5COHA

Crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans crystallized in presence of beta-mercaptoethanol
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
231
structure length
231
Chain Sequence
SEKIRVDIWSDIACPWCYIGKRRFESALGQFPQRDQVEVVWHSFELDPSARPLNPIAMRDGLAMKYSISPAQAQGSLDHMTQTAAQEGLEYHFDRVKLANTFLAHQLIHYAAEQGQGDAMKERLLRAYMSEGQNVNDLDTLQKLAAEVGLDAGAARAALEAGTYAQAVRYDEAQAQQLGITGVPFFVLGGKYGVSGAQAPETLLGALSQVWAEQHPAPLTMLGQDAPAEGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FrnE protein
publication title drFrnE Represents a Hitherto Unknown Class of Eubacterial Cytoplasmic Disulfide Oxido-Reductases.
pubmed doi rcsb
source organism Deinococcus radiodurans (strain atcc 13939 / dsm 20539 / jcm 16871 / lmg 4051 /
total genus 88
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2015-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5cohA01
2X99A 3UIWA 5JCGA 1V40A 1GLQA 4TOPA 1SKWB 2NVLA 4J57E 5JWRB 4Q5FA 3R2QA 1YEXA 1V57A 2M72A 1B9YC 3GIXA 3QPMA 4JE1A 1FB0A 2L6DA 2B7JA 2M46A 2R5GA 2MMZA 1B48A 2H1GA 2HSHA 2VCTA 4NMUA 4NHZA 1C72A 3GRXA 3WGEA 2TRCP 2VLTA 4EF0A 5G2ZA 3C71A 2DIZA 3TKSC 4BL7A 2P31A 3ZREA 5FHIA 1YKCA 4F0CA 5B6NA 1LJRA 4POLA 1WPIA 3JCML 2H6XA 4MLYA 3OR5A 1W4VA 2HXKA 4XRDA 3VPQA 2DIYA 4CHSA 4DSRA 4GWRA 2FWHA 1GUMA 5J3RA 1XBSA 2L57A 4EDYA 6GSWA 2C8UA 2WGRA 2PGTA 3P2AA 5L71A 17GSA 2HT9A 5CRHA 3D0ZA 1MTCA 5E59A 2B1KA 3DKSA 2F8AA 3TKSE 4G2EA 4EVMA 4AJ7A 5JWOB 3O3TA 5IMVA 5ECRB 2OBIA 4OO5A 4N0VA 4ZB6A 3UEMA 3M1GA 4ZL9A 4PQHA 1ERVA 3VI7A 4DVCA 4I5QA 5EPFA 14GSA 1XIYA 2V6KA 4K7NA 2PBJA 4FH8A 1WWJA 2C0EA 4EC0A 2VD1A 2NPBA 2O8VB 3F8UA 3TRPA 1EZKA 2BTOT 2FWEA 3ZYWA 1GUKA 3M3MA 3GKMA 5F0GA 5IIZA 3E3EA 2H75A 3N5OA 5ABRA 3A2VA 1JLVA 1TU8A 5IMDA 2YCDA 19GSA 2HYXA 3FZ5A 2WRTA 2PVOC 2N5FA 1U3IA 4FYCA 1UA5A 3CMIA 4K6XA 1B4PA 1LU4A 2YN1A 4IBPA 1EGRA 2CAQA 1O81A 1THOA 1PX7A 2LJRA 1X0RA 2OBKA 4IELA 3CXGA 5H5SA 2H8LA 2E7PA 2H6ZA 1JZRA 3H4KA 3TJJA 1SD9A 1UN2A 1TRUA 5G5EA 2R4VA 3C1SA 3ZZXA 5DDLA 2FHEA 2P5RA 1ZOFA 5D96A 5IOXA 2LJKA 3CSHA 1XW9A 3EU3A 5GAPD 4LLRA 3DVWA 3E0UA 1T4ZA 5JWQB 4ECIA 16GSA 3UVTA 3L9SA 2VD0A 2CVKA 3C7MA 4F0BA 5DBQA 4YQUA 2IL3A 2JADA 4ISDA 3EE2A 3LG6A 4BVYA 2LEGA 5HFKA 3H93A 2J23A 5ECKB 2P5QA 1X9MB 4IGJA 1K0CA 1TU7A 2WZ9A 4GQCA 2PMTA 1DE1A 3HXSA 4G9HA 2GZPA 5CREA 5F05A 2ZNMA 3FYGA 1QXHA 4KAEA 3QD9A 3TKSA 2M80A 4JEDA 1AW9A 2AAWA 2YNXA 2LQQA 3TJBA 1M2AA 4PUAA 2KOKA 1WE0A 2YJHA 3IK9A 1F3AA 2YZHA 2LRTA 1TJDA 2CV4A 3FY7A 3G7IA 2H66A 4DSSB 1PD21 2BJXA 4HUAA 1GL8A 2HZFA 1GSEA 4N30A 1Y6EA 4TR3A 4EO3A 5JCWA 1T00A 3LORA 20GSA 2QC7A 2GT5A 5INYA 3MDKA 1SL2B 5LCZA 5HR0A 6GSTA 1QMVA 2ALBA 2GQKA 4JRRA 2CVBA 2CA8A 1O85A 3ME7A 2XC2A 5A4VA 4MPGA 1XWAA 2H70A 4IP6A 2RUEA 4P3YB 5IMFA 5ECHB 2K18A 2OE3A 1XWGA 1F37A 1JFUA 1TW9A 4PGTA 3A5WA 2FWGA 4PQIA 4DSSA 1SYRA 4MA9A 2H1AA 2VLUA 5CO3A 5AGYA 1A2LA 7GSSA 2L59A 4HI7A 1VRSD 3J7Yb 2N5BA 18GSA 4K9ZA 3VLNA 2R37A 1BYEA 5ELAA 1KNGA 1E2YA 4YQMA 2A2RA 3HKRA 2GSRA 1EOGA 5J41A 5IMAA 4K1FA 1GWCA 1N2AA 2PWJA 3UL3A 3WD6A 3DRNA 3KM6A 2MMNA 3KP8A 4KNDA 5B8AA 1A0FA 2CZ3A 1EEJA 1NSWA 1EV4A 5D73A 2AB6A 1T7PB 2K8VA 1PGTA 4OMVA 5COHA 4PURA 4NV2A 2WCIA 3KGKA 2PN8A 3SWLA 2BMXA 2O85A 2IJYA 3LFLA 3M8NA 3UVHA 3FHKA 1WJKA 3TB2A 1ON4A 1GTBA 4TW5A 3LSZA 2IMFA 3D4TA 4WR5A 3RPPA 2DJKA 1HNBA 5D9VA 9GSSA 2VM2A 4HQZA 1GRXA 4L5OA 1BEDA 4WF5A 4MJAA 3IE3A 3KD0A 4QQ7A 1WRYA 2GZZA 2FCHA 1K0AA 4LMWA 4OWYA 3LWAA 1XZOA 3LYKA 3ZVJD 1HQOA 4KX4A 2VCWA 4OFNA 2DMMA 4AJ8A 2HRFA 4JR6A 2WJUA 2OE0A 1N8JA 2LRCA 2P0GA 3W6GA 4XHMA 4XRAA 3QAGA 3LYPA 4YH2A 5B6MA 4PNGA 3VK9A 2LV3A 3F3RA 2FD3A 4GCIA 4MZCA 2RUFA 1OVNA 4CW9A 3APSA 3IRAA 3LQ7A 2I81A 2H74A 1ZYQB 3FZ4A 4ECJA 2H71A 2G0FA 1SJ6A 2JZRA 1XPVA 1QGVA 1JLWA 5KEJA 1BG5A 3KXOA 2L6CA 4GSSA 2L5OA 2YWNA 2IFQB 3VI5A 10GSA 5DALB 4TRXA 2MMAA 1NHYA 3D4MA 2FNOA 1MDIA 5G5FA 1YY7A 2GDRA 5CRDA 2VCQA 5ELGA 5GSTA 2ZUPA 3SBCA 4DEJA 4MH3A 3TJGA 2MMOA 2B1LA 2H01A 3Q6OA 3GA4A 1O8XA 3GHAA 2I1UA 2LNTA 1Z9HA 2O89A 1ACVA 2PU9C 5D93A 3M9KA 5KN1A 4BVXA 2IIYA 1B8XA 2H73A 6GSSA 4IVFA 2B5XA 2EC4A 3WT1A 2JSYA 1ZYEA 4KCEA 3ZITA 3CTFA 2IFQA 4AJ6A 3GNJA 5DALA 2CVDA 2HFDA 1ILOA 1Z5YE 3L0HA 1R5AA 4Q5QA 5AISA 4MZWA 1M0UA 4L5LA 1PKWA 3HYPA 3US3A 3ISOA 1AAZA 4QL9A 1QUWA 3KTLA 5ECSA 4OCFA 2V32A 4I8BA 2KP1A 1W89A 3EMXA 1YEPA 4K8MA 3KTBA 2NTOA 2B5YA 2WB9A 2PUKC 2WDUA 1NW2A 3C1RA 2K8SA 2F3MA 4MJBA 5IPGA 1MDJA 2O87A 1U3AA 2GT6A 1MD3A 1PQNA 3I9V2 1VF1A 1TI3A 1I5GA 2Z9SA 2X8CA 2TRXA 2YOIA 5LNKe 3CSJA 2H1BA 3J7Yk 3TUEA 4YQVA 4KW6A 2CZ2A 3BOAA 3MNGA 4I2TA 4KUNA 4E8HA 1O6JA 3GUSA 2FWFA 2LTKA 4GRFA 2H30A 4GXZA 1FVKA 1XXUA 3GKNA 4AF2A 5FT3A 5IO2A 3GN3A 1F2EA 3DXBA 4KB3A 2X64A 1ZMAA 2RM5A 2JU5A 4ZBDA 2YWMA 3ZRDA 4H86A 2E2GA 3A3TA 2YANA 5ECMB 4IHUA 3IA1A 1K0NA 3CRUA 2K6VA 3O6TA 2C4JA 3IPZA 4WXTA 2GQMA 2VCZA 5DAKB 1YQ1A 2I9HA 3WGDA 1Z3EA 2LSTA 1TRSA 2FLSA 5IOWA 3WT2A 3CSIA 3FEUA 2C80A 1ZL9A 3TJKA 2VIMA 4IS0A 1IYHA 4HZ4A 5HR1A 3DMLA 1ERUA 1EWXA 5ECOB 3GX0A 1PX6A 5G31A 1GSQA 1Z6NA 2AUVA 1SK0A 1OKDA 1FO5A 4K0NA 2NDOA 2LJAA 4J2FA 2TIRA 2HE3A 1U88A 3IK7A 4LMVA 2PERA 4JU5A 1TTZA 5GZZB 4HJ2A 4AGSA 5DAKA 5CRWA 1QFNA 2DC5A 4TR1B 4OFTA 3U6VA 3ZLPA 1TK5B 1TDIA 3KZQA 1RW1A 1XVQA 3APOA 4IQ1A 2ON7A 2CQ9A 4RI6A 2MBSA 1G0TA 2GSSA 2YP6A 4ZBAA 5F07A 1TXXA 4MABA 3GSSA 3TDGA 3KMNA 3ME8A 3NIVA 2QGVA 4X0XA 1AXDA 4LL1B 5G1KA 1FB6A 3GL3A 4XTSA 4NPBA 5HFIA 1X9SB 3MWHA 1YZXA 3EVIA 3C73A 3IR4A 5B7CA 2A4VA 4ID0A 5IO0A 2IMIA 3FZ9A 4Q5RA 4EUYA 1OC3A 1UC7A 2LRNA 5DJLA 4TR1A 3F0IA 4O92A 3QFBC 4IJ3A 2AV4A 2XPDA 4WBJA 5IM9A 1A2JA 3E9JB 4EL1A 4MCUA 3A2XA 3TJFA 3LEFA 1GSUA 3HA9A 2IN3A 1XWBA 1B9XC 2I3YA 1X5EA 4ZBBA 4XIHA 3UMAA 3UOMA 3F4SA 4CDOA 4TKYA 4FYUA 1SJIA 2LKUA 2JL4A 4EXJA 3S9FA 3UBKA 4G19A 1GSYA 5HR2A 2K9FA 1AC1A 2V41A 3EU4A 4KDYA 2HI7A 1PMTA 4TVEA 4O7HA 1GNWA 1UVZA 1S3CA 1CQGA 3MSZA 1BX9A 1V98A 1TK0B 4MH2A 2V6OA 4HEA2 3GTUB 1B4QA 3H79A 3TRXA 1XW5A 1X9WB 1A8YA 2C0DA 5EY6A 4ZIJA 1CQHA 3TRQA 1FOVA 2PPTA 2E0QA 1SYXA 5B8BA 4TXVA 3QOUA 3HD5A 4GTUA 1SJZA 4K7OA 1ZGNA 4X1UA 3QCPA 3EURA 2YJ7A 3C8EA 4NWYA 2VLVA 4GQFA 3ZMLA 3IOSA 3IBHA 3Q19A 3ZMKA 1V58A 4MK3A 1EP8A 3RPNA 3ERGA 3GTUA 3RHCA 1XCCA 4GSNA 3DEXA 1M2DA 1VGLA 2RM6A 4TN8A 4ML6A 4RI7A 1ST9A 4PX1A 3VFIA 1FVJA 4FO5A 1WMJA 1GP1A 2YZUA 5J5NA 1A2MA 1E6BA 1HYUA 3IC4A 1S3AA 2R3XA 4WKWA 1EEMA 3D5JA 5CAXA 1J0FA 4GF0A 3KH9A 2DBCA 3TGZA 2MYGA 1ABAA 2HNLA 4F2IA 2FA8A 1F6MC 5DCGA 5ID2B 4YAVA 4OO4A 3GMFA 4N11A 3U5RE 4O32A 5HR3A 6GSVA 1SU9A 1A23A 4BWSA 1WOUA 5G30A 3CBUA 4IN0A 1OE8A 4KSOA 1J08A 2B5EA 4I6XA 1YF0A 3VWVA 4IQAA 4WETA 5CNWA 3I69A 5DJMA 2ZCTA 2GSTA 4PNFA 2GS3A 4JZQA 4F9ZA 3NZNA 1K0DA 1JZOA 4JR4A 1T4YA 1GUHA 4NHWA 3F4RA 4HU9A 1Z6MA 3HZ8A 2HRNA 3VURA 4K0GA 2LUSA 4E8EA 2CX3A 1M9BA 5D9TA 4KGIA 5ID2A 1XOAA 6GSYA 3KEBA 5GSSA 4KSMA 2O7KA 2VL3A 1WIKA 1TOFA 2DMLA 3EWLA 3W8JA 2I4AA 4PUFC 1RK4A 4EE0A 4F03A 2OE1A 3ZTLA 3L4NA 6GSUA 4PQ1A 1JHBA 4RUVA 5IPHA 1O7UA 1QQ2A 4ULXA 1SKSB 5DCHA 1Z7RA 3V1WA 4ILFA 3GV1A 5E4WA 1EGOA 2HZEB 3G7JA 3F3QA 3IAM2 3HJPA 2VO4A 1A24A 4KDXA 3L78A 2H76A 3F63A 1GNEA 3QR6A 4EKZA 3KCMA 2VAFA 1SKRB 1XW6A 12GSA 4IKHA 3O76A 4V2NA 1YF1A 1KTEA 1VF2A 2NBSA 4NV5A 2FUG2 4BPYA 3CRTA 4ECCA 1VF4A 22GSA 3DD3A 3FRCA 1Z7PA 1RQMA 1SENA 1LBKA 2GSQA 5DVBA 4ZXGA 5EL8A 4HJMA 3HJOA 2HZEA 5A4WA 2B7KA 3D6IA 4HQSA 3HDCA 3ERWA 4I97A 1SK1A 1AQWA 3PR8A 4K7IA 4MP4A 2OJLA 1V9WA 3LGCA 1THXA 4YAPA 5ECNB 4KA0A 3EMPA 1O73A 1K0BA 5CRGA 4GLTA 2R6KA 3GL5A 3VWXA 1KEBA 3DGQA 3UJ1A 3VWWA 3TKRA 4V2LA 3K8NA 3FW2A 3F4TA 3I6AA 2LNSA 5LD0A 2H0GA 3BJ5A 1R5PA 1PKZA 3Q18A 1GSSA 2J9HA 3P8WA 1DUGA 4NAXA 1ZCPA 5H5RA 2RIIA 3IDVA 4LL4B 2KHPA 3CTGA 1GSDA 1M2BA 1G7EA 2DJJA 4XCSA 3GFKA 5ECIB 2AJQB 1HD2A 1K0OA 5D8IA 2FGXA 2C3TA 4FYBA 3HHVA 3DWVA 1H4OA 4ZILA 1DE2A 5J9BA 5FWGA 4RQRA 4WBRD 3F6FA 8GSSA 2C0FA 4IW9A 3TCOA 5GAND 1J9BA 3QDNA 2VM1A 2WULA 1SD8A 2IWTA 2X8HA 4POBA 2N5AA 5CYYA 1XFLA 3LXZA 2MZCA 1PL2A 3F6DA 4OD7A 4JBBA 5HFGA 1TRWA 3M0FA 4XS6A 4WEYA 3ED3A 3BCKA 3QMXA 1FG4A 1M7TA 3UBLA 2JZSA 1GLPA 2FA4A 1OAZA 2MBTA 1HNCA 5DQYA 4ACSA 3D22A 3I43A 4POMA 4O5RA 2YV9A 5AIVA 4MPFA 1SL0B 4Q5NA 2GLRA 2VL2C 2RLIA 2KP2A 2X8GA 1MD4A 1PSQA 1HNAA 1FAAA 1GTIA 2VUPA 3BD2A 4MZBA 2DJ2A 4L8EA 2D2ZA 3F9UA 3EC3A 4ZB8A 3EINA 5IQYA 1AUCA 1GTUA 5F8BA 3ZL5A 4FIWA 3G7YA 3DIEA 3GKKA 1A8LA 1EV9A 1O8WA 1TK8B 3BBYA 1GH2A 1NHOA 3PGTA 2C1YA 1DBYA 4BA7A 3HVVA 1XWKA 4N10A 3D21A 5A4UA 3DVXA 2B6MA 4DSQA 2B3SA 4HOJA 1KBNA 3P90A 1ZZYA 2DJ3A 4TR0A 1M9AA 3DYRA 5KN2A 1FHEA 1R7HA 4OFMA 4MJCA 3KJYA 5IMCA 1EOHA 1G7OA 1S3DA 4G10A 1K0MA 1TP9A 3TKPA 3Q74A 2F9SA 2CT6A 4MDCA 4OCEA 3GURA 3GSTA 5CP1A 4IP1A 4V1Ag 4WF4A 1YJ6A 4MF6A 1M99A 5ECLB 4TR4A 1X5CA 1QK8A 2GQLA 4TXOB 2H72A 3PH9A 4X43A 2C3NA 2OADA 1I9DA 2R2JA 2DJ0A 2IPAA 2H19A 2LQOA 5J4UA 1GULA 4IJIA 1U6TA 1ERTA 3HJMA 2AYTA 3QAVA 4HDEA 3P7XA 2L4QA 3L9VA 1PN9A 4N0ZA 2XBIA 2HLSA 1T8EB 2YWOA 4PXOA 4RQXA 6GSXA 3MAKA 13GSA 2L5LA 5G1LA 5AIXA 3HZ4A 5A5KA 2YWIA 4ZL7A 2L4CA 4TXOA 2V1MA 3HVXA 1VF3A 1YKAA 4V1Ap 1TRVA 3A2WA 3M9JA 1R4WA 3QAWA 1JZWA 1K3YA 2XPEA 5ENUA 5H5QA 1T3BA 3AY8A 5KN0A 1OE7A 1G6WA 2XBQA 4MJEA 3FR6A 1SK2A 4KCAA 1K3LA 1PL1A 3TOTA 2IMKA 4NXIA 3CYNA 3RAZA 3FK8A 1XVWA 5D9XA 4MMMA 2ES7A 2H6YA 3VWUA 3VPTA 3HVSA 4L0UA 5C00A 1TI1A 1V2AA 2QSIA 3ZFLA 2EIOA 1ERWA 3WYWA 3EYTA 2EIQA 1R26A 2VL2A 3ZFBA 4WR4A 2WS2A 1H75A 1Q4JA 3PINA 2FY6A 3KP9A 1OC8A 5DQSA 2GGTA 2PVQA 2G2QA 2KUCA 4XS4B 4BWQA 2H0HA 3BCIA 1ML6A 5C04A 1T1VA 5EVOA 2VCVA 3QFAC 3GH9A 4L0WA 4K2DA 4ECBA 1DSBA 3FR3A 2GZYA 1BAYA 2V2GA 4V2MA 1OC9B 2OKAA 4MF7A 4HZ2A 4D73B 3L9UA 2IMEA 1AIUA 2OA7A 5JCUA 1X5DA 2CX4A 4Z7XA 4KDUA 3TKQA 2YV7A 1A0RP 3IV4A 3FZAA 1YDKA 1K3OA 3FKFA 2DSAA 3KH7A 4XS4A 2AHEA 3W8SA 3GKXA 3GH6A 4MF5A 2VCXA 3IXRA 4KE3A 1F9MA 2YPMA 3KIJA 1OYJA 4QL7A 1FW1A 5ECQB 3LJRA 3FR9A 3N9JA 5ECPB 4POKA 3TOUA 4HS1A 1AQVA 2E2MA 1F3BA 4EDZA 1OC9A 4F82A 2DJ1A 1WP0A 2JSZA 1BQ7A 4D73A 1URMA 3RHBA 3ZIJA 3UAPA 1G6YA 5F06A 3H8QA 1MEKA 2EIRA 2GVPA 3NOFA 1MDKA 4ZL8A 2OACA 5HQPA 1USBA 3IHQA 4LA1A 2F51A 2LS5A 2KLXA 1NM3A 3GX8A 2ON5A 1BJXA 1PRXA 1Q98A 3ZVJA 2VOCA 3HCZA 4KH7A 1GSFA 2A2SA 5KN3A 2GTUA 4ZB9A 1XOBA 2IMDA 3G9BA 4XS1A 3UARA 3GYKA 2C3QA 2WFCA 2QKEA 3APQA 3LXTA 2JZTA 3ZIVA 3HY2A 1JZDA 3KMOA 5AN1A 1OKTA 2H1DA 5J9CA 2CAIA 2HSYA 2C0GA 1AQXA 3IAS2 5D9WA 1GTAA 3H1NA 3RDWA 3WGXA 4I2UA 1U87A 3ERFA 2XHFA 2VL9A 1XWCA 2F8FA 5IMZA 4ML1A 2DLXA 1EP7A 1SL1B 1IYIA 3RBTA 11GSA 2REMA 2H0IA 4GSTA 1PA3A 1Y25A 2JACA 4HU7A 1TKDB 4J56E
chains in the Genus database with same CATH superfamily
2X99A 3UIWA 5JCGA 1V40A 1GLQA 4TOPA 1SKWB 2NVLA 4J57E 5JWRB 4Q5FA 3R2QA 1YEXA 1V57A 2M72A 1B9YC 3GIXA 3QPMA 4JE1A 1FB0A 2L6DA 2B7JA 2M46A 2R5GA 2MMZA 1B48A 2H1GA 2HSHA 2VCTA 4NMUA 4NHZA 1C72A 3GRXA 3WGEA 2TRCP 2VLTA 4EF0A 5G2ZA 4O5QA 3C71A 2DIZA 3TKSC 4BL7A 2P31A 3ZREA 5FHIA 1YKCA 4F0CA 5B6NA 1LJRA 4POLA 1WPIA 3JCML 2H6XA 4MLYA 3OR5A 1W4VA 2HXKA 4XRDA 3VPQA 2DIYA 4CHSA 4DSRA 4GWRA 2FWHA 1GUMA 5J3RA 1XBSA 2L57A 4EDYA 6GSWA 2C8UA 2WGRA 2PGTA 2QA2A 3P2AA 5L71A 17GSA 2HT9A 5CRHA 3D0ZA 1MTCA 5E59A 2B1KA 3DKSA 2F8AA 3TKSE 4G2EA 4EVMA 4AJ7A 5JWOB 3O3TA 5IMVA 5ECRB 2OBIA 4OO5A 4N0VA 4ZB6A 3UEMA 3M1GA 4ZL9A 4PQHA 1ERVA 3VI7A 4DVCA 4I5QA 4KF9A 5EPFA 14GSA 1XIYA 2V6KA 4K7NA 2PBJA 4FH8A 1WWJA 2C0EA 4EC0A 2VD1A 2NPBA 2O8VB 3F8UA 3TRPA 1EZKA 2BTOT 1PN0A 2FWEA 3ZYWA 1GUKA 3M3MA 3GKMA 5F0GA 5IIZA 3E3EA 2H75A 3N5OA 5ABRA 3A2VA 1JLVA 1TU8A 5IMDA 2YCDA 19GSA 2HYXA 3MYDA 3FZ5A 2WRTA 2PVOC 2N5FA 1U3IA 4FYCA 1UA5A 3CMIA 4K6XA 1B4PA 4BVYB 1LU4A 2YN1A 4IBPA 1EGRA 2CAQA 1O81A 1THOA 1PX7A 2LJRA 1X0RA 1FOHA 2OBKA 4IELA 3CXGA 5H5SA 2H8LA 2E7PA 2H6ZA 1JZRA 3H4KA 3TJJA 1SD9A 1UN2A 1TRUA 5G5EA 2R4VA 3C1SA 3ZZXA 5DDLA 2FHEA 2P5RA 1ZOFA 5D96A 5IOXA 2LJKA 3CSHA 1XW9A 3EU3A 5GAPD 4LLRA 3DVWA 3E0UA 1T4ZA 5JWQB 4ECIA 16GSA 3UVTA 3L9SA 3A5IA 2VD0A 2CVKA 3C7MA 4F0BA 5DBQA 4YQUA 2IL3A 5KOXA 2JADA 4ISDA 3EE2A 3LG6A 4BVYA 2LEGA 5HFKA 3H93A 2J23A 5ECKB 2P5QA 1X9MB 4IGJA 1K0CA 1TU7A 2DKIA 2WZ9A 4GQCA 2PMTA 1DE1A 3HXSA 4G9HA 2GZPA 5CREA 4USSA 5F05A 2ZNMA 3FYGA 4G0IA 1QXHA 4KAEA 3QD9A 3TKSA 2M80A 4JEDA 1AW9A 2AAWA 2YNXA 2LQQA 3TJBA 1M2AA 4PUAA 2KOKA 1WE0A 2YJHA 3IK9A 1F3AA 2YZHA 2LRTA 1ZYNA 1TJDA 2CV4A 3FY7A 3G7IA 2H66A 4DSSB 1PD21 2BJXA 4HUAA 1GL8A 2HZFA 1GSEA 4N30A 1Y6EA 4TR3A 4EO3A 5JCWA 2UZ8A 1T00A 3LORA 20GSA 2QC7A 2GT5A 5INYA 3MDKA 1SL2B 5LCZA 5HR0A 6GSTA 1QMVA 2ALBA 2GQKA 4JRRA 2CVBA 2CA8A 1O85A 3ME7A 2XC2A 5A4VA 4MPGA 1XWAA 2H70A 4IP6A 2RUEA 4P3YB 5IMFA 5ECHB 2K18A 2OE3A 1XWGA 1F37A 1JFUA 4K2XA 1TW9A 4PGTA 3A5WA 2FWGA 4Z2TA 4PQIA 4DSSA 1SYRA 4MA9A 2H1AA 2VLUA 5CO3A 5AGYA 1A2LA 7GSSA 2L59A 4CY8A 4HI7A 1VRSD 3J7Yb 2N5BA 18GSA 4K9ZA 3VLNA 2R37A 1BYEA 5ELAA 1KNGA 1E2YA 4YQMA 2A2RA 3HKRA 2GSRA 1EOGA 5J41A 5IMAA 4K1FA 1GWCA 1N2AA 2PWJA 3UL3A 3WD6A 3DRNA 3KM6A 2MMNA 3KP8A 4KNDA 5B8AA 1A0FA 2CZ3A 1EEJA 1NSWA 1EV4A 5D73A 2AB6A 1T7PB 2K8VA 1PGTA 4OMVA 5COHA 4PURA 4NV2A 2WCIA 3KGKA 2PN8A 3SWLA 2BMXA 2O85A 2IJYA 3LFLA 3M8NA 3UVHA 3FHKA 1WJKA 3TB2A 1ON4A 1GTBA 4TW5A 3LSZA 2IMFA 4K5SA 2DKHA 3D4TA 4WR5A 3RPPA 1S3RA 2DJKA 4FQUA 1HNBA 5D9VA 9GSSA 2VM2A 4HQZA 1GRXA 4L5OA 1BEDA 4WF5A 4MJAA 1ZYPA 3IE3A 3KD0A 4QQ7A 1WRYA 2GZZA 2FCHA 1K0AA 4LMWA 3MIXA 4OWYA 3LWAA 1XZOA 3LYKA 3ZVJD 1HQOA 4KX4A 2VCWA 4OFNA 2DMMA 4AJ8A 2HRFA 4JR6A 2WJUA 2OE0A 1N8JA 2LRCA 2P0GA 3W6GA 4XHMA 4XRAA 3QAGA 3LYPA 4YH2A 5B6MA 4PNGA 3VK9A 2LV3A 3F3RA 2FD3A 4GCIA 4MZCA 2RUFA 1OVNA 4CW9A 3APSA 3IRAA 3LQ7A 2I81A 2H74A 1ZYQB 3FZ4A 4ECJA 4BVXB 2H71A 2A2PA 2G0FA 1SJ6A 2JZRA 1XPVA 1QGVA 1JLWA 5KEJA 1BG5A 3KXOA 2L6CA 4GSSA 2L5OA 2YWNA 2IFQB 3VI5A 10GSA 5DALB 4TRXA 2MMAA 1NHYA 3D4MA 2FNOA 1MDIA 5G5FA 1YY7A 2GDRA 5CRDA 2VCQA 5ELGA 5GSTA 2ZUPA 3SBCA 4DEJA 4MH3A 3TJGA 2MMOA 2B1LA 2H01A 3Q6OA 3GA4A 3LW9A 1O8XA 3GHAA 2I1UA 2LNTA 1Z9HA 2O89A 1ACVA 2PU9C 5D93A 3M9KA 5KN1A 4BVXA 2IIYA 1B8XA 2H73A 6GSSA 4IVFA 2B5XA 2EC4A 3WT1A 2JSYA 1ZYEA 4KCEA 3ZITA 3CTFA 2IFQA 4AJ6A 3GNJA 5DALA 2CVDA 2HFDA 3EPTA 1ILOA 1Z5YE 3L0HA 1R5AA 2HSMA 4Q5QA 5AISA 5BRTA 4MZWA 1M0UA 4L5LA 1PKWA 3HYPA 3US3A 3ISOA 1AAZA 4QL9A 1QUWA 3KTLA 5ECSA 4OCFA 5BMUA 2V32A 4I8BA 2KP1A 1W89A 3EMXA 1YEPA 4K8MA 3KTBA 2NTOA 2B5YA 2WB9A 2PUKC 2WDUA 1NW2A 3C1RA 2K8SA 2F3MA 4MJBA 5IPGA 1MDJA 2O87A 1U3AA 2GT6A 1MD3A 1PQNA 3I9V2 1VF1A 4MNNA 1TI3A 4G0LA 1I5GA 1XG8A 2Z9SA 2X8CA 2TRXA 3IC8A 2YOIA 3PPUA 5LNKe 3CSJA 2H1BA 3J7Yk 3TUEA 4YQVA 4KW6A 2CZ2A 3BOAA 3MNGA 4I2TA 4KUNA 4E8HA 1O6JA 3GUSA 3IHGA 2FWFA 2LTKA 4GRFA 2H30A 4GXZA 1FVKA 1XXUA 3GKNA 4AF2A 5FT3A 5IO2A 3GN3A 1F2EA 3DXBA 4KB3A 2X64A 1ZMAA 2RM5A 2JU5A 4ZBDA 2YWMA 3ZRDA 4H86A 2E2GA 3A3TA 2YANA 5ECMB 2X49A 4IHUA 3IA1A 1K0NA 3CRUA 2K6VA 3O6TA 2C4JA 3IPZA 4WXTA 2GQMA 2VCZA 5DAKB 1YQ1A 2I9HA 3WGDA 1Z3EA 2LSTA 1TRSA 2FLSA 5IOWA 3WT2A 3CSIA 3FEUA 2C80A 1ZL9A 3TJKA 2VIMA 4IS0A 1IYHA 4HZ4A 5HR1A 3DMLA 1ERUA 1EWXA 5ECOB 3GX0A 1PX6A 5G31A 1GSQA 1Z6NA 2AUVA 1SK0A 1OKDA 1FO5A 4K0NA 2NDOA 2LJAA 4J2FA 2TIRA 2HE3A 1U88A 3IK7A 4LMVA 2PERA 4JU5A 1TTZA 5GZZB 4HJ2A 4AGSA 5DAKA 5CRWA 1QFNA 2DC5A 4TR1B 4OFTA 3U6VA 3ZLPA 1TK5B 1TDIA 3KZQA 1RW1A 1XVQA 3APOA 4IQ1A 4O5UA 2ON7A 2CQ9A 4RI6A 2MBSA 3FMWA 1G0TA 2GSSA 2QA1A 2YP6A 4ZBAA 5F07A 1TXXA 4MABA 3GSSA 3TDGA 3KMNA 3ME8A 3NIVA 2QGVA 4X0XA 1AXDA 4LL1B 5G1KA 1FB6A 3GL3A 4X4JA 4XTSA 4NPBA 5HFIA 5KOWA 1X9SB 3MWHA 1YZXA 3EVIA 3C73A 3IR4A 5B7CA 2A4VA 4ID0A 5IO0A 2IMIA 3FZ9A 4Q5RA 4EUYA 1OC3A 1UC7A 2LRNA 5DJLA 4TR1A 3F0IA 4O92A 3QFBC 4IJ3A 2AV4A 2XPDA 4WBJA 5IM9A 1A2JA 3E9JB 4EL1A 4MCUA 3A2XA 3R3EA 3TJFA 3LEFA 1GSUA 3HA9A 2IN3A 1XWBA 1B9XC 2I3YA 1X5EA 4ZBBA 1PFOA 4HSCX 4XIHA 3UMAA 3UOMA 2R0PA 3F4SA 4CDOA 4TKYA 4FYUA 1M3JA 1SJIA 2LKUA 2JL4A 4EXJA 3S9FA 3UBKA 4G19A 1GSYA 5HR2A 2K9FA 1AC1A 2V41A 3EU4A 4KDYA 2HI7A 1PMTA 4TVEA 4O7HA 1GNWA 1UVZA 1S3CA 1CQGA 3MSZA 1BX9A 1V98A 1TK0B 4MH2A 2V6OA 4HEA2 3GTUB 1B4QA 3H79A 3TRXA 1XW5A 1X9WB 1A8YA 2C0DA 4YKGA 2HRKA 5EY6A 4ZIJA 1CQHA 3TRQA 1FOVA 2PPTA 2E0QA 1SYXA 5B8BA 4TXVA 3QOUA 3HD5A 4GTUA 1SJZA 4K7OA 1ZGNA 4X1UA 3QCPA 3EURA 2YJ7A 3C8EA 4NWYA 2VLVA 4GQFA 3ZMLA 3IOSA 3IBHA 3Q19A 3ZMKA 1V58A 4MK3A 1EP8A 3RPNA 3ERGA 2X4AA 3GTUA 3RHCA 1XCCA 4GSNA 3DEXA 1M2DA 1VGLA 2RM6A 4TN8A 4ML6A 4RI7A 1ST9A 4PX1A 3VFIA 1FVJA 4FO5A 1WMJA 1GP1A 2YZUA 5J5NA 1A2MA 1E6BA 1HYUA 3IC4A 1S3AA 2R3XA 4WKWA 1EEMA 3D5JA 5CAXA 1J0FA 4GF0A 3KH9A 2DBCA 3TGZA 2MYGA 1ABAA 2HNLA 4F2IA 2FA8A 1F6MC 5DCGA 5ID2B 4YAVA 4OO4A 3GMFA 4N11A 3U5RE 4O32A 5HR3A 6GSVA 1SU9A 1A23A 4BWSA 1WOUA 5G30A 3CBUA 4IN0A 1OE8A 4KSOA 1J08A 2B5EA 4I6XA 1YF0A 3VWVA 4IQAA 4WETA 5CNWA 3I69A 5DJMA 2ZCTA 2GSTA 4PNFA 2GS3A 4JZQA 4F9ZA 3NZNA 1K0DA 1JZOA 4JR4A 1T4YA 1GUHA 4NHWA 3F4RA 4HU9A 4YKFA 1Z6MA 3HZ8A 2HRNA 3VURA 4K0GA 2LUSA 4E8EA 2CX3A 1M9BA 5D9TA 4KGIA 5ID2A 1XOAA 6GSYA 3KEBA 5GSSA 4KSMA 2O7KA 2VL3A 1WIKA 1TOFA 2DMLA 3EWLA 3W8JA 2I4AA 4PUFC 1RK4A 4EE0A 4F03A 2OE1A 3ZTLA 3L4NA 6GSUA 4PQ1A 1JHBA 4RUVA 5IPHA 1O7UA 1QQ2A 3CQFA 4ULXA 1SKSB 5DCHA 1Z7RA 3V1WA 4ILFA 3GV1A 5E4WA 1EGOA 2HZEB 3G7JA 3F3QA 3IAM2 3HJPA 2VO4A 1A24A 4KDXA 3L78A 2H76A 3F63A 1GNEA 3QR6A 4EKZA 3KCMA 2VAFA 1SKRB 1XW6A 12GSA 4IKHA 3O76A 4V2NA 1YF1A 4K5RA 1KTEA 1VF2A 2NBSA 4NV5A 2FUG2 4BPYA 3CRTA 4ECCA 1VF4A 22GSA 3DD3A 3FRCA 1Z7PA 1RQMA 1SENA 1LBKA 2GSQA 5DVBA 4ZXGA 5EL8A 4HJMA 3HJOA 2HZEA 5A4WA 2B7KA 3D6IA 4HQSA 3HDCA 3ERWA 4I97A 1SK1A 1AQWA 3PR8A 4K7IA 4MP4A 2R0GA 2OJLA 1V9WA 3LGCA 1THXA 4YAPA 5ECNB 4KA0A 3EMPA 1O73A 1K0BA 1M3IA 5CRGA 4GLTA 2R6KA 3GL5A 3VWXA 1KEBA 3DGQA 3UJ1A 3VWWA 3TKRA 4V2LA 3K8NA 3FW2A 3F4TA 3I6AA 2LNSA 5LD0A 2H0GA 3BJ5A 1R5PA 1PKZA 3Q18A 1GSSA 2J9HA 3P8WA 1DUGA 4NAXA 1ZCPA 5H5RA 2RIIA 3IDVA 4LL4B 2KHPA 3CTGA 1GSDA 1M2BA 1G7EA 2DJJA 4XCSA 3GFKA 5ECIB 2AJQB 1HD2A 1K0OA 5D8IA 2FGXA 2C3TA 4FYBA 4Z2UA 3HHVA 3DWVA 1H4OA 4ZILA 1DE2A 5J9BA 5FWGA 4RQRA 4WBRD 3F6FA 8GSSA 2C0FA 4IW9A 3TCOA 5GAND 1J9BA 2HRAA 3QDNA 2VM1A 2WULA 1SD8A 2IWTA 2X8HA 4POBA 2N5AA 5CYYA 1XFLA 3LXZA 2MZCA 1PL2A 3F6DA 4OD7A 4JBBA 5HFGA 1TRWA 3M0FA 4XS6A 4WEYA 3ED3A 3BCKA 3QMXA 1FG4A 1M7TA 3UBLA 2JZSA 1GLPA 2FA4A 1OAZA 2MBTA 1HNCA 5DQYA 4ACSA 3D22A 3I43A 4POMA 4O5RA 2R0CA 2YV9A 5AIVA 4MPFA 1SL0B 4Q5NA 2GLRA 2VL2C 2RLIA 2KP2A 2X8GA 1MD4A 1PSQA 1HNAA 1FAAA 1GTIA 2VUPA 3BD2A 4MZBA 2DJ2A 4L8EA 2D2ZA 3F9UA 3EC3A 4ZB8A 3EINA 5IQYA 1AUCA 1GTUA 5F8BA 3ZL5A 4FIWA 3G7YA 3DIEA 3GKKA 1A8LA 1EV9A 1O8WA 1TK8B 3BBYA 1GH2A 1NHOA 3PGTA 2C1YA 1DBYA 4BA7A 3HVVA 1XWKA 4N10A 3D21A 5A4UA 3DVXA 2B6MA 4DSQA 2B3SA 4HOJA 1KBNA 3P90A 1ZZYA 4Z2RA 2DJ3A 4TR0A 1M9AA 3DYRA 5KN2A 1FHEA 1R7HA 4OFMA 4MJCA 3KJYA 5IMCA 1EOHA 1G7OA 1S3DA 4G10A 1K0MA 1TP9A 3TKPA 4EIQA 3Q74A 2F9SA 2CT6A 4MDCA 4OCEA 3GURA 3GSTA 5CP1A 4IP1A 4V1Ag 4WF4A 1YJ6A 4MF6A 1M99A 5ECLB 4TR4A 1X5CA 1QK8A 2GQLA 4TXOB 2H72A 3PH9A 4X43A 2C3NA 2OADA 1I9DA 2R2JA 4A5PA 2DJ0A 2IPAA 2H19A 2LQOA 5J4UA 1GULA 4IJIA 1U6TA 1ERTA 3HJMA 2AYTA 3QAVA 4HDEA 3P7XA 2L4QA 3L9VA 1PN9A 4N0ZA 2XBIA 2HLSA 1T8EB 2YWOA 4PXOA 4RQXA 6GSXA 3MAKA 13GSA 2L5LA 5G1LA 5AIXA 3HZ4A 5A5KA 2YWIA 4ZL7A 2L4CA 4TXOA 2V1MA 3HVXA 1VF3A 1YKAA 4V1Ap 1TRVA 3A2WA 3M9JA 1R4WA 3QAWA 1JZWA 1K3YA 2XPEA 5ENUA 5H5QA 1T3BA 4ICYA 3AY8A 5KN0A 1OE7A 1G6WA 2XBQA 4MJEA 3FR6A 1SK2A 4KCAA 1K3LA 1PL1A 3TOTA 2IMKA 4NXIA 3CYNA 3RAZA 3FK8A 1XVWA 5D9XA 4EIPA 4MMMA 2ES7A 2H6YA 3VWUA 3VPTA 3HVSA 4L0UA 5C00A 1TI1A 1V2AA 2QSIA 3ZFLA 2EIOA 1ERWA 3WYWA 3EYTA 2EIQA 1R26A 2VL2A 3ZFBA 4WR4A 2WS2A 1H75A 1Q4JA 3PINA 2FY6A 3KP9A 4CY6A 1OC8A 5DQSA 2GGTA 2PVQA 2G2QA 2KUCA 4XS4B 4BWQA 2H0HA 3BCIA 3HVNA 1ML6A 5C04A 1T1VA 5EVOA 2VCVA 3QFAC 3GH9A 4L0WA 4K2DA 4ECBA 4BIKA 1DSBA 3FR3A 2GZYA 1BAYA 2V2GA 4V2MA 1OC9B 2OKAA 4MF7A 4HZ2A 4D73B 3L9UA 2IMEA 1AIUA 2OA7A 5JCUA 1X5DA 2CX4A 4Z7XA 4KDUA 3TKQA 2YV7A 1A0RP 3IV4A 3FZAA 1YDKA 1K3OA 3FKFA 2DSAA 3KH7A 4XS4A 2AHEA 3W8SA 3GKXA 3GH6A 4MF5A 2VCXA 3IXRA 4KE3A 1F9MA 2YPMA 3KIJA 1OYJA 4QL7A 1FW1A 5ECQB 3LJRA 3FR9A 3N9JA 5ECPB 4POKA 3TOUA 4HS1A 1AQVA 2E2MA 1F3BA 4PTSA 4EDZA 1OC9A 4F82A 2DJ1A 1WP0A 2JSZA 1BQ7A 4D73A 4G0KA 1URMA 3RHBA 3ZIJA 3UAPA 1G6YA 5F06A 3H8QA 1MEKA 2EIRA 2GVPA 3NOFA 1MDKA 4ZL8A 2OACA 5HQPA 1USBA 3IHQA 4LA1A 2F51A 2LS5A 2KLXA 1NM3A 3GX8A 2A4HA 2ON5A 1BJXA 1PRXA 1Q98A 3ZVJA 2VOCA 3HCZA 4KH7A 1GSFA 2A2SA 5KN3A 2GTUA 4ZB9A 1XOBA 2IMDA 3G9BA 4XS1A 3UARA 3GYKA 2C3QA 2WFCA 2QKEA 3APQA 3LXTA 2JZTA 3ZIVA 3HY2A 1JZDA 3KMOA 5AN1A 1OKTA 2H1DA 5J9CA 2CAIA 2HSYA 2C0GA 1AQXA 3IAS2 5D9WA 1GTAA 3H1NA 3RDWA 3WGXA 4I2UA 1U87A 3ERFA 2XHFA 2VL9A 1XWCA 2F8FA 5IMZA 4ML1A 2DLXA 1EP7A 1SL1B 1IYIA 3RBTA 11GSA 2REMA 2H0IA 4GSTA 1PA3A 1Y25A 2JACA 4HU7A 1TKDB 4BL7B 4J56E
chains in the Genus database with same CATH topology
2X99A 3UIWA 5JCGA 1V40A 1GLQA 4TOPA 1SKWB 2NVLA 4J57E 5JWRB 4Q5FA 3R2QA 1YEXA 1V57A 2M72A 1B9YC 3GIXA 3QPMA 4JE1A 1FB0A 2L6DA 2B7JA 2M46A 2R5GA 2MMZA 1B48A 2H1GA 2HSHA 2VCTA 4NMUA 4NHZA 1C72A 3GRXA 3WGEA 2TRCP 2VLTA 4EF0A 5G2ZA 4O5QA 3C71A 2DIZA 3TKSC 4BL7A 2P31A 3ZREA 5FHIA 1YKCA 4F0CA 5B6NA 1LJRA 4POLA 1WPIA 3JCML 2H6XA 4MLYA 3OR5A 1W4VA 2HXKA 4XRDA 3VPQA 2DIYA 4CHSA 4DSRA 4GWRA 2FWHA 1GUMA 5J3RA 1XBSA 2L57A 4EDYA 6GSWA 2C8UA 2WGRA 2PGTA 2QA2A 3P2AA 5L71A 17GSA 2HT9A 5CRHA 3D0ZA 1MTCA 5E59A 2B1KA 3DKSA 2F8AA 3TKSE 4G2EA 4EVMA 4AJ7A 5JWOB 3O3TA 5IMVA 5ECRB 2OBIA 4OO5A 4N0VA 4ZB6A 3UEMA 3M1GA 4ZL9A 4PQHA 1ERVA 3VI7A 4DVCA 4I5QA 4KF9A 5EPFA 14GSA 1XIYA 2V6KA 4K7NA 2PBJA 4FH8A 1WWJA 2C0EA 4EC0A 2VD1A 2NPBA 2O8VB 3F8UA 3TRPA 1EZKA 2BTOT 1PN0A 2FWEA 3ZYWA 1GUKA 3M3MA 3GKMA 5F0GA 5IIZA 3E3EA 2H75A 3N5OA 5ABRA 3A2VA 1JLVA 1TU8A 5IMDA 2YCDA 19GSA 2HYXA 3MYDA 3FZ5A 2WRTA 2PVOC 2N5FA 1U3IA 4FYCA 1UA5A 3CMIA 4K6XA 1B4PA 4BVYB 1LU4A 2YN1A 4IBPA 1EGRA 2CAQA 1O81A 1THOA 1PX7A 2LJRA 1X0RA 1FOHA 2OBKA 4IELA 3CXGA 5H5SA 2H8LA 2E7PA 2H6ZA 1JZRA 3H4KA 3TJJA 1SD9A 1UN2A 1TRUA 5G5EA 2R4VA 3C1SA 3ZZXA 5DDLA 2FHEA 2P5RA 1ZOFA 5D96A 5IOXA 2LJKA 3CSHA 1XW9A 3EU3A 5GAPD 4LLRA 3DVWA 3E0UA 1T4ZA 5JWQB 4ECIA 16GSA 3UVTA 3L9SA 3A5IA 2VD0A 2CVKA 3C7MA 4F0BA 5DBQA 4YQUA 2IL3A 5KOXA 2JADA 4ISDA 3EE2A 3LG6A 4BVYA 2LEGA 5HFKA 3H93A 2J23A 5ECKB 2P5QA 1X9MB 4IGJA 1K0CA 1TU7A 2DKIA 2WZ9A 4GQCA 2PMTA 1DE1A 3HXSA 4G9HA 2GZPA 5CREA 4USSA 5F05A 2ZNMA 3FYGA 4G0IA 1QXHA 4KAEA 3QD9A 3TKSA 2M80A 4JEDA 1AW9A 2AAWA 2YNXA 2LQQA 3TJBA 1M2AA 4PUAA 2KOKA 1WE0A 2YJHA 3IK9A 1F3AA 2YZHA 2LRTA 1ZYNA 1TJDA 2CV4A 3FY7A 3G7IA 2H66A 4DSSB 1PD21 2BJXA 4HUAA 1GL8A 2HZFA 1GSEA 4N30A 1Y6EA 4TR3A 4EO3A 5JCWA 2UZ8A 1T00A 3LORA 20GSA 2QC7A 2GT5A 5INYA 3MDKA 1SL2B 5LCZA 5HR0A 6GSTA 1QMVA 2ALBA 2GQKA 4JRRA 2CVBA 2CA8A 1O85A 3ME7A 2XC2A 5A4VA 4MPGA 1XWAA 2H70A 4IP6A 2RUEA 4P3YB 5IMFA 5ECHB 2K18A 2OE3A 1XWGA 1F37A 1JFUA 4K2XA 1TW9A 4PGTA 3A5WA 2FWGA 4Z2TA 4PQIA 4DSSA 1SYRA 4MA9A 2H1AA 2VLUA 5CO3A 5AGYA 1A2LA 7GSSA 2L59A 4CY8A 4HI7A 1VRSD 3J7Yb 2N5BA 18GSA 4K9ZA 3VLNA 2R37A 1BYEA 5ELAA 1KNGA 1E2YA 4YQMA 2A2RA 3HKRA 2GSRA 1EOGA 5J41A 5IMAA 4K1FA 1GWCA 1N2AA 2PWJA 3UL3A 3WD6A 3DRNA 3KM6A 2MMNA 3KP8A 4KNDA 5B8AA 1A0FA 2CZ3A 1EEJA 1NSWA 1EV4A 5D73A 2AB6A 1T7PB 2K8VA 1PGTA 4OMVA 5COHA 4PURA 4NV2A 2WCIA 3KGKA 2PN8A 3SWLA 2BMXA 2O85A 2IJYA 3LFLA 3M8NA 3UVHA 3FHKA 1WJKA 3TB2A 1ON4A 1GTBA 4TW5A 3LSZA 2IMFA 4K5SA 2DKHA 3D4TA 4WR5A 3RPPA 2DJKA 4FQUA 1HNBA 5D9VA 9GSSA 2VM2A 4HQZA 1GRXA 4L5OA 1BEDA 4WF5A 4MJAA 1ZYPA 3IE3A 3KD0A 4QQ7A 1WRYA 2GZZA 2FCHA 1K0AA 4LMWA 3MIXA 4OWYA 3LWAA 1XZOA 3LYKA 3ZVJD 1HQOA 4KX4A 2VCWA 4OFNA 2DMMA 4AJ8A 2HRFA 4JR6A 2WJUA 2OE0A 1N8JA 2LRCA 2P0GA 3W6GA 4XHMA 4XRAA 3QAGA 3LYPA 4YH2A 5B6MA 4PNGA 3VK9A 2LV3A 3F3RA 2FD3A 4GCIA 4MZCA 2RUFA 1OVNA 4CW9A 3APSA 3IRAA 3LQ7A 2I81A 2H74A 1ZYQB 3FZ4A 4ECJA 4BVXB 2H71A 2A2PA 2G0FA 1SJ6A 2JZRA 1XPVA 1QGVA 1JLWA 5KEJA 1BG5A 3KXOA 2L6CA 4GSSA 2L5OA 2YWNA 2IFQB 3VI5A 10GSA 5DALB 4TRXA 2MMAA 1NHYA 3D4MA 2FNOA 1MDIA 5G5FA 1YY7A 2GDRA 5CRDA 2VCQA 5ELGA 5GSTA 2ZUPA 3SBCA 4DEJA 4MH3A 3TJGA 2MMOA 2B1LA 2H01A 3Q6OA 3GA4A 3LW9A 1O8XA 3GHAA 2I1UA 2LNTA 1Z9HA 2O89A 1ACVA 2PU9C 5D93A 3M9KA 5KN1A 4BVXA 2IIYA 1B8XA 2H73A 6GSSA 4IVFA 2B5XA 2EC4A 3WT1A 2JSYA 1ZYEA 4KCEA 3ZITA 3CTFA 2IFQA 4AJ6A 3GNJA 5DALA 2CVDA 2HFDA 3EPTA 1ILOA 1Z5YE 3L0HA 1R5AA 2HSMA 4Q5QA 5AISA 5BRTA 4MZWA 1M0UA 4L5LA 1PKWA 3HYPA 3US3A 3ISOA 1AAZA 4QL9A 1QUWA 3KTLA 5ECSA 4OCFA 5BMUA 2V32A 4I8BA 2KP1A 1W89A 3EMXA 1YEPA 4K8MA 3KTBA 2NTOA 2B5YA 2WB9A 2PUKC 2WDUA 1NW2A 3C1RA 2K8SA 2F3MA 4MJBA 5IPGA 1MDJA 2O87A 1U3AA 2GT6A 1MD3A 1PQNA 3I9V2 1VF1A 4MNNA 1TI3A 4G0LA 1I5GA 2Z9SA 2X8CA 2TRXA 3IC8A 2YOIA 3PPUA 5LNKe 3CSJA 2H1BA 3J7Yk 3TUEA 4YQVA 4KW6A 2CZ2A 3BOAA 3MNGA 4I2TA 4KUNA 4E8HA 1O6JA 3GUSA 3IHGA 2FWFA 2LTKA 4GRFA 2H30A 4GXZA 1FVKA 1XXUA 3GKNA 4AF2A 5FT3A 5IO2A 3GN3A 1F2EA 3DXBA 4KB3A 2X64A 1ZMAA 2RM5A 2JU5A 4ZBDA 2YWMA 3ZRDA 4H86A 2E2GA 3A3TA 2YANA 5ECMB 2X49A 4IHUA 3IA1A 1K0NA 3CRUA 2K6VA 3O6TA 2C4JA 3IPZA 4WXTA 2GQMA 2VCZA 5DAKB 1YQ1A 2I9HA 3WGDA 1Z3EA 2LSTA 1TRSA 2FLSA 5IOWA 3WT2A 3CSIA 3FEUA 2C80A 1ZL9A 3TJKA 2VIMA 4IS0A 1IYHA 4HZ4A 5HR1A 3DMLA 1ERUA 1EWXA 5ECOB 3GX0A 1PX6A 5G31A 1GSQA 1Z6NA 2AUVA 1SK0A 1OKDA 1FO5A 4K0NA 2NDOA 2LJAA 4J2FA 2TIRA 2HE3A 1U88A 3IK7A 4LMVA 2PERA 4JU5A 1TTZA 5GZZB 4HJ2A 4AGSA 5DAKA 5CRWA 1QFNA 2DC5A 4TR1B 4OFTA 3U6VA 3ZLPA 1TK5B 1TDIA 3KZQA 1RW1A 1XVQA 3APOA 4IQ1A 4O5UA 2ON7A 2CQ9A 4RI6A 2MBSA 3FMWA 1G0TA 2GSSA 2QA1A 2YP6A 4ZBAA 5F07A 1TXXA 4MABA 3GSSA 3TDGA 3KMNA 3ME8A 3NIVA 2QGVA 4X0XA 1AXDA 4LL1B 5G1KA 1FB6A 3GL3A 4X4JA 4XTSA 4NPBA 5HFIA 5KOWA 1X9SB 3MWHA 1YZXA 3EVIA 3C73A 3IR4A 5B7CA 2A4VA 4ID0A 5IO0A 2IMIA 3FZ9A 4Q5RA 4EUYA 1OC3A 1UC7A 2LRNA 5DJLA 4TR1A 3F0IA 4O92A 3QFBC 4IJ3A 2AV4A 2XPDA 4WBJA 5IM9A 1A2JA 3E9JB 4EL1A 4MCUA 3A2XA 3R3EA 3TJFA 3LEFA 1GSUA 3HA9A 2IN3A 1XWBA 1B9XC 2I3YA 1X5EA 4ZBBA 4XIHA 3UMAA 3UOMA 2R0PA 3F4SA 4CDOA 4TKYA 4FYUA 1SJIA 2LKUA 2JL4A 4EXJA 3S9FA 3UBKA 4G19A 1GSYA 5HR2A 2K9FA 1AC1A 2V41A 3EU4A 4KDYA 2HI7A 1PMTA 4TVEA 4O7HA 1GNWA 1UVZA 1S3CA 1CQGA 3MSZA 1BX9A 1V98A 1TK0B 4MH2A 2V6OA 4HEA2 3GTUB 1B4QA 3H79A 3TRXA 1XW5A 1X9WB 1A8YA 2C0DA 4YKGA 2HRKA 5EY6A 4ZIJA 1CQHA 3TRQA 1FOVA 2PPTA 2E0QA 1SYXA 5B8BA 4TXVA 3QOUA 3HD5A 4GTUA 1SJZA 4K7OA 1ZGNA 4X1UA 3QCPA 3EURA 2YJ7A 3C8EA 4NWYA 2VLVA 4GQFA 3ZMLA 3IOSA 3IBHA 3Q19A 3ZMKA 1V58A 4MK3A 1EP8A 3RPNA 3ERGA 2X4AA 3GTUA 3RHCA 1XCCA 4GSNA 3DEXA 1M2DA 1VGLA 2RM6A 4TN8A 4ML6A 4RI7A 1ST9A 4PX1A 3VFIA 1FVJA 4FO5A 1WMJA 1GP1A 2YZUA 5J5NA 1A2MA 1E6BA 1HYUA 3IC4A 1S3AA 2R3XA 4WKWA 1EEMA 3D5JA 5CAXA 1J0FA 4GF0A 3KH9A 2DBCA 3TGZA 2MYGA 1ABAA 2HNLA 4F2IA 2FA8A 1F6MC 5DCGA 5ID2B 4YAVA 4OO4A 3GMFA 4N11A 3U5RE 4O32A 5HR3A 6GSVA 1SU9A 1A23A 4BWSA 1WOUA 5G30A 3CBUA 4IN0A 1OE8A 4KSOA 1J08A 2B5EA 4I6XA 1YF0A 3VWVA 4IQAA 4WETA 5CNWA 3I69A 5DJMA 2ZCTA 2GSTA 4PNFA 2GS3A 4JZQA 4F9ZA 3NZNA 1K0DA 1JZOA 4JR4A 1T4YA 1GUHA 4NHWA 3F4RA 4HU9A 4YKFA 1Z6MA 3HZ8A 2HRNA 3VURA 4K0GA 2LUSA 4E8EA 2CX3A 1M9BA 5D9TA 4KGIA 5ID2A 1XOAA 6GSYA 3KEBA 5GSSA 4KSMA 2O7KA 2VL3A 1WIKA 1TOFA 2DMLA 3EWLA 3W8JA 2I4AA 4PUFC 1RK4A 4EE0A 4F03A 2OE1A 3ZTLA 3L4NA 6GSUA 4PQ1A 1JHBA 4RUVA 5IPHA 1O7UA 1QQ2A 4ULXA 1SKSB 5DCHA 1Z7RA 3V1WA 4ILFA 3GV1A 5E4WA 1EGOA 2HZEB 3G7JA 3F3QA 3IAM2 3HJPA 2VO4A 1A24A 4KDXA 3L78A 2H76A 3F63A 1GNEA 3QR6A 4EKZA 3KCMA 2VAFA 1SKRB 1XW6A 12GSA 4IKHA 3O76A 4V2NA 1YF1A 4K5RA 1KTEA 1VF2A 2NBSA 4NV5A 2FUG2 4BPYA 3CRTA 4ECCA 1VF4A 22GSA 3DD3A 3FRCA 1Z7PA 1RQMA 1SENA 1LBKA 2GSQA 5DVBA 4ZXGA 5EL8A 4HJMA 3HJOA 2HZEA 5A4WA 2B7KA 3D6IA 4HQSA 3HDCA 3ERWA 4I97A 1SK1A 1AQWA 3PR8A 4K7IA 4MP4A 2R0GA 2OJLA 1V9WA 3LGCA 1THXA 4YAPA 5ECNB 4KA0A 3EMPA 1O73A 1K0BA 5CRGA 4GLTA 2R6KA 3GL5A 3VWXA 1KEBA 3DGQA 3UJ1A 3VWWA 3TKRA 4V2LA 3K8NA 3FW2A 3F4TA 3I6AA 2LNSA 5LD0A 2H0GA 3BJ5A 1R5PA 1PKZA 3Q18A 1GSSA 2J9HA 3P8WA 1DUGA 4NAXA 1ZCPA 5H5RA 2RIIA 3IDVA 4LL4B 2KHPA 3CTGA 1GSDA 1M2BA 1G7EA 2DJJA 4XCSA 3GFKA 5ECIB 2AJQB 1HD2A 1K0OA 5D8IA 2FGXA 2C3TA 4FYBA 4Z2UA 3HHVA 3DWVA 1H4OA 4ZILA 1DE2A 5J9BA 5FWGA 4RQRA 4WBRD 3F6FA 8GSSA 2C0FA 4IW9A 3TCOA 5GAND 1J9BA 2HRAA 3QDNA 2VM1A 2WULA 1SD8A 2IWTA 2X8HA 4POBA 2N5AA 5CYYA 1XFLA 3LXZA 2MZCA 1PL2A 3F6DA 4OD7A 4JBBA 5HFGA 1TRWA 3M0FA 4XS6A 4WEYA 3ED3A 3BCKA 3QMXA 1FG4A 1M7TA 3UBLA 2JZSA 1GLPA 2FA4A 1OAZA 2MBTA 1HNCA 5DQYA 4ACSA 3D22A 3I43A 4POMA 4O5RA 2R0CA 2YV9A 5AIVA 4MPFA 1SL0B 4Q5NA 2GLRA 2VL2C 2RLIA 2KP2A 2X8GA 1MD4A 1PSQA 1HNAA 1FAAA 1GTIA 2VUPA 3BD2A 4MZBA 2DJ2A 4L8EA 2D2ZA 3F9UA 3EC3A 4ZB8A 3EINA 5IQYA 1AUCA 1GTUA 5F8BA 3ZL5A 4FIWA 3G7YA 3DIEA 3GKKA 1A8LA 1EV9A 1O8WA 1TK8B 3BBYA 1GH2A 1NHOA 3PGTA 2C1YA 1DBYA 4BA7A 3HVVA 1XWKA 4N10A 3D21A 5A4UA 3DVXA 2B6MA 4DSQA 2B3SA 4HOJA 1KBNA 3P90A 1ZZYA 4Z2RA 2DJ3A 4TR0A 1M9AA 3DYRA 5KN2A 1FHEA 1R7HA 4OFMA 4MJCA 3KJYA 5IMCA 1EOHA 1G7OA 1S3DA 4G10A 1K0MA 1TP9A 3TKPA 4EIQA 3Q74A 2F9SA 2CT6A 4MDCA 4OCEA 3GURA 3GSTA 5CP1A 4IP1A 4V1Ag 4WF4A 1YJ6A 4MF6A 1M99A 5ECLB 4TR4A 1X5CA 1QK8A 2GQLA 4TXOB 2H72A 3PH9A 4X43A 2C3NA 2OADA 1I9DA 2R2JA 4A5PA 2DJ0A 2IPAA 2H19A 2LQOA 5J4UA 1GULA 4IJIA 1U6TA 1ERTA 3HJMA 2AYTA 3QAVA 4HDEA 3P7XA 2L4QA 3L9VA 1PN9A 4N0ZA 2XBIA 2HLSA 1T8EB 2YWOA 4PXOA 4RQXA 6GSXA 3MAKA 13GSA 2L5LA 5G1LA 5AIXA 3HZ4A 5A5KA 2YWIA 4ZL7A 2L4CA 4TXOA 2V1MA 3HVXA 1VF3A 1YKAA 4V1Ap 1TRVA 3A2WA 3M9JA 1R4WA 3QAWA 1JZWA 1K3YA 2XPEA 5ENUA 5H5QA 1T3BA 4ICYA 3AY8A 5KN0A 1OE7A 1G6WA 2XBQA 4MJEA 3FR6A 1SK2A 4KCAA 1K3LA 1PL1A 3TOTA 2IMKA 4NXIA 3CYNA 3RAZA 3FK8A 1XVWA 5D9XA 4EIPA 4MMMA 2ES7A 2H6YA 3VWUA 3VPTA 3HVSA 4L0UA 5C00A 1TI1A 1V2AA 2QSIA 3ZFLA 2EIOA 1ERWA 3WYWA 3EYTA 2EIQA 1R26A 2VL2A 3ZFBA 4WR4A 2WS2A 1H75A 1Q4JA 3PINA 2FY6A 3KP9A 4CY6A 1OC8A 5DQSA 2GGTA 2PVQA 2G2QA 2KUCA 4XS4B 4BWQA 2H0HA 3BCIA 1ML6A 5C04A 1T1VA 5EVOA 2VCVA 3QFAC 3GH9A 4L0WA 4K2DA 4ECBA 1DSBA 3FR3A 2GZYA 1BAYA 2V2GA 4V2MA 1OC9B 2OKAA 4MF7A 4HZ2A 4D73B 3L9UA 2IMEA 1AIUA 2OA7A 5JCUA 1X5DA 2CX4A 4Z7XA 4KDUA 3TKQA 2YV7A 1A0RP 3IV4A 3FZAA 1YDKA 1K3OA 3FKFA 2DSAA 3KH7A 4XS4A 2AHEA 3W8SA 3GKXA 3GH6A 4MF5A 2VCXA 3IXRA 4KE3A 1F9MA 2YPMA 3KIJA 1OYJA 4QL7A 1FW1A 5ECQB 3LJRA 3FR9A 3N9JA 5ECPB 4POKA 3TOUA 4HS1A 1AQVA 2E2MA 1F3BA 4PTSA 4EDZA 1OC9A 4F82A 2DJ1A 1WP0A 2JSZA 1BQ7A 4D73A 4G0KA 1URMA 3RHBA 3ZIJA 3UAPA 1G6YA 5F06A 3H8QA 1MEKA 2EIRA 2GVPA 3NOFA 1MDKA 4ZL8A 2OACA 5HQPA 1USBA 3IHQA 4LA1A 2F51A 2LS5A 2KLXA 1NM3A 3GX8A 2A4HA 2ON5A 1BJXA 1PRXA 1Q98A 3ZVJA 2VOCA 3HCZA 4KH7A 1GSFA 2A2SA 5KN3A 2GTUA 4ZB9A 1XOBA 2IMDA 3G9BA 4XS1A 3UARA 3GYKA 2C3QA 2WFCA 2QKEA 3APQA 3LXTA 2JZTA 3ZIVA 3HY2A 1JZDA 3KMOA 5AN1A 1OKTA 2H1DA 5J9CA 2CAIA 2HSYA 2C0GA 1AQXA 3IAS2 5D9WA 1GTAA 3H1NA 3RDWA 3WGXA 4I2UA 1U87A 3ERFA 2XHFA 2VL9A 1XWCA 2F8FA 5IMZA 4ML1A 2DLXA 1EP7A 1SL1B 1IYIA 3RBTA 11GSA 2REMA 2H0IA 4GSTA 1PA3A 1Y25A 2JACA 4HU7A 1TKDB 4BL7B 4J56E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X99 A;  3UIW A;  5JCG A;  1V40 A;  1GLQ A;  4TOP A;  1SKW B;  2NVL A;  4J57 E;  5JWR B;  4Q5F A;  3R2Q A;  1YEX A;  1V57 A;  2M72 A;  1B9Y C;  3GIX A;  3QPM A;  4JE1 A;  1FB0 A;  2L6D A;  2B7J A;  2M46 A;  2R5G A;  2MMZ A;  1B48 A;  2H1G A;  2HSH A;  2VCT A;  4NMU A;  4NHZ A;  1C72 A;  3GRX A;  3WGE A;  2TRC P;  2VLT A;  4EF0 A;  5G2Z A;  3C71 A;  2DIZ A;  3TKS C;  4BL7 A;  2P31 A;  3ZRE A;  5FHI A;  1YKC A;  4F0C A;  5B6N A;  1LJR A;  4POL A;  1WPI A;  3JCM L;  2H6X A;  4MLY A;  3OR5 A;  1W4V A;  2HXK A;  4XRD A;  3VPQ A;  2DIY A;  4CHS A;  4DSR A;  4GWR A;  2FWH A;  1GUM A;  5J3R A;  1XBS A;  2L57 A;  4EDY A;  6GSW A;  2C8U A;  2WGR A;  2PGT A;  3P2A A;  5L71 A;  17GS A;  2HT9 A;  5CRH A;  3D0Z A;  1MTC A;  5E59 A;  2B1K A;  3DKS A;  2F8A A;  3TKS E;  4G2E A;  4EVM A;  4AJ7 A;  5JWO B;  3O3T A;  5IMV A;  5ECR B;  2OBI A;  4OO5 A;  4N0V A;  4ZB6 A;  3UEM A;  3M1G A;  4ZL9 A;  4PQH A;  1ERV A;  3VI7 A;  4DVC A;  4I5Q A;  5EPF A;  14GS A;  1XIY A;  2V6K A;  4K7N A;  2PBJ A;  4FH8 A;  1WWJ A;  2C0E A;  4EC0 A;  2VD1 A;  2NPB A;  2O8V B;  3F8U A;  3TRP A;  1EZK A;  2BTO T;  2FWE A;  3ZYW A;  1GUK A;  3M3M A;  3GKM A;  5F0G A;  5IIZ A;  3E3E A;  2H75 A;  3N5O A;  5ABR A;  3A2V A;  1JLV A;  1TU8 A;  5IMD A;  2YCD A;  19GS A;  2HYX A;  3FZ5 A;  2WRT A;  2PVO C;  2N5F A;  1U3I A;  4FYC A;  1UA5 A;  3CMI A;  4K6X A;  1B4P A;  1LU4 A;  2YN1 A;  4IBP A;  1EGR A;  2CAQ A;  1O81 A;  1THO A;  1PX7 A;  2LJR A;  1X0R A;  2OBK A;  4IEL A;  3CXG A;  5H5S A;  2H8L A;  2E7P A;  2H6Z A;  1JZR A;  3H4K A;  3TJJ A;  1SD9 A;  1UN2 A;  1TRU A;  5G5E A;  2R4V A;  3C1S A;  3ZZX A;  5DDL A;  2FHE A;  2P5R A;  1ZOF A;  5D96 A;  5IOX A;  2LJK A;  3CSH A;  1XW9 A;  3EU3 A;  5GAP D;  4LLR A;  3DVW A;  3E0U A;  1T4Z A;  5JWQ B;  4ECI A;  16GS A;  3UVT A;  3L9S A;  2VD0 A;  2CVK A;  3C7M A;  4F0B A;  5DBQ A;  4YQU A;  2IL3 A;  2JAD A;  4ISD A;  3EE2 A;  3LG6 A;  4BVY A;  2LEG A;  5HFK A;  3H93 A;  2J23 A;  5ECK B;  2P5Q A;  1X9M B;  4IGJ A;  1K0C A;  1TU7 A;  2WZ9 A;  4GQC A;  2PMT A;  1DE1 A;  3HXS A;  4G9H A;  2GZP A;  5CRE A;  5F05 A;  2ZNM A;  3FYG A;  1QXH A;  4KAE A;  3QD9 A;  3TKS A;  2M80 A;  4JED A;  1AW9 A;  2AAW A;  2YNX A;  2LQQ A;  3TJB A;  1M2A A;  4PUA A;  2KOK A;  1WE0 A;  2YJH A;  3IK9 A;  1F3A A;  2YZH A;  2LRT A;  1TJD A;  2CV4 A;  3FY7 A;  3G7I A;  2H66 A;  4DSS B;  1PD2 1;  2BJX A;  4HUA A;  1GL8 A;  2HZF A;  1GSE A;  4N30 A;  1Y6E A;  4TR3 A;  4EO3 A;  5JCW A;  1T00 A;  3LOR A;  20GS A;  2QC7 A;  2GT5 A;  5INY A;  3MDK A;  1SL2 B;  5LCZ A;  5HR0 A;  6GST A;  1QMV A;  2ALB A;  2GQK A;  4JRR A;  2CVB A;  2CA8 A;  1O85 A;  3ME7 A;  2XC2 A;  5A4V A;  4MPG A;  1XWA A;  2H70 A;  4IP6 A;  2RUE A;  4P3Y B;  5IMF A;  5ECH B;  2K18 A;  2OE3 A;  1XWG A;  1F37 A;  1JFU A;  1TW9 A;  4PGT A;  3A5W A;  2FWG A;  4PQI A;  4DSS A;  1SYR A;  4MA9 A;  2H1A A;  2VLU A;  5CO3 A;  5AGY A;  1A2L A;  7GSS A;  2L59 A;  4HI7 A;  1VRS D;  3J7Y b;  2N5B A;  18GS A;  4K9Z A;  3VLN A;  2R37 A;  1BYE A;  5ELA A;  1KNG A;  1E2Y A;  4YQM A;  2A2R A;  3HKR A;  2GSR A;  1EOG A;  5J41 A;  5IMA A;  4K1F A;  1GWC A;  1N2A A;  2PWJ A;  3UL3 A;  3WD6 A;  3DRN A;  3KM6 A;  2MMN A;  3KP8 A;  4KND A;  5B8A A;  1A0F A;  2CZ3 A;  1EEJ A;  1NSW A;  1EV4 A;  5D73 A;  2AB6 A;  1T7P B;  2K8V A;  1PGT A;  4OMV A;  5COH A;  4PUR A;  4NV2 A;  2WCI A;  3KGK A;  2PN8 A;  3SWL A;  2BMX A;  2O85 A;  2IJY A;  3LFL A;  3M8N A;  3UVH A;  3FHK A;  1WJK A;  3TB2 A;  1ON4 A;  1GTB A;  4TW5 A;  3LSZ A;  2IMF A;  3D4T A;  4WR5 A;  3RPP A;  2DJK A;  1HNB A;  5D9V A;  9GSS A;  2VM2 A;  4HQZ A;  1GRX A;  4L5O A;  1BED A;  4WF5 A;  4MJA A;  3IE3 A;  3KD0 A;  4QQ7 A;  1WRY A;  2GZZ A;  2FCH A;  1K0A A;  4LMW A;  4OWY A;  3LWA A;  1XZO A;  3LYK A;  3ZVJ D;  1HQO A;  4KX4 A;  2VCW A;  4OFN A;  2DMM A;  4AJ8 A;  2HRF A;  4JR6 A;  2WJU A;  2OE0 A;  1N8J A;  2LRC A;  2P0G A;  3W6G A;  4XHM A;  4XRA A;  3QAG A;  3LYP A;  4YH2 A;  5B6M A;  4PNG A;  3VK9 A;  2LV3 A;  3F3R A;  2FD3 A;  4GCI A;  4MZC A;  2RUF A;  1OVN A;  4CW9 A;  3APS A;  3IRA A;  3LQ7 A;  2I81 A;  2H74 A;  1ZYQ B;  3FZ4 A;  4ECJ A;  2H71 A;  2G0F A;  1SJ6 A;  2JZR A;  1XPV A;  1QGV A;  1JLW A;  5KEJ A;  1BG5 A;  3KXO A;  2L6C A;  4GSS A;  2L5O A;  2YWN A;  2IFQ B;  3VI5 A;  10GS A;  5DAL B;  4TRX A;  2MMA A;  1NHY A;  3D4M A;  2FNO A;  1MDI A;  5G5F A;  1YY7 A;  2GDR A;  5CRD A;  2VCQ A;  5ELG A;  5GST A;  2ZUP A;  3SBC A;  4DEJ A;  4MH3 A;  3TJG A;  2MMO A;  2B1L A;  2H01 A;  3Q6O A;  3GA4 A;  1O8X A;  3GHA A;  2I1U A;  2LNT A;  1Z9H A;  2O89 A;  1ACV A;  2PU9 C;  5D93 A;  3M9K A;  5KN1 A;  4BVX A;  2IIY A;  1B8X A;  2H73 A;  6GSS A;  4IVF A;  2B5X A;  2EC4 A;  3WT1 A;  2JSY A;  1ZYE A;  4KCE A;  3ZIT A;  3CTF A;  2IFQ A;  4AJ6 A;  3GNJ A;  5DAL A;  2CVD A;  2HFD A;  1ILO A;  1Z5Y E;  3L0H A;  1R5A A;  4Q5Q A;  5AIS A;  4MZW A;  1M0U A;  4L5L A;  1PKW A;  3HYP A;  3US3 A;  3ISO A;  1AAZ A;  4QL9 A;  1QUW A;  3KTL A;  5ECS A;  4OCF A;  2V32 A;  4I8B A;  2KP1 A;  1W89 A;  3EMX A;  1YEP A;  4K8M A;  3KTB A;  2NTO A;  2B5Y A;  2WB9 A;  2PUK C;  2WDU A;  1NW2 A;  3C1R A;  2K8S A;  2F3M A;  4MJB A;  5IPG A;  1MDJ A;  2O87 A;  1U3A A;  2GT6 A;  1MD3 A;  1PQN A;  3I9V 2;  1VF1 A;  1TI3 A;  1I5G A;  2Z9S A;  2X8C A;  2TRX A;  2YOI A;  5LNK e;  3CSJ A;  2H1B A;  3J7Y k;  3TUE A;  4YQV A;  4KW6 A;  2CZ2 A;  3BOA A;  3MNG A;  4I2T A;  4KUN A;  4E8H A;  1O6J A;  3GUS A;  2FWF A;  2LTK A;  4GRF A;  2H30 A;  4GXZ A;  1FVK A;  1XXU A;  3GKN A;  4AF2 A;  5FT3 A;  5IO2 A;  3GN3 A;  1F2E A;  3DXB A;  4KB3 A;  2X64 A;  1ZMA A;  2RM5 A;  2JU5 A;  4ZBD A;  2YWM A;  3ZRD A;  4H86 A;  2E2G A;  3A3T A;  2YAN A;  5ECM B;  4IHU A;  3IA1 A;  1K0N A;  3CRU A;  2K6V A;  3O6T A;  2C4J A;  3IPZ A;  4WXT A;  2GQM A;  2VCZ A;  5DAK B;  1YQ1 A;  2I9H A;  3WGD A;  1Z3E A;  2LST A;  1TRS A;  2FLS A;  5IOW A;  3WT2 A;  3CSI A;  3FEU A;  2C80 A;  1ZL9 A;  3TJK A;  2VIM A;  4IS0 A;  1IYH A;  4HZ4 A;  5HR1 A;  3DML A;  1ERU A;  1EWX A;  5ECO B;  3GX0 A;  1PX6 A;  5G31 A;  1GSQ A;  1Z6N A;  2AUV A;  1SK0 A;  1OKD A;  1FO5 A;  4K0N A;  2NDO A;  2LJA A;  4J2F A;  2TIR A;  2HE3 A;  1U88 A;  3IK7 A;  4LMV A;  2PER A;  4JU5 A;  1TTZ A;  5GZZ B;  4HJ2 A;  4AGS A;  5DAK A;  5CRW A;  1QFN A;  2DC5 A;  4TR1 B;  4OFT A;  3U6V A;  3ZLP A;  1TK5 B;  1TDI A;  3KZQ A;  1RW1 A;  1XVQ A;  3APO A;  4IQ1 A;  2ON7 A;  2CQ9 A;  4RI6 A;  2MBS A;  1G0T A;  2GSS A;  2YP6 A;  4ZBA A;  5F07 A;  1TXX A;  4MAB A;  3GSS A;  3TDG A;  3KMN A;  3ME8 A;  3NIV A;  2QGV A;  4X0X A;  1AXD A;  4LL1 B;  5G1K A;  1FB6 A;  3GL3 A;  4XTS A;  4NPB A;  5HFI A;  1X9S B;  3MWH A;  1YZX A;  3EVI A;  3C73 A;  3IR4 A;  5B7C A;  2A4V A;  4ID0 A;  5IO0 A;  2IMI A;  3FZ9 A;  4Q5R A;  4EUY A;  1OC3 A;  1UC7 A;  2LRN A;  5DJL A;  4TR1 A;  3F0I A;  4O92 A;  3QFB C;  4IJ3 A;  2AV4 A;  2XPD A;  4WBJ A;  5IM9 A;  1A2J A;  3E9J B;  4EL1 A;  4MCU A;  3A2X A;  3TJF A;  3LEF A;  1GSU A;  3HA9 A;  2IN3 A;  1XWB A;  1B9X C;  2I3Y A;  1X5E A;  4ZBB A;  4XIH A;  3UMA A;  3UOM A;  3F4S A;  4CDO A;  4TKY A;  4FYU A;  1SJI A;  2LKU A;  2JL4 A;  4EXJ A;  3S9F A;  3UBK A;  4G19 A;  1GSY A;  5HR2 A;  2K9F A;  1AC1 A;  2V41 A;  3EU4 A;  4KDY A;  2HI7 A;  1PMT A;  4TVE A;  4O7H A;  1GNW A;  1UVZ A;  1S3C A;  1CQG A;  3MSZ A;  1BX9 A;  1V98 A;  1TK0 B;  4MH2 A;  2V6O A;  4HEA 2;  3GTU B;  1B4Q A;  3H79 A;  3TRX A;  1XW5 A;  1X9W B;  1A8Y A;  2C0D A;  5EY6 A;  4ZIJ A;  1CQH A;  3TRQ A;  1FOV A;  2PPT A;  2E0Q A;  1SYX A;  5B8B A;  4TXV A;  3QOU A;  3HD5 A;  4GTU A;  1SJZ A;  4K7O A;  1ZGN A;  4X1U A;  3QCP A;  3EUR A;  2YJ7 A;  3C8E A;  4NWY A;  2VLV A;  4GQF A;  3ZML A;  3IOS A;  3IBH A;  3Q19 A;  3ZMK A;  1V58 A;  4MK3 A;  1EP8 A;  3RPN A;  3ERG A;  3GTU A;  3RHC A;  1XCC A;  4GSN A;  3DEX A;  1M2D A;  1VGL A;  2RM6 A;  4TN8 A;  4ML6 A;  4RI7 A;  1ST9 A;  4PX1 A;  3VFI A;  1FVJ A;  4FO5 A;  1WMJ A;  1GP1 A;  2YZU A;  5J5N A;  1A2M A;  1E6B A;  1HYU A;  3IC4 A;  1S3A A;  2R3X A;  4WKW A;  1EEM A;  3D5J A;  5CAX A;  1J0F A;  4GF0 A;  3KH9 A;  2DBC A;  3TGZ A;  2MYG A;  1ABA A;  2HNL A;  4F2I A;  2FA8 A;  1F6M C;  5DCG A;  5ID2 B;  4YAV A;  4OO4 A;  3GMF A;  4N11 A;  3U5R E;  4O32 A;  5HR3 A;  6GSV A;  1SU9 A;  1A23 A;  4BWS A;  1WOU A;  5G30 A;  3CBU A;  4IN0 A;  1OE8 A;  4KSO A;  1J08 A;  2B5E A;  4I6X A;  1YF0 A;  3VWV A;  4IQA A;  4WET A;  5CNW A;  3I69 A;  5DJM A;  2ZCT A;  2GST A;  4PNF A;  2GS3 A;  4JZQ A;  4F9Z A;  3NZN A;  1K0D A;  1JZO A;  4JR4 A;  1T4Y A;  1GUH A;  4NHW A;  3F4R A;  4HU9 A;  1Z6M A;  3HZ8 A;  2HRN A;  3VUR A;  4K0G A;  2LUS A;  4E8E A;  2CX3 A;  1M9B A;  5D9T A;  4KGI A;  5ID2 A;  1XOA A;  6GSY A;  3KEB A;  5GSS A;  4KSM A;  2O7K A;  2VL3 A;  1WIK A;  1TOF A;  2DML A;  3EWL A;  3W8J A;  2I4A A;  4PUF C;  1RK4 A;  4EE0 A;  4F03 A;  2OE1 A;  3ZTL A;  3L4N A;  6GSU A;  4PQ1 A;  1JHB A;  4RUV A;  5IPH A;  1O7U A;  1QQ2 A;  4ULX A;  1SKS B;  5DCH A;  1Z7R A;  3V1W A;  4ILF A;  3GV1 A;  5E4W A;  1EGO A;  2HZE B;  3G7J A;  3F3Q A;  3IAM 2;  3HJP A;  2VO4 A;  1A24 A;  4KDX A;  3L78 A;  2H76 A;  3F63 A;  1GNE A;  3QR6 A;  4EKZ A;  3KCM A;  2VAF A;  1SKR B;  1XW6 A;  12GS A;  4IKH A;  3O76 A;  4V2N A;  1YF1 A;  1KTE A;  1VF2 A;  2NBS A;  4NV5 A;  2FUG 2;  4BPY A;  3CRT A;  4ECC A;  1VF4 A;  22GS A;  3DD3 A;  3FRC A;  1Z7P A;  1RQM A;  1SEN A;  1LBK A;  2GSQ A;  5DVB A;  4ZXG A;  5EL8 A;  4HJM A;  3HJO A;  2HZE A;  5A4W A;  2B7K A;  3D6I A;  4HQS A;  3HDC A;  3ERW A;  4I97 A;  1SK1 A;  1AQW A;  3PR8 A;  4K7I A;  4MP4 A;  2OJL A;  1V9W A;  3LGC A;  1THX A;  4YAP A;  5ECN B;  4KA0 A;  3EMP A;  1O73 A;  1K0B A;  5CRG A;  4GLT A;  2R6K A;  3GL5 A;  3VWX A;  1KEB A;  3DGQ A;  3UJ1 A;  3VWW A;  3TKR A;  4V2L A;  3K8N A;  3FW2 A;  3F4T A;  3I6A A;  2LNS A;  5LD0 A;  2H0G A;  3BJ5 A;  1R5P A;  1PKZ A;  3Q18 A;  1GSS A;  2J9H A;  3P8W A;  1DUG A;  4NAX A;  1ZCP A;  5H5R A;  2RII A;  3IDV A;  4LL4 B;  2KHP A;  3CTG A;  1GSD A;  1M2B A;  1G7E A;  2DJJ A;  4XCS A;  3GFK A;  5ECI B;  2AJQ B;  1HD2 A;  1K0O A;  5D8I A;  2FGX A;  2C3T A;  4FYB A;  3HHV A;  3DWV A;  1H4O A;  4ZIL A;  1DE2 A;  5J9B A;  5FWG A;  4RQR A;  4WBR D;  3F6F A;  8GSS A;  2C0F A;  4IW9 A;  3TCO A;  5GAN D;  1J9B A;  3QDN A;  2VM1 A;  2WUL A;  1SD8 A;  2IWT A;  2X8H A;  4POB A;  2N5A A;  5CYY A;  1XFL A;  3LXZ A;  2MZC A;  1PL2 A;  3F6D A;  4OD7 A;  4JBB A;  5HFG A;  1TRW A;  3M0F A;  4XS6 A;  4WEY A;  3ED3 A;  3BCK A;  3QMX A;  1FG4 A;  1M7T A;  3UBL A;  2JZS A;  1GLP A;  2FA4 A;  1OAZ A;  2MBT A;  1HNC A;  5DQY A;  4ACS A;  3D22 A;  3I43 A;  4POM A;  4O5R A;  2YV9 A;  5AIV A;  4MPF A;  1SL0 B;  4Q5N A;  2GLR A;  2VL2 C;  2RLI A;  2KP2 A;  2X8G A;  1MD4 A;  1PSQ A;  1HNA A;  1FAA A;  1GTI A;  2VUP A;  3BD2 A;  4MZB A;  2DJ2 A;  4L8E A;  2D2Z A;  3F9U A;  3EC3 A;  4ZB8 A;  3EIN A;  5IQY A;  1AUC A;  1GTU A;  5F8B A;  3ZL5 A;  4FIW A;  3G7Y A;  3DIE A;  3GKK A;  1A8L A;  1EV9 A;  1O8W A;  1TK8 B;  3BBY A;  1GH2 A;  1NHO A;  3PGT A;  2C1Y A;  1DBY A;  4BA7 A;  3HVV A;  1XWK A;  4N10 A;  3D21 A;  5A4U A;  3DVX A;  2B6M A;  4DSQ A;  2B3S A;  4HOJ A;  1KBN A;  3P90 A;  1ZZY A;  2DJ3 A;  4TR0 A;  1M9A A;  3DYR A;  5KN2 A;  1FHE A;  1R7H A;  4OFM A;  4MJC A;  3KJY A;  5IMC A;  1EOH A;  1G7O A;  1S3D A;  4G10 A;  1K0M A;  1TP9 A;  3TKP A;  3Q74 A;  2F9S A;  2CT6 A;  4MDC A;  4OCE A;  3GUR A;  3GST A;  5CP1 A;  4IP1 A;  4V1A g;  4WF4 A;  1YJ6 A;  4MF6 A;  1M99 A;  5ECL B;  4TR4 A;  1X5C A;  1QK8 A;  2GQL A;  4TXO B;  2H72 A;  3PH9 A;  4X43 A;  2C3N A;  2OAD A;  1I9D A;  2R2J A;  2DJ0 A;  2IPA A;  2H19 A;  2LQO A;  5J4U A;  1GUL A;  4IJI A;  1U6T A;  1ERT A;  3HJM A;  2AYT A;  3QAV A;  4HDE A;  3P7X A;  2L4Q A;  3L9V A;  1PN9 A;  4N0Z A;  2XBI A;  2HLS A;  1T8E B;  2YWO A;  4PXO A;  4RQX A;  6GSX A;  3MAK A;  13GS A;  2L5L A;  5G1L A;  5AIX A;  3HZ4 A;  5A5K A;  2YWI A;  4ZL7 A;  2L4C A;  4TXO A;  2V1M A;  3HVX A;  1VF3 A;  1YKA A;  4V1A p;  1TRV A;  3A2W A;  3M9J A;  1R4W A;  3QAW A;  1JZW A;  1K3Y A;  2XPE A;  5ENU A;  5H5Q A;  1T3B A;  3AY8 A;  5KN0 A;  1OE7 A;  1G6W A;  2XBQ A;  4MJE A;  3FR6 A;  1SK2 A;  4KCA A;  1K3L A;  1PL1 A;  3TOT A;  2IMK A;  4NXI A;  3CYN A;  3RAZ A;  3FK8 A;  1XVW A;  5D9X A;  4MMM A;  2ES7 A;  2H6Y A;  3VWU A;  3VPT A;  3HVS A;  4L0U A;  5C00 A;  1TI1 A;  1V2A A;  2QSI A;  3ZFL A;  2EIO A;  1ERW A;  3WYW A;  3EYT A;  2EIQ A;  1R26 A;  2VL2 A;  3ZFB A;  4WR4 A;  2WS2 A;  1H75 A;  1Q4J A;  3PIN A;  2FY6 A;  3KP9 A;  1OC8 A;  5DQS A;  2GGT A;  2PVQ A;  2G2Q A;  2KUC A;  4XS4 B;  4BWQ A;  2H0H A;  3BCI A;  1ML6 A;  5C04 A;  1T1V A;  5EVO A;  2VCV A;  3QFA C;  3GH9 A;  4L0W A;  4K2D A;  4ECB A;  1DSB A;  3FR3 A;  2GZY A;  1BAY A;  2V2G A;  4V2M A;  1OC9 B;  2OKA A;  4MF7 A;  4HZ2 A;  4D73 B;  3L9U A;  2IME A;  1AIU A;  2OA7 A;  5JCU A;  1X5D A;  2CX4 A;  4Z7X A;  4KDU A;  3TKQ A;  2YV7 A;  1A0R P;  3IV4 A;  3FZA A;  1YDK A;  1K3O A;  3FKF A;  2DSA A;  3KH7 A;  4XS4 A;  2AHE A;  3W8S A;  3GKX A;  3GH6 A;  4MF5 A;  2VCX A;  3IXR A;  4KE3 A;  1F9M A;  2YPM A;  3KIJ A;  1OYJ A;  4QL7 A;  1FW1 A;  5ECQ B;  3LJR A;  3FR9 A;  3N9J A;  5ECP B;  4POK A;  3TOU A;  4HS1 A;  1AQV A;  2E2M A;  1F3B A;  4EDZ A;  1OC9 A;  4F82 A;  2DJ1 A;  1WP0 A;  2JSZ A;  1BQ7 A;  4D73 A;  1URM A;  3RHB A;  3ZIJ A;  3UAP A;  1G6Y A;  5F06 A;  3H8Q A;  1MEK A;  2EIR A;  2GVP A;  3NOF A;  1MDK A;  4ZL8 A;  2OAC A;  5HQP A;  1USB A;  3IHQ A;  4LA1 A;  2F51 A;  2LS5 A;  2KLX A;  1NM3 A;  3GX8 A;  2ON5 A;  1BJX A;  1PRX A;  1Q98 A;  3ZVJ A;  2VOC A;  3HCZ A;  4KH7 A;  1GSF A;  2A2S A;  5KN3 A;  2GTU A;  4ZB9 A;  1XOB A;  2IMD A;  3G9B A;  4XS1 A;  3UAR A;  3GYK A;  2C3Q A;  2WFC A;  2QKE A;  3APQ A;  3LXT A;  2JZT A;  3ZIV A;  3HY2 A;  1JZD A;  3KMO A;  5AN1 A;  1OKT A;  2H1D A;  5J9C A;  2CAI A;  2HSY A;  2C0G A;  1AQX A;  3IAS 2;  5D9W A;  1GTA A;  3H1N A;  3RDW A;  3WGX A;  4I2U A;  1U87 A;  3ERF A;  2XHF A;  2VL9 A;  1XWC A;  2F8F A;  5IMZ A;  4ML1 A;  2DLX A;  1EP7 A;  1SL1 B;  1IYI A;  3RBT A;  11GS A;  2REM A;  2H0I A;  4GST A;  1PA3 A;  1Y25 A;  2JAC A;  4HU7 A;  1TKD B;  4J56 E; 
#chains in the Genus database with same CATH topology
 2X99 A;  3UIW A;  5JCG A;  1V40 A;  1GLQ A;  4TOP A;  1SKW B;  2NVL A;  4J57 E;  5JWR B;  4Q5F A;  3R2Q A;  1YEX A;  1V57 A;  2M72 A;  1B9Y C;  3GIX A;  3QPM A;  4JE1 A;  1FB0 A;  2L6D A;  2B7J A;  2M46 A;  2R5G A;  2MMZ A;  1B48 A;  2H1G A;  2HSH A;  2VCT A;  4NMU A;  4NHZ A;  1C72 A;  3GRX A;  3WGE A;  2TRC P;  2VLT A;  4EF0 A;  5G2Z A;  4O5Q A;  3C71 A;  2DIZ A;  3TKS C;  4BL7 A;  2P31 A;  3ZRE A;  5FHI A;  1YKC A;  4F0C A;  5B6N A;  1LJR A;  4POL A;  1WPI A;  3JCM L;  2H6X A;  4MLY A;  3OR5 A;  1W4V A;  2HXK A;  4XRD A;  3VPQ A;  2DIY A;  4CHS A;  4DSR A;  4GWR A;  2FWH A;  1GUM A;  5J3R A;  1XBS A;  2L57 A;  4EDY A;  6GSW A;  2C8U A;  2WGR A;  2PGT A;  2QA2 A;  3P2A A;  5L71 A;  17GS A;  2HT9 A;  5CRH A;  3D0Z A;  1MTC A;  5E59 A;  2B1K A;  3DKS A;  2F8A A;  3TKS E;  4G2E A;  4EVM A;  4AJ7 A;  5JWO B;  3O3T A;  5IMV A;  5ECR B;  2OBI A;  4OO5 A;  4N0V A;  4ZB6 A;  3UEM A;  3M1G A;  4ZL9 A;  4PQH A;  1ERV A;  3VI7 A;  4DVC A;  4I5Q A;  4KF9 A;  5EPF A;  14GS A;  1XIY A;  2V6K A;  4K7N A;  2PBJ A;  4FH8 A;  1WWJ A;  2C0E A;  4EC0 A;  2VD1 A;  2NPB A;  2O8V B;  3F8U A;  3TRP A;  1EZK A;  2BTO T;  1PN0 A;  2FWE A;  3ZYW A;  1GUK A;  3M3M A;  3GKM A;  5F0G A;  5IIZ A;  3E3E A;  2H75 A;  3N5O A;  5ABR A;  3A2V A;  1JLV A;  1TU8 A;  5IMD A;  2YCD A;  19GS A;  2HYX A;  3MYD A;  3FZ5 A;  2WRT A;  2PVO C;  2N5F A;  1U3I A;  4FYC A;  1UA5 A;  3CMI A;  4K6X A;  1B4P A;  4BVY B;  1LU4 A;  2YN1 A;  4IBP A;  1EGR A;  2CAQ A;  1O81 A;  1THO A;  1PX7 A;  2LJR A;  1X0R A;  1FOH A;  2OBK A;  4IEL A;  3CXG A;  5H5S A;  2H8L A;  2E7P A;  2H6Z A;  1JZR A;  3H4K A;  3TJJ A;  1SD9 A;  1UN2 A;  1TRU A;  5G5E A;  2R4V A;  3C1S A;  3ZZX A;  5DDL A;  2FHE A;  2P5R A;  1ZOF A;  5D96 A;  5IOX A;  2LJK A;  3CSH A;  1XW9 A;  3EU3 A;  5GAP D;  4LLR A;  3DVW A;  3E0U A;  1T4Z A;  5JWQ B;  4ECI A;  16GS A;  3UVT A;  3L9S A;  3A5I A;  2VD0 A;  2CVK A;  3C7M A;  4F0B A;  5DBQ A;  4YQU A;  2IL3 A;  5KOX A;  2JAD A;  4ISD A;  3EE2 A;  3LG6 A;  4BVY A;  2LEG A;  5HFK A;  3H93 A;  2J23 A;  5ECK B;  2P5Q A;  1X9M B;  4IGJ A;  1K0C A;  1TU7 A;  2DKI A;  2WZ9 A;  4GQC A;  2PMT A;  1DE1 A;  3HXS A;  4G9H A;  2GZP A;  5CRE A;  4USS A;  5F05 A;  2ZNM A;  3FYG A;  4G0I A;  1QXH A;  4KAE A;  3QD9 A;  3TKS A;  2M80 A;  4JED A;  1AW9 A;  2AAW A;  2YNX A;  2LQQ A;  3TJB A;  1M2A A;  4PUA A;  2KOK A;  1WE0 A;  2YJH A;  3IK9 A;  1F3A A;  2YZH A;  2LRT A;  1ZYN A;  1TJD A;  2CV4 A;  3FY7 A;  3G7I A;  2H66 A;  4DSS B;  1PD2 1;  2BJX A;  4HUA A;  1GL8 A;  2HZF A;  1GSE A;  4N30 A;  1Y6E A;  4TR3 A;  4EO3 A;  5JCW A;  2UZ8 A;  1T00 A;  3LOR A;  20GS A;  2QC7 A;  2GT5 A;  5INY A;  3MDK A;  1SL2 B;  5LCZ A;  5HR0 A;  6GST A;  1QMV A;  2ALB A;  2GQK A;  4JRR A;  2CVB A;  2CA8 A;  1O85 A;  3ME7 A;  2XC2 A;  5A4V A;  4MPG A;  1XWA A;  2H70 A;  4IP6 A;  2RUE A;  4P3Y B;  5IMF A;  5ECH B;  2K18 A;  2OE3 A;  1XWG A;  1F37 A;  1JFU A;  4K2X A;  1TW9 A;  4PGT A;  3A5W A;  2FWG A;  4Z2T A;  4PQI A;  4DSS A;  1SYR A;  4MA9 A;  2H1A A;  2VLU A;  5CO3 A;  5AGY A;  1A2L A;  7GSS A;  2L59 A;  4CY8 A;  4HI7 A;  1VRS D;  3J7Y b;  2N5B A;  18GS A;  4K9Z A;  3VLN A;  2R37 A;  1BYE A;  5ELA A;  1KNG A;  1E2Y A;  4YQM A;  2A2R A;  3HKR A;  2GSR A;  1EOG A;  5J41 A;  5IMA A;  4K1F A;  1GWC A;  1N2A A;  2PWJ A;  3UL3 A;  3WD6 A;  3DRN A;  3KM6 A;  2MMN A;  3KP8 A;  4KND A;  5B8A A;  1A0F A;  2CZ3 A;  1EEJ A;  1NSW A;  1EV4 A;  5D73 A;  2AB6 A;  1T7P B;  2K8V A;  1PGT A;  4OMV A;  5COH A;  4PUR A;  4NV2 A;  2WCI A;  3KGK A;  2PN8 A;  3SWL A;  2BMX A;  2O85 A;  2IJY A;  3LFL A;  3M8N A;  3UVH A;  3FHK A;  1WJK A;  3TB2 A;  1ON4 A;  1GTB A;  4TW5 A;  3LSZ A;  2IMF A;  4K5S A;  2DKH A;  3D4T A;  4WR5 A;  3RPP A;  1S3R A;  2DJK A;  4FQU A;  1HNB A;  5D9V A;  9GSS A;  2VM2 A;  4HQZ A;  1GRX A;  4L5O A;  1BED A;  4WF5 A;  4MJA A;  1ZYP A;  3IE3 A;  3KD0 A;  4QQ7 A;  1WRY A;  2GZZ A;  2FCH A;  1K0A A;  4LMW A;  3MIX A;  4OWY A;  3LWA A;  1XZO A;  3LYK A;  3ZVJ D;  1HQO A;  4KX4 A;  2VCW A;  4OFN A;  2DMM A;  4AJ8 A;  2HRF A;  4JR6 A;  2WJU A;  2OE0 A;  1N8J A;  2LRC A;  2P0G A;  3W6G A;  4XHM A;  4XRA A;  3QAG A;  3LYP A;  4YH2 A;  5B6M A;  4PNG A;  3VK9 A;  2LV3 A;  3F3R A;  2FD3 A;  4GCI A;  4MZC A;  2RUF A;  1OVN A;  4CW9 A;  3APS A;  3IRA A;  3LQ7 A;  2I81 A;  2H74 A;  1ZYQ B;  3FZ4 A;  4ECJ A;  4BVX B;  2H71 A;  2A2P A;  2G0F A;  1SJ6 A;  2JZR A;  1XPV A;  1QGV A;  1JLW A;  5KEJ A;  1BG5 A;  3KXO A;  2L6C A;  4GSS A;  2L5O A;  2YWN A;  2IFQ B;  3VI5 A;  10GS A;  5DAL B;  4TRX A;  2MMA A;  1NHY A;  3D4M A;  2FNO A;  1MDI A;  5G5F A;  1YY7 A;  2GDR A;  5CRD A;  2VCQ A;  5ELG A;  5GST A;  2ZUP A;  3SBC A;  4DEJ A;  4MH3 A;  3TJG A;  2MMO A;  2B1L A;  2H01 A;  3Q6O A;  3GA4 A;  3LW9 A;  1O8X A;  3GHA A;  2I1U A;  2LNT A;  1Z9H A;  2O89 A;  1ACV A;  2PU9 C;  5D93 A;  3M9K A;  5KN1 A;  4BVX A;  2IIY A;  1B8X A;  2H73 A;  6GSS A;  4IVF A;  2B5X A;  2EC4 A;  3WT1 A;  2JSY A;  1ZYE A;  4KCE A;  3ZIT A;  3CTF A;  2IFQ A;  4AJ6 A;  3GNJ A;  5DAL A;  2CVD A;  2HFD A;  3EPT A;  1ILO A;  1Z5Y E;  3L0H A;  1R5A A;  2HSM A;  4Q5Q A;  5AIS A;  5BRT A;  4MZW A;  1M0U A;  4L5L A;  1PKW A;  3HYP A;  3US3 A;  3ISO A;  1AAZ A;  4QL9 A;  1QUW A;  3KTL A;  5ECS A;  4OCF A;  5BMU A;  2V32 A;  4I8B A;  2KP1 A;  1W89 A;  3EMX A;  1YEP A;  4K8M A;  3KTB A;  2NTO A;  2B5Y A;  2WB9 A;  2PUK C;  2WDU A;  1NW2 A;  3C1R A;  2K8S A;  2F3M A;  4MJB A;  5IPG A;  1MDJ A;  2O87 A;  1U3A A;  2GT6 A;  1MD3 A;  1PQN A;  3I9V 2;  1VF1 A;  4MNN A;  1TI3 A;  4G0L A;  1I5G A;  1XG8 A;  2Z9S A;  2X8C A;  2TRX A;  3IC8 A;  2YOI A;  3PPU A;  5LNK e;  3CSJ A;  2H1B A;  3J7Y k;  3TUE A;  4YQV A;  4KW6 A;  2CZ2 A;  3BOA A;  3MNG A;  4I2T A;  4KUN A;  4E8H A;  1O6J A;  3GUS A;  3IHG A;  2FWF A;  2LTK A;  4GRF A;  2H30 A;  4GXZ A;  1FVK A;  1XXU A;  3GKN A;  4AF2 A;  5FT3 A;  5IO2 A;  3GN3 A;  1F2E A;  3DXB A;  4KB3 A;  2X64 A;  1ZMA A;  2RM5 A;  2JU5 A;  4ZBD A;  2YWM A;  3ZRD A;  4H86 A;  2E2G A;  3A3T A;  2YAN A;  5ECM B;  2X49 A;  4IHU A;  3IA1 A;  1K0N A;  3CRU A;  2K6V A;  3O6T A;  2C4J A;  3IPZ A;  4WXT A;  2GQM A;  2VCZ A;  5DAK B;  1YQ1 A;  2I9H A;  3WGD A;  1Z3E A;  2LST A;  1TRS A;  2FLS A;  5IOW A;  3WT2 A;  3CSI A;  3FEU A;  2C80 A;  1ZL9 A;  3TJK A;  2VIM A;  4IS0 A;  1IYH A;  4HZ4 A;  5HR1 A;  3DML A;  1ERU A;  1EWX A;  5ECO B;  3GX0 A;  1PX6 A;  5G31 A;  1GSQ A;  1Z6N A;  2AUV A;  1SK0 A;  1OKD A;  1FO5 A;  4K0N A;  2NDO A;  2LJA A;  4J2F A;  2TIR A;  2HE3 A;  1U88 A;  3IK7 A;  4LMV A;  2PER A;  4JU5 A;  1TTZ A;  5GZZ B;  4HJ2 A;  4AGS A;  5DAK A;  5CRW A;  1QFN A;  2DC5 A;  4TR1 B;  4OFT A;  3U6V A;  3ZLP A;  1TK5 B;  1TDI A;  3KZQ A;  1RW1 A;  1XVQ A;  3APO A;  4IQ1 A;  4O5U A;  2ON7 A;  2CQ9 A;  4RI6 A;  2MBS A;  3FMW A;  1G0T A;  2GSS A;  2QA1 A;  2YP6 A;  4ZBA A;  5F07 A;  1TXX A;  4MAB A;  3GSS A;  3TDG A;  3KMN A;  3ME8 A;  3NIV A;  2QGV A;  4X0X A;  1AXD A;  4LL1 B;  5G1K A;  1FB6 A;  3GL3 A;  4X4J A;  4XTS A;  4NPB A;  5HFI A;  5KOW A;  1X9S B;  3MWH A;  1YZX A;  3EVI A;  3C73 A;  3IR4 A;  5B7C A;  2A4V A;  4ID0 A;  5IO0 A;  2IMI A;  3FZ9 A;  4Q5R A;  4EUY A;  1OC3 A;  1UC7 A;  2LRN A;  5DJL A;  4TR1 A;  3F0I A;  4O92 A;  3QFB C;  4IJ3 A;  2AV4 A;  2XPD A;  4WBJ A;  5IM9 A;  1A2J A;  3E9J B;  4EL1 A;  4MCU A;  3A2X A;  3R3E A;  3TJF A;  3LEF A;  1GSU A;  3HA9 A;  2IN3 A;  1XWB A;  1B9X C;  2I3Y A;  1X5E A;  4ZBB A;  1PFO A;  4HSC X;  4XIH A;  3UMA A;  3UOM A;  2R0P A;  3F4S A;  4CDO A;  4TKY A;  4FYU A;  1M3J A;  1SJI A;  2LKU A;  2JL4 A;  4EXJ A;  3S9F A;  3UBK A;  4G19 A;  1GSY A;  5HR2 A;  2K9F A;  1AC1 A;  2V41 A;  3EU4 A;  4KDY A;  2HI7 A;  1PMT A;  4TVE A;  4O7H A;  1GNW A;  1UVZ A;  1S3C A;  1CQG A;  3MSZ A;  1BX9 A;  1V98 A;  1TK0 B;  4MH2 A;  2V6O A;  4HEA 2;  3GTU B;  1B4Q A;  3H79 A;  3TRX A;  1XW5 A;  1X9W B;  1A8Y A;  2C0D A;  4YKG A;  2HRK A;  5EY6 A;  4ZIJ A;  1CQH A;  3TRQ A;  1FOV A;  2PPT A;  2E0Q A;  1SYX A;  5B8B A;  4TXV A;  3QOU A;  3HD5 A;  4GTU A;  1SJZ A;  4K7O A;  1ZGN A;  4X1U A;  3QCP A;  3EUR A;  2YJ7 A;  3C8E A;  4NWY A;  2VLV A;  4GQF A;  3ZML A;  3IOS A;  3IBH A;  3Q19 A;  3ZMK A;  1V58 A;  4MK3 A;  1EP8 A;  3RPN A;  3ERG A;  2X4A A;  3GTU A;  3RHC A;  1XCC A;  4GSN A;  3DEX A;  1M2D A;  1VGL A;  2RM6 A;  4TN8 A;  4ML6 A;  4RI7 A;  1ST9 A;  4PX1 A;  3VFI A;  1FVJ A;  4FO5 A;  1WMJ A;  1GP1 A;  2YZU A;  5J5N A;  1A2M A;  1E6B A;  1HYU A;  3IC4 A;  1S3A A;  2R3X A;  4WKW A;  1EEM A;  3D5J A;  5CAX A;  1J0F A;  4GF0 A;  3KH9 A;  2DBC A;  3TGZ A;  2MYG A;  1ABA A;  2HNL A;  4F2I A;  2FA8 A;  1F6M C;  5DCG A;  5ID2 B;  4YAV A;  4OO4 A;  3GMF A;  4N11 A;  3U5R E;  4O32 A;  5HR3 A;  6GSV A;  1SU9 A;  1A23 A;  4BWS A;  1WOU A;  5G30 A;  3CBU A;  4IN0 A;  1OE8 A;  4KSO A;  1J08 A;  2B5E A;  4I6X A;  1YF0 A;  3VWV A;  4IQA A;  4WET A;  5CNW A;  3I69 A;  5DJM A;  2ZCT A;  2GST A;  4PNF A;  2GS3 A;  4JZQ A;  4F9Z A;  3NZN A;  1K0D A;  1JZO A;  4JR4 A;  1T4Y A;  1GUH A;  4NHW A;  3F4R A;  4HU9 A;  4YKF A;  1Z6M A;  3HZ8 A;  2HRN A;  3VUR A;  4K0G A;  2LUS A;  4E8E A;  2CX3 A;  1M9B A;  5D9T A;  4KGI A;  5ID2 A;  1XOA A;  6GSY A;  3KEB A;  5GSS A;  4KSM A;  2O7K A;  2VL3 A;  1WIK A;  1TOF A;  2DML A;  3EWL A;  3W8J A;  2I4A A;  4PUF C;  1RK4 A;  4EE0 A;  4F03 A;  2OE1 A;  3ZTL A;  3L4N A;  6GSU A;  4PQ1 A;  1JHB A;  4RUV A;  5IPH A;  1O7U A;  1QQ2 A;  3CQF A;  4ULX A;  1SKS B;  5DCH A;  1Z7R A;  3V1W A;  4ILF A;  3GV1 A;  5E4W A;  1EGO A;  2HZE B;  3G7J A;  3F3Q A;  3IAM 2;  3HJP A;  2VO4 A;  1A24 A;  4KDX A;  3L78 A;  2H76 A;  3F63 A;  1GNE A;  3QR6 A;  4EKZ A;  3KCM A;  2VAF A;  1SKR B;  1XW6 A;  12GS A;  4IKH A;  3O76 A;  4V2N A;  1YF1 A;  4K5R A;  1KTE A;  1VF2 A;  2NBS A;  4NV5 A;  2FUG 2;  4BPY A;  3CRT A;  4ECC A;  1VF4 A;  22GS A;  3DD3 A;  3FRC A;  1Z7P A;  1RQM A;  1SEN A;  1LBK A;  2GSQ A;  5DVB A;  4ZXG A;  5EL8 A;  4HJM A;  3HJO A;  2HZE A;  5A4W A;  2B7K A;  3D6I A;  4HQS A;  3HDC A;  3ERW A;  4I97 A;  1SK1 A;  1AQW A;  3PR8 A;  4K7I A;  4MP4 A;  2R0G A;  2OJL A;  1V9W A;  3LGC A;  1THX A;  4YAP A;  5ECN B;  4KA0 A;  3EMP A;  1O73 A;  1K0B A;  1M3I A;  5CRG A;  4GLT A;  2R6K A;  3GL5 A;  3VWX A;  1KEB A;  3DGQ A;  3UJ1 A;  3VWW A;  3TKR A;  4V2L A;  3K8N A;  3FW2 A;  3F4T A;  3I6A A;  2LNS A;  5LD0 A;  2H0G A;  3BJ5 A;  1R5P A;  1PKZ A;  3Q18 A;  1GSS A;  2J9H A;  3P8W A;  1DUG A;  4NAX A;  1ZCP A;  5H5R A;  2RII A;  3IDV A;  4LL4 B;  2KHP A;  3CTG A;  1GSD A;  1M2B A;  1G7E A;  2DJJ A;  4XCS A;  3GFK A;  5ECI B;  2AJQ B;  1HD2 A;  1K0O A;  5D8I A;  2FGX A;  2C3T A;  4FYB A;  4Z2U A;  3HHV A;  3DWV A;  1H4O A;  4ZIL A;  1DE2 A;  5J9B A;  5FWG A;  4RQR A;  4WBR D;  3F6F A;  8GSS A;  2C0F A;  4IW9 A;  3TCO A;  5GAN D;  1J9B A;  2HRA A;  3QDN A;  2VM1 A;  2WUL A;  1SD8 A;  2IWT A;  2X8H A;  4POB A;  2N5A A;  5CYY A;  1XFL A;  3LXZ A;  2MZC A;  1PL2 A;  3F6D A;  4OD7 A;  4JBB A;  5HFG A;  1TRW A;  3M0F A;  4XS6 A;  4WEY A;  3ED3 A;  3BCK A;  3QMX A;  1FG4 A;  1M7T A;  3UBL A;  2JZS A;  1GLP A;  2FA4 A;  1OAZ A;  2MBT A;  1HNC A;  5DQY A;  4ACS A;  3D22 A;  3I43 A;  4POM A;  4O5R A;  2R0C A;  2YV9 A;  5AIV A;  4MPF A;  1SL0 B;  4Q5N A;  2GLR A;  2VL2 C;  2RLI A;  2KP2 A;  2X8G A;  1MD4 A;  1PSQ A;  1HNA A;  1FAA A;  1GTI A;  2VUP A;  3BD2 A;  4MZB A;  2DJ2 A;  4L8E A;  2D2Z A;  3F9U A;  3EC3 A;  4ZB8 A;  3EIN A;  5IQY A;  1AUC A;  1GTU A;  5F8B A;  3ZL5 A;  4FIW A;  3G7Y A;  3DIE A;  3GKK A;  1A8L A;  1EV9 A;  1O8W A;  1TK8 B;  3BBY A;  1GH2 A;  1NHO A;  3PGT A;  2C1Y A;  1DBY A;  4BA7 A;  3HVV A;  1XWK A;  4N10 A;  3D21 A;  5A4U A;  3DVX A;  2B6M A;  4DSQ A;  2B3S A;  4HOJ A;  1KBN A;  3P90 A;  1ZZY A;  4Z2R A;  2DJ3 A;  4TR0 A;  1M9A A;  3DYR A;  5KN2 A;  1FHE A;  1R7H A;  4OFM A;  4MJC A;  3KJY A;  5IMC A;  1EOH A;  1G7O A;  1S3D A;  4G10 A;  1K0M A;  1TP9 A;  3TKP A;  4EIQ A;  3Q74 A;  2F9S A;  2CT6 A;  4MDC A;  4OCE A;  3GUR A;  3GST A;  5CP1 A;  4IP1 A;  4V1A g;  4WF4 A;  1YJ6 A;  4MF6 A;  1M99 A;  5ECL B;  4TR4 A;  1X5C A;  1QK8 A;  2GQL A;  4TXO B;  2H72 A;  3PH9 A;  4X43 A;  2C3N A;  2OAD A;  1I9D A;  2R2J A;  4A5P A;  2DJ0 A;  2IPA A;  2H19 A;  2LQO A;  5J4U A;  1GUL A;  4IJI A;  1U6T A;  1ERT A;  3HJM A;  2AYT A;  3QAV A;  4HDE A;  3P7X A;  2L4Q A;  3L9V A;  1PN9 A;  4N0Z A;  2XBI A;  2HLS A;  1T8E B;  2YWO A;  4PXO A;  4RQX A;  6GSX A;  3MAK A;  13GS A;  2L5L A;  5G1L A;  5AIX A;  3HZ4 A;  5A5K A;  2YWI A;  4ZL7 A;  2L4C A;  4TXO A;  2V1M A;  3HVX A;  1VF3 A;  1YKA A;  4V1A p;  1TRV A;  3A2W A;  3M9J A;  1R4W A;  3QAW A;  1JZW A;  1K3Y A;  2XPE A;  5ENU A;  5H5Q A;  1T3B A;  4ICY A;  3AY8 A;  5KN0 A;  1OE7 A;  1G6W A;  2XBQ A;  4MJE A;  3FR6 A;  1SK2 A;  4KCA A;  1K3L A;  1PL1 A;  3TOT A;  2IMK A;  4NXI A;  3CYN A;  3RAZ A;  3FK8 A;  1XVW A;  5D9X A;  4EIP A;  4MMM A;  2ES7 A;  2H6Y A;  3VWU A;  3VPT A;  3HVS A;  4L0U A;  5C00 A;  1TI1 A;  1V2A A;  2QSI A;  3ZFL A;  2EIO A;  1ERW A;  3WYW A;  3EYT A;  2EIQ A;  1R26 A;  2VL2 A;  3ZFB A;  4WR4 A;  2WS2 A;  1H75 A;  1Q4J A;  3PIN A;  2FY6 A;  3KP9 A;  4CY6 A;  1OC8 A;  5DQS A;  2GGT A;  2PVQ A;  2G2Q A;  2KUC A;  4XS4 B;  4BWQ A;  2H0H A;  3BCI A;  3HVN A;  1ML6 A;  5C04 A;  1T1V A;  5EVO A;  2VCV A;  3QFA C;  3GH9 A;  4L0W A;  4K2D A;  4ECB A;  4BIK A;  1DSB A;  3FR3 A;  2GZY A;  1BAY A;  2V2G A;  4V2M A;  1OC9 B;  2OKA A;  4MF7 A;  4HZ2 A;  4D73 B;  3L9U A;  2IME A;  1AIU A;  2OA7 A;  5JCU A;  1X5D A;  2CX4 A;  4Z7X A;  4KDU A;  3TKQ A;  2YV7 A;  1A0R P;  3IV4 A;  3FZA A;  1YDK A;  1K3O A;  3FKF A;  2DSA A;  3KH7 A;  4XS4 A;  2AHE A;  3W8S A;  3GKX A;  3GH6 A;  4MF5 A;  2VCX A;  3IXR A;  4KE3 A;  1F9M A;  2YPM A;  3KIJ A;  1OYJ A;  4QL7 A;  1FW1 A;  5ECQ B;  3LJR A;  3FR9 A;  3N9J A;  5ECP B;  4POK A;  3TOU A;  4HS1 A;  1AQV A;  2E2M A;  1F3B A;  4PTS A;  4EDZ A;  1OC9 A;  4F82 A;  2DJ1 A;  1WP0 A;  2JSZ A;  1BQ7 A;  4D73 A;  4G0K A;  1URM A;  3RHB A;  3ZIJ A;  3UAP A;  1G6Y A;  5F06 A;  3H8Q A;  1MEK A;  2EIR A;  2GVP A;  3NOF A;  1MDK A;  4ZL8 A;  2OAC A;  5HQP A;  1USB A;  3IHQ A;  4LA1 A;  2F51 A;  2LS5 A;  2KLX A;  1NM3 A;  3GX8 A;  2A4H A;  2ON5 A;  1BJX A;  1PRX A;  1Q98 A;  3ZVJ A;  2VOC A;  3HCZ A;  4KH7 A;  1GSF A;  2A2S A;  5KN3 A;  2GTU A;  4ZB9 A;  1XOB A;  2IMD A;  3G9B A;  4XS1 A;  3UAR A;  3GYK A;  2C3Q A;  2WFC A;  2QKE A;  3APQ A;  3LXT A;  2JZT A;  3ZIV A;  3HY2 A;  1JZD A;  3KMO A;  5AN1 A;  1OKT A;  2H1D A;  5J9C A;  2CAI A;  2HSY A;  2C0G A;  1AQX A;  3IAS 2;  5D9W A;  1GTA A;  3H1N A;  3RDW A;  3WGX A;  4I2U A;  1U87 A;  3ERF A;  2XHF A;  2VL9 A;  1XWC A;  2F8F A;  5IMZ A;  4ML1 A;  2DLX A;  1EP7 A;  1SL1 B;  1IYI A;  3RBT A;  11GS A;  2REM A;  2H0I A;  4GST A;  1PA3 A;  1Y25 A;  2JAC A;  4HU7 A;  1TKD B;  4BL7 B;  4J56 E; 
#chains in the Genus database with same CATH homology
 2X99 A;  3UIW A;  5JCG A;  1V40 A;  1GLQ A;  4TOP A;  1SKW B;  2NVL A;  4J57 E;  5JWR B;  4Q5F A;  3R2Q A;  1YEX A;  1V57 A;  2M72 A;  1B9Y C;  3GIX A;  3QPM A;  4JE1 A;  1FB0 A;  2L6D A;  2B7J A;  2M46 A;  2R5G A;  2MMZ A;  1B48 A;  2H1G A;  2HSH A;  2VCT A;  4NMU A;  4NHZ A;  1C72 A;  3GRX A;  3WGE A;  2TRC P;  2VLT A;  4EF0 A;  5G2Z A;  4O5Q A;  3C71 A;  2DIZ A;  3TKS C;  4BL7 A;  2P31 A;  3ZRE A;  5FHI A;  1YKC A;  4F0C A;  5B6N A;  1LJR A;  4POL A;  1WPI A;  3JCM L;  2H6X A;  4MLY A;  3OR5 A;  1W4V A;  2HXK A;  4XRD A;  3VPQ A;  2DIY A;  4CHS A;  4DSR A;  4GWR A;  2FWH A;  1GUM A;  5J3R A;  1XBS A;  2L57 A;  4EDY A;  6GSW A;  2C8U A;  2WGR A;  2PGT A;  2QA2 A;  3P2A A;  5L71 A;  17GS A;  2HT9 A;  5CRH A;  3D0Z A;  1MTC A;  5E59 A;  2B1K A;  3DKS A;  2F8A A;  3TKS E;  4G2E A;  4EVM A;  4AJ7 A;  5JWO B;  3O3T A;  5IMV A;  5ECR B;  2OBI A;  4OO5 A;  4N0V A;  4ZB6 A;  3UEM A;  3M1G A;  4ZL9 A;  4PQH A;  1ERV A;  3VI7 A;  4DVC A;  4I5Q A;  4KF9 A;  5EPF A;  14GS A;  1XIY A;  2V6K A;  4K7N A;  2PBJ A;  4FH8 A;  1WWJ A;  2C0E A;  4EC0 A;  2VD1 A;  2NPB A;  2O8V B;  3F8U A;  3TRP A;  1EZK A;  2BTO T;  1PN0 A;  2FWE A;  3ZYW A;  1GUK A;  3M3M A;  3GKM A;  5F0G A;  5IIZ A;  3E3E A;  2H75 A;  3N5O A;  5ABR A;  3A2V A;  1JLV A;  1TU8 A;  5IMD A;  2YCD A;  19GS A;  2HYX A;  3MYD A;  3FZ5 A;  2WRT A;  2PVO C;  2N5F A;  1U3I A;  4FYC A;  1UA5 A;  3CMI A;  4K6X A;  1B4P A;  4BVY B;  1LU4 A;  2YN1 A;  4IBP A;  1EGR A;  2CAQ A;  1O81 A;  1THO A;  1PX7 A;  2LJR A;  1X0R A;  1FOH A;  2OBK A;  4IEL A;  3CXG A;  5H5S A;  2H8L A;  2E7P A;  2H6Z A;  1JZR A;  3H4K A;  3TJJ A;  1SD9 A;  1UN2 A;  1TRU A;  5G5E A;  2R4V A;  3C1S A;  3ZZX A;  5DDL A;  2FHE A;  2P5R A;  1ZOF A;  5D96 A;  5IOX A;  2LJK A;  3CSH A;  1XW9 A;  3EU3 A;  5GAP D;  4LLR A;  3DVW A;  3E0U A;  1T4Z A;  5JWQ B;  4ECI A;  16GS A;  3UVT A;  3L9S A;  3A5I A;  2VD0 A;  2CVK A;  3C7M A;  4F0B A;  5DBQ A;  4YQU A;  2IL3 A;  5KOX A;  2JAD A;  4ISD A;  3EE2 A;  3LG6 A;  4BVY A;  2LEG A;  5HFK A;  3H93 A;  2J23 A;  5ECK B;  2P5Q A;  1X9M B;  4IGJ A;  1K0C A;  1TU7 A;  2DKI A;  2WZ9 A;  4GQC A;  2PMT A;  1DE1 A;  3HXS A;  4G9H A;  2GZP A;  5CRE A;  4USS A;  5F05 A;  2ZNM A;  3FYG A;  4G0I A;  1QXH A;  4KAE A;  3QD9 A;  3TKS A;  2M80 A;  4JED A;  1AW9 A;  2AAW A;  2YNX A;  2LQQ A;  3TJB A;  1M2A A;  4PUA A;  2KOK A;  1WE0 A;  2YJH A;  3IK9 A;  1F3A A;  2YZH A;  2LRT A;  1ZYN A;  1TJD A;  2CV4 A;  3FY7 A;  3G7I A;  2H66 A;  4DSS B;  1PD2 1;  2BJX A;  4HUA A;  1GL8 A;  2HZF A;  1GSE A;  4N30 A;  1Y6E A;  4TR3 A;  4EO3 A;  5JCW A;  2UZ8 A;  1T00 A;  3LOR A;  20GS A;  2QC7 A;  2GT5 A;  5INY A;  3MDK A;  1SL2 B;  5LCZ A;  5HR0 A;  6GST A;  1QMV A;  2ALB A;  2GQK A;  4JRR A;  2CVB A;  2CA8 A;  1O85 A;  3ME7 A;  2XC2 A;  5A4V A;  4MPG A;  1XWA A;  2H70 A;  4IP6 A;  2RUE A;  4P3Y B;  5IMF A;  5ECH B;  2K18 A;  2OE3 A;  1XWG A;  1F37 A;  1JFU A;  4K2X A;  1TW9 A;  4PGT A;  3A5W A;  2FWG A;  4Z2T A;  4PQI A;  4DSS A;  1SYR A;  4MA9 A;  2H1A A;  2VLU A;  5CO3 A;  5AGY A;  1A2L A;  7GSS A;  2L59 A;  4CY8 A;  4HI7 A;  1VRS D;  3J7Y b;  2N5B A;  18GS A;  4K9Z A;  3VLN A;  2R37 A;  1BYE A;  5ELA A;  1KNG A;  1E2Y A;  4YQM A;  2A2R A;  3HKR A;  2GSR A;  1EOG A;  5J41 A;  5IMA A;  4K1F A;  1GWC A;  1N2A A;  2PWJ A;  3UL3 A;  3WD6 A;  3DRN A;  3KM6 A;  2MMN A;  3KP8 A;  4KND A;  5B8A A;  1A0F A;  2CZ3 A;  1EEJ A;  1NSW A;  1EV4 A;  5D73 A;  2AB6 A;  1T7P B;  2K8V A;  1PGT A;  4OMV A;  5COH A;  4PUR A;  4NV2 A;  2WCI A;  3KGK A;  2PN8 A;  3SWL A;  2BMX A;  2O85 A;  2IJY A;  3LFL A;  3M8N A;  3UVH A;  3FHK A;  1WJK A;  3TB2 A;  1ON4 A;  1GTB A;  4TW5 A;  3LSZ A;  2IMF A;  4K5S A;  2DKH A;  3D4T A;  4WR5 A;  3RPP A;  2DJK A;  4FQU A;  1HNB A;  5D9V A;  9GSS A;  2VM2 A;  4HQZ A;  1GRX A;  4L5O A;  1BED A;  4WF5 A;  4MJA A;  1ZYP A;  3IE3 A;  3KD0 A;  4QQ7 A;  1WRY A;  2GZZ A;  2FCH A;  1K0A A;  4LMW A;  3MIX A;  4OWY A;  3LWA A;  1XZO A;  3LYK A;  3ZVJ D;  1HQO A;  4KX4 A;  2VCW A;  4OFN A;  2DMM A;  4AJ8 A;  2HRF A;  4JR6 A;  2WJU A;  2OE0 A;  1N8J A;  2LRC A;  2P0G A;  3W6G A;  4XHM A;  4XRA A;  3QAG A;  3LYP A;  4YH2 A;  5B6M A;  4PNG A;  3VK9 A;  2LV3 A;  3F3R A;  2FD3 A;  4GCI A;  4MZC A;  2RUF A;  1OVN A;  4CW9 A;  3APS A;  3IRA A;  3LQ7 A;  2I81 A;  2H74 A;  1ZYQ B;  3FZ4 A;  4ECJ A;  4BVX B;  2H71 A;  2A2P A;  2G0F A;  1SJ6 A;  2JZR A;  1XPV A;  1QGV A;  1JLW A;  5KEJ A;  1BG5 A;  3KXO A;  2L6C A;  4GSS A;  2L5O A;  2YWN A;  2IFQ B;  3VI5 A;  10GS A;  5DAL B;  4TRX A;  2MMA A;  1NHY A;  3D4M A;  2FNO A;  1MDI A;  5G5F A;  1YY7 A;  2GDR A;  5CRD A;  2VCQ A;  5ELG A;  5GST A;  2ZUP A;  3SBC A;  4DEJ A;  4MH3 A;  3TJG A;  2MMO A;  2B1L A;  2H01 A;  3Q6O A;  3GA4 A;  3LW9 A;  1O8X A;  3GHA A;  2I1U A;  2LNT A;  1Z9H A;  2O89 A;  1ACV A;  2PU9 C;  5D93 A;  3M9K A;  5KN1 A;  4BVX A;  2IIY A;  1B8X A;  2H73 A;  6GSS A;  4IVF A;  2B5X A;  2EC4 A;  3WT1 A;  2JSY A;  1ZYE A;  4KCE A;  3ZIT A;  3CTF A;  2IFQ A;  4AJ6 A;  3GNJ A;  5DAL A;  2CVD A;  2HFD A;  3EPT A;  1ILO A;  1Z5Y E;  3L0H A;  1R5A A;  2HSM A;  4Q5Q A;  5AIS A;  5BRT A;  4MZW A;  1M0U A;  4L5L A;  1PKW A;  3HYP A;  3US3 A;  3ISO A;  1AAZ A;  4QL9 A;  1QUW A;  3KTL A;  5ECS A;  4OCF A;  5BMU A;  2V32 A;  4I8B A;  2KP1 A;  1W89 A;  3EMX A;  1YEP A;  4K8M A;  3KTB A;  2NTO A;  2B5Y A;  2WB9 A;  2PUK C;  2WDU A;  1NW2 A;  3C1R A;  2K8S A;  2F3M A;  4MJB A;  5IPG A;  1MDJ A;  2O87 A;  1U3A A;  2GT6 A;  1MD3 A;  1PQN A;  3I9V 2;  1VF1 A;  4MNN A;  1TI3 A;  4G0L A;  1I5G A;  2Z9S A;  2X8C A;  2TRX A;  3IC8 A;  2YOI A;  3PPU A;  5LNK e;  3CSJ A;  2H1B A;  3J7Y k;  3TUE A;  4YQV A;  4KW6 A;  2CZ2 A;  3BOA A;  3MNG A;  4I2T A;  4KUN A;  4E8H A;  1O6J A;  3GUS A;  3IHG A;  2FWF A;  2LTK A;  4GRF A;  2H30 A;  4GXZ A;  1FVK A;  1XXU A;  3GKN A;  4AF2 A;  5FT3 A;  5IO2 A;  3GN3 A;  1F2E A;  3DXB A;  4KB3 A;  2X64 A;  1ZMA A;  2RM5 A;  2JU5 A;  4ZBD A;  2YWM A;  3ZRD A;  4H86 A;  2E2G A;  3A3T A;  2YAN A;  5ECM B;  2X49 A;  4IHU A;  3IA1 A;  1K0N A;  3CRU A;  2K6V A;  3O6T A;  2C4J A;  3IPZ A;  4WXT A;  2GQM A;  2VCZ A;  5DAK B;  1YQ1 A;  2I9H A;  3WGD A;  1Z3E A;  2LST A;  1TRS A;  2FLS A;  5IOW A;  3WT2 A;  3CSI A;  3FEU A;  2C80 A;  1ZL9 A;  3TJK A;  2VIM A;  4IS0 A;  1IYH A;  4HZ4 A;  5HR1 A;  3DML A;  1ERU A;  1EWX A;  5ECO B;  3GX0 A;  1PX6 A;  5G31 A;  1GSQ A;  1Z6N A;  2AUV A;  1SK0 A;  1OKD A;  1FO5 A;  4K0N A;  2NDO A;  2LJA A;  4J2F A;  2TIR A;  2HE3 A;  1U88 A;  3IK7 A;  4LMV A;  2PER A;  4JU5 A;  1TTZ A;  5GZZ B;  4HJ2 A;  4AGS A;  5DAK A;  5CRW A;  1QFN A;  2DC5 A;  4TR1 B;  4OFT A;  3U6V A;  3ZLP A;  1TK5 B;  1TDI A;  3KZQ A;  1RW1 A;  1XVQ A;  3APO A;  4IQ1 A;  4O5U A;  2ON7 A;  2CQ9 A;  4RI6 A;  2MBS A;  3FMW A;  1G0T A;  2GSS A;  2QA1 A;  2YP6 A;  4ZBA A;  5F07 A;  1TXX A;  4MAB A;  3GSS A;  3TDG A;  3KMN A;  3ME8 A;  3NIV A;  2QGV A;  4X0X A;  1AXD A;  4LL1 B;  5G1K A;  1FB6 A;  3GL3 A;  4X4J A;  4XTS A;  4NPB A;  5HFI A;  5KOW A;  1X9S B;  3MWH A;  1YZX A;  3EVI A;  3C73 A;  3IR4 A;  5B7C A;  2A4V A;  4ID0 A;  5IO0 A;  2IMI A;  3FZ9 A;  4Q5R A;  4EUY A;  1OC3 A;  1UC7 A;  2LRN A;  5DJL A;  4TR1 A;  3F0I A;  4O92 A;  3QFB C;  4IJ3 A;  2AV4 A;  2XPD A;  4WBJ A;  5IM9 A;  1A2J A;  3E9J B;  4EL1 A;  4MCU A;  3A2X A;  3R3E A;  3TJF A;  3LEF A;  1GSU A;  3HA9 A;  2IN3 A;  1XWB A;  1B9X C;  2I3Y A;  1X5E A;  4ZBB A;  4XIH A;  3UMA A;  3UOM A;  2R0P A;  3F4S A;  4CDO A;  4TKY A;  4FYU A;  1SJI A;  2LKU A;  2JL4 A;  4EXJ A;  3S9F A;  3UBK A;  4G19 A;  1GSY A;  5HR2 A;  2K9F A;  1AC1 A;  2V41 A;  3EU4 A;  4KDY A;  2HI7 A;  1PMT A;  4TVE A;  4O7H A;  1GNW A;  1UVZ A;  1S3C A;  1CQG A;  3MSZ A;  1BX9 A;  1V98 A;  1TK0 B;  4MH2 A;  2V6O A;  4HEA 2;  3GTU B;  1B4Q A;  3H79 A;  3TRX A;  1XW5 A;  1X9W B;  1A8Y A;  2C0D A;  4YKG A;  2HRK A;  5EY6 A;  4ZIJ A;  1CQH A;  3TRQ A;  1FOV A;  2PPT A;  2E0Q A;  1SYX A;  5B8B A;  4TXV A;  3QOU A;  3HD5 A;  4GTU A;  1SJZ A;  4K7O A;  1ZGN A;  4X1U A;  3QCP A;  3EUR A;  2YJ7 A;  3C8E A;  4NWY A;  2VLV A;  4GQF A;  3ZML A;  3IOS A;  3IBH A;  3Q19 A;  3ZMK A;  1V58 A;  4MK3 A;  1EP8 A;  3RPN A;  3ERG A;  2X4A A;  3GTU A;  3RHC A;  1XCC A;  4GSN A;  3DEX A;  1M2D A;  1VGL A;  2RM6 A;  4TN8 A;  4ML6 A;  4RI7 A;  1ST9 A;  4PX1 A;  3VFI A;  1FVJ A;  4FO5 A;  1WMJ A;  1GP1 A;  2YZU A;  5J5N A;  1A2M A;  1E6B A;  1HYU A;  3IC4 A;  1S3A A;  2R3X A;  4WKW A;  1EEM A;  3D5J A;  5CAX A;  1J0F A;  4GF0 A;  3KH9 A;  2DBC A;  3TGZ A;  2MYG A;  1ABA A;  2HNL A;  4F2I A;  2FA8 A;  1F6M C;  5DCG A;  5ID2 B;  4YAV A;  4OO4 A;  3GMF A;  4N11 A;  3U5R E;  4O32 A;  5HR3 A;  6GSV A;  1SU9 A;  1A23 A;  4BWS A;  1WOU A;  5G30 A;  3CBU A;  4IN0 A;  1OE8 A;  4KSO A;  1J08 A;  2B5E A;  4I6X A;  1YF0 A;  3VWV A;  4IQA A;  4WET A;  5CNW A;  3I69 A;  5DJM A;  2ZCT A;  2GST A;  4PNF A;  2GS3 A;  4JZQ A;  4F9Z A;  3NZN A;  1K0D A;  1JZO A;  4JR4 A;  1T4Y A;  1GUH A;  4NHW A;  3F4R A;  4HU9 A;  4YKF A;  1Z6M A;  3HZ8 A;  2HRN A;  3VUR A;  4K0G A;  2LUS A;  4E8E A;  2CX3 A;  1M9B A;  5D9T A;  4KGI A;  5ID2 A;  1XOA A;  6GSY A;  3KEB A;  5GSS A;  4KSM A;  2O7K A;  2VL3 A;  1WIK A;  1TOF A;  2DML A;  3EWL A;  3W8J A;  2I4A A;  4PUF C;  1RK4 A;  4EE0 A;  4F03 A;  2OE1 A;  3ZTL A;  3L4N A;  6GSU A;  4PQ1 A;  1JHB A;  4RUV A;  5IPH A;  1O7U A;  1QQ2 A;  4ULX A;  1SKS B;  5DCH A;  1Z7R A;  3V1W A;  4ILF A;  3GV1 A;  5E4W A;  1EGO A;  2HZE B;  3G7J A;  3F3Q A;  3IAM 2;  3HJP A;  2VO4 A;  1A24 A;  4KDX A;  3L78 A;  2H76 A;  3F63 A;  1GNE A;  3QR6 A;  4EKZ A;  3KCM A;  2VAF A;  1SKR B;  1XW6 A;  12GS A;  4IKH A;  3O76 A;  4V2N A;  1YF1 A;  4K5R A;  1KTE A;  1VF2 A;  2NBS A;  4NV5 A;  2FUG 2;  4BPY A;  3CRT A;  4ECC A;  1VF4 A;  22GS A;  3DD3 A;  3FRC A;  1Z7P A;  1RQM A;  1SEN A;  1LBK A;  2GSQ A;  5DVB A;  4ZXG A;  5EL8 A;  4HJM A;  3HJO A;  2HZE A;  5A4W A;  2B7K A;  3D6I A;  4HQS A;  3HDC A;  3ERW A;  4I97 A;  1SK1 A;  1AQW A;  3PR8 A;  4K7I A;  4MP4 A;  2R0G A;  2OJL A;  1V9W A;  3LGC A;  1THX A;  4YAP A;  5ECN B;  4KA0 A;  3EMP A;  1O73 A;  1K0B A;  5CRG A;  4GLT A;  2R6K A;  3GL5 A;  3VWX A;  1KEB A;  3DGQ A;  3UJ1 A;  3VWW A;  3TKR A;  4V2L A;  3K8N A;  3FW2 A;  3F4T A;  3I6A A;  2LNS A;  5LD0 A;  2H0G A;  3BJ5 A;  1R5P A;  1PKZ A;  3Q18 A;  1GSS A;  2J9H A;  3P8W A;  1DUG A;  4NAX A;  1ZCP A;  5H5R A;  2RII A;  3IDV A;  4LL4 B;  2KHP A;  3CTG A;  1GSD A;  1M2B A;  1G7E A;  2DJJ A;  4XCS A;  3GFK A;  5ECI B;  2AJQ B;  1HD2 A;  1K0O A;  5D8I A;  2FGX A;  2C3T A;  4FYB A;  4Z2U A;  3HHV A;  3DWV A;  1H4O A;  4ZIL A;  1DE2 A;  5J9B A;  5FWG A;  4RQR A;  4WBR D;  3F6F A;  8GSS A;  2C0F A;  4IW9 A;  3TCO A;  5GAN D;  1J9B A;  2HRA A;  3QDN A;  2VM1 A;  2WUL A;  1SD8 A;  2IWT A;  2X8H A;  4POB A;  2N5A A;  5CYY A;  1XFL A;  3LXZ A;  2MZC A;  1PL2 A;  3F6D A;  4OD7 A;  4JBB A;  5HFG A;  1TRW A;  3M0F A;  4XS6 A;  4WEY A;  3ED3 A;  3BCK A;  3QMX A;  1FG4 A;  1M7T A;  3UBL A;  2JZS A;  1GLP A;  2FA4 A;  1OAZ A;  2MBT A;  1HNC A;  5DQY A;  4ACS A;  3D22 A;  3I43 A;  4POM A;  4O5R A;  2R0C A;  2YV9 A;  5AIV A;  4MPF A;  1SL0 B;  4Q5N A;  2GLR A;  2VL2 C;  2RLI A;  2KP2 A;  2X8G A;  1MD4 A;  1PSQ A;  1HNA A;  1FAA A;  1GTI A;  2VUP A;  3BD2 A;  4MZB A;  2DJ2 A;  4L8E A;  2D2Z A;  3F9U A;  3EC3 A;  4ZB8 A;  3EIN A;  5IQY A;  1AUC A;  1GTU A;  5F8B A;  3ZL5 A;  4FIW A;  3G7Y A;  3DIE A;  3GKK A;  1A8L A;  1EV9 A;  1O8W A;  1TK8 B;  3BBY A;  1GH2 A;  1NHO A;  3PGT A;  2C1Y A;  1DBY A;  4BA7 A;  3HVV A;  1XWK A;  4N10 A;  3D21 A;  5A4U A;  3DVX A;  2B6M A;  4DSQ A;  2B3S A;  4HOJ A;  1KBN A;  3P90 A;  1ZZY A;  4Z2R A;  2DJ3 A;  4TR0 A;  1M9A A;  3DYR A;  5KN2 A;  1FHE A;  1R7H A;  4OFM A;  4MJC A;  3KJY A;  5IMC A;  1EOH A;  1G7O A;  1S3D A;  4G10 A;  1K0M A;  1TP9 A;  3TKP A;  4EIQ A;  3Q74 A;  2F9S A;  2CT6 A;  4MDC A;  4OCE A;  3GUR A;  3GST A;  5CP1 A;  4IP1 A;  4V1A g;  4WF4 A;  1YJ6 A;  4MF6 A;  1M99 A;  5ECL B;  4TR4 A;  1X5C A;  1QK8 A;  2GQL A;  4TXO B;  2H72 A;  3PH9 A;  4X43 A;  2C3N A;  2OAD A;  1I9D A;  2R2J A;  4A5P A;  2DJ0 A;  2IPA A;  2H19 A;  2LQO A;  5J4U A;  1GUL A;  4IJI A;  1U6T A;  1ERT A;  3HJM A;  2AYT A;  3QAV A;  4HDE A;  3P7X A;  2L4Q A;  3L9V A;  1PN9 A;  4N0Z A;  2XBI A;  2HLS A;  1T8E B;  2YWO A;  4PXO A;  4RQX A;  6GSX A;  3MAK A;  13GS A;  2L5L A;  5G1L A;  5AIX A;  3HZ4 A;  5A5K A;  2YWI A;  4ZL7 A;  2L4C A;  4TXO A;  2V1M A;  3HVX A;  1VF3 A;  1YKA A;  4V1A p;  1TRV A;  3A2W A;  3M9J A;  1R4W A;  3QAW A;  1JZW A;  1K3Y A;  2XPE A;  5ENU A;  5H5Q A;  1T3B A;  4ICY A;  3AY8 A;  5KN0 A;  1OE7 A;  1G6W A;  2XBQ A;  4MJE A;  3FR6 A;  1SK2 A;  4KCA A;  1K3L A;  1PL1 A;  3TOT A;  2IMK A;  4NXI A;  3CYN A;  3RAZ A;  3FK8 A;  1XVW A;  5D9X A;  4EIP A;  4MMM A;  2ES7 A;  2H6Y A;  3VWU A;  3VPT A;  3HVS A;  4L0U A;  5C00 A;  1TI1 A;  1V2A A;  2QSI A;  3ZFL A;  2EIO A;  1ERW A;  3WYW A;  3EYT A;  2EIQ A;  1R26 A;  2VL2 A;  3ZFB A;  4WR4 A;  2WS2 A;  1H75 A;  1Q4J A;  3PIN A;  2FY6 A;  3KP9 A;  4CY6 A;  1OC8 A;  5DQS A;  2GGT A;  2PVQ A;  2G2Q A;  2KUC A;  4XS4 B;  4BWQ A;  2H0H A;  3BCI A;  1ML6 A;  5C04 A;  1T1V A;  5EVO A;  2VCV A;  3QFA C;  3GH9 A;  4L0W A;  4K2D A;  4ECB A;  1DSB A;  3FR3 A;  2GZY A;  1BAY A;  2V2G A;  4V2M A;  1OC9 B;  2OKA A;  4MF7 A;  4HZ2 A;  4D73 B;  3L9U A;  2IME A;  1AIU A;  2OA7 A;  5JCU A;  1X5D A;  2CX4 A;  4Z7X A;  4KDU A;  3TKQ A;  2YV7 A;  1A0R P;  3IV4 A;  3FZA A;  1YDK A;  1K3O A;  3FKF A;  2DSA A;  3KH7 A;  4XS4 A;  2AHE A;  3W8S A;  3GKX A;  3GH6 A;  4MF5 A;  2VCX A;  3IXR A;  4KE3 A;  1F9M A;  2YPM A;  3KIJ A;  1OYJ A;  4QL7 A;  1FW1 A;  5ECQ B;  3LJR A;  3FR9 A;  3N9J A;  5ECP B;  4POK A;  3TOU A;  4HS1 A;  1AQV A;  2E2M A;  1F3B A;  4PTS A;  4EDZ A;  1OC9 A;  4F82 A;  2DJ1 A;  1WP0 A;  2JSZ A;  1BQ7 A;  4D73 A;  4G0K A;  1URM A;  3RHB A;  3ZIJ A;  3UAP A;  1G6Y A;  5F06 A;  3H8Q A;  1MEK A;  2EIR A;  2GVP A;  3NOF A;  1MDK A;  4ZL8 A;  2OAC A;  5HQP A;  1USB A;  3IHQ A;  4LA1 A;  2F51 A;  2LS5 A;  2KLX A;  1NM3 A;  3GX8 A;  2A4H A;  2ON5 A;  1BJX A;  1PRX A;  1Q98 A;  3ZVJ A;  2VOC A;  3HCZ A;  4KH7 A;  1GSF A;  2A2S A;  5KN3 A;  2GTU A;  4ZB9 A;  1XOB A;  2IMD A;  3G9B A;  4XS1 A;  3UAR A;  3GYK A;  2C3Q A;  2WFC A;  2QKE A;  3APQ A;  3LXT A;  2JZT A;  3ZIV A;  3HY2 A;  1JZD A;  3KMO A;  5AN1 A;  1OKT A;  2H1D A;  5J9C A;  2CAI A;  2HSY A;  2C0G A;  1AQX A;  3IAS 2;  5D9W A;  1GTA A;  3H1N A;  3RDW A;  3WGX A;  4I2U A;  1U87 A;  3ERF A;  2XHF A;  2VL9 A;  1XWC A;  2F8F A;  5IMZ A;  4ML1 A;  2DLX A;  1EP7 A;  1SL1 B;  1IYI A;  3RBT A;  11GS A;  2REM A;  2H0I A;  4GST A;  1PA3 A;  1Y25 A;  2JAC A;  4HU7 A;  1TKD B;  4BL7 B;  4J56 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...