT A;  4AF2 A;  4WF5 A;  1EP7 A;  5CP1 A;  4L0W A;  5CYY A;  2E7P A;  5GAP D;  1ERW A;  5DCG A;  4ZXG A;  3D21 A;  3KH7 A;  2H75 A;  2IIY A;  3HZ4 A;  4EO3 A;  3DXB A;  4KDY A;  3LXT A;  1NHO A;  1FO5 A;  4WBR D;  5DBQ A;  1NHY A;  4LMW A;  4KDX A;  5IIZ A;  3TRP A;  4FO5 A;  2P5Q A;  5IM9 A;  5IOW A;  4MMM A;  3TOT A;  2AJQ B;  5EPF A;  3HDC A;  2EIQ A;  4BPY A;  3W8S A;  1G7E A;  1K0B A;  4F0C A;  2LS5 A;  9GSS A;  3FR3 A;  1TI3 A;  1XWA A;  19GS A;  2LRT A;  4KCA A;  2I1U A;  1T1V A;  4OCE A;  4HI7 A;  2A2S A;  2P31 A;  4IN0 A;  1BJX A;  3QAV A;  3EE2 A;  4JR4 A;  2L4Q A;  6GSV A;  1H75 A;  4O92 A;  3LYP A;  18GS A;  1FHE A;  4O5R A;  1ILO A;  3QOU A;  2OE3 A;  2IPA A;  1XWG A;  2N5A A;  3CTF A;  1A23 A;  1TOF A;  1QQ2 A;  4G10 A;  2HZF A;  3H93 A;  3H4K A;  1IYH A;  1M2B A;  5J5N A;  4JED A;  2XPD A;  3BCK A;  4O7H A;  4JZQ A;  2AHE A;  4FIW A;  1UA5 A;  4I2U A;  2OAD A;  2PVO C;  1X9M B;  2VM2 A;  2KP2 A;  2IFQ B;  2IMK A;  4KND A;  5CRD A;  3HCZ A;  3IHQ A;  2HRN A;  2XC2 A;  1SK0 A;  3H79 A;  1V9W A;  4HEA 2;  2HSH A;  1GLP A;  3WGX A;  1JFU A;  4MLY A;  3FKF A;  2IME A;  2KUC A;  4OD7 A;  2B7K A;  2M80 A;  2LQQ A;  5HR0 A;  2H19 A;  1SJI A;  4RUV A;  1X0R A;  2HYX A;  4IBP A;  4RI7 A;  4MF5 A;  3RHB A;  2YOI A;  1T8E B;  4DSS B;  5E4W A;  4NPB A;  1PGT A;  5G5E A;  4HQZ A;  3L4N A;  2OJL A;  1V58 A;  6GSW A;  3EU4 A;  5DAL A;  3C1R A;  1ON4 A;  2B5E A;  5AGY A;  2DJ3 A;  1EV9 A;  4OO5 A;  1DE2 A;  5CRE A;  5HFI A;  2CX3 A;  1AUC A;  4LA1 A;  2YWO A;  4JU5 A;  3ED3 A;  3E0U A;  1A0F A;  3HD5 A;  4KSM A;  1E2Y A;  1XZO A;  3GTU A;  4XTS A;  3O76 A;  3KZQ A;  3EVI A;  5DCH A;  2P0G A;  2IN3 A;  3EUR A;  3ZYW A;  3VWV A;  1F3B A;  4ML1 A;  1K0O A;  4GLT A;  4OMV A;  2HSY A;  1AXD A;  4TKY A;  4FYU A;  4XS1 A;  1YDK A;  4XIH A;  5A5K A;  2ZCT A;  3JCM L;  4X1U A;  3A2W A;  3GL3 A;  1XWC A;  1KEB A;  2D2Z A;  2H6Z A;  4H86 A;  3GFK A;  1TU8 A;  2H71 A;  1WE0 A;  4GQC A;  5ID2 A;  4K7O A;  3MSZ A;  2JSY A;  3P8W A;  4V2N A;  2C8U A;  3F4T A;  3IR4 A;  1SL1 B;  1O85 A;  2H6X A;  3GRX A;  2GLR A;  4EDZ A;  3H1N A;  4PQI A;  1OVN A;  3P90 A;  1OAZ A;  2EC4 A;  1OC9 B;  5A4V A;  2XHF A;  1HNA A;  1T7P B;  2FWE A;  2YWM A;  4ZB6 A;  1XXU A;  3GKN A;  1EEJ A;  2VCW A;  3HJM A;  5DQY A;  1PMT A;  2WS2 A;  3A3T A;  2BMX A;  1XWB A;  1EGR A;  3ZL5 A;  1SU9 A;  2MMN A;  5EL8 A;  4KUN A;  3UVH A;  12GS A;  2AB6 A;  3GST A;  3FEU A;  1MEK A;  3PH9 A;  4HJM A;  2F8F A;  1X9W B;  2GS3 A;  3N9J A;  1G6W A;  5ELA A;  2VCX A;  4MA9 A;  4KSO A;  3TCO A;  3ISO A;  4EL1 A;  2C3Q A;  5IMF A;  2IMI A;  2RII A;  2KOK A;  4POM A;  2VCT A;  3G7I A;  2B1L A;  2H74 A;  3IK7 A;  4WXT A;  5D93 A;  5GAN D;  4ZBD A;  3LG6 A;  5ECH B;  1GSD A;  4RI6 A;  4PGT A;  2GSS A;  2YZU A;  3APQ A;  2R6K A;  4BL7 A;  2VO4 A;  3WD6 A;  4PUF C;  2GGT A;  2X8H A;  2GZP A;  2JZR A;  1N2A A;  3KTL A;  2CZ2 A;  2DSA A;  1BAY A;  2QGV A;  4PQ1 A;  1VGL A;  4MF6 A;  3VWW A;  3F3R A;  1VF1 A;  5AN1 A;  2YJH A;  5ENU A;  3DWV A;  4DVC A;  5B8A A;  1XOB A;  1ZOF A;  2MMA A;  1WMJ A;  4EXJ A;  2IJY A;  2V6K A;  1FAA A;  2L4C A;  4LLR A;  2K18 A;  2VL3 A;  3EWL A;  3IDV A;  5D9X A;  1FB6 A;  2AYT A;  4PXO A;  2LST A;  1V98 A;  5FHI A;  2H66 A;  4HOJ A;  3CSJ A;  3G9B A;  2VCQ A;  2DBC A;  5KN1 A;  2DJK A;  1O73 A;  2VLT A;  2ZNM A;  3VLN A;  3Q19 A;  1PN9 A;  3CRT A;  3GH9 A;  5J3R A;  4L5L A;  3F6D A;  5D9W A;  2PVQ A;  5IMV A;  1YF1 A;  4PX1 A;  2B5Y A;  3IAS 2;  1EWX A;  3TKS A;  1PA3 A;  3FZ5 A;  3HJP A;  3QFA C;  4PNF A;  1GP1 A;  1HD2 A;  1PL1 A;  1YKA A;  1ZCP A;  4JR6 A;  3SBC A;  1F9M A;  2H0G A;  1KTE A;  5F07 A;  3O3T A;  1T4Y A;  2GZY A;  5L71 A;  4TOP A;  3M9K A;  4ZL7 A;  4IW9 A;  22GS A;  2E2M A;  3HJO A;  5IPH A;  5J4U A;  2AV4 A;  2H72 A;  1NM3 A;  2H73 A;  1UVZ A;  2VLV A;  1FB0 A;  4NMU A;  1A2L A;  3VI5 A;  3R2Q A;  2IWT A;  3DKS A;  1GTA A;  1WJK A;  4Z7X A;  1X5C A;  2K8V A;  3EMP A;  3UL3 A;  17GS A;  4MJB A;  4GF0 A;  1TI1 A;  1M99 A;  4G9H A;  1XVQ A;  1QMV A;  2H8L A;  3CXG A;  3ZIV A;  2BJX A;  4EDY A;  4ZIJ A;  3DVW A;  1GUL A;  2GQL A;  4MPF A;  1ML6 A;  3VWU A;  2KLX A;  1PL2 A;  4V1A p;  2VUP A;  5C00 A;  2LV3 A;  5G1L A;  4FH8 A;  1ZZY A;  2GTU A;  3D22 A;  1EOG A;  2H6Y A;  2WFC A;  4POL A;  5E59 A;  4GXZ A;  1SEN A;  5JCG A;  4DSS A;  2G0F A;  2WJU A;  3M0F A;  3TKS C;  1BG5 A;  2E0Q A;  3DYR A;  4KX4 A;  2RUF A;  3U6V A;  2K9F A;  4YAV A;  4L0U A;  4K1F A;  2A4V A;  3RBT A;  3NIV A;  4NAX A;  5FT3 A;  2F8A A;  1A8Y A;  3HY2 A;  2LNT A;  4RQX A;  5FWG A;  2MMZ A;  5IO2 A;  1CQH A;  6GSU A;  4KH7 A;  2XBI A;  1K0C A;  4I5Q A;  3DEX A;  5ECI B;  4ACS A;  4MPG A;  5DQS A;  1YF0 A;  4WR5 A;  4ECI A;  1OKT A;  1PKZ A;  1GWC A;  4AJ8 A;  5H5S A;  1A24 A;  4BWS A;  1TK8 B;  1NW2 A;  3HHV A;  4D73 B;  5EY6 A;  2VL9 A;  4FYC A;  1V57 A;  1SL2 B;  5C04 A;  4F82 A;  4MAB A;  3HKR A;  2GT6 A;  3MNG A;  1LJR A;  2B3S A;  2RUE A;  1H4O A;  3ME7 A;  4OWY A;  1JZR A;  4MZB A;  1ABA A;  1GSS A;  3QFB C;  6GSS A;  2HRF A;  3FK8 A;  2GSR A;  4GSN A;  3MWH A;  4F0B A;  2LTK A;  3L9V A;  3RHC A;  2JAD A;  1R26 A;  4GTU A;  1K3Y A;  3UVT A;  1SD8 A;  2VM1 A;  10GS A;  5DVB A;  5B7C A;  2PPT A;  2YAN A;  4ULX A;  1TDI A;  4G19 A;  1J9B A;  4O32 A;  3GA4 A;  4NWY A;  1THX A;  1DUG A;  3I69 A;  1ERU A;  1M9A A;  4FYB A;  2N5F A;  2QSI A;  1K0N A;  4EF0 A;  2GST A;  1TK5 B;  1SD9 A;  1K0M A;  2M46 A;  2I9H A;  2WGR A;  3GSS A;  3ZMK A;  3IXR A;  4XS6 A;  1URM A;  2C3T A;  2CA8 A;  2H0I A;  1LU4 A;  4I2T A;  3TDG A;  4Q5R A;  3APO A;  1OE8 A;  4E8H A;  2MBS A;  4EVM A;  3DRN A;  1DSB A;  4JE1 A;  4LMV A;  2OE1 A;  1B9X C;  4OFT A;  4WET A;  5AIS A;  4IS0 A;  2WUL A;  1K3L A;  1V40 A;  3M3M A;  2B7J A;  2ALB A;  2DIZ A;  3EU3 A;  3KJY A;  2DJ0 A;  7GSS A;  3DD3 A;  1M2A A;  3C73 A;  3FZ9 A;  3GX0 A;  1TRU A;  4MJE A;  2K8S A;  2REM A;  5F0G A;  3LJR A;  5HR2 A;  4ZIL A;  3GH6 A;  4IKH A;  2J23 A;  1ZL9 A;  20GS A;  1Q98 A;  1KNG A;  1NSW A;  4N0V A;  3M9J A;  2OE0 A;  3O6T A;  2R4V A;  5IMC A;  4GQF A;  3UAR A;  1Z6M A;  4MH2 A;  1FVK A;  1PRX A;  2VL2 A;  5ECK B;  1S3C A;  2X8G A;  11GS A;  1W4V A;  3F4S A;  2YJ7 A;  2O8V B;  2H0H A;  1XW6 A;  3FHK A;  2IL3 A;  4K9Z A;  4RQR A;  3QD9 A;  1VRS D;  1Y6E A;  4ZBA A;  3D0Z A;  1MDK A;  1GSU A;  2YCD A;  5ELG A;  1B48 A;  2VD1 A;  2FGX A;  1A2J A;  5KEJ A;  5IMZ A;  3I6A A;  2KP1 A;  3VPQ A;  1ACV A;  1WWJ A;  5G5F A;  3EYT A;  3IV4 A;  3VUR A;  1OYJ A;  4IP1 A;  1O7U A;  1Z9H A;  4J56 E;  3TKP A;  1GLQ A;  3QCP A;  1AIU A;  2C1Y A;  1HNC A;  3ZLP A;  4BA7 A;  3HVX A;  1DBY A;  3LYK A;  3P7X A;  2N5B A;  2XPE A;  3RPP A;  4Q5F A;  3CSH A;  1GNW A;  5CNW A;  4I97 A;  4LL1 B;  1SK1 A;  2C4J A;  1G6Y A;  1U3A A;  4TXV A;  2RM5 A;  1AQV A;  1OE7 A;  3I9V 2;  3NZN A;  1FG4 A;  4N10 A;  4ID0 A;  1WOU A;  5ECO B;  3F6F A;  1RQM A;  4KAE A;  2VD0 A;  2ZUP A;  2NBS A;  2VL2 C;  3IOS A;  3F63 A;  3L9S A;  3HA9 A;  3TKS E;  2X64 A;  5IOX A;  2L57 A;  4F9Z A;  3IK9 A;  3C8E A;  1OKD A;  2FNO A;  4GRF A;  3TRX A;  1PX6 A;  1ERT A;  2NTO A;  2J9H A;  3ZRE A;  3K8N A;  3IAM 2;  4HZ2 A;  3GN3 A;  4OFN A;  4EKZ A;  5B8B A;  1Z7R A;  4N30 A;  4DEJ A;  1KBN A;  4K7I A;  3HVS A;  1C72 A;  1EEM A;  4KW6 A;  2VOC A;  4MJC A;  1USB A;  4CDO A;  3D5J A;  1M9B A;  2PUK C;  3ZTL A;  3KMN A;  2PN8 A;  1Y25 A;  3CYN A;  2I4A A;  2HZE B;  5D8I A;  3BOA A;  3UIW A;  6GSY A;  1UC7 A;  1S3A A;  4V2M A;  2OKA A;  2ON7 A;  1GTI A;  3QPM A;  1QXH A;  1TTZ A;  1XWK A;  3W8J A;  3IC4 A;  4XCS A;  3FRC A;  2WRT A;  3BJ5 A;  5B6M A;  2F9S A;  1SKW B;  4IJI A;  1J0F A;  1XOA A;  4YQV A;  1U6T A;  3U5R E;  6GSX A;  5D9T A;  1GSY A;  4X0X A;  3ERG A;  5DAK B;  1O6J A;  4G2E A;  4GCI A;  5F05 A;  4TR0 A;  3US3 A;  2H30 A;  4Q5Q A;  5DAL B;  3AY8 A;  1PQN A;  2C80 A;  2O87 A;  1ZMA A;  5IO0 A;  2C0D A;  4CW9 A;  4ECJ A;  4TR1 B;  3GKM A;  3GUS A;  3ZVJ A;  2RM6 A;  4WKW A;  4HQS A;  1Z3E A;  1YY7 A;  2LKU A;  1HQO A;  2VCZ A;  4MDC A;  5IPG A;  1R5A A;  1X9S B;  2H1B A;  2H70 A;  2YZH A;  3GKK A;  2I81 A;  1SL0 B;  5DJL A;  1RW1 A;  3ME8 A;  1MDJ A;  1XPV A;  3TGZ A;  1AQX A;  3TJG A;  4NV5 A;  4V2L A;  3KH9 A;  4ECC A;  2H76 A;  2YV7 A;  5HR1 A;  2VCV A;  3LEF A;  3UEM A;  1A2M A;  1PD2 1;  2X99 A;  4KA0 A;  2DMM A;  3KCM A;  2PGT A;  5ID2 B;  3LOR A;  5LNK e;  3F9U A;  4I8B A;  2V1M A;  2H1D A;  1A8L A;  2PER A;  3ZIJ A;  5F8B A;  3ZFB A;  1XVW A;  4MCU A;  2IFQ A;  4J2F A;  1TK0 B;  2PBJ A;  4KGI A;  3ZML A;  3TUE A;  2AUV A;  2NDO A;  4GSS A;  2LRC A;  1TRW A;  3EMX A;  3IRA A;  3VPT A;  2YWN A;  4K8M A;  2O89 A;  4AJ7 A;  1EOH A;  4JBB A;  16GS A;  2PWJ A;  1WP0 A;  4HDE A;  3L0H A;  2R37 A;  2QKE A;  4ZB9 A;  1O8X A;  5KN2 A;  2MYG A;  2KHP A;  3APS A;  4IQA A;  2RLI A;  2EIO A;  3C71 A;  2FHE A;  2JSZ A;  4WBJ A;  2R3X A;  4N0Z A;  3C7M A;  5ECM B;  5HQP A;  4ISD A;  3W6G A;  1QFN A;  5HFK A;  2CV4 A;  2CZ3 A;  4OCF A;  1HNB A;  1OC3 A;  5ECR B;  5B6N A;  3RAZ A;  3GV1 A;  4TN8 A;  8GSS A;  4PUR A;  2O85 A;  2YV9 A;  5CRW A;  1UN2 A;  4K0N A;  4L8E A;  2L5L A;  4NHW A;  1FVJ A;  4ML6 A;  1EV4 A;  1GSF A;  2TIR A;  3M1G A;  1T00 A;  3J7Y k;  3FR6 A;  2AAW A;  1GUM A;  1ZGN A;  3KP9 A;  5AIX A;  3GUR A;  4ZBB A;  5A4W A;  1U88 A;  4CHS A;  1GNE A;  1VF3 A;  2FA8 A;  2DC5 A;  4PUA A;  2GDR A;  2HFD A;  3N5O A;  2HT9 A;  2V6O A;  1T4Z A;  2V32 A;  2FY6 A;  4LL4 B;  2CVD A;  3CTG A;  1THO A;  2X8C A;  2NVL A;  1SKR B;  1TXX A;  1F3A A;  3A2X A;  2CT6 A;  5CRH A;  3WT2 A;  2I3Y A;  4PQH A;  1JZO A;  2OBI A;  1EGO A;  1AAZ A;  3HZ8 A;  4KB3 A;  3TKQ A;  4IGJ A;  5GZZ B;  2IMD A;  1JLV A;  4GWR A;  5ECP B;  4TW5 A;  1HYU A;  3HVV A;  3VI7 A;  3ERW A;  3IPZ A;  4OO4 A;  3TJJ A;  3Q74 A;  1BED A;  1JLW A;  2HXK A;  4GST A;  1QUW A;  1S3D A;  2DIY A;  4HUA A;  2B5X A;  2HI7 A;  1OC9 A;  3H8Q A;  5AIV A;  1RK4 A;  2YP6 A;  1TKD B;  4J57 E;  2O7K A;  4YAP A;  2F3M A;  3TRQ A;  3HYP A;  1SYX A;  4XS4 B;  1FW1 A;  4IP6 A;  4MK3 A;  5D73 A;  3RDW A;  3UAP A;  2YNX A;  2BTO T;  5G2Z A;  3VK9 A;  3WGD A;  1R4W A;  2Z9S A;  2GT5 A;  2L6C A;  3KGK A;  1YJ6 A;  3TB2 A;  3UJ1 A;  2YPM A;  2A2R A;  1IYI A;  3PIN A;  3UBK A;  4BVY A;  4Q5N A;  4WEY A;  5ECL B;  4E8E A;  5KN3 A;  3LWA A;  3S9F A;  1V2A A;  2WDU A;  4TXO B;  2JL4 A;  3CMI A;  4XHM A;  3PR8 A;  2C0G A;  2HZE A;  3FW2 A;  1GUK A;  1XBS A;  3WYW A;  1JHB A;  2M72 A;  5H5Q A;  2JAC A;  3EC3 A;  1XFL A;  4AGS A;  3QR6 A;  2HE3 A;  3LGC A;  3ERF A;  3MDK A;  2YWI A;  4HZ4 A;  3GKX A;  5J9C A;  5ECQ B;  5CAX A;  1SJ6 A;  1K0A A;  3HXS A;  2LJK A;  1MD3 A;  5GST A;  1Z5Y E;  2FWG A;  1YQ1 A;  4YQM A;  3QDN A;  4IEL A;  3ZIT A;  2DJJ A;  1YKC A;  2L6D A;  5JCU A;  5G1K A;  3EIN A;  2LRN A;  5DAK A;  1XCC A;  4YH2 A;  4ILF A;  2CX4 A;  5DDL A;  2LUS A;  3BBY A;  3D4T A;  2IMF A;  3KP8 A;  5JWR B;  4V1A g;  2R5G A;  2GVP A;  5D96 A;  2XBQ A;  4TR1 A;  2VLU A;  1XW9 A;  4TVE A;  3OR5 A;  4BWQ A;  1J08 A;  3IE3 A;  2GZZ A;  3J7Y b;  2LNS A;  3GHA A;  4ECB A;  3GMF A;  3WGE A;  4MH3 A;  1GSQ A;  4POB A;  13GS A;  4HU9 A;  5IMA A;  1GSE A;  2HLS A;  3F4R A;  2FWH A;  4HS1 A;  2R2J A;  1MDI A;  3E3E A;  3Q6O A;  1ERV A;  3TJK A;  3Q18 A;  3F0I A;  3A2V A;  4XRA A;  1YZX A;  2V41 A;  4QQ7 A;  4KDU A;  3KEB A;  1E6B A;  3TKR A;  3UOM A;  1B9Y C;  2G2Q A;  4AJ6 A;  1GL8 A;  1AQW A;  1K0D A;  1YEP A;  1XW5 A;  2FD3 A;  4DSQ A;  1I9D A;  3ZVJ D;  4KE3 A;  2YN1 A;  1WIK A;  4EC0 A;  2CQ9 A;  2DJ2 A;  4EUY A;  4BVX A;  5J41 A;  3A5W A;  1F37 A;  2VAF A;  3TOU A;  1G7O A;  1SK2 A;  1ZYE A;  1ZYQ B;  3KM6 A;  3D6I A;  2NPB A;  3BD2 A;  3CBU A;  1YEX A;  2PMT A;  5G31 A;  1F2E A;  4MP4 A;  3RPN A;  3PGT A;  5D9V A;  1GTB A;  5J9B A;  4QL7 A;  2MBT A;  4NXI A;  3FYG A;  2DML A;  2H1A A;  3LSZ A;  1QGV A;  5HR3 A;  4MF7 A;  1ST9 A;  3GL5 A;  1VF4 A;  5F06 A;  2FLS A;  1TRS A;  1PX7 A;  2ES7 A;  3LQ7 A;  2FWF A;  2L59 A;  3LFL A;  2FCH A;  4ZB8 A;  1TJD A;  1TP9 A;  4DSR A;  3FZ4 A;  1B4Q A;  5KN0 A;  2EIR A;  2CAQ A; 
#chains in the Genus database with same CATH topology
 3BCI A;  1GRX A;  1EP8 A;  2OBK A;  1PN0 A;  3L78 A;  6GST A;  5LCZ A;  2B6M A;  3GX8 A;  4F03 A;  3SWL A;  2C0E A;  2L5O A;  3UBL A;  2JU5 A;  3ZFL A;  3KD0 A;  1VF2 A;  3V1W A;  2C0F A;  1B4P A;  2DLX A;  1Z6N A;  2HRK A;  5JWO B;  4D73 A;  3IHG A;  2WCI A;  1SJZ A;  2K6V A;  4ZL9 A;  4MZW A;  2HNL A;  4IJ3 A;  1PSQ A;  1M2D A;  3DIE A;  1WRY A;  3QAW A;  3ZZX A;  3F3Q A;  2ON5 A;  3D4M A;  1W89 A;  3I43 A;  3KIJ A;  1K3O A;  2QC7 A;  4XRD A;  2OA7 A;  1EZK A;  1U87 A;  5G30 A;  1SKS B;  2MMO A;  4O5U A;  3G7Y A;  2LQO A;  1SYR A;  2OAC A;  3GYK A;  2VIM A;  5IQY A;  3CSI A;  2FUG 2;  1DE1 A;  1BQ7 A;  4TRX A;  3KXO A;  4P3Y B;  2CAI A;  3GTU B;  3FY7 A;  1TW9 A;  3GNJ A;  1X5E A;  1CQG A;  1R7H A;  2H01 A;  2TRX A;  3DVX A;  3P2A A;  1F6M C;  4JRR A;  4K0G A;  1Q4J A;  4XS4 A;  4K2D A;  1OC8 A;  4MJA A;  5DJM A;  2F51 A;  1N8J A;  5KOX A;  5KOW A;  2LJA A;  4K7N A;  1XIY A;  4IQ1 A;  3LXZ A;  1QK8 A;  2DJ1 A;  4KCE A;  2PU9 C;  1R5P A;  1M0U A;  2CVK A;  1A0R P;  3FR9 A;  1AW9 A;  2JZS A;  3M8N A;  5A4U A;  4POK A;  1JZW A;  5GSS A;  1BYE A;  3KMO A;  5H5R A;  3NOF A;  1G0T A;  4TXO A;  1X5D A;  3KTB A;  5COH A;  3DML A;  1TU7 A;  2H1G A;  5ECN B;  2TRC P;  5LD0 A;  4F2I A;  1O8W A;  2E2G A;  5CRG A;  1U3I A;  3TJB A;  3G7J A;  4HU7 A;  2C3N A;  4X4J A;  1Z7P A;  2FA4 A;  1TRV A;  1B8X A;  2P5R A;  1FOV A;  3IA1 A;  5ABR A;  4OFM A;  3CRU A;  5EVO A;  3WT1 A;  3QAG A;  4TR4 A;  1LBK A;  1GUH A;  2HSM A;  2GQM A;  3GIX A;  5ECS A;  3E9J B;  3L9U A;  2CVB A;  4IHU A;  2WZ9 A;  4K6X A;  4QL9 A;  1I5G A;  1M7T A;  3ZRD A;  4NV2 A;  3VFI A;  1PKW A;  4WR4 A;  1GTU A;  3UMA A;  3MAK A;  4G0L A;  1WPI A;  2B1K A;  1MTC A;  4L5O A;  3F8U A;  2WB9 A;  3C1S A;  4TR3 A;  1T3B A;  3IBH A;  1O81 A;  5JWQ B;  14GS A;  5INY A;  4NHZ A;  1GH2 A;  2LEG A;  5CO3 A;  4HJ2 A;  2MZC A;  3QMX A;  5IMD A;  4BIK A;  1MD4 A;  1AC1 A;  2V2G A;  5HFG A;  4N11 A;  1JZD A;  4WF4 A;  2GSQ A;  3VWX A;  3TJF A;  1BX9 A;  4YQU A;  1M3I A;  4EE0 A;  2GQK A;  3FZA A;  3DGQ A;  4I6X A;  4KF9 A;  4ZL8 A;  4IVF A;  2LJR A;  4MZC A;  4PNG A;  5JCW A;  4X43 A;  2JZT A;  4AF2 A;  4WF5 A;  1EP7 A;  5CP1 A;  4L0W A;  5CYY A;  2E7P A;  5GAP D;  1ERW A;  5DCG A;  4ZXG A;  3D21 A;  3KH7 A;  2H75 A;  4K2X A;  2IIY A;  3HZ4 A;  4EO3 A;  3DXB A;  4KDY A;  3LXT A;  1NHO A;  4EIQ A;  4WBR D;  5DBQ A;  1FO5 A;  1NHY A;  4LMW A;  4KDX A;  5IIZ A;  3TRP A;  4FO5 A;  2P5Q A;  5IM9 A;  5IOW A;  4MMM A;  3TOT A;  2AJQ B;  5EPF A;  3HDC A;  2EIQ A;  4BPY A;  3W8S A;  1G7E A;  1K0B A;  4F0C A;  4YKG A;  2LS5 A;  9GSS A;  3FR3 A;  1TI3 A;  1XWA A;  19GS A;  2LRT A;  4KCA A;  2I1U A;  1T1V A;  4OCE A;  4HI7 A;  2A2S A;  2P31 A;  4IN0 A;  1BJX A;  3QAV A;  3EE2 A;  4JR4 A;  2L4Q A;  6GSV A;  1H75 A;  4O92 A;  3LYP A;  18GS A;  1FHE A;  4O5R A;  1ILO A;  3QOU A;  2OE3 A;  2IPA A;  1XWG A;  2N5A A;  3CTF A;  1A23 A;  1TOF A;  1QQ2 A;  4G10 A;  2HZF A;  3H93 A;  3H4K A;  2HRA A;  1IYH A;  1M2B A;  5J5N A;  4JED A;  2XPD A;  3BCK A;  4O7H A;  4JZQ A;  2AHE A;  4FIW A;  1UA5 A;  4I2U A;  2OAD A;  2PVO C;  1X9M B;  2VM2 A;  2KP2 A;  2IFQ B;  2IMK A;  4KND A;  4A5P A;  5CRD A;  3HCZ A;  3IHQ A;  2HRN A;  2XC2 A;  1SK0 A;  3H79 A;  1V9W A;  4HEA 2;  2HSH A;  1GLP A;  3WGX A;  1JFU A;  4MLY A;  3FKF A;  2IME A;  2KUC A;  4OD7 A;  2B7K A;  2M80 A;  2LQQ A;  5HR0 A;  2H19 A;  1SJI A;  4RUV A;  1X0R A;  2HYX A;  4IBP A;  4RI7 A;  4MF5 A;  3RHB A;  2YOI A;  1T8E B;  4DSS B;  1FOH A;  5E4W A;  4NPB A;  1PGT A;  5G5E A;  4HQZ A;  3L4N A;  2OJL A;  1V58 A;  6GSW A;  3EU4 A;  5DAL A;  3C1R A;  1ON4 A;  3CQF A;  2B5E A;  5AGY A;  2DJ3 A;  1EV9 A;  4OO5 A;  1DE2 A;  5CRE A;  5HFI A;  2CX3 A;  1AUC A;  4LA1 A;  2YWO A;  4JU5 A;  3ED3 A;  3E0U A;  1A0F A;  3HD5 A;  4KSM A;  1E2Y A;  1XZO A;  3GTU A;  4XTS A;  3O76 A;  3KZQ A;  3EVI A;  5DCH A;  2P0G A;  2IN3 A;  3EUR A;  3ZYW A;  3VWV A;  1F3B A;  4Z2U A;  4ML1 A;  1K0O A;  4GLT A;  4OMV A;  2HSY A;  1AXD A;  4TKY A;  4FYU A;  4XS1 A;  1YDK A;  4XIH A;  5A5K A;  2ZCT A;  3JCM L;  4X1U A;  3A2W A;  3IC8 A;  3GL3 A;  1XWC A;  1KEB A;  2D2Z A;  2H6Z A;  4G0I A;  4H86 A;  3GFK A;  1TU8 A;  2H71 A;  1WE0 A;  4GQC A;  5ID2 A;  4K7O A;  3MSZ A;  2JSY A;  3P8W A;  4V2N A;  2C8U A;  3F4T A;  3IR4 A;  1SL1 B;  1O85 A;  2H6X A;  3GRX A;  2GLR A;  4EDZ A;  3H1N A;  4PQI A;  1OVN A;  3P90 A;  1OAZ A;  2EC4 A;  1OC9 B;  5A4V A;  2XHF A;  1HNA A;  1T7P B;  2FWE A;  2YWM A;  4ZB6 A;  1XXU A;  3GKN A;  1EEJ A;  2VCW A;  3HJM A;  5DQY A;  1PMT A;  2WS2 A;  3A3T A;  2BMX A;  1XWB A;  1EGR A;  3ZL5 A;  1SU9 A;  2MMN A;  5EL8 A;  4KUN A;  4HSC X;  3UVH A;  12GS A;  2AB6 A;  3GST A;  3FEU A;  1MEK A;  3PH9 A;  4HJM A;  2F8F A;  1X9W B;  2GS3 A;  3N9J A;  1G6W A;  5ELA A;  2VCX A;  4MA9 A;  4KSO A;  3TCO A;  3ISO A;  4EL1 A;  2C3Q A;  5IMF A;  2IMI A;  2RII A;  2KOK A;  4POM A;  2VCT A;  3G7I A;  2B1L A;  2H74 A;  3IK7 A;  4WXT A;  4BVY B;  5D93 A;  5GAN D;  4ZBD A;  3LG6 A;  5ECH B;  1GSD A;  4RI6 A;  4PGT A;  2QA2 A;  2GSS A;  2YZU A;  3APQ A;  2R6K A;  4BL7 A;  2VO4 A;  3WD6 A;  4PUF C;  2GGT A;  2X8H A;  2GZP A;  2JZR A;  1N2A A;  3KTL A;  2CZ2 A;  2DSA A;  3MIX A;  1BAY A;  2QGV A;  4PQ1 A;  1VGL A;  4MF6 A;  3VWW A;  3F3R A;  1VF1 A;  5AN1 A;  2YJH A;  5ENU A;  3DWV A;  4DVC A;  5B8A A;  1XOB A;  1ZOF A;  2MMA A;  1WMJ A;  4EXJ A;  2IJY A;  2V6K A;  1FAA A;  2L4C A;  4LLR A;  2K18 A;  2VL3 A;  3EWL A;  3IDV A;  5D9X A;  1FB6 A;  2AYT A;  4PXO A;  2LST A;  1V98 A;  5FHI A;  2H66 A;  4HOJ A;  3CSJ A;  3G9B A;  2VCQ A;  5BMU A;  2DBC A;  2X4A A;  5KN1 A;  2DJK A;  1O73 A;  2VLT A;  2ZNM A;  3VLN A;  3Q19 A;  1PN9 A;  3CRT A;  3GH9 A;  5J3R A;  4L5L A;  3F6D A;  5D9W A;  2PVQ A;  5IMV A;  1YF1 A;  4PX1 A;  2B5Y A;  3IAS 2;  1EWX A;  3TKS A;  1PA3 A;  3FZ5 A;  3HJP A;  2R0C A;  3QFA C;  4PNF A;  1GP1 A;  1HD2 A;  1PL1 A;  1YKA A;  1ZCP A;  4JR6 A;  3SBC A;  1F9M A;  2H0G A;  1KTE A;  5F07 A;  3O3T A;  1T4Y A;  2GZY A;  5L71 A;  4TOP A;  3M9K A;  4ZL7 A;  4IW9 A;  22GS A;  2E2M A;  3HJO A;  5IPH A;  5J4U A;  2AV4 A;  2H72 A;  1NM3 A;  2H73 A;  1UVZ A;  2VLV A;  1FB0 A;  4NMU A;  1A2L A;  3VI5 A;  3R2Q A;  2IWT A;  3DKS A;  1GTA A;  1WJK A;  4Z7X A;  1X5C A;  2K8V A;  3EMP A;  3UL3 A;  17GS A;  4MJB A;  4GF0 A;  1TI1 A;  1M99 A;  4G9H A;  1XVQ A;  1QMV A;  2H8L A;  3CXG A;  3ZIV A;  2BJX A;  4EDY A;  4ZIJ A;  3DVW A;  1GUL A;  2GQL A;  4MPF A;  1ML6 A;  3VWU A;  2KLX A;  1PL2 A;  4V1A p;  4BVX B;  2VUP A;  5C00 A;  2LV3 A;  5G1L A;  4FH8 A;  1ZZY A;  2GTU A;  3D22 A;  1EOG A;  2H6Y A;  2WFC A;  4POL A;  5E59 A;  5A2Q I;  1PFO A;  4GXZ A;  1SEN A;  5JCG A;  4DSS A;  2G0F A;  2WJU A;  3M0F A;  3TKS C;  1BG5 A;  2E0Q A;  3DYR A;  4KX4 A;  2RUF A;  3U6V A;  2K9F A;  4YAV A;  4L0U A;  4K1F A;  2A4V A;  3RBT A;  3NIV A;  4NAX A;  5FT3 A;  2F8A A;  2A4H A;  1A8Y A;  3HY2 A;  2LNT A;  4RQX A;  5FWG A;  2MMZ A;  5IO2 A;  1CQH A;  6GSU A;  4KH7 A;  2XBI A;  1K0C A;  4I5Q A;  3DEX A;  5ECI B;  4ACS A;  4MPG A;  5DQS A;  5FLX I;  1YF0 A;  4WR5 A;  4ECI A;  1OKT A;  1PKZ A;  1GWC A;  4AJ8 A;  5H5S A;  1A24 A;  4BWS A;  1TK8 B;  1NW2 A;  3HHV A;  4D73 B;  5EY6 A;  2VL9 A;  4FYC A;  1V57 A;  1SL2 B;  5C04 A;  4F82 A;  4MAB A;  3HKR A;  2GT6 A;  3MNG A;  1LJR A;  2B3S A;  2RUE A;  1H4O A;  3ME7 A;  4OWY A;  1JZR A;  4MZB A;  1ABA A;  1GSS A;  3QFB C;  6GSS A;  2HRF A;  3A5I A;  3FK8 A;  2GSR A;  4GSN A;  3MWH A;  4F0B A;  2LTK A;  3L9V A;  4FQU A;  3RHC A;  2JAD A;  1R26 A;  4GTU A;  1K3Y A;  3UVT A;  1SD8 A;  2VM1 A;  10GS A;  5DVB A;  5B7C A;  2PPT A;  2YAN A;  4ULX A;  1TDI A;  4G19 A;  1J9B A;  4O32 A;  3GA4 A;  4NWY A;  1THX A;  1DUG A;  3I69 A;  1ERU A;  1M9A A;  4FYB A;  2N5F A;  2QSI A;  1K0N A;  4EF0 A;  2GST A;  1TK5 B;  1SD9 A;  1K0M A;  2M46 A;  2I9H A;  2WGR A;  3GSS A;  3ZMK A;  3IXR A;  4XS6 A;  1URM A;  2C3T A;  2CA8 A;  2H0I A;  1LU4 A;  4I2T A;  4K5R A;  3TDG A;  4Q5R A;  3APO A;  1OE8 A;  4E8H A;  2MBS A;  4EVM A;  3DRN A;  1DSB A;  4JE1 A;  4LMV A;  2OE1 A;  1B9X C;  4OFT A;  4WET A;  5AIS A;  4IS0 A;  2WUL A;  1K3L A;  3J81 I;  1V40 A;  3M3M A;  2B7J A;  2ALB A;  2DIZ A;  3EU3 A;  3KJY A;  2DJ0 A;  7GSS A;  3DD3 A;  1M2A A;  3C73 A;  3FZ9 A;  3GX0 A;  1ZYP A;  1TRU A;  4MJE A;  2K8S A;  2REM A;  5F0G A;  5IT9 I;  3LJR A;  5HR2 A;  4ZIL A;  3GH6 A;  4IKH A;  2J23 A;  1ZL9 A;  20GS A;  1Q98 A;  1KNG A;  1NSW A;  4N0V A;  3M9J A;  2OE0 A;  3O6T A;  2R4V A;  5IMC A;  4GQF A;  3UAR A;  1Z6M A;  4MH2 A;  1FVK A;  1PRX A;  4MNN A;  4CY6 A;  2VL2 A;  5ECK B;  1S3C A;  2X8G A;  11GS A;  1W4V A;  3F4S A;  2YJ7 A;  3HVN A;  2O8V B;  2H0H A;  1XW6 A;  3FHK A;  2IL3 A;  4K9Z A;  4RQR A;  3QD9 A;  1VRS D;  1Y6E A;  4ZBA A;  3D0Z A;  1MDK A;  1GSU A;  2YCD A;  5ELG A;  1B48 A;  2VD1 A;  2FGX A;  1A2J A;  5KEJ A;  5IMZ A;  3I6A A;  2KP1 A;  3VPQ A;  1ACV A;  1WWJ A;  5G5F A;  3EYT A;  1S3R A;  3IV4 A;  3VUR A;  1OYJ A;  3MYD A;  4IP1 A;  1O7U A;  1Z9H A;  4J56 E;  3TKP A;  1GLQ A;  3QCP A;  1AIU A;  2C1Y A;  1HNC A;  3ZLP A;  4BA7 A;  3HVX A;  1DBY A;  2X49 A;  3LYK A;  3P7X A;  2N5B A;  2DKI A;  2XPE A;  3RPP A;  4Q5F A;  3CSH A;  1GNW A;  5CNW A;  4I97 A;  4LL1 B;  1SK1 A;  2C4J A;  1G6Y A;  1U3A A;  4TXV A;  2RM5 A;  1AQV A;  1OE7 A;  3I9V 2;  4YKF A;  3NZN A;  1FG4 A;  4N10 A;  4ID0 A;  1WOU A;  5ECO B;  3F6F A;  1RQM A;  4KAE A;  2VD0 A;  4PTS A;  2ZUP A;  2NBS A;  4K5S A;  2VL2 C;  3IOS A;  3F63 A;  3L9S A;  3HA9 A;  3TKS E;  2X64 A;  5IOX A;  2L57 A;  4F9Z A;  3IK9 A;  3C8E A;  1OKD A;  2FNO A;  4GRF A;  3TRX A;  1PX6 A;  1ERT A;  2NTO A;  2J9H A;  3ZRE A;  3K8N A;  3IAM 2;  4HZ2 A;  3GN3 A;  4OFN A;  4EKZ A;  5B8B A;  1Z7R A;  4N30 A;  4DEJ A;  1KBN A;  4K7I A;  3HVS A;  1C72 A;  1EEM A;  4KW6 A;  2VOC A;  4MJC A;  1USB A;  4CDO A;  3D5J A;  1M9B A;  2PUK C;  3ZTL A;  3KMN A;  3R3E A;  2PN8 A;  1Y25 A;  3CYN A;  2I4A A;  2HZE B;  5D8I A;  3BOA A;  3UIW A;  6GSY A;  1UC7 A;  1S3A A;  4V2M A;  2OKA A;  5BRT A;  2ON7 A;  1GTI A;  3QPM A;  1QXH A;  1TTZ A;  1XWK A;  3W8J A;  3IC4 A;  4XCS A;  3FRC A;  2WRT A;  3BJ5 A;  5B6M A;  2F9S A;  1SKW B;  4IJI A;  1J0F A;  1XOA A;  4YQV A;  1U6T A;  3U5R E;  6GSX A;  5D9T A;  1GSY A;  4X0X A;  3ERG A;  5DAK B;  1O6J A;  4G2E A;  4GCI A;  2R0G A;  5F05 A;  4G0K A;  4TR0 A;  3US3 A;  2H30 A;  4Q5Q A;  5DAL B;  4EIP A;  3AY8 A;  1PQN A;  2C80 A;  2O87 A;  1ZMA A;  5IO0 A;  2C0D A;  4CW9 A;  4ECJ A;  4TR1 B;  3GKM A;  3GUS A;  3ZVJ A;  2RM6 A;  4WKW A;  4HQS A;  1Z3E A;  1YY7 A;  2LKU A;  1HQO A;  2VCZ A;  4MDC A;  5IPG A;  1R5A A;  1X9S B;  2H1B A;  2H70 A;  2YZH A;  3GKK A;  2I81 A;  1SL0 B;  5DJL A;  1RW1 A;  3ME8 A;  1MDJ A;  1XPV A;  3FMW A;  3TGZ A;  1AQX A;  3TJG A;  4NV5 A;  4V2L A;  3KH9 A;  2A2P A;  4ECC A;  2H76 A;  2YV7 A;  3PPU A;  5HR1 A;  2VCV A;  3LEF A;  3UEM A;  1A2M A;  1PD2 1;  2X99 A;  4KA0 A;  2DMM A;  3KCM A;  2PGT A;  5ID2 B;  3LOR A;  5LNK e;  3F9U A;  4I8B A;  2V1M A;  2H1D A;  4Z2R A;  1A8L A;  2PER A;  3ZIJ A;  5F8B A;  3LW9 A;  3ZFB A;  1XVW A;  4MCU A;  2IFQ A;  4J2F A;  1TK0 B;  2PBJ A;  4KGI A;  3ZML A;  3TUE A;  2AUV A;  3JAM I;  2NDO A;  4GSS A;  2LRC A;  1TRW A;  3EMX A;  3IRA A;  3VPT A;  2YWN A;  4K8M A;  2O89 A;  4AJ7 A;  1EOH A;  4JBB A;  16GS A;  2PWJ A;  1WP0 A;  4HDE A;  3L0H A;  2R37 A;  2QKE A;  4ZB9 A;  1O8X A;  5KN2 A;  2MYG A;  2KHP A;  3APS A;  4IQA A;  2RLI A;  2EIO A;  3C71 A;  2FHE A;  2JSZ A;  4WBJ A;  2R3X A;  4N0Z A;  3C7M A;  5ECM B;  5HQP A;  4ISD A;  3W6G A;  1QFN A;  5HFK A;  2CV4 A;  2QA1 A;  2CZ3 A;  4OCF A;  1ZYN A;  1HNB A;  1OC3 A;  5ECR B;  5B6N A;  3RAZ A;  3GV1 A;  4TN8 A;  8GSS A;  4PUR A;  2O85 A;  2YV9 A;  5CRW A;  1UN2 A;  4K0N A;  3J80 I;  4L8E A;  2L5L A;  4NHW A;  1FVJ A;  4ML6 A;  1EV4 A;  4BL7 B;  1GSF A;  2TIR A;  3M1G A;  1T00 A;  3J7Y k;  3FR6 A;  2AAW A;  1GUM A;  1ZGN A;  3KP9 A;  5AIX A;  3GUR A;  4ZBB A;  5A4W A;  1U88 A;  4CHS A;  1GNE A;  1VF3 A;  2FA8 A;  2DC5 A;  4PUA A;  2GDR A;  2HFD A;  3N5O A;  2HT9 A;  2V6O A;  1T4Z A;  2V32 A;  2FY6 A;  4LL4 B;  2CVD A;  3CTG A;  1THO A;  2X8C A;  2NVL A;  1SKR B;  1TXX A;  1F3A A;  3A2X A;  2CT6 A;  5CRH A;  3WT2 A;  2I3Y A;  4PQH A;  2DKH A;  1JZO A;  2OBI A;  1EGO A;  1AAZ A;  3HZ8 A;  4KB3 A;  3TKQ A;  4IGJ A;  5GZZ B;  2IMD A;  1JLV A;  4GWR A;  5ECP B;  4TW5 A;  1HYU A;  3HVV A;  3VI7 A;  3ERW A;  3IPZ A;  4OO4 A;  3TJJ A;  3Q74 A;  1BED A;  1JLW A;  2HXK A;  4GST A;  1QUW A;  1S3D A;  2DIY A;  4HUA A;  2B5X A;  2HI7 A;  1OC9 A;  3H8Q A;  5AIV A;  1RK4 A;  2YP6 A;  1XG8 A;  1TKD B;  4J57 E;  2O7K A;  4YAP A;  2F3M A;  3TRQ A;  3HYP A;  1SYX A;  4XS4 B;  1FW1 A;  4IP6 A;  4MK3 A;  1M3J A;  5D73 A;  3RDW A;  3UAP A;  2YNX A;  2BTO T;  5G2Z A;  3VK9 A;  3WGD A;  1R4W A;  2Z9S A;  2GT5 A;  2L6C A;  3KGK A;  1YJ6 A;  3TB2 A;  3UJ1 A;  2UZ8 A;  2YPM A;  2A2R A;  1IYI A;  3PIN A;  3UBK A;  4BVY A;  4Q5N A;  4WEY A;  5ECL B;  4E8E A;  5KN3 A;  3LWA A;  3S9F A;  3EPT A;  1V2A A;  2WDU A;  4TXO B;  2JL4 A;  3CMI A;  4XHM A;  3PR8 A;  2C0G A;  2HZE A;  3FW2 A;  1GUK A;  1XBS A;  3WYW A;  1JHB A;  2M72 A;  5H5Q A;  2JAC A;  3EC3 A;  4USS A;  1XFL A;  4AGS A;  3QR6 A;  2HE3 A;  3LGC A;  3ERF A;  3MDK A;  2YWI A;  4HZ4 A;  3GKX A;  5J9C A;  5ECQ B;  5CAX A;  1SJ6 A;  1K0A A;  3HXS A;  2LJK A;  1MD3 A;  5GST A;  1Z5Y E;  2FWG A;  1YQ1 A;  4YQM A;  3QDN A;  4IEL A;  2R0P A;  3ZIT A;  2DJJ A;  1YKC A;  2L6D A;  5JCU A;  5G1K A;  5LL6 V;  3EIN A;  2LRN A;  5DAK A;  1XCC A;  4YH2 A;  4ILF A;  2CX4 A;  5DDL A;  2LUS A;  3BBY A;  3D4T A;  2IMF A;  3KP8 A;  5JWR B;  4V1A g;  2R5G A;  2GVP A;  4ICY A;  5D96 A;  2XBQ A;  4CY8 A;  4TR1 A;  2VLU A;  1XW9 A;  4TVE A;  4Z2T A;  3OR5 A;  4O5Q A;  4BWQ A;  1J08 A;  3IE3 A;  2GZZ A;  3J7Y b;  2LNS A;  3GHA A;  4ECB A;  3GMF A;  3WGE A;  4MH3 A;  1GSQ A;  4POB A;  13GS A;  4HU9 A;  5IMA A;  1GSE A;  2HLS A;  3F4R A;  2FWH A;  4HS1 A;  2R2J A;  1MDI A;  3E3E A;  3Q6O A;  1ERV A;  3TJK A;  3Q18 A;  3F0I A;  3A2V A;  4XRA A;  1YZX A;  2V41 A;  4QQ7 A;  4KDU A;  3KEB A;  1E6B A;  3TKR A;  3UOM A;  1B9Y C;  2G2Q A;  4AJ6 A;  1GL8 A;  1AQW A;  1K0D A;  1YEP A;  1XW5 A;  2FD3 A;  4DSQ A;  1I9D A;  3ZVJ D;  4KE3 A;  2YN1 A;  1WIK A;  4EC0 A;  2CQ9 A;  2DJ2 A;  4EUY A;  4BVX A;  5J41 A;  3A5W A;  1F37 A;  2VAF A;  3TOU A;  1G7O A;  1SK2 A;  1ZYE A;  1ZYQ B;  3KM6 A;  3D6I A;  2NPB A;  3BD2 A;  3CBU A;  1YEX A;  2PMT A;  5G31 A;  1F2E A;  4MP4 A;  3RPN A;  3PGT A;  5D9V A;  1GTB A;  5J9B A;  4QL7 A;  2MBT A;  4NXI A;  3FYG A;  2DML A;  2H1A A;  3LSZ A;  1QGV A;  5HR3 A;  4MF7 A;  1ST9 A;  3GL5 A;  1VF4 A;  5F06 A;  2FLS A;  1TRS A;  1PX7 A;  2ES7 A;  3LQ7 A;  2FWF A;  2L59 A;  3LFL A;  2FCH A;  4ZB8 A;  1TJD A;  1TP9 A;  4DSR A;  3FZ4 A;  1B4Q A;  5KN0 A;  2EIR A;  2CAQ A; 
#chains in the Genus database with same CATH homology
 3BCI A;  1GRX A;  1EP8 A;  2OBK A;  1PN0 A;  3L78 A;  6GST A;  5LCZ A;  2B6M A;  3GX8 A;  4F03 A;  3SWL A;  2C0E A;  2L5O A;  3UBL A;  2JU5 A;  3ZFL A;  3KD0 A;  1VF2 A;  3V1W A;  2C0F A;  1B4P A;  2DLX A;  1Z6N A;  2HRK A;  5JWO B;  4D73 A;  3IHG A;  2WCI A;  1SJZ A;  2K6V A;  4ZL9 A;  4MZW A;  2HNL A;  4IJ3 A;  1PSQ A;  1M2D A;  3DIE A;  1WRY A;  3QAW A;  3ZZX A;  3F3Q A;  2ON5 A;  3D4M A;  1W89 A;  3I43 A;  3KIJ A;  1K3O A;  2QC7 A;  4XRD A;  2OA7 A;  1EZK A;  1U87 A;  5G30 A;  1SKS B;  2MMO A;  4O5U A;  3G7Y A;  2LQO A;  1SYR A;  2OAC A;  3GYK A;  2VIM A;  5IQY A;  3CSI A;  2FUG 2;  1DE1 A;  1BQ7 A;  4TRX A;  3KXO A;  4P3Y B;  2CAI A;  3GTU B;  3FY7 A;  1TW9 A;  3GNJ A;  1X5E A;  1CQG A;  1R7H A;  2H01 A;  2TRX A;  3DVX A;  3P2A A;  1F6M C;  4JRR A;  4K0G A;  1Q4J A;  4XS4 A;  4K2D A;  1OC8 A;  4MJA A;  5DJM A;  2F51 A;  1N8J A;  5KOX A;  5KOW A;  2LJA A;  4K7N A;  1XIY A;  4IQ1 A;  3LXZ A;  1QK8 A;  2DJ1 A;  4KCE A;  2PU9 C;  1R5P A;  1M0U A;  2CVK A;  1A0R P;  3FR9 A;  1AW9 A;  2JZS A;  3M8N A;  5A4U A;  4POK A;  1JZW A;  5GSS A;  1BYE A;  3KMO A;  5H5R A;  3NOF A;  1G0T A;  4TXO A;  1X5D A;  3KTB A;  5COH A;  3DML A;  1TU7 A;  2H1G A;  5ECN B;  2TRC P;  5LD0 A;  4F2I A;  1O8W A;  2E2G A;  5CRG A;  1U3I A;  3TJB A;  3G7J A;  4HU7 A;  2C3N A;  4X4J A;  1Z7P A;  2FA4 A;  1TRV A;  1B8X A;  2P5R A;  1FOV A;  3IA1 A;  5ABR A;  4OFM A;  3CRU A;  5EVO A;  3WT1 A;  3QAG A;  4TR4 A;  1LBK A;  1GUH A;  2HSM A;  2GQM A;  3GIX A;  5ECS A;  3E9J B;  3L9U A;  2CVB A;  4IHU A;  2WZ9 A;  4K6X A;  4QL9 A;  1I5G A;  1M7T A;  3ZRD A;  4NV2 A;  3VFI A;  1PKW A;  4WR4 A;  1GTU A;  3UMA A;  3MAK A;  4G0L A;  1WPI A;  2B1K A;  1MTC A;  4L5O A;  3F8U A;  2WB9 A;  3C1S A;  4TR3 A;  1T3B A;  3IBH A;  1O81 A;  5JWQ B;  14GS A;  5INY A;  4NHZ A;  1GH2 A;  2LEG A;  5CO3 A;  4HJ2 A;  2MZC A;  3QMX A;  5IMD A;  1MD4 A;  1AC1 A;  2V2G A;  5HFG A;  4N11 A;  1JZD A;  4WF4 A;  2GSQ A;  3VWX A;  3TJF A;  1BX9 A;  4YQU A;  4EE0 A;  2GQK A;  3FZA A;  3DGQ A;  4I6X A;  4KF9 A;  4ZL8 A;  4IVF A;  2LJR A;  4MZC A;  4PNG A;  5JCW A;  4X43 A;  2JZT A;  4AF2 A;  4WF5 A;  1EP7 A;  5CP1 A;  4L0W A;  5CYY A;  2E7P A;  5GAP D;  1ERW A;  5DCG A;  4ZXG A;  3D21 A;  3KH7 A;  2H75 A;  4K2X A;  2IIY A;  3HZ4 A;  4EO3 A;  3DXB A;  4KDY A;  3LXT A;  1NHO A;  4EIQ A;  4WBR D;  5DBQ A;  1FO5 A;  1NHY A;  4LMW A;  4KDX A;  5IIZ A;  3TRP A;  4FO5 A;  2P5Q A;  5IM9 A;  5IOW A;  4MMM A;  3TOT A;  2AJQ B;  5EPF A;  3HDC A;  2EIQ A;  4BPY A;  3W8S A;  1G7E A;  1K0B A;  4F0C A;  4YKG A;  2LS5 A;  9GSS A;  3FR3 A;  1TI3 A;  1XWA A;  19GS A;  2LRT A;  4KCA A;  2I1U A;  1T1V A;  4OCE A;  4HI7 A;  2A2S A;  2P31 A;  4IN0 A;  1BJX A;  3QAV A;  3EE2 A;  4JR4 A;  2L4Q A;  6GSV A;  1H75 A;  4O92 A;  3LYP A;  18GS A;  1FHE A;  4O5R A;  1ILO A;  3QOU A;  2OE3 A;  2IPA A;  1XWG A;  2N5A A;  3CTF A;  1A23 A;  1TOF A;  1QQ2 A;  4G10 A;  2HZF A;  3H93 A;  3H4K A;  2HRA A;  1IYH A;  1M2B A;  5J5N A;  4JED A;  2XPD A;  3BCK A;  4O7H A;  4JZQ A;  2AHE A;  4FIW A;  1UA5 A;  4I2U A;  2OAD A;  2PVO C;  1X9M B;  2VM2 A;  2KP2 A;  2IFQ B;  2IMK A;  4KND A;  4A5P A;  5CRD A;  3HCZ A;  3IHQ A;  2HRN A;  2XC2 A;  1SK0 A;  3H79 A;  1V9W A;  4HEA 2;  2HSH A;  1GLP A;  3WGX A;  1JFU A;  4MLY A;  3FKF A;  2IME A;  2KUC A;  4OD7 A;  2B7K A;  2M80 A;  2LQQ A;  5HR0 A;  2H19 A;  1SJI A;  4RUV A;  1X0R A;  2HYX A;  4IBP A;  4RI7 A;  4MF5 A;  3RHB A;  2YOI A;  1T8E B;  4DSS B;  1FOH A;  5E4W A;  4NPB A;  1PGT A;  5G5E A;  4HQZ A;  3L4N A;  2OJL A;  1V58 A;  6GSW A;  3EU4 A;  5DAL A;  3C1R A;  1ON4 A;  2B5E A;  5AGY A;  2DJ3 A;  1EV9 A;  4OO5 A;  1DE2 A;  5CRE A;  5HFI A;  2CX3 A;  1AUC A;  4LA1 A;  2YWO A;  4JU5 A;  3ED3 A;  3E0U A;  1A0F A;  3HD5 A;  4KSM A;  1E2Y A;  1XZO A;  3GTU A;  4XTS A;  3O76 A;  3KZQ A;  3EVI A;  5DCH A;  2P0G A;  2IN3 A;  3EUR A;  3ZYW A;  3VWV A;  1F3B A;  4Z2U A;  4ML1 A;  1K0O A;  4GLT A;  4OMV A;  2HSY A;  1AXD A;  4TKY A;  4FYU A;  4XS1 A;  1YDK A;  4XIH A;  5A5K A;  2ZCT A;  3JCM L;  4X1U A;  3A2W A;  3IC8 A;  3GL3 A;  1XWC A;  1KEB A;  2D2Z A;  2H6Z A;  4G0I A;  4H86 A;  3GFK A;  1TU8 A;  2H71 A;  1WE0 A;  4GQC A;  5ID2 A;  4K7O A;  3MSZ A;  2JSY A;  3P8W A;  4V2N A;  2C8U A;  3F4T A;  3IR4 A;  1SL1 B;  1O85 A;  2H6X A;  3GRX A;  2GLR A;  4EDZ A;  3H1N A;  4PQI A;  1OVN A;  3P90 A;  1OAZ A;  2EC4 A;  1OC9 B;  5A4V A;  2XHF A;  1HNA A;  1T7P B;  2FWE A;  2YWM A;  4ZB6 A;  1XXU A;  3GKN A;  1EEJ A;  2VCW A;  3HJM A;  5DQY A;  1PMT A;  2WS2 A;  3A3T A;  2BMX A;  1XWB A;  1EGR A;  3ZL5 A;  1SU9 A;  2MMN A;  5EL8 A;  4KUN A;  3UVH A;  12GS A;  2AB6 A;  3GST A;  3FEU A;  1MEK A;  3PH9 A;  4HJM A;  2F8F A;  1X9W B;  2GS3 A;  3N9J A;  1G6W A;  5ELA A;  2VCX A;  4MA9 A;  4KSO A;  3TCO A;  3ISO A;  4EL1 A;  2C3Q A;  5IMF A;  2IMI A;  2RII A;  2KOK A;  4POM A;  2VCT A;  3G7I A;  2B1L A;  2H74 A;  3IK7 A;  4WXT A;  4BVY B;  5D93 A;  5GAN D;  4ZBD A;  3LG6 A;  5ECH B;  1GSD A;  4RI6 A;  4PGT A;  2QA2 A;  2GSS A;  2YZU A;  3APQ A;  2R6K A;  4BL7 A;  2VO4 A;  3WD6 A;  4PUF C;  2GGT A;  2X8H A;  2GZP A;  2JZR A;  1N2A A;  3KTL A;  2CZ2 A;  2DSA A;  3MIX A;  1BAY A;  2QGV A;  4PQ1 A;  1VGL A;  4MF6 A;  3VWW A;  3F3R A;  1VF1 A;  5AN1 A;  2YJH A;  5ENU A;  3DWV A;  4DVC A;  5B8A A;  1XOB A;  1ZOF A;  2MMA A;  1WMJ A;  4EXJ A;  2IJY A;  2V6K A;  1FAA A;  2L4C A;  4LLR A;  2K18 A;  2VL3 A;  3EWL A;  3IDV A;  5D9X A;  1FB6 A;  2AYT A;  4PXO A;  2LST A;  1V98 A;  5FHI A;  2H66 A;  4HOJ A;  3CSJ A;  3G9B A;  2VCQ A;  5BMU A;  2DBC A;  2X4A A;  5KN1 A;  2DJK A;  1O73 A;  2VLT A;  2ZNM A;  3VLN A;  3Q19 A;  1PN9 A;  3CRT A;  3GH9 A;  5J3R A;  4L5L A;  3F6D A;  5D9W A;  2PVQ A;  5IMV A;  1YF1 A;  4PX1 A;  2B5Y A;  3IAS 2;  1EWX A;  3TKS A;  1PA3 A;  3FZ5 A;  3HJP A;  2R0C A;  3QFA C;  4PNF A;  1GP1 A;  1HD2 A;  1PL1 A;  1YKA A;  1ZCP A;  4JR6 A;  3SBC A;  1F9M A;  2H0G A;  1KTE A;  5F07 A;  3O3T A;  1T4Y A;  2GZY A;  5L71 A;  4TOP A;  3M9K A;  4ZL7 A;  4IW9 A;  22GS A;  2E2M A;  3HJO A;  5IPH A;  5J4U A;  2AV4 A;  2H72 A;  1NM3 A;  2H73 A;  1UVZ A;  2VLV A;  1FB0 A;  4NMU A;  1A2L A;  3VI5 A;  3R2Q A;  2IWT A;  3DKS A;  1GTA A;  1WJK A;  4Z7X A;  1X5C A;  2K8V A;  3EMP A;  3UL3 A;  17GS A;  4MJB A;  4GF0 A;  1TI1 A;  1M99 A;  4G9H A;  1XVQ A;  1QMV A;  2H8L A;  3CXG A;  3ZIV A;  2BJX A;  4EDY A;  4ZIJ A;  3DVW A;  1GUL A;  2GQL A;  4MPF A;  1ML6 A;  3VWU A;  2KLX A;  1PL2 A;  4V1A p;  4BVX B;  2VUP A;  5C00 A;  2LV3 A;  5G1L A;  4FH8 A;  1ZZY A;  2GTU A;  3D22 A;  1EOG A;  2H6Y A;  2WFC A;  4POL A;  5E59 A;  4GXZ A;  1SEN A;  5JCG A;  4DSS A;  2G0F A;  2WJU A;  3M0F A;  3TKS C;  1BG5 A;  2E0Q A;  3DYR A;  4KX4 A;  2RUF A;  3U6V A;  2K9F A;  4YAV A;  4L0U A;  4K1F A;  2A4V A;  3RBT A;  3NIV A;  4NAX A;  5FT3 A;  2F8A A;  2A4H A;  1A8Y A;  3HY2 A;  2LNT A;  4RQX A;  5FWG A;  2MMZ A;  5IO2 A;  1CQH A;  6GSU A;  4KH7 A;  2XBI A;  1K0C A;  4I5Q A;  3DEX A;  5ECI B;  4ACS A;  4MPG A;  5DQS A;  1YF0 A;  4WR5 A;  4ECI A;  1OKT A;  1PKZ A;  1GWC A;  4AJ8 A;  5H5S A;  1A24 A;  4BWS A;  1TK8 B;  1NW2 A;  3HHV A;  4D73 B;  5EY6 A;  2VL9 A;  4FYC A;  1V57 A;  1SL2 B;  5C04 A;  4F82 A;  4MAB A;  3HKR A;  2GT6 A;  3MNG A;  1LJR A;  2B3S A;  2RUE A;  1H4O A;  3ME7 A;  4OWY A;  1JZR A;  4MZB A;  1ABA A;  1GSS A;  3QFB C;  6GSS A;  2HRF A;  3A5I A;  3FK8 A;  2GSR A;  4GSN A;  3MWH A;  4F0B A;  2LTK A;  3L9V A;  4FQU A;  3RHC A;  2JAD A;  1R26 A;  4GTU A;  1K3Y A;  3UVT A;  1SD8 A;  2VM1 A;  10GS A;  5DVB A;  5B7C A;  2PPT A;  2YAN A;  4ULX A;  1TDI A;  4G19 A;  1J9B A;  4O32 A;  3GA4 A;  4NWY A;  1THX A;  1DUG A;  3I69 A;  1ERU A;  1M9A A;  4FYB A;  2N5F A;  2QSI A;  1K0N A;  4EF0 A;  2GST A;  1TK5 B;  1SD9 A;  1K0M A;  2M46 A;  2I9H A;  2WGR A;  3GSS A;  3ZMK A;  3IXR A;  4XS6 A;  1URM A;  2C3T A;  2CA8 A;  2H0I A;  1LU4 A;  4I2T A;  4K5R A;  3TDG A;  4Q5R A;  3APO A;  1OE8 A;  4E8H A;  2MBS A;  4EVM A;  3DRN A;  1DSB A;  4JE1 A;  4LMV A;  2OE1 A;  1B9X C;  4OFT A;  4WET A;  5AIS A;  4IS0 A;  2WUL A;  1K3L A;  1V40 A;  3M3M A;  2B7J A;  2ALB A;  2DIZ A;  3EU3 A;  3KJY A;  2DJ0 A;  7GSS A;  3DD3 A;  1M2A A;  3C73 A;  3FZ9 A;  3GX0 A;  1ZYP A;  1TRU A;  4MJE A;  2K8S A;  2REM A;  5F0G A;  3LJR A;  5HR2 A;  4ZIL A;  3GH6 A;  4IKH A;  2J23 A;  1ZL9 A;  20GS A;  1Q98 A;  1KNG A;  1NSW A;  4N0V A;  3M9J A;  2OE0 A;  3O6T A;  2R4V A;  5IMC A;  4GQF A;  3UAR A;  1Z6M A;  4MH2 A;  1FVK A;  1PRX A;  4MNN A;  4CY6 A;  2VL2 A;  5ECK B;  1S3C A;  2X8G A;  11GS A;  1W4V A;  3F4S A;  2YJ7 A;  2O8V B;  2H0H A;  1XW6 A;  3FHK A;  2IL3 A;  4K9Z A;  4RQR A;  3QD9 A;  1VRS D;  1Y6E A;  4ZBA A;  3D0Z A;  1MDK A;  1GSU A;  2YCD A;  5ELG A;  1B48 A;  2VD1 A;  2FGX A;  1A2J A;  5KEJ A;  5IMZ A;  3I6A A;  2KP1 A;  3VPQ A;  1ACV A;  1WWJ A;  5G5F A;  3EYT A;  3IV4 A;  3VUR A;  1OYJ A;  3MYD A;  4IP1 A;  1O7U A;  1Z9H A;  4J56 E;  3TKP A;  1GLQ A;  3QCP A;  1AIU A;  2C1Y A;  1HNC A;  3ZLP A;  4BA7 A;  3HVX A;  1DBY A;  2X49 A;  3LYK A;  3P7X A;  2N5B A;  2DKI A;  2XPE A;  3RPP A;  4Q5F A;  3CSH A;  1GNW A;  5CNW A;  4I97 A;  4LL1 B;  1SK1 A;  2C4J A;  1G6Y A;  1U3A A;  4TXV A;  2RM5 A;  1AQV A;  1OE7 A;  3I9V 2;  4YKF A;  3NZN A;  1FG4 A;  4N10 A;  4ID0 A;  1WOU A;  5ECO B;  3F6F A;  1RQM A;  4KAE A;  2VD0 A;  4PTS A;  2ZUP A;  2NBS A;  4K5S A;  2VL2 C;  3IOS A;  3F63 A;  3L9S A;  3HA9 A;  3TKS E;  2X64 A;  5IOX A;  2L57 A;  4F9Z A;  3IK9 A;  3C8E A;  1OKD A;  2FNO A;  4GRF A;  3TRX A;  1PX6 A;  1ERT A;  2NTO A;  2J9H A;  3ZRE A;  3K8N A;  3IAM 2;  4HZ2 A;  3GN3 A;  4OFN A;  4EKZ A;  5B8B A;  1Z7R A;  4N30 A;  4DEJ A;  1KBN A;  4K7I A;  3HVS A;  1C72 A;  1EEM A;  4KW6 A;  2VOC A;  4MJC A;  1USB A;  4CDO A;  3D5J A;  1M9B A;  2PUK C;  3ZTL A;  3KMN A;  3R3E A;  2PN8 A;  1Y25 A;  3CYN A;  2I4A A;  2HZE B;  5D8I A;  3BOA A;  3UIW A;  6GSY A;  1UC7 A;  1S3A A;  4V2M A;  2OKA A;  5BRT A;  2ON7 A;  1GTI A;  3QPM A;  1QXH A;  1TTZ A;  1XWK A;  3W8J A;  3IC4 A;  4XCS A;  3FRC A;  2WRT A;  3BJ5 A;  5B6M A;  2F9S A;  1SKW B;  4IJI A;  1J0F A;  1XOA A;  4YQV A;  1U6T A;  3U5R E;  6GSX A;  5D9T A;  1GSY A;  4X0X A;  3ERG A;  5DAK B;  1O6J A;  4G2E A;  4GCI A;  2R0G A;  5F05 A;  4G0K A;  4TR0 A;  3US3 A;  2H30 A;  4Q5Q A;  5DAL B;  4EIP A;  3AY8 A;  1PQN A;  2C80 A;  2O87 A;  1ZMA A;  5IO0 A;  2C0D A;  4CW9 A;  4ECJ A;  4TR1 B;  3GKM A;  3GUS A;  3ZVJ A;  2RM6 A;  4WKW A;  4HQS A;  1Z3E A;  1YY7 A;  2LKU A;  1HQO A;  2VCZ A;  4MDC A;  5IPG A;  1R5A A;  1X9S B;  2H1B A;  2H70 A;  2YZH A;  3GKK A;  2I81 A;  1SL0 B;  5DJL A;  1RW1 A;  3ME8 A;  1MDJ A;  1XPV A;  3FMW A;  3TGZ A;  1AQX A;  3TJG A;  4NV5 A;  4V2L A;  3KH9 A;  2A2P A;  4ECC A;  2H76 A;  2YV7 A;  3PPU A;  5HR1 A;  2VCV A;  3LEF A;  3UEM A;  1A2M A;  1PD2 1;  2X99 A;  4KA0 A;  2DMM A;  3KCM A;  2PGT A;  5ID2 B;  3LOR A;  5LNK e;  3F9U A;  4I8B A;  2V1M A;  2H1D A;  4Z2R A;  1A8L A;  2PER A;  3ZIJ A;  5F8B A;  3LW9 A;  3ZFB A;  1XVW A;  4MCU A;  2IFQ A;  4J2F A;  1TK0 B;  2PBJ A;  4KGI A;  3ZML A;  3TUE A;  2AUV A;  2NDO A;  4GSS A;  2LRC A;  1TRW A;  3EMX A;  3IRA A;  3VPT A;  2YWN A;  4K8M A;  2O89 A;  4AJ7 A;  1EOH A;  4JBB A;  16GS A;  2PWJ A;  1WP0 A;  4HDE A;  3L0H A;  2R37 A;  2QKE A;  4ZB9 A;  1O8X A;  5KN2 A;  2MYG A;  2KHP A;  3APS A;  4IQA A;  2RLI A;  2EIO A;  3C71 A;  2FHE A;  2JSZ A;  4WBJ A;  2R3X A;  4N0Z A;  3C7M A;  5ECM B;  5HQP A;  4ISD A;  3W6G A;  1QFN A;  5HFK A;  2CV4 A;  2QA1 A;  2CZ3 A;  4OCF A;  1ZYN A;  1HNB A;  1OC3 A;  5ECR B;  5B6N A;  3RAZ A;  3GV1 A;  4TN8 A;  8GSS A;  4PUR A;  2O85 A;  2YV9 A;  5CRW A;  1UN2 A;  4K0N A;  4L8E A;  2L5L A;  4NHW A;  1FVJ A;  4ML6 A;  1EV4 A;  4BL7 B;  1GSF A;  2TIR A;  3M1G A;  1T00 A;  3J7Y k;  3FR6 A;  2AAW A;  1GUM A;  1ZGN A;  3KP9 A;  5AIX A;  3GUR A;  4ZBB A;  5A4W A;  1U88 A;  4CHS A;  1GNE A;  1VF3 A;  2FA8 A;  2DC5 A;  4PUA A;  2GDR A;  2HFD A;  3N5O A;  2HT9 A;  2V6O A;  1T4Z A;  2V32 A;  2FY6 A;  4LL4 B;  2CVD A;  3CTG A;  1THO A;  2X8C A;  2NVL A;  1SKR B;  1TXX A;  1F3A A;  3A2X A;  2CT6 A;  5CRH A;  3WT2 A;  2I3Y A;  4PQH A;  2DKH A;  1JZO A;  2OBI A;  1EGO A;  1AAZ A;  3HZ8 A;  4KB3 A;  3TKQ A;  4IGJ A;  5GZZ B;  2IMD A;  1JLV A;  4GWR A;  5ECP B;  4TW5 A;  1HYU A;  3HVV A;  3VI7 A;  3ERW A;  3IPZ A;  4OO4 A;  3TJJ A;  3Q74 A;  1BED A;  1JLW A;  2HXK A;  4GST A;  1QUW A;  1S3D A;  2DIY A;  4HUA A;  2B5X A;  2HI7 A;  1OC9 A;  3H8Q A;  5AIV A;  1RK4 A;  2YP6 A;  1TKD B;  4J57 E;  2O7K A;  4YAP A;  2F3M A;  3TRQ A;  3HYP A;  1SYX A;  4XS4 B;  1FW1 A;  4IP6 A;  4MK3 A;  5D73 A;  3RDW A;  3UAP A;  2YNX A;  2BTO T;  5G2Z A;  3VK9 A;  3WGD A;  1R4W A;  2Z9S A;  2GT5 A;  2L6C A;  3KGK A;  1YJ6 A;  3TB2 A;  3UJ1 A;  2UZ8 A;  2YPM A;  2A2R A;  1IYI A;  3PIN A;  3UBK A;  4BVY A;  4Q5N A;  4WEY A;  5ECL B;  4E8E A;  5KN3 A;  3LWA A;  3S9F A;  3EPT A;  1V2A A;  2WDU A;  4TXO B;  2JL4 A;  3CMI A;  4XHM A;  3PR8 A;  2C0G A;  2HZE A;  3FW2 A;  1GUK A;  1XBS A;  3WYW A;  1JHB A;  2M72 A;  5H5Q A;  2JAC A;  3EC3 A;  4USS A;  1XFL A;  4AGS A;  3QR6 A;  2HE3 A;  3LGC A;  3ERF A;  3MDK A;  2YWI A;  4HZ4 A;  3GKX A;  5J9C A;  5ECQ B;  5CAX A;  1SJ6 A;  1K0A A;  3HXS A;  2LJK A;  1MD3 A;  5GST A;  1Z5Y E;  2FWG A;  1YQ1 A;  4YQM A;  3QDN A;  4IEL A;  2R0P A;  3ZIT A;  2DJJ A;  1YKC A;  2L6D A;  5JCU A;  5G1K A;  3EIN A;  2LRN A;  5DAK A;  1XCC A;  4YH2 A;  4ILF A;  2CX4 A;  5DDL A;  2LUS A;  3BBY A;  3D4T A;  2IMF A;  3KP8 A;  5JWR B;  4V1A g;  2R5G A;  2GVP A;  4ICY A;  5D96 A;  2XBQ A;  4CY8 A;  4TR1 A;  2VLU A;  1XW9 A;  4TVE A;  4Z2T A;  3OR5 A;  4O5Q A;  4BWQ A;  1J08 A;  3IE3 A;  2GZZ A;  3J7Y b;  2LNS A;  3GHA A;  4ECB A;  3GMF A;  3WGE A;  4MH3 A;  1GSQ A;  4POB A;  13GS A;  4HU9 A;  5IMA A;  1GSE A;  2HLS A;  3F4R A;  2FWH A;  4HS1 A;  2R2J A;  1MDI A;  3E3E A;  3Q6O A;  1ERV A;  3TJK A;  3Q18 A;  3F0I A;  3A2V A;  4XRA A;  1YZX A;  2V41 A;  4QQ7 A;  4KDU A;  3KEB A;  1E6B A;  3TKR A;  3UOM A;  1B9Y C;  2G2Q A;  4AJ6 A;  1GL8 A;  1AQW A;  1K0D A;  1YEP A;  1XW5 A;  2FD3 A;  4DSQ A;  1I9D A;  3ZVJ D;  4KE3 A;  2YN1 A;  1WIK A;  4EC0 A;  2CQ9 A;  2DJ2 A;  4EUY A;  4BVX A;  5J41 A;  3A5W A;  1F37 A;  2VAF A;  3TOU A;  1G7O A;  1SK2 A;  1ZYE A;  1ZYQ B;  3KM6 A;  3D6I A;  2NPB A;  3BD2 A;  3CBU A;  1YEX A;  2PMT A;  5G31 A;  1F2E A;  4MP4 A;  3RPN A;  3PGT A;  5D9V A;  1GTB A;  5J9B A;  4QL7 A;  2MBT A;  4NXI A;  3FYG A;  2DML A;  2H1A A;  3LSZ A;  1QGV A;  5HR3 A;  4MF7 A;  1ST9 A;  3GL5 A;  1VF4 A;  5F06 A;  2FLS A;  1TRS A;  1PX7 A;  2ES7 A;  3LQ7 A;  2FWF A;  2L59 A;  3LFL A;  2FCH A;  4ZB8 A;  1TJD A;  1TP9 A;  4DSR A;  3FZ4 A;  1B4Q A;  5KN0 A;  2EIR A;  2CAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...