3KIJA

Crystal structure of the human pdi-peroxidase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
171
structure length
171
Chain Sequence
FLKPKINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVIIKKKEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable glutathione peroxidase 8
publication title Two Endoplasmic Reticulum PDI Peroxidases Increase the Efficiency of the Use of Peroxide during Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 171
sequence length 171
chains with identical sequence B, C
ec nomenclature ec 1.11.1.9: Glutathione peroxidase.
pdb deposition date 2009-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kijA00
4POBA 1O7UA 3ZIVA 5HR0A 2GSTA 3LGCA 2DJJA 5ECRB 3CMIA 1TJDA 4WF5A 1XFLA 3FR6A 3KGKA 2VL3A 5ECMB 3K8NA 4N0VA 2QGVA 2K8SA 4MZWA 3F9UA 2B7KA 3ERGA 4MJCA 1NW2A 3GTUB 3TKRA 5IMVA 4TKYA 4BWQA 3EC3A 4O92A 1A8LA 3FW2A 2HRNA 4P3YB 2VL2A 3RHCA 2E0QA 2HE3A 4RI6A 1QGVA 1GTAA 4Q5FA 4ZB6A 3GIXA 3GV1A 3CYNA 4ML1A 1YKAA 18GSA 1ERUA 1A8YA 1TU8A 3AY8A 2KLXA 1H75A 1EV4A 2DIZA 8GSSA 3TRPA 3UBLA 2J23A 4KAEA 1MD4A 4ZILA 3TKQA 4ECBA 5B8BA 5A4UA 3QFAC 1V40A 1W4VA 1GSUA 1DSBA 1SJZA 3GA4A 3C7MA 5DJMA 5J5NA 2GSSA 2QSIA 3F3QA 2HZFA 2YZUA 4TXOB 4OO5A 4YQUA 3IR4A 2A2RA 2MZCA 5CNWA 3EMPA 4MF6A 2LRCA 1DUGA 3HHVA 1TXXA 3HY2A 3KCMA 2FA8A 1GUHA 3LYKA 1XVWA 2YJHA 1J0FA 3IPZA 3M9JA 4I5QA 4FIWA 3C8EA 2V6OA 4XRDA 2AAWA 5H5SA 1XOAA 2B6MA 4IVFA 1HNCA 4EKZA 3O76A 3D4MA 5AIVA 1ZL9A 5J9CA 5CP1A 1GSYA 1HNAA 3US3A 5D9XA 4ILFA 4JRRA 3GUSA 5IOWA 1GSFA 3IV4A 5F06A 5DALB 3UOMA 3KD0A 4AJ7A 5G2ZA 1GWCA 5AGYA 2YN1A 4JZQA 4CDOA 1EZKA 2LJKA 1GTBA 1MDKA 2GGTA 3D21A 4X0XA 17GSA 3LXTA 4HDEA 3UBKA 4ZBDA 3ZLPA 4ISDA 5ECIB 5LCZA 3F4RA 1ZMAA 4V2LA 1BYEA 1VF2A 1YZXA 3W6GA 2ALBA 3TJKA 2YV7A 3H4KA 4E8HA 4OFTA 2DJ3A 5ID2B 1PRXA 2L59A 3ZMLA 1ERVA 3FEUA 1TOFA 2JU5A 4HUAA 4PXOA 3UL3A 4IGJA 2CZ3A 5AN1A 4GSTA 1BJXA 3BD2A 4MJAA 2TRCP 2R3XA 3PINA 4EC0A 2JSYA 1B9YC 4MA9A 4NHWA 1TK8B 1XW9A 4XS6A 1ILOA 1Z3EA 3GX8A 4LLRA 1UA5A 1YDKA 3KIJA 1TRVA 1AUCA 5EY6A 3EVIA 3M1GA 5C04A 2P5QA 2LUSA 2WGRA 1K0NA 5F8BA 4I8BA 2MMZA 4XHMA 2LJRA 4NAXA 2VLUA 1KTEA 2GLRA 1VF3A 1EEMA 1S3AA 2VL2C 4FH8A 1SJIA 2Z9SA 2J9HA 4TXVA 3QPMA 2H1GA 1PQNA 1X5DA 4OCEA 3LJRA 1X0RA 11GSA 2YNXA 1SL1B 3L9SA 4TOPA 3WGDA 3FZAA 2AB6A 2GZZA 4MPGA 2QC7A 1OE8A 2H0HA 1M9BA 1JZRA 1WMJA 3ZMKA 2DIYA 1JHBA 2LNSA 3H8QA 1QUWA 3ME8A 14GSA 1SK1A 2DJKA 2JZTA 2V1MA 7GSSA 4GLTA 1YJ6A 1V2AA 1E2YA 3LQ7A 5HFGA 4ZB9A 1FAAA 2A2SA 2H74A 2PGTA 4NMUA 3DYRA 2GDRA 4CW9A 2X8HA 2VL9A 1ST9A 2K8VA 5ECNB 1JLVA 2XBIA 3DGQA 5HQPA 3HJOA 2C0DA 4IW9A 3ZVJD 2ZCTA 3CSJA 1EP8A 4YQMA 3GTUA 1CQHA 1VF1A 4LMVA 2HLSA 2GSQA 5DJLA 2CX4A 4MJBA 3HCZA 4OMVA 4MABA 5FT3A 1OYJA 2H76A 2YWIA 2HI7A 1K0BA 5IPHA 5ECQB 1WE0A 2I9HA 2YCDA 5G1LA 4KNDA 1N2AA 3CBUA 3ZRDA 2PBJA 3NIVA 1A0FA 2VAFA 4MH2A 5IPGA 3UEMA 2H6ZA 3L0HA 3DEXA 3KM6A 4TXOA 2F9SA 5F07A 3ME7A 1V58A 3EU3A 2CVKA 3ZL5A 4V1Ap 2MYGA 2H01A 2IMFA 2M72A 3GFKA 4ML6A 2KHPA 5G5EA 4YH2A 4QL9A 1Z6MA 2HYXA 4WEYA 1J9BA 4G9HA 3EU4A 1XCCA 4BVXA 1URMA 2RUFA 2DJ1A 3EINA 4WXTA 4OWYA 2H0GA 2K6VA 2NDOA 3HYPA 5IMAA 4MF5A 1TI3A 1PKZA 3R2QA 5CRGA 5DALA 3TGZA 4DSSB 3LSZA 1X9WB 3FZ9A 2GS3A 3ED3A 1THOA 4EO3A 1YF0A 2VUPA 1TK5B 2JADA 3GL5A 1ZOFA 1PX6A 3HVSA 4KCAA 1M2DA 4QQ7A 2LRTA 5IO2A 2CAQA 1EOHA 1PSQA 3VWWA 2B1KA 3LEFA 2YWMA 1ZYEA 1HD2A 1OAZA 4RQRA 3H79A 5J3RA 4IKHA 1I5GA 5GSTA 3QAGA 2WCIA 5ID2A 5JCGA 1T8EB 1K0OA 1TTZA 3ZREA 3GX0A 2B5XA 4IS0A 2WS2A 1SD8A 3A2VA 1R5PA 2HZEA 3MWHA 1O81A 4LL1B 5DQYA 4IN0A 5ELGA 1AC1A 1I9DA 3TJBA 1EWXA 2P31A 2EIOA 3C1RA 2B1LA 2XPEA 4XRAA 2X8GA 1MDJA 4G19A 1XXUA 2YANA 10GSA 3DD3A 1G6WA 4IBPA 3JCML 5H5QA 3RAZA 1F9MA 3CRTA 5DAKB 2B5EA 4XS4B 2EIQA 5EL8A 1FVJA 3QAWA 5E59A 4Q5NA 4J2FA 4HJ2A 4AJ6A 1QK8A 1T7PB 5DVBA 3IDVA 5DDLA 2TRXA 4PQ1A 2G0FA 1AQWA 3WYWA 5J9BA 3A2XA 4EVMA 1OVNA 5CREA 5ECSA 3E9JB 4QL7A 2RUEA 5COHA 3G7IA 4OFNA 3FR9A 2H72A 2XHFA 4K7NA 12GSA 2LV3A 3VPQA 5LNKe 1CQGA 4BPYA 1AXDA 4KB3A 5AISA 1SKSB 5DBQA 4O32A 2H30A 5CRHA 1AQVA 1ZYQB 3UARA 4KX4A 1JFUA 4WF4A 1UN2A 5B6MA 4TN8A 2A4VA 2L6CA 2VO4A 4L8EA 1ERTA 2FGXA 2CVDA 4D73B 4F2IA 3ISOA 5J4UA 2AUVA 1FHEA 4MK3A 4POKA 1U87A 4XTSA 2VCWA 4GTUA 4RUVA 5FHIA 3F4SA 2K9FA 1V9WA 4IQ1A 4K0NA 3TRXA 5ELAA 1RQMA 1XPVA 2YWNA 5D73A 3D0ZA 2DBCA 1YQ1A 1GL8A 1Y6EA 3HZ4A 4TVEA 1JLWA 3TB2A 1B48A 4PX1A 2C0GA 2H66A 3H1NA 4K7OA 1TKDB 5D9TA 1HQOA 3BCIA 1TDIA 3EYTA 1EP7A 1SENA 5IMFA 2R4VA 4X1UA 2P5RA 1PA3A 3M9KA 5CRDA 2RM6A 3GYKA 2OACA 3HA9A 2D2ZA 3QR6A 1WP0A 1S3DA 1G6YA 3QD9A 4XIHA 3VURA 3FK8A 5DQSA 3WGXA 4LA1A 1C72A 4EF0A 3KJYA 3IK7A 2N5BA 2GQKA 2B7JA 2LEGA 5HFKA 3HVVA 3TKSC 3Q19A 4EXJA 2WB9A 4ULXA 2HSHA 1YEPA 1UVZA 2IWTA 3KMOA 1AW9A 3F0IA 3UVHA 2IL3A 4N0ZA 1WPIA 3H93A 2PERA 1Z5YE 4KDXA 2MMOA 1PX7A 5ECPB 3DXBA 2YWOA 2HNLA 3VI7A 2FWHA 4DSSA 1PL1A 5ECKB 2O87A 3U5RE 2XBQA 4YAPA 1SKRB 1SK2A 3A5WA 4GSNA 3WD6A 1OKTA 4K7IA 2NPBA 2MBSA 3I69A 3GKNA 5L71A 4GQCA 4AJ8A 2H8LA 3IBHA 4TR3A 4ZL7A 4Q5RA 4K6XA 4NV5A 2I81A 2AJQB 3MDKA 2L4CA 1GP1A 1BEDA 3IAM2 4ECJA 5KN2A 4DSQA 1VGLA 4JEDA 1M9AA 5D96A 3SWLA 2PUKC 2L5LA 1B8XA 3BBYA 4GSSA 1A2LA 1TU7A 4KSOA 1XWKA 3QAVA 2PVQA 2O89A 3VLNA 2WULA 1SJ6A 1THXA 3TCOA 4JE1A 5F05A 1F37A 2LKUA 1UC7A 2FWFA 1JZDA 4PUFC 2C4JA 2GQLA 3P90A 4J56E 1BX9A 4G10A 4OO4A 2FCHA 3GKXA 1QMVA 5DAKA 4XS4A 3QDNA 2DLXA 2H6YA 3KTBA 4Q5QA 4WBRD 1EEJA 5IMCA 1X9MB 2R2JA 5CYYA 4ZXGA 5GAND 3KZQA 3LWAA 1XIYA 1WOUA 3F6DA 2XC2A 1OE7A 3RDWA 4MMMA 2VD0A 5ABRA 4I6XA 2GVPA 2KUCA 2KOKA 4IJIA 2LSTA 3VFIA 1GRXA 2DC5A 3IRAA 1N8JA 3TUEA 4ZL9A 3V1WA 2BTOT 1F3BA 1KNGA 4GQFA 2FY6A 4MZBA 4IJ3A 3FRCA 1GULA 2WJUA 1F3AA 4KGIA 3FZ5A 4DSRA 2X99A 2C80A 3KH7A 1K3LA 2IIYA 1PMTA 2DMLA 2VOCA 2FWGA 1YY7A 4JU5A 3UJ1A 1O85A 4D73A 2VCVA 1LBKA 3S9FA 1A23A 3IE3A 2YV9A 1O8WA 4F0BA 5G5FA 3IA1A 4JR6A 3M8NA 4TR1B 2PU9C 5GAPD 5CO3A 4FYCA 2EIRA 4KDYA 1ZGNA 2H0IA 5G1KA 1F6MC 4TW5A 4I97A 2VM2A 1T4YA 3L78A 2CA8A 1WWJA 1FB0A 6GSSA 2F8AA 3RBTA 5EPFA 2OA7A 1VF4A 2LNTA 4POLA 1O73A 3N9JA 2V6KA 2H71A 1F2EA 1G7OA 1M2AA 2ON5A 2IJYA 3W8JA 5KN3A 2KP2A 2ZUPA 1PKWA 3NOFA 2O85A 2F51A 2PMTA 2FLSA 2B3SA 1FG4A 4WR5A 2L4QA 3D4TA 5JCWA 1XOBA 1Q4JA 5H5RA 3GSTA 4X43A 3TJJA 4GWRA 1OKDA 2VM1A 5GSSA 3HJPA 1XWAA 1EOGA 1MEKA 3HZ8A 3GH6A 2IMDA 2VCTA 4N11A 4EL1A 1SYRA 4NXIA 1XVQA 4DEJA 5IM9A 3CRUA 2GZYA 3KXOA 4XCSA 1OC9B 1O6JA 3NZNA 4ECCA 5ENUA 1X5EA 4MZCA 5ECHB 1NM3A 3VWXA 1R26A 3KP8A 4ZBBA 1BG5A 1A2MA 2ES7A 2GTUA 5DCHA 4HJMA 1DE2A 3E0UA 3CXGA 2V32A 2PVOC 3GSSA 1TRWA 1KBNA 3FY7A 2M46A 3DRNA 3PH9A 1YKCA 5JWRB 2LQQA 2VCXA 1S3CA 1ERWA 1K0MA 2WFCA 1U3IA 2VCQA 5JWQB 2BJXA 2DSAA 3TDGA 5ECLB 3KP9A 1M2BA 2OBIA 1SK0A 3O6TA 4K9ZA 4YAVA 1G0TA 2RLIA 4WR4A 2VD1A 5D8IA 5D93A 4HOJA 4DVCA 1LU4A 2C0FA 3J7Yk 3WT1A 3ERFA 2N5FA 1WRYA 3DWVA 4GF0A 4TRXA 3TKSE 1GNWA 1ABAA 2IN3A 2EC4A 4FO5A 1YF1A 1AQXA 4AGSA 4ACSA 4TR4A 1ON4A 4WBJA 3SBCA 1U6TA 1V98A 4OFMA 2VIMA 4L0WA 2NTOA 16GSA 3GNJA 3J7Yb 1A24A 4F0CA 5G31A 3BJ5A 1K3YA 2C3TA 2C0EA 3GMFA 2O8VB 5EVOA 1K0DA 4EDYA 2ON7A 5E4WA 3VWVA 5KN1A 3D6IA 4O5RA 3UVTA 4JR4A 4PNGA 1WIKA 2GT6A 3HKRA 3QMXA 3P2AA 1SYXA 1J08A 1TRUA 3GHAA 5C00A 5GZZB 1DE1A 2H6XA 3APOA 4EDZA 1IYIA 3KMNA 3Q6OA 4YQVA 1Y25A 4MDCA 2WDUA 3G7JA 5D9VA 3G9BA 3TOTA 2H1DA 3LYPA 3BCKA 4BL7A 2PN8A 1SL2B 2C3NA 1NHOA 2I1UA 3HDCA 1B4PA 3C1SA 4ZBAA 3VI5A 1A0RP 2MMNA 1GLQA 2HT9A 5KEJA 3Q18A 1PD21 4PUAA 2M80A 1EGRA 1MTCA 5HFIA 6GSVA 4H86A 1FB6A 1KEBA 3W8SA 1HNBA 1SKWB 1W89A 1TI1A 4MH3A 4BA7A 4ZIJA 3TJFA 1XWBA 1AIUA 3M0FA 3GL3A 3FR3A 3FHKA 4XS1A 1X5CA 4IELA 2HSYA 3GH9A 3CSHA 4MLYA 3IOSA 1XBSA 2CQ9A 5HR1A 5A4WA 1M0UA 2K18A 3GKKA 4TR1A 3LORA 3PGTA 13GSA 2RM5A 2GZPA 4LMWA 2MMAA 3TOUA 2GT5A 3WGEA 5FWGA 5IMDA 2X64A 3GKMA 4MPFA 3O3TA 3VPTA 6GSTA 2OE0A 4K2DA 2C8UA 3P8WA 3C73A 1R5AA 2P0GA 3LG6A 3KTLA 3UIWA 2IMKA 4PNFA 1X9SB 3RPNA 1YEXA 4FYBA 1GUKA 2FA4A 1SD9A 2C3QA 3F8UA 1EV9A 3IAS2 4HI7A 1K0AA 4WKWA 5KN0A 4ECIA 3PR8A 1FVKA 1Z7RA 3ZYWA 2YP6A 4HQZA 1VRSD 1XWCA 2H1BA 1GSEA 3IXRA 1LJRA 1GSDA 2OKAA 2C1YA 2LTKA 1OC9A 4PGTA 3VWUA 2OE1A 4HZ4A 3GURA 2R5GA 1MDIA 1E6BA 2GSRA 3APQA 1DBYA 4LL4B 5IMZA 1FOVA 2OJLA 5CRWA 2CVBA 4EE0A 5HR2A 2DMMA 2V2GA 1Z7PA 4V2MA 3F3RA 3DVXA 2L6DA 1A2JA 5G30A 1GSQA 1G7EA 3EWLA 2OADA 4HQSA 2FNOA 3I9V2 2KP1A 3MSZA 4F82A 1GUMA 3GRXA 2YPMA 4BWSA 4K8MA 2HZEB 4I2UA 3F4TA 2BMXA 2B5YA 3TKPA 3LFLA 5IO0A 2VCZA 2OE3A 4NV2A 3APSA 4V1Ag 3RHBA 3QFBC 2LS5A 2MBTA 6GSWA 3FYGA 2YOIA 20GSA 6GSUA 4ZB8A 1BAYA 1NHYA 2CV4A 5IIZA 2FHEA 2L5OA 3KEBA 5B8AA 3I6AA 2IFQB 3GN3A 2AYTA 2PWJA 2H19A 2YZHA 4NHZA 2XPDA 1RK4A 1TW9A 5ECOB 4J57E 4Z7XA 5AIXA 1Z6NA 3TJGA 3ZITA 2FUG2 1XZOA 2JZSA 3CTGA 1T4ZA 3IK9A 1O8XA 2R6KA 3G7YA 5F0GA 3TRQA 3IC4A 2IPAA 2LRNA 4HZ2A 2IMIA 1QXHA 3UMAA 2H73A 4CHSA 4IQAA 2HRFA 4ZL8A 2G2QA 3QCPA 4KCEA 1H4OA 1XWGA 4PURA 2WZ9A 5B6NA 19GSA 2I4AA 1TRSA 2GQMA 4KH7A 2IMEA 5A4VA 4OCFA 3FKFA 1K0CA 3F63A 4RI7A 1JZOA 3VK9A 4KSMA 1T00A 4PQIA 2H70A 3P7XA 5INYA 1SL0B 5DCGA 1PGTA 1T1VA 3ZZXA 2ZNMA 4O7HA 2OBKA 1EGOA 2E2MA 3KH9A 4ID0A 2WRTA 1BQ7A 3L9UA 3HD5A 1NSWA 1HYUA 4HEA2 1U88A 3QOUA 3CTFA 2NVLA 1XW6A 1PL2A 4GRFA 3L9VA 3A3TA 4L5LA 4GCIA 3HJMA 5JCUA 3M3MA 1GTIA 5IOXA 2F3MA 3ZIJA 3U6VA 2HXKA 3OR5A 4KA0A 4F9ZA 22GSA 4PQHA 2E2GA 1V57A 1ML6A 2TIRA 4KUNA 1TK0B 1USBA 1GLPA 3RPPA 3ZTLA 3HXSA 3N5OA 3D5JA 1R7HA 2CX3A 3ZFLA 4MF7A 1M7TA 4KE3A 4G2EA 4NPBA 3LXZA 5D9WA 3WT2A 2JL4A 3ZVJA 2AHEA 1B9XC 2REMA 3E3EA 2CZ2A 4NWYA 1SU9A 2VLTA 3F6FA 1GTUA 1Z9HA 1QFNA 1B4QA 4AF2A 2YJ7A 1GNEA 2H75A 2VLVA 2LQOA 4N30A 1FO5A 4HS1A 2NBSA 4IP6A 4EUYA 2LJAA 1OC8A 2E7PA 3Q74A 4K0GA 4KW6A 2F8FA 3DMLA 2FD3A 4E8EA 3A2WA 3L4NA 4KDUA 4POMA 1OC3A 3DVWA 1Q98A 3CSIA 1FW1A 4MJEA 4I2TA 3TKSA 2R37A 3MNGA 4K1FA 5CAXA 5B7CA 1AAZA 4F03A 1K3OA 1GSSA 3C71A 2JZRA 1QQ2A 5J41A 2JACA 2V41A 5A5KA 1MD3A 4FYUA 3FZ4A 2QKEA 5HR3A 3ZFBA 6GSXA 2N5AA 3EURA 1T3BA 2AV4A 1ZCPA 1GH2A 3I43A 4L0UA 2FWEA 3ERWA 3DKSA 4TR0A 1XW5A 1M99A 2HFDA 2H1AA 4OD7A 2RIIA 1WJKA 5JWOB 1JZWA 1TP9A 4HU7A 3HVXA 4MP4A 1RW1A 3IHQA 9GSSA 3UAPA 1R4WA 2IFQA 4HU9A 2I3YA 2PPTA 3EE2A 1ZZYA 4V2NA 3D22A 2CT6A 3EMXA 1ACVA 5IQYA 3DIEA 3BOAA 5LD0A 4L5OA 1PN9A 4BVYA 1U3AA 4JBBA 2O7KA 4WETA 2DJ0A 2DJ2A 2L57A 4N10A 2X8CA 3MAKA 2CAIA 2JSZA 4GXZA 6GSYA 4IP1A 4IHUA 4MCUA 1IYHA 4RQXA
chains in the Genus database with same CATH superfamily
4POBA 1O7UA 3ZIVA 5HR0A 2GSTA 3LGCA 2DJJA 5ECRB 3CMIA 1TJDA 4WF5A 1XFLA 3FR6A 3KGKA 2VL3A 5ECMB 3K8NA 4N0VA 2QGVA 2K8SA 4MZWA 3F9UA 2B7KA 3ERGA 4MJCA 1NW2A 3GTUB 3TKRA 5IMVA 2QA1A 4TKYA 4BWQA 3EC3A 4O92A 1A8LA 3FW2A 2HRNA 3EPTA 4K5SA 4P3YB 2VL2A 3RHCA 2E0QA 2HE3A 4RI6A 1QGVA 1GTAA 4Q5FA 4ZB6A 3GIXA 3GV1A 3CYNA 4ML1A 1YKAA 18GSA 1ERUA 1A8YA 1TU8A 3AY8A 2KLXA 1H75A 1EV4A 2DIZA 8GSSA 3TRPA 3UBLA 2J23A 4KAEA 1MD4A 4ZILA 3TKQA 4ECBA 5B8BA 5A4UA 3QFAC 1V40A 1W4VA 1GSUA 1DSBA 5BRTA 1SJZA 3GA4A 3C7MA 3A5IA 5DJMA 5J5NA 2GSSA 2QSIA 3F3QA 2HZFA 2YZUA 4TXOB 4OO5A 4YQUA 3IR4A 2A2RA 2MZCA 5CNWA 1M3IA 3EMPA 4MF6A 2LRCA 1DUGA 3HHVA 1TXXA 3HY2A 3KCMA 2FA8A 1GUHA 3LYKA 1XVWA 2YJHA 1J0FA 3IPZA 3M9JA 4I5QA 4FIWA 3C8EA 2V6OA 4XRDA 2AAWA 5H5SA 1XOAA 2B6MA 4BVXB 4IVFA 1HNCA 4EKZA 3O76A 3D4MA 3MIXA 5AIVA 1ZL9A 5J9CA 5CP1A 1GSYA 1HNAA 1M3JA 4CY8A 3US3A 5D9XA 4ILFA 4JRRA 3GUSA 5IOWA 1GSFA 3IV4A 5F06A 5DALB 3UOMA 3KD0A 4AJ7A 5G2ZA 1GWCA 5AGYA 2YN1A 4JZQA 4CDOA 1EZKA 2LJKA 1GTBA 1MDKA 2GGTA 3D21A 4X0XA 17GSA 3LXTA 4HDEA 3UBKA 4ZBDA 3ZLPA 4ISDA 5ECIB 5LCZA 3F4RA 1ZMAA 4V2LA 1BYEA 4A5PA 1VF2A 1YZXA 3W6GA 4Z2UA 2ALBA 3TJKA 2YV7A 3H4KA 4E8HA 4OFTA 2DJ3A 5ID2B 1PRXA 2L59A 3ZMLA 1ERVA 3FEUA 1TOFA 2JU5A 4HUAA 4PXOA 3UL3A 4IGJA 2CZ3A 5AN1A 4GSTA 1BJXA 3BD2A 4MJAA 2TRCP 2R3XA 3PINA 4EC0A 2JSYA 1B9YC 4MA9A 4NHWA 1TK8B 1XW9A 4XS6A 1ILOA 1Z3EA 3GX8A 4LLRA 1UA5A 1YDKA 3KIJA 1TRVA 1AUCA 5EY6A 3EVIA 3M1GA 5C04A 2P5QA 2LUSA 2WGRA 1K0NA 5F8BA 4I8BA 2MMZA 4XHMA 2LJRA 4NAXA 2VLUA 1KTEA 2GLRA 1VF3A 1EEMA 1S3AA 2VL2C 4FH8A 1SJIA 2Z9SA 2J9HA 4TXVA 3QPMA 2H1GA 1PQNA 1X5DA 4OCEA 3LJRA 1X0RA 11GSA 2YNXA 1SL1B 3L9SA 4TOPA 3WGDA 3FZAA 2AB6A 2GZZA 4MPGA 2QC7A 1OE8A 2H0HA 1M9BA 1JZRA 1WMJA 3ZMKA 2DIYA 2QA2A 2LNSA 1JHBA 3H8QA 1QUWA 3ME8A 14GSA 1SK1A 2DJKA 2JZTA 2V1MA 7GSSA 4GLTA 4EIQA 4O5QA 1YJ6A 1V2AA 1E2YA 3LQ7A 5HFGA 4ZB9A 1FAAA 2A2SA 2H74A 2PGTA 4NMUA 2HSMA 3DYRA 2GDRA 4CW9A 2X8HA 2VL9A 1ST9A 2K8VA 5ECNB 1JLVA 2XBIA 3DGQA 5HQPA 3HJOA 2C0DA 4IW9A 3ZVJD 2ZCTA 3CSJA 2HRAA 1EP8A 4YQMA 3GTUA 1CQHA 1VF1A 4LMVA 2HLSA 2GSQA 5DJLA 2CX4A 4MJBA 3HCZA 4OMVA 4MABA 5FT3A 1OYJA 2H76A 2YWIA 2HI7A 1K0BA 5IPHA 5ECQB 1WE0A 2I9HA 2YCDA 5G1LA 4KNDA 1N2AA 3CBUA 3ZRDA 2PBJA 3NIVA 1A0FA 2VAFA 4MH2A 5IPGA 3UEMA 2H6ZA 2UZ8A 3L0HA 3DEXA 3KM6A 4TXOA 2F9SA 5F07A 3ME7A 1V58A 3EU3A 2CVKA 3ZL5A 4V1Ap 2MYGA 4O5UA 2H01A 2IMFA 2M72A 3GFKA 4ML6A 2KHPA 5G5EA 4YH2A 4QL9A 1Z6MA 2HYXA 4WEYA 1J9BA 4G9HA 3EU4A 1XCCA 4BVXA 1URMA 2RUFA 2DJ1A 3EINA 4WXTA 4OWYA 2H0GA 2K6VA 2NDOA 3HYPA 5IMAA 4MF5A 3HVNA 1TI3A 1PKZA 3R2QA 5CRGA 5DALA 3TGZA 4DSSB 3LSZA 1X9WB 3FZ9A 2GS3A 3ED3A 1THOA 4EO3A 1YF0A 2VUPA 1TK5B 2JADA 3GL5A 1ZOFA 1PX6A 3HVSA 4KCAA 1M2DA 4QQ7A 2LRTA 5IO2A 2CAQA 1EOHA 1PSQA 3VWWA 2B1KA 3LEFA 2YWMA 1ZYEA 1HD2A 1OAZA 4RQRA 3H79A 5J3RA 4X4JA 4IKHA 1I5GA 5GSTA 3QAGA 2WCIA 5ID2A 5JCGA 1T8EB 1K0OA 1TTZA 3ZREA 3GX0A 2B5XA 4IS0A 2WS2A 3LW9A 1SD8A 3A2VA 1R5PA 2HZEA 3MWHA 1O81A 4LL1B 5DQYA 4IN0A 5ELGA 1AC1A 1I9DA 3TJBA 1EWXA 2P31A 2EIOA 3C1RA 2B1LA 2XPEA 4XRAA 2X8GA 1MDJA 4G19A 1XXUA 2YANA 10GSA 3DD3A 1G6WA 4IBPA 3JCML 5H5QA 3FMWA 3RAZA 1F9MA 3CRTA 5DAKB 2B5EA 4XS4B 2EIQA 5EL8A 1FVJA 3QAWA 5E59A 4Q5NA 4J2FA 4HJ2A 4AJ6A 1QK8A 1T7PB 5DVBA 3IDVA 5DDLA 2TRXA 4PQ1A 2G0FA 1AQWA 3WYWA 5J9BA 3A2XA 4EVMA 1OVNA 4MNNA 5CREA 5ECSA 3E9JB 4QL7A 2RUEA 5COHA 3G7IA 4OFNA 3FR9A 2H72A 2XHFA 4K7NA 12GSA 2LV3A 3VPQA 5LNKe 1CQGA 4BPYA 1AXDA 4KB3A 5AISA 1SKSB 5DBQA 4O32A 2H30A 5CRHA 1AQVA 1ZYQB 3UARA 4KX4A 1JFUA 4WF4A 1UN2A 5B6MA 4TN8A 2A4VA 2L6CA 2VO4A 4L8EA 1ERTA 2FGXA 2CVDA 4D73B 4F2IA 3ISOA 5J4UA 2AUVA 1FHEA 4MK3A 4POKA 1U87A 4XTSA 2VCWA 4GTUA 4RUVA 5FHIA 3F4SA 2K9FA 1V9WA 4IQ1A 4K0NA 3TRXA 1RQMA 1XPVA 2YWNA 5ELAA 5D73A 3D0ZA 2DBCA 1YQ1A 1GL8A 1Y6EA 3HZ4A 4TVEA 2HRKA 1JLWA 3TB2A 1B48A 4PX1A 2C0GA 2H66A 3H1NA 4K7OA 4Z2RA 1TKDB 5D9TA 1HQOA 3BCIA 1TDIA 3EYTA 1EP7A 1SENA 5IMFA 2R4VA 4X1UA 2P5RA 1PA3A 3M9KA 5CRDA 2RM6A 3GYKA 2OACA 3HA9A 2D2ZA 3QR6A 1WP0A 1S3DA 1G6YA 3QD9A 4XIHA 3VURA 3FK8A 5DQSA 3WGXA 4LA1A 1C72A 4EF0A 3KJYA 3IK7A 2N5BA 2GQKA 2B7JA 2LEGA 5HFKA 3HVVA 3TKSC 3Q19A 4EXJA 2WB9A 4ULXA 2HSHA 1YEPA 1UVZA 2IWTA 3KMOA 1AW9A 3F0IA 3UVHA 2IL3A 4N0ZA 1WPIA 3H93A 2PERA 2DKIA 1Z5YE 2A4HA 4KDXA 2MMOA 1PX7A 5ECPB 3DXBA 2YWOA 2HNLA 3VI7A 2FWHA 4DSSA 1PL1A 5ECKB 2O87A 3U5RE 4YKGA 2XBQA 4YAPA 1SKRB 1SK2A 3A5WA 4GSNA 3WD6A 1OKTA 4K7IA 2NPBA 2MBSA 3I69A 3GKNA 5L71A 4GQCA 4AJ8A 2H8LA 3IBHA 4TR3A 4ZL7A 4Q5RA 4K6XA 4NV5A 2I81A 1S3RA 2AJQB 3MDKA 2L4CA 1GP1A 1BEDA 3IAM2 4ECJA 5KN2A 4DSQA 1VGLA 4JEDA 1M9AA 5D96A 3SWLA 2PUKC 2L5LA 1B8XA 3BBYA 4GSSA 1A2LA 1TU7A 4KSOA 1XWKA 3QAVA 2PVQA 5BMUA 2O89A 3VLNA 2WULA 1SJ6A 1THXA 3TCOA 4JE1A 5F05A 1F37A 2LKUA 1UC7A 2FWFA 1JZDA 4PUFC 2C4JA 2GQLA 3P90A 4J56E 1BX9A 4G10A 4OO4A 2FCHA 3GKXA 1QMVA 5DAKA 4XS4A 3QDNA 2DLXA 2H6YA 3KTBA 4Q5QA 4WBRD 1EEJA 5IMCA 1X9MB 2R2JA 5CYYA 4ZXGA 5GAND 3KZQA 3LWAA 1XIYA 1WOUA 3F6DA 2XC2A 1OE7A 3RDWA 4MMMA 4BL7B 2VD0A 4G0KA 5ABRA 4I6XA 2GVPA 2KUCA 2KOKA 4IJIA 2LSTA 3VFIA 1GRXA 2DC5A 3IRAA 1N8JA 3TUEA 4ZL9A 3V1WA 2BTOT 4BIKA 1F3BA 1KNGA 4GQFA 2FY6A 4MZBA 4IJ3A 3FRCA 1GULA 2WJUA 1F3AA 4KGIA 3FZ5A 4DSRA 2X99A 2C80A 3KH7A 1K3LA 2IIYA 1PMTA 2DMLA 2VOCA 2FWGA 1YY7A 4JU5A 3UJ1A 1O85A 4D73A 2VCVA 1LBKA 3S9FA 1A23A 3IE3A 2YV9A 1O8WA 4F0BA 5G5FA 3IA1A 4JR6A 3M8NA 4Z2TA 4TR1B 2PU9C 5GAPD 5CO3A 4FYCA 2EIRA 4KDYA 1ZGNA 2H0IA 5G1KA 1F6MC 4TW5A 4I97A 2VM2A 1T4YA 3L78A 2CA8A 1WWJA 1FB0A 6GSSA 2F8AA 3RBTA 5EPFA 2OA7A 1VF4A 2LNTA 4POLA 1O73A 3N9JA 2V6KA 2H71A 1F2EA 1G7OA 1M2AA 2ON5A 2IJYA 3PPUA 3W8JA 5KN3A 2KP2A 2ZUPA 1PKWA 3NOFA 2O85A 2F51A 2PMTA 2FLSA 2B3SA 3R3EA 1FG4A 4WR5A 2L4QA 3D4TA 5JCWA 1XOBA 1Q4JA 5H5RA 4G0IA 3GSTA 4X43A 3TJJA 4GWRA 1OKDA 2VM1A 5GSSA 3HJPA 1XWAA 1ZYPA 1EOGA 1MEKA 3HZ8A 3GH6A 2IMDA 2VCTA 4N11A 4EL1A 1SYRA 4NXIA 1XVQA 4DEJA 5IM9A 3CRUA 2GZYA 3KXOA 4XCSA 1OC9B 1O6JA 3IC8A 3NZNA 4ECCA 5ENUA 1X5EA 4MZCA 5ECHB 1NM3A 3VWXA 1R26A 3KP8A 4ZBBA 1BG5A 1A2MA 2ES7A 2GTUA 5DCHA 4HJMA 1DE2A 3E0UA 3CXGA 2V32A 2PVOC 3GSSA 1TRWA 1KBNA 3FY7A 2M46A 3DRNA 3PH9A 1YKCA 5JWRB 2LQQA 1PFOA 2VCXA 1S3CA 1ERWA 1K0MA 2WFCA 1U3IA 2VCQA 5JWQB 2BJXA 2DSAA 3TDGA 5ECLB 3KP9A 1M2BA 2OBIA 1SK0A 2R0CA 3O6TA 4K9ZA 4YAVA 1G0TA 2RLIA 4WR4A 2VD1A 5D8IA 5D93A 4HOJA 4DVCA 1LU4A 2C0FA 3J7Yk 3WT1A 3ERFA 2N5FA 1WRYA 3DWVA 4GF0A 4TRXA 3TKSE 1GNWA 1ABAA 2IN3A 2EC4A 4FO5A 1YF1A 1AQXA 4AGSA 4ACSA 4CY6A 4TR4A 1ON4A 4WBJA 3SBCA 1U6TA 1V98A 4OFMA 2VIMA 4L0WA 2NTOA 16GSA 3GNJA 3J7Yb 1A24A 4F0CA 5G31A 3BJ5A 1K3YA 2C3TA 2C0EA 3GMFA 2O8VB 5EVOA 1K0DA 4EDYA 2ON7A 5E4WA 3VWVA 5KN1A 3D6IA 4O5RA 3UVTA 4JR4A 1ZYNA 4YKFA 4PNGA 1WIKA 2GT6A 3HKRA 3QMXA 3P2AA 1SYXA 1J08A 1TRUA 3GHAA 4FQUA 5C00A 5GZZB 1DE1A 2H6XA 3APOA 4EDZA 1IYIA 3KMNA 3Q6OA 4YQVA 1PN0A 1Y25A 4MDCA 2WDUA 3G7JA 5D9VA 3G9BA 3TOTA 2H1DA 3LYPA 3BCKA 4BL7A 2PN8A 1SL2B 2C3NA 1NHOA 2I1UA 3IHGA 3HDCA 1B4PA 3C1SA 4ZBAA 3VI5A 1A0RP 2MMNA 1GLQA 2HT9A 5KEJA 3Q18A 1PD21 4PUAA 2M80A 1EGRA 1MTCA 5HFIA 6GSVA 4H86A 1FB6A 1KEBA 3W8SA 1HNBA 1SKWB 1W89A 1TI1A 4MH3A 4BA7A 4ZIJA 3TJFA 1XWBA 2R0GA 1AIUA 3M0FA 3GL3A 3FR3A 3FHKA 4XS1A 1X5CA 4IELA 2HSYA 3GH9A 3CSHA 4MLYA 3IOSA 1XBSA 2CQ9A 5HR1A 5A4WA 1M0UA 2K18A 3GKKA 4TR1A 3LORA 3PGTA 13GSA 2RM5A 2GZPA 4LMWA 4K5RA 2MMAA 3TOUA 2GT5A 3WGEA 1XG8A 5FWGA 5IMDA 2X64A 3GKMA 4MPFA 3O3TA 3VPTA 6GSTA 2OE0A 4K2DA 2C8UA 3P8WA 3C73A 1R5AA 2P0GA 3LG6A 3KTLA 3UIWA 3MYDA 2IMKA 4PNFA 1X9SB 3RPNA 1YEXA 4FYBA 1GUKA 2FA4A 1SD9A 2C3QA 3F8UA 1EV9A 3IAS2 2A2PA 4HI7A 1K0AA 4WKWA 5KN0A 4ECIA 3PR8A 1FVKA 1Z7RA 3ZYWA 2YP6A 4HQZA 1VRSD 1XWCA 2H1BA 1GSEA 3IXRA 1LJRA 1GSDA 2OKAA 2C1YA 2LTKA 1OC9A 4PGTA 3VWUA 2OE1A 4HZ4A 3GURA 2R5GA 1MDIA 1E6BA 2GSRA 3APQA 1DBYA 4LL4B 5IMZA 1FOVA 2OJLA 5CRWA 2CVBA 4EE0A 2X49A 5HR2A 2DMMA 2V2GA 1Z7PA 4V2MA 3F3RA 3DVXA 2L6DA 1A2JA 5G30A 1GSQA 1G7EA 3EWLA 2OADA 4HQSA 2FNOA 3I9V2 2KP1A 3MSZA 4F82A 1GUMA 3GRXA 2YPMA 4BWSA 4K8MA 2HZEB 4I2UA 3F4TA 2BMXA 2B5YA 3TKPA 3LFLA 5IO0A 2VCZA 2OE3A 4NV2A 3APSA 4V1Ag 3RHBA 3QFBC 2LS5A 2MBTA 6GSWA 3FYGA 2YOIA 20GSA 6GSUA 4ZB8A 1BAYA 1NHYA 2CV4A 5IIZA 2FHEA 2L5OA 3KEBA 5B8AA 3I6AA 2IFQB 3GN3A 2AYTA 2PWJA 2H19A 2YZHA 4NHZA 2XPDA 1RK4A 1TW9A 5ECOB 4J57E 4Z7XA 4BVYB 5AIXA 1Z6NA 3TJGA 3ZITA 2FUG2 1XZOA 2JZSA 3CTGA 1T4ZA 3IK9A 1O8XA 2R6KA 3G7YA 5F0GA 3TRQA 4G0LA 3IC4A 2IPAA 2LRNA 4HZ2A 1FOHA 2IMIA 1QXHA 3UMAA 2H73A 4CHSA 4IQAA 2HRFA 4ZL8A 2G2QA 3QCPA 4KCEA 1H4OA 1XWGA 4PURA 2WZ9A 5B6NA 19GSA 2I4AA 1TRSA 2GQMA 4KH7A 2IMEA 5A4VA 4OCFA 3FKFA 1K0CA 3F63A 4RI7A 1JZOA 3VK9A 4KSMA 1T00A 4PQIA 2H70A 3P7XA 5INYA 1SL0B 5DCGA 1PGTA 1T1VA 3ZZXA 2ZNMA 4O7HA 2OBKA 1EGOA 2E2MA 3KH9A 4ID0A 2WRTA 1BQ7A 3L9UA 3HD5A 1NSWA 1HYUA 4HEA2 1U88A 3QOUA 3CTFA 2NVLA 5KOXA 1XW6A 1PL2A 4GRFA 3L9VA 3A3TA 4L5LA 4GCIA 3HJMA 5JCUA 3M3MA 1GTIA 5IOXA 2F3MA 3ZIJA 3U6VA 2HXKA 3OR5A 4KA0A 4F9ZA 22GSA 4PTSA 4PQHA 2E2GA 1V57A 1ML6A 2TIRA 4KUNA 1TK0B 1USBA 1GLPA 3RPPA 3ZTLA 3HXSA 3N5OA 3D5JA 1R7HA 2CX3A 3ZFLA 4MF7A 1M7TA 4KE3A 4G2EA 4NPBA 3LXZA 5D9WA 4HSCX 3WT2A 2JL4A 3ZVJA 2AHEA 1B9XC 4ICYA 2REMA 3E3EA 2CZ2A 4NWYA 1SU9A 3F6FA 2VLTA 1GTUA 1Z9HA 2X4AA 1QFNA 1B4QA 4AF2A 2YJ7A 1GNEA 2H75A 2VLVA 2LQOA 4N30A 1FO5A 4HS1A 2NBSA 4IP6A 4EUYA 2LJAA 1OC8A 2E7PA 3Q74A 4K0GA 4KW6A 2F8FA 3DMLA 2FD3A 4E8EA 3A2WA 3L4NA 4KDUA 4POMA 1OC3A 3DVWA 1Q98A 3CSIA 1FW1A 4MJEA 4I2TA 3TKSA 2R37A 3MNGA 4K1FA 5CAXA 5B7CA 1AAZA 4F03A 1K3OA 1GSSA 3C71A 2JZRA 1QQ2A 5J41A 2JACA 2V41A 5A5KA 1MD3A 4FYUA 3FZ4A 2QKEA 4EIPA 5HR3A 3ZFBA 6GSXA 2N5AA 3EURA 1T3BA 2AV4A 1ZCPA 1GH2A 3I43A 4L0UA 2FWEA 3ERWA 5KOWA 3DKSA 4TR0A 1XW5A 1M99A 2HFDA 2H1AA 4OD7A 2RIIA 1WJKA 5JWOB 1JZWA 1TP9A 4HU7A 3HVXA 4MP4A 1RW1A 3IHQA 9GSSA 3UAPA 1R4WA 2IFQA 4HU9A 2I3YA 2PPTA 2R0PA 3EE2A 1ZZYA 4V2NA 3D22A 2CT6A 3EMXA 1ACVA 5IQYA 3DIEA 3BOAA 5LD0A 4L5OA 1PN9A 4K2XA 4BVYA 3CQFA 1U3AA 4JBBA 2O7KA 2DKHA 4WETA 2DJ0A 2DJ2A 4KF9A 2L57A 4N10A 2X8CA 3MAKA 2CAIA 2JSZA 4GXZA 6GSYA 4IP1A 4USSA 4IHUA 4MCUA 1IYHA 4RQXA
chains in the Genus database with same CATH topology
4POBA 1O7UA 3ZIVA 5HR0A 2GSTA 3LGCA 2DJJA 5ECRB 3CMIA 1TJDA 4WF5A 1XFLA 3FR6A 3KGKA 2VL3A 5ECMB 3K8NA 4N0VA 2QGVA 2K8SA 4MZWA 3F9UA 2B7KA 3ERGA 4MJCA 1NW2A 3GTUB 3TKRA 5IMVA 2QA1A 4TKYA 4BWQA 3EC3A 4O92A 1A8LA 3FW2A 2HRNA 3EPTA 4K5SA 4P3YB 2VL2A 3RHCA 2E0QA 2HE3A 4RI6A 1QGVA 1GTAA 4Q5FA 4ZB6A 3GIXA 3GV1A 3CYNA 4ML1A 1YKAA 18GSA 1ERUA 1A8YA 1TU8A 3AY8A 2KLXA 1H75A 1EV4A 2DIZA 8GSSA 3TRPA 3UBLA 2J23A 4KAEA 1MD4A 4ZILA 3TKQA 4ECBA 5B8BA 5A4UA 3QFAC 1V40A 1W4VA 1GSUA 1DSBA 5BRTA 1SJZA 3GA4A 3C7MA 3A5IA 5DJMA 5J5NA 2GSSA 2QSIA 3F3QA 2HZFA 2YZUA 4TXOB 4OO5A 4YQUA 3IR4A 2A2RA 2MZCA 5CNWA 3EMPA 4MF6A 2LRCA 1DUGA 3HHVA 1TXXA 3HY2A 3KCMA 2FA8A 1GUHA 3LYKA 1XVWA 2YJHA 1J0FA 3IPZA 3M9JA 4I5QA 4FIWA 3C8EA 2V6OA 4XRDA 2AAWA 5H5SA 1XOAA 2B6MA 4BVXB 4IVFA 1HNCA 4EKZA 3O76A 3D4MA 3MIXA 5AIVA 1ZL9A 5J9CA 5CP1A 1GSYA 1HNAA 4CY8A 3US3A 5D9XA 4ILFA 4JRRA 3GUSA 5IOWA 1GSFA 3IV4A 5F06A 5DALB 3UOMA 3KD0A 4AJ7A 5G2ZA 1GWCA 5AGYA 2YN1A 4JZQA 4CDOA 1EZKA 2LJKA 1GTBA 1MDKA 2GGTA 3D21A 4X0XA 17GSA 3LXTA 4HDEA 3UBKA 4ZBDA 3ZLPA 4ISDA 5ECIB 5LCZA 3F4RA 1ZMAA 4V2LA 1BYEA 4A5PA 1VF2A 1YZXA 3W6GA 4Z2UA 2ALBA 3TJKA 2YV7A 3H4KA 4E8HA 4OFTA 2DJ3A 5ID2B 1PRXA 2L59A 3ZMLA 1ERVA 3FEUA 1TOFA 2JU5A 4HUAA 4PXOA 3UL3A 4IGJA 2CZ3A 5AN1A 4GSTA 1BJXA 3BD2A 4MJAA 2TRCP 2R3XA 3PINA 4EC0A 2JSYA 1B9YC 4MA9A 4NHWA 1TK8B 1XW9A 4XS6A 1ILOA 1Z3EA 3GX8A 4LLRA 1UA5A 1YDKA 3KIJA 1TRVA 1AUCA 5EY6A 3EVIA 3M1GA 5C04A 2P5QA 2LUSA 2WGRA 1K0NA 5F8BA 4I8BA 2MMZA 4XHMA 2LJRA 4NAXA 2VLUA 1KTEA 2GLRA 1VF3A 1EEMA 1S3AA 2VL2C 4FH8A 1SJIA 2Z9SA 2J9HA 4TXVA 3QPMA 2H1GA 1PQNA 1X5DA 4OCEA 3LJRA 1X0RA 11GSA 2YNXA 1SL1B 3L9SA 4TOPA 3WGDA 3FZAA 2AB6A 2GZZA 4MPGA 2QC7A 1OE8A 2H0HA 1M9BA 1JZRA 1WMJA 3ZMKA 2DIYA 2QA2A 2LNSA 1JHBA 3H8QA 1QUWA 3ME8A 14GSA 1SK1A 2DJKA 2JZTA 2V1MA 7GSSA 4GLTA 4EIQA 4O5QA 1YJ6A 1V2AA 1E2YA 3LQ7A 5HFGA 4ZB9A 1FAAA 2A2SA 2H74A 2PGTA 4NMUA 2HSMA 3DYRA 2GDRA 4CW9A 2X8HA 2VL9A 1ST9A 2K8VA 5ECNB 1JLVA 2XBIA 3DGQA 5HQPA 3HJOA 2C0DA 4IW9A 3ZVJD 2ZCTA 3CSJA 2HRAA 1EP8A 4YQMA 3GTUA 1CQHA 1VF1A 4LMVA 2HLSA 2GSQA 5DJLA 2CX4A 4MJBA 3HCZA 4OMVA 4MABA 5FT3A 1OYJA 2H76A 2YWIA 2HI7A 1K0BA 5IPHA 5ECQB 1WE0A 2I9HA 2YCDA 5G1LA 4KNDA 1N2AA 3CBUA 3ZRDA 2PBJA 3NIVA 1A0FA 2VAFA 4MH2A 5IPGA 3UEMA 2H6ZA 2UZ8A 3L0HA 3DEXA 3KM6A 4TXOA 2F9SA 5F07A 3ME7A 1V58A 3EU3A 2CVKA 3ZL5A 4V1Ap 2MYGA 4O5UA 2H01A 2IMFA 2M72A 3GFKA 4ML6A 2KHPA 5G5EA 4YH2A 4QL9A 1Z6MA 2HYXA 4WEYA 1J9BA 4G9HA 3EU4A 1XCCA 4BVXA 1URMA 2RUFA 2DJ1A 3EINA 4WXTA 4OWYA 2H0GA 2K6VA 2NDOA 3HYPA 5IMAA 4MF5A 1TI3A 1PKZA 3R2QA 5CRGA 5DALA 3TGZA 4DSSB 3LSZA 1X9WB 3FZ9A 2GS3A 3ED3A 1THOA 4EO3A 1YF0A 2VUPA 1TK5B 2JADA 3GL5A 1ZOFA 1PX6A 3HVSA 4KCAA 1M2DA 4QQ7A 2LRTA 5IO2A 2CAQA 1EOHA 1PSQA 3VWWA 2B1KA 3LEFA 2YWMA 1ZYEA 1HD2A 1OAZA 4RQRA 3H79A 5J3RA 4X4JA 4IKHA 1I5GA 5GSTA 3QAGA 2WCIA 5ID2A 5JCGA 1T8EB 1K0OA 1TTZA 3ZREA 3GX0A 2B5XA 4IS0A 2WS2A 3LW9A 1SD8A 3A2VA 1R5PA 2HZEA 3MWHA 1O81A 4LL1B 5DQYA 4IN0A 5ELGA 1AC1A 1I9DA 3TJBA 1EWXA 2P31A 2EIOA 3C1RA 2B1LA 2XPEA 4XRAA 2X8GA 1MDJA 4G19A 1XXUA 2YANA 10GSA 3DD3A 1G6WA 4IBPA 3JCML 5H5QA 3FMWA 3RAZA 1F9MA 3CRTA 5DAKB 2B5EA 4XS4B 2EIQA 5EL8A 1FVJA 3QAWA 5E59A 4Q5NA 4J2FA 4HJ2A 4AJ6A 1QK8A 1T7PB 5DVBA 3IDVA 5DDLA 2TRXA 4PQ1A 2G0FA 1AQWA 3WYWA 5J9BA 3A2XA 4EVMA 1OVNA 4MNNA 5CREA 5ECSA 3E9JB 4QL7A 2RUEA 5COHA 3G7IA 4OFNA 3FR9A 2H72A 2XHFA 4K7NA 12GSA 2LV3A 3VPQA 5LNKe 1CQGA 4BPYA 1AXDA 4KB3A 5AISA 1SKSB 5DBQA 4O32A 2H30A 5CRHA 1AQVA 1ZYQB 3UARA 4KX4A 1JFUA 4WF4A 1UN2A 5B6MA 4TN8A 2A4VA 2L6CA 2VO4A 4L8EA 1ERTA 2FGXA 2CVDA 4D73B 4F2IA 3ISOA 5J4UA 2AUVA 1FHEA 4MK3A 4POKA 1U87A 4XTSA 2VCWA 4GTUA 4RUVA 5FHIA 3F4SA 2K9FA 1V9WA 4IQ1A 4K0NA 3TRXA 1RQMA 1XPVA 2YWNA 5ELAA 5D73A 3D0ZA 2DBCA 1YQ1A 1GL8A 1Y6EA 3HZ4A 4TVEA 2HRKA 1JLWA 3TB2A 1B48A 4PX1A 2C0GA 2H66A 3H1NA 4K7OA 4Z2RA 1TKDB 5D9TA 1HQOA 3BCIA 1TDIA 3EYTA 1EP7A 1SENA 5IMFA 2R4VA 4X1UA 2P5RA 1PA3A 3M9KA 5CRDA 2RM6A 3GYKA 2OACA 3HA9A 2D2ZA 3QR6A 1WP0A 1S3DA 1G6YA 3QD9A 4XIHA 3VURA 3FK8A 5DQSA 3WGXA 4LA1A 1C72A 4EF0A 3KJYA 3IK7A 2N5BA 2GQKA 2B7JA 2LEGA 5HFKA 3HVVA 3TKSC 3Q19A 4EXJA 2WB9A 4ULXA 2HSHA 1YEPA 1UVZA 2IWTA 3KMOA 1AW9A 3F0IA 3UVHA 2IL3A 4N0ZA 1WPIA 3H93A 2PERA 2DKIA 1Z5YE 2A4HA 4KDXA 2MMOA 1PX7A 5ECPB 3DXBA 2YWOA 2HNLA 3VI7A 2FWHA 4DSSA 1PL1A 5ECKB 2O87A 3U5RE 4YKGA 2XBQA 4YAPA 1SKRB 1SK2A 3A5WA 4GSNA 3WD6A 1OKTA 4K7IA 2NPBA 2MBSA 3I69A 3GKNA 5L71A 4GQCA 4AJ8A 2H8LA 3IBHA 4TR3A 4ZL7A 4Q5RA 4K6XA 4NV5A 2I81A 2AJQB 3MDKA 2L4CA 1GP1A 1BEDA 3IAM2 4ECJA 5KN2A 4DSQA 1VGLA 4JEDA 1M9AA 5D96A 3SWLA 2PUKC 2L5LA 1B8XA 3BBYA 4GSSA 1A2LA 1TU7A 4KSOA 1XWKA 3QAVA 2PVQA 5BMUA 2O89A 3VLNA 2WULA 1SJ6A 1THXA 3TCOA 4JE1A 5F05A 1F37A 2LKUA 1UC7A 2FWFA 1JZDA 4PUFC 2C4JA 2GQLA 3P90A 4J56E 1BX9A 4G10A 4OO4A 2FCHA 3GKXA 1QMVA 5DAKA 4XS4A 3QDNA 2DLXA 2H6YA 3KTBA 4Q5QA 4WBRD 1EEJA 5IMCA 1X9MB 2R2JA 5CYYA 4ZXGA 5GAND 3KZQA 3LWAA 1XIYA 1WOUA 3F6DA 2XC2A 1OE7A 3RDWA 4MMMA 4BL7B 2VD0A 4G0KA 5ABRA 4I6XA 2GVPA 2KUCA 2KOKA 4IJIA 2LSTA 3VFIA 1GRXA 2DC5A 3IRAA 1N8JA 3TUEA 4ZL9A 3V1WA 2BTOT 1F3BA 1KNGA 4GQFA 2FY6A 4MZBA 4IJ3A 3FRCA 1GULA 2WJUA 1F3AA 4KGIA 3FZ5A 4DSRA 2X99A 2C80A 3KH7A 1K3LA 2IIYA 1PMTA 2DMLA 2VOCA 2FWGA 1YY7A 4JU5A 3UJ1A 1O85A 4D73A 2VCVA 1LBKA 3S9FA 1A23A 3IE3A 2YV9A 1O8WA 4F0BA 5G5FA 3IA1A 4JR6A 3M8NA 4Z2TA 4TR1B 2PU9C 5GAPD 5CO3A 4FYCA 2EIRA 4KDYA 1ZGNA 2H0IA 5G1KA 1F6MC 4TW5A 4I97A 2VM2A 1T4YA 3L78A 2CA8A 1WWJA 1FB0A 6GSSA 2F8AA 3RBTA 5EPFA 2OA7A 1VF4A 2LNTA 4POLA 1O73A 3N9JA 2V6KA 2H71A 1F2EA 1G7OA 1M2AA 2ON5A 2IJYA 3PPUA 3W8JA 5KN3A 2KP2A 2ZUPA 1PKWA 3NOFA 2O85A 2F51A 2PMTA 2FLSA 2B3SA 3R3EA 1FG4A 4WR5A 2L4QA 3D4TA 5JCWA 1XOBA 1Q4JA 5H5RA 4G0IA 3GSTA 4X43A 3TJJA 4GWRA 1OKDA 2VM1A 5GSSA 3HJPA 1XWAA 1ZYPA 1EOGA 1MEKA 3HZ8A 3GH6A 2IMDA 2VCTA 4N11A 4EL1A 1SYRA 4NXIA 1XVQA 4DEJA 5IM9A 3CRUA 2GZYA 3KXOA 4XCSA 1OC9B 1O6JA 3IC8A 3NZNA 4ECCA 5ENUA 1X5EA 4MZCA 5ECHB 1NM3A 3VWXA 1R26A 3KP8A 4ZBBA 1BG5A 1A2MA 2ES7A 2GTUA 5DCHA 4HJMA 1DE2A 3E0UA 3CXGA 2V32A 2PVOC 3GSSA 1TRWA 1KBNA 3FY7A 2M46A 3DRNA 3PH9A 1YKCA 5JWRB 2LQQA 2VCXA 1S3CA 1ERWA 1K0MA 2WFCA 1U3IA 2VCQA 5JWQB 2BJXA 2DSAA 3TDGA 5ECLB 3KP9A 1M2BA 2OBIA 1SK0A 2R0CA 3O6TA 4K9ZA 4YAVA 1G0TA 2RLIA 4WR4A 2VD1A 5D8IA 5D93A 4HOJA 4DVCA 1LU4A 2C0FA 3J7Yk 3WT1A 3ERFA 2N5FA 1WRYA 3DWVA 4GF0A 4TRXA 3TKSE 1GNWA 1ABAA 2IN3A 2EC4A 4FO5A 1YF1A 1AQXA 4AGSA 4ACSA 4CY6A 4TR4A 1ON4A 4WBJA 3SBCA 1U6TA 1V98A 4OFMA 2VIMA 4L0WA 2NTOA 16GSA 3GNJA 3J7Yb 1A24A 4F0CA 5G31A 3BJ5A 1K3YA 2C3TA 2C0EA 3GMFA 2O8VB 5EVOA 1K0DA 4EDYA 2ON7A 5E4WA 3VWVA 5KN1A 3D6IA 4O5RA 3UVTA 4JR4A 1ZYNA 4YKFA 4PNGA 1WIKA 2GT6A 3HKRA 3QMXA 3P2AA 1SYXA 1J08A 1TRUA 3GHAA 4FQUA 5C00A 5GZZB 1DE1A 2H6XA 3APOA 4EDZA 1IYIA 3KMNA 3Q6OA 4YQVA 1PN0A 1Y25A 4MDCA 2WDUA 3G7JA 5D9VA 3G9BA 3TOTA 2H1DA 3LYPA 3BCKA 4BL7A 2PN8A 1SL2B 2C3NA 1NHOA 2I1UA 3IHGA 3HDCA 1B4PA 3C1SA 4ZBAA 3VI5A 1A0RP 2MMNA 1GLQA 2HT9A 5KEJA 3Q18A 1PD21 4PUAA 2M80A 1EGRA 1MTCA 5HFIA 6GSVA 4H86A 1FB6A 1KEBA 3W8SA 1HNBA 1SKWB 1W89A 1TI1A 4MH3A 4BA7A 4ZIJA 3TJFA 1XWBA 2R0GA 1AIUA 3M0FA 3GL3A 3FR3A 3FHKA 4XS1A 1X5CA 4IELA 2HSYA 3GH9A 3CSHA 4MLYA 3IOSA 1XBSA 2CQ9A 5HR1A 5A4WA 1M0UA 2K18A 3GKKA 4TR1A 3LORA 3PGTA 13GSA 2RM5A 2GZPA 4LMWA 4K5RA 2MMAA 3TOUA 2GT5A 3WGEA 5FWGA 5IMDA 2X64A 3GKMA 4MPFA 3O3TA 3VPTA 6GSTA 2OE0A 4K2DA 2C8UA 3P8WA 3C73A 1R5AA 2P0GA 3LG6A 3KTLA 3UIWA 3MYDA 2IMKA 4PNFA 1X9SB 3RPNA 1YEXA 4FYBA 1GUKA 2FA4A 1SD9A 2C3QA 3F8UA 1EV9A 3IAS2 2A2PA 4HI7A 1K0AA 4WKWA 5KN0A 4ECIA 3PR8A 1FVKA 1Z7RA 3ZYWA 2YP6A 4HQZA 1VRSD 1XWCA 2H1BA 1GSEA 3IXRA 1LJRA 1GSDA 2OKAA 2C1YA 2LTKA 1OC9A 4PGTA 3VWUA 2OE1A 4HZ4A 3GURA 2R5GA 1MDIA 1E6BA 2GSRA 3APQA 1DBYA 4LL4B 5IMZA 1FOVA 2OJLA 5CRWA 2CVBA 4EE0A 2X49A 5HR2A 2DMMA 2V2GA 1Z7PA 4V2MA 3F3RA 3DVXA 2L6DA 1A2JA 5G30A 1GSQA 1G7EA 3EWLA 2OADA 4HQSA 2FNOA 3I9V2 2KP1A 3MSZA 4F82A 1GUMA 3GRXA 2YPMA 4BWSA 4K8MA 2HZEB 4I2UA 3F4TA 2BMXA 2B5YA 3TKPA 3LFLA 5IO0A 2VCZA 2OE3A 4NV2A 3APSA 4V1Ag 3RHBA 3QFBC 2LS5A 2MBTA 6GSWA 3FYGA 2YOIA 20GSA 6GSUA 4ZB8A 1BAYA 1NHYA 2CV4A 5IIZA 2FHEA 2L5OA 3KEBA 5B8AA 3I6AA 2IFQB 3GN3A 2AYTA 2PWJA 2H19A 2YZHA 4NHZA 2XPDA 1RK4A 1TW9A 5ECOB 4J57E 4Z7XA 4BVYB 5AIXA 1Z6NA 3TJGA 3ZITA 2FUG2 1XZOA 2JZSA 3CTGA 1T4ZA 3IK9A 1O8XA 2R6KA 3G7YA 5F0GA 3TRQA 4G0LA 3IC4A 2IPAA 2LRNA 4HZ2A 1FOHA 2IMIA 1QXHA 3UMAA 2H73A 4CHSA 4IQAA 2HRFA 4ZL8A 2G2QA 3QCPA 4KCEA 1H4OA 1XWGA 4PURA 2WZ9A 5B6NA 19GSA 2I4AA 1TRSA 2GQMA 4KH7A 2IMEA 5A4VA 4OCFA 3FKFA 1K0CA 3F63A 4RI7A 1JZOA 3VK9A 4KSMA 1T00A 4PQIA 2H70A 3P7XA 5INYA 1SL0B 5DCGA 1PGTA 1T1VA 3ZZXA 2ZNMA 4O7HA 2OBKA 1EGOA 2E2MA 3KH9A 4ID0A 2WRTA 1BQ7A 3L9UA 3HD5A 1NSWA 1HYUA 4HEA2 1U88A 3QOUA 3CTFA 2NVLA 5KOXA 1XW6A 1PL2A 4GRFA 3L9VA 3A3TA 4L5LA 4GCIA 3HJMA 5JCUA 3M3MA 1GTIA 5IOXA 2F3MA 3ZIJA 3U6VA 2HXKA 3OR5A 4KA0A 4F9ZA 22GSA 4PTSA 4PQHA 2E2GA 1V57A 1ML6A 2TIRA 4KUNA 1TK0B 1USBA 1GLPA 3RPPA 3ZTLA 3HXSA 3N5OA 3D5JA 1R7HA 2CX3A 3ZFLA 4MF7A 1M7TA 4KE3A 4G2EA 4NPBA 3LXZA 5D9WA 3WT2A 2JL4A 3ZVJA 2AHEA 1B9XC 4ICYA 2REMA 3E3EA 2CZ2A 4NWYA 1SU9A 3F6FA 2VLTA 1GTUA 1Z9HA 2X4AA 1QFNA 1B4QA 4AF2A 2YJ7A 1GNEA 2H75A 2VLVA 2LQOA 4N30A 1FO5A 4HS1A 2NBSA 4IP6A 4EUYA 2LJAA 1OC8A 2E7PA 3Q74A 4K0GA 4KW6A 2F8FA 3DMLA 2FD3A 4E8EA 3A2WA 3L4NA 4KDUA 4POMA 1OC3A 3DVWA 1Q98A 3CSIA 1FW1A 4MJEA 4I2TA 3TKSA 2R37A 3MNGA 4K1FA 5CAXA 5B7CA 1AAZA 4F03A 1K3OA 1GSSA 3C71A 2JZRA 1QQ2A 5J41A 2JACA 2V41A 5A5KA 1MD3A 4FYUA 3FZ4A 2QKEA 4EIPA 5HR3A 3ZFBA 6GSXA 2N5AA 3EURA 1T3BA 2AV4A 1ZCPA 1GH2A 3I43A 4L0UA 2FWEA 3ERWA 5KOWA 3DKSA 4TR0A 1XW5A 1M99A 2HFDA 2H1AA 4OD7A 2RIIA 1WJKA 5JWOB 1JZWA 1TP9A 4HU7A 3HVXA 4MP4A 1RW1A 3IHQA 9GSSA 3UAPA 1R4WA 2IFQA 4HU9A 2I3YA 2PPTA 2R0PA 3EE2A 1ZZYA 4V2NA 3D22A 2CT6A 3EMXA 1ACVA 5IQYA 3DIEA 3BOAA 5LD0A 4L5OA 1PN9A 4K2XA 4BVYA 1U3AA 4JBBA 2O7KA 2DKHA 4WETA 2DJ0A 2DJ2A 4KF9A 2L57A 4N10A 2X8CA 3MAKA 2CAIA 2JSZA 4GXZA 6GSYA 4IP1A 4USSA 4IHUA 4MCUA 1IYHA 4RQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4POB A;  1O7U A;  3ZIV A;  5HR0 A;  2GST A;  3LGC A;  2DJJ A;  5ECR B;  3CMI A;  1TJD A;  4WF5 A;  1XFL A;  3FR6 A;  3KGK A;  2VL3 A;  5ECM B;  3K8N A;  4N0V A;  2QGV A;  2K8S A;  4MZW A;  3F9U A;  2B7K A;  3ERG A;  4MJC A;  1NW2 A;  3GTU B;  3TKR A;  5IMV A;  4TKY A;  4BWQ A;  3EC3 A;  4O92 A;  1A8L A;  3FW2 A;  2HRN A;  4P3Y B;  2VL2 A;  3RHC A;  2E0Q A;  2HE3 A;  4RI6 A;  1QGV A;  1GTA A;  4Q5F A;  4ZB6 A;  3GIX A;  3GV1 A;  3CYN A;  4ML1 A;  1YKA A;  18GS A;  1ERU A;  1A8Y A;  1TU8 A;  3AY8 A;  2KLX A;  1H75 A;  1EV4 A;  2DIZ A;  8GSS A;  3TRP A;  3UBL A;  2J23 A;  4KAE A;  1MD4 A;  4ZIL A;  3TKQ A;  4ECB A;  5B8B A;  5A4U A;  3QFA C;  1V40 A;  1W4V A;  1GSU A;  1DSB A;  1SJZ A;  3GA4 A;  3C7M A;  5DJM A;  5J5N A;  2GSS A;  2QSI A;  3F3Q A;  2HZF A;  2YZU A;  4TXO B;  4OO5 A;  4YQU A;  3IR4 A;  2A2R A;  2MZC A;  5CNW A;  3EMP A;  4MF6 A;  2LRC A;  1DUG A;  3HHV A;  1TXX A;  3HY2 A;  3KCM A;  2FA8 A;  1GUH A;  3LYK A;  1XVW A;  2YJH A;  1J0F A;  3IPZ A;  3M9J A;  4I5Q A;  4FIW A;  3C8E A;  2V6O A;  4XRD A;  2AAW A;  5H5S A;  1XOA A;  2B6M A;  4IVF A;  1HNC A;  4EKZ A;  3O76 A;  3D4M A;  5AIV A;  1ZL9 A;  5J9C A;  5CP1 A;  1GSY A;  1HNA A;  3US3 A;  5D9X A;  4ILF A;  4JRR A;  3GUS A;  5IOW A;  1GSF A;  3IV4 A;  5F06 A;  5DAL B;  3UOM A;  3KD0 A;  4AJ7 A;  5G2Z A;  1GWC A;  5AGY A;  2YN1 A;  4JZQ A;  4CDO A;  1EZK A;  2LJK A;  1GTB A;  1MDK A;  2GGT A;  3D21 A;  4X0X A;  17GS A;  3LXT A;  4HDE A;  3UBK A;  4ZBD A;  3ZLP A;  4ISD A;  5ECI B;  5LCZ A;  3F4R A;  1ZMA A;  4V2L A;  1BYE A;  1VF2 A;  1YZX A;  3W6G A;  2ALB A;  3TJK A;  2YV7 A;  3H4K A;  4E8H A;  4OFT A;  2DJ3 A;  5ID2 B;  1PRX A;  2L59 A;  3ZML A;  1ERV A;  3FEU A;  1TOF A;  2JU5 A;  4HUA A;  4PXO A;  3UL3 A;  4IGJ A;  2CZ3 A;  5AN1 A;  4GST A;  1BJX A;  3BD2 A;  4MJA A;  2TRC P;  2R3X A;  3PIN A;  4EC0 A;  2JSY A;  1B9Y C;  4MA9 A;  4NHW A;  1TK8 B;  1XW9 A;  4XS6 A;  1ILO A;  1Z3E A;  3GX8 A;  4LLR A;  1UA5 A;  1YDK A;  3KIJ A;  1TRV A;  1AUC A;  5EY6 A;  3EVI A;  3M1G A;  5C04 A;  2P5Q A;  2LUS A;  2WGR A;  1K0N A;  5F8B A;  4I8B A;  2MMZ A;  4XHM A;  2LJR A;  4NAX A;  2VLU A;  1KTE A;  2GLR A;  1VF3 A;  1EEM A;  1S3A A;  2VL2 C;  4FH8 A;  1SJI A;  2Z9S A;  2J9H A;  4TXV A;  3QPM A;  2H1G A;  1PQN A;  1X5D A;  4OCE A;  3LJR A;  1X0R A;  11GS A;  2YNX A;  1SL1 B;  3L9S A;  4TOP A;  3WGD A;  3FZA A;  2AB6 A;  2GZZ A;  4MPG A;  2QC7 A;  1OE8 A;  2H0H A;  1M9B A;  1JZR A;  1WMJ A;  3ZMK A;  2DIY A;  1JHB A;  2LNS A;  3H8Q A;  1QUW A;  3ME8 A;  14GS A;  1SK1 A;  2DJK A;  2JZT A;  2V1M A;  7GSS A;  4GLT A;  1YJ6 A;  1V2A A;  1E2Y A;  3LQ7 A;  5HFG A;  4ZB9 A;  1FAA A;  2A2S A;  2H74 A;  2PGT A;  4NMU A;  3DYR A;  2GDR A;  4CW9 A;  2X8H A;  2VL9 A;  1ST9 A;  2K8V A;  5ECN B;  1JLV A;  2XBI A;  3DGQ A;  5HQP A;  3HJO A;  2C0D A;  4IW9 A;  3ZVJ D;  2ZCT A;  3CSJ A;  1EP8 A;  4YQM A;  3GTU A;  1CQH A;  1VF1 A;  4LMV A;  2HLS A;  2GSQ A;  5DJL A;  2CX4 A;  4MJB A;  3HCZ A;  4OMV A;  4MAB A;  5FT3 A;  1OYJ A;  2H76 A;  2YWI A;  2HI7 A;  1K0B A;  5IPH A;  5ECQ B;  1WE0 A;  2I9H A;  2YCD A;  5G1L A;  4KND A;  1N2A A;  3CBU A;  3ZRD A;  2PBJ A;  3NIV A;  1A0F A;  2VAF A;  4MH2 A;  5IPG A;  3UEM A;  2H6Z A;  3L0H A;  3DEX A;  3KM6 A;  4TXO A;  2F9S A;  5F07 A;  3ME7 A;  1V58 A;  3EU3 A;  2CVK A;  3ZL5 A;  4V1A p;  2MYG A;  2H01 A;  2IMF A;  2M72 A;  3GFK A;  4ML6 A;  2KHP A;  5G5E A;  4YH2 A;  4QL9 A;  1Z6M A;  2HYX A;  4WEY A;  1J9B A;  4G9H A;  3EU4 A;  1XCC A;  4BVX A;  1URM A;  2RUF A;  2DJ1 A;  3EIN A;  4WXT A;  4OWY A;  2H0G A;  2K6V A;  2NDO A;  3HYP A;  5IMA A;  4MF5 A;  1TI3 A;  1PKZ A;  3R2Q A;  5CRG A;  5DAL A;  3TGZ A;  4DSS B;  3LSZ A;  1X9W B;  3FZ9 A;  2GS3 A;  3ED3 A;  1THO A;  4EO3 A;  1YF0 A;  2VUP A;  1TK5 B;  2JAD A;  3GL5 A;  1ZOF A;  1PX6 A;  3HVS A;  4KCA A;  1M2D A;  4QQ7 A;  2LRT A;  5IO2 A;  2CAQ A;  1EOH A;  1PSQ A;  3VWW A;  2B1K A;  3LEF A;  2YWM A;  1ZYE A;  1HD2 A;  1OAZ A;  4RQR A;  3H79 A;  5J3R A;  4IKH A;  1I5G A;  5GST A;  3QAG A;  2WCI A;  5ID2 A;  5JCG A;  1T8E B;  1K0O A;  1TTZ A;  3ZRE A;  3GX0 A;  2B5X A;  4IS0 A;  2WS2 A;  1SD8 A;  3A2V A;  1R5P A;  2HZE A;  3MWH A;  1O81 A;  4LL1 B;  5DQY A;  4IN0 A;  5ELG A;  1AC1 A;  1I9D A;  3TJB A;  1EWX A;  2P31 A;  2EIO A;  3C1R A;  2B1L A;  2XPE A;  4XRA A;  2X8G A;  1MDJ A;  4G19 A;  1XXU A;  2YAN A;  10GS A;  3DD3 A;  1G6W A;  4IBP A;  3JCM L;  5H5Q A;  3RAZ A;  1F9M A;  3CRT A;  5DAK B;  2B5E A;  4XS4 B;  2EIQ A;  5EL8 A;  1FVJ A;  3QAW A;  5E59 A;  4Q5N A;  4J2F A;  4HJ2 A;  4AJ6 A;  1QK8 A;  1T7P B;  5DVB A;  3IDV A;  5DDL A;  2TRX A;  4PQ1 A;  2G0F A;  1AQW A;  3WYW A;  5J9B A;  3A2X A;  4EVM A;  1OVN A;  5CRE A;  5ECS A;  3E9J B;  4QL7 A;  2RUE A;  5COH A;  3G7I A;  4OFN A;  3FR9 A;  2H72 A;  2XHF A;  4K7N A;  12GS A;  2LV3 A;  3VPQ A;  5LNK e;  1CQG A;  4BPY A;  1AXD A;  4KB3 A;  5AIS A;  1SKS B;  5DBQ A;  4O32 A;  2H30 A;  5CRH A;  1AQV A;  1ZYQ B;  3UAR A;  4KX4 A;  1JFU A;  4WF4 A;  1UN2 A;  5B6M A;  4TN8 A;  2A4V A;  2L6C A;  2VO4 A;  4L8E A;  1ERT A;  2FGX A;  2CVD A;  4D73 B;  4F2I A;  3ISO A;  5J4U A;  2AUV A;  1FHE A;  4MK3 A;  4POK A;  1U87 A;  4XTS A;  2VCW A;  4GTU A;  4RUV A;  5FHI A;  3F4S A;  2K9F A;  1V9W A;  4IQ1 A;  4K0N A;  3TRX A;  5ELA A;  1RQM A;  1XPV A;  2YWN A;  5D73 A;  3D0Z A;  2DBC A;  1YQ1 A;  1GL8 A;  1Y6E A;  3HZ4 A;  4TVE A;  1JLW A;  3TB2 A;  1B48 A;  4PX1 A;  2C0G A;  2H66 A;  3H1N A;  4K7O A;  1TKD B;  5D9T A;  1HQO A;  3BCI A;  1TDI A;  3EYT A;  1EP7 A;  1SEN A;  5IMF A;  2R4V A;  4X1U A;  2P5R A;  1PA3 A;  3M9K A;  5CRD A;  2RM6 A;  3GYK A;  2OAC A;  3HA9 A;  2D2Z A;  3QR6 A;  1WP0 A;  1S3D A;  1G6Y A;  3QD9 A;  4XIH A;  3VUR A;  3FK8 A;  5DQS A;  3WGX A;  4LA1 A;  1C72 A;  4EF0 A;  3KJY A;  3IK7 A;  2N5B A;  2GQK A;  2B7J A;  2LEG A;  5HFK A;  3HVV A;  3TKS C;  3Q19 A;  4EXJ A;  2WB9 A;  4ULX A;  2HSH A;  1YEP A;  1UVZ A;  2IWT A;  3KMO A;  1AW9 A;  3F0I A;  3UVH A;  2IL3 A;  4N0Z A;  1WPI A;  3H93 A;  2PER A;  1Z5Y E;  4KDX A;  2MMO A;  1PX7 A;  5ECP B;  3DXB A;  2YWO A;  2HNL A;  3VI7 A;  2FWH A;  4DSS A;  1PL1 A;  5ECK B;  2O87 A;  3U5R E;  2XBQ A;  4YAP A;  1SKR B;  1SK2 A;  3A5W A;  4GSN A;  3WD6 A;  1OKT A;  4K7I A;  2NPB A;  2MBS A;  3I69 A;  3GKN A;  5L71 A;  4GQC A;  4AJ8 A;  2H8L A;  3IBH A;  4TR3 A;  4ZL7 A;  4Q5R A;  4K6X A;  4NV5 A;  2I81 A;  2AJQ B;  3MDK A;  2L4C A;  1GP1 A;  1BED A;  3IAM 2;  4ECJ A;  5KN2 A;  4DSQ A;  1VGL A;  4JED A;  1M9A A;  5D96 A;  3SWL A;  2PUK C;  2L5L A;  1B8X A;  3BBY A;  4GSS A;  1A2L A;  1TU7 A;  4KSO A;  1XWK A;  3QAV A;  2PVQ A;  2O89 A;  3VLN A;  2WUL A;  1SJ6 A;  1THX A;  3TCO A;  4JE1 A;  5F05 A;  1F37 A;  2LKU A;  1UC7 A;  2FWF A;  1JZD A;  4PUF C;  2C4J A;  2GQL A;  3P90 A;  4J56 E;  1BX9 A;  4G10 A;  4OO4 A;  2FCH A;  3GKX A;  1QMV A;  5DAK A;  4XS4 A;  3QDN A;  2DLX A;  2H6Y A;  3KTB A;  4Q5Q A;  4WBR D;  1EEJ A;  5IMC A;  1X9M B;  2R2J A;  5CYY A;  4ZXG A;  5GAN D;  3KZQ A;  3LWA A;  1XIY A;  1WOU A;  3F6D A;  2XC2 A;  1OE7 A;  3RDW A;  4MMM A;  2VD0 A;  5ABR A;  4I6X A;  2GVP A;  2KUC A;  2KOK A;  4IJI A;  2LST A;  3VFI A;  1GRX A;  2DC5 A;  3IRA A;  1N8J A;  3TUE A;  4ZL9 A;  3V1W A;  2BTO T;  1F3B A;  1KNG A;  4GQF A;  2FY6 A;  4MZB A;  4IJ3 A;  3FRC A;  1GUL A;  2WJU A;  1F3A A;  4KGI A;  3FZ5 A;  4DSR A;  2X99 A;  2C80 A;  3KH7 A;  1K3L A;  2IIY A;  1PMT A;  2DML A;  2VOC A;  2FWG A;  1YY7 A;  4JU5 A;  3UJ1 A;  1O85 A;  4D73 A;  2VCV A;  1LBK A;  3S9F A;  1A23 A;  3IE3 A;  2YV9 A;  1O8W A;  4F0B A;  5G5F A;  3IA1 A;  4JR6 A;  3M8N A;  4TR1 B;  2PU9 C;  5GAP D;  5CO3 A;  4FYC A;  2EIR A;  4KDY A;  1ZGN A;  2H0I A;  5G1K A;  1F6M C;  4TW5 A;  4I97 A;  2VM2 A;  1T4Y A;  3L78 A;  2CA8 A;  1WWJ A;  1FB0 A;  6GSS A;  2F8A A;  3RBT A;  5EPF A;  2OA7 A;  1VF4 A;  2LNT A;  4POL A;  1O73 A;  3N9J A;  2V6K A;  2H71 A;  1F2E A;  1G7O A;  1M2A A;  2ON5 A;  2IJY A;  3W8J A;  5KN3 A;  2KP2 A;  2ZUP A;  1PKW A;  3NOF A;  2O85 A;  2F51 A;  2PMT A;  2FLS A;  2B3S A;  1FG4 A;  4WR5 A;  2L4Q A;  3D4T A;  5JCW A;  1XOB A;  1Q4J A;  5H5R A;  3GST A;  4X43 A;  3TJJ A;  4GWR A;  1OKD A;  2VM1 A;  5GSS A;  3HJP A;  1XWA A;  1EOG A;  1MEK A;  3HZ8 A;  3GH6 A;  2IMD A;  2VCT A;  4N11 A;  4EL1 A;  1SYR A;  4NXI A;  1XVQ A;  4DEJ A;  5IM9 A;  3CRU A;  2GZY A;  3KXO A;  4XCS A;  1OC9 B;  1O6J A;  3NZN A;  4ECC A;  5ENU A;  1X5E A;  4MZC A;  5ECH B;  1NM3 A;  3VWX A;  1R26 A;  3KP8 A;  4ZBB A;  1BG5 A;  1A2M A;  2ES7 A;  2GTU A;  5DCH A;  4HJM A;  1DE2 A;  3E0U A;  3CXG A;  2V32 A;  2PVO C;  3GSS A;  1TRW A;  1KBN A;  3FY7 A;  2M46 A;  3DRN A;  3PH9 A;  1YKC A;  5JWR B;  2LQQ A;  2VCX A;  1S3C A;  1ERW A;  1K0M A;  2WFC A;  1U3I A;  2VCQ A;  5JWQ B;  2BJX A;  2DSA A;  3TDG A;  5ECL B;  3KP9 A;  1M2B A;  2OBI A;  1SK0 A;  3O6T A;  4K9Z A;  4YAV A;  1G0T A;  2RLI A;  4WR4 A;  2VD1 A;  5D8I A;  5D93 A;  4HOJ A;  4DVC A;  1LU4 A;  2C0F A;  3J7Y k;  3WT1 A;  3ERF A;  2N5F A;  1WRY A;  3DWV A;  4GF0 A;  4TRX A;  3TKS E;  1GNW A;  1ABA A;  2IN3 A;  2EC4 A;  4FO5 A;  1YF1 A;  1AQX A;  4AGS A;  4ACS A;  4TR4 A;  1ON4 A;  4WBJ A;  3SBC A;  1U6T A;  1V98 A;  4OFM A;  2VIM A;  4L0W A;  2NTO A;  16GS A;  3GNJ A;  3J7Y b;  1A24 A;  4F0C A;  5G31 A;  3BJ5 A;  1K3Y A;  2C3T A;  2C0E A;  3GMF A;  2O8V B;  5EVO A;  1K0D A;  4EDY A;  2ON7 A;  5E4W A;  3VWV A;  5KN1 A;  3D6I A;  4O5R A;  3UVT A;  4JR4 A;  4PNG A;  1WIK A;  2GT6 A;  3HKR A;  3QMX A;  3P2A A;  1SYX A;  1J08 A;  1TRU A;  3GHA A;  5C00 A;  5GZZ B;  1DE1 A;  2H6X A;  3APO A;  4EDZ A;  1IYI A;  3KMN A;  3Q6O A;  4YQV A;  1Y25 A;  4MDC A;  2WDU A;  3G7J A;  5D9V A;  3G9B A;  3TOT A;  2H1D A;  3LYP A;  3BCK A;  4BL7 A;  2PN8 A;  1SL2 B;  2C3N A;  1NHO A;  2I1U A;  3HDC A;  1B4P A;  3C1S A;  4ZBA A;  3VI5 A;  1A0R P;  2MMN A;  1GLQ A;  2HT9 A;  5KEJ A;  3Q18 A;  1PD2 1;  4PUA A;  2M80 A;  1EGR A;  1MTC A;  5HFI A;  6GSV A;  4H86 A;  1FB6 A;  1KEB A;  3W8S A;  1HNB A;  1SKW B;  1W89 A;  1TI1 A;  4MH3 A;  4BA7 A;  4ZIJ A;  3TJF A;  1XWB A;  1AIU A;  3M0F A;  3GL3 A;  3FR3 A;  3FHK A;  4XS1 A;  1X5C A;  4IEL A;  2HSY A;  3GH9 A;  3CSH A;  4MLY A;  3IOS A;  1XBS A;  2CQ9 A;  5HR1 A;  5A4W A;  1M0U A;  2K18 A;  3GKK A;  4TR1 A;  3LOR A;  3PGT A;  13GS A;  2RM5 A;  2GZP A;  4LMW A;  2MMA A;  3TOU A;  2GT5 A;  3WGE A;  5FWG A;  5IMD A;  2X64 A;  3GKM A;  4MPF A;  3O3T A;  3VPT A;  6GST A;  2OE0 A;  4K2D A;  2C8U A;  3P8W A;  3C73 A;  1R5A A;  2P0G A;  3LG6 A;  3KTL A;  3UIW A;  2IMK A;  4PNF A;  1X9S B;  3RPN A;  1YEX A;  4FYB A;  1GUK A;  2FA4 A;  1SD9 A;  2C3Q A;  3F8U A;  1EV9 A;  3IAS 2;  4HI7 A;  1K0A A;  4WKW A;  5KN0 A;  4ECI A;  3PR8 A;  1FVK A;  1Z7R A;  3ZYW A;  2YP6 A;  4HQZ A;  1VRS D;  1XWC A;  2H1B A;  1GSE A;  3IXR A;  1LJR A;  1GSD A;  2OKA A;  2C1Y A;  2LTK A;  1OC9 A;  4PGT A;  3VWU A;  2OE1 A;  4HZ4 A;  3GUR A;  2R5G A;  1MDI A;  1E6B A;  2GSR A;  3APQ A;  1DBY A;  4LL4 B;  5IMZ A;  1FOV A;  2OJL A;  5CRW A;  2CVB A;  4EE0 A;  5HR2 A;  2DMM A;  2V2G A;  1Z7P A;  4V2M A;  3F3R A;  3DVX A;  2L6D A;  1A2J A;  5G30 A;  1GSQ A;  1G7E A;  3EWL A;  2OAD A;  4HQS A;  2FNO A;  3I9V 2;  2KP1 A;  3MSZ A;  4F82 A;  1GUM A;  3GRX A;  2YPM A;  4BWS A;  4K8M A;  2HZE B;  4I2U A;  3F4T A;  2BMX A;  2B5Y A;  3TKP A;  3LFL A;  5IO0 A;  2VCZ A;  2OE3 A;  4NV2 A;  3APS A;  4V1A g;  3RHB A;  3QFB C;  2LS5 A;  2MBT A;  6GSW A;  3FYG A;  2YOI A;  20GS A;  6GSU A;  4ZB8 A;  1BAY A;  1NHY A;  2CV4 A;  5IIZ A;  2FHE A;  2L5O A;  3KEB A;  5B8A A;  3I6A A;  2IFQ B;  3GN3 A;  2AYT A;  2PWJ A;  2H19 A;  2YZH A;  4NHZ A;  2XPD A;  1RK4 A;  1TW9 A;  5ECO B;  4J57 E;  4Z7X A;  5AIX A;  1Z6N A;  3TJG A;  3ZIT A;  2FUG 2;  1XZO A;  2JZS A;  3CTG A;  1T4Z A;  3IK9 A;  1O8X A;  2R6K A;  3G7Y A;  5F0G A;  3TRQ A;  3IC4 A;  2IPA A;  2LRN A;  4HZ2 A;  2IMI A;  1QXH A;  3UMA A;  2H73 A;  4CHS A;  4IQA A;  2HRF A;  4ZL8 A;  2G2Q A;  3QCP A;  4KCE A;  1H4O A;  1XWG A;  4PUR A;  2WZ9 A;  5B6N A;  19GS A;  2I4A A;  1TRS A;  2GQM A;  4KH7 A;  2IME A;  5A4V A;  4OCF A;  3FKF A;  1K0C A;  3F63 A;  4RI7 A;  1JZO A;  3VK9 A;  4KSM A;  1T00 A;  4PQI A;  2H70 A;  3P7X A;  5INY A;  1SL0 B;  5DCG A;  1PGT A;  1T1V A;  3ZZX A;  2ZNM A;  4O7H A;  2OBK A;  1EGO A;  2E2M A;  3KH9 A;  4ID0 A;  2WRT A;  1BQ7 A;  3L9U A;  3HD5 A;  1NSW A;  1HYU A;  4HEA 2;  1U88 A;  3QOU A;  3CTF A;  2NVL A;  1XW6 A;  1PL2 A;  4GRF A;  3L9V A;  3A3T A;  4L5L A;  4GCI A;  3HJM A;  5JCU A;  3M3M A;  1GTI A;  5IOX A;  2F3M A;  3ZIJ A;  3U6V A;  2HXK A;  3OR5 A;  4KA0 A;  4F9Z A;  22GS A;  4PQH A;  2E2G A;  1V57 A;  1ML6 A;  2TIR A;  4KUN A;  1TK0 B;  1USB A;  1GLP A;  3RPP A;  3ZTL A;  3HXS A;  3N5O A;  3D5J A;  1R7H A;  2CX3 A;  3ZFL A;  4MF7 A;  1M7T A;  4KE3 A;  4G2E A;  4NPB A;  3LXZ A;  5D9W A;  3WT2 A;  2JL4 A;  3ZVJ A;  2AHE A;  1B9X C;  2REM A;  3E3E A;  2CZ2 A;  4NWY A;  1SU9 A;  2VLT A;  3F6F A;  1GTU A;  1Z9H A;  1QFN A;  1B4Q A;  4AF2 A;  2YJ7 A;  1GNE A;  2H75 A;  2VLV A;  2LQO A;  4N30 A;  1FO5 A;  4HS1 A;  2NBS A;  4IP6 A;  4EUY A;  2LJA A;  1OC8 A;  2E7P A;  3Q74 A;  4K0G A;  4KW6 A;  2F8F A;  3DML A;  2FD3 A;  4E8E A;  3A2W A;  3L4N A;  4KDU A;  4POM A;  1OC3 A;  3DVW A;  1Q98 A;  3CSI A;  1FW1 A;  4MJE A;  4I2T A;  3TKS A;  2R37 A;  3MNG A;  4K1F A;  5CAX A;  5B7C A;  1AAZ A;  4F03 A;  1K3O A;  1GSS A;  3C71 A;  2JZR A;  1QQ2 A;  5J41 A;  2JAC A;  2V41 A;  5A5K A;  1MD3 A;  4FYU A;  3FZ4 A;  2QKE A;  5HR3 A;  3ZFB A;  6GSX A;  2N5A A;  3EUR A;  1T3B A;  2AV4 A;  1ZCP A;  1GH2 A;  3I43 A;  4L0U A;  2FWE A;  3ERW A;  3DKS A;  4TR0 A;  1XW5 A;  1M99 A;  2HFD A;  2H1A A;  4OD7 A;  2RII A;  1WJK A;  5JWO B;  1JZW A;  1TP9 A;  4HU7 A;  3HVX A;  4MP4 A;  1RW1 A;  3IHQ A;  9GSS A;  3UAP A;  1R4W A;  2IFQ A;  4HU9 A;  2I3Y A;  2PPT A;  3EE2 A;  1ZZY A;  4V2N A;  3D22 A;  2CT6 A;  3EMX A;  1ACV A;  5IQY A;  3DIE A;  3BOA A;  5LD0 A;  4L5O A;  1PN9 A;  4BVY A;  1U3A A;  4JBB A;  2O7K A;  4WET A;  2DJ0 A;  2DJ2 A;  2L57 A;  4N10 A;  2X8C A;  3MAK A;  2CAI A;  2JSZ A;  4GXZ A;  6GSY A;  4IP1 A;  4IHU A;  4MCU A;  1IYH A;  4RQX A; 
#chains in the Genus database with same CATH topology
 4POB A;  1O7U A;  3ZIV A;  5HR0 A;  2GST A;  3LGC A;  2DJJ A;  5ECR B;  3CMI A;  1TJD A;  4WF5 A;  1XFL A;  3FR6 A;  3KGK A;  2VL3 A;  5ECM B;  3K8N A;  4N0V A;  2QGV A;  2K8S A;  4MZW A;  3F9U A;  2B7K A;  3ERG A;  4MJC A;  1NW2 A;  3GTU B;  3TKR A;  5IMV A;  2QA1 A;  4TKY A;  4BWQ A;  3EC3 A;  4O92 A;  1A8L A;  3FW2 A;  2HRN A;  3EPT A;  4K5S A;  4P3Y B;  2VL2 A;  3RHC A;  2E0Q A;  2HE3 A;  4RI6 A;  1QGV A;  1GTA A;  4Q5F A;  4ZB6 A;  3GIX A;  3GV1 A;  3CYN A;  4ML1 A;  1YKA A;  18GS A;  1ERU A;  1A8Y A;  1TU8 A;  3AY8 A;  2KLX A;  1H75 A;  1EV4 A;  2DIZ A;  8GSS A;  3TRP A;  3UBL A;  2J23 A;  4KAE A;  1MD4 A;  4ZIL A;  3TKQ A;  4ECB A;  5B8B A;  5A4U A;  3QFA C;  1V40 A;  1W4V A;  1GSU A;  1DSB A;  5BRT A;  1SJZ A;  3GA4 A;  3C7M A;  3A5I A;  5DJM A;  5J5N A;  2GSS A;  2QSI A;  3F3Q A;  2HZF A;  2YZU A;  4TXO B;  4OO5 A;  4YQU A;  3IR4 A;  2A2R A;  2MZC A;  5CNW A;  1M3I A;  3EMP A;  4MF6 A;  2LRC A;  1DUG A;  3HHV A;  1TXX A;  3HY2 A;  3KCM A;  2FA8 A;  1GUH A;  3LYK A;  1XVW A;  2YJH A;  1J0F A;  3IPZ A;  3M9J A;  4I5Q A;  4FIW A;  3C8E A;  2V6O A;  4XRD A;  2AAW A;  5H5S A;  1XOA A;  2B6M A;  4BVX B;  4IVF A;  1HNC A;  4EKZ A;  3O76 A;  3D4M A;  3MIX A;  5AIV A;  1ZL9 A;  5J9C A;  5CP1 A;  1GSY A;  1HNA A;  1M3J A;  4CY8 A;  3US3 A;  5D9X A;  4ILF A;  4JRR A;  3GUS A;  5IOW A;  1GSF A;  3IV4 A;  5F06 A;  5DAL B;  3UOM A;  3KD0 A;  4AJ7 A;  5G2Z A;  1GWC A;  5AGY A;  2YN1 A;  4JZQ A;  4CDO A;  1EZK A;  2LJK A;  1GTB A;  1MDK A;  2GGT A;  3D21 A;  4X0X A;  17GS A;  3LXT A;  4HDE A;  3UBK A;  4ZBD A;  3ZLP A;  4ISD A;  5ECI B;  5LCZ A;  3F4R A;  1ZMA A;  4V2L A;  1BYE A;  4A5P A;  1VF2 A;  1YZX A;  3W6G A;  4Z2U A;  2ALB A;  3TJK A;  2YV7 A;  3H4K A;  4E8H A;  4OFT A;  2DJ3 A;  5ID2 B;  1PRX A;  2L59 A;  3ZML A;  1ERV A;  3FEU A;  1TOF A;  2JU5 A;  4HUA A;  4PXO A;  3UL3 A;  4IGJ A;  2CZ3 A;  5AN1 A;  4GST A;  1BJX A;  3BD2 A;  4MJA A;  2TRC P;  2R3X A;  3PIN A;  4EC0 A;  2JSY A;  1B9Y C;  4MA9 A;  4NHW A;  1TK8 B;  1XW9 A;  4XS6 A;  1ILO A;  1Z3E A;  3GX8 A;  4LLR A;  1UA5 A;  1YDK A;  3KIJ A;  1TRV A;  1AUC A;  5EY6 A;  3EVI A;  3M1G A;  5C04 A;  2P5Q A;  2LUS A;  2WGR A;  1K0N A;  5F8B A;  4I8B A;  2MMZ A;  4XHM A;  2LJR A;  4NAX A;  2VLU A;  1KTE A;  2GLR A;  1VF3 A;  1EEM A;  1S3A A;  2VL2 C;  4FH8 A;  1SJI A;  2Z9S A;  2J9H A;  4TXV A;  3QPM A;  2H1G A;  1PQN A;  1X5D A;  4OCE A;  3LJR A;  1X0R A;  11GS A;  2YNX A;  1SL1 B;  3L9S A;  4TOP A;  3WGD A;  3FZA A;  2AB6 A;  2GZZ A;  4MPG A;  2QC7 A;  1OE8 A;  2H0H A;  1M9B A;  1JZR A;  1WMJ A;  3ZMK A;  2DIY A;  2QA2 A;  2LNS A;  1JHB A;  3H8Q A;  1QUW A;  3ME8 A;  14GS A;  1SK1 A;  2DJK A;  2JZT A;  2V1M A;  7GSS A;  4GLT A;  4EIQ A;  4O5Q A;  1YJ6 A;  1V2A A;  1E2Y A;  3LQ7 A;  5HFG A;  4ZB9 A;  1FAA A;  2A2S A;  2H74 A;  2PGT A;  4NMU A;  2HSM A;  3DYR A;  2GDR A;  4CW9 A;  2X8H A;  2VL9 A;  1ST9 A;  2K8V A;  5ECN B;  1JLV A;  2XBI A;  3DGQ A;  5HQP A;  3HJO A;  2C0D A;  4IW9 A;  3ZVJ D;  2ZCT A;  3CSJ A;  2HRA A;  1EP8 A;  4YQM A;  3GTU A;  1CQH A;  1VF1 A;  4LMV A;  2HLS A;  2GSQ A;  5DJL A;  2CX4 A;  4MJB A;  3HCZ A;  4OMV A;  4MAB A;  5FT3 A;  1OYJ A;  2H76 A;  2YWI A;  2HI7 A;  1K0B A;  5IPH A;  5ECQ B;  1WE0 A;  2I9H A;  2YCD A;  5G1L A;  4KND A;  1N2A A;  3CBU A;  3ZRD A;  2PBJ A;  3NIV A;  1A0F A;  2VAF A;  4MH2 A;  5IPG A;  3UEM A;  2H6Z A;  2UZ8 A;  3L0H A;  3DEX A;  3KM6 A;  4TXO A;  2F9S A;  5F07 A;  3ME7 A;  1V58 A;  3EU3 A;  2CVK A;  3ZL5 A;  4V1A p;  2MYG A;  4O5U A;  2H01 A;  2IMF A;  2M72 A;  3GFK A;  4ML6 A;  2KHP A;  5G5E A;  4YH2 A;  4QL9 A;  1Z6M A;  2HYX A;  4WEY A;  1J9B A;  4G9H A;  3EU4 A;  1XCC A;  4BVX A;  1URM A;  2RUF A;  2DJ1 A;  3EIN A;  4WXT A;  4OWY A;  2H0G A;  2K6V A;  2NDO A;  3HYP A;  5IMA A;  4MF5 A;  3HVN A;  1TI3 A;  1PKZ A;  3R2Q A;  5CRG A;  5DAL A;  3TGZ A;  4DSS B;  3LSZ A;  1X9W B;  3FZ9 A;  2GS3 A;  3ED3 A;  1THO A;  4EO3 A;  1YF0 A;  2VUP A;  1TK5 B;  2JAD A;  3GL5 A;  1ZOF A;  1PX6 A;  3HVS A;  4KCA A;  1M2D A;  4QQ7 A;  2LRT A;  5IO2 A;  2CAQ A;  1EOH A;  1PSQ A;  3VWW A;  2B1K A;  3LEF A;  2YWM A;  1ZYE A;  1HD2 A;  1OAZ A;  4RQR A;  3H79 A;  5J3R A;  4X4J A;  4IKH A;  1I5G A;  5GST A;  3QAG A;  2WCI A;  5ID2 A;  5JCG A;  1T8E B;  1K0O A;  1TTZ A;  3ZRE A;  3GX0 A;  2B5X A;  4IS0 A;  2WS2 A;  3LW9 A;  1SD8 A;  3A2V A;  1R5P A;  2HZE A;  3MWH A;  1O81 A;  4LL1 B;  5DQY A;  4IN0 A;  5ELG A;  1AC1 A;  1I9D A;  3TJB A;  1EWX A;  2P31 A;  2EIO A;  3C1R A;  2B1L A;  2XPE A;  4XRA A;  2X8G A;  1MDJ A;  4G19 A;  1XXU A;  2YAN A;  10GS A;  3DD3 A;  1G6W A;  4IBP A;  3JCM L;  5H5Q A;  3FMW A;  3RAZ A;  1F9M A;  3CRT A;  5DAK B;  2B5E A;  4XS4 B;  2EIQ A;  5EL8 A;  1FVJ A;  3QAW A;  5E59 A;  4Q5N A;  4J2F A;  4HJ2 A;  4AJ6 A;  1QK8 A;  1T7P B;  5DVB A;  3IDV A;  5DDL A;  2TRX A;  4PQ1 A;  2G0F A;  1AQW A;  3WYW A;  5J9B A;  3A2X A;  4EVM A;  1OVN A;  4MNN A;  5CRE A;  5ECS A;  3E9J B;  4QL7 A;  2RUE A;  5COH A;  3G7I A;  4OFN A;  3FR9 A;  2H72 A;  2XHF A;  4K7N A;  12GS A;  2LV3 A;  3VPQ A;  5LNK e;  1CQG A;  4BPY A;  1AXD A;  4KB3 A;  5AIS A;  1SKS B;  5DBQ A;  4O32 A;  2H30 A;  5CRH A;  1AQV A;  1ZYQ B;  3UAR A;  4KX4 A;  1JFU A;  4WF4 A;  1UN2 A;  5B6M A;  4TN8 A;  2A4V A;  2L6C A;  2VO4 A;  4L8E A;  1ERT A;  2FGX A;  2CVD A;  4D73 B;  4F2I A;  3ISO A;  5J4U A;  2AUV A;  1FHE A;  4MK3 A;  4POK A;  1U87 A;  4XTS A;  2VCW A;  4GTU A;  4RUV A;  5FHI A;  3F4S A;  2K9F A;  1V9W A;  4IQ1 A;  4K0N A;  3TRX A;  1RQM A;  1XPV A;  2YWN A;  5ELA A;  5D73 A;  3D0Z A;  2DBC A;  1YQ1 A;  1GL8 A;  1Y6E A;  3HZ4 A;  4TVE A;  2HRK A;  1JLW A;  3TB2 A;  1B48 A;  4PX1 A;  2C0G A;  2H66 A;  3H1N A;  4K7O A;  4Z2R A;  1TKD B;  5D9T A;  1HQO A;  3BCI A;  1TDI A;  3EYT A;  1EP7 A;  1SEN A;  5IMF A;  2R4V A;  4X1U A;  2P5R A;  1PA3 A;  3M9K A;  5CRD A;  2RM6 A;  3GYK A;  2OAC A;  3HA9 A;  2D2Z A;  3QR6 A;  1WP0 A;  1S3D A;  1G6Y A;  3QD9 A;  4XIH A;  3VUR A;  3FK8 A;  5DQS A;  3WGX A;  4LA1 A;  1C72 A;  4EF0 A;  3KJY A;  3IK7 A;  2N5B A;  2GQK A;  2B7J A;  2LEG A;  5HFK A;  3HVV A;  3TKS C;  3Q19 A;  4EXJ A;  2WB9 A;  4ULX A;  2HSH A;  1YEP A;  1UVZ A;  2IWT A;  3KMO A;  1AW9 A;  3F0I A;  3UVH A;  2IL3 A;  4N0Z A;  1WPI A;  3H93 A;  2PER A;  2DKI A;  1Z5Y E;  2A4H A;  4KDX A;  2MMO A;  1PX7 A;  5ECP B;  3DXB A;  2YWO A;  2HNL A;  3VI7 A;  2FWH A;  4DSS A;  1PL1 A;  5ECK B;  2O87 A;  3U5R E;  4YKG A;  2XBQ A;  4YAP A;  1SKR B;  1SK2 A;  3A5W A;  4GSN A;  3WD6 A;  1OKT A;  4K7I A;  2NPB A;  2MBS A;  3I69 A;  3GKN A;  5L71 A;  4GQC A;  4AJ8 A;  2H8L A;  3IBH A;  4TR3 A;  4ZL7 A;  4Q5R A;  4K6X A;  4NV5 A;  2I81 A;  1S3R A;  2AJQ B;  3MDK A;  2L4C A;  1GP1 A;  1BED A;  3IAM 2;  4ECJ A;  5KN2 A;  4DSQ A;  1VGL A;  4JED A;  1M9A A;  5D96 A;  3SWL A;  2PUK C;  2L5L A;  1B8X A;  3BBY A;  4GSS A;  1A2L A;  1TU7 A;  4KSO A;  1XWK A;  3QAV A;  2PVQ A;  5BMU A;  2O89 A;  3VLN A;  2WUL A;  1SJ6 A;  1THX A;  3TCO A;  4JE1 A;  5F05 A;  1F37 A;  2LKU A;  1UC7 A;  2FWF A;  1JZD A;  4PUF C;  2C4J A;  2GQL A;  3P90 A;  4J56 E;  1BX9 A;  4G10 A;  4OO4 A;  2FCH A;  3GKX A;  1QMV A;  5DAK A;  4XS4 A;  3QDN A;  2DLX A;  2H6Y A;  3KTB A;  4Q5Q A;  4WBR D;  1EEJ A;  5IMC A;  1X9M B;  2R2J A;  5CYY A;  4ZXG A;  5GAN D;  3KZQ A;  3LWA A;  1XIY A;  1WOU A;  3F6D A;  2XC2 A;  1OE7 A;  3RDW A;  4MMM A;  4BL7 B;  2VD0 A;  4G0K A;  5ABR A;  4I6X A;  2GVP A;  2KUC A;  2KOK A;  4IJI A;  2LST A;  3VFI A;  1GRX A;  2DC5 A;  3IRA A;  1N8J A;  3TUE A;  4ZL9 A;  3V1W A;  2BTO T;  4BIK A;  1F3B A;  1KNG A;  4GQF A;  2FY6 A;  4MZB A;  4IJ3 A;  3FRC A;  1GUL A;  2WJU A;  1F3A A;  4KGI A;  3FZ5 A;  4DSR A;  2X99 A;  2C80 A;  3KH7 A;  1K3L A;  2IIY A;  1PMT A;  2DML A;  2VOC A;  2FWG A;  1YY7 A;  4JU5 A;  3UJ1 A;  1O85 A;  4D73 A;  2VCV A;  1LBK A;  3S9F A;  1A23 A;  3IE3 A;  2YV9 A;  1O8W A;  4F0B A;  5G5F A;  3IA1 A;  4JR6 A;  3M8N A;  4Z2T A;  4TR1 B;  2PU9 C;  5GAP D;  5CO3 A;  4FYC A;  2EIR A;  4KDY A;  1ZGN A;  2H0I A;  5G1K A;  1F6M C;  4TW5 A;  4I97 A;  2VM2 A;  1T4Y A;  3L78 A;  2CA8 A;  1WWJ A;  1FB0 A;  6GSS A;  2F8A A;  3RBT A;  5EPF A;  2OA7 A;  1VF4 A;  2LNT A;  4POL A;  1O73 A;  3N9J A;  2V6K A;  2H71 A;  1F2E A;  1G7O A;  1M2A A;  2ON5 A;  2IJY A;  3PPU A;  3W8J A;  5KN3 A;  2KP2 A;  2ZUP A;  1PKW A;  3NOF A;  2O85 A;  2F51 A;  2PMT A;  2FLS A;  2B3S A;  3R3E A;  1FG4 A;  4WR5 A;  2L4Q A;  3D4T A;  5JCW A;  1XOB A;  1Q4J A;  5H5R A;  4G0I A;  3GST A;  4X43 A;  3TJJ A;  4GWR A;  1OKD A;  2VM1 A;  5GSS A;  3HJP A;  1XWA A;  1ZYP A;  1EOG A;  1MEK A;  3HZ8 A;  3GH6 A;  2IMD A;  2VCT A;  4N11 A;  4EL1 A;  1SYR A;  4NXI A;  1XVQ A;  4DEJ A;  5IM9 A;  3CRU A;  2GZY A;  3KXO A;  4XCS A;  1OC9 B;  1O6J A;  3IC8 A;  3NZN A;  4ECC A;  5ENU A;  1X5E A;  4MZC A;  5ECH B;  1NM3 A;  3VWX A;  1R26 A;  3KP8 A;  4ZBB A;  1BG5 A;  1A2M A;  2ES7 A;  2GTU A;  5DCH A;  4HJM A;  1DE2 A;  3E0U A;  3CXG A;  2V32 A;  2PVO C;  3GSS A;  1TRW A;  1KBN A;  3FY7 A;  2M46 A;  3DRN A;  3PH9 A;  1YKC A;  5JWR B;  2LQQ A;  1PFO A;  2VCX A;  1S3C A;  1ERW A;  1K0M A;  2WFC A;  1U3I A;  2VCQ A;  5JWQ B;  2BJX A;  2DSA A;  3TDG A;  5ECL B;  3KP9 A;  1M2B A;  2OBI A;  1SK0 A;  2R0C A;  3O6T A;  4K9Z A;  4YAV A;  1G0T A;  2RLI A;  4WR4 A;  2VD1 A;  5D8I A;  5D93 A;  4HOJ A;  4DVC A;  1LU4 A;  2C0F A;  3J7Y k;  3WT1 A;  3ERF A;  2N5F A;  1WRY A;  3DWV A;  4GF0 A;  4TRX A;  3TKS E;  1GNW A;  1ABA A;  2IN3 A;  2EC4 A;  4FO5 A;  1YF1 A;  1AQX A;  4AGS A;  4ACS A;  4CY6 A;  4TR4 A;  1ON4 A;  4WBJ A;  3SBC A;  1U6T A;  1V98 A;  4OFM A;  2VIM A;  4L0W A;  2NTO A;  16GS A;  3GNJ A;  3J7Y b;  1A24 A;  4F0C A;  5G31 A;  3BJ5 A;  1K3Y A;  2C3T A;  2C0E A;  3GMF A;  2O8V B;  5EVO A;  1K0D A;  4EDY A;  2ON7 A;  5E4W A;  3VWV A;  5KN1 A;  3D6I A;  4O5R A;  3UVT A;  4JR4 A;  1ZYN A;  4YKF A;  4PNG A;  1WIK A;  2GT6 A;  3HKR A;  3QMX A;  3P2A A;  1SYX A;  1J08 A;  1TRU A;  3GHA A;  4FQU A;  5C00 A;  5GZZ B;  1DE1 A;  2H6X A;  3APO A;  4EDZ A;  1IYI A;  3KMN A;  3Q6O A;  4YQV A;  1PN0 A;  1Y25 A;  4MDC A;  2WDU A;  3G7J A;  5D9V A;  3G9B A;  3TOT A;  2H1D A;  3LYP A;  3BCK A;  4BL7 A;  2PN8 A;  1SL2 B;  2C3N A;  1NHO A;  2I1U A;  3IHG A;  3HDC A;  1B4P A;  3C1S A;  4ZBA A;  3VI5 A;  1A0R P;  2MMN A;  1GLQ A;  2HT9 A;  5KEJ A;  3Q18 A;  1PD2 1;  4PUA A;  2M80 A;  1EGR A;  1MTC A;  5HFI A;  6GSV A;  4H86 A;  1FB6 A;  1KEB A;  3W8S A;  1HNB A;  1SKW B;  1W89 A;  1TI1 A;  4MH3 A;  4BA7 A;  4ZIJ A;  3TJF A;  1XWB A;  2R0G A;  1AIU A;  3M0F A;  3GL3 A;  3FR3 A;  3FHK A;  4XS1 A;  1X5C A;  4IEL A;  2HSY A;  3GH9 A;  3CSH A;  4MLY A;  3IOS A;  1XBS A;  2CQ9 A;  5HR1 A;  5A4W A;  1M0U A;  2K18 A;  3GKK A;  4TR1 A;  3LOR A;  3PGT A;  13GS A;  2RM5 A;  2GZP A;  4LMW A;  4K5R A;  2MMA A;  3TOU A;  2GT5 A;  3WGE A;  1XG8 A;  5FWG A;  5IMD A;  2X64 A;  3GKM A;  4MPF A;  3O3T A;  3VPT A;  6GST A;  2OE0 A;  4K2D A;  2C8U A;  3P8W A;  3C73 A;  1R5A A;  2P0G A;  3LG6 A;  3KTL A;  3UIW A;  3MYD A;  2IMK A;  4PNF A;  1X9S B;  3RPN A;  1YEX A;  4FYB A;  1GUK A;  2FA4 A;  1SD9 A;  2C3Q A;  3F8U A;  1EV9 A;  3IAS 2;  2A2P A;  4HI7 A;  1K0A A;  4WKW A;  5KN0 A;  4ECI A;  3PR8 A;  1FVK A;  1Z7R A;  3ZYW A;  2YP6 A;  4HQZ A;  1VRS D;  1XWC A;  2H1B A;  1GSE A;  3IXR A;  1LJR A;  1GSD A;  2OKA A;  2C1Y A;  2LTK A;  1OC9 A;  4PGT A;  3VWU A;  2OE1 A;  4HZ4 A;  3GUR A;  2R5G A;  1MDI A;  1E6B A;  2GSR A;  3APQ A;  1DBY A;  4LL4 B;  5IMZ A;  1FOV A;  2OJL A;  5CRW A;  2CVB A;  4EE0 A;  2X49 A;  5HR2 A;  2DMM A;  2V2G A;  1Z7P A;  4V2M A;  3F3R A;  3DVX A;  2L6D A;  1A2J A;  5G30 A;  1GSQ A;  1G7E A;  3EWL A;  2OAD A;  4HQS A;  2FNO A;  3I9V 2;  2KP1 A;  3MSZ A;  4F82 A;  1GUM A;  3GRX A;  2YPM A;  4BWS A;  4K8M A;  2HZE B;  4I2U A;  3F4T A;  2BMX A;  2B5Y A;  3TKP A;  3LFL A;  5IO0 A;  2VCZ A;  2OE3 A;  4NV2 A;  3APS A;  4V1A g;  3RHB A;  3QFB C;  2LS5 A;  2MBT A;  6GSW A;  3FYG A;  2YOI A;  20GS A;  6GSU A;  4ZB8 A;  1BAY A;  1NHY A;  2CV4 A;  5IIZ A;  2FHE A;  2L5O A;  3KEB A;  5B8A A;  3I6A A;  2IFQ B;  3GN3 A;  2AYT A;  2PWJ A;  2H19 A;  2YZH A;  4NHZ A;  2XPD A;  1RK4 A;  1TW9 A;  5ECO B;  4J57 E;  4Z7X A;  4BVY B;  5AIX A;  1Z6N A;  3TJG A;  3ZIT A;  2FUG 2;  1XZO A;  2JZS A;  3CTG A;  1T4Z A;  3IK9 A;  1O8X A;  2R6K A;  3G7Y A;  5F0G A;  3TRQ A;  4G0L A;  3IC4 A;  2IPA A;  2LRN A;  4HZ2 A;  1FOH A;  2IMI A;  1QXH A;  3UMA A;  2H73 A;  4CHS A;  4IQA A;  2HRF A;  4ZL8 A;  2G2Q A;  3QCP A;  4KCE A;  1H4O A;  1XWG A;  4PUR A;  2WZ9 A;  5B6N A;  19GS A;  2I4A A;  1TRS A;  2GQM A;  4KH7 A;  2IME A;  5A4V A;  4OCF A;  3FKF A;  1K0C A;  3F63 A;  4RI7 A;  1JZO A;  3VK9 A;  4KSM A;  1T00 A;  4PQI A;  2H70 A;  3P7X A;  5INY A;  1SL0 B;  5DCG A;  1PGT A;  1T1V A;  3ZZX A;  2ZNM A;  4O7H A;  2OBK A;  1EGO A;  2E2M A;  3KH9 A;  4ID0 A;  2WRT A;  1BQ7 A;  3L9U A;  3HD5 A;  1NSW A;  1HYU A;  4HEA 2;  1U88 A;  3QOU A;  3CTF A;  2NVL A;  5KOX A;  1XW6 A;  1PL2 A;  4GRF A;  3L9V A;  3A3T A;  4L5L A;  4GCI A;  3HJM A;  5JCU A;  3M3M A;  1GTI A;  5IOX A;  2F3M A;  3ZIJ A;  3U6V A;  2HXK A;  3OR5 A;  4KA0 A;  4F9Z A;  22GS A;  4PTS A;  4PQH A;  2E2G A;  1V57 A;  1ML6 A;  2TIR A;  4KUN A;  1TK0 B;  1USB A;  1GLP A;  3RPP A;  3ZTL A;  3HXS A;  3N5O A;  3D5J A;  1R7H A;  2CX3 A;  3ZFL A;  4MF7 A;  1M7T A;  4KE3 A;  4G2E A;  4NPB A;  3LXZ A;  5D9W A;  4HSC X;  3WT2 A;  2JL4 A;  3ZVJ A;  2AHE A;  1B9X C;  4ICY A;  2REM A;  3E3E A;  2CZ2 A;  4NWY A;  1SU9 A;  3F6F A;  2VLT A;  1GTU A;  1Z9H A;  2X4A A;  1QFN A;  1B4Q A;  4AF2 A;  2YJ7 A;  1GNE A;  2H75 A;  2VLV A;  2LQO A;  4N30 A;  1FO5 A;  4HS1 A;  2NBS A;  4IP6 A;  4EUY A;  2LJA A;  1OC8 A;  2E7P A;  3Q74 A;  4K0G A;  4KW6 A;  2F8F A;  3DML A;  2FD3 A;  4E8E A;  3A2W A;  3L4N A;  4KDU A;  4POM A;  1OC3 A;  3DVW A;  1Q98 A;  3CSI A;  1FW1 A;  4MJE A;  4I2T A;  3TKS A;  2R37 A;  3MNG A;  4K1F A;  5CAX A;  5B7C A;  1AAZ A;  4F03 A;  1K3O A;  1GSS A;  3C71 A;  2JZR A;  1QQ2 A;  5J41 A;  2JAC A;  2V41 A;  5A5K A;  1MD3 A;  4FYU A;  3FZ4 A;  2QKE A;  4EIP A;  5HR3 A;  3ZFB A;  6GSX A;  2N5A A;  3EUR A;  1T3B A;  2AV4 A;  1ZCP A;  1GH2 A;  3I43 A;  4L0U A;  2FWE A;  3ERW A;  5KOW A;  3DKS A;  4TR0 A;  1XW5 A;  1M99 A;  2HFD A;  2H1A A;  4OD7 A;  2RII A;  1WJK A;  5JWO B;  1JZW A;  1TP9 A;  4HU7 A;  3HVX A;  4MP4 A;  1RW1 A;  3IHQ A;  9GSS A;  3UAP A;  1R4W A;  2IFQ A;  4HU9 A;  2I3Y A;  2PPT A;  2R0P A;  3EE2 A;  1ZZY A;  4V2N A;  3D22 A;  2CT6 A;  3EMX A;  1ACV A;  5IQY A;  3DIE A;  3BOA A;  5LD0 A;  4L5O A;  1PN9 A;  4K2X A;  4BVY A;  3CQF A;  1U3A A;  4JBB A;  2O7K A;  2DKH A;  4WET A;  2DJ0 A;  2DJ2 A;  4KF9 A;  2L57 A;  4N10 A;  2X8C A;  3MAK A;  2CAI A;  2JSZ A;  4GXZ A;  6GSY A;  4IP1 A;  4USS A;  4IHU A;  4MCU A;  1IYH A;  4RQX A; 
#chains in the Genus database with same CATH homology
 4POB A;  1O7U A;  3ZIV A;  5HR0 A;  2GST A;  3LGC A;  2DJJ A;  5ECR B;  3CMI A;  1TJD A;  4WF5 A;  1XFL A;  3FR6 A;  3KGK A;  2VL3 A;  5ECM B;  3K8N A;  4N0V A;  2QGV A;  2K8S A;  4MZW A;  3F9U A;  2B7K A;  3ERG A;  4MJC A;  1NW2 A;  3GTU B;  3TKR A;  5IMV A;  2QA1 A;  4TKY A;  4BWQ A;  3EC3 A;  4O92 A;  1A8L A;  3FW2 A;  2HRN A;  3EPT A;  4K5S A;  4P3Y B;  2VL2 A;  3RHC A;  2E0Q A;  2HE3 A;  4RI6 A;  1QGV A;  1GTA A;  4Q5F A;  4ZB6 A;  3GIX A;  3GV1 A;  3CYN A;  4ML1 A;  1YKA A;  18GS A;  1ERU A;  1A8Y A;  1TU8 A;  3AY8 A;  2KLX A;  1H75 A;  1EV4 A;  2DIZ A;  8GSS A;  3TRP A;  3UBL A;  2J23 A;  4KAE A;  1MD4 A;  4ZIL A;  3TKQ A;  4ECB A;  5B8B A;  5A4U A;  3QFA C;  1V40 A;  1W4V A;  1GSU A;  1DSB A;  5BRT A;  1SJZ A;  3GA4 A;  3C7M A;  3A5I A;  5DJM A;  5J5N A;  2GSS A;  2QSI A;  3F3Q A;  2HZF A;  2YZU A;  4TXO B;  4OO5 A;  4YQU A;  3IR4 A;  2A2R A;  2MZC A;  5CNW A;  3EMP A;  4MF6 A;  2LRC A;  1DUG A;  3HHV A;  1TXX A;  3HY2 A;  3KCM A;  2FA8 A;  1GUH A;  3LYK A;  1XVW A;  2YJH A;  1J0F A;  3IPZ A;  3M9J A;  4I5Q A;  4FIW A;  3C8E A;  2V6O A;  4XRD A;  2AAW A;  5H5S A;  1XOA A;  2B6M A;  4BVX B;  4IVF A;  1HNC A;  4EKZ A;  3O76 A;  3D4M A;  3MIX A;  5AIV A;  1ZL9 A;  5J9C A;  5CP1 A;  1GSY A;  1HNA A;  4CY8 A;  3US3 A;  5D9X A;  4ILF A;  4JRR A;  3GUS A;  5IOW A;  1GSF A;  3IV4 A;  5F06 A;  5DAL B;  3UOM A;  3KD0 A;  4AJ7 A;  5G2Z A;  1GWC A;  5AGY A;  2YN1 A;  4JZQ A;  4CDO A;  1EZK A;  2LJK A;  1GTB A;  1MDK A;  2GGT A;  3D21 A;  4X0X A;  17GS A;  3LXT A;  4HDE A;  3UBK A;  4ZBD A;  3ZLP A;  4ISD A;  5ECI B;  5LCZ A;  3F4R A;  1ZMA A;  4V2L A;  1BYE A;  4A5P A;  1VF2 A;  1YZX A;  3W6G A;  4Z2U A;  2ALB A;  3TJK A;  2YV7 A;  3H4K A;  4E8H A;  4OFT A;  2DJ3 A;  5ID2 B;  1PRX A;  2L59 A;  3ZML A;  1ERV A;  3FEU A;  1TOF A;  2JU5 A;  4HUA A;  4PXO A;  3UL3 A;  4IGJ A;  2CZ3 A;  5AN1 A;  4GST A;  1BJX A;  3BD2 A;  4MJA A;  2TRC P;  2R3X A;  3PIN A;  4EC0 A;  2JSY A;  1B9Y C;  4MA9 A;  4NHW A;  1TK8 B;  1XW9 A;  4XS6 A;  1ILO A;  1Z3E A;  3GX8 A;  4LLR A;  1UA5 A;  1YDK A;  3KIJ A;  1TRV A;  1AUC A;  5EY6 A;  3EVI A;  3M1G A;  5C04 A;  2P5Q A;  2LUS A;  2WGR A;  1K0N A;  5F8B A;  4I8B A;  2MMZ A;  4XHM A;  2LJR A;  4NAX A;  2VLU A;  1KTE A;  2GLR A;  1VF3 A;  1EEM A;  1S3A A;  2VL2 C;  4FH8 A;  1SJI A;  2Z9S A;  2J9H A;  4TXV A;  3QPM A;  2H1G A;  1PQN A;  1X5D A;  4OCE A;  3LJR A;  1X0R A;  11GS A;  2YNX A;  1SL1 B;  3L9S A;  4TOP A;  3WGD A;  3FZA A;  2AB6 A;  2GZZ A;  4MPG A;  2QC7 A;  1OE8 A;  2H0H A;  1M9B A;  1JZR A;  1WMJ A;  3ZMK A;  2DIY A;  2QA2 A;  2LNS A;  1JHB A;  3H8Q A;  1QUW A;  3ME8 A;  14GS A;  1SK1 A;  2DJK A;  2JZT A;  2V1M A;  7GSS A;  4GLT A;  4EIQ A;  4O5Q A;  1YJ6 A;  1V2A A;  1E2Y A;  3LQ7 A;  5HFG A;  4ZB9 A;  1FAA A;  2A2S A;  2H74 A;  2PGT A;  4NMU A;  2HSM A;  3DYR A;  2GDR A;  4CW9 A;  2X8H A;  2VL9 A;  1ST9 A;  2K8V A;  5ECN B;  1JLV A;  2XBI A;  3DGQ A;  5HQP A;  3HJO A;  2C0D A;  4IW9 A;  3ZVJ D;  2ZCT A;  3CSJ A;  2HRA A;  1EP8 A;  4YQM A;  3GTU A;  1CQH A;  1VF1 A;  4LMV A;  2HLS A;  2GSQ A;  5DJL A;  2CX4 A;  4MJB A;  3HCZ A;  4OMV A;  4MAB A;  5FT3 A;  1OYJ A;  2H76 A;  2YWI A;  2HI7 A;  1K0B A;  5IPH A;  5ECQ B;  1WE0 A;  2I9H A;  2YCD A;  5G1L A;  4KND A;  1N2A A;  3CBU A;  3ZRD A;  2PBJ A;  3NIV A;  1A0F A;  2VAF A;  4MH2 A;  5IPG A;  3UEM A;  2H6Z A;  2UZ8 A;  3L0H A;  3DEX A;  3KM6 A;  4TXO A;  2F9S A;  5F07 A;  3ME7 A;  1V58 A;  3EU3 A;  2CVK A;  3ZL5 A;  4V1A p;  2MYG A;  4O5U A;  2H01 A;  2IMF A;  2M72 A;  3GFK A;  4ML6 A;  2KHP A;  5G5E A;  4YH2 A;  4QL9 A;  1Z6M A;  2HYX A;  4WEY A;  1J9B A;  4G9H A;  3EU4 A;  1XCC A;  4BVX A;  1URM A;  2RUF A;  2DJ1 A;  3EIN A;  4WXT A;  4OWY A;  2H0G A;  2K6V A;  2NDO A;  3HYP A;  5IMA A;  4MF5 A;  1TI3 A;  1PKZ A;  3R2Q A;  5CRG A;  5DAL A;  3TGZ A;  4DSS B;  3LSZ A;  1X9W B;  3FZ9 A;  2GS3 A;  3ED3 A;  1THO A;  4EO3 A;  1YF0 A;  2VUP A;  1TK5 B;  2JAD A;  3GL5 A;  1ZOF A;  1PX6 A;  3HVS A;  4KCA A;  1M2D A;  4QQ7 A;  2LRT A;  5IO2 A;  2CAQ A;  1EOH A;  1PSQ A;  3VWW A;  2B1K A;  3LEF A;  2YWM A;  1ZYE A;  1HD2 A;  1OAZ A;  4RQR A;  3H79 A;  5J3R A;  4X4J A;  4IKH A;  1I5G A;  5GST A;  3QAG A;  2WCI A;  5ID2 A;  5JCG A;  1T8E B;  1K0O A;  1TTZ A;  3ZRE A;  3GX0 A;  2B5X A;  4IS0 A;  2WS2 A;  3LW9 A;  1SD8 A;  3A2V A;  1R5P A;  2HZE A;  3MWH A;  1O81 A;  4LL1 B;  5DQY A;  4IN0 A;  5ELG A;  1AC1 A;  1I9D A;  3TJB A;  1EWX A;  2P31 A;  2EIO A;  3C1R A;  2B1L A;  2XPE A;  4XRA A;  2X8G A;  1MDJ A;  4G19 A;  1XXU A;  2YAN A;  10GS A;  3DD3 A;  1G6W A;  4IBP A;  3JCM L;  5H5Q A;  3FMW A;  3RAZ A;  1F9M A;  3CRT A;  5DAK B;  2B5E A;  4XS4 B;  2EIQ A;  5EL8 A;  1FVJ A;  3QAW A;  5E59 A;  4Q5N A;  4J2F A;  4HJ2 A;  4AJ6 A;  1QK8 A;  1T7P B;  5DVB A;  3IDV A;  5DDL A;  2TRX A;  4PQ1 A;  2G0F A;  1AQW A;  3WYW A;  5J9B A;  3A2X A;  4EVM A;  1OVN A;  4MNN A;  5CRE A;  5ECS A;  3E9J B;  4QL7 A;  2RUE A;  5COH A;  3G7I A;  4OFN A;  3FR9 A;  2H72 A;  2XHF A;  4K7N A;  12GS A;  2LV3 A;  3VPQ A;  5LNK e;  1CQG A;  4BPY A;  1AXD A;  4KB3 A;  5AIS A;  1SKS B;  5DBQ A;  4O32 A;  2H30 A;  5CRH A;  1AQV A;  1ZYQ B;  3UAR A;  4KX4 A;  1JFU A;  4WF4 A;  1UN2 A;  5B6M A;  4TN8 A;  2A4V A;  2L6C A;  2VO4 A;  4L8E A;  1ERT A;  2FGX A;  2CVD A;  4D73 B;  4F2I A;  3ISO A;  5J4U A;  2AUV A;  1FHE A;  4MK3 A;  4POK A;  1U87 A;  4XTS A;  2VCW A;  4GTU A;  4RUV A;  5FHI A;  3F4S A;  2K9F A;  1V9W A;  4IQ1 A;  4K0N A;  3TRX A;  1RQM A;  1XPV A;  2YWN A;  5ELA A;  5D73 A;  3D0Z A;  2DBC A;  1YQ1 A;  1GL8 A;  1Y6E A;  3HZ4 A;  4TVE A;  2HRK A;  1JLW A;  3TB2 A;  1B48 A;  4PX1 A;  2C0G A;  2H66 A;  3H1N A;  4K7O A;  4Z2R A;  1TKD B;  5D9T A;  1HQO A;  3BCI A;  1TDI A;  3EYT A;  1EP7 A;  1SEN A;  5IMF A;  2R4V A;  4X1U A;  2P5R A;  1PA3 A;  3M9K A;  5CRD A;  2RM6 A;  3GYK A;  2OAC A;  3HA9 A;  2D2Z A;  3QR6 A;  1WP0 A;  1S3D A;  1G6Y A;  3QD9 A;  4XIH A;  3VUR A;  3FK8 A;  5DQS A;  3WGX A;  4LA1 A;  1C72 A;  4EF0 A;  3KJY A;  3IK7 A;  2N5B A;  2GQK A;  2B7J A;  2LEG A;  5HFK A;  3HVV A;  3TKS C;  3Q19 A;  4EXJ A;  2WB9 A;  4ULX A;  2HSH A;  1YEP A;  1UVZ A;  2IWT A;  3KMO A;  1AW9 A;  3F0I A;  3UVH A;  2IL3 A;  4N0Z A;  1WPI A;  3H93 A;  2PER A;  2DKI A;  1Z5Y E;  2A4H A;  4KDX A;  2MMO A;  1PX7 A;  5ECP B;  3DXB A;  2YWO A;  2HNL A;  3VI7 A;  2FWH A;  4DSS A;  1PL1 A;  5ECK B;  2O87 A;  3U5R E;  4YKG A;  2XBQ A;  4YAP A;  1SKR B;  1SK2 A;  3A5W A;  4GSN A;  3WD6 A;  1OKT A;  4K7I A;  2NPB A;  2MBS A;  3I69 A;  3GKN A;  5L71 A;  4GQC A;  4AJ8 A;  2H8L A;  3IBH A;  4TR3 A;  4ZL7 A;  4Q5R A;  4K6X A;  4NV5 A;  2I81 A;  2AJQ B;  3MDK A;  2L4C A;  1GP1 A;  1BED A;  3IAM 2;  4ECJ A;  5KN2 A;  4DSQ A;  1VGL A;  4JED A;  1M9A A;  5D96 A;  3SWL A;  2PUK C;  2L5L A;  1B8X A;  3BBY A;  4GSS A;  1A2L A;  1TU7 A;  4KSO A;  1XWK A;  3QAV A;  2PVQ A;  5BMU A;  2O89 A;  3VLN A;  2WUL A;  1SJ6 A;  1THX A;  3TCO A;  4JE1 A;  5F05 A;  1F37 A;  2LKU A;  1UC7 A;  2FWF A;  1JZD A;  4PUF C;  2C4J A;  2GQL A;  3P90 A;  4J56 E;  1BX9 A;  4G10 A;  4OO4 A;  2FCH A;  3GKX A;  1QMV A;  5DAK A;  4XS4 A;  3QDN A;  2DLX A;  2H6Y A;  3KTB A;  4Q5Q A;  4WBR D;  1EEJ A;  5IMC A;  1X9M B;  2R2J A;  5CYY A;  4ZXG A;  5GAN D;  3KZQ A;  3LWA A;  1XIY A;  1WOU A;  3F6D A;  2XC2 A;  1OE7 A;  3RDW A;  4MMM A;  4BL7 B;  2VD0 A;  4G0K A;  5ABR A;  4I6X A;  2GVP A;  2KUC A;  2KOK A;  4IJI A;  2LST A;  3VFI A;  1GRX A;  2DC5 A;  3IRA A;  1N8J A;  3TUE A;  4ZL9 A;  3V1W A;  2BTO T;  1F3B A;  1KNG A;  4GQF A;  2FY6 A;  4MZB A;  4IJ3 A;  3FRC A;  1GUL A;  2WJU A;  1F3A A;  4KGI A;  3FZ5 A;  4DSR A;  2X99 A;  2C80 A;  3KH7 A;  1K3L A;  2IIY A;  1PMT A;  2DML A;  2VOC A;  2FWG A;  1YY7 A;  4JU5 A;  3UJ1 A;  1O85 A;  4D73 A;  2VCV A;  1LBK A;  3S9F A;  1A23 A;  3IE3 A;  2YV9 A;  1O8W A;  4F0B A;  5G5F A;  3IA1 A;  4JR6 A;  3M8N A;  4Z2T A;  4TR1 B;  2PU9 C;  5GAP D;  5CO3 A;  4FYC A;  2EIR A;  4KDY A;  1ZGN A;  2H0I A;  5G1K A;  1F6M C;  4TW5 A;  4I97 A;  2VM2 A;  1T4Y A;  3L78 A;  2CA8 A;  1WWJ A;  1FB0 A;  6GSS A;  2F8A A;  3RBT A;  5EPF A;  2OA7 A;  1VF4 A;  2LNT A;  4POL A;  1O73 A;  3N9J A;  2V6K A;  2H71 A;  1F2E A;  1G7O A;  1M2A A;  2ON5 A;  2IJY A;  3PPU A;  3W8J A;  5KN3 A;  2KP2 A;  2ZUP A;  1PKW A;  3NOF A;  2O85 A;  2F51 A;  2PMT A;  2FLS A;  2B3S A;  3R3E A;  1FG4 A;  4WR5 A;  2L4Q A;  3D4T A;  5JCW A;  1XOB A;  1Q4J A;  5H5R A;  4G0I A;  3GST A;  4X43 A;  3TJJ A;  4GWR A;  1OKD A;  2VM1 A;  5GSS A;  3HJP A;  1XWA A;  1ZYP A;  1EOG A;  1MEK A;  3HZ8 A;  3GH6 A;  2IMD A;  2VCT A;  4N11 A;  4EL1 A;  1SYR A;  4NXI A;  1XVQ A;  4DEJ A;  5IM9 A;  3CRU A;  2GZY A;  3KXO A;  4XCS A;  1OC9 B;  1O6J A;  3IC8 A;  3NZN A;  4ECC A;  5ENU A;  1X5E A;  4MZC A;  5ECH B;  1NM3 A;  3VWX A;  1R26 A;  3KP8 A;  4ZBB A;  1BG5 A;  1A2M A;  2ES7 A;  2GTU A;  5DCH A;  4HJM A;  1DE2 A;  3E0U A;  3CXG A;  2V32 A;  2PVO C;  3GSS A;  1TRW A;  1KBN A;  3FY7 A;  2M46 A;  3DRN A;  3PH9 A;  1YKC A;  5JWR B;  2LQQ A;  2VCX A;  1S3C A;  1ERW A;  1K0M A;  2WFC A;  1U3I A;  2VCQ A;  5JWQ B;  2BJX A;  2DSA A;  3TDG A;  5ECL B;  3KP9 A;  1M2B A;  2OBI A;  1SK0 A;  2R0C A;  3O6T A;  4K9Z A;  4YAV A;  1G0T A;  2RLI A;  4WR4 A;  2VD1 A;  5D8I A;  5D93 A;  4HOJ A;  4DVC A;  1LU4 A;  2C0F A;  3J7Y k;  3WT1 A;  3ERF A;  2N5F A;  1WRY A;  3DWV A;  4GF0 A;  4TRX A;  3TKS E;  1GNW A;  1ABA A;  2IN3 A;  2EC4 A;  4FO5 A;  1YF1 A;  1AQX A;  4AGS A;  4ACS A;  4CY6 A;  4TR4 A;  1ON4 A;  4WBJ A;  3SBC A;  1U6T A;  1V98 A;  4OFM A;  2VIM A;  4L0W A;  2NTO A;  16GS A;  3GNJ A;  3J7Y b;  1A24 A;  4F0C A;  5G31 A;  3BJ5 A;  1K3Y A;  2C3T A;  2C0E A;  3GMF A;  2O8V B;  5EVO A;  1K0D A;  4EDY A;  2ON7 A;  5E4W A;  3VWV A;  5KN1 A;  3D6I A;  4O5R A;  3UVT A;  4JR4 A;  1ZYN A;  4YKF A;  4PNG A;  1WIK A;  2GT6 A;  3HKR A;  3QMX A;  3P2A A;  1SYX A;  1J08 A;  1TRU A;  3GHA A;  4FQU A;  5C00 A;  5GZZ B;  1DE1 A;  2H6X A;  3APO A;  4EDZ A;  1IYI A;  3KMN A;  3Q6O A;  4YQV A;  1PN0 A;  1Y25 A;  4MDC A;  2WDU A;  3G7J A;  5D9V A;  3G9B A;  3TOT A;  2H1D A;  3LYP A;  3BCK A;  4BL7 A;  2PN8 A;  1SL2 B;  2C3N A;  1NHO A;  2I1U A;  3IHG A;  3HDC A;  1B4P A;  3C1S A;  4ZBA A;  3VI5 A;  1A0R P;  2MMN A;  1GLQ A;  2HT9 A;  5KEJ A;  3Q18 A;  1PD2 1;  4PUA A;  2M80 A;  1EGR A;  1MTC A;  5HFI A;  6GSV A;  4H86 A;  1FB6 A;  1KEB A;  3W8S A;  1HNB A;  1SKW B;  1W89 A;  1TI1 A;  4MH3 A;  4BA7 A;  4ZIJ A;  3TJF A;  1XWB A;  2R0G A;  1AIU A;  3M0F A;  3GL3 A;  3FR3 A;  3FHK A;  4XS1 A;  1X5C A;  4IEL A;  2HSY A;  3GH9 A;  3CSH A;  4MLY A;  3IOS A;  1XBS A;  2CQ9 A;  5HR1 A;  5A4W A;  1M0U A;  2K18 A;  3GKK A;  4TR1 A;  3LOR A;  3PGT A;  13GS A;  2RM5 A;  2GZP A;  4LMW A;  4K5R A;  2MMA A;  3TOU A;  2GT5 A;  3WGE A;  5FWG A;  5IMD A;  2X64 A;  3GKM A;  4MPF A;  3O3T A;  3VPT A;  6GST A;  2OE0 A;  4K2D A;  2C8U A;  3P8W A;  3C73 A;  1R5A A;  2P0G A;  3LG6 A;  3KTL A;  3UIW A;  3MYD A;  2IMK A;  4PNF A;  1X9S B;  3RPN A;  1YEX A;  4FYB A;  1GUK A;  2FA4 A;  1SD9 A;  2C3Q A;  3F8U A;  1EV9 A;  3IAS 2;  2A2P A;  4HI7 A;  1K0A A;  4WKW A;  5KN0 A;  4ECI A;  3PR8 A;  1FVK A;  1Z7R A;  3ZYW A;  2YP6 A;  4HQZ A;  1VRS D;  1XWC A;  2H1B A;  1GSE A;  3IXR A;  1LJR A;  1GSD A;  2OKA A;  2C1Y A;  2LTK A;  1OC9 A;  4PGT A;  3VWU A;  2OE1 A;  4HZ4 A;  3GUR A;  2R5G A;  1MDI A;  1E6B A;  2GSR A;  3APQ A;  1DBY A;  4LL4 B;  5IMZ A;  1FOV A;  2OJL A;  5CRW A;  2CVB A;  4EE0 A;  2X49 A;  5HR2 A;  2DMM A;  2V2G A;  1Z7P A;  4V2M A;  3F3R A;  3DVX A;  2L6D A;  1A2J A;  5G30 A;  1GSQ A;  1G7E A;  3EWL A;  2OAD A;  4HQS A;  2FNO A;  3I9V 2;  2KP1 A;  3MSZ A;  4F82 A;  1GUM A;  3GRX A;  2YPM A;  4BWS A;  4K8M A;  2HZE B;  4I2U A;  3F4T A;  2BMX A;  2B5Y A;  3TKP A;  3LFL A;  5IO0 A;  2VCZ A;  2OE3 A;  4NV2 A;  3APS A;  4V1A g;  3RHB A;  3QFB C;  2LS5 A;  2MBT A;  6GSW A;  3FYG A;  2YOI A;  20GS A;  6GSU A;  4ZB8 A;  1BAY A;  1NHY A;  2CV4 A;  5IIZ A;  2FHE A;  2L5O A;  3KEB A;  5B8A A;  3I6A A;  2IFQ B;  3GN3 A;  2AYT A;  2PWJ A;  2H19 A;  2YZH A;  4NHZ A;  2XPD A;  1RK4 A;  1TW9 A;  5ECO B;  4J57 E;  4Z7X A;  4BVY B;  5AIX A;  1Z6N A;  3TJG A;  3ZIT A;  2FUG 2;  1XZO A;  2JZS A;  3CTG A;  1T4Z A;  3IK9 A;  1O8X A;  2R6K A;  3G7Y A;  5F0G A;  3TRQ A;  4G0L A;  3IC4 A;  2IPA A;  2LRN A;  4HZ2 A;  1FOH A;  2IMI A;  1QXH A;  3UMA A;  2H73 A;  4CHS A;  4IQA A;  2HRF A;  4ZL8 A;  2G2Q A;  3QCP A;  4KCE A;  1H4O A;  1XWG A;  4PUR A;  2WZ9 A;  5B6N A;  19GS A;  2I4A A;  1TRS A;  2GQM A;  4KH7 A;  2IME A;  5A4V A;  4OCF A;  3FKF A;  1K0C A;  3F63 A;  4RI7 A;  1JZO A;  3VK9 A;  4KSM A;  1T00 A;  4PQI A;  2H70 A;  3P7X A;  5INY A;  1SL0 B;  5DCG A;  1PGT A;  1T1V A;  3ZZX A;  2ZNM A;  4O7H A;  2OBK A;  1EGO A;  2E2M A;  3KH9 A;  4ID0 A;  2WRT A;  1BQ7 A;  3L9U A;  3HD5 A;  1NSW A;  1HYU A;  4HEA 2;  1U88 A;  3QOU A;  3CTF A;  2NVL A;  5KOX A;  1XW6 A;  1PL2 A;  4GRF A;  3L9V A;  3A3T A;  4L5L A;  4GCI A;  3HJM A;  5JCU A;  3M3M A;  1GTI A;  5IOX A;  2F3M A;  3ZIJ A;  3U6V A;  2HXK A;  3OR5 A;  4KA0 A;  4F9Z A;  22GS A;  4PTS A;  4PQH A;  2E2G A;  1V57 A;  1ML6 A;  2TIR A;  4KUN A;  1TK0 B;  1USB A;  1GLP A;  3RPP A;  3ZTL A;  3HXS A;  3N5O A;  3D5J A;  1R7H A;  2CX3 A;  3ZFL A;  4MF7 A;  1M7T A;  4KE3 A;  4G2E A;  4NPB A;  3LXZ A;  5D9W A;  3WT2 A;  2JL4 A;  3ZVJ A;  2AHE A;  1B9X C;  4ICY A;  2REM A;  3E3E A;  2CZ2 A;  4NWY A;  1SU9 A;  3F6F A;  2VLT A;  1GTU A;  1Z9H A;  2X4A A;  1QFN A;  1B4Q A;  4AF2 A;  2YJ7 A;  1GNE A;  2H75 A;  2VLV A;  2LQO A;  4N30 A;  1FO5 A;  4HS1 A;  2NBS A;  4IP6 A;  4EUY A;  2LJA A;  1OC8 A;  2E7P A;  3Q74 A;  4K0G A;  4KW6 A;  2F8F A;  3DML A;  2FD3 A;  4E8E A;  3A2W A;  3L4N A;  4KDU A;  4POM A;  1OC3 A;  3DVW A;  1Q98 A;  3CSI A;  1FW1 A;  4MJE A;  4I2T A;  3TKS A;  2R37 A;  3MNG A;  4K1F A;  5CAX A;  5B7C A;  1AAZ A;  4F03 A;  1K3O A;  1GSS A;  3C71 A;  2JZR A;  1QQ2 A;  5J41 A;  2JAC A;  2V41 A;  5A5K A;  1MD3 A;  4FYU A;  3FZ4 A;  2QKE A;  4EIP A;  5HR3 A;  3ZFB A;  6GSX A;  2N5A A;  3EUR A;  1T3B A;  2AV4 A;  1ZCP A;  1GH2 A;  3I43 A;  4L0U A;  2FWE A;  3ERW A;  5KOW A;  3DKS A;  4TR0 A;  1XW5 A;  1M99 A;  2HFD A;  2H1A A;  4OD7 A;  2RII A;  1WJK A;  5JWO B;  1JZW A;  1TP9 A;  4HU7 A;  3HVX A;  4MP4 A;  1RW1 A;  3IHQ A;  9GSS A;  3UAP A;  1R4W A;  2IFQ A;  4HU9 A;  2I3Y A;  2PPT A;  2R0P A;  3EE2 A;  1ZZY A;  4V2N A;  3D22 A;  2CT6 A;  3EMX A;  1ACV A;  5IQY A;  3DIE A;  3BOA A;  5LD0 A;  4L5O A;  1PN9 A;  4K2X A;  4BVY A;  1U3A A;  4JBB A;  2O7K A;  2DKH A;  4WET A;  2DJ0 A;  2DJ2 A;  4KF9 A;  2L57 A;  4N10 A;  2X8C A;  3MAK A;  2CAI A;  2JSZ A;  4GXZ A;  6GSY A;  4IP1 A;  4USS A;  4IHU A;  4MCU A;  1IYH A;  4RQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...