5COHA

Crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans crystallized in presence of beta-mercaptoethanol
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
231
structure length
231
Chain Sequence
SEKIRVDIWSDIACPWCYIGKRRFESALGQFPQRDQVEVVWHSFELDPSARPLNPIAMRDGLAMKYSISPAQAQGSLDHMTQTAAQEGLEYHFDRVKLANTFLAHQLIHYAAEQGQGDAMKERLLRAYMSEGQNVNDLDTLQKLAAEVGLDAGAARAALEAGTYAQAVRYDEAQAQQLGITGVPFFVLGGKYGVSGAQAPETLLGALSQVWAEQHPAPLTMLGQDAPAEGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FrnE protein
publication title drFrnE Represents a Hitherto Unknown Class of Eubacterial Cytoplasmic Disulfide Oxido-Reductases.
pubmed doi rcsb
source organism Deinococcus radiodurans (strain atcc 13939 / dsm 20539 / jcm 16871 / lmg 4051 /
molecule tags Oxidoreductase
total genus 88
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2015-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5cohA01
2P5QA 1K3YA 3DXBA 5COHA 3WYWA 5E4WA 5J9CA 1TRVA 3UIWA 1OKDA 3H8QA 2FNOA 1ML6A 4AGSA 2MMAA 2WDUA 2VUPA 5ECPB 4AF2A 3ZRDA 3H79A 2R6KA 3CSJA 1XXUA 2NBSA 3L9SA 3K8NA 1SL1B 2L4QA 5DVBA 4AJ7A 4MPFA 2L59A 4FO5A 4IKHA 4L8EA 4K0NA 4I5QA 3KZQA 4XS1A 4XS4A 3ZMKA 3MDKA 4GQCA 1G0TA 1YQ1A 4F82A 3LYKA 4LA1A 1K0DA 4EDYA 3BCIA 4MA9A 1SL0B 2L57A 1JZDA 7GSSA 2C0GA 3DIEA 2LV3A 3BD2A 2TIRA 2KUCA 3CSHA 2C8UA 5D8IA 3RHBA 2DLXA 9GSSA 4KE3A 4DSRA 4RI6A 2GQMA 3LORA 2RM6A 3TJJA 4EVMA 3G9BA 4XS4B 1HNCA 1AUCA 2H1GA 2O87A 1NSWA 5IPHA 1EP8A 5DBQA 1XVQA 1O8XA 2YANA 3IPZA 4HU7A 2DC5A 1K0MA 2GZZA 4QQ7A 2HE3A 1G7OA 1IYHA 3U5RE 3QAWA 2C3QA 3GMFA 1ERUA 1SKSB 3KD0A 1W4VA 4TKYA 3ZVJD 2H6YA 4MF7A 2GZPA 4HZ4A 1GSYA 3F4RA 4IELA 3M0FA 1GSUA 2AB6A 3A2XA 1DE1A 1OVNA 4NHWA 1WJKA 3FZ9A 3LFLA 2J9HA 3O76A 1QGVA 5GSTA 4MJBA 1AAZA 1BJXA 4GRFA 4HU9A 1V40A 6GSVA 1B9XC 2L5LA 4TR3A 2DMMA 1K0OA 4ULXA 4PGTA 4OMVA 2IMIA 5A4UA 2HSYA 3WD6A 4MH2A 5F06A 2H8LA 2CAQA 1O7UA 5AIXA 1QMVA 5HFKA 4MJEA 1ERWA 4TXOA 5LCZA 4PURA 1QQ2A 1O6JA 4JR4A 2N5AA 2N5BA 3TKSC 3KIJA 4ECIA 4H86A 3RPPA 2JADA 5H5RA 2B1KA 2LS5A 1SJ6A 4BWSA 2FA4A 6GSSA 4ZB9A 1MDKA 4RQXA 2LRCA 5DQSA 2LQOA 1V98A 2YV9A 2H72A 1X5DA 5HR2A 3IC4A 4BVXA 5A4VA 1O85A 1URMA 3ERGA 2YZUA 5G5EA 2ALBA 3LEFA 1T8EB 5FT3A 1EV9A 3TJFA 1TKDB 4I2UA 3GKMA 3VLNA 4JU5A 3GIXA 4OD7A 3TCOA 5IOXA 2MZCA 3TKSA 1ST9A 3CRTA 1J0FA 3W8JA 2X8GA 3HY2A 3HZ4A 3HDCA 5J9BA 1BYEA 3F9UA 1U3AA 3L9VA 3GN3A 3L0HA 4K8MA 2MYGA 1EOHA 4PX1A 3VWVA 3A3TA 3NZNA 4O7HA 2OBKA 4BA7A 2BJXA 5FHIA 5G1KA 3IDVA 3EMXA 4KSOA 1GH2A 4DSSB 2KP1A 2E0QA 4BPYA 2F3MA 4MDCA 4GF0A 5IMVA 1OC9B 2LRNA 2VLTA 4MZBA 2MMNA 1OC3A 4MF6A 5ID2A 5JCWA 5ENUA 3KTLA 2WGRA 5DALA 2ZNMA 2VLUA 1W89A 2LJKA 4NV2A 1JLWA 2VL3A 2HZFA 1K3LA 4K9ZA 4L0UA 1GRXA 4XHMA 2HFDA 1EOGA 3CYNA 1ZMAA 1EWXA 3EWLA 5ELGA 1ZYQB 1XIYA 6GSYA 5D93A 2QKEA 5EL8A 3D5JA 3QPMA 4NPBA 4J57E 1X0RA 2QC7A 3VURA 2B5YA 3KH9A 3HHVA 1A8YA 1YEXA 3DVXA 1JHBA 2H30A 2EC4A 1TDIA 1Z3EA 2QGVA 22GSA 2K9FA 5D9XA 3EURA 3EVIA 2XPEA 2MBSA 4ECCA 3G7JA 1F3BA 3F63A 1XWCA 5ECSA 3UVHA 3EYTA 1Q98A 1T4ZA 1PMTA 5FWGA 3WGEA 4ID0A 5G1LA 1Z7PA 1N8JA 4LL1B 2FA8A 1BEDA 6GSWA 3LYPA 2L5OA 3TUEA 4KDUA 2REMA 3U6VA 1VF4A 2EIRA 4KAEA 2H76A 6GSTA 5B7CA 4YH2A 3CXGA 3AY8A 4IQ1A 1EGOA 1BQ7A 1OE7A 2RLIA 4Q5NA 1DUGA 2VM2A 4POLA 2DJ1A 2WULA 2VCVA 3HVSA 1PRXA 3NOFA 5AGYA 4KH7A 1BAYA 3M3MA 2K8VA 4PQIA 3APQA 1YDKA 3S9FA 3FZ4A 4Q5RA 3H4KA 2OJLA 3QAVA 3LJRA 4D73A 2F9SA 4NV5A 3O3TA 4GLTA 1Z6NA 4LL4B 2IMKA 3UMAA 1V58A 3ISOA 3ERWA 1KEBA 4WR5A 3WT2A 3F6DA 1VF1A 3L4NA 4IGJA 3IHQA 4POKA 1GSSA 4KDXA 1U88A 1Y25A 2RUEA 4NXIA 4XTSA 19GSA 1Z9HA 2DJ3A 4V1Ag 4RI7A 2HLSA 3TJKA 4KCEA 1ZCPA 4GSNA 1F37A 2X64A 2NTOA 3TJBA 4G9HA 2IN3A 2ON7A 1U3IA 3IE3A 3PR8A 4WR4A 2WS2A 2HI7A 1U6TA 2HRNA 4KUNA 4XIHA 4F2IA 1E6BA 1NM3A 1K3OA 4QL9A 3UAPA 1WIKA 1S3AA 1H75A 2WCIA 5J5NA 2LRTA 2JZSA 1G7EA 2AV4A 1TRSA 1VRSD 2HRFA 4EO3A 4ZBAA 1SK2A 2DIZA 1XCCA 1WPIA 4YAVA 1XWBA 2DBCA 2B3SA 5C00A 2VCXA 1CQHA 3MNGA 5JCUA 1PX6A 4ZIJA 4I6XA 2XHFA 2M72A 18GSA 1AXDA 5IMZA 5D9TA 3F3RA 4I8BA 5A5KA 3IRAA 12GSA 3PINA 1T7PB 2V41A 2HNLA 5DAKA 3FR3A 1MTCA 2GSQA 4TR1A 3RAZA 1TRUA 2VAFA 2IPAA 2LNTA 1S3DA 3GL5A 5J41A 1DE2A 3EE2A 5IQYA 3FR6A 1AC1A 5HFIA 3RDWA 4KDYA 4TVEA 1B9YC 1USBA 4NHZA 1B48A 4POMA 2L6CA 2GTUA 4ZB6A 5KN2A 4ML1A 2H6ZA 2P31A 2O8VB 3P7XA 4MJCA 3BOAA 3OR5A 2C1YA 4EL1A 3HZ8A 1X5EA 2PUKC 4PNGA 5GZZB 4HZ2A 1XPVA 1EP7A 1THXA 3FW2A 1T4YA 2F51A 3GKNA 4GWRA 3GUSA 3C7MA 4ZL7A 4XRDA 4N11A 4L5OA 1GL8A 3Q6OA 1F6MC 4GCIA 4HEA2 4Z7XA 3DKSA 3DEXA 3HVVA 3VPTA 1FW1A 3HVXA 2CZ2A 2C80A 2E2MA 4OO5A 5LNKe 4KGIA 2PERA 5G2ZA 5HR0A 3E9JB 4MMMA 4I97A 2FWHA 5ABRA 2I9HA 2C0FA 1X9WB 4TXVA 1ZGNA 4X0XA 3IR4A 1TK0B 4WF5A 4F03A 1TTZA 2IWTA 5G31A 4HUAA 1R5AA 5JWQB 2IIYA 3ZITA 1OC8A 2E7PA 3RPNA 5B8AA 4ISDA 1FO5A 3TRQA 2YOIA 4MZWA 1HQOA 3VPQA 1MDIA 2MMZA 1ON4A 5CYYA 2VCTA 2WB9A 2X8CA 1KTEA 1M7TA 2GSTA 4PXOA 2IMEA 3PH9A 3BJ5A 1JZRA 1RK4A 3VI7A 2B7JA 2H74A 3LXZA 1A8LA 3HCZA 1TW9A 2LEGA 1R26A 3HKRA 1HD2A 3A2WA 4IS0A 3UARA 5J4UA 3F4SA 5D96A 3M8NA 3M9KA 5ECHB 4MPGA 5F8BA 2RM5A 2KOKA 2G0FA 2VD0A 1JFUA 2R4VA 2FWEA 2PVOC 4PQHA 4L0WA 4XS6A 6GSXA 4ZBDA 5IO0A 2C3TA 3UL3A 4K7OA 20GSA 4EKZA 1HYUA 4IP6A 4N0ZA 1NHYA 3IAM2 1TK8B 3C71A 4FYUA 2H71A 1UC7A 2WZ9A 2YWOA 1XWGA 1TI1A 1PKWA 3ZVJA 3DWVA 4TOPA 3CRUA 1EEJA 4V1Ap 3ZIJA 1J08A 4MH3A 5EY6A 4JE1A 3V1WA 1TXXA 2A4VA 4F0CA 3IK9A 1M2BA 4P3YB 2DJKA 4ZL8A 5INYA 1SKRB 1SU9A 1WWJA 4WEYA 4O32A 2DJ2A 1QUWA 1TP9A 3DYRA 2R5GA 1A2LA 2GZYA 4ECJA 1SJZA 1GTBA 4TXOB 2H01A 3TJGA 3TOUA 2FWFA 3FK8A 1GLPA 1PX7A 3F3QA 1DBYA 1YY7A 4I2TA 4MF5A 2LQQA 1GSQA 3WGXA 2ZCTA 4HJ2A 4GSSA 3HD5A 4MLYA 3VWWA 4MCUA 5CRDA 2I1UA 1FHEA 2AUVA 2EIOA 3KTBA 2HSHA 2I3YA 2F8FA 3LWAA 4HS1A 4HOJA 2I81A 2YV7A 1XOBA 4IJ3A 2K8SA 3TKQA 2NVLA 2CZ3A 2NDOA 1LU4A 3P90A 3MSZA 2IFQA 1GTUA 3VWUA 3LSZA 1GTIA 1YF1A 1TOFA 2BTOT 3N9JA 2LJRA 2JSYA 5ECLB 5JCGA 1JZWA 4MABA 2IMFA 2NPBA 3LQ7A 3UBKA 4EC0A 3H1NA 4ACSA 5HQPA 3EC3A 5CREA 3QDNA 3IOSA 3DVWA 4QL7A 1V9WA 4IJIA 2VCZA 3LG6A 14GSA 4K0GA 5ID2B 1NHOA 1YKAA 4XCSA 5DALB 3M9JA 1EV4A 1GLQA 1QXHA 3C73A 4JBBA 1XOAA 3ERFA 2VIMA 4DSQA 1FB6A 1K0NA 3FYGA 1LBKA 5KN3A 2V6OA 1G6WA 4WBRD 2AYTA 3D4TA 3VWXA 4E8HA 4POBA 4HJMA 1T00A 2MBTA 3D0ZA 2GSSA 3I43A 2RIIA 1EEMA 1SL2B 2Z9SA 2H0HA 2IMDA 3TGZA 4EDZA 3W8SA 2M46A 3GA4A 2PVQA 2KHPA 2GQLA 5CP1A 5IMCA 2XC2A 2RUFA 4E8EA 3QR6A 4IHUA 1EGRA 1SENA 2WFCA 2K18A 2HYXA 3EINA 3CTGA 3BCKA 1GNEA 4YQMA 1E2YA 3M1GA 2OE1A 3ZTLA 3KP8A 2OADA 2TRCP 5ELAA 1R4WA 1WE0A 1ERVA 1Z6MA 1TU8A 1PL1A 1WP0A 4JZQA 2LUSA 3TRXA 4YAPA 4TN8A 2KP2A 4J2FA 5DDLA 3E3EA 3GTUA 4JEDA 3QD9A 1M99A 3L78A 3MAKA 4D73B 3CSIA 5IMDA 4O5RA 4MP4A 3CBUA 3LGCA 4KW6A 4HQZA 2H1DA 4NWYA 2YPMA 3KM6A 3Q74A 3PGTA 1TI3A 2HZEA 4YQVA 2JZTA 1FB0A 3IV4A 3P2AA 5H5SA 2VD1A 3DMLA 2R37A 2H0GA 5CRHA 3ZIVA 3TKRA 1GSFA 3HXSA 3TRPA 2J23A 1XFLA 4KA0A 2LNSA 3KCMA 4KB3A 1A2JA 2GGTA 2VCQA 4AJ8A 3I9V2 4RUVA 2XBIA 4OCFA 1YJ6A 3HA9A 3HJMA 2HZEB 1RQMA 3ZREA 1XWKA 2A2SA 5KN1A 3SBCA 3GL3A 3VI5A 1AW9A 1YEPA 2FHEA 4GTUA 1F9MA 3GRXA 5L71A 5J3RA 2DMLA 3Q18A 1JZOA 1O81A 4EE0A 2DSAA 1GWCA 2H1AA 3D4MA 1BX9A 1THOA 2VL2C 3TKPA 1Z7RA 2CV4A 2N5FA 4ILFA 5B6NA 1BG5A 2V32A 3VK9A 2GS3A 1UN2A 3FHKA 3I69A 2OACA 3IA1A 2CT6A 2YJ7A 3ZMLA 3DRNA 2H19A 5D9VA 5DAKB 4ZILA 3CTFA 4TR1B 1C72A 2YJHA 2FGXA 2CVKA 1SYRA 1WOUA 4O92A 4EUYA 2JL4A 2YWNA 1XWAA 5E59A 2B5XA 2DJ0A 3IK7A 2VL2A 3F4TA 4TRXA 2OBIA 1GTAA 4MK3A 1A0RP 2CX3A 4OFTA 2PN8A 13GSA 4TR0A 2HT9A 2YWIA 2ES7A 3ED3A 1PD21 4AJ6A 4OFNA 3A2VA 1GUHA 3QFBC 2ZUPA 2GLRA 1VGLA 5B6MA 2H73A 1ABAA 2C0DA 4FIWA 2B1LA 4V2MA 2GVPA 2H66A 2JU5A 2ON5A 1OAZA 4IN0A 3GV1A 3C8EA 1V57A 2MMOA 2FD3A 2AJQB 1AQWA 1GUMA 3G7IA 5IMFA 3UEMA 4FH8A 2H75A 3R2QA 2EIQA 4DEJA 1M9AA 1GULA 2D2ZA 5ECOB 4ZB8A 4K7IA 1A2MA 2C0EA 5KEJA 1SD9A 2CQ9A 2L6DA 5IM9A 3JCML 4X1UA 3G7YA 5F0GA 5CRWA 5CNWA 3ZZXA 4KNDA 4EXJA 2OE0A 4G10A 1O73A 3L9UA 3KJYA 2YN1A 3Q19A 2LTKA 3N5OA 3TOTA 1B8XA 2VO4A 5JWRB 2GSRA 4KCAA 4CHSA 5B8BA 3TKSE 1ZL9A 5IMAA 1TK5B 5JWOB 1T3BA 2FCHA 4TR4A 4N30A 3WT1A 5C04A 3SWLA 4JR6A 1LJRA 4IVFA 4WBJA 4HI7A 3GSSA 4LMWA 2OE3A 2PPTA 1PA3A 3ZL5A 1XW6A 3HYPA 1Z5YE 4ZBBA 5ECQB 4NMUA 3QOUA 2B7KA 1HNBA 1M2AA 1GUKA 3TDGA 2E2GA 2OKAA 4OCEA 1VF2A 1MD3A 1ACVA 2IJYA 3APOA 3UVTA 10GSA 4K7NA 3I6AA 2CX4A 3D22A 4F0BA 5EPFA 4YQUA 5A4WA 1ERTA 3D6IA 5KN0A 3O6TA 3RBTA 1XBSA 2LJAA 3F0IA 2YCDA 3GYKA 4J56E 3WGDA 4OWYA 3P8WA 1AIUA 2FWGA 3QMXA 1WRYA 4GXZA 2QSIA 4CW9A 4V2LA 3KXOA 5G5FA 1F2EA 3UOMA 2GDRA 4NAXA 1A24A 4Q5FA 2FY6A 2B5EA 1SKWB 3DD3A 2JSZA 1FG4A 3QFAC 1O8WA 4DSSA 3QAGA 1ILOA 3HJPA 1MDJA 1ZOFA 1M9BA 2OA7A 2VL9A 1OC9A 1V2AA 1R5PA 1GNWA 1WMJA 2AAWA 5IOWA 3H93A 1M2DA 2HXKA 1G6YA 5IIZA 3C1SA 3EU3A 5ECNB 4PNFA 1VF3A 5IO2A 1GSEA 1TU7A 4GQFA 2O7KA 5HFGA 2LSTA 5F05A 5AIVA 2PMTA 3KEBA 3GH9A 2L4CA 3BBYA 3KMOA 2KLXA 3GX0A 1SD8A 1JLVA 3GFKA 1FVJA 2PWJA 2IFQB 4OO4A 5LD0A 3US3A 5GAPD 3IBHA 4ZXGA 2R2JA 11GSA 1PSQA 2GQKA 4ML6A 4TW5A 1YZXA 17GSA 3ZFBA 5HR3A 3FY7A 4PUAA 3F8UA 1TRWA 5CAXA 1PGTA 5CRGA 2O85A 4LMVA 3RHCA 1X5CA 4HDEA 1K0AA 1OYJA 4K6XA 1R7HA 5H5QA 4G2EA 2P5RA 4MJAA 1SYXA 8GSSA 1K0BA 2F8AA 4CDOA 2V2GA 5D73A 3CMIA 1A23A 2A2RA 4IW9A 1B4QA 1I5GA 1OKTA 2I4AA 3GURA 5G30A 4F9ZA 4GSTA 3UBLA 3UJ1A 1PN9A 2YP6A 3HJOA 5ECMB 1S3CA 1HNAA 1PL2A 1XW9A 4K2DA 1A0FA 5GAND 3FZ5A 4X43A 4ECBA 1I9DA 5ECKB 16GSA 2R3XA 3KMNA 3ZFLA 1SK0A 2K6VA 4EF0A 4MZCA 2GT6A 1DSBA 4RQRA 1CQGA 1F3AA 1PQNA 5ECIB 3FEUA 4OFMA 5DQYA 3A5WA 1KNGA 2XPDA 2PBJA 3QCPA 2X99A 2VOCA 4JRRA 4FYBA 2H6XA 1PKZA 4WKWA 2PGTA 2G2QA 2IL3A 4BL7A 3GKXA 1EZKA 4N0VA 1U87A 2VCWA 2CVDA 2B6MA 5DJMA 4WXTA 4PQ1A 2C3NA 2V1MA 4KSMA 1N2AA 3FRCA 5HR1A 2DJJA 3VFIA 3GX8A 1OE8A 1GSDA 3ZYWA 1SK1A 2YWMA 3TB2A 5EVOA 1MEKA 5ECRB 4IBPA 1QK8A 2GT5A 2YNXA 4PUFC 3E0UA 2XBQA 2DIYA 2VLVA 2H70A 2V6KA 3FR9A 4BVYA 3GHAA 5DCGA 5AISA 1UVZA 2CVBA 1TJDA 3DGQA 5AN1A 2BMXA 4G19A 3GH6A 1UA5A 5CO3A 3F6FA 3GTUB 5D9WA 1IYIA 2H1BA 1YF0A 3J7Yk 5DCHA 1X9SB 4LLRA 4L5LA 3LXTA 2P0GA 2X8HA 1ZZYA 3KGKA 3EU4A 1RW1A 1Q4JA 3C1RA 2JZRA 1MD4A 4BWQA 6GSUA 1T1VA 2O89A 1QFNA 3GKKA 3ME7A 2CA8A 3D21A 1H4OA 4N10A 1K0CA 1KBNA 3EMPA 3GNJA 5IPGA 4HQSA 3IAS2 3NIVA 3W6GA 5F07A 5DJLA 1ZYEA 1YKCA 1XVWA 3KH7A 1FAAA 1X9MB 1M0UA 4XRAA 1Y6EA 2FLSA 3FKFA 4WF4A 4KX4A 5GSSA 2AHEA 2YZHA 4IQAA 1GP1A 3KP9A 1AQXA 2H0IA 2JACA 3APSA 3GSTA 4Q5QA 3MWHA 3J7Yb 2M80A 2PU9C 4K1FA 1SJIA 2C4JA 3IXRA 1J9BA 2LKUA 2TRXA 4FYCA 1NW2A 1B4PA 4WETA 1AQVA 3ME8A 3FZAA 4V2NA 2CAIA 2FUG2 1FVKA 2WJUA 2WRTA 1XZOA 2VM1A 4IP1A 3ZLPA 4ZL9A 4DVCA 1XW5A 1FOVA
chains in the Genus database with same CATH superfamily
2P5QA 1K3YA 2QA1A 3DXBA 5COHA 3WYWA 5E4WA 5J9CA 1TRVA 3UIWA 1OKDA 3H8QA 2FNOA 1ML6A 4AGSA 2MMAA 2WDUA 2VUPA 5ECPB 4AF2A 3ZRDA 3H79A 2R6KA 3CSJA 1XXUA 2NBSA 3L9SA 3K8NA 1SL1B 2L4QA 5DVBA 4AJ7A 4MPFA 2L59A 4FO5A 4IKHA 4L8EA 4YKGA 4K0NA 4I5QA 3KZQA 4XS1A 4XS4A 3ZMKA 3MDKA 4GQCA 1G0TA 1YQ1A 4F82A 3LYKA 4LA1A 1K0DA 4EDYA 3BCIA 4MA9A 1SL0B 2L57A 1JZDA 7GSSA 4HSCX 2C0GA 3DIEA 2LV3A 3BD2A 2TIRA 2KUCA 3CSHA 2C8UA 5D8IA 3RHBA 2DLXA 9GSSA 4KE3A 4DSRA 4RI6A 2GQMA 3LORA 2RM6A 3TJJA 4EVMA 4ICYA 3G9BA 4O5UA 4XS4B 1HNCA 1AUCA 2H1GA 2O87A 4K5SA 1NSWA 5IPHA 1EP8A 5DBQA 1XVQA 1O8XA 2YANA 3IPZA 4HU7A 2QA2A 1S3RA 2DC5A 1K0MA 2GZZA 4QQ7A 2HE3A 1G7OA 1IYHA 3U5RE 3QAWA 2C3QA 3GMFA 1ERUA 1SKSB 4X4JA 3KD0A 1W4VA 4TKYA 3FMWA 3ZVJD 2H6YA 4MF7A 2GZPA 4HZ4A 1GSYA 3F4RA 4IELA 3M0FA 1GSUA 2AB6A 3A2XA 1DE1A 1OVNA 4NHWA 1WJKA 3FZ9A 1ZYNA 3LFLA 2J9HA 3O76A 1QGVA 5GSTA 3HVNA 4MJBA 1AAZA 1BJXA 4GRFA 4HU9A 1V40A 6GSVA 1B9XC 2L5LA 4TR3A 2DMMA 1K0OA 4ULXA 4PGTA 4OMVA 2IMIA 5A4UA 2HSYA 3WD6A 4MH2A 5F06A 2H8LA 2CAQA 1O7UA 5AIXA 1QMVA 5HFKA 4MJEA 1ERWA 4TXOA 5LCZA 4PURA 1QQ2A 1O6JA 4JR4A 2N5AA 2N5BA 3TKSC 3KIJA 4ECIA 4H86A 3RPPA 2JADA 5H5RA 4EIPA 2B1KA 2LS5A 1SJ6A 4BWSA 2FA4A 6GSSA 4ZB9A 1MDKA 4RQXA 2LRCA 5DQSA 2LQOA 1V98A 2YV9A 2H72A 1X5DA 5HR2A 3IC4A 4BVXA 5A4VA 1O85A 1URMA 3ERGA 2YZUA 5G5EA 2ALBA 3LEFA 1T8EB 5FT3A 1EV9A 3TJFA 1TKDB 4I2UA 3GKMA 3VLNA 4JU5A 3GIXA 4OD7A 3TCOA 5IOXA 2MZCA 3TKSA 1ST9A 3CRTA 1J0FA 3W8JA 2X8GA 3HY2A 3HZ4A 3HDCA 5J9BA 1BYEA 2HSMA 1U3AA 3F9UA 3GN3A 3L9VA 3L0HA 4K8MA 4BVXB 2MYGA 1EOHA 4PX1A 3VWVA 3A3TA 3NZNA 4O7HA 2OBKA 4BA7A 2BJXA 2R0GA 5FHIA 5G1KA 3IDVA 3EMXA 4KSOA 1GH2A 4DSSB 2KP1A 4MNNA 2E0QA 4BPYA 2F3MA 4MDCA 4GF0A 5IMVA 1OC9B 2LRNA 2VLTA 4MZBA 2MMNA 1OC3A 4MF6A 5ID2A 5JCWA 5ENUA 3KTLA 2WGRA 5DALA 2ZNMA 2VLUA 4A5PA 1W89A 2LJKA 4NV2A 1JLWA 2VL3A 2HZFA 1K3LA 4K9ZA 4L0UA 1GRXA 4XHMA 2HFDA 1EOGA 3CYNA 1ZMAA 1EWXA 3EWLA 5ELGA 1ZYQB 1XIYA 6GSYA 5D93A 2QKEA 5EL8A 3D5JA 3QPMA 4NPBA 4J57E 1X0RA 2QC7A 3VURA 2B5YA 3KH9A 3HHVA 1A8YA 1YEXA 3DVXA 1JHBA 2H30A 2EC4A 1TDIA 1Z3EA 2QGVA 22GSA 2K9FA 5D9XA 3EURA 3EVIA 2XPEA 2MBSA 4ECCA 3G7JA 1F3BA 3F63A 1XWCA 5ECSA 3UVHA 3EYTA 1Q98A 3LW9A 1T4ZA 1PMTA 5FWGA 3WGEA 4ID0A 5G1LA 1Z7PA 1N8JA 4LL1B 3R3EA 2FA8A 1BEDA 6GSWA 3LYPA 2L5OA 3TUEA 4KDUA 2REMA 3U6VA 1VF4A 2EIRA 4KAEA 2H76A 6GSTA 5B7CA 4YH2A 3CXGA 3AY8A 4IQ1A 1EGOA 1BQ7A 1OE7A 2RLIA 4Q5NA 1DUGA 2VM2A 4POLA 2DJ1A 2WULA 2VCVA 3MYDA 3HVSA 1PRXA 3NOFA 5AGYA 4KH7A 1BAYA 3M3MA 2K8VA 4PQIA 3APQA 1YDKA 3S9FA 3FZ4A 4Q5RA 3H4KA 2OJLA 3QAVA 3LJRA 4D73A 2F9SA 4NV5A 3O3TA 4GLTA 1Z6NA 4LL4B 2IMKA 3UMAA 1V58A 3ISOA 3ERWA 1KEBA 4WR5A 3WT2A 3F6DA 1VF1A 3L4NA 4IGJA 3IHQA 4POKA 1GSSA 4KDXA 4BL7B 1U88A 1Y25A 2RUEA 4NXIA 4XTSA 19GSA 1Z9HA 2DJ3A 4V1Ag 4RI7A 2HLSA 3TJKA 4KCEA 1ZCPA 4GSNA 1F37A 2X64A 2NTOA 3TJBA 4G9HA 2IN3A 2ON7A 1U3IA 3IE3A 3PR8A 4WR4A 2WS2A 2HI7A 1U6TA 2HRNA 4KUNA 4XIHA 4F2IA 1E6BA 1NM3A 1K3OA 4QL9A 3UAPA 1WIKA 1S3AA 1H75A 2WCIA 5J5NA 2LRTA 2JZSA 1G7EA 2AV4A 1TRSA 1VRSD 2HRFA 4EO3A 4ZBAA 1SK2A 2DIZA 1XCCA 1WPIA 4YAVA 1XWBA 2DBCA 2B3SA 5C00A 2VCXA 1CQHA 3MNGA 5JCUA 1PX6A 4ZIJA 4I6XA 2XHFA 2M72A 18GSA 1AXDA 5IMZA 5D9TA 3F3RA 4I8BA 5A5KA 3IRAA 12GSA 3PINA 1T7PB 2V41A 2HNLA 5DAKA 3FR3A 1MTCA 2GSQA 4TR1A 1ZYPA 3RAZA 1TRUA 2VAFA 2IPAA 2LNTA 1S3DA 2R0PA 3GL5A 5J41A 1DE2A 3EE2A 2A2PA 5IQYA 3FR6A 1AC1A 5HFIA 3RDWA 4KDYA 4TVEA 1B9YC 1USBA 4NHZA 1B48A 4POMA 2L6CA 2GTUA 4ZB6A 5KN2A 4ML1A 2H6ZA 2P31A 2O8VB 3P7XA 4MJCA 3BOAA 3OR5A 2C1YA 4EL1A 3HZ8A 1X5EA 2PUKC 4PNGA 5GZZB 4HZ2A 1XPVA 1EP7A 1THXA 3FW2A 1T4YA 2F51A 3GKNA 4GWRA 3GUSA 3C7MA 4ZL7A 4XRDA 4N11A 4L5OA 1GL8A 3Q6OA 1F6MC 4GCIA 4HEA2 4Z7XA 3DKSA 3DEXA 3HVVA 3VPTA 1FW1A 3HVXA 2CZ2A 2C80A 1M3JA 2E2MA 4OO5A 5LNKe 2DKIA 4KGIA 2PERA 5G2ZA 5HR0A 3E9JB 4MMMA 4I97A 2FWHA 5ABRA 2I9HA 2C0FA 1X9WB 4TXVA 1ZGNA 4X0XA 3IR4A 1TK0B 4WF5A 4F03A 1TTZA 2IWTA 5G31A 4HUAA 1R5AA 5JWQB 2IIYA 3ZITA 1OC8A 2E7PA 3RPNA 5B8AA 4ISDA 1FO5A 3TRQA 2YOIA 4MZWA 1HQOA 3VPQA 1MDIA 2MMZA 1ON4A 5CYYA 2VCTA 2WB9A 2X8CA 1KTEA 4KF9A 1M7TA 2GSTA 4PXOA 2IMEA 3PH9A 3BJ5A 1JZRA 1RK4A 3VI7A 2B7JA 2H74A 3LXZA 1A8LA 3HCZA 1TW9A 2LEGA 1R26A 3HKRA 1HD2A 3A2WA 4IS0A 3UARA 5J4UA 3F4SA 5D96A 3M8NA 1PFOA 3M9KA 2UZ8A 5ECHB 4MPGA 5F8BA 2RM5A 4CY8A 2KOKA 2G0FA 2VD0A 1JFUA 2R4VA 2FWEA 2PVOC 4PQHA 4L0WA 4XS6A 6GSXA 4ZBDA 5IO0A 2C3TA 3UL3A 4K7OA 20GSA 4EKZA 1HYUA 4IP6A 4N0ZA 1NHYA 3IAM2 1TK8B 3C71A 4FYUA 2H71A 1UC7A 2WZ9A 2YWOA 1XWGA 1TI1A 1PKWA 3ZVJA 3DWVA 4TOPA 3CRUA 1EEJA 4V1Ap 3ZIJA 1J08A 4MH3A 5EY6A 4JE1A 3V1WA 1TXXA 2A4VA 4F0CA 3IK9A 1M2BA 4P3YB 2DJKA 4ZL8A 5INYA 4G0IA 1SKRB 1SU9A 1WWJA 4WEYA 4O32A 2DJ2A 1QUWA 1TP9A 4Z2UA 3DYRA 2R5GA 1A2LA 2GZYA 4ECJA 1SJZA 1GTBA 4TXOB 2H01A 3TJGA 3TOUA 2FWFA 3FK8A 1GLPA 1PX7A 3F3QA 1DBYA 1YY7A 4I2TA 4G0KA 4MF5A 2LQQA 1GSQA 3WGXA 2ZCTA 4HJ2A 4GSSA 3HD5A 2X4AA 4MLYA 3VWWA 4MCUA 5CRDA 2I1UA 1FHEA 2AUVA 2EIOA 3KTBA 2HSHA 2I3YA 2F8FA 1XG8A 3LWAA 4HS1A 4HOJA 2I81A 2YV7A 1XOBA 4IJ3A 2K8SA 3TKQA 2NVLA 2CZ3A 2NDOA 1LU4A 3P90A 3MSZA 2IFQA 1GTUA 3VWUA 3LSZA 1GTIA 1YF1A 1TOFA 2BTOT 3N9JA 2LJRA 2JSYA 5ECLB 5JCGA 1JZWA 4MABA 2X49A 2IMFA 2NPBA 3LQ7A 3UBKA 4EC0A 3H1NA 4ACSA 5HQPA 3EC3A 5CREA 3QDNA 3IOSA 3DVWA 4QL7A 1V9WA 4IJIA 2VCZA 3LG6A 14GSA 5KOXA 4K0GA 5ID2B 1NHOA 1YKAA 4XCSA 5DALB 3M9JA 1EV4A 1GLQA 1QXHA 3C73A 4JBBA 1XOAA 3ERFA 2VIMA 4DSQA 1FB6A 1K0NA 3FYGA 4PTSA 1LBKA 4FQUA 5KN3A 2V6OA 1G6WA 4WBRD 2AYTA 3D4TA 3VWXA 4E8HA 4POBA 4HJMA 1T00A 2MBTA 3D0ZA 2GSSA 4K2XA 3I43A 2RIIA 1EEMA 1SL2B 2Z9SA 2H0HA 2IMDA 3TGZA 4EDZA 3W8SA 2M46A 3GA4A 2PVQA 2KHPA 2GQLA 5CP1A 5IMCA 2XC2A 2RUFA 4E8EA 3QR6A 4IHUA 1EGRA 1SENA 2WFCA 2K18A 2HYXA 3EINA 3CTGA 3BCKA 1GNEA 4YQMA 1E2YA 3M1GA 2OE1A 3ZTLA 3KP8A 2OADA 2TRCP 1R4WA 1WE0A 5ELAA 1ERVA 1Z6MA 1TU8A 1PL1A 1WP0A 4JZQA 2LUSA 3TRXA 4YAPA 4TN8A 2KP2A 3IHGA 1M3IA 4J2FA 5DDLA 3E3EA 3GTUA 4JEDA 3QD9A 1M99A 3L78A 3MAKA 4D73B 3CSIA 5IMDA 4O5RA 4MP4A 3CBUA 4G0LA 3LGCA 4KW6A 4HQZA 2H1DA 4NWYA 2YPMA 3KM6A 2HRKA 3Q74A 3PGTA 1TI3A 2HZEA 4YQVA 2JZTA 1FB0A 3IV4A 3P2AA 5H5SA 2VD1A 3DMLA 4CY6A 2R37A 2H0GA 5CRHA 3ZIVA 5BMUA 3TKRA 1GSFA 3HXSA 3TRPA 2J23A 1XFLA 4KA0A 2LNSA 4Z2RA 5BRTA 3KCMA 4KB3A 1A2JA 2DKHA 2GGTA 2VCQA 4AJ8A 3I9V2 4RUVA 4EIQA 2XBIA 4OCFA 1YJ6A 3HA9A 3HJMA 2HZEB 1RQMA 3ZREA 1XWKA 2A2SA 5KN1A 3SBCA 3GL3A 3VI5A 1AW9A 1YEPA 2FHEA 4GTUA 1F9MA 3GRXA 5L71A 5J3RA 2DMLA 3Q18A 1JZOA 1O81A 4EE0A 2DSAA 1GWCA 2H1AA 3D4MA 1BX9A 1THOA 2VL2C 3TKPA 1Z7RA 2CV4A 2N5FA 4ILFA 5B6NA 1BG5A 2V32A 3VK9A 2GS3A 1UN2A 3FHKA 1PN0A 3I69A 2OACA 3IA1A 2CT6A 2YJ7A 3ZMLA 3DRNA 2H19A 5D9VA 5DAKB 4ZILA 3CTFA 4TR1B 1C72A 2YJHA 2FGXA 2CVKA 1SYRA 4BIKA 1WOUA 4O92A 4EUYA 2JL4A 2YWNA 1XWAA 5E59A 2B5XA 2DJ0A 3IK7A 2VL2A 3F4TA 4TRXA 2OBIA 1GTAA 4MK3A 1A0RP 2CX3A 4OFTA 2PN8A 13GSA 4TR0A 2HT9A 2YWIA 2ES7A 3ED3A 1PD21 4AJ6A 4OFNA 3A2VA 1GUHA 3QFBC 2ZUPA 2GLRA 1VGLA 5B6MA 2H73A 1ABAA 2C0DA 4FIWA 3MIXA 2B1LA 4V2MA 2GVPA 2H66A 2JU5A 2ON5A 1OAZA 4IN0A 3GV1A 3C8EA 1V57A 2MMOA 2FD3A 2AJQB 1AQWA 1GUMA 1FOHA 3G7IA 5IMFA 3UEMA 4FH8A 2H75A 3R2QA 2EIQA 4DEJA 1M9AA 1GULA 2D2ZA 5ECOB 4ZB8A 4K7IA 1A2MA 2C0EA 5KEJA 2R0CA 1SD9A 2CQ9A 2L6DA 5IM9A 3JCML 4X1UA 3G7YA 5F0GA 5CRWA 5CNWA 3ZZXA 4KNDA 4EXJA 2OE0A 4G10A 2HRAA 1O73A 3L9UA 3KJYA 4O5QA 2YN1A 3Q19A 2LTKA 3N5OA 3TOTA 1B8XA 2VO4A 5JWRB 2GSRA 4KCAA 4CHSA 5B8BA 3TKSE 1ZL9A 5IMAA 1TK5B 5JWOB 1T3BA 2FCHA 4TR4A 4N30A 3WT1A 5C04A 3SWLA 4JR6A 1LJRA 4IVFA 4WBJA 4HI7A 3GSSA 4LMWA 2OE3A 2PPTA 1PA3A 3ZL5A 1XW6A 3HYPA 1Z5YE 4ZBBA 5ECQB 4NMUA 3QOUA 2B7KA 1HNBA 1M2AA 1GUKA 3TDGA 2E2GA 2OKAA 4OCEA 1VF2A 1MD3A 1ACVA 2IJYA 3APOA 3UVTA 10GSA 4K7NA 3I6AA 2CX4A 3D22A 4F0BA 5EPFA 4YQUA 5A4WA 1ERTA 3D6IA 5KN0A 3O6TA 3RBTA 1XBSA 2LJAA 3F0IA 2YCDA 3GYKA 4J56E 3WGDA 4YKFA 4OWYA 3P8WA 1AIUA 2FWGA 3QMXA 1WRYA 4GXZA 2QSIA 4CW9A 4V2LA 3KXOA 5G5FA 1F2EA 3UOMA 2GDRA 4NAXA 1A24A 4Q5FA 2FY6A 2B5EA 1SKWB 3DD3A 2JSZA 1FG4A 3QFAC 1O8WA 4DSSA 3QAGA 1ILOA 3HJPA 1MDJA 1ZOFA 1M9BA 2OA7A 2VL9A 1OC9A 1V2AA 1R5PA 1GNWA 1WMJA 2AAWA 5IOWA 3H93A 1M2DA 2HXKA 1G6YA 5IIZA 3C1SA 3EU3A 5ECNB 4PNFA 1VF3A 3CQFA 5IO2A 1GSEA 1TU7A 4GQFA 2O7KA 5HFGA 2LSTA 4USSA 5F05A 5AIVA 2PMTA 3KEBA 3GH9A 2L4CA 3BBYA 3KMOA 2KLXA 3GX0A 1SD8A 1JLVA 3GFKA 1FVJA 2PWJA 2IFQB 4OO4A 5LD0A 3US3A 5GAPD 3IBHA 4ZXGA 2R2JA 11GSA 1PSQA 2GQKA 3IC8A 4ML6A 4TW5A 1YZXA 17GSA 3ZFBA 5HR3A 3FY7A 4PUAA 3F8UA 1TRWA 5CAXA 1PGTA 5CRGA 2O85A 4LMVA 3RHCA 4K5RA 1X5CA 4HDEA 1K0AA 1OYJA 4K6XA 1R7HA 5H5QA 4G2EA 2P5RA 4MJAA 1SYXA 8GSSA 1K0BA 2F8AA 4CDOA 2V2GA 5D73A 3CMIA 1A23A 2A2RA 4IW9A 3EPTA 1B4QA 1I5GA 1OKTA 2I4AA 3GURA 5G30A 4F9ZA 4GSTA 3UBLA 3UJ1A 1PN9A 2YP6A 3HJOA 1S3CA 5ECMB 1HNAA 1PL2A 1XW9A 4K2DA 1A0FA 5GAND 3FZ5A 4X43A 4ECBA 1I9DA 5ECKB 16GSA 2R3XA 3KMNA 3ZFLA 1SK0A 2K6VA 4EF0A 4MZCA 2GT6A 1DSBA 4RQRA 1CQGA 1F3AA 1PQNA 5ECIB 3FEUA 4OFMA 5DQYA 3A5WA 1KNGA 2XPDA 2PBJA 3QCPA 2X99A 2VOCA 4JRRA 4FYBA 2H6XA 1PKZA 4WKWA 2PGTA 2G2QA 2IL3A 4BL7A 3GKXA 1EZKA 4N0VA 1U87A 2VCWA 2CVDA 2B6MA 5DJMA 4WXTA 4PQ1A 2C3NA 2V1MA 4KSMA 1N2AA 3FRCA 5HR1A 2DJJA 3VFIA 3GX8A 1OE8A 1GSDA 3ZYWA 1SK1A 2YWMA 3TB2A 5EVOA 5KOWA 1MEKA 5ECRB 4IBPA 1QK8A 2GT5A 2YNXA 4PUFC 3E0UA 2XBQA 2DIYA 2VLVA 2H70A 2V6KA 3FR9A 4BVYA 3GHAA 5DCGA 5AISA 1UVZA 2CVBA 1TJDA 3DGQA 3PPUA 5AN1A 2BMXA 4G19A 3GH6A 1UA5A 5CO3A 3F6FA 3GTUB 5D9WA 1IYIA 2H1BA 1YF0A 3J7Yk 5DCHA 1X9SB 4LLRA 4L5LA 3LXTA 2P0GA 2X8HA 2A4HA 1ZZYA 3KGKA 3EU4A 1RW1A 1Q4JA 3C1RA 4Z2TA 2JZRA 1MD4A 4BWQA 6GSUA 1T1VA 2O89A 1QFNA 3GKKA 3ME7A 2CA8A 4BVYB 3D21A 1H4OA 4N10A 1K0CA 1KBNA 3EMPA 3GNJA 5IPGA 4HQSA 3IAS2 3NIVA 3W6GA 5F07A 5DJLA 1ZYEA 1YKCA 1XVWA 3KH7A 1FAAA 1X9MB 1M0UA 4XRAA 1Y6EA 2FLSA 3FKFA 4WF4A 4KX4A 5GSSA 2AHEA 2YZHA 4IQAA 1GP1A 3KP9A 1AQXA 2H0IA 2JACA 3APSA 3GSTA 4Q5QA 3MWHA 3J7Yb 2M80A 2PU9C 4K1FA 1SJIA 2C4JA 3IXRA 1J9BA 2LKUA 2TRXA 4FYCA 1NW2A 1B4PA 4WETA 1AQVA 3ME8A 3FZAA 4V2NA 2CAIA 2FUG2 1FVKA 2WJUA 2WRTA 1XZOA 2VM1A 4IP1A 3ZLPA 4ZL9A 3A5IA 4DVCA 1XW5A 1FOVA
chains in the Genus database with same CATH topology
2P5QA 1K3YA 2QA1A 3DXBA 5COHA 3WYWA 5E4WA 5J9CA 1TRVA 3UIWA 1OKDA 3H8QA 2FNOA 1ML6A 4AGSA 2MMAA 2WDUA 2VUPA 5ECPB 4AF2A 3ZRDA 3H79A 2R6KA 3CSJA 1XXUA 2NBSA 3L9SA 3K8NA 1SL1B 2L4QA 5DVBA 4AJ7A 4MPFA 2L59A 4FO5A 4IKHA 4L8EA 4YKGA 4K0NA 4I5QA 3KZQA 4XS1A 4XS4A 3ZMKA 3MDKA 4GQCA 1G0TA 1YQ1A 4F82A 3LYKA 4LA1A 1K0DA 4EDYA 3BCIA 4MA9A 1SL0B 2L57A 1JZDA 7GSSA 2C0GA 3DIEA 2LV3A 3BD2A 2TIRA 2KUCA 3CSHA 2C8UA 5D8IA 3RHBA 2DLXA 9GSSA 4KE3A 4DSRA 4RI6A 2GQMA 3LORA 2RM6A 3TJJA 4EVMA 4ICYA 3G9BA 4O5UA 4XS4B 1HNCA 1AUCA 2H1GA 2O87A 4K5SA 1NSWA 5IPHA 1EP8A 5DBQA 1XVQA 1O8XA 2YANA 3IPZA 4HU7A 2QA2A 2DC5A 1K0MA 2GZZA 4QQ7A 2HE3A 1G7OA 1IYHA 3U5RE 3QAWA 2C3QA 3GMFA 1ERUA 1SKSB 4X4JA 3KD0A 1W4VA 4TKYA 3FMWA 3ZVJD 2H6YA 4MF7A 2GZPA 4HZ4A 1GSYA 3F4RA 4IELA 3M0FA 1GSUA 2AB6A 3A2XA 1DE1A 1OVNA 4NHWA 1WJKA 3FZ9A 1ZYNA 3LFLA 2J9HA 3O76A 1QGVA 5GSTA 4MJBA 1AAZA 1BJXA 4GRFA 4HU9A 1V40A 6GSVA 1B9XC 2L5LA 4TR3A 2DMMA 1K0OA 4ULXA 4PGTA 4OMVA 2IMIA 5A4UA 2HSYA 3WD6A 4MH2A 5F06A 2H8LA 2CAQA 1O7UA 5AIXA 1QMVA 5HFKA 4MJEA 1ERWA 4TXOA 5LCZA 4PURA 1QQ2A 1O6JA 4JR4A 2N5AA 2N5BA 3TKSC 3KIJA 4ECIA 4H86A 3RPPA 2JADA 5H5RA 4EIPA 2B1KA 2LS5A 1SJ6A 4BWSA 2FA4A 6GSSA 4ZB9A 1MDKA 4RQXA 2LRCA 5DQSA 2LQOA 1V98A 2YV9A 2H72A 1X5DA 5HR2A 3IC4A 4BVXA 5A4VA 1O85A 1URMA 3ERGA 2YZUA 5G5EA 2ALBA 3LEFA 1T8EB 5FT3A 1EV9A 3TJFA 1TKDB 4I2UA 3GKMA 3VLNA 4JU5A 3GIXA 4OD7A 3TCOA 5IOXA 2MZCA 3TKSA 1ST9A 3CRTA 1J0FA 3W8JA 2X8GA 3HY2A 3HZ4A 3HDCA 5J9BA 1BYEA 2HSMA 1U3AA 3F9UA 3GN3A 3L9VA 3L0HA 4K8MA 4BVXB 2MYGA 1EOHA 4PX1A 3VWVA 3A3TA 3NZNA 4O7HA 2OBKA 4BA7A 2BJXA 2R0GA 5FHIA 5G1KA 3IDVA 3EMXA 4KSOA 1GH2A 4DSSB 2KP1A 4MNNA 2E0QA 4BPYA 2F3MA 4MDCA 4GF0A 5IMVA 1OC9B 2LRNA 2VLTA 4MZBA 2MMNA 1OC3A 4MF6A 5ID2A 5JCWA 5ENUA 3KTLA 2WGRA 5DALA 2ZNMA 2VLUA 4A5PA 1W89A 2LJKA 4NV2A 1JLWA 2VL3A 2HZFA 1K3LA 4K9ZA 4L0UA 1GRXA 4XHMA 2HFDA 1EOGA 3CYNA 1ZMAA 1EWXA 3EWLA 5ELGA 1ZYQB 1XIYA 6GSYA 5D93A 2QKEA 5EL8A 3D5JA 3QPMA 4NPBA 4J57E 1X0RA 2QC7A 3VURA 2B5YA 3KH9A 3HHVA 1A8YA 1YEXA 3DVXA 1JHBA 2H30A 2EC4A 1TDIA 1Z3EA 2QGVA 22GSA 2K9FA 5D9XA 3EURA 3EVIA 2XPEA 2MBSA 4ECCA 3G7JA 1F3BA 3F63A 1XWCA 5ECSA 3UVHA 3EYTA 1Q98A 3LW9A 1T4ZA 1PMTA 5FWGA 3WGEA 4ID0A 5G1LA 1Z7PA 1N8JA 4LL1B 3R3EA 2FA8A 1BEDA 6GSWA 3LYPA 2L5OA 3TUEA 4KDUA 2REMA 3U6VA 1VF4A 2EIRA 4KAEA 2H76A 6GSTA 5B7CA 4YH2A 3CXGA 3AY8A 4IQ1A 1EGOA 1BQ7A 1OE7A 2RLIA 4Q5NA 1DUGA 2VM2A 4POLA 2DJ1A 2WULA 2VCVA 3MYDA 3HVSA 1PRXA 3NOFA 5AGYA 4KH7A 1BAYA 3M3MA 2K8VA 4PQIA 3APQA 1YDKA 3S9FA 3FZ4A 4Q5RA 3H4KA 2OJLA 3QAVA 3LJRA 4D73A 2F9SA 4NV5A 3O3TA 4GLTA 1Z6NA 4LL4B 2IMKA 3UMAA 1V58A 3ISOA 3ERWA 1KEBA 4WR5A 3WT2A 3F6DA 1VF1A 3L4NA 4IGJA 3IHQA 4POKA 1GSSA 4KDXA 4BL7B 1U88A 1Y25A 2RUEA 4NXIA 4XTSA 19GSA 1Z9HA 2DJ3A 4V1Ag 4RI7A 2HLSA 3TJKA 4KCEA 1ZCPA 4GSNA 1F37A 2X64A 2NTOA 3TJBA 4G9HA 2IN3A 2ON7A 1U3IA 3IE3A 3PR8A 4WR4A 2WS2A 2HI7A 1U6TA 2HRNA 4KUNA 4XIHA 4F2IA 1E6BA 1NM3A 1K3OA 4QL9A 3UAPA 1WIKA 1S3AA 1H75A 2WCIA 5J5NA 2LRTA 2JZSA 1G7EA 2AV4A 1TRSA 1VRSD 2HRFA 4EO3A 4ZBAA 1SK2A 2DIZA 1XCCA 1WPIA 4YAVA 1XWBA 2DBCA 2B3SA 5C00A 2VCXA 1CQHA 3MNGA 5JCUA 1PX6A 4ZIJA 4I6XA 2XHFA 2M72A 18GSA 1AXDA 5IMZA 5D9TA 3F3RA 4I8BA 5A5KA 3IRAA 12GSA 3PINA 1T7PB 2V41A 2HNLA 5DAKA 3FR3A 1MTCA 2GSQA 4TR1A 1ZYPA 3RAZA 1TRUA 2VAFA 2IPAA 2LNTA 1S3DA 2R0PA 3GL5A 5J41A 1DE2A 3EE2A 2A2PA 5IQYA 3FR6A 1AC1A 5HFIA 3RDWA 4KDYA 4TVEA 1B9YC 1USBA 4NHZA 1B48A 4POMA 2L6CA 2GTUA 4ZB6A 5KN2A 4ML1A 2H6ZA 2P31A 2O8VB 3P7XA 4MJCA 3BOAA 3OR5A 2C1YA 4EL1A 3HZ8A 1X5EA 2PUKC 4PNGA 5GZZB 4HZ2A 1XPVA 1EP7A 1THXA 3FW2A 1T4YA 2F51A 3GKNA 4GWRA 3GUSA 3C7MA 4ZL7A 4XRDA 4N11A 4L5OA 1GL8A 3Q6OA 1F6MC 4GCIA 4HEA2 4Z7XA 3DKSA 3DEXA 3HVVA 3VPTA 1FW1A 3HVXA 2CZ2A 2C80A 2E2MA 4OO5A 5LNKe 2DKIA 4KGIA 2PERA 5G2ZA 5HR0A 3E9JB 4MMMA 4I97A 2FWHA 5ABRA 2I9HA 2C0FA 1X9WB 4TXVA 1ZGNA 4X0XA 3IR4A 1TK0B 4WF5A 4F03A 1TTZA 2IWTA 5G31A 4HUAA 1R5AA 5JWQB 2IIYA 3ZITA 1OC8A 2E7PA 3RPNA 5B8AA 4ISDA 1FO5A 3TRQA 2YOIA 4MZWA 1HQOA 3VPQA 1MDIA 2MMZA 1ON4A 5CYYA 2VCTA 2WB9A 2X8CA 1KTEA 4KF9A 1M7TA 2GSTA 4PXOA 2IMEA 3PH9A 3BJ5A 1JZRA 1RK4A 3VI7A 2B7JA 2H74A 3LXZA 1A8LA 3HCZA 1TW9A 2LEGA 1R26A 3HKRA 1HD2A 3A2WA 4IS0A 3UARA 5J4UA 3F4SA 5D96A 3M8NA 3M9KA 2UZ8A 5ECHB 4MPGA 5F8BA 2RM5A 4CY8A 2KOKA 2G0FA 2VD0A 1JFUA 2R4VA 2FWEA 2PVOC 4PQHA 4L0WA 4XS6A 6GSXA 4ZBDA 5IO0A 2C3TA 3UL3A 4K7OA 20GSA 4EKZA 1HYUA 4IP6A 4N0ZA 1NHYA 3IAM2 1TK8B 3C71A 4FYUA 2H71A 1UC7A 2WZ9A 2YWOA 1XWGA 1TI1A 1PKWA 3ZVJA 3DWVA 4TOPA 3CRUA 1EEJA 4V1Ap 3ZIJA 1J08A 4MH3A 5EY6A 4JE1A 3V1WA 1TXXA 2A4VA 4F0CA 3IK9A 1M2BA 4P3YB 2DJKA 4ZL8A 5INYA 4G0IA 1SKRB 1SU9A 1WWJA 4WEYA 4O32A 2DJ2A 1QUWA 1TP9A 4Z2UA 3DYRA 2R5GA 1A2LA 2GZYA 4ECJA 1SJZA 1GTBA 4TXOB 2H01A 3TJGA 3TOUA 2FWFA 3FK8A 1GLPA 1PX7A 3F3QA 1DBYA 1YY7A 4I2TA 4G0KA 4MF5A 2LQQA 1GSQA 3WGXA 2ZCTA 4HJ2A 4GSSA 3HD5A 2X4AA 4MLYA 3VWWA 4MCUA 5CRDA 2I1UA 1FHEA 2AUVA 2EIOA 3KTBA 2HSHA 2I3YA 2F8FA 3LWAA 4HS1A 4HOJA 2I81A 2YV7A 1XOBA 4IJ3A 2K8SA 3TKQA 2NVLA 2CZ3A 2NDOA 1LU4A 3P90A 3MSZA 2IFQA 1GTUA 3VWUA 3LSZA 1GTIA 1YF1A 1TOFA 2BTOT 3N9JA 2LJRA 2JSYA 5ECLB 5JCGA 1JZWA 4MABA 2X49A 2IMFA 2NPBA 3LQ7A 3UBKA 4EC0A 3H1NA 4ACSA 5HQPA 3EC3A 5CREA 3QDNA 3IOSA 3DVWA 4QL7A 1V9WA 4IJIA 2VCZA 3LG6A 14GSA 5KOXA 4K0GA 5ID2B 1NHOA 1YKAA 4XCSA 5DALB 3M9JA 1EV4A 1GLQA 1QXHA 3C73A 4JBBA 1XOAA 3ERFA 2VIMA 4DSQA 1FB6A 1K0NA 3FYGA 4PTSA 1LBKA 4FQUA 5KN3A 2V6OA 1G6WA 4WBRD 2AYTA 3D4TA 3VWXA 4E8HA 4POBA 4HJMA 1T00A 2MBTA 3D0ZA 2GSSA 4K2XA 3I43A 2RIIA 1EEMA 1SL2B 2Z9SA 2H0HA 2IMDA 3TGZA 4EDZA 3W8SA 2M46A 3GA4A 2PVQA 2KHPA 2GQLA 5CP1A 5IMCA 2XC2A 2RUFA 4E8EA 3QR6A 4IHUA 1EGRA 1SENA 2WFCA 2K18A 2HYXA 3EINA 3CTGA 3BCKA 1GNEA 4YQMA 1E2YA 3M1GA 2OE1A 3ZTLA 3KP8A 2OADA 2TRCP 1R4WA 1WE0A 5ELAA 1ERVA 1Z6MA 1TU8A 1PL1A 1WP0A 4JZQA 2LUSA 3TRXA 4YAPA 4TN8A 2KP2A 3IHGA 4J2FA 5DDLA 3E3EA 3GTUA 4JEDA 3QD9A 1M99A 3L78A 3MAKA 4D73B 3CSIA 5IMDA 4O5RA 4MP4A 3CBUA 4G0LA 3LGCA 4KW6A 4HQZA 2H1DA 4NWYA 2YPMA 3KM6A 2HRKA 3Q74A 3PGTA 1TI3A 2HZEA 4YQVA 2JZTA 1FB0A 3IV4A 3P2AA 5H5SA 2VD1A 3DMLA 4CY6A 2R37A 2H0GA 5CRHA 3ZIVA 5BMUA 3TKRA 1GSFA 3HXSA 3TRPA 2J23A 1XFLA 4KA0A 2LNSA 4Z2RA 5BRTA 3KCMA 4KB3A 1A2JA 2DKHA 2GGTA 2VCQA 4AJ8A 3I9V2 4RUVA 4EIQA 2XBIA 4OCFA 1YJ6A 3HA9A 3HJMA 2HZEB 1RQMA 3ZREA 1XWKA 2A2SA 5KN1A 3SBCA 3GL3A 3VI5A 1AW9A 1YEPA 2FHEA 4GTUA 1F9MA 3GRXA 5L71A 5J3RA 2DMLA 3Q18A 1JZOA 1O81A 4EE0A 2DSAA 1GWCA 2H1AA 3D4MA 1BX9A 1THOA 2VL2C 3TKPA 1Z7RA 2CV4A 2N5FA 4ILFA 5B6NA 1BG5A 2V32A 3VK9A 2GS3A 1UN2A 3FHKA 1PN0A 3I69A 2OACA 3IA1A 2CT6A 2YJ7A 3ZMLA 3DRNA 2H19A 5D9VA 5DAKB 4ZILA 3CTFA 4TR1B 1C72A 2YJHA 2FGXA 2CVKA 1SYRA 1WOUA 4O92A 4EUYA 2JL4A 2YWNA 1XWAA 5E59A 2B5XA 2DJ0A 3IK7A 2VL2A 3F4TA 4TRXA 2OBIA 1GTAA 4MK3A 1A0RP 2CX3A 4OFTA 2PN8A 13GSA 4TR0A 2HT9A 2YWIA 2ES7A 3ED3A 1PD21 4AJ6A 4OFNA 3A2VA 1GUHA 3QFBC 2ZUPA 2GLRA 1VGLA 5B6MA 2H73A 1ABAA 2C0DA 4FIWA 3MIXA 2B1LA 4V2MA 2GVPA 2H66A 2JU5A 2ON5A 1OAZA 4IN0A 3GV1A 3C8EA 1V57A 2MMOA 2FD3A 2AJQB 1AQWA 1GUMA 1FOHA 3G7IA 5IMFA 3UEMA 4FH8A 2H75A 3R2QA 2EIQA 4DEJA 1M9AA 1GULA 2D2ZA 5ECOB 4ZB8A 4K7IA 1A2MA 2C0EA 5KEJA 2R0CA 1SD9A 2CQ9A 2L6DA 5IM9A 3JCML 4X1UA 3G7YA 5F0GA 5CRWA 5CNWA 3ZZXA 4KNDA 4EXJA 2OE0A 4G10A 2HRAA 1O73A 3L9UA 3KJYA 4O5QA 2YN1A 3Q19A 2LTKA 3N5OA 3TOTA 1B8XA 2VO4A 5JWRB 2GSRA 4KCAA 4CHSA 5B8BA 3TKSE 1ZL9A 5IMAA 1TK5B 5JWOB 1T3BA 2FCHA 4TR4A 4N30A 3WT1A 5C04A 3SWLA 4JR6A 1LJRA 4IVFA 4WBJA 4HI7A 3GSSA 4LMWA 2OE3A 2PPTA 1PA3A 3ZL5A 1XW6A 3HYPA 1Z5YE 4ZBBA 5ECQB 4NMUA 3QOUA 2B7KA 1HNBA 1M2AA 1GUKA 3TDGA 2E2GA 2OKAA 4OCEA 1VF2A 1MD3A 1ACVA 2IJYA 3APOA 3UVTA 10GSA 4K7NA 3I6AA 2CX4A 3D22A 4F0BA 5EPFA 4YQUA 5A4WA 1ERTA 3D6IA 5KN0A 3O6TA 3RBTA 1XBSA 2LJAA 3F0IA 2YCDA 3GYKA 4J56E 3WGDA 4YKFA 4OWYA 3P8WA 1AIUA 2FWGA 3QMXA 1WRYA 4GXZA 2QSIA 4CW9A 4V2LA 3KXOA 5G5FA 1F2EA 3UOMA 2GDRA 4NAXA 1A24A 4Q5FA 2FY6A 2B5EA 1SKWB 3DD3A 2JSZA 1FG4A 3QFAC 1O8WA 4DSSA 3QAGA 1ILOA 3HJPA 1MDJA 1ZOFA 1M9BA 2OA7A 2VL9A 1OC9A 1V2AA 1R5PA 1GNWA 1WMJA 2AAWA 5IOWA 3H93A 1M2DA 2HXKA 1G6YA 5IIZA 3C1SA 3EU3A 5ECNB 4PNFA 1VF3A 5IO2A 1GSEA 1TU7A 4GQFA 2O7KA 5HFGA 2LSTA 4USSA 5F05A 5AIVA 2PMTA 3KEBA 3GH9A 2L4CA 3BBYA 3KMOA 2KLXA 3GX0A 1SD8A 1JLVA 3GFKA 1FVJA 2PWJA 2IFQB 4OO4A 5LD0A 3US3A 5GAPD 3IBHA 4ZXGA 2R2JA 11GSA 1PSQA 2GQKA 3IC8A 4ML6A 4TW5A 1YZXA 17GSA 3ZFBA 5HR3A 3FY7A 4PUAA 3F8UA 1TRWA 5CAXA 1PGTA 5CRGA 2O85A 4LMVA 3RHCA 4K5RA 1X5CA 4HDEA 1K0AA 1OYJA 4K6XA 1R7HA 5H5QA 4G2EA 2P5RA 4MJAA 1SYXA 8GSSA 1K0BA 2F8AA 4CDOA 5D73A 2V2GA 3CMIA 1A23A 2A2RA 4IW9A 3EPTA 1B4QA 1I5GA 1OKTA 2I4AA 3GURA 5G30A 4F9ZA 4GSTA 3UBLA 3UJ1A 1PN9A 2YP6A 3HJOA 1S3CA 5ECMB 1HNAA 1PL2A 1XW9A 4K2DA 1A0FA 5GAND 3FZ5A 4X43A 4ECBA 1I9DA 5ECKB 16GSA 2R3XA 3KMNA 3ZFLA 1SK0A 2K6VA 4EF0A 4MZCA 2GT6A 1DSBA 4RQRA 1CQGA 1F3AA 1PQNA 5ECIB 3FEUA 4OFMA 5DQYA 3A5WA 1KNGA 2XPDA 2PBJA 3QCPA 2X99A 2VOCA 4JRRA 4FYBA 2H6XA 1PKZA 4WKWA 2PGTA 2G2QA 2IL3A 4BL7A 3GKXA 1EZKA 4N0VA 1U87A 2VCWA 2CVDA 2B6MA 5DJMA 4WXTA 4PQ1A 2C3NA 2V1MA 4KSMA 1N2AA 3FRCA 5HR1A 2DJJA 3VFIA 3GX8A 1OE8A 1GSDA 3ZYWA 1SK1A 2YWMA 3TB2A 5EVOA 5KOWA 1MEKA 5ECRB 4IBPA 1QK8A 2GT5A 2YNXA 4PUFC 3E0UA 2XBQA 2DIYA 2VLVA 2H70A 2V6KA 3FR9A 4BVYA 3GHAA 5DCGA 5AISA 1UVZA 2CVBA 1TJDA 3DGQA 3PPUA 5AN1A 2BMXA 4G19A 3GH6A 1UA5A 5CO3A 3F6FA 3GTUB 5D9WA 1IYIA 2H1BA 1YF0A 3J7Yk 5DCHA 1X9SB 4LLRA 4L5LA 3LXTA 2P0GA 2X8HA 2A4HA 1ZZYA 3KGKA 3EU4A 1RW1A 1Q4JA 3C1RA 4Z2TA 2JZRA 1MD4A 4BWQA 6GSUA 1T1VA 2O89A 1QFNA 3GKKA 3ME7A 2CA8A 4BVYB 3D21A 1H4OA 4N10A 1K0CA 1KBNA 3EMPA 3GNJA 5IPGA 4HQSA 3IAS2 3NIVA 3W6GA 5F07A 5DJLA 1ZYEA 1YKCA 1XVWA 3KH7A 1FAAA 1X9MB 1M0UA 4XRAA 1Y6EA 2FLSA 3FKFA 4WF4A 4KX4A 5GSSA 2AHEA 2YZHA 4IQAA 1GP1A 3KP9A 1AQXA 2H0IA 2JACA 3APSA 3GSTA 4Q5QA 3MWHA 3J7Yb 2M80A 2PU9C 4K1FA 1SJIA 2C4JA 3IXRA 1J9BA 2LKUA 2TRXA 4FYCA 1NW2A 1B4PA 4WETA 1AQVA 3ME8A 3FZAA 4V2NA 2CAIA 2FUG2 1FVKA 2WJUA 2WRTA 1XZOA 2VM1A 4IP1A 3ZLPA 4ZL9A 3A5IA 4DVCA 1XW5A 1FOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P5Q A;  1K3Y A;  3DXB A;  5COH A;  3WYW A;  5E4W A;  5J9C A;  1TRV A;  3UIW A;  1OKD A;  3H8Q A;  2FNO A;  1ML6 A;  4AGS A;  2MMA A;  2WDU A;  2VUP A;  5ECP B;  4AF2 A;  3ZRD A;  3H79 A;  2R6K A;  3CSJ A;  1XXU A;  2NBS A;  3L9S A;  3K8N A;  1SL1 B;  2L4Q A;  5DVB A;  4AJ7 A;  4MPF A;  2L59 A;  4FO5 A;  4IKH A;  4L8E A;  4K0N A;  4I5Q A;  3KZQ A;  4XS1 A;  4XS4 A;  3ZMK A;  3MDK A;  4GQC A;  1G0T A;  1YQ1 A;  4F82 A;  3LYK A;  4LA1 A;  1K0D A;  4EDY A;  3BCI A;  4MA9 A;  1SL0 B;  2L57 A;  1JZD A;  7GSS A;  2C0G A;  3DIE A;  2LV3 A;  3BD2 A;  2TIR A;  2KUC A;  3CSH A;  2C8U A;  5D8I A;  3RHB A;  2DLX A;  9GSS A;  4KE3 A;  4DSR A;  4RI6 A;  2GQM A;  3LOR A;  2RM6 A;  3TJJ A;  4EVM A;  3G9B A;  4XS4 B;  1HNC A;  1AUC A;  2H1G A;  2O87 A;  1NSW A;  5IPH A;  1EP8 A;  5DBQ A;  1XVQ A;  1O8X A;  2YAN A;  3IPZ A;  4HU7 A;  2DC5 A;  1K0M A;  2GZZ A;  4QQ7 A;  2HE3 A;  1G7O A;  1IYH A;  3U5R E;  3QAW A;  2C3Q A;  3GMF A;  1ERU A;  1SKS B;  3KD0 A;  1W4V A;  4TKY A;  3ZVJ D;  2H6Y A;  4MF7 A;  2GZP A;  4HZ4 A;  1GSY A;  3F4R A;  4IEL A;  3M0F A;  1GSU A;  2AB6 A;  3A2X A;  1DE1 A;  1OVN A;  4NHW A;  1WJK A;  3FZ9 A;  3LFL A;  2J9H A;  3O76 A;  1QGV A;  5GST A;  4MJB A;  1AAZ A;  1BJX A;  4GRF A;  4HU9 A;  1V40 A;  6GSV A;  1B9X C;  2L5L A;  4TR3 A;  2DMM A;  1K0O A;  4ULX A;  4PGT A;  4OMV A;  2IMI A;  5A4U A;  2HSY A;  3WD6 A;  4MH2 A;  5F06 A;  2H8L A;  2CAQ A;  1O7U A;  5AIX A;  1QMV A;  5HFK A;  4MJE A;  1ERW A;  4TXO A;  5LCZ A;  4PUR A;  1QQ2 A;  1O6J A;  4JR4 A;  2N5A A;  2N5B A;  3TKS C;  3KIJ A;  4ECI A;  4H86 A;  3RPP A;  2JAD A;  5H5R A;  2B1K A;  2LS5 A;  1SJ6 A;  4BWS A;  2FA4 A;  6GSS A;  4ZB9 A;  1MDK A;  4RQX A;  2LRC A;  5DQS A;  2LQO A;  1V98 A;  2YV9 A;  2H72 A;  1X5D A;  5HR2 A;  3IC4 A;  4BVX A;  5A4V A;  1O85 A;  1URM A;  3ERG A;  2YZU A;  5G5E A;  2ALB A;  3LEF A;  1T8E B;  5FT3 A;  1EV9 A;  3TJF A;  1TKD B;  4I2U A;  3GKM A;  3VLN A;  4JU5 A;  3GIX A;  4OD7 A;  3TCO A;  5IOX A;  2MZC A;  3TKS A;  1ST9 A;  3CRT A;  1J0F A;  3W8J A;  2X8G A;  3HY2 A;  3HZ4 A;  3HDC A;  5J9B A;  1BYE A;  3F9U A;  1U3A A;  3L9V A;  3GN3 A;  3L0H A;  4K8M A;  2MYG A;  1EOH A;  4PX1 A;  3VWV A;  3A3T A;  3NZN A;  4O7H A;  2OBK A;  4BA7 A;  2BJX A;  5FHI A;  5G1K A;  3IDV A;  3EMX A;  4KSO A;  1GH2 A;  4DSS B;  2KP1 A;  2E0Q A;  4BPY A;  2F3M A;  4MDC A;  4GF0 A;  5IMV A;  1OC9 B;  2LRN A;  2VLT A;  4MZB A;  2MMN A;  1OC3 A;  4MF6 A;  5ID2 A;  5JCW A;  5ENU A;  3KTL A;  2WGR A;  5DAL A;  2ZNM A;  2VLU A;  1W89 A;  2LJK A;  4NV2 A;  1JLW A;  2VL3 A;  2HZF A;  1K3L A;  4K9Z A;  4L0U A;  1GRX A;  4XHM A;  2HFD A;  1EOG A;  3CYN A;  1ZMA A;  1EWX A;  3EWL A;  5ELG A;  1ZYQ B;  1XIY A;  6GSY A;  5D93 A;  2QKE A;  5EL8 A;  3D5J A;  3QPM A;  4NPB A;  4J57 E;  1X0R A;  2QC7 A;  3VUR A;  2B5Y A;  3KH9 A;  3HHV A;  1A8Y A;  1YEX A;  3DVX A;  1JHB A;  2H30 A;  2EC4 A;  1TDI A;  1Z3E A;  2QGV A;  22GS A;  2K9F A;  5D9X A;  3EUR A;  3EVI A;  2XPE A;  2MBS A;  4ECC A;  3G7J A;  1F3B A;  3F63 A;  1XWC A;  5ECS A;  3UVH A;  3EYT A;  1Q98 A;  1T4Z A;  1PMT A;  5FWG A;  3WGE A;  4ID0 A;  5G1L A;  1Z7P A;  1N8J A;  4LL1 B;  2FA8 A;  1BED A;  6GSW A;  3LYP A;  2L5O A;  3TUE A;  4KDU A;  2REM A;  3U6V A;  1VF4 A;  2EIR A;  4KAE A;  2H76 A;  6GST A;  5B7C A;  4YH2 A;  3CXG A;  3AY8 A;  4IQ1 A;  1EGO A;  1BQ7 A;  1OE7 A;  2RLI A;  4Q5N A;  1DUG A;  2VM2 A;  4POL A;  2DJ1 A;  2WUL A;  2VCV A;  3HVS A;  1PRX A;  3NOF A;  5AGY A;  4KH7 A;  1BAY A;  3M3M A;  2K8V A;  4PQI A;  3APQ A;  1YDK A;  3S9F A;  3FZ4 A;  4Q5R A;  3H4K A;  2OJL A;  3QAV A;  3LJR A;  4D73 A;  2F9S A;  4NV5 A;  3O3T A;  4GLT A;  1Z6N A;  4LL4 B;  2IMK A;  3UMA A;  1V58 A;  3ISO A;  3ERW A;  1KEB A;  4WR5 A;  3WT2 A;  3F6D A;  1VF1 A;  3L4N A;  4IGJ A;  3IHQ A;  4POK A;  1GSS A;  4KDX A;  1U88 A;  1Y25 A;  2RUE A;  4NXI A;  4XTS A;  19GS A;  1Z9H A;  2DJ3 A;  4V1A g;  4RI7 A;  2HLS A;  3TJK A;  4KCE A;  1ZCP A;  4GSN A;  1F37 A;  2X64 A;  2NTO A;  3TJB A;  4G9H A;  2IN3 A;  2ON7 A;  1U3I A;  3IE3 A;  3PR8 A;  4WR4 A;  2WS2 A;  2HI7 A;  1U6T A;  2HRN A;  4KUN A;  4XIH A;  4F2I A;  1E6B A;  1NM3 A;  1K3O A;  4QL9 A;  3UAP A;  1WIK A;  1S3A A;  1H75 A;  2WCI A;  5J5N A;  2LRT A;  2JZS A;  1G7E A;  2AV4 A;  1TRS A;  1VRS D;  2HRF A;  4EO3 A;  4ZBA A;  1SK2 A;  2DIZ A;  1XCC A;  1WPI A;  4YAV A;  1XWB A;  2DBC A;  2B3S A;  5C00 A;  2VCX A;  1CQH A;  3MNG A;  5JCU A;  1PX6 A;  4ZIJ A;  4I6X A;  2XHF A;  2M72 A;  18GS A;  1AXD A;  5IMZ A;  5D9T A;  3F3R A;  4I8B A;  5A5K A;  3IRA A;  12GS A;  3PIN A;  1T7P B;  2V41 A;  2HNL A;  5DAK A;  3FR3 A;  1MTC A;  2GSQ A;  4TR1 A;  3RAZ A;  1TRU A;  2VAF A;  2IPA A;  2LNT A;  1S3D A;  3GL5 A;  5J41 A;  1DE2 A;  3EE2 A;  5IQY A;  3FR6 A;  1AC1 A;  5HFI A;  3RDW A;  4KDY A;  4TVE A;  1B9Y C;  1USB A;  4NHZ A;  1B48 A;  4POM A;  2L6C A;  2GTU A;  4ZB6 A;  5KN2 A;  4ML1 A;  2H6Z A;  2P31 A;  2O8V B;  3P7X A;  4MJC A;  3BOA A;  3OR5 A;  2C1Y A;  4EL1 A;  3HZ8 A;  1X5E A;  2PUK C;  4PNG A;  5GZZ B;  4HZ2 A;  1XPV A;  1EP7 A;  1THX A;  3FW2 A;  1T4Y A;  2F51 A;  3GKN A;  4GWR A;  3GUS A;  3C7M A;  4ZL7 A;  4XRD A;  4N11 A;  4L5O A;  1GL8 A;  3Q6O A;  1F6M C;  4GCI A;  4HEA 2;  4Z7X A;  3DKS A;  3DEX A;  3HVV A;  3VPT A;  1FW1 A;  3HVX A;  2CZ2 A;  2C80 A;  2E2M A;  4OO5 A;  5LNK e;  4KGI A;  2PER A;  5G2Z A;  5HR0 A;  3E9J B;  4MMM A;  4I97 A;  2FWH A;  5ABR A;  2I9H A;  2C0F A;  1X9W B;  4TXV A;  1ZGN A;  4X0X A;  3IR4 A;  1TK0 B;  4WF5 A;  4F03 A;  1TTZ A;  2IWT A;  5G31 A;  4HUA A;  1R5A A;  5JWQ B;  2IIY A;  3ZIT A;  1OC8 A;  2E7P A;  3RPN A;  5B8A A;  4ISD A;  1FO5 A;  3TRQ A;  2YOI A;  4MZW A;  1HQO A;  3VPQ A;  1MDI A;  2MMZ A;  1ON4 A;  5CYY A;  2VCT A;  2WB9 A;  2X8C A;  1KTE A;  1M7T A;  2GST A;  4PXO A;  2IME A;  3PH9 A;  3BJ5 A;  1JZR A;  1RK4 A;  3VI7 A;  2B7J A;  2H74 A;  3LXZ A;  1A8L A;  3HCZ A;  1TW9 A;  2LEG A;  1R26 A;  3HKR A;  1HD2 A;  3A2W A;  4IS0 A;  3UAR A;  5J4U A;  3F4S A;  5D96 A;  3M8N A;  3M9K A;  5ECH B;  4MPG A;  5F8B A;  2RM5 A;  2KOK A;  2G0F A;  2VD0 A;  1JFU A;  2R4V A;  2FWE A;  2PVO C;  4PQH A;  4L0W A;  4XS6 A;  6GSX A;  4ZBD A;  5IO0 A;  2C3T A;  3UL3 A;  4K7O A;  20GS A;  4EKZ A;  1HYU A;  4IP6 A;  4N0Z A;  1NHY A;  3IAM 2;  1TK8 B;  3C71 A;  4FYU A;  2H71 A;  1UC7 A;  2WZ9 A;  2YWO A;  1XWG A;  1TI1 A;  1PKW A;  3ZVJ A;  3DWV A;  4TOP A;  3CRU A;  1EEJ A;  4V1A p;  3ZIJ A;  1J08 A;  4MH3 A;  5EY6 A;  4JE1 A;  3V1W A;  1TXX A;  2A4V A;  4F0C A;  3IK9 A;  1M2B A;  4P3Y B;  2DJK A;  4ZL8 A;  5INY A;  1SKR B;  1SU9 A;  1WWJ A;  4WEY A;  4O32 A;  2DJ2 A;  1QUW A;  1TP9 A;  3DYR A;  2R5G A;  1A2L A;  2GZY A;  4ECJ A;  1SJZ A;  1GTB A;  4TXO B;  2H01 A;  3TJG A;  3TOU A;  2FWF A;  3FK8 A;  1GLP A;  1PX7 A;  3F3Q A;  1DBY A;  1YY7 A;  4I2T A;  4MF5 A;  2LQQ A;  1GSQ A;  3WGX A;  2ZCT A;  4HJ2 A;  4GSS A;  3HD5 A;  4MLY A;  3VWW A;  4MCU A;  5CRD A;  2I1U A;  1FHE A;  2AUV A;  2EIO A;  3KTB A;  2HSH A;  2I3Y A;  2F8F A;  3LWA A;  4HS1 A;  4HOJ A;  2I81 A;  2YV7 A;  1XOB A;  4IJ3 A;  2K8S A;  3TKQ A;  2NVL A;  2CZ3 A;  2NDO A;  1LU4 A;  3P90 A;  3MSZ A;  2IFQ A;  1GTU A;  3VWU A;  3LSZ A;  1GTI A;  1YF1 A;  1TOF A;  2BTO T;  3N9J A;  2LJR A;  2JSY A;  5ECL B;  5JCG A;  1JZW A;  4MAB A;  2IMF A;  2NPB A;  3LQ7 A;  3UBK A;  4EC0 A;  3H1N A;  4ACS A;  5HQP A;  3EC3 A;  5CRE A;  3QDN A;  3IOS A;  3DVW A;  4QL7 A;  1V9W A;  4IJI A;  2VCZ A;  3LG6 A;  14GS A;  4K0G A;  5ID2 B;  1NHO A;  1YKA A;  4XCS A;  5DAL B;  3M9J A;  1EV4 A;  1GLQ A;  1QXH A;  3C73 A;  4JBB A;  1XOA A;  3ERF A;  2VIM A;  4DSQ A;  1FB6 A;  1K0N A;  3FYG A;  1LBK A;  5KN3 A;  2V6O A;  1G6W A;  4WBR D;  2AYT A;  3D4T A;  3VWX A;  4E8H A;  4POB A;  4HJM A;  1T00 A;  2MBT A;  3D0Z A;  2GSS A;  3I43 A;  2RII A;  1EEM A;  1SL2 B;  2Z9S A;  2H0H A;  2IMD A;  3TGZ A;  4EDZ A;  3W8S A;  2M46 A;  3GA4 A;  2PVQ A;  2KHP A;  2GQL A;  5CP1 A;  5IMC A;  2XC2 A;  2RUF A;  4E8E A;  3QR6 A;  4IHU A;  1EGR A;  1SEN A;  2WFC A;  2K18 A;  2HYX A;  3EIN A;  3CTG A;  3BCK A;  1GNE A;  4YQM A;  1E2Y A;  3M1G A;  2OE1 A;  3ZTL A;  3KP8 A;  2OAD A;  2TRC P;  5ELA A;  1R4W A;  1WE0 A;  1ERV A;  1Z6M A;  1TU8 A;  1PL1 A;  1WP0 A;  4JZQ A;  2LUS A;  3TRX A;  4YAP A;  4TN8 A;  2KP2 A;  4J2F A;  5DDL A;  3E3E A;  3GTU A;  4JED A;  3QD9 A;  1M99 A;  3L78 A;  3MAK A;  4D73 B;  3CSI A;  5IMD A;  4O5R A;  4MP4 A;  3CBU A;  3LGC A;  4KW6 A;  4HQZ A;  2H1D A;  4NWY A;  2YPM A;  3KM6 A;  3Q74 A;  3PGT A;  1TI3 A;  2HZE A;  4YQV A;  2JZT A;  1FB0 A;  3IV4 A;  3P2A A;  5H5S A;  2VD1 A;  3DML A;  2R37 A;  2H0G A;  5CRH A;  3ZIV A;  3TKR A;  1GSF A;  3HXS A;  3TRP A;  2J23 A;  1XFL A;  4KA0 A;  2LNS A;  3KCM A;  4KB3 A;  1A2J A;  2GGT A;  2VCQ A;  4AJ8 A;  3I9V 2;  4RUV A;  2XBI A;  4OCF A;  1YJ6 A;  3HA9 A;  3HJM A;  2HZE B;  1RQM A;  3ZRE A;  1XWK A;  2A2S A;  5KN1 A;  3SBC A;  3GL3 A;  3VI5 A;  1AW9 A;  1YEP A;  2FHE A;  4GTU A;  1F9M A;  3GRX A;  5L71 A;  5J3R A;  2DML A;  3Q18 A;  1JZO A;  1O81 A;  4EE0 A;  2DSA A;  1GWC A;  2H1A A;  3D4M A;  1BX9 A;  1THO A;  2VL2 C;  3TKP A;  1Z7R A;  2CV4 A;  2N5F A;  4ILF A;  5B6N A;  1BG5 A;  2V32 A;  3VK9 A;  2GS3 A;  1UN2 A;  3FHK A;  3I69 A;  2OAC A;  3IA1 A;  2CT6 A;  2YJ7 A;  3ZML A;  3DRN A;  2H19 A;  5D9V A;  5DAK B;  4ZIL A;  3CTF A;  4TR1 B;  1C72 A;  2YJH A;  2FGX A;  2CVK A;  1SYR A;  1WOU A;  4O92 A;  4EUY A;  2JL4 A;  2YWN A;  1XWA A;  5E59 A;  2B5X A;  2DJ0 A;  3IK7 A;  2VL2 A;  3F4T A;  4TRX A;  2OBI A;  1GTA A;  4MK3 A;  1A0R P;  2CX3 A;  4OFT A;  2PN8 A;  13GS A;  4TR0 A;  2HT9 A;  2YWI A;  2ES7 A;  3ED3 A;  1PD2 1;  4AJ6 A;  4OFN A;  3A2V A;  1GUH A;  3QFB C;  2ZUP A;  2GLR A;  1VGL A;  5B6M A;  2H73 A;  1ABA A;  2C0D A;  4FIW A;  2B1L A;  4V2M A;  2GVP A;  2H66 A;  2JU5 A;  2ON5 A;  1OAZ A;  4IN0 A;  3GV1 A;  3C8E A;  1V57 A;  2MMO A;  2FD3 A;  2AJQ B;  1AQW A;  1GUM A;  3G7I A;  5IMF A;  3UEM A;  4FH8 A;  2H75 A;  3R2Q A;  2EIQ A;  4DEJ A;  1M9A A;  1GUL A;  2D2Z A;  5ECO B;  4ZB8 A;  4K7I A;  1A2M A;  2C0E A;  5KEJ A;  1SD9 A;  2CQ9 A;  2L6D A;  5IM9 A;  3JCM L;  4X1U A;  3G7Y A;  5F0G A;  5CRW A;  5CNW A;  3ZZX A;  4KND A;  4EXJ A;  2OE0 A;  4G10 A;  1O73 A;  3L9U A;  3KJY A;  2YN1 A;  3Q19 A;  2LTK A;  3N5O A;  3TOT A;  1B8X A;  2VO4 A;  5JWR B;  2GSR A;  4KCA A;  4CHS A;  5B8B A;  3TKS E;  1ZL9 A;  5IMA A;  1TK5 B;  5JWO B;  1T3B A;  2FCH A;  4TR4 A;  4N30 A;  3WT1 A;  5C04 A;  3SWL A;  4JR6 A;  1LJR A;  4IVF A;  4WBJ A;  4HI7 A;  3GSS A;  4LMW A;  2OE3 A;  2PPT A;  1PA3 A;  3ZL5 A;  1XW6 A;  3HYP A;  1Z5Y E;  4ZBB A;  5ECQ B;  4NMU A;  3QOU A;  2B7K A;  1HNB A;  1M2A A;  1GUK A;  3TDG A;  2E2G A;  2OKA A;  4OCE A;  1VF2 A;  1MD3 A;  1ACV A;  2IJY A;  3APO A;  3UVT A;  10GS A;  4K7N A;  3I6A A;  2CX4 A;  3D22 A;  4F0B A;  5EPF A;  4YQU A;  5A4W A;  1ERT A;  3D6I A;  5KN0 A;  3O6T A;  3RBT A;  1XBS A;  2LJA A;  3F0I A;  2YCD A;  3GYK A;  4J56 E;  3WGD A;  4OWY A;  3P8W A;  1AIU A;  2FWG A;  3QMX A;  1WRY A;  4GXZ A;  2QSI A;  4CW9 A;  4V2L A;  3KXO A;  5G5F A;  1F2E A;  3UOM A;  2GDR A;  4NAX A;  1A24 A;  4Q5F A;  2FY6 A;  2B5E A;  1SKW B;  3DD3 A;  2JSZ A;  1FG4 A;  3QFA C;  1O8W A;  4DSS A;  3QAG A;  1ILO A;  3HJP A;  1MDJ A;  1ZOF A;  1M9B A;  2OA7 A;  2VL9 A;  1OC9 A;  1V2A A;  1R5P A;  1GNW A;  1WMJ A;  2AAW A;  5IOW A;  3H93 A;  1M2D A;  2HXK A;  1G6Y A;  5IIZ A;  3C1S A;  3EU3 A;  5ECN B;  4PNF A;  1VF3 A;  5IO2 A;  1GSE A;  1TU7 A;  4GQF A;  2O7K A;  5HFG A;  2LST A;  5F05 A;  5AIV A;  2PMT A;  3KEB A;  3GH9 A;  2L4C A;  3BBY A;  3KMO A;  2KLX A;  3GX0 A;  1SD8 A;  1JLV A;  3GFK A;  1FVJ A;  2PWJ A;  2IFQ B;  4OO4 A;  5LD0 A;  3US3 A;  5GAP D;  3IBH A;  4ZXG A;  2R2J A;  11GS A;  1PSQ A;  2GQK A;  4ML6 A;  4TW5 A;  1YZX A;  17GS A;  3ZFB A;  5HR3 A;  3FY7 A;  4PUA A;  3F8U A;  1TRW A;  5CAX A;  1PGT A;  5CRG A;  2O85 A;  4LMV A;  3RHC A;  1X5C A;  4HDE A;  1K0A A;  1OYJ A;  4K6X A;  1R7H A;  5H5Q A;  4G2E A;  2P5R A;  4MJA A;  1SYX A;  8GSS A;  1K0B A;  2F8A A;  4CDO A;  2V2G A;  5D73 A;  3CMI A;  1A23 A;  2A2R A;  4IW9 A;  1B4Q A;  1I5G A;  1OKT A;  2I4A A;  3GUR A;  5G30 A;  4F9Z A;  4GST A;  3UBL A;  3UJ1 A;  1PN9 A;  2YP6 A;  3HJO A;  5ECM B;  1S3C A;  1HNA A;  1PL2 A;  1XW9 A;  4K2D A;  1A0F A;  5GAN D;  3FZ5 A;  4X43 A;  4ECB A;  1I9D A;  5ECK B;  16GS A;  2R3X A;  3KMN A;  3ZFL A;  1SK0 A;  2K6V A;  4EF0 A;  4MZC A;  2GT6 A;  1DSB A;  4RQR A;  1CQG A;  1F3A A;  1PQN A;  5ECI B;  3FEU A;  4OFM A;  5DQY A;  3A5W A;  1KNG A;  2XPD A;  2PBJ A;  3QCP A;  2X99 A;  2VOC A;  4JRR A;  4FYB A;  2H6X A;  1PKZ A;  4WKW A;  2PGT A;  2G2Q A;  2IL3 A;  4BL7 A;  3GKX A;  1EZK A;  4N0V A;  1U87 A;  2VCW A;  2CVD A;  2B6M A;  5DJM A;  4WXT A;  4PQ1 A;  2C3N A;  2V1M A;  4KSM A;  1N2A A;  3FRC A;  5HR1 A;  2DJJ A;  3VFI A;  3GX8 A;  1OE8 A;  1GSD A;  3ZYW A;  1SK1 A;  2YWM A;  3TB2 A;  5EVO A;  1MEK A;  5ECR B;  4IBP A;  1QK8 A;  2GT5 A;  2YNX A;  4PUF C;  3E0U A;  2XBQ A;  2DIY A;  2VLV A;  2H70 A;  2V6K A;  3FR9 A;  4BVY A;  3GHA A;  5DCG A;  5AIS A;  1UVZ A;  2CVB A;  1TJD A;  3DGQ A;  5AN1 A;  2BMX A;  4G19 A;  3GH6 A;  1UA5 A;  5CO3 A;  3F6F A;  3GTU B;  5D9W A;  1IYI A;  2H1B A;  1YF0 A;  3J7Y k;  5DCH A;  1X9S B;  4LLR A;  4L5L A;  3LXT A;  2P0G A;  2X8H A;  1ZZY A;  3KGK A;  3EU4 A;  1RW1 A;  1Q4J A;  3C1R A;  2JZR A;  1MD4 A;  4BWQ A;  6GSU A;  1T1V A;  2O89 A;  1QFN A;  3GKK A;  3ME7 A;  2CA8 A;  3D21 A;  1H4O A;  4N10 A;  1K0C A;  1KBN A;  3EMP A;  3GNJ A;  5IPG A;  4HQS A;  3IAS 2;  3NIV A;  3W6G A;  5F07 A;  5DJL A;  1ZYE A;  1YKC A;  1XVW A;  3KH7 A;  1FAA A;  1X9M B;  1M0U A;  4XRA A;  1Y6E A;  2FLS A;  3FKF A;  4WF4 A;  4KX4 A;  5GSS A;  2AHE A;  2YZH A;  4IQA A;  1GP1 A;  3KP9 A;  1AQX A;  2H0I A;  2JAC A;  3APS A;  3GST A;  4Q5Q A;  3MWH A;  3J7Y b;  2M80 A;  2PU9 C;  4K1F A;  1SJI A;  2C4J A;  3IXR A;  1J9B A;  2LKU A;  2TRX A;  4FYC A;  1NW2 A;  1B4P A;  4WET A;  1AQV A;  3ME8 A;  3FZA A;  4V2N A;  2CAI A;  2FUG 2;  1FVK A;  2WJU A;  2WRT A;  1XZO A;  2VM1 A;  4IP1 A;  3ZLP A;  4ZL9 A;  4DVC A;  1XW5 A;  1FOV A; 
#chains in the Genus database with same CATH topology
 2P5Q A;  1K3Y A;  2QA1 A;  3DXB A;  5COH A;  3WYW A;  5E4W A;  5J9C A;  1TRV A;  3UIW A;  1OKD A;  3H8Q A;  2FNO A;  1ML6 A;  4AGS A;  2MMA A;  2WDU A;  2VUP A;  5ECP B;  4AF2 A;  3ZRD A;  3H79 A;  2R6K A;  3CSJ A;  1XXU A;  2NBS A;  3L9S A;  3K8N A;  1SL1 B;  2L4Q A;  5DVB A;  4AJ7 A;  4MPF A;  2L59 A;  4FO5 A;  4IKH A;  4L8E A;  4YKG A;  4K0N A;  4I5Q A;  3KZQ A;  4XS1 A;  4XS4 A;  3ZMK A;  3MDK A;  4GQC A;  1G0T A;  1YQ1 A;  4F82 A;  3LYK A;  4LA1 A;  1K0D A;  4EDY A;  3BCI A;  4MA9 A;  1SL0 B;  2L57 A;  1JZD A;  7GSS A;  4HSC X;  2C0G A;  3DIE A;  2LV3 A;  3BD2 A;  2TIR A;  2KUC A;  3CSH A;  2C8U A;  5D8I A;  3RHB A;  2DLX A;  9GSS A;  4KE3 A;  4DSR A;  4RI6 A;  2GQM A;  3LOR A;  2RM6 A;  3TJJ A;  4EVM A;  4ICY A;  3G9B A;  4O5U A;  4XS4 B;  1HNC A;  1AUC A;  2H1G A;  2O87 A;  4K5S A;  1NSW A;  5IPH A;  1EP8 A;  5DBQ A;  1XVQ A;  1O8X A;  2YAN A;  3IPZ A;  4HU7 A;  2QA2 A;  1S3R A;  2DC5 A;  1K0M A;  2GZZ A;  4QQ7 A;  2HE3 A;  1G7O A;  1IYH A;  3U5R E;  3QAW A;  2C3Q A;  3GMF A;  1ERU A;  1SKS B;  4X4J A;  3KD0 A;  1W4V A;  4TKY A;  3FMW A;  3ZVJ D;  2H6Y A;  4MF7 A;  2GZP A;  4HZ4 A;  1GSY A;  3F4R A;  4IEL A;  3M0F A;  1GSU A;  2AB6 A;  3A2X A;  1DE1 A;  1OVN A;  4NHW A;  1WJK A;  3FZ9 A;  1ZYN A;  3LFL A;  2J9H A;  3O76 A;  1QGV A;  5GST A;  3HVN A;  4MJB A;  1AAZ A;  1BJX A;  4GRF A;  4HU9 A;  1V40 A;  6GSV A;  1B9X C;  2L5L A;  4TR3 A;  2DMM A;  1K0O A;  4ULX A;  4PGT A;  4OMV A;  2IMI A;  5A4U A;  2HSY A;  3WD6 A;  4MH2 A;  5F06 A;  2H8L A;  2CAQ A;  1O7U A;  5AIX A;  1QMV A;  5HFK A;  4MJE A;  1ERW A;  4TXO A;  5LCZ A;  4PUR A;  1QQ2 A;  1O6J A;  4JR4 A;  2N5A A;  2N5B A;  3TKS C;  3KIJ A;  4ECI A;  4H86 A;  3RPP A;  2JAD A;  5H5R A;  4EIP A;  2B1K A;  2LS5 A;  1SJ6 A;  4BWS A;  2FA4 A;  6GSS A;  4ZB9 A;  1MDK A;  4RQX A;  2LRC A;  5DQS A;  2LQO A;  1V98 A;  2YV9 A;  2H72 A;  1X5D A;  5HR2 A;  3IC4 A;  4BVX A;  5A4V A;  1O85 A;  1URM A;  3ERG A;  2YZU A;  5G5E A;  2ALB A;  3LEF A;  1T8E B;  5FT3 A;  1EV9 A;  3TJF A;  1TKD B;  4I2U A;  3GKM A;  3VLN A;  4JU5 A;  3GIX A;  4OD7 A;  3TCO A;  5IOX A;  2MZC A;  3TKS A;  1ST9 A;  3CRT A;  1J0F A;  3W8J A;  2X8G A;  3HY2 A;  3HZ4 A;  3HDC A;  5J9B A;  1BYE A;  2HSM A;  1U3A A;  3F9U A;  3GN3 A;  3L9V A;  3L0H A;  4K8M A;  4BVX B;  2MYG A;  1EOH A;  4PX1 A;  3VWV A;  3A3T A;  3NZN A;  4O7H A;  2OBK A;  4BA7 A;  2BJX A;  2R0G A;  5FHI A;  5G1K A;  3IDV A;  3EMX A;  4KSO A;  1GH2 A;  4DSS B;  2KP1 A;  4MNN A;  2E0Q A;  4BPY A;  2F3M A;  4MDC A;  4GF0 A;  5IMV A;  1OC9 B;  2LRN A;  2VLT A;  4MZB A;  2MMN A;  1OC3 A;  4MF6 A;  5ID2 A;  5JCW A;  5ENU A;  3KTL A;  2WGR A;  5DAL A;  2ZNM A;  2VLU A;  4A5P A;  1W89 A;  2LJK A;  4NV2 A;  1JLW A;  2VL3 A;  2HZF A;  1K3L A;  4K9Z A;  4L0U A;  1GRX A;  4XHM A;  2HFD A;  1EOG A;  3CYN A;  1ZMA A;  1EWX A;  3EWL A;  5ELG A;  1ZYQ B;  1XIY A;  6GSY A;  5D93 A;  2QKE A;  5EL8 A;  3D5J A;  3QPM A;  4NPB A;  4J57 E;  1X0R A;  2QC7 A;  3VUR A;  2B5Y A;  3KH9 A;  3HHV A;  1A8Y A;  1YEX A;  3DVX A;  1JHB A;  2H30 A;  2EC4 A;  1TDI A;  1Z3E A;  2QGV A;  22GS A;  2K9F A;  5D9X A;  3EUR A;  3EVI A;  2XPE A;  2MBS A;  4ECC A;  3G7J A;  1F3B A;  3F63 A;  1XWC A;  5ECS A;  3UVH A;  3EYT A;  1Q98 A;  3LW9 A;  1T4Z A;  1PMT A;  5FWG A;  3WGE A;  4ID0 A;  5G1L A;  1Z7P A;  1N8J A;  4LL1 B;  3R3E A;  2FA8 A;  1BED A;  6GSW A;  3LYP A;  2L5O A;  3TUE A;  4KDU A;  2REM A;  3U6V A;  1VF4 A;  2EIR A;  4KAE A;  2H76 A;  6GST A;  5B7C A;  4YH2 A;  3CXG A;  3AY8 A;  4IQ1 A;  1EGO A;  1BQ7 A;  1OE7 A;  2RLI A;  4Q5N A;  1DUG A;  2VM2 A;  4POL A;  2DJ1 A;  2WUL A;  2VCV A;  3MYD A;  3HVS A;  1PRX A;  3NOF A;  5AGY A;  4KH7 A;  1BAY A;  3M3M A;  2K8V A;  4PQI A;  3APQ A;  1YDK A;  3S9F A;  3FZ4 A;  4Q5R A;  3H4K A;  2OJL A;  3QAV A;  3LJR A;  4D73 A;  2F9S A;  4NV5 A;  3O3T A;  4GLT A;  1Z6N A;  4LL4 B;  2IMK A;  3UMA A;  1V58 A;  3ISO A;  3ERW A;  1KEB A;  4WR5 A;  3WT2 A;  3F6D A;  1VF1 A;  3L4N A;  4IGJ A;  3IHQ A;  4POK A;  1GSS A;  4KDX A;  4BL7 B;  1U88 A;  1Y25 A;  2RUE A;  4NXI A;  4XTS A;  19GS A;  1Z9H A;  2DJ3 A;  4V1A g;  4RI7 A;  2HLS A;  3TJK A;  4KCE A;  1ZCP A;  4GSN A;  1F37 A;  2X64 A;  2NTO A;  3TJB A;  4G9H A;  2IN3 A;  2ON7 A;  1U3I A;  3IE3 A;  3PR8 A;  4WR4 A;  2WS2 A;  2HI7 A;  1U6T A;  2HRN A;  4KUN A;  4XIH A;  4F2I A;  1E6B A;  1NM3 A;  1K3O A;  4QL9 A;  3UAP A;  1WIK A;  1S3A A;  1H75 A;  2WCI A;  5J5N A;  2LRT A;  2JZS A;  1G7E A;  2AV4 A;  1TRS A;  1VRS D;  2HRF A;  4EO3 A;  4ZBA A;  1SK2 A;  2DIZ A;  1XCC A;  1WPI A;  4YAV A;  1XWB A;  2DBC A;  2B3S A;  5C00 A;  2VCX A;  1CQH A;  3MNG A;  5JCU A;  1PX6 A;  4ZIJ A;  4I6X A;  2XHF A;  2M72 A;  18GS A;  1AXD A;  5IMZ A;  5D9T A;  3F3R A;  4I8B A;  5A5K A;  3IRA A;  12GS A;  3PIN A;  1T7P B;  2V41 A;  2HNL A;  5DAK A;  3FR3 A;  1MTC A;  2GSQ A;  4TR1 A;  1ZYP A;  3RAZ A;  1TRU A;  2VAF A;  2IPA A;  2LNT A;  1S3D A;  2R0P A;  3GL5 A;  5J41 A;  1DE2 A;  3EE2 A;  2A2P A;  5IQY A;  3FR6 A;  1AC1 A;  5HFI A;  3RDW A;  4KDY A;  4TVE A;  1B9Y C;  1USB A;  4NHZ A;  1B48 A;  4POM A;  2L6C A;  2GTU A;  4ZB6 A;  5KN2 A;  4ML1 A;  2H6Z A;  2P31 A;  2O8V B;  3P7X A;  4MJC A;  3BOA A;  3OR5 A;  2C1Y A;  4EL1 A;  3HZ8 A;  1X5E A;  2PUK C;  4PNG A;  5GZZ B;  4HZ2 A;  1XPV A;  1EP7 A;  1THX A;  3FW2 A;  1T4Y A;  2F51 A;  3GKN A;  4GWR A;  3GUS A;  3C7M A;  4ZL7 A;  4XRD A;  4N11 A;  4L5O A;  1GL8 A;  3Q6O A;  1F6M C;  4GCI A;  4HEA 2;  4Z7X A;  3DKS A;  3DEX A;  3HVV A;  3VPT A;  1FW1 A;  3HVX A;  2CZ2 A;  2C80 A;  1M3J A;  2E2M A;  4OO5 A;  5LNK e;  2DKI A;  4KGI A;  2PER A;  5G2Z A;  5HR0 A;  3E9J B;  4MMM A;  4I97 A;  2FWH A;  5ABR A;  2I9H A;  2C0F A;  1X9W B;  4TXV A;  1ZGN A;  4X0X A;  3IR4 A;  1TK0 B;  4WF5 A;  4F03 A;  1TTZ A;  2IWT A;  5G31 A;  4HUA A;  1R5A A;  5JWQ B;  2IIY A;  3ZIT A;  1OC8 A;  2E7P A;  3RPN A;  5B8A A;  4ISD A;  1FO5 A;  3TRQ A;  2YOI A;  4MZW A;  1HQO A;  3VPQ A;  1MDI A;  2MMZ A;  1ON4 A;  5CYY A;  2VCT A;  2WB9 A;  2X8C A;  1KTE A;  4KF9 A;  1M7T A;  2GST A;  4PXO A;  2IME A;  3PH9 A;  3BJ5 A;  1JZR A;  1RK4 A;  3VI7 A;  2B7J A;  2H74 A;  3LXZ A;  1A8L A;  3HCZ A;  1TW9 A;  2LEG A;  1R26 A;  3HKR A;  1HD2 A;  3A2W A;  4IS0 A;  3UAR A;  5J4U A;  3F4S A;  5D96 A;  3M8N A;  1PFO A;  3M9K A;  2UZ8 A;  5ECH B;  4MPG A;  5F8B A;  2RM5 A;  4CY8 A;  2KOK A;  2G0F A;  2VD0 A;  1JFU A;  2R4V A;  2FWE A;  2PVO C;  4PQH A;  4L0W A;  4XS6 A;  6GSX A;  4ZBD A;  5IO0 A;  2C3T A;  3UL3 A;  4K7O A;  20GS A;  4EKZ A;  1HYU A;  4IP6 A;  4N0Z A;  1NHY A;  3IAM 2;  1TK8 B;  3C71 A;  4FYU A;  2H71 A;  1UC7 A;  2WZ9 A;  2YWO A;  1XWG A;  1TI1 A;  1PKW A;  3ZVJ A;  3DWV A;  4TOP A;  3CRU A;  1EEJ A;  4V1A p;  3ZIJ A;  1J08 A;  4MH3 A;  5EY6 A;  4JE1 A;  3V1W A;  1TXX A;  2A4V A;  4F0C A;  3IK9 A;  1M2B A;  4P3Y B;  2DJK A;  4ZL8 A;  5INY A;  4G0I A;  1SKR B;  1SU9 A;  1WWJ A;  4WEY A;  4O32 A;  2DJ2 A;  1QUW A;  1TP9 A;  4Z2U A;  3DYR A;  2R5G A;  1A2L A;  2GZY A;  4ECJ A;  1SJZ A;  1GTB A;  4TXO B;  2H01 A;  3TJG A;  3TOU A;  2FWF A;  3FK8 A;  1GLP A;  1PX7 A;  3F3Q A;  1DBY A;  1YY7 A;  4I2T A;  4G0K A;  4MF5 A;  2LQQ A;  1GSQ A;  3WGX A;  2ZCT A;  4HJ2 A;  4GSS A;  3HD5 A;  2X4A A;  4MLY A;  3VWW A;  4MCU A;  5CRD A;  2I1U A;  1FHE A;  2AUV A;  2EIO A;  3KTB A;  2HSH A;  2I3Y A;  2F8F A;  1XG8 A;  3LWA A;  4HS1 A;  4HOJ A;  2I81 A;  2YV7 A;  1XOB A;  4IJ3 A;  2K8S A;  3TKQ A;  2NVL A;  2CZ3 A;  2NDO A;  1LU4 A;  3P90 A;  3MSZ A;  2IFQ A;  1GTU A;  3VWU A;  3LSZ A;  1GTI A;  1YF1 A;  1TOF A;  2BTO T;  3N9J A;  2LJR A;  2JSY A;  5ECL B;  5JCG A;  1JZW A;  4MAB A;  2X49 A;  2IMF A;  2NPB A;  3LQ7 A;  3UBK A;  4EC0 A;  3H1N A;  4ACS A;  5HQP A;  3EC3 A;  5CRE A;  3QDN A;  3IOS A;  3DVW A;  4QL7 A;  1V9W A;  4IJI A;  2VCZ A;  3LG6 A;  14GS A;  5KOX A;  4K0G A;  5ID2 B;  1NHO A;  1YKA A;  4XCS A;  5DAL B;  3M9J A;  1EV4 A;  1GLQ A;  1QXH A;  3C73 A;  4JBB A;  1XOA A;  3ERF A;  2VIM A;  4DSQ A;  1FB6 A;  1K0N A;  3FYG A;  4PTS A;  1LBK A;  4FQU A;  5KN3 A;  2V6O A;  1G6W A;  4WBR D;  2AYT A;  3D4T A;  3VWX A;  4E8H A;  4POB A;  4HJM A;  1T00 A;  2MBT A;  3D0Z A;  2GSS A;  4K2X A;  3I43 A;  2RII A;  1EEM A;  1SL2 B;  2Z9S A;  2H0H A;  2IMD A;  3TGZ A;  4EDZ A;  3W8S A;  2M46 A;  3GA4 A;  2PVQ A;  2KHP A;  2GQL A;  5CP1 A;  5IMC A;  2XC2 A;  2RUF A;  4E8E A;  3QR6 A;  4IHU A;  1EGR A;  1SEN A;  2WFC A;  2K18 A;  2HYX A;  3EIN A;  3CTG A;  3BCK A;  1GNE A;  4YQM A;  1E2Y A;  3M1G A;  2OE1 A;  3ZTL A;  3KP8 A;  2OAD A;  2TRC P;  1R4W A;  1WE0 A;  5ELA A;  1ERV A;  1Z6M A;  1TU8 A;  1PL1 A;  1WP0 A;  4JZQ A;  2LUS A;  3TRX A;  4YAP A;  4TN8 A;  2KP2 A;  3IHG A;  1M3I A;  4J2F A;  5DDL A;  3E3E A;  3GTU A;  4JED A;  3QD9 A;  1M99 A;  3L78 A;  3MAK A;  4D73 B;  3CSI A;  5IMD A;  4O5R A;  4MP4 A;  3CBU A;  4G0L A;  3LGC A;  4KW6 A;  4HQZ A;  2H1D A;  4NWY A;  2YPM A;  3KM6 A;  2HRK A;  3Q74 A;  3PGT A;  1TI3 A;  2HZE A;  4YQV A;  2JZT A;  1FB0 A;  3IV4 A;  3P2A A;  5H5S A;  2VD1 A;  3DML A;  4CY6 A;  2R37 A;  2H0G A;  5CRH A;  3ZIV A;  5BMU A;  3TKR A;  1GSF A;  3HXS A;  3TRP A;  2J23 A;  1XFL A;  4KA0 A;  2LNS A;  4Z2R A;  5BRT A;  3KCM A;  4KB3 A;  1A2J A;  2DKH A;  2GGT A;  2VCQ A;  4AJ8 A;  3I9V 2;  4RUV A;  4EIQ A;  2XBI A;  4OCF A;  1YJ6 A;  3HA9 A;  3HJM A;  2HZE B;  1RQM A;  3ZRE A;  1XWK A;  2A2S A;  5KN1 A;  3SBC A;  3GL3 A;  3VI5 A;  1AW9 A;  1YEP A;  2FHE A;  4GTU A;  1F9M A;  3GRX A;  5L71 A;  5J3R A;  2DML A;  3Q18 A;  1JZO A;  1O81 A;  4EE0 A;  2DSA A;  1GWC A;  2H1A A;  3D4M A;  1BX9 A;  1THO A;  2VL2 C;  3TKP A;  1Z7R A;  2CV4 A;  2N5F A;  4ILF A;  5B6N A;  1BG5 A;  2V32 A;  3VK9 A;  2GS3 A;  1UN2 A;  3FHK A;  1PN0 A;  3I69 A;  2OAC A;  3IA1 A;  2CT6 A;  2YJ7 A;  3ZML A;  3DRN A;  2H19 A;  5D9V A;  5DAK B;  4ZIL A;  3CTF A;  4TR1 B;  1C72 A;  2YJH A;  2FGX A;  2CVK A;  1SYR A;  4BIK A;  1WOU A;  4O92 A;  4EUY A;  2JL4 A;  2YWN A;  1XWA A;  5E59 A;  2B5X A;  2DJ0 A;  3IK7 A;  2VL2 A;  3F4T A;  4TRX A;  2OBI A;  1GTA A;  4MK3 A;  1A0R P;  2CX3 A;  4OFT A;  2PN8 A;  13GS A;  4TR0 A;  2HT9 A;  2YWI A;  2ES7 A;  3ED3 A;  1PD2 1;  4AJ6 A;  4OFN A;  3A2V A;  1GUH A;  3QFB C;  2ZUP A;  2GLR A;  1VGL A;  5B6M A;  2H73 A;  1ABA A;  2C0D A;  4FIW A;  3MIX A;  2B1L A;  4V2M A;  2GVP A;  2H66 A;  2JU5 A;  2ON5 A;  1OAZ A;  4IN0 A;  3GV1 A;  3C8E A;  1V57 A;  2MMO A;  2FD3 A;  2AJQ B;  1AQW A;  1GUM A;  1FOH A;  3G7I A;  5IMF A;  3UEM A;  4FH8 A;  2H75 A;  3R2Q A;  2EIQ A;  4DEJ A;  1M9A A;  1GUL A;  2D2Z A;  5ECO B;  4ZB8 A;  4K7I A;  1A2M A;  2C0E A;  5KEJ A;  2R0C A;  1SD9 A;  2CQ9 A;  2L6D A;  5IM9 A;  3JCM L;  4X1U A;  3G7Y A;  5F0G A;  5CRW A;  5CNW A;  3ZZX A;  4KND A;  4EXJ A;  2OE0 A;  4G10 A;  2HRA A;  1O73 A;  3L9U A;  3KJY A;  4O5Q A;  2YN1 A;  3Q19 A;  2LTK A;  3N5O A;  3TOT A;  1B8X A;  2VO4 A;  5JWR B;  2GSR A;  4KCA A;  4CHS A;  5B8B A;  3TKS E;  1ZL9 A;  5IMA A;  1TK5 B;  5JWO B;  1T3B A;  2FCH A;  4TR4 A;  4N30 A;  3WT1 A;  5C04 A;  3SWL A;  4JR6 A;  1LJR A;  4IVF A;  4WBJ A;  4HI7 A;  3GSS A;  4LMW A;  2OE3 A;  2PPT A;  1PA3 A;  3ZL5 A;  1XW6 A;  3HYP A;  1Z5Y E;  4ZBB A;  5ECQ B;  4NMU A;  3QOU A;  2B7K A;  1HNB A;  1M2A A;  1GUK A;  3TDG A;  2E2G A;  2OKA A;  4OCE A;  1VF2 A;  1MD3 A;  1ACV A;  2IJY A;  3APO A;  3UVT A;  10GS A;  4K7N A;  3I6A A;  2CX4 A;  3D22 A;  4F0B A;  5EPF A;  4YQU A;  5A4W A;  1ERT A;  3D6I A;  5KN0 A;  3O6T A;  3RBT A;  1XBS A;  2LJA A;  3F0I A;  2YCD A;  3GYK A;  4J56 E;  3WGD A;  4YKF A;  4OWY A;  3P8W A;  1AIU A;  2FWG A;  3QMX A;  1WRY A;  4GXZ A;  2QSI A;  4CW9 A;  4V2L A;  3KXO A;  5G5F A;  1F2E A;  3UOM A;  2GDR A;  4NAX A;  1A24 A;  4Q5F A;  2FY6 A;  2B5E A;  1SKW B;  3DD3 A;  2JSZ A;  1FG4 A;  3QFA C;  1O8W A;  4DSS A;  3QAG A;  1ILO A;  3HJP A;  1MDJ A;  1ZOF A;  1M9B A;  2OA7 A;  2VL9 A;  1OC9 A;  1V2A A;  1R5P A;  1GNW A;  1WMJ A;  2AAW A;  5IOW A;  3H93 A;  1M2D A;  2HXK A;  1G6Y A;  5IIZ A;  3C1S A;  3EU3 A;  5ECN B;  4PNF A;  1VF3 A;  3CQF A;  5IO2 A;  1GSE A;  1TU7 A;  4GQF A;  2O7K A;  5HFG A;  2LST A;  4USS A;  5F05 A;  5AIV A;  2PMT A;  3KEB A;  3GH9 A;  2L4C A;  3BBY A;  3KMO A;  2KLX A;  3GX0 A;  1SD8 A;  1JLV A;  3GFK A;  1FVJ A;  2PWJ A;  2IFQ B;  4OO4 A;  5LD0 A;  3US3 A;  5GAP D;  3IBH A;  4ZXG A;  2R2J A;  11GS A;  1PSQ A;  2GQK A;  3IC8 A;  4ML6 A;  4TW5 A;  1YZX A;  17GS A;  3ZFB A;  5HR3 A;  3FY7 A;  4PUA A;  3F8U A;  1TRW A;  5CAX A;  1PGT A;  5CRG A;  2O85 A;  4LMV A;  3RHC A;  4K5R A;  1X5C A;  4HDE A;  1K0A A;  1OYJ A;  4K6X A;  1R7H A;  5H5Q A;  4G2E A;  2P5R A;  4MJA A;  1SYX A;  8GSS A;  1K0B A;  2F8A A;  4CDO A;  2V2G A;  5D73 A;  3CMI A;  1A23 A;  2A2R A;  4IW9 A;  3EPT A;  1B4Q A;  1I5G A;  1OKT A;  2I4A A;  3GUR A;  5G30 A;  4F9Z A;  4GST A;  3UBL A;  3UJ1 A;  1PN9 A;  2YP6 A;  3HJO A;  1S3C A;  5ECM B;  1HNA A;  1PL2 A;  1XW9 A;  4K2D A;  1A0F A;  5GAN D;  3FZ5 A;  4X43 A;  4ECB A;  1I9D A;  5ECK B;  16GS A;  2R3X A;  3KMN A;  3ZFL A;  1SK0 A;  2K6V A;  4EF0 A;  4MZC A;  2GT6 A;  1DSB A;  4RQR A;  1CQG A;  1F3A A;  1PQN A;  5ECI B;  3FEU A;  4OFM A;  5DQY A;  3A5W A;  1KNG A;  2XPD A;  2PBJ A;  3QCP A;  2X99 A;  2VOC A;  4JRR A;  4FYB A;  2H6X A;  1PKZ A;  4WKW A;  2PGT A;  2G2Q A;  2IL3 A;  4BL7 A;  3GKX A;  1EZK A;  4N0V A;  1U87 A;  2VCW A;  2CVD A;  2B6M A;  5DJM A;  4WXT A;  4PQ1 A;  2C3N A;  2V1M A;  4KSM A;  1N2A A;  3FRC A;  5HR1 A;  2DJJ A;  3VFI A;  3GX8 A;  1OE8 A;  1GSD A;  3ZYW A;  1SK1 A;  2YWM A;  3TB2 A;  5EVO A;  5KOW A;  1MEK A;  5ECR B;  4IBP A;  1QK8 A;  2GT5 A;  2YNX A;  4PUF C;  3E0U A;  2XBQ A;  2DIY A;  2VLV A;  2H70 A;  2V6K A;  3FR9 A;  4BVY A;  3GHA A;  5DCG A;  5AIS A;  1UVZ A;  2CVB A;  1TJD A;  3DGQ A;  3PPU A;  5AN1 A;  2BMX A;  4G19 A;  3GH6 A;  1UA5 A;  5CO3 A;  3F6F A;  3GTU B;  5D9W A;  1IYI A;  2H1B A;  1YF0 A;  3J7Y k;  5DCH A;  1X9S B;  4LLR A;  4L5L A;  3LXT A;  2P0G A;  2X8H A;  2A4H A;  1ZZY A;  3KGK A;  3EU4 A;  1RW1 A;  1Q4J A;  3C1R A;  4Z2T A;  2JZR A;  1MD4 A;  4BWQ A;  6GSU A;  1T1V A;  2O89 A;  1QFN A;  3GKK A;  3ME7 A;  2CA8 A;  4BVY B;  3D21 A;  1H4O A;  4N10 A;  1K0C A;  1KBN A;  3EMP A;  3GNJ A;  5IPG A;  4HQS A;  3IAS 2;  3NIV A;  3W6G A;  5F07 A;  5DJL A;  1ZYE A;  1YKC A;  1XVW A;  3KH7 A;  1FAA A;  1X9M B;  1M0U A;  4XRA A;  1Y6E A;  2FLS A;  3FKF A;  4WF4 A;  4KX4 A;  5GSS A;  2AHE A;  2YZH A;  4IQA A;  1GP1 A;  3KP9 A;  1AQX A;  2H0I A;  2JAC A;  3APS A;  3GST A;  4Q5Q A;  3MWH A;  3J7Y b;  2M80 A;  2PU9 C;  4K1F A;  1SJI A;  2C4J A;  3IXR A;  1J9B A;  2LKU A;  2TRX A;  4FYC A;  1NW2 A;  1B4P A;  4WET A;  1AQV A;  3ME8 A;  3FZA A;  4V2N A;  2CAI A;  2FUG 2;  1FVK A;  2WJU A;  2WRT A;  1XZO A;  2VM1 A;  4IP1 A;  3ZLP A;  4ZL9 A;  3A5I A;  4DVC A;  1XW5 A;  1FOV A; 
#chains in the Genus database with same CATH homology
 2P5Q A;  1K3Y A;  2QA1 A;  3DXB A;  5COH A;  3WYW A;  5E4W A;  5J9C A;  1TRV A;  3UIW A;  1OKD A;  3H8Q A;  2FNO A;  1ML6 A;  4AGS A;  2MMA A;  2WDU A;  2VUP A;  5ECP B;  4AF2 A;  3ZRD A;  3H79 A;  2R6K A;  3CSJ A;  1XXU A;  2NBS A;  3L9S A;  3K8N A;  1SL1 B;  2L4Q A;  5DVB A;  4AJ7 A;  4MPF A;  2L59 A;  4FO5 A;  4IKH A;  4L8E A;  4YKG A;  4K0N A;  4I5Q A;  3KZQ A;  4XS1 A;  4XS4 A;  3ZMK A;  3MDK A;  4GQC A;  1G0T A;  1YQ1 A;  4F82 A;  3LYK A;  4LA1 A;  1K0D A;  4EDY A;  3BCI A;  4MA9 A;  1SL0 B;  2L57 A;  1JZD A;  7GSS A;  2C0G A;  3DIE A;  2LV3 A;  3BD2 A;  2TIR A;  2KUC A;  3CSH A;  2C8U A;  5D8I A;  3RHB A;  2DLX A;  9GSS A;  4KE3 A;  4DSR A;  4RI6 A;  2GQM A;  3LOR A;  2RM6 A;  3TJJ A;  4EVM A;  4ICY A;  3G9B A;  4O5U A;  4XS4 B;  1HNC A;  1AUC A;  2H1G A;  2O87 A;  4K5S A;  1NSW A;  5IPH A;  1EP8 A;  5DBQ A;  1XVQ A;  1O8X A;  2YAN A;  3IPZ A;  4HU7 A;  2QA2 A;  2DC5 A;  1K0M A;  2GZZ A;  4QQ7 A;  2HE3 A;  1G7O A;  1IYH A;  3U5R E;  3QAW A;  2C3Q A;  3GMF A;  1ERU A;  1SKS B;  4X4J A;  3KD0 A;  1W4V A;  4TKY A;  3FMW A;  3ZVJ D;  2H6Y A;  4MF7 A;  2GZP A;  4HZ4 A;  1GSY A;  3F4R A;  4IEL A;  3M0F A;  1GSU A;  2AB6 A;  3A2X A;  1DE1 A;  1OVN A;  4NHW A;  1WJK A;  3FZ9 A;  1ZYN A;  3LFL A;  2J9H A;  3O76 A;  1QGV A;  5GST A;  4MJB A;  1AAZ A;  1BJX A;  4GRF A;  4HU9 A;  1V40 A;  6GSV A;  1B9X C;  2L5L A;  4TR3 A;  2DMM A;  1K0O A;  4ULX A;  4PGT A;  4OMV A;  2IMI A;  5A4U A;  2HSY A;  3WD6 A;  4MH2 A;  5F06 A;  2H8L A;  2CAQ A;  1O7U A;  5AIX A;  1QMV A;  5HFK A;  4MJE A;  1ERW A;  4TXO A;  5LCZ A;  4PUR A;  1QQ2 A;  1O6J A;  4JR4 A;  2N5A A;  2N5B A;  3TKS C;  3KIJ A;  4ECI A;  4H86 A;  3RPP A;  2JAD A;  5H5R A;  4EIP A;  2B1K A;  2LS5 A;  1SJ6 A;  4BWS A;  2FA4 A;  6GSS A;  4ZB9 A;  1MDK A;  4RQX A;  2LRC A;  5DQS A;  2LQO A;  1V98 A;  2YV9 A;  2H72 A;  1X5D A;  5HR2 A;  3IC4 A;  4BVX A;  5A4V A;  1O85 A;  1URM A;  3ERG A;  2YZU A;  5G5E A;  2ALB A;  3LEF A;  1T8E B;  5FT3 A;  1EV9 A;  3TJF A;  1TKD B;  4I2U A;  3GKM A;  3VLN A;  4JU5 A;  3GIX A;  4OD7 A;  3TCO A;  5IOX A;  2MZC A;  3TKS A;  1ST9 A;  3CRT A;  1J0F A;  3W8J A;  2X8G A;  3HY2 A;  3HZ4 A;  3HDC A;  5J9B A;  1BYE A;  2HSM A;  1U3A A;  3F9U A;  3GN3 A;  3L9V A;  3L0H A;  4K8M A;  4BVX B;  2MYG A;  1EOH A;  4PX1 A;  3VWV A;  3A3T A;  3NZN A;  4O7H A;  2OBK A;  4BA7 A;  2BJX A;  2R0G A;  5FHI A;  5G1K A;  3IDV A;  3EMX A;  4KSO A;  1GH2 A;  4DSS B;  2KP1 A;  4MNN A;  2E0Q A;  4BPY A;  2F3M A;  4MDC A;  4GF0 A;  5IMV A;  1OC9 B;  2LRN A;  2VLT A;  4MZB A;  2MMN A;  1OC3 A;  4MF6 A;  5ID2 A;  5JCW A;  5ENU A;  3KTL A;  2WGR A;  5DAL A;  2ZNM A;  2VLU A;  4A5P A;  1W89 A;  2LJK A;  4NV2 A;  1JLW A;  2VL3 A;  2HZF A;  1K3L A;  4K9Z A;  4L0U A;  1GRX A;  4XHM A;  2HFD A;  1EOG A;  3CYN A;  1ZMA A;  1EWX A;  3EWL A;  5ELG A;  1ZYQ B;  1XIY A;  6GSY A;  5D93 A;  2QKE A;  5EL8 A;  3D5J A;  3QPM A;  4NPB A;  4J57 E;  1X0R A;  2QC7 A;  3VUR A;  2B5Y A;  3KH9 A;  3HHV A;  1A8Y A;  1YEX A;  3DVX A;  1JHB A;  2H30 A;  2EC4 A;  1TDI A;  1Z3E A;  2QGV A;  22GS A;  2K9F A;  5D9X A;  3EUR A;  3EVI A;  2XPE A;  2MBS A;  4ECC A;  3G7J A;  1F3B A;  3F63 A;  1XWC A;  5ECS A;  3UVH A;  3EYT A;  1Q98 A;  3LW9 A;  1T4Z A;  1PMT A;  5FWG A;  3WGE A;  4ID0 A;  5G1L A;  1Z7P A;  1N8J A;  4LL1 B;  3R3E A;  2FA8 A;  1BED A;  6GSW A;  3LYP A;  2L5O A;  3TUE A;  4KDU A;  2REM A;  3U6V A;  1VF4 A;  2EIR A;  4KAE A;  2H76 A;  6GST A;  5B7C A;  4YH2 A;  3CXG A;  3AY8 A;  4IQ1 A;  1EGO A;  1BQ7 A;  1OE7 A;  2RLI A;  4Q5N A;  1DUG A;  2VM2 A;  4POL A;  2DJ1 A;  2WUL A;  2VCV A;  3MYD A;  3HVS A;  1PRX A;  3NOF A;  5AGY A;  4KH7 A;  1BAY A;  3M3M A;  2K8V A;  4PQI A;  3APQ A;  1YDK A;  3S9F A;  3FZ4 A;  4Q5R A;  3H4K A;  2OJL A;  3QAV A;  3LJR A;  4D73 A;  2F9S A;  4NV5 A;  3O3T A;  4GLT A;  1Z6N A;  4LL4 B;  2IMK A;  3UMA A;  1V58 A;  3ISO A;  3ERW A;  1KEB A;  4WR5 A;  3WT2 A;  3F6D A;  1VF1 A;  3L4N A;  4IGJ A;  3IHQ A;  4POK A;  1GSS A;  4KDX A;  4BL7 B;  1U88 A;  1Y25 A;  2RUE A;  4NXI A;  4XTS A;  19GS A;  1Z9H A;  2DJ3 A;  4V1A g;  4RI7 A;  2HLS A;  3TJK A;  4KCE A;  1ZCP A;  4GSN A;  1F37 A;  2X64 A;  2NTO A;  3TJB A;  4G9H A;  2IN3 A;  2ON7 A;  1U3I A;  3IE3 A;  3PR8 A;  4WR4 A;  2WS2 A;  2HI7 A;  1U6T A;  2HRN A;  4KUN A;  4XIH A;  4F2I A;  1E6B A;  1NM3 A;  1K3O A;  4QL9 A;  3UAP A;  1WIK A;  1S3A A;  1H75 A;  2WCI A;  5J5N A;  2LRT A;  2JZS A;  1G7E A;  2AV4 A;  1TRS A;  1VRS D;  2HRF A;  4EO3 A;  4ZBA A;  1SK2 A;  2DIZ A;  1XCC A;  1WPI A;  4YAV A;  1XWB A;  2DBC A;  2B3S A;  5C00 A;  2VCX A;  1CQH A;  3MNG A;  5JCU A;  1PX6 A;  4ZIJ A;  4I6X A;  2XHF A;  2M72 A;  18GS A;  1AXD A;  5IMZ A;  5D9T A;  3F3R A;  4I8B A;  5A5K A;  3IRA A;  12GS A;  3PIN A;  1T7P B;  2V41 A;  2HNL A;  5DAK A;  3FR3 A;  1MTC A;  2GSQ A;  4TR1 A;  1ZYP A;  3RAZ A;  1TRU A;  2VAF A;  2IPA A;  2LNT A;  1S3D A;  2R0P A;  3GL5 A;  5J41 A;  1DE2 A;  3EE2 A;  2A2P A;  5IQY A;  3FR6 A;  1AC1 A;  5HFI A;  3RDW A;  4KDY A;  4TVE A;  1B9Y C;  1USB A;  4NHZ A;  1B48 A;  4POM A;  2L6C A;  2GTU A;  4ZB6 A;  5KN2 A;  4ML1 A;  2H6Z A;  2P31 A;  2O8V B;  3P7X A;  4MJC A;  3BOA A;  3OR5 A;  2C1Y A;  4EL1 A;  3HZ8 A;  1X5E A;  2PUK C;  4PNG A;  5GZZ B;  4HZ2 A;  1XPV A;  1EP7 A;  1THX A;  3FW2 A;  1T4Y A;  2F51 A;  3GKN A;  4GWR A;  3GUS A;  3C7M A;  4ZL7 A;  4XRD A;  4N11 A;  4L5O A;  1GL8 A;  3Q6O A;  1F6M C;  4GCI A;  4HEA 2;  4Z7X A;  3DKS A;  3DEX A;  3HVV A;  3VPT A;  1FW1 A;  3HVX A;  2CZ2 A;  2C80 A;  2E2M A;  4OO5 A;  5LNK e;  2DKI A;  4KGI A;  2PER A;  5G2Z A;  5HR0 A;  3E9J B;  4MMM A;  4I97 A;  2FWH A;  5ABR A;  2I9H A;  2C0F A;  1X9W B;  4TXV A;  1ZGN A;  4X0X A;  3IR4 A;  1TK0 B;  4WF5 A;  4F03 A;  1TTZ A;  2IWT A;  5G31 A;  4HUA A;  1R5A A;  5JWQ B;  2IIY A;  3ZIT A;  1OC8 A;  2E7P A;  3RPN A;  5B8A A;  4ISD A;  1FO5 A;  3TRQ A;  2YOI A;  4MZW A;  1HQO A;  3VPQ A;  1MDI A;  2MMZ A;  1ON4 A;  5CYY A;  2VCT A;  2WB9 A;  2X8C A;  1KTE A;  4KF9 A;  1M7T A;  2GST A;  4PXO A;  2IME A;  3PH9 A;  3BJ5 A;  1JZR A;  1RK4 A;  3VI7 A;  2B7J A;  2H74 A;  3LXZ A;  1A8L A;  3HCZ A;  1TW9 A;  2LEG A;  1R26 A;  3HKR A;  1HD2 A;  3A2W A;  4IS0 A;  3UAR A;  5J4U A;  3F4S A;  5D96 A;  3M8N A;  3M9K A;  2UZ8 A;  5ECH B;  4MPG A;  5F8B A;  2RM5 A;  4CY8 A;  2KOK A;  2G0F A;  2VD0 A;  1JFU A;  2R4V A;  2FWE A;  2PVO C;  4PQH A;  4L0W A;  4XS6 A;  6GSX A;  4ZBD A;  5IO0 A;  2C3T A;  3UL3 A;  4K7O A;  20GS A;  4EKZ A;  1HYU A;  4IP6 A;  4N0Z A;  1NHY A;  3IAM 2;  1TK8 B;  3C71 A;  4FYU A;  2H71 A;  1UC7 A;  2WZ9 A;  2YWO A;  1XWG A;  1TI1 A;  1PKW A;  3ZVJ A;  3DWV A;  4TOP A;  3CRU A;  1EEJ A;  4V1A p;  3ZIJ A;  1J08 A;  4MH3 A;  5EY6 A;  4JE1 A;  3V1W A;  1TXX A;  2A4V A;  4F0C A;  3IK9 A;  1M2B A;  4P3Y B;  2DJK A;  4ZL8 A;  5INY A;  4G0I A;  1SKR B;  1SU9 A;  1WWJ A;  4WEY A;  4O32 A;  2DJ2 A;  1QUW A;  1TP9 A;  4Z2U A;  3DYR A;  2R5G A;  1A2L A;  2GZY A;  4ECJ A;  1SJZ A;  1GTB A;  4TXO B;  2H01 A;  3TJG A;  3TOU A;  2FWF A;  3FK8 A;  1GLP A;  1PX7 A;  3F3Q A;  1DBY A;  1YY7 A;  4I2T A;  4G0K A;  4MF5 A;  2LQQ A;  1GSQ A;  3WGX A;  2ZCT A;  4HJ2 A;  4GSS A;  3HD5 A;  2X4A A;  4MLY A;  3VWW A;  4MCU A;  5CRD A;  2I1U A;  1FHE A;  2AUV A;  2EIO A;  3KTB A;  2HSH A;  2I3Y A;  2F8F A;  3LWA A;  4HS1 A;  4HOJ A;  2I81 A;  2YV7 A;  1XOB A;  4IJ3 A;  2K8S A;  3TKQ A;  2NVL A;  2CZ3 A;  2NDO A;  1LU4 A;  3P90 A;  3MSZ A;  2IFQ A;  1GTU A;  3VWU A;  3LSZ A;  1GTI A;  1YF1 A;  1TOF A;  2BTO T;  3N9J A;  2LJR A;  2JSY A;  5ECL B;  5JCG A;  1JZW A;  4MAB A;  2X49 A;  2IMF A;  2NPB A;  3LQ7 A;  3UBK A;  4EC0 A;  3H1N A;  4ACS A;  5HQP A;  3EC3 A;  5CRE A;  3QDN A;  3IOS A;  3DVW A;  4QL7 A;  1V9W A;  4IJI A;  2VCZ A;  3LG6 A;  14GS A;  5KOX A;  4K0G A;  5ID2 B;  1NHO A;  1YKA A;  4XCS A;  5DAL B;  3M9J A;  1EV4 A;  1GLQ A;  1QXH A;  3C73 A;  4JBB A;  1XOA A;  3ERF A;  2VIM A;  4DSQ A;  1FB6 A;  1K0N A;  3FYG A;  4PTS A;  1LBK A;  4FQU A;  5KN3 A;  2V6O A;  1G6W A;  4WBR D;  2AYT A;  3D4T A;  3VWX A;  4E8H A;  4POB A;  4HJM A;  1T00 A;  2MBT A;  3D0Z A;  2GSS A;  4K2X A;  3I43 A;  2RII A;  1EEM A;  1SL2 B;  2Z9S A;  2H0H A;  2IMD A;  3TGZ A;  4EDZ A;  3W8S A;  2M46 A;  3GA4 A;  2PVQ A;  2KHP A;  2GQL A;  5CP1 A;  5IMC A;  2XC2 A;  2RUF A;  4E8E A;  3QR6 A;  4IHU A;  1EGR A;  1SEN A;  2WFC A;  2K18 A;  2HYX A;  3EIN A;  3CTG A;  3BCK A;  1GNE A;  4YQM A;  1E2Y A;  3M1G A;  2OE1 A;  3ZTL A;  3KP8 A;  2OAD A;  2TRC P;  1R4W A;  1WE0 A;  5ELA A;  1ERV A;  1Z6M A;  1TU8 A;  1PL1 A;  1WP0 A;  4JZQ A;  2LUS A;  3TRX A;  4YAP A;  4TN8 A;  2KP2 A;  3IHG A;  4J2F A;  5DDL A;  3E3E A;  3GTU A;  4JED A;  3QD9 A;  1M99 A;  3L78 A;  3MAK A;  4D73 B;  3CSI A;  5IMD A;  4O5R A;  4MP4 A;  3CBU A;  4G0L A;  3LGC A;  4KW6 A;  4HQZ A;  2H1D A;  4NWY A;  2YPM A;  3KM6 A;  2HRK A;  3Q74 A;  3PGT A;  1TI3 A;  2HZE A;  4YQV A;  2JZT A;  1FB0 A;  3IV4 A;  3P2A A;  5H5S A;  2VD1 A;  3DML A;  4CY6 A;  2R37 A;  2H0G A;  5CRH A;  3ZIV A;  5BMU A;  3TKR A;  1GSF A;  3HXS A;  3TRP A;  2J23 A;  1XFL A;  4KA0 A;  2LNS A;  4Z2R A;  5BRT A;  3KCM A;  4KB3 A;  1A2J A;  2DKH A;  2GGT A;  2VCQ A;  4AJ8 A;  3I9V 2;  4RUV A;  4EIQ A;  2XBI A;  4OCF A;  1YJ6 A;  3HA9 A;  3HJM A;  2HZE B;  1RQM A;  3ZRE A;  1XWK A;  2A2S A;  5KN1 A;  3SBC A;  3GL3 A;  3VI5 A;  1AW9 A;  1YEP A;  2FHE A;  4GTU A;  1F9M A;  3GRX A;  5L71 A;  5J3R A;  2DML A;  3Q18 A;  1JZO A;  1O81 A;  4EE0 A;  2DSA A;  1GWC A;  2H1A A;  3D4M A;  1BX9 A;  1THO A;  2VL2 C;  3TKP A;  1Z7R A;  2CV4 A;  2N5F A;  4ILF A;  5B6N A;  1BG5 A;  2V32 A;  3VK9 A;  2GS3 A;  1UN2 A;  3FHK A;  1PN0 A;  3I69 A;  2OAC A;  3IA1 A;  2CT6 A;  2YJ7 A;  3ZML A;  3DRN A;  2H19 A;  5D9V A;  5DAK B;  4ZIL A;  3CTF A;  4TR1 B;  1C72 A;  2YJH A;  2FGX A;  2CVK A;  1SYR A;  1WOU A;  4O92 A;  4EUY A;  2JL4 A;  2YWN A;  1XWA A;  5E59 A;  2B5X A;  2DJ0 A;  3IK7 A;  2VL2 A;  3F4T A;  4TRX A;  2OBI A;  1GTA A;  4MK3 A;  1A0R P;  2CX3 A;  4OFT A;  2PN8 A;  13GS A;  4TR0 A;  2HT9 A;  2YWI A;  2ES7 A;  3ED3 A;  1PD2 1;  4AJ6 A;  4OFN A;  3A2V A;  1GUH A;  3QFB C;  2ZUP A;  2GLR A;  1VGL A;  5B6M A;  2H73 A;  1ABA A;  2C0D A;  4FIW A;  3MIX A;  2B1L A;  4V2M A;  2GVP A;  2H66 A;  2JU5 A;  2ON5 A;  1OAZ A;  4IN0 A;  3GV1 A;  3C8E A;  1V57 A;  2MMO A;  2FD3 A;  2AJQ B;  1AQW A;  1GUM A;  1FOH A;  3G7I A;  5IMF A;  3UEM A;  4FH8 A;  2H75 A;  3R2Q A;  2EIQ A;  4DEJ A;  1M9A A;  1GUL A;  2D2Z A;  5ECO B;  4ZB8 A;  4K7I A;  1A2M A;  2C0E A;  5KEJ A;  2R0C A;  1SD9 A;  2CQ9 A;  2L6D A;  5IM9 A;  3JCM L;  4X1U A;  3G7Y A;  5F0G A;  5CRW A;  5CNW A;  3ZZX A;  4KND A;  4EXJ A;  2OE0 A;  4G10 A;  2HRA A;  1O73 A;  3L9U A;  3KJY A;  4O5Q A;  2YN1 A;  3Q19 A;  2LTK A;  3N5O A;  3TOT A;  1B8X A;  2VO4 A;  5JWR B;  2GSR A;  4KCA A;  4CHS A;  5B8B A;  3TKS E;  1ZL9 A;  5IMA A;  1TK5 B;  5JWO B;  1T3B A;  2FCH A;  4TR4 A;  4N30 A;  3WT1 A;  5C04 A;  3SWL A;  4JR6 A;  1LJR A;  4IVF A;  4WBJ A;  4HI7 A;  3GSS A;  4LMW A;  2OE3 A;  2PPT A;  1PA3 A;  3ZL5 A;  1XW6 A;  3HYP A;  1Z5Y E;  4ZBB A;  5ECQ B;  4NMU A;  3QOU A;  2B7K A;  1HNB A;  1M2A A;  1GUK A;  3TDG A;  2E2G A;  2OKA A;  4OCE A;  1VF2 A;  1MD3 A;  1ACV A;  2IJY A;  3APO A;  3UVT A;  10GS A;  4K7N A;  3I6A A;  2CX4 A;  3D22 A;  4F0B A;  5EPF A;  4YQU A;  5A4W A;  1ERT A;  3D6I A;  5KN0 A;  3O6T A;  3RBT A;  1XBS A;  2LJA A;  3F0I A;  2YCD A;  3GYK A;  4J56 E;  3WGD A;  4YKF A;  4OWY A;  3P8W A;  1AIU A;  2FWG A;  3QMX A;  1WRY A;  4GXZ A;  2QSI A;  4CW9 A;  4V2L A;  3KXO A;  5G5F A;  1F2E A;  3UOM A;  2GDR A;  4NAX A;  1A24 A;  4Q5F A;  2FY6 A;  2B5E A;  1SKW B;  3DD3 A;  2JSZ A;  1FG4 A;  3QFA C;  1O8W A;  4DSS A;  3QAG A;  1ILO A;  3HJP A;  1MDJ A;  1ZOF A;  1M9B A;  2OA7 A;  2VL9 A;  1OC9 A;  1V2A A;  1R5P A;  1GNW A;  1WMJ A;  2AAW A;  5IOW A;  3H93 A;  1M2D A;  2HXK A;  1G6Y A;  5IIZ A;  3C1S A;  3EU3 A;  5ECN B;  4PNF A;  1VF3 A;  5IO2 A;  1GSE A;  1TU7 A;  4GQF A;  2O7K A;  5HFG A;  2LST A;  4USS A;  5F05 A;  5AIV A;  2PMT A;  3KEB A;  3GH9 A;  2L4C A;  3BBY A;  3KMO A;  2KLX A;  3GX0 A;  1SD8 A;  1JLV A;  3GFK A;  1FVJ A;  2PWJ A;  2IFQ B;  4OO4 A;  5LD0 A;  3US3 A;  5GAP D;  3IBH A;  4ZXG A;  2R2J A;  11GS A;  1PSQ A;  2GQK A;  3IC8 A;  4ML6 A;  4TW5 A;  1YZX A;  17GS A;  3ZFB A;  5HR3 A;  3FY7 A;  4PUA A;  3F8U A;  1TRW A;  5CAX A;  1PGT A;  5CRG A;  2O85 A;  4LMV A;  3RHC A;  4K5R A;  1X5C A;  4HDE A;  1K0A A;  1OYJ A;  4K6X A;  1R7H A;  5H5Q A;  4G2E A;  2P5R A;  4MJA A;  1SYX A;  8GSS A;  1K0B A;  2F8A A;  4CDO A;  5D73 A;  2V2G A;  3CMI A;  1A23 A;  2A2R A;  4IW9 A;  3EPT A;  1B4Q A;  1I5G A;  1OKT A;  2I4A A;  3GUR A;  5G30 A;  4F9Z A;  4GST A;  3UBL A;  3UJ1 A;  1PN9 A;  2YP6 A;  3HJO A;  1S3C A;  5ECM B;  1HNA A;  1PL2 A;  1XW9 A;  4K2D A;  1A0F A;  5GAN D;  3FZ5 A;  4X43 A;  4ECB A;  1I9D A;  5ECK B;  16GS A;  2R3X A;  3KMN A;  3ZFL A;  1SK0 A;  2K6V A;  4EF0 A;  4MZC A;  2GT6 A;  1DSB A;  4RQR A;  1CQG A;  1F3A A;  1PQN A;  5ECI B;  3FEU A;  4OFM A;  5DQY A;  3A5W A;  1KNG A;  2XPD A;  2PBJ A;  3QCP A;  2X99 A;  2VOC A;  4JRR A;  4FYB A;  2H6X A;  1PKZ A;  4WKW A;  2PGT A;  2G2Q A;  2IL3 A;  4BL7 A;  3GKX A;  1EZK A;  4N0V A;  1U87 A;  2VCW A;  2CVD A;  2B6M A;  5DJM A;  4WXT A;  4PQ1 A;  2C3N A;  2V1M A;  4KSM A;  1N2A A;  3FRC A;  5HR1 A;  2DJJ A;  3VFI A;  3GX8 A;  1OE8 A;  1GSD A;  3ZYW A;  1SK1 A;  2YWM A;  3TB2 A;  5EVO A;  5KOW A;  1MEK A;  5ECR B;  4IBP A;  1QK8 A;  2GT5 A;  2YNX A;  4PUF C;  3E0U A;  2XBQ A;  2DIY A;  2VLV A;  2H70 A;  2V6K A;  3FR9 A;  4BVY A;  3GHA A;  5DCG A;  5AIS A;  1UVZ A;  2CVB A;  1TJD A;  3DGQ A;  3PPU A;  5AN1 A;  2BMX A;  4G19 A;  3GH6 A;  1UA5 A;  5CO3 A;  3F6F A;  3GTU B;  5D9W A;  1IYI A;  2H1B A;  1YF0 A;  3J7Y k;  5DCH A;  1X9S B;  4LLR A;  4L5L A;  3LXT A;  2P0G A;  2X8H A;  2A4H A;  1ZZY A;  3KGK A;  3EU4 A;  1RW1 A;  1Q4J A;  3C1R A;  4Z2T A;  2JZR A;  1MD4 A;  4BWQ A;  6GSU A;  1T1V A;  2O89 A;  1QFN A;  3GKK A;  3ME7 A;  2CA8 A;  4BVY B;  3D21 A;  1H4O A;  4N10 A;  1K0C A;  1KBN A;  3EMP A;  3GNJ A;  5IPG A;  4HQS A;  3IAS 2;  3NIV A;  3W6G A;  5F07 A;  5DJL A;  1ZYE A;  1YKC A;  1XVW A;  3KH7 A;  1FAA A;  1X9M B;  1M0U A;  4XRA A;  1Y6E A;  2FLS A;  3FKF A;  4WF4 A;  4KX4 A;  5GSS A;  2AHE A;  2YZH A;  4IQA A;  1GP1 A;  3KP9 A;  1AQX A;  2H0I A;  2JAC A;  3APS A;  3GST A;  4Q5Q A;  3MWH A;  3J7Y b;  2M80 A;  2PU9 C;  4K1F A;  1SJI A;  2C4J A;  3IXR A;  1J9B A;  2LKU A;  2TRX A;  4FYC A;  1NW2 A;  1B4P A;  4WET A;  1AQV A;  3ME8 A;  3FZA A;  4V2N A;  2CAI A;  2FUG 2;  1FVK A;  2WJU A;  2WRT A;  1XZO A;  2VM1 A;  4IP1 A;  3ZLP A;  4ZL9 A;  3A5I A;  4DVC A;  1XW5 A;  1FOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...