3F3RA

Crystal structure of yeast thioredoxin1-glutathione mixed disulfide complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
HHHMVTQFKTASEFDSAIAQDKLVVVDFYATWCGPSKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin-1
publication title Structural and kinetic analysis of Saccharomyces cerevisiae thioredoxin Trx1: implications for the catalytic mechanism of GSSG reduced by the thioredoxin system
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Electron transport
total genus 28
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f3rA00
4K7NA 1SK1A 4F0CA 5INYA 1K0BA 2R37A 2H74A 3M9JA 5JCUA 3BCKA 4IELA 3A2WA 1YF0A 3G7IA 3EU4A 1X5DA 3GH9A 2IN3A 4GTUA 1A0FA 2N5BA 2VL9A 4KCEA 4OMVA 4PQIA 2C0DA 3DEXA 3ZVJA 3HCZA 4NV5A 5JWQB 1M99A 1O81A 1O7UA 3M9KA 1SJIA 1AQXA 2FA8A 4I6XA 4HI7A 3F6FA 1X9MB 4G2EA 4PUAA 4WF4A 5ENUA 4TVEA 4MJAA 4HZ2A 1BYEA 1X0RA 2JSZA 2F51A 3P8WA 4XTSA 5CREA 3JCML 2WULA 4GSTA 5G31A 1U87A 3D4MA 3LSZA 4QL9A 2VD0A 2H01A 1Z7RA 3IK7A 2PU9C 4DSQA 3C1RA 2XBQA 4PUFC 1FW1A 2F8AA 2PMTA 4NHZA 1RK4A 1JZDA 2CAQA 1TP9A 4RI7A 5KN2A 1UVZA 3FR3A 1OE7A 2AB6A 2E2MA 3FZ9A 2VLUA 3I43A 1SJ6A 3GFKA 5DALB 4ISDA 1UA5A 3GNJA 2VD1A 5H5QA 1O8WA 5JCWA 1YEPA 4WBRD 3D5JA 5AGYA 5DALA 2PERA 5KEJA 1T1VA 8GSSA 4TW5A 2H6ZA 3S9FA 1XW9A 3M3MA 4FYUA 4KDXA 17GSA 5A5KA 3R2QA 1KTEA 4L5LA 3C71A 2PN8A 12GSA 3L9UA 4ECIA 1ABAA 5HR3A 3M8NA 5IMFA 1K3YA 3IA1A 1GRXA 5B6NA 3LG6A 5J3RA 1K0DA 3P90A 5D96A 2K18A 3L9VA 2CX4A 3QAGA 4XIHA 4KNDA 1DE1A 1PGTA 1X5EA 2C4JA 4GWRA 3GKXA 4HQSA 2CVBA 2RM6A 3TCOA 5ECPB 4KCAA 4KSMA 3HVSA 5EPFA 4OFNA 3PGTA 1EP8A 1PKWA 4IN0A 3TKSE 3LGCA 1FOVA 4ZL7A 2B1KA 1EWXA 1CQGA 5DAKA 5ECHB 3E9JB 3C7MA 4H86A 1X9SB 3LJRA 4JBBA 4WXTA 1YQ1A 4MABA 3P7XA 3TRPA 1TDIA 3GKMA 2H71A 3HA9A 3IV4A 2GLRA 3UL3A 4J2FA 1XWGA 3DRNA 1XVQA 2WCIA 1SL2B 2H0GA 1WJKA 5L71A 1YKCA 4YQMA 4EO3A 1EEMA 3FZAA 4JU5A 5IMCA 4KDUA 3O76A 4XRDA 5B7CA 4WEYA 3VLNA 2M72A 3GURA 1WOUA 2DBCA 3CBUA 4MMMA 6GSSA 3C73A 5H5RA 2WGRA 2J9HA 4AF2A 2N5AA 1V58A 2PUKC 2VM1A 4G10A 4HJ2A 1V57A 2YANA 5ABRA 4MPGA 4HU7A 1EEJA 5KN3A 1A23A 2HNLA 1RW1A 3DXBA 5GAND 3EC3A 2OE3A 3GKKA 3GIXA 1W4VA 4IP6A 3Q74A 2YPMA 2ZUPA 4MF6A 1NHOA 3FK8A 2DIYA 2LQQA 2YJHA 4GSNA 3G9BA 1GSUA 1XCCA 2GSRA 1EGOA 2XC2A 3K8NA 1PX6A 2A2SA 1WRYA 2P5RA 3FEUA 4I8BA 4IKHA 2OJLA 1VRSD 1S3DA 4YAPA 1ERVA 3TDGA 4OO5A 2B5EA 1Y25A 1XOBA 2K8SA 2FY6A 5CRDA 1O6JA 1EOHA 2IFQB 1B48A 2IIYA 2PBJA 4TOPA 4MZWA 1GNWA 3ISOA 3KM6A 2KUCA 4MLYA 2LUSA 4OCEA 5LD0A 2M80A 2IMEA 3A3TA 2YWIA 1XWCA 2B3SA 2X99A 4F0BA 4FYCA 1V2AA 2JADA 4IS0A 3O3TA 1F3BA 1MD4A 5J9CA 1LU4A 4JRRA 1ACVA 2L5LA 3GYKA 4LA1A 6GSXA 2QSIA 5JCGA 1MTCA 3LFLA 5IOXA 5C04A 1ZYQB 2H66A 1SU9A 3ZZXA 2H0IA 2VCTA 4O92A 1QK8A 1GSSA 2IMFA 1FAAA 9GSSA 5B8AA 4KH7A 1NHYA 2GZYA 5GZZB 1ZGNA 4HDEA 4DSSB 4TXOB 2IPAA 2GQLA 1WE0A 3UBLA 3TOTA 6GSWA 2WFCA 4DSSA 4TXOA 2CX3A 2A4VA 2Z9SA 2EIQA 5A4VA 3D0ZA 1E2YA 3DKSA 4Q5NA 1TRSA 5F8BA 3RAZA 5GAPD 2DIZA 5ECRB 3GA4A 5GSSA 5ECLB 1HNAA 4HQZA 1SL1B 2I4AA 2MMOA 3VPTA 1BX9A 1F37A 1H4OA 4ML1A 2XPEA 4LMVA 4YH2A 2LKUA 2GVPA 1JFUA 4PNFA 1F9MA 5GSTA 4WKWA 2GSQA 4OCFA 4QQ7A 3TJKA 2YWOA 1DUGA 3BJ5A 3CXGA 3HY2A 4N11A 4MJBA 1CQHA 5F07A 3M0FA 3BCIA 5G1KA 2L5OA 1O73A 2LEGA 2H6YA 2VM2A 3CYNA 2GSTA 4PGTA 3GMFA 4PQ1A 5D73A 4XRAA 3IC4A 3TB2A 3TKQA 2H19A 4XHMA 5AN1A 4EDYA 3F0IA 4O7HA 3WT1A 2HSHA 2VCZA 2H6XA 1LBKA 1G0TA 1XXUA 3QDNA 2LTKA 1WIKA 1KBNA 4KGIA 1T00A 2MBSA 1S3CA 5EL8A 4I97A 3IDVA 2KP2A 3ZREA 1XWBA 2V2GA 2YOIA 3F4SA 2D2ZA 5IPGA 3FW2A 1T3BA 2H73A 1OVNA 1HNBA 2DMMA 2BTOT 3I9V2 4JEDA 3DIEA 1PL1A 5CO3A 5HQPA 5D93A 1NM3A 2FWEA 2XPDA 3ED3A 1Z9HA 1AXDA 2FWHA 4K8MA 5EY6A 4K0NA 3V1WA 3VI7A 1M9BA 2RM5A 2CAIA 4F82A 4BVYA 3DWVA 4HUAA 1V40A 3N5OA 5B8BA 2IWTA 3UVTA 2FCHA 2H1GA 5DJMA 3QMXA 1M7TA 20GSA 5IMVA 3SBCA 2ALBA 3N9JA 5IO0A 3CSJA 3PR8A 3EWLA 1Q98A 3CRTA 3HHVA 1PMTA 2WB9A 1TRWA 4OFMA 1G7OA 2MZCA 2C3QA 2DC5A 1XOAA 2LSTA 2GTUA 1WPIA 1U6TA 2P0GA 3UJ1A 3VWXA 1ZMAA 3L9SA 1ZL9A 3UMAA 4F9ZA 2AUVA 2YNXA 1XW6A 4GCIA 1Z6MA 1K0AA 4J57E 5JWOB 1SKWB 1VF4A 3EMXA 3J7Yb 3ERFA 5HFIA 1GSFA 1A2LA 2EIRA 4NMUA 3WD6A 3RBTA 1SYRA 2N5FA 4J56E 2ZCTA 4BWQA 2M46A 1B8XA 2HLSA 2OKAA 1WP0A 4K9ZA 4BL7A 5AIXA 3F3QA 2TIRA 3GL5A 2E7PA 5D8IA 1PA3A 2YZHA 1HNCA 2LNSA 2LS5A 3ZLPA 2CVKA 2X8HA 4OWYA 1R5PA 1F6MC 4L5OA 1K0CA 3EINA 1K0MA 5J4UA 4IVFA 1A8YA 1Z3EA 3HJOA 3QPMA 4K2DA 2ES7A 3UAPA 2YWNA 2XBIA 1B9XC 2L4QA 2B7KA 1QMVA 2FA4A 1A24A 4ZB9A 2I9HA 3H4KA 2AHEA 3G7JA 3C8EA 3GV1A 2C80A 3ME7A 2F3MA 1PN9A 3HZ8A 2R3XA 4V1Ag 2MYGA 1GTAA 1A0RP 5ECOB 2VO4A 4EUYA 3WGXA 1SJZA 2I3YA 4G19A 1YF1A 4IQ1A 3KCMA 3Q19A 1AW9A 5D9TA 3FHKA 2BJXA 5H5SA 2YN1A 5CP1A 1SENA 5D9WA 3WT2A 1V98A 3LEFA 1JLVA 6GSYA 3HVXA 2B1LA 3F63A 4DEJA 2LRTA 6GSTA 2G2QA 2EC4A 1FVJA 1MD3A 1R26A 3QD9A 5DCHA 4MA9A 1PD21 3L78A 1QGVA 2VOCA 2KHPA 1A8LA 2H1DA 3KJYA 3GH6A 3VK9A 3LYPA 2RIIA 2V1MA 1BG5A 4O32A 3KIJA 3F6DA 3MSZA 2HZEB 4QL7A 5KN0A 1N8JA 5CRWA 2HE3A 1TK0B 3MDKA 2AJQB 3LQ7A 3D22A 1ZYEA 1VF2A 4MF5A 1AQVA 3IHQA 3O6TA 2JACA 2PGTA 1B4QA 1QQ2A 4MDCA 6GSVA 1GLPA 5G1LA 4PURA 1QXHA 3ZFLA 3NZNA 3QFBC 3DGQA 4IJ3A 5J9BA 10GSA 4L8EA 1ZOFA 4TKYA 1X5CA 4MCUA 5JWRB 4BA7A 4KB3A 3MWHA 2NVLA 2AV4A 1TOFA 1KEBA 1XWKA 7GSSA 3GL3A 5CYYA 2GZPA 4WR5A 1THXA 2C3TA 1M2BA 3KP8A 3US3A 1URMA 5B6MA 4V1Ap 3TKSA 5FWGA 3DVXA 5ECSA 2GGTA 3GUSA 6GSUA 3EMPA 3F4TA 4OFTA 4GRFA 4EDZA 3CTGA 1K3LA 4K0GA 2VL2A 3IXRA 2RUEA 1AIUA 1FVKA 3IPZA 1AUCA 1XW5A 3UARA 1PQNA 2CT6A 3IAM2 3TRXA 1AC1A 4IP1A 2RUFA 2LRCA 3F4RA 1TKDB 1VF3A 3ZITA 3UEMA 3FRCA 2LQOA 2RLIA 4YQVA 1LJRA 2IFQA 3C1SA 1O8XA 3UOMA 4ZBBA 4K7OA 1ZCPA 3L4NA 1GUHA 2R5GA 2H1AA 2I1UA 1S3AA 1TI3A 3IBHA 4TR3A 4RQRA 2PWJA 3A2XA 3HZ4A 2PVQA 4BPYA 1GTUA 1EV4A 2X8GA 4EKZA 2C0FA 2FD3A 1THOA 1EP7A 1JZRA 1PSQA 2FGXA 2NDOA 13GSA 4HZ4A 3GN3A 5DDLA 2JZTA 4IHUA 3D21A 2L57A 3KTLA 3VWWA 2GDRA 2HYXA 1FO5A 3G7YA 1WWJA 2H70A 1N2AA 1OC9B 2GT5A 1C72A 5IMAA 3DMLA 1ST9A 4EC0A 1JZOA 4V2NA 3EURA 5CRHA 5IPHA 2H1BA 4NXIA 5G30A 4LL4B 3FZ4A 2FWGA 3KZQA 4IQAA 1WMJA 1GLQA 18GSA 2DJJA 3Q18A 1XIYA 3VFIA 4N0ZA 4WF5A 2IMDA 2V6OA 1ILOA 2P31A 1BQ7A 3ZL5A 1MEKA 4ZB8A 2GSSA 1J9BA 3QOUA 1G7EA 1PRXA 3BBYA 4Q5RA 2B5YA 2X64A 3TJJA 2JZSA 5ELGA 1BAYA 3RPNA 3KMOA 1EZKA 4X0XA 3IAS2 1JLWA 3FKFA 4MP4A 4RQXA 2VUPA 2L6DA 1DBYA 5IM9A 4AJ6A 1GSQA 1U3AA 4PQHA 1UC7A 2FUG2 5ID2B 3D6IA 3KP9A 4K7IA 3GSSA 2K6VA 2OA7A 4XCSA 1MDJA 4ZIJA 1TU8A 3QAWA 5E4WA 1OC3A 3RHCA 5CAXA 3E3EA 5ID2A 1F2EA 3KH7A 4CHSA 4KUNA 2GQMA 3IRAA 3GTUB 1GTIA 4P3YB 3TRQA 2LJAA 3TKPA 5LNKe 2FNOA 4BVXA 1YY7A 1Z6NA 3A2VA 1TU7A 4TR0A 4ZL9A 4TR4A 1SK2A 3GTUA 2YCDA 3U6VA 4POLA 4GF0A 3QAVA 1H75A 4ECBA 3FYGA 3VWUA 3APSA 5HR2A 2A2RA 1GNEA 4MK3A 4IJIA 2HT9A 4AJ8A 3PH9A 3ZRDA 2G0FA 5J41A 1I9DA 4EXJA 4WETA 2C0EA 3H93A 2AAWA 2WJUA 3TJGA 3ERGA 3GSTA 4MZBA 2CZ3A 2YWMA 3H8QA 1A2JA 4N10A 4ZXGA 1TXXA 3FZ5A 3HJMA 4NPBA 3ZMLA 5CNWA 2H75A 1GP1A 1F3AA 1AAZA 2IL3A 4KDYA 2KP1A 4FIWA 2LJKA 4MF7A 2H76A 3W8SA 4EF0A 3APQA 2TRXA 1I5GA 1GH2A 2KLXA 2HZFA 5F05A 1R5AA 4XS6A 1J0FA 3LXZA 3D4TA 4I5QA 5C00A 5DQSA 5ECKB 4I2TA 4ZB6A 4N0VA 1FB6A 4POMA 5IIZA 4GXZA 4MZCA 2IJYA 5AISA 3FR6A 2FWFA 1K0NA 2REMA 3HXSA 5EVOA 3TOUA 1J08A 2GT6A 3F3RA 1U88A 2IMIA 2XHFA 4MPFA 2O87A 3PINA 1GSEA 2GS3A 4DSRA 4ACSA 2F9SA 4Q5FA 5IMZA 3KMNA 4DVCA 2F8FA 4KAEA 3Q6OA 1TTZA 2LNTA 3F9UA 4MH2A 1OYJA 2DJ0A 1XFLA 1XBSA 2LV3A 2WRTA 1R4WA 3KTBA 2H0HA 4G9HA 4K6XA 4NAXA 2R2JA 2VCQA 19GSA 2PVOC 2VCXA 1YKAA 2DSAA 4HEA2 3TGZA 4NHWA 2YV9A 3BOAA 1JHBA 1B4PA 5COHA 1SKSB 4L0UA 1EOGA 1SD9A 5D9VA 3IOSA 2HSYA 3LORA 4TN8A 5DJLA 2V41A 5G5FA 3SWLA 4WR4A 22GSA 4LLRA 3QR6A 3HYPA 2HFDA 1DE2A 1ERTA 3ZIVA 1OE8A 1FHEA 2MMNA 1T4ZA 5FHIA 3VI5A 4ID0A 4L0WA 2O7KA 1E6BA 1RQMA 1O85A 2K8VA 3ZIJA 3RHBA 3U5RE 1Z5YE 4X43A 2JZRA 3AY8A 1X9WB 4NV2A 2CA8A 1GL8A 5LCZA 2OE1A 2WS2A 3TKSC 3DD3A 1OKTA 4RI6A 2O89A 2MMAA 4IGJA 2LRNA 2V32A 2ZNMA 4HU9A 4TXVA 2P5QA 4KE3A 4YQUA 5ELAA 1FG4A 1OKDA 2CQ9A 5DAKB 2JSYA 1TK5B 1TRUA 2VL2C 1ERUA 3LWAA 1PKZA 1BJXA 3CMIA 2NBSA 1ON4A 4BWSA 2QGVA 1QUWA 4V2LA 2O8VB 5CRGA 4FO5A 4HS1A 1GWCA 2V6KA 1ML6A 1DSBA 2VLVA 1YEXA 2VLTA 3KGKA 3UVHA 5ECIB 5E59A 1PX7A 1GSDA 3ZVJD 2WZ9A 4I2UA 2HZEA 4Q5QA 4ZL8A 1T4YA 3EYTA 2OACA 4KX4A 3TUEA 3L0HA 4E8EA 4GLTA 5ECNB 1UN2A 1T7PB 1IYHA 4GSSA 1VGLA 3ERWA 1XWAA 1USBA 2C8UA 2LJRA 1HQOA 1NW2A 1TJDA 1W89A 1Z7PA 5G5EA 4TRXA 1OC8A 2K9FA 2E0QA 16GSA 4MH3A 3ZTLA 3P2AA 3KEBA 4LL1B 3ME8A 1HD2A 2C3NA 2YV7A 5HR0A 1G6YA 2KOKA 2HRNA 4GQCA 3DVWA 1NSWA 2C0GA 2OBKA 1SD8A 1R7HA 3VWVA 1M0UA 3RDWA 1IYIA 2B7JA 4HOJA 5FT3A 3GX0A 3VPQA 3W6GA 4POKA 4O5RA 2IMKA 5KN1A 1T8EB 1EV9A 3NIVA 1PL2A 4ML6A 3QCPA 4D73B 4FH8A 5IMDA 1Q4JA 4V2MA 5HFKA 3NOFA 1HYUA 1GSYA 2PPTA 3RPPA 2CZ2A 1TRVA 1KNGA 2C1YA 3I69A 2HXKA 4D73A 2EIOA 2QKEA 4CDOA 2HRFA 1SK0A 3TJBA 4ULXA 4MJCA 4XS1A 4NWYA 5IO2A 3QFAC 2GZZA 4K1FA 2MBTA 2WDUA 2ON7A 4N30A 3FR9A 3LXTA 3GX8A 4GQFA 2VCVA 3HKRA 4IBPA 5AIVA 3F8UA 3OR5A 3UBKA 1AQWA 1V9WA 3ZMKA 5IQYA 2OBIA 4F2IA 3M1GA 1Y6EA 1SYXA 4ZBDA 4JR6A 3ZYWA 2YZUA 2JL4A 4ZBAA 1QFNA 2VAFA 4MJEA 3WGEA 5G2ZA 4PX1A 1M2AA 5F06A 3GHAA 1GUMA 1GTBA 2OE0A 2AYTA 1YZXA 1ZZYA 2YP6A 4HJMA 2MMZA 5ECMB 2DJ2A 3IE3A 4PXOA 1TW9A 4CW9A 1OC9A 2H30A 3H1NA 2NTOA 5DCGA 3VURA 4KSOA 11GSA 3IK9A 2B5XA 5DBQA 3CRUA 3UIWA 4JR4A 3HD5A 3BD2A 4E8HA 2ON5A 1K3OA 3LYKA 3APOA 2GQKA 3WGDA 2OADA 1XPVA 4OD7A 5HFGA 2J23A 1TI1A 2VCWA 2QC7A 4EE0A 2R4VA 4PNGA 4TR1B 3W8JA 1XZOA 2CVDA 2NPBA 1FB0A 2DLXA 2FLSA 4Z7XA 1TK8B 1K0OA 2L59A 2HI7A 4X1UA 4XS4B 4JZQA 5J5NA 4ECJA 5A4WA 3EU3A 4KA0A 4JE1A 3A5WA 4TR1A 1GUKA 4ECCA 5D9XA 2DJKA 5IOWA 4XS4A 3KH9A 1G6WA 2DJ3A 1EGRA 3DYRA 3KD0A 3J7Yk 4F03A 1MDKA 3MNGA 2H8LA 1M9AA 2E2GA 3CSHA 3ZFBA 2DJ1A 1YJ6A 2L4CA 2BMXA 4YAVA 5HR1A 4EVMA 1JZWA 1M2DA 4AJ7A 2H72A 3GKNA 4IW9A 3HDCA 4FYBA 4WBJA 14GSA 1BEDA 2YJ7A 5A4UA 1ERWA 3I6AA 4POBA 2R6KA 3KXOA 2VL3A 5DQYA 3TKRA 1OAZA 2FHEA 4LMWA 5DVBA 1U3IA 3HVVA 4ZILA 1XVWA 1GULA 3CSIA 3FY7A 1SKRB 2CV4A 3E0UA 1B9YC 3WYWA 3GRXA 4EL1A 3EVIA 2TRCP 2B6MA 3IR4A 3MAKA 2DMLA 1VF1A 2O85A 1MDIA 5F0GA 1A2MA 3TJFA 1SL0B 2JU5A 3CTFA 4RUVA 1YDKA 4KW6A 3H79A 4ILFA 2L6CA 2VIMA 5ECQB 3EE2A 2I81A 3HJPA 4AGSA 4OO4A 2X8CA
chains in the Genus database with same CATH superfamily
4K7NA 1SK1A 4F0CA 5INYA 1K0BA 2R37A 2H74A 3M9JA 5JCUA 3BCKA 4IELA 3A2WA 1YF0A 3G7IA 3EU4A 1X5DA 3GH9A 2IN3A 4GTUA 1A0FA 2N5BA 2VL9A 4KCEA 4OMVA 4PQIA 2C0DA 3DEXA 3ZVJA 3HCZA 4NV5A 5JWQB 1M99A 1O81A 1O7UA 3M9KA 1SJIA 1AQXA 2FA8A 4I6XA 4HI7A 2HSMA 3F6FA 1X9MB 4G2EA 4PUAA 4WF4A 5ENUA 4TVEA 4MJAA 4HZ2A 1BYEA 1X0RA 2JSZA 2F51A 3P8WA 4XTSA 5CREA 3JCML 2WULA 4GSTA 5G31A 1U87A 3D4MA 3LSZA 4QL9A 2VD0A 2H01A 1Z7RA 3IK7A 2X4AA 2PU9C 4DSQA 3C1RA 4BL7B 2XBQA 4PUFC 1FW1A 2F8AA 2PMTA 4NHZA 1RK4A 1JZDA 2CAQA 1TP9A 4RI7A 5KN2A 1UVZA 3FR3A 1OE7A 2AB6A 2E2MA 3FZ9A 2VLUA 3I43A 1SJ6A 3GFKA 5DALB 4ISDA 1UA5A 3GNJA 2VD1A 5H5QA 1O8WA 5JCWA 1YEPA 4WBRD 3D5JA 5AGYA 5DALA 2PERA 5KEJA 1T1VA 8GSSA 4TW5A 4A5PA 2H6ZA 3S9FA 1XW9A 3M3MA 4FYUA 4KDXA 17GSA 5A5KA 3R2QA 1KTEA 4L5LA 3C71A 2PN8A 12GSA 3L9UA 4ECIA 1ABAA 5HR3A 3M8NA 5IMFA 1K3YA 3IA1A 1GRXA 5B6NA 3LG6A 5J3RA 1K0DA 3EPTA 3P90A 5D96A 2K18A 3L9VA 2CX4A 3QAGA 4XIHA 4KNDA 1DE1A 1PGTA 1X5EA 2C4JA 4GWRA 3GKXA 4HQSA 2CVBA 2RM6A 3TCOA 5ECPB 4KCAA 4KSMA 3HVSA 1S3RA 5EPFA 4OFNA 3PGTA 1EP8A 1PKWA 2X49A 4IN0A 3TKSE 3LGCA 1FOVA 4ZL7A 2B1KA 1EWXA 4KF9A 1CQGA 5DAKA 5ECHB 3E9JB 3C7MA 4H86A 1X9SB 3LJRA 4JBBA 4WXTA 1YQ1A 4MABA 3P7XA 3TRPA 1TDIA 3GKMA 2H71A 3HA9A 3IV4A 2GLRA 3UL3A 4J2FA 1XWGA 3DRNA 1XVQA 2WCIA 1SL2B 4PTSA 2H0GA 1WJKA 5L71A 1YKCA 4YQMA 4EO3A 1EEMA 3FZAA 4JU5A 5IMCA 4KDUA 3O76A 4XRDA 5B7CA 4WEYA 3VLNA 2M72A 3GURA 1WOUA 2DBCA 3CBUA 4MMMA 6GSSA 3C73A 5H5RA 2WGRA 2J9HA 4AF2A 2N5AA 1V58A 2PUKC 2VM1A 4G10A 4HJ2A 1V57A 2YANA 5ABRA 4MPGA 4HU7A 1EEJA 5KN3A 1A23A 2HNLA 1RW1A 3DXBA 5GAND 3EC3A 2OE3A 3GKKA 3GIXA 1W4VA 4IP6A 3Q74A 2YPMA 2ZUPA 4MF6A 1NHOA 3FK8A 2DIYA 2LQQA 2YJHA 4GSNA 3G9BA 1GSUA 1XCCA 2GSRA 1EGOA 2XC2A 3K8NA 1PX6A 2A2SA 2HRKA 1WRYA 2P5RA 3FEUA 4I8BA 4IKHA 2OJLA 1VRSD 1S3DA 4YAPA 1ERVA 3TDGA 4OO5A 2B5EA 1Y25A 1XOBA 2K8SA 4K5RA 2FY6A 5CRDA 1O6JA 1EOHA 2R0GA 2IFQB 1B48A 2IIYA 2PBJA 4TOPA 4MZWA 1GNWA 3ISOA 3KM6A 2KUCA 2A2PA 4MLYA 2LUSA 4OCEA 2DKIA 5LD0A 2M80A 2IMEA 3A3TA 2YWIA 1XWCA 2B3SA 2X99A 4F0BA 4FYCA 1V2AA 2JADA 4IS0A 3O3TA 1F3BA 1MD4A 5J9CA 1LU4A 4JRRA 3PPUA 1ACVA 4O5UA 2L5LA 3GYKA 4LA1A 6GSXA 2QSIA 5JCGA 1MTCA 3LFLA 5IOXA 5C04A 1ZYQB 2H66A 1SU9A 3ZZXA 2H0IA 2VCTA 4O92A 1QK8A 1GSSA 1ZYPA 2IMFA 1FAAA 9GSSA 5B8AA 4KH7A 1NHYA 2GZYA 5GZZB 1ZGNA 4HDEA 4DSSB 4TXOB 2IPAA 2GQLA 1WE0A 3UBLA 3TOTA 6GSWA 2WFCA 4DSSA 4TXOA 2CX3A 2A4VA 2Z9SA 2EIQA 5A4VA 3D0ZA 1E2YA 3DKSA 4Q5NA 1ZYNA 1TRSA 5F8BA 3RAZA 5GAPD 2DIZA 5ECRB 3GA4A 5GSSA 5ECLB 3IC8A 1HNAA 4HQZA 1SL1B 2I4AA 2MMOA 3VPTA 1BX9A 1F37A 1H4OA 4ML1A 2XPEA 4LMVA 4YH2A 2LKUA 2GVPA 1JFUA 4PNFA 1F9MA 5GSTA 4WKWA 2GSQA 4OCFA 4QQ7A 3TJKA 2YWOA 1DUGA 3BJ5A 3CXGA 3HY2A 4N11A 4MJBA 1CQHA 5F07A 3M0FA 3BCIA 4Z2TA 5G1KA 2L5OA 1O73A 2LEGA 2H6YA 2VM2A 3CYNA 2GSTA 4PGTA 3GMFA 4PQ1A 5D73A 4XRAA 3IC4A 3TB2A 3TKQA 2H19A 4XHMA 5AN1A 4EDYA 3F0IA 4O7HA 3WT1A 2HSHA 2VCZA 2H6XA 1LBKA 1G0TA 1XXUA 3QDNA 2LTKA 1WIKA 1KBNA 4KGIA 1T00A 2MBSA 1S3CA 5EL8A 4I97A 3IDVA 2KP2A 3ZREA 1XWBA 2V2GA 2YOIA 3F4SA 2D2ZA 5IPGA 3FW2A 1T3BA 2H73A 1OVNA 4O5QA 1HNBA 2DMMA 2BTOT 3I9V2 4JEDA 3DIEA 1PL1A 5CO3A 5HQPA 5D93A 1NM3A 2FWEA 2XPDA 3ED3A 1Z9HA 1AXDA 2FWHA 4K8MA 5EY6A 4K0NA 3V1WA 3VI7A 1M9BA 2RM5A 2CAIA 4F82A 4BVYA 3DWVA 4HUAA 1V40A 3N5OA 5B8BA 2IWTA 3UVTA 2FCHA 2H1GA 5DJMA 3QMXA 1M7TA 20GSA 5IMVA 3SBCA 2ALBA 3N9JA 5IO0A 3CSJA 3PR8A 3EWLA 1Q98A 3CRTA 3HHVA 1PMTA 2WB9A 1TRWA 4OFMA 1G7OA 2MZCA 2C3QA 2DC5A 1XOAA 2LSTA 2GTUA 1WPIA 1U6TA 2P0GA 3UJ1A 3VWXA 1ZMAA 3L9SA 1ZL9A 3UMAA 4F9ZA 2AUVA 2YNXA 4K5SA 1XW6A 4GCIA 1Z6MA 1K0AA 4J57E 5JWOB 1SKWB 1VF4A 3EMXA 3J7Yb 3ERFA 5HFIA 1GSFA 1A2LA 2EIRA 5KOWA 4NMUA 3WD6A 3RBTA 1SYRA 2N5FA 4J56E 2ZCTA 4BWQA 2M46A 1B8XA 2HLSA 2OKAA 1WP0A 4K9ZA 4BL7A 5AIXA 3F3QA 2TIRA 3GL5A 2E7PA 5D8IA 1PA3A 2YZHA 1HNCA 2LNSA 2LS5A 3ZLPA 2CVKA 2X8HA 4OWYA 1R5PA 1F6MC 4L5OA 1K0CA 3EINA 1K0MA 5J4UA 4IVFA 1A8YA 1Z3EA 3HJOA 3QPMA 4K2DA 2ES7A 3UAPA 2YWNA 2XBIA 1B9XC 2L4QA 2B7KA 1QMVA 2FA4A 1A24A 4ZB9A 2I9HA 3H4KA 2AHEA 3G7JA 3C8EA 3GV1A 2C80A 3ME7A 1FOHA 2F3MA 1PN9A 3HZ8A 2R3XA 4V1Ag 2MYGA 1GTAA 5BRTA 1A0RP 5ECOB 2VO4A 4EUYA 3WGXA 1SJZA 2I3YA 4G19A 1YF1A 4IQ1A 3KCMA 3Q19A 1AW9A 5D9TA 3FHKA 2BJXA 5H5SA 2YN1A 4EIPA 5CP1A 1SENA 5D9WA 3WT2A 1V98A 3LEFA 1JLVA 6GSYA 3HVXA 2B1LA 3F63A 4DEJA 2LRTA 6GSTA 2G2QA 2EC4A 1FVJA 1MD3A 1R26A 3QD9A 5DCHA 4MA9A 1PD21 3L78A 1QGVA 2VOCA 2KHPA 1A8LA 2H1DA 3KJYA 3GH6A 3VK9A 3LYPA 2RIIA 2V1MA 1BG5A 4O32A 3KIJA 3F6DA 3MSZA 2HZEB 4QL7A 5KN0A 1N8JA 5CRWA 2HE3A 1TK0B 3MDKA 2AJQB 3LQ7A 3D22A 1ZYEA 1VF2A 4MF5A 1AQVA 3IHQA 3O6TA 2JACA 2PGTA 1B4QA 1QQ2A 4MDCA 2QA1A 6GSVA 4YKFA 1GLPA 5G1LA 4PURA 1QXHA 3ZFLA 3NZNA 3QFBC 3DGQA 4IJ3A 5J9BA 10GSA 4L8EA 1ZOFA 4TKYA 1X5CA 1XG8A 4MCUA 2UZ8A 5JWRB 4BA7A 4KB3A 3MWHA 2NVLA 2AV4A 1TOFA 1KEBA 1XWKA 7GSSA 3GL3A 5CYYA 2GZPA 4WR5A 1THXA 2C3TA 1M2BA 3KP8A 3US3A 1URMA 5B6MA 4V1Ap 3TKSA 5FWGA 3DVXA 5ECSA 2GGTA 4G0IA 3GUSA 6GSUA 3EMPA 3F4TA 4OFTA 4GRFA 1M3IA 3CTGA 4EDZA 1K3LA 4K0GA 2VL2A 3IXRA 2RUEA 1AIUA 1FVKA 3A5IA 3IPZA 1AUCA 1PFOA 1XW5A 3UARA 1PQNA 2CT6A 3IAM2 3TRXA 1AC1A 4IP1A 2RUFA 2LRCA 3F4RA 1TKDB 1VF3A 3ZITA 3UEMA 3FRCA 2LQOA 2RLIA 4YQVA 1LJRA 2IFQA 3LW9A 3C1SA 1O8XA 3UOMA 4ZBBA 4K7OA 1ZCPA 3L4NA 1GUHA 2R5GA 2H1AA 2I1UA 1S3AA 1TI3A 3IBHA 4TR3A 4RQRA 4USSA 2PWJA 3A2XA 3HZ4A 2PVQA 4BPYA 1GTUA 1EV4A 2X8GA 4EKZA 2C0FA 2FD3A 4G0LA 1THOA 1EP7A 1JZRA 1PSQA 2FGXA 2NDOA 13GSA 4HZ4A 3GN3A 5DDLA 2JZTA 4IHUA 3D21A 2L57A 3KTLA 3VWWA 2GDRA 2HYXA 1FO5A 3G7YA 1WWJA 2H70A 1N2AA 1OC9B 2GT5A 1C72A 5IMAA 3DMLA 1ST9A 4EC0A 1JZOA 4V2NA 3EURA 5CRHA 5IPHA 2H1BA 4NXIA 5G30A 4LL4B 3FZ4A 2FWGA 3KZQA 4IQAA 1WMJA 1GLQA 3CQFA 18GSA 2DJJA 3Q18A 1XIYA 3VFIA 4N0ZA 4K2XA 4WF5A 2IMDA 2V6OA 1ILOA 2P31A 1BQ7A 3ZL5A 1MEKA 4ZB8A 2GSSA 1J9BA 3QOUA 1G7EA 1PRXA 3BBYA 4Q5RA 2B5YA 2X64A 3TJJA 2JZSA 5ELGA 1BAYA 3RPNA 3KMOA 1EZKA 4X0XA 3IAS2 3IHGA 1JLWA 3FKFA 4MP4A 4RQXA 2VUPA 2L6DA 1DBYA 5IM9A 4AJ6A 1GSQA 1U3AA 4PQHA 1UC7A 2FUG2 5ID2B 3D6IA 3KP9A 4K7IA 3GSSA 2K6VA 4CY6A 2OA7A 4XCSA 1MDJA 4ZIJA 1TU8A 3QAWA 5E4WA 1OC3A 3RHCA 5CAXA 3E3EA 5ID2A 1F2EA 4BVXB 3KH7A 4CHSA 4KUNA 2GQMA 3IRAA 3GTUB 1GTIA 4P3YB 3TRQA 2LJAA 3TKPA 5LNKe 2FNOA 4BVXA 1YY7A 1Z6NA 3A2VA 1TU7A 4TR0A 4ZL9A 4TR4A 1SK2A 3GTUA 2YCDA 3U6VA 4POLA 4GF0A 3QAVA 1H75A 4ECBA 3FYGA 3VWUA 3APSA 5HR2A 2A2RA 1GNEA 4MK3A 4IJIA 2HT9A 4AJ8A 3PH9A 3ZRDA 2G0FA 5J41A 1I9DA 4EXJA 4WETA 2C0EA 3H93A 2AAWA 2WJUA 3TJGA 3ERGA 3GSTA 4MZBA 2CZ3A 2YWMA 3H8QA 1A2JA 4N10A 4ZXGA 1TXXA 3FZ5A 3HJMA 4NPBA 3ZMLA 5CNWA 2H75A 1GP1A 1F3AA 1AAZA 2IL3A 4KDYA 4HSCX 2KP1A 4FIWA 2LJKA 4MF7A 2H76A 3W8SA 4EF0A 3APQA 2TRXA 1I5GA 1GH2A 2KLXA 3MYDA 2HZFA 5F05A 1R5AA 4XS6A 1J0FA 3LXZA 3D4TA 4I5QA 5C00A 5DQSA 5ECKB 4I2TA 4ZB6A 4N0VA 1FB6A 4POMA 5IIZA 4GXZA 4MZCA 2IJYA 5AISA 3FR6A 2FWFA 1K0NA 2REMA 3HXSA 5EVOA 3TOUA 1J08A 2GT6A 3F3RA 1U88A 2IMIA 2XHFA 4MPFA 2O87A 3PINA 1GSEA 2GS3A 4DSRA 4ACSA 2F9SA 4Q5FA 5IMZA 3KMNA 4DVCA 2F8FA 4KAEA 2R0CA 3Q6OA 1TTZA 2LNTA 3F9UA 3HVNA 4MH2A 1OYJA 2R0PA 2DJ0A 1XFLA 1XBSA 2LV3A 2WRTA 1R4WA 3KTBA 2H0HA 4G9HA 4K6XA 4NAXA 2R2JA 4MNNA 2VCQA 19GSA 2PVOC 2VCXA 1YKAA 2DSAA 4HEA2 3TGZA 4NHWA 2YV9A 3BOAA 1JHBA 1B4PA 5COHA 1SKSB 3MIXA 4L0UA 1EOGA 1SD9A 5D9VA 3IOSA 2HSYA 3LORA 4TN8A 5DJLA 2V41A 5G5FA 3SWLA 4WR4A 22GSA 4LLRA 3QR6A 3HYPA 2HFDA 1DE2A 1ERTA 3ZIVA 1OE8A 1FHEA 2MMNA 1T4ZA 5FHIA 3VI5A 4ID0A 4L0WA 2O7KA 1E6BA 1RQMA 1O85A 5BMUA 2K8VA 3ZIJA 4CY8A 3RHBA 3U5RE 1Z5YE 4X43A 2JZRA 3AY8A 1X9WB 4NV2A 4BIKA 2CA8A 1GL8A 5LCZA 2OE1A 2WS2A 3TKSC 3DD3A 1OKTA 4RI6A 2O89A 2MMAA 4IGJA 2LRNA 2V32A 2ZNMA 3FMWA 4HU9A 4TXVA 2P5QA 4KE3A 4YQUA 5ELAA 1FG4A 1OKDA 2CQ9A 5DAKB 2JSYA 1TK5B 1TRUA 2VL2C 1ERUA 3LWAA 1PKZA 1BJXA 3CMIA 2NBSA 1ON4A 4BWSA 2QGVA 1QUWA 4V2LA 1M3JA 2O8VB 5CRGA 4FO5A 4HS1A 1GWCA 2V6KA 1ML6A 1DSBA 2VLVA 1YEXA 2VLTA 2QA2A 3KGKA 3UVHA 5ECIB 5E59A 1PX7A 1GSDA 3ZVJD 2WZ9A 4I2UA 2HZEA 4Q5QA 4ZL8A 1T4YA 3EYTA 2OACA 4KX4A 4Z2UA 3TUEA 3L0HA 4E8EA 4GLTA 5ECNB 1UN2A 1T7PB 1IYHA 4GSSA 1VGLA 3ERWA 1XWAA 1USBA 2C8UA 2LJRA 1HQOA 1NW2A 1TJDA 1W89A 1Z7PA 5G5EA 4TRXA 1OC8A 2K9FA 2E0QA 3R3EA 16GSA 4MH3A 2A4HA 3ZTLA 3P2AA 3KEBA 4LL1B 3ME8A 1HD2A 2C3NA 2YV7A 5HR0A 1G6YA 2KOKA 2HRNA 4GQCA 3DVWA 1NSWA 2C0GA 2OBKA 1SD8A 1R7HA 2HRAA 3VWVA 1M0UA 3RDWA 1IYIA 2B7JA 4HOJA 5FT3A 3GX0A 3VPQA 3W6GA 4POKA 4O5RA 2IMKA 5KN1A 1T8EB 1EV9A 3NIVA 1PL2A 4ML6A 3QCPA 4D73B 4FH8A 5IMDA 1Q4JA 4V2MA 5HFKA 3NOFA 1HYUA 1GSYA 2PPTA 3RPPA 2CZ2A 1TRVA 1KNGA 2C1YA 3I69A 4G0KA 2HXKA 4D73A 2EIOA 2QKEA 4CDOA 2HRFA 1SK0A 3TJBA 4ULXA 4MJCA 4XS1A 4NWYA 5IO2A 3QFAC 2GZZA 4K1FA 2MBTA 2WDUA 2ON7A 4N30A 3FR9A 3LXTA 3GX8A 4GQFA 4YKGA 2VCVA 3HKRA 4IBPA 5AIVA 4EIQA 3F8UA 3OR5A 3UBKA 1AQWA 1V9WA 3ZMKA 5IQYA 2OBIA 4F2IA 3M1GA 1Y6EA 1SYXA 4ZBDA 4JR6A 3ZYWA 2YZUA 2JL4A 4ZBAA 1QFNA 2VAFA 4MJEA 3WGEA 5G2ZA 4PX1A 1M2AA 5F06A 3GHAA 1GUMA 1GTBA 2OE0A 2AYTA 1YZXA 1ZZYA 2YP6A 4HJMA 2MMZA 5ECMB 2DJ2A 3IE3A 4PXOA 1TW9A 4CW9A 1OC9A 2H30A 3H1NA 2NTOA 5DCGA 3VURA 4KSOA 11GSA 3IK9A 2B5XA 5DBQA 3CRUA 3UIWA 4JR4A 3HD5A 4FQUA 3BD2A 4E8HA 2ON5A 1K3OA 3LYKA 3APOA 2GQKA 3WGDA 2OADA 1XPVA 4OD7A 5HFGA 2J23A 1TI1A 2VCWA 2QC7A 4EE0A 2R4VA 4PNGA 4TR1B 3W8JA 1XZOA 2CVDA 2NPBA 1FB0A 2DLXA 2FLSA 4Z7XA 1TK8B 1K0OA 2L59A 2HI7A 4X1UA 4XS4B 4JZQA 5J5NA 4ECJA 5A4WA 3EU3A 4KA0A 4JE1A 3A5WA 4TR1A 1GUKA 4ECCA 5D9XA 2DJKA 5IOWA 4XS4A 3KH9A 5KOXA 1G6WA 2DJ3A 1EGRA 3DYRA 3KD0A 3J7Yk 4F03A 1MDKA 3MNGA 2H8LA 1M9AA 2E2GA 3CSHA 3ZFBA 2DJ1A 1YJ6A 2L4CA 2BMXA 4YAVA 5HR1A 4EVMA 1JZWA 1M2DA 4AJ7A 2H72A 3GKNA 4IW9A 3HDCA 4FYBA 4WBJA 14GSA 1BEDA 2YJ7A 5A4UA 1ERWA 3I6AA 4POBA 2R6KA 3KXOA 2VL3A 5DQYA 2DKHA 3TKRA 1OAZA 2FHEA 4LMWA 5DVBA 4ICYA 1U3IA 3HVVA 4ZILA 1XVWA 1GULA 1PN0A 3CSIA 3FY7A 1SKRB 2CV4A 4X4JA 3E0UA 1B9YC 3WYWA 3GRXA 4EL1A 3EVIA 2TRCP 2B6MA 3IR4A 3MAKA 2DMLA 1VF1A 2O85A 1MDIA 5F0GA 1A2MA 3TJFA 1SL0B 2JU5A 3CTFA 4RUVA 1YDKA 4KW6A 3H79A 4ILFA 2L6CA 2VIMA 5ECQB 3EE2A 2I81A 4BVYB 3HJPA 4AGSA 4OO4A 4Z2RA 2X8CA
chains in the Genus database with same CATH topology
4K7NA 1SK1A 4F0CA 5INYA 1K0BA 2R37A 2H74A 3M9JA 5JCUA 3BCKA 4IELA 3A2WA 1YF0A 3G7IA 3EU4A 1X5DA 3GH9A 2IN3A 4GTUA 1A0FA 2N5BA 2VL9A 4KCEA 4OMVA 4PQIA 2C0DA 3DEXA 3ZVJA 3HCZA 4NV5A 5JWQB 1M99A 1O81A 1O7UA 3M9KA 1SJIA 1AQXA 2FA8A 4I6XA 4HI7A 2HSMA 3F6FA 1X9MB 4G2EA 4PUAA 4WF4A 5ENUA 4TVEA 4MJAA 4HZ2A 1BYEA 1X0RA 2JSZA 2F51A 3P8WA 4XTSA 5CREA 3JCML 2WULA 4GSTA 5G31A 1U87A 3D4MA 3LSZA 4QL9A 2VD0A 2H01A 1Z7RA 3IK7A 2X4AA 2PU9C 4DSQA 3C1RA 4BL7B 2XBQA 4PUFC 1FW1A 2F8AA 2PMTA 4NHZA 1RK4A 1JZDA 2CAQA 1TP9A 4RI7A 5KN2A 1UVZA 3FR3A 1OE7A 2AB6A 2E2MA 3FZ9A 2VLUA 3I43A 1SJ6A 3GFKA 5DALB 4ISDA 1UA5A 3GNJA 2VD1A 5H5QA 1O8WA 5JCWA 1YEPA 4WBRD 3D5JA 5AGYA 5DALA 2PERA 5KEJA 1T1VA 8GSSA 4TW5A 4A5PA 2H6ZA 3S9FA 1XW9A 3M3MA 4FYUA 4KDXA 17GSA 5A5KA 3R2QA 1KTEA 4L5LA 3C71A 2PN8A 12GSA 3L9UA 4ECIA 1ABAA 5HR3A 3M8NA 5IMFA 1K3YA 3IA1A 1GRXA 5B6NA 3LG6A 5J3RA 1K0DA 3EPTA 3P90A 5D96A 2K18A 3L9VA 2CX4A 3QAGA 4XIHA 4KNDA 1DE1A 1PGTA 1X5EA 2C4JA 4GWRA 3GKXA 4HQSA 2CVBA 2RM6A 3TCOA 5ECPB 4KCAA 4KSMA 3HVSA 5EPFA 4OFNA 3PGTA 1EP8A 1PKWA 2X49A 4IN0A 3TKSE 3LGCA 1FOVA 4ZL7A 2B1KA 1EWXA 4KF9A 1CQGA 5DAKA 5ECHB 3E9JB 3C7MA 4H86A 1X9SB 3LJRA 4JBBA 4WXTA 1YQ1A 4MABA 3P7XA 3TRPA 1TDIA 3GKMA 2H71A 3HA9A 3IV4A 2GLRA 3UL3A 4J2FA 1XWGA 3DRNA 1XVQA 2WCIA 1SL2B 4PTSA 2H0GA 1WJKA 5L71A 1YKCA 4YQMA 4EO3A 1EEMA 3FZAA 4JU5A 5IMCA 4KDUA 3O76A 4XRDA 5B7CA 4WEYA 3VLNA 2M72A 3GURA 1WOUA 2DBCA 3CBUA 4MMMA 6GSSA 3C73A 5H5RA 2WGRA 2J9HA 4AF2A 2N5AA 1V58A 2PUKC 2VM1A 4G10A 4HJ2A 1V57A 2YANA 5ABRA 4MPGA 4HU7A 1EEJA 5KN3A 1A23A 2HNLA 1RW1A 3DXBA 5GAND 3EC3A 2OE3A 3GKKA 3GIXA 1W4VA 4IP6A 3Q74A 2YPMA 2ZUPA 4MF6A 1NHOA 3FK8A 2DIYA 2LQQA 2YJHA 4GSNA 3G9BA 1GSUA 1XCCA 2GSRA 1EGOA 2XC2A 3K8NA 1PX6A 2A2SA 2HRKA 1WRYA 2P5RA 3FEUA 4I8BA 4IKHA 2OJLA 1VRSD 1S3DA 4YAPA 1ERVA 3TDGA 4OO5A 2B5EA 1Y25A 1XOBA 2K8SA 4K5RA 2FY6A 5CRDA 1O6JA 1EOHA 2R0GA 2IFQB 1B48A 2IIYA 2PBJA 4TOPA 4MZWA 1GNWA 3ISOA 3KM6A 2KUCA 2A2PA 4MLYA 2LUSA 4OCEA 2DKIA 5LD0A 2M80A 2IMEA 3A3TA 2YWIA 1XWCA 2B3SA 2X99A 4F0BA 4FYCA 1V2AA 2JADA 4IS0A 3O3TA 1F3BA 1MD4A 5J9CA 1LU4A 4JRRA 3PPUA 1ACVA 4O5UA 2L5LA 3GYKA 4LA1A 6GSXA 2QSIA 5JCGA 1MTCA 3LFLA 5IOXA 5C04A 1ZYQB 2H66A 1SU9A 3ZZXA 2H0IA 2VCTA 4O92A 1QK8A 1GSSA 1ZYPA 2IMFA 1FAAA 9GSSA 5B8AA 4KH7A 1NHYA 2GZYA 5GZZB 1ZGNA 4HDEA 4DSSB 4TXOB 2IPAA 2GQLA 1WE0A 3UBLA 3TOTA 6GSWA 2WFCA 4DSSA 4TXOA 2CX3A 2A4VA 2Z9SA 2EIQA 5A4VA 3D0ZA 1E2YA 3DKSA 4Q5NA 1ZYNA 1TRSA 5F8BA 3RAZA 5GAPD 2DIZA 5ECRB 3GA4A 5GSSA 5ECLB 3IC8A 1HNAA 4HQZA 1SL1B 2I4AA 2MMOA 3VPTA 1BX9A 1F37A 1H4OA 4ML1A 2XPEA 4LMVA 4YH2A 2LKUA 2GVPA 1JFUA 4PNFA 1F9MA 5GSTA 4WKWA 2GSQA 4OCFA 4QQ7A 3TJKA 2YWOA 1DUGA 3BJ5A 3CXGA 3HY2A 4N11A 4MJBA 1CQHA 5F07A 3M0FA 3BCIA 4Z2TA 5G1KA 2L5OA 1O73A 2LEGA 2H6YA 2VM2A 3CYNA 2GSTA 4PGTA 3GMFA 4PQ1A 5D73A 4XRAA 3IC4A 3TB2A 3TKQA 2H19A 4XHMA 5AN1A 4EDYA 3F0IA 4O7HA 3WT1A 2HSHA 2VCZA 2H6XA 1LBKA 1G0TA 1XXUA 3QDNA 2LTKA 1WIKA 1KBNA 4KGIA 1T00A 2MBSA 1S3CA 5EL8A 4I97A 3IDVA 2KP2A 3ZREA 1XWBA 2V2GA 2YOIA 3F4SA 2D2ZA 5IPGA 3FW2A 1T3BA 2H73A 1OVNA 4O5QA 1HNBA 2DMMA 2BTOT 3I9V2 4JEDA 3DIEA 1PL1A 5CO3A 5HQPA 5D93A 1NM3A 2FWEA 2XPDA 3ED3A 1Z9HA 1AXDA 2FWHA 4K8MA 5EY6A 4K0NA 3V1WA 3VI7A 1M9BA 2RM5A 2CAIA 4F82A 4BVYA 3DWVA 4HUAA 1V40A 3N5OA 5B8BA 2IWTA 3UVTA 2FCHA 2H1GA 5DJMA 3QMXA 1M7TA 20GSA 5IMVA 3SBCA 2ALBA 3N9JA 5IO0A 3CSJA 3PR8A 3EWLA 1Q98A 3CRTA 3HHVA 1PMTA 2WB9A 1TRWA 4OFMA 1G7OA 2MZCA 2C3QA 2DC5A 1XOAA 2LSTA 2GTUA 1WPIA 1U6TA 2P0GA 3UJ1A 3VWXA 1ZMAA 3L9SA 1ZL9A 3UMAA 4F9ZA 2AUVA 2YNXA 4K5SA 1XW6A 4GCIA 1Z6MA 1K0AA 4J57E 5JWOB 1SKWB 1VF4A 3EMXA 3J7Yb 3ERFA 5HFIA 1GSFA 1A2LA 2EIRA 5KOWA 4NMUA 3WD6A 3RBTA 1SYRA 2N5FA 4J56E 2ZCTA 4BWQA 2M46A 1B8XA 2HLSA 2OKAA 1WP0A 4K9ZA 4BL7A 5AIXA 3F3QA 2TIRA 3GL5A 2E7PA 5D8IA 1PA3A 2YZHA 1HNCA 2LNSA 2LS5A 3ZLPA 2CVKA 2X8HA 4OWYA 1R5PA 1F6MC 4L5OA 1K0CA 3EINA 1K0MA 5J4UA 4IVFA 1A8YA 1Z3EA 3HJOA 3QPMA 4K2DA 2ES7A 3UAPA 2YWNA 2XBIA 1B9XC 2L4QA 2B7KA 1QMVA 2FA4A 1A24A 4ZB9A 2I9HA 3H4KA 2AHEA 3G7JA 3C8EA 3GV1A 2C80A 3ME7A 1FOHA 2F3MA 1PN9A 3HZ8A 2R3XA 4V1Ag 2MYGA 1GTAA 5BRTA 1A0RP 5ECOB 2VO4A 4EUYA 3WGXA 1SJZA 2I3YA 4G19A 1YF1A 4IQ1A 3KCMA 3Q19A 1AW9A 5D9TA 3FHKA 2BJXA 5H5SA 2YN1A 4EIPA 5CP1A 1SENA 5D9WA 3WT2A 1V98A 3LEFA 1JLVA 6GSYA 3HVXA 2B1LA 3F63A 4DEJA 2LRTA 6GSTA 2G2QA 2EC4A 1FVJA 1MD3A 1R26A 3QD9A 5DCHA 4MA9A 1PD21 3L78A 1QGVA 2VOCA 2KHPA 1A8LA 2H1DA 3KJYA 3GH6A 3VK9A 3LYPA 2RIIA 2V1MA 1BG5A 4O32A 3KIJA 3F6DA 3MSZA 2HZEB 4QL7A 5KN0A 1N8JA 5CRWA 2HE3A 1TK0B 3MDKA 2AJQB 3LQ7A 3D22A 1ZYEA 1VF2A 4MF5A 1AQVA 3IHQA 3O6TA 2JACA 2PGTA 1B4QA 1QQ2A 4MDCA 2QA1A 6GSVA 4YKFA 1GLPA 5G1LA 4PURA 1QXHA 3ZFLA 3NZNA 3QFBC 3DGQA 4IJ3A 5J9BA 10GSA 4L8EA 1ZOFA 4TKYA 1X5CA 4MCUA 2UZ8A 5JWRB 4BA7A 4KB3A 3MWHA 2NVLA 2AV4A 1TOFA 1KEBA 1XWKA 7GSSA 3GL3A 5CYYA 2GZPA 4WR5A 1THXA 2C3TA 1M2BA 3KP8A 3US3A 1URMA 5B6MA 4V1Ap 3TKSA 5FWGA 3DVXA 5ECSA 2GGTA 4G0IA 3GUSA 6GSUA 3EMPA 3F4TA 4OFTA 4GRFA 4EDZA 3CTGA 1K3LA 4K0GA 2VL2A 3IXRA 2RUEA 1AIUA 1FVKA 3A5IA 3IPZA 1AUCA 1XW5A 3UARA 1PQNA 2CT6A 3IAM2 3TRXA 1AC1A 4IP1A 2RUFA 2LRCA 3F4RA 1TKDB 1VF3A 3ZITA 3UEMA 3FRCA 2LQOA 2RLIA 4YQVA 1LJRA 2IFQA 3LW9A 3C1SA 1O8XA 3UOMA 4ZBBA 4K7OA 1ZCPA 3L4NA 1GUHA 2R5GA 2H1AA 2I1UA 1S3AA 1TI3A 3IBHA 4TR3A 4RQRA 4USSA 2PWJA 3A2XA 3HZ4A 2PVQA 4BPYA 1GTUA 1EV4A 2X8GA 4EKZA 2C0FA 2FD3A 4G0LA 1THOA 1EP7A 1JZRA 1PSQA 2FGXA 2NDOA 13GSA 4HZ4A 3GN3A 5DDLA 2JZTA 4IHUA 3D21A 2L57A 3KTLA 3VWWA 2GDRA 2HYXA 1FO5A 3G7YA 1WWJA 2H70A 1N2AA 1OC9B 2GT5A 1C72A 5IMAA 3DMLA 1ST9A 4EC0A 1JZOA 4V2NA 3EURA 5CRHA 5IPHA 2H1BA 4NXIA 5G30A 4LL4B 3FZ4A 2FWGA 3KZQA 4IQAA 1WMJA 1GLQA 18GSA 2DJJA 3Q18A 1XIYA 3VFIA 4N0ZA 4K2XA 4WF5A 2IMDA 2V6OA 1ILOA 2P31A 1BQ7A 3ZL5A 1MEKA 4ZB8A 2GSSA 1J9BA 3QOUA 1G7EA 1PRXA 3BBYA 4Q5RA 2B5YA 2X64A 3TJJA 2JZSA 5ELGA 1BAYA 3RPNA 3KMOA 1EZKA 4X0XA 3IAS2 3IHGA 1JLWA 3FKFA 4MP4A 4RQXA 2VUPA 2L6DA 1DBYA 5IM9A 4AJ6A 1GSQA 1U3AA 4PQHA 1UC7A 2FUG2 5ID2B 3D6IA 3KP9A 4K7IA 3GSSA 2K6VA 4CY6A 2OA7A 4XCSA 1MDJA 4ZIJA 1TU8A 3QAWA 5E4WA 1OC3A 3RHCA 5CAXA 3E3EA 5ID2A 1F2EA 4BVXB 3KH7A 4CHSA 4KUNA 2GQMA 3IRAA 3GTUB 1GTIA 4P3YB 3TRQA 2LJAA 3TKPA 5LNKe 2FNOA 4BVXA 1YY7A 1Z6NA 3A2VA 1TU7A 4TR0A 4ZL9A 4TR4A 1SK2A 3GTUA 2YCDA 3U6VA 4POLA 4GF0A 3QAVA 1H75A 4ECBA 3FYGA 3VWUA 3APSA 5HR2A 2A2RA 1GNEA 4MK3A 4IJIA 2HT9A 4AJ8A 3PH9A 3ZRDA 2G0FA 5J41A 1I9DA 4EXJA 4WETA 2C0EA 3H93A 2AAWA 2WJUA 3TJGA 3ERGA 3GSTA 4MZBA 2CZ3A 2YWMA 3H8QA 1A2JA 4N10A 4ZXGA 1TXXA 3FZ5A 3HJMA 4NPBA 3ZMLA 5CNWA 2H75A 1GP1A 1F3AA 1AAZA 2IL3A 4KDYA 2KP1A 4FIWA 2LJKA 4MF7A 2H76A 3W8SA 4EF0A 3APQA 2TRXA 1I5GA 1GH2A 2KLXA 3MYDA 2HZFA 5F05A 1R5AA 4XS6A 1J0FA 3LXZA 3D4TA 4I5QA 5C00A 5DQSA 5ECKB 4I2TA 4ZB6A 4N0VA 1FB6A 4POMA 5IIZA 4GXZA 4MZCA 2IJYA 5AISA 3FR6A 2FWFA 1K0NA 2REMA 3HXSA 5EVOA 3TOUA 1J08A 2GT6A 3F3RA 1U88A 2IMIA 2XHFA 4MPFA 2O87A 3PINA 1GSEA 2GS3A 4DSRA 4ACSA 2F9SA 4Q5FA 5IMZA 3KMNA 4DVCA 2F8FA 4KAEA 2R0CA 3Q6OA 1TTZA 2LNTA 3F9UA 4MH2A 1OYJA 2R0PA 2DJ0A 1XFLA 1XBSA 2LV3A 2WRTA 1R4WA 3KTBA 2H0HA 4G9HA 4K6XA 4NAXA 2R2JA 4MNNA 2VCQA 19GSA 2PVOC 2VCXA 1YKAA 2DSAA 4HEA2 3TGZA 4NHWA 2YV9A 3BOAA 1JHBA 1B4PA 5COHA 1SKSB 3MIXA 4L0UA 1EOGA 1SD9A 5D9VA 3IOSA 2HSYA 3LORA 4TN8A 5DJLA 2V41A 5G5FA 3SWLA 4WR4A 22GSA 4LLRA 3QR6A 3HYPA 2HFDA 1DE2A 1ERTA 3ZIVA 1OE8A 1FHEA 2MMNA 1T4ZA 5FHIA 3VI5A 4ID0A 4L0WA 2O7KA 1E6BA 1RQMA 1O85A 5BMUA 2K8VA 3ZIJA 4CY8A 3RHBA 3U5RE 1Z5YE 4X43A 2JZRA 3AY8A 1X9WB 4NV2A 2CA8A 1GL8A 5LCZA 2OE1A 2WS2A 3TKSC 3DD3A 1OKTA 4RI6A 2O89A 2MMAA 4IGJA 2LRNA 2V32A 2ZNMA 3FMWA 4HU9A 4TXVA 2P5QA 4KE3A 4YQUA 5ELAA 1FG4A 1OKDA 2CQ9A 5DAKB 2JSYA 1TK5B 1TRUA 2VL2C 1ERUA 3LWAA 1PKZA 1BJXA 3CMIA 2NBSA 1ON4A 4BWSA 2QGVA 1QUWA 4V2LA 2O8VB 5CRGA 4FO5A 4HS1A 1GWCA 2V6KA 1ML6A 1DSBA 2VLVA 1YEXA 2VLTA 2QA2A 3KGKA 3UVHA 5ECIB 5E59A 1PX7A 1GSDA 3ZVJD 2WZ9A 4I2UA 2HZEA 4Q5QA 4ZL8A 1T4YA 3EYTA 2OACA 4KX4A 4Z2UA 3TUEA 3L0HA 4E8EA 4GLTA 5ECNB 1UN2A 1T7PB 1IYHA 4GSSA 1VGLA 3ERWA 1XWAA 1USBA 2C8UA 2LJRA 1HQOA 1NW2A 1TJDA 1W89A 1Z7PA 5G5EA 4TRXA 1OC8A 2K9FA 2E0QA 3R3EA 16GSA 4MH3A 2A4HA 3ZTLA 3P2AA 3KEBA 4LL1B 3ME8A 1HD2A 2C3NA 2YV7A 5HR0A 1G6YA 2KOKA 2HRNA 4GQCA 3DVWA 1NSWA 2C0GA 2OBKA 1SD8A 1R7HA 2HRAA 3VWVA 1M0UA 3RDWA 1IYIA 2B7JA 4HOJA 5FT3A 3GX0A 3VPQA 3W6GA 4POKA 4O5RA 2IMKA 5KN1A 1T8EB 1EV9A 3NIVA 1PL2A 4ML6A 3QCPA 4D73B 4FH8A 5IMDA 1Q4JA 4V2MA 5HFKA 3NOFA 1HYUA 1GSYA 2PPTA 3RPPA 2CZ2A 1TRVA 1KNGA 2C1YA 3I69A 4G0KA 2HXKA 4D73A 2EIOA 2QKEA 4CDOA 2HRFA 1SK0A 3TJBA 4ULXA 4MJCA 4XS1A 4NWYA 5IO2A 3QFAC 2GZZA 4K1FA 2MBTA 2WDUA 2ON7A 4N30A 3FR9A 3LXTA 3GX8A 4GQFA 4YKGA 2VCVA 3HKRA 4IBPA 5AIVA 4EIQA 3F8UA 3OR5A 3UBKA 1AQWA 1V9WA 3ZMKA 5IQYA 2OBIA 4F2IA 3M1GA 1Y6EA 1SYXA 4ZBDA 4JR6A 3ZYWA 2YZUA 2JL4A 4ZBAA 1QFNA 2VAFA 4MJEA 3WGEA 5G2ZA 4PX1A 1M2AA 5F06A 3GHAA 1GUMA 1GTBA 2OE0A 2AYTA 1YZXA 1ZZYA 2YP6A 4HJMA 2MMZA 5ECMB 2DJ2A 3IE3A 4PXOA 1TW9A 4CW9A 1OC9A 2H30A 3H1NA 2NTOA 5DCGA 3VURA 4KSOA 11GSA 3IK9A 2B5XA 5DBQA 3CRUA 3UIWA 4JR4A 3HD5A 4FQUA 3BD2A 4E8HA 2ON5A 1K3OA 3LYKA 3APOA 2GQKA 3WGDA 2OADA 1XPVA 4OD7A 5HFGA 2J23A 1TI1A 2VCWA 2QC7A 4EE0A 2R4VA 4PNGA 4TR1B 3W8JA 1XZOA 2CVDA 2NPBA 1FB0A 2DLXA 2FLSA 4Z7XA 1TK8B 1K0OA 2L59A 2HI7A 4X1UA 4XS4B 4JZQA 5J5NA 4ECJA 5A4WA 3EU3A 4KA0A 4JE1A 3A5WA 4TR1A 1GUKA 4ECCA 5D9XA 2DJKA 5IOWA 4XS4A 3KH9A 5KOXA 1G6WA 2DJ3A 1EGRA 3DYRA 3KD0A 3J7Yk 4F03A 1MDKA 3MNGA 2H8LA 1M9AA 2E2GA 3CSHA 3ZFBA 2DJ1A 1YJ6A 2L4CA 2BMXA 4YAVA 5HR1A 4EVMA 1JZWA 1M2DA 4AJ7A 2H72A 3GKNA 4IW9A 3HDCA 4FYBA 4WBJA 14GSA 1BEDA 2YJ7A 5A4UA 1ERWA 3I6AA 4POBA 2R6KA 3KXOA 2VL3A 5DQYA 2DKHA 3TKRA 1OAZA 2FHEA 4LMWA 5DVBA 4ICYA 1U3IA 3HVVA 4ZILA 1XVWA 1GULA 1PN0A 3CSIA 3FY7A 1SKRB 2CV4A 4X4JA 3E0UA 1B9YC 3WYWA 3GRXA 4EL1A 3EVIA 2TRCP 2B6MA 3IR4A 3MAKA 2DMLA 1VF1A 2O85A 1MDIA 5F0GA 1A2MA 3TJFA 1SL0B 2JU5A 3CTFA 4RUVA 1YDKA 4KW6A 3H79A 4ILFA 2L6CA 2VIMA 5ECQB 3EE2A 2I81A 4BVYB 3HJPA 4AGSA 4OO4A 4Z2RA 2X8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7N A;  1SK1 A;  4F0C A;  5INY A;  1K0B A;  2R37 A;  2H74 A;  3M9J A;  5JCU A;  3BCK A;  4IEL A;  3A2W A;  1YF0 A;  3G7I A;  3EU4 A;  1X5D A;  3GH9 A;  2IN3 A;  4GTU A;  1A0F A;  2N5B A;  2VL9 A;  4KCE A;  4OMV A;  4PQI A;  2C0D A;  3DEX A;  3ZVJ A;  3HCZ A;  4NV5 A;  5JWQ B;  1M99 A;  1O81 A;  1O7U A;  3M9K A;  1SJI A;  1AQX A;  2FA8 A;  4I6X A;  4HI7 A;  3F6F A;  1X9M B;  4G2E A;  4PUA A;  4WF4 A;  5ENU A;  4TVE A;  4MJA A;  4HZ2 A;  1BYE A;  1X0R A;  2JSZ A;  2F51 A;  3P8W A;  4XTS A;  5CRE A;  3JCM L;  2WUL A;  4GST A;  5G31 A;  1U87 A;  3D4M A;  3LSZ A;  4QL9 A;  2VD0 A;  2H01 A;  1Z7R A;  3IK7 A;  2PU9 C;  4DSQ A;  3C1R A;  2XBQ A;  4PUF C;  1FW1 A;  2F8A A;  2PMT A;  4NHZ A;  1RK4 A;  1JZD A;  2CAQ A;  1TP9 A;  4RI7 A;  5KN2 A;  1UVZ A;  3FR3 A;  1OE7 A;  2AB6 A;  2E2M A;  3FZ9 A;  2VLU A;  3I43 A;  1SJ6 A;  3GFK A;  5DAL B;  4ISD A;  1UA5 A;  3GNJ A;  2VD1 A;  5H5Q A;  1O8W A;  5JCW A;  1YEP A;  4WBR D;  3D5J A;  5AGY A;  5DAL A;  2PER A;  5KEJ A;  1T1V A;  8GSS A;  4TW5 A;  2H6Z A;  3S9F A;  1XW9 A;  3M3M A;  4FYU A;  4KDX A;  17GS A;  5A5K A;  3R2Q A;  1KTE A;  4L5L A;  3C71 A;  2PN8 A;  12GS A;  3L9U A;  4ECI A;  1ABA A;  5HR3 A;  3M8N A;  5IMF A;  1K3Y A;  3IA1 A;  1GRX A;  5B6N A;  3LG6 A;  5J3R A;  1K0D A;  3P90 A;  5D96 A;  2K18 A;  3L9V A;  2CX4 A;  3QAG A;  4XIH A;  4KND A;  1DE1 A;  1PGT A;  1X5E A;  2C4J A;  4GWR A;  3GKX A;  4HQS A;  2CVB A;  2RM6 A;  3TCO A;  5ECP B;  4KCA A;  4KSM A;  3HVS A;  5EPF A;  4OFN A;  3PGT A;  1EP8 A;  1PKW A;  4IN0 A;  3TKS E;  3LGC A;  1FOV A;  4ZL7 A;  2B1K A;  1EWX A;  1CQG A;  5DAK A;  5ECH B;  3E9J B;  3C7M A;  4H86 A;  1X9S B;  3LJR A;  4JBB A;  4WXT A;  1YQ1 A;  4MAB A;  3P7X A;  3TRP A;  1TDI A;  3GKM A;  2H71 A;  3HA9 A;  3IV4 A;  2GLR A;  3UL3 A;  4J2F A;  1XWG A;  3DRN A;  1XVQ A;  2WCI A;  1SL2 B;  2H0G A;  1WJK A;  5L71 A;  1YKC A;  4YQM A;  4EO3 A;  1EEM A;  3FZA A;  4JU5 A;  5IMC A;  4KDU A;  3O76 A;  4XRD A;  5B7C A;  4WEY A;  3VLN A;  2M72 A;  3GUR A;  1WOU A;  2DBC A;  3CBU A;  4MMM A;  6GSS A;  3C73 A;  5H5R A;  2WGR A;  2J9H A;  4AF2 A;  2N5A A;  1V58 A;  2PUK C;  2VM1 A;  4G10 A;  4HJ2 A;  1V57 A;  2YAN A;  5ABR A;  4MPG A;  4HU7 A;  1EEJ A;  5KN3 A;  1A23 A;  2HNL A;  1RW1 A;  3DXB A;  5GAN D;  3EC3 A;  2OE3 A;  3GKK A;  3GIX A;  1W4V A;  4IP6 A;  3Q74 A;  2YPM A;  2ZUP A;  4MF6 A;  1NHO A;  3FK8 A;  2DIY A;  2LQQ A;  2YJH A;  4GSN A;  3G9B A;  1GSU A;  1XCC A;  2GSR A;  1EGO A;  2XC2 A;  3K8N A;  1PX6 A;  2A2S A;  1WRY A;  2P5R A;  3FEU A;  4I8B A;  4IKH A;  2OJL A;  1VRS D;  1S3D A;  4YAP A;  1ERV A;  3TDG A;  4OO5 A;  2B5E A;  1Y25 A;  1XOB A;  2K8S A;  2FY6 A;  5CRD A;  1O6J A;  1EOH A;  2IFQ B;  1B48 A;  2IIY A;  2PBJ A;  4TOP A;  4MZW A;  1GNW A;  3ISO A;  3KM6 A;  2KUC A;  4MLY A;  2LUS A;  4OCE A;  5LD0 A;  2M80 A;  2IME A;  3A3T A;  2YWI A;  1XWC A;  2B3S A;  2X99 A;  4F0B A;  4FYC A;  1V2A A;  2JAD A;  4IS0 A;  3O3T A;  1F3B A;  1MD4 A;  5J9C A;  1LU4 A;  4JRR A;  1ACV A;  2L5L A;  3GYK A;  4LA1 A;  6GSX A;  2QSI A;  5JCG A;  1MTC A;  3LFL A;  5IOX A;  5C04 A;  1ZYQ B;  2H66 A;  1SU9 A;  3ZZX A;  2H0I A;  2VCT A;  4O92 A;  1QK8 A;  1GSS A;  2IMF A;  1FAA A;  9GSS A;  5B8A A;  4KH7 A;  1NHY A;  2GZY A;  5GZZ B;  1ZGN A;  4HDE A;  4DSS B;  4TXO B;  2IPA A;  2GQL A;  1WE0 A;  3UBL A;  3TOT A;  6GSW A;  2WFC A;  4DSS A;  4TXO A;  2CX3 A;  2A4V A;  2Z9S A;  2EIQ A;  5A4V A;  3D0Z A;  1E2Y A;  3DKS A;  4Q5N A;  1TRS A;  5F8B A;  3RAZ A;  5GAP D;  2DIZ A;  5ECR B;  3GA4 A;  5GSS A;  5ECL B;  1HNA A;  4HQZ A;  1SL1 B;  2I4A A;  2MMO A;  3VPT A;  1BX9 A;  1F37 A;  1H4O A;  4ML1 A;  2XPE A;  4LMV A;  4YH2 A;  2LKU A;  2GVP A;  1JFU A;  4PNF A;  1F9M A;  5GST A;  4WKW A;  2GSQ A;  4OCF A;  4QQ7 A;  3TJK A;  2YWO A;  1DUG A;  3BJ5 A;  3CXG A;  3HY2 A;  4N11 A;  4MJB A;  1CQH A;  5F07 A;  3M0F A;  3BCI A;  5G1K A;  2L5O A;  1O73 A;  2LEG A;  2H6Y A;  2VM2 A;  3CYN A;  2GST A;  4PGT A;  3GMF A;  4PQ1 A;  5D73 A;  4XRA A;  3IC4 A;  3TB2 A;  3TKQ A;  2H19 A;  4XHM A;  5AN1 A;  4EDY A;  3F0I A;  4O7H A;  3WT1 A;  2HSH A;  2VCZ A;  2H6X A;  1LBK A;  1G0T A;  1XXU A;  3QDN A;  2LTK A;  1WIK A;  1KBN A;  4KGI A;  1T00 A;  2MBS A;  1S3C A;  5EL8 A;  4I97 A;  3IDV A;  2KP2 A;  3ZRE A;  1XWB A;  2V2G A;  2YOI A;  3F4S A;  2D2Z A;  5IPG A;  3FW2 A;  1T3B A;  2H73 A;  1OVN A;  1HNB A;  2DMM A;  2BTO T;  3I9V 2;  4JED A;  3DIE A;  1PL1 A;  5CO3 A;  5HQP A;  5D93 A;  1NM3 A;  2FWE A;  2XPD A;  3ED3 A;  1Z9H A;  1AXD A;  2FWH A;  4K8M A;  5EY6 A;  4K0N A;  3V1W A;  3VI7 A;  1M9B A;  2RM5 A;  2CAI A;  4F82 A;  4BVY A;  3DWV A;  4HUA A;  1V40 A;  3N5O A;  5B8B A;  2IWT A;  3UVT A;  2FCH A;  2H1G A;  5DJM A;  3QMX A;  1M7T A;  20GS A;  5IMV A;  3SBC A;  2ALB A;  3N9J A;  5IO0 A;  3CSJ A;  3PR8 A;  3EWL A;  1Q98 A;  3CRT A;  3HHV A;  1PMT A;  2WB9 A;  1TRW A;  4OFM A;  1G7O A;  2MZC A;  2C3Q A;  2DC5 A;  1XOA A;  2LST A;  2GTU A;  1WPI A;  1U6T A;  2P0G A;  3UJ1 A;  3VWX A;  1ZMA A;  3L9S A;  1ZL9 A;  3UMA A;  4F9Z A;  2AUV A;  2YNX A;  1XW6 A;  4GCI A;  1Z6M A;  1K0A A;  4J57 E;  5JWO B;  1SKW B;  1VF4 A;  3EMX A;  3J7Y b;  3ERF A;  5HFI A;  1GSF A;  1A2L A;  2EIR A;  4NMU A;  3WD6 A;  3RBT A;  1SYR A;  2N5F A;  4J56 E;  2ZCT A;  4BWQ A;  2M46 A;  1B8X A;  2HLS A;  2OKA A;  1WP0 A;  4K9Z A;  4BL7 A;  5AIX A;  3F3Q A;  2TIR A;  3GL5 A;  2E7P A;  5D8I A;  1PA3 A;  2YZH A;  1HNC A;  2LNS A;  2LS5 A;  3ZLP A;  2CVK A;  2X8H A;  4OWY A;  1R5P A;  1F6M C;  4L5O A;  1K0C A;  3EIN A;  1K0M A;  5J4U A;  4IVF A;  1A8Y A;  1Z3E A;  3HJO A;  3QPM A;  4K2D A;  2ES7 A;  3UAP A;  2YWN A;  2XBI A;  1B9X C;  2L4Q A;  2B7K A;  1QMV A;  2FA4 A;  1A24 A;  4ZB9 A;  2I9H A;  3H4K A;  2AHE A;  3G7J A;  3C8E A;  3GV1 A;  2C80 A;  3ME7 A;  2F3M A;  1PN9 A;  3HZ8 A;  2R3X A;  4V1A g;  2MYG A;  1GTA A;  1A0R P;  5ECO B;  2VO4 A;  4EUY A;  3WGX A;  1SJZ A;  2I3Y A;  4G19 A;  1YF1 A;  4IQ1 A;  3KCM A;  3Q19 A;  1AW9 A;  5D9T A;  3FHK A;  2BJX A;  5H5S A;  2YN1 A;  5CP1 A;  1SEN A;  5D9W A;  3WT2 A;  1V98 A;  3LEF A;  1JLV A;  6GSY A;  3HVX A;  2B1L A;  3F63 A;  4DEJ A;  2LRT A;  6GST A;  2G2Q A;  2EC4 A;  1FVJ A;  1MD3 A;  1R26 A;  3QD9 A;  5DCH A;  4MA9 A;  1PD2 1;  3L78 A;  1QGV A;  2VOC A;  2KHP A;  1A8L A;  2H1D A;  3KJY A;  3GH6 A;  3VK9 A;  3LYP A;  2RII A;  2V1M A;  1BG5 A;  4O32 A;  3KIJ A;  3F6D A;  3MSZ A;  2HZE B;  4QL7 A;  5KN0 A;  1N8J A;  5CRW A;  2HE3 A;  1TK0 B;  3MDK A;  2AJQ B;  3LQ7 A;  3D22 A;  1ZYE A;  1VF2 A;  4MF5 A;  1AQV A;  3IHQ A;  3O6T A;  2JAC A;  2PGT A;  1B4Q A;  1QQ2 A;  4MDC A;  6GSV A;  1GLP A;  5G1L A;  4PUR A;  1QXH A;  3ZFL A;  3NZN A;  3QFB C;  3DGQ A;  4IJ3 A;  5J9B A;  10GS A;  4L8E A;  1ZOF A;  4TKY A;  1X5C A;  4MCU A;  5JWR B;  4BA7 A;  4KB3 A;  3MWH A;  2NVL A;  2AV4 A;  1TOF A;  1KEB A;  1XWK A;  7GSS A;  3GL3 A;  5CYY A;  2GZP A;  4WR5 A;  1THX A;  2C3T A;  1M2B A;  3KP8 A;  3US3 A;  1URM A;  5B6M A;  4V1A p;  3TKS A;  5FWG A;  3DVX A;  5ECS A;  2GGT A;  3GUS A;  6GSU A;  3EMP A;  3F4T A;  4OFT A;  4GRF A;  4EDZ A;  3CTG A;  1K3L A;  4K0G A;  2VL2 A;  3IXR A;  2RUE A;  1AIU A;  1FVK A;  3IPZ A;  1AUC A;  1XW5 A;  3UAR A;  1PQN A;  2CT6 A;  3IAM 2;  3TRX A;  1AC1 A;  4IP1 A;  2RUF A;  2LRC A;  3F4R A;  1TKD B;  1VF3 A;  3ZIT A;  3UEM A;  3FRC A;  2LQO A;  2RLI A;  4YQV A;  1LJR A;  2IFQ A;  3C1S A;  1O8X A;  3UOM A;  4ZBB A;  4K7O A;  1ZCP A;  3L4N A;  1GUH A;  2R5G A;  2H1A A;  2I1U A;  1S3A A;  1TI3 A;  3IBH A;  4TR3 A;  4RQR A;  2PWJ A;  3A2X A;  3HZ4 A;  2PVQ A;  4BPY A;  1GTU A;  1EV4 A;  2X8G A;  4EKZ A;  2C0F A;  2FD3 A;  1THO A;  1EP7 A;  1JZR A;  1PSQ A;  2FGX A;  2NDO A;  13GS A;  4HZ4 A;  3GN3 A;  5DDL A;  2JZT A;  4IHU A;  3D21 A;  2L57 A;  3KTL A;  3VWW A;  2GDR A;  2HYX A;  1FO5 A;  3G7Y A;  1WWJ A;  2H70 A;  1N2A A;  1OC9 B;  2GT5 A;  1C72 A;  5IMA A;  3DML A;  1ST9 A;  4EC0 A;  1JZO A;  4V2N A;  3EUR A;  5CRH A;  5IPH A;  2H1B A;  4NXI A;  5G30 A;  4LL4 B;  3FZ4 A;  2FWG A;  3KZQ A;  4IQA A;  1WMJ A;  1GLQ A;  18GS A;  2DJJ A;  3Q18 A;  1XIY A;  3VFI A;  4N0Z A;  4WF5 A;  2IMD A;  2V6O A;  1ILO A;  2P31 A;  1BQ7 A;  3ZL5 A;  1MEK A;  4ZB8 A;  2GSS A;  1J9B A;  3QOU A;  1G7E A;  1PRX A;  3BBY A;  4Q5R A;  2B5Y A;  2X64 A;  3TJJ A;  2JZS A;  5ELG A;  1BAY A;  3RPN A;  3KMO A;  1EZK A;  4X0X A;  3IAS 2;  1JLW A;  3FKF A;  4MP4 A;  4RQX A;  2VUP A;  2L6D A;  1DBY A;  5IM9 A;  4AJ6 A;  1GSQ A;  1U3A A;  4PQH A;  1UC7 A;  2FUG 2;  5ID2 B;  3D6I A;  3KP9 A;  4K7I A;  3GSS A;  2K6V A;  2OA7 A;  4XCS A;  1MDJ A;  4ZIJ A;  1TU8 A;  3QAW A;  5E4W A;  1OC3 A;  3RHC A;  5CAX A;  3E3E A;  5ID2 A;  1F2E A;  3KH7 A;  4CHS A;  4KUN A;  2GQM A;  3IRA A;  3GTU B;  1GTI A;  4P3Y B;  3TRQ A;  2LJA A;  3TKP A;  5LNK e;  2FNO A;  4BVX A;  1YY7 A;  1Z6N A;  3A2V A;  1TU7 A;  4TR0 A;  4ZL9 A;  4TR4 A;  1SK2 A;  3GTU A;  2YCD A;  3U6V A;  4POL A;  4GF0 A;  3QAV A;  1H75 A;  4ECB A;  3FYG A;  3VWU A;  3APS A;  5HR2 A;  2A2R A;  1GNE A;  4MK3 A;  4IJI A;  2HT9 A;  4AJ8 A;  3PH9 A;  3ZRD A;  2G0F A;  5J41 A;  1I9D A;  4EXJ A;  4WET A;  2C0E A;  3H93 A;  2AAW A;  2WJU A;  3TJG A;  3ERG A;  3GST A;  4MZB A;  2CZ3 A;  2YWM A;  3H8Q A;  1A2J A;  4N10 A;  4ZXG A;  1TXX A;  3FZ5 A;  3HJM A;  4NPB A;  3ZML A;  5CNW A;  2H75 A;  1GP1 A;  1F3A A;  1AAZ A;  2IL3 A;  4KDY A;  2KP1 A;  4FIW A;  2LJK A;  4MF7 A;  2H76 A;  3W8S A;  4EF0 A;  3APQ A;  2TRX A;  1I5G A;  1GH2 A;  2KLX A;  2HZF A;  5F05 A;  1R5A A;  4XS6 A;  1J0F A;  3LXZ A;  3D4T A;  4I5Q A;  5C00 A;  5DQS A;  5ECK B;  4I2T A;  4ZB6 A;  4N0V A;  1FB6 A;  4POM A;  5IIZ A;  4GXZ A;  4MZC A;  2IJY A;  5AIS A;  3FR6 A;  2FWF A;  1K0N A;  2REM A;  3HXS A;  5EVO A;  3TOU A;  1J08 A;  2GT6 A;  3F3R A;  1U88 A;  2IMI A;  2XHF A;  4MPF A;  2O87 A;  3PIN A;  1GSE A;  2GS3 A;  4DSR A;  4ACS A;  2F9S A;  4Q5F A;  5IMZ A;  3KMN A;  4DVC A;  2F8F A;  4KAE A;  3Q6O A;  1TTZ A;  2LNT A;  3F9U A;  4MH2 A;  1OYJ A;  2DJ0 A;  1XFL A;  1XBS A;  2LV3 A;  2WRT A;  1R4W A;  3KTB A;  2H0H A;  4G9H A;  4K6X A;  4NAX A;  2R2J A;  2VCQ A;  19GS A;  2PVO C;  2VCX A;  1YKA A;  2DSA A;  4HEA 2;  3TGZ A;  4NHW A;  2YV9 A;  3BOA A;  1JHB A;  1B4P A;  5COH A;  1SKS B;  4L0U A;  1EOG A;  1SD9 A;  5D9V A;  3IOS A;  2HSY A;  3LOR A;  4TN8 A;  5DJL A;  2V41 A;  5G5F A;  3SWL A;  4WR4 A;  22GS A;  4LLR A;  3QR6 A;  3HYP A;  2HFD A;  1DE2 A;  1ERT A;  3ZIV A;  1OE8 A;  1FHE A;  2MMN A;  1T4Z A;  5FHI A;  3VI5 A;  4ID0 A;  4L0W A;  2O7K A;  1E6B A;  1RQM A;  1O85 A;  2K8V A;  3ZIJ A;  3RHB A;  3U5R E;  1Z5Y E;  4X43 A;  2JZR A;  3AY8 A;  1X9W B;  4NV2 A;  2CA8 A;  1GL8 A;  5LCZ A;  2OE1 A;  2WS2 A;  3TKS C;  3DD3 A;  1OKT A;  4RI6 A;  2O89 A;  2MMA A;  4IGJ A;  2LRN A;  2V32 A;  2ZNM A;  4HU9 A;  4TXV A;  2P5Q A;  4KE3 A;  4YQU A;  5ELA A;  1FG4 A;  1OKD A;  2CQ9 A;  5DAK B;  2JSY A;  1TK5 B;  1TRU A;  2VL2 C;  1ERU A;  3LWA A;  1PKZ A;  1BJX A;  3CMI A;  2NBS A;  1ON4 A;  4BWS A;  2QGV A;  1QUW A;  4V2L A;  2O8V B;  5CRG A;  4FO5 A;  4HS1 A;  1GWC A;  2V6K A;  1ML6 A;  1DSB A;  2VLV A;  1YEX A;  2VLT A;  3KGK A;  3UVH A;  5ECI B;  5E59 A;  1PX7 A;  1GSD A;  3ZVJ D;  2WZ9 A;  4I2U A;  2HZE A;  4Q5Q A;  4ZL8 A;  1T4Y A;  3EYT A;  2OAC A;  4KX4 A;  3TUE A;  3L0H A;  4E8E A;  4GLT A;  5ECN B;  1UN2 A;  1T7P B;  1IYH A;  4GSS A;  1VGL A;  3ERW A;  1XWA A;  1USB A;  2C8U A;  2LJR A;  1HQO A;  1NW2 A;  1TJD A;  1W89 A;  1Z7P A;  5G5E A;  4TRX A;  1OC8 A;  2K9F A;  2E0Q A;  16GS A;  4MH3 A;  3ZTL A;  3P2A A;  3KEB A;  4LL1 B;  3ME8 A;  1HD2 A;  2C3N A;  2YV7 A;  5HR0 A;  1G6Y A;  2KOK A;  2HRN A;  4GQC A;  3DVW A;  1NSW A;  2C0G A;  2OBK A;  1SD8 A;  1R7H A;  3VWV A;  1M0U A;  3RDW A;  1IYI A;  2B7J A;  4HOJ A;  5FT3 A;  3GX0 A;  3VPQ A;  3W6G A;  4POK A;  4O5R A;  2IMK A;  5KN1 A;  1T8E B;  1EV9 A;  3NIV A;  1PL2 A;  4ML6 A;  3QCP A;  4D73 B;  4FH8 A;  5IMD A;  1Q4J A;  4V2M A;  5HFK A;  3NOF A;  1HYU A;  1GSY A;  2PPT A;  3RPP A;  2CZ2 A;  1TRV A;  1KNG A;  2C1Y A;  3I69 A;  2HXK A;  4D73 A;  2EIO A;  2QKE A;  4CDO A;  2HRF A;  1SK0 A;  3TJB A;  4ULX A;  4MJC A;  4XS1 A;  4NWY A;  5IO2 A;  3QFA C;  2GZZ A;  4K1F A;  2MBT A;  2WDU A;  2ON7 A;  4N30 A;  3FR9 A;  3LXT A;  3GX8 A;  4GQF A;  2VCV A;  3HKR A;  4IBP A;  5AIV A;  3F8U A;  3OR5 A;  3UBK A;  1AQW A;  1V9W A;  3ZMK A;  5IQY A;  2OBI A;  4F2I A;  3M1G A;  1Y6E A;  1SYX A;  4ZBD A;  4JR6 A;  3ZYW A;  2YZU A;  2JL4 A;  4ZBA A;  1QFN A;  2VAF A;  4MJE A;  3WGE A;  5G2Z A;  4PX1 A;  1M2A A;  5F06 A;  3GHA A;  1GUM A;  1GTB A;  2OE0 A;  2AYT A;  1YZX A;  1ZZY A;  2YP6 A;  4HJM A;  2MMZ A;  5ECM B;  2DJ2 A;  3IE3 A;  4PXO A;  1TW9 A;  4CW9 A;  1OC9 A;  2H30 A;  3H1N A;  2NTO A;  5DCG A;  3VUR A;  4KSO A;  11GS A;  3IK9 A;  2B5X A;  5DBQ A;  3CRU A;  3UIW A;  4JR4 A;  3HD5 A;  3BD2 A;  4E8H A;  2ON5 A;  1K3O A;  3LYK A;  3APO A;  2GQK A;  3WGD A;  2OAD A;  1XPV A;  4OD7 A;  5HFG A;  2J23 A;  1TI1 A;  2VCW A;  2QC7 A;  4EE0 A;  2R4V A;  4PNG A;  4TR1 B;  3W8J A;  1XZO A;  2CVD A;  2NPB A;  1FB0 A;  2DLX A;  2FLS A;  4Z7X A;  1TK8 B;  1K0O A;  2L59 A;  2HI7 A;  4X1U A;  4XS4 B;  4JZQ A;  5J5N A;  4ECJ A;  5A4W A;  3EU3 A;  4KA0 A;  4JE1 A;  3A5W A;  4TR1 A;  1GUK A;  4ECC A;  5D9X A;  2DJK A;  5IOW A;  4XS4 A;  3KH9 A;  1G6W A;  2DJ3 A;  1EGR A;  3DYR A;  3KD0 A;  3J7Y k;  4F03 A;  1MDK A;  3MNG A;  2H8L A;  1M9A A;  2E2G A;  3CSH A;  3ZFB A;  2DJ1 A;  1YJ6 A;  2L4C A;  2BMX A;  4YAV A;  5HR1 A;  4EVM A;  1JZW A;  1M2D A;  4AJ7 A;  2H72 A;  3GKN A;  4IW9 A;  3HDC A;  4FYB A;  4WBJ A;  14GS A;  1BED A;  2YJ7 A;  5A4U A;  1ERW A;  3I6A A;  4POB A;  2R6K A;  3KXO A;  2VL3 A;  5DQY A;  3TKR A;  1OAZ A;  2FHE A;  4LMW A;  5DVB A;  1U3I A;  3HVV A;  4ZIL A;  1XVW A;  1GUL A;  3CSI A;  3FY7 A;  1SKR B;  2CV4 A;  3E0U A;  1B9Y C;  3WYW A;  3GRX A;  4EL1 A;  3EVI A;  2TRC P;  2B6M A;  3IR4 A;  3MAK A;  2DML A;  1VF1 A;  2O85 A;  1MDI A;  5F0G A;  1A2M A;  3TJF A;  1SL0 B;  2JU5 A;  3CTF A;  4RUV A;  1YDK A;  4KW6 A;  3H79 A;  4ILF A;  2L6C A;  2VIM A;  5ECQ B;  3EE2 A;  2I81 A;  3HJP A;  4AGS A;  4OO4 A;  2X8C A; 
#chains in the Genus database with same CATH topology
 4K7N A;  1SK1 A;  4F0C A;  5INY A;  1K0B A;  2R37 A;  2H74 A;  3M9J A;  5JCU A;  3BCK A;  4IEL A;  3A2W A;  1YF0 A;  3G7I A;  3EU4 A;  1X5D A;  3GH9 A;  2IN3 A;  4GTU A;  1A0F A;  2N5B A;  2VL9 A;  4KCE A;  4OMV A;  4PQI A;  2C0D A;  3DEX A;  3ZVJ A;  3HCZ A;  4NV5 A;  5JWQ B;  1M99 A;  1O81 A;  1O7U A;  3M9K A;  1SJI A;  1AQX A;  2FA8 A;  4I6X A;  4HI7 A;  2HSM A;  3F6F A;  1X9M B;  4G2E A;  4PUA A;  4WF4 A;  5ENU A;  4TVE A;  4MJA A;  4HZ2 A;  1BYE A;  1X0R A;  2JSZ A;  2F51 A;  3P8W A;  4XTS A;  5CRE A;  3JCM L;  2WUL A;  4GST A;  5G31 A;  1U87 A;  3D4M A;  3LSZ A;  4QL9 A;  2VD0 A;  2H01 A;  1Z7R A;  3IK7 A;  2X4A A;  2PU9 C;  4DSQ A;  3C1R A;  4BL7 B;  2XBQ A;  4PUF C;  1FW1 A;  2F8A A;  2PMT A;  4NHZ A;  1RK4 A;  1JZD A;  2CAQ A;  1TP9 A;  4RI7 A;  5KN2 A;  1UVZ A;  3FR3 A;  1OE7 A;  2AB6 A;  2E2M A;  3FZ9 A;  2VLU A;  3I43 A;  1SJ6 A;  3GFK A;  5DAL B;  4ISD A;  1UA5 A;  3GNJ A;  2VD1 A;  5H5Q A;  1O8W A;  5JCW A;  1YEP A;  4WBR D;  3D5J A;  5AGY A;  5DAL A;  2PER A;  5KEJ A;  1T1V A;  8GSS A;  4TW5 A;  4A5P A;  2H6Z A;  3S9F A;  1XW9 A;  3M3M A;  4FYU A;  4KDX A;  17GS A;  5A5K A;  3R2Q A;  1KTE A;  4L5L A;  3C71 A;  2PN8 A;  12GS A;  3L9U A;  4ECI A;  1ABA A;  5HR3 A;  3M8N A;  5IMF A;  1K3Y A;  3IA1 A;  1GRX A;  5B6N A;  3LG6 A;  5J3R A;  1K0D A;  3EPT A;  3P90 A;  5D96 A;  2K18 A;  3L9V A;  2CX4 A;  3QAG A;  4XIH A;  4KND A;  1DE1 A;  1PGT A;  1X5E A;  2C4J A;  4GWR A;  3GKX A;  4HQS A;  2CVB A;  2RM6 A;  3TCO A;  5ECP B;  4KCA A;  4KSM A;  3HVS A;  1S3R A;  5EPF A;  4OFN A;  3PGT A;  1EP8 A;  1PKW A;  2X49 A;  4IN0 A;  3TKS E;  3LGC A;  1FOV A;  4ZL7 A;  2B1K A;  1EWX A;  4KF9 A;  1CQG A;  5DAK A;  5ECH B;  3E9J B;  3C7M A;  4H86 A;  1X9S B;  3LJR A;  4JBB A;  4WXT A;  1YQ1 A;  4MAB A;  3P7X A;  3TRP A;  1TDI A;  3GKM A;  2H71 A;  3HA9 A;  3IV4 A;  2GLR A;  3UL3 A;  4J2F A;  1XWG A;  3DRN A;  1XVQ A;  2WCI A;  1SL2 B;  4PTS A;  2H0G A;  1WJK A;  5L71 A;  1YKC A;  4YQM A;  4EO3 A;  1EEM A;  3FZA A;  4JU5 A;  5IMC A;  4KDU A;  3O76 A;  4XRD A;  5B7C A;  4WEY A;  3VLN A;  2M72 A;  3GUR A;  1WOU A;  2DBC A;  3CBU A;  4MMM A;  6GSS A;  3C73 A;  5H5R A;  2WGR A;  2J9H A;  4AF2 A;  2N5A A;  1V58 A;  2PUK C;  2VM1 A;  4G10 A;  4HJ2 A;  1V57 A;  2YAN A;  5ABR A;  4MPG A;  4HU7 A;  1EEJ A;  5KN3 A;  1A23 A;  2HNL A;  1RW1 A;  3DXB A;  5GAN D;  3EC3 A;  2OE3 A;  3GKK A;  3GIX A;  1W4V A;  4IP6 A;  3Q74 A;  2YPM A;  2ZUP A;  4MF6 A;  1NHO A;  3FK8 A;  2DIY A;  2LQQ A;  2YJH A;  4GSN A;  3G9B A;  1GSU A;  1XCC A;  2GSR A;  1EGO A;  2XC2 A;  3K8N A;  1PX6 A;  2A2S A;  2HRK A;  1WRY A;  2P5R A;  3FEU A;  4I8B A;  4IKH A;  2OJL A;  1VRS D;  1S3D A;  4YAP A;  1ERV A;  3TDG A;  4OO5 A;  2B5E A;  1Y25 A;  1XOB A;  2K8S A;  4K5R A;  2FY6 A;  5CRD A;  1O6J A;  1EOH A;  2R0G A;  2IFQ B;  1B48 A;  2IIY A;  2PBJ A;  4TOP A;  4MZW A;  1GNW A;  3ISO A;  3KM6 A;  2KUC A;  2A2P A;  4MLY A;  2LUS A;  4OCE A;  2DKI A;  5LD0 A;  2M80 A;  2IME A;  3A3T A;  2YWI A;  1XWC A;  2B3S A;  2X99 A;  4F0B A;  4FYC A;  1V2A A;  2JAD A;  4IS0 A;  3O3T A;  1F3B A;  1MD4 A;  5J9C A;  1LU4 A;  4JRR A;  3PPU A;  1ACV A;  4O5U A;  2L5L A;  3GYK A;  4LA1 A;  6GSX A;  2QSI A;  5JCG A;  1MTC A;  3LFL A;  5IOX A;  5C04 A;  1ZYQ B;  2H66 A;  1SU9 A;  3ZZX A;  2H0I A;  2VCT A;  4O92 A;  1QK8 A;  1GSS A;  1ZYP A;  2IMF A;  1FAA A;  9GSS A;  5B8A A;  4KH7 A;  1NHY A;  2GZY A;  5GZZ B;  1ZGN A;  4HDE A;  4DSS B;  4TXO B;  2IPA A;  2GQL A;  1WE0 A;  3UBL A;  3TOT A;  6GSW A;  2WFC A;  4DSS A;  4TXO A;  2CX3 A;  2A4V A;  2Z9S A;  2EIQ A;  5A4V A;  3D0Z A;  1E2Y A;  3DKS A;  4Q5N A;  1ZYN A;  1TRS A;  5F8B A;  3RAZ A;  5GAP D;  2DIZ A;  5ECR B;  3GA4 A;  5GSS A;  5ECL B;  3IC8 A;  1HNA A;  4HQZ A;  1SL1 B;  2I4A A;  2MMO A;  3VPT A;  1BX9 A;  1F37 A;  1H4O A;  4ML1 A;  2XPE A;  4LMV A;  4YH2 A;  2LKU A;  2GVP A;  1JFU A;  4PNF A;  1F9M A;  5GST A;  4WKW A;  2GSQ A;  4OCF A;  4QQ7 A;  3TJK A;  2YWO A;  1DUG A;  3BJ5 A;  3CXG A;  3HY2 A;  4N11 A;  4MJB A;  1CQH A;  5F07 A;  3M0F A;  3BCI A;  4Z2T A;  5G1K A;  2L5O A;  1O73 A;  2LEG A;  2H6Y A;  2VM2 A;  3CYN A;  2GST A;  4PGT A;  3GMF A;  4PQ1 A;  5D73 A;  4XRA A;  3IC4 A;  3TB2 A;  3TKQ A;  2H19 A;  4XHM A;  5AN1 A;  4EDY A;  3F0I A;  4O7H A;  3WT1 A;  2HSH A;  2VCZ A;  2H6X A;  1LBK A;  1G0T A;  1XXU A;  3QDN A;  2LTK A;  1WIK A;  1KBN A;  4KGI A;  1T00 A;  2MBS A;  1S3C A;  5EL8 A;  4I97 A;  3IDV A;  2KP2 A;  3ZRE A;  1XWB A;  2V2G A;  2YOI A;  3F4S A;  2D2Z A;  5IPG A;  3FW2 A;  1T3B A;  2H73 A;  1OVN A;  4O5Q A;  1HNB A;  2DMM A;  2BTO T;  3I9V 2;  4JED A;  3DIE A;  1PL1 A;  5CO3 A;  5HQP A;  5D93 A;  1NM3 A;  2FWE A;  2XPD A;  3ED3 A;  1Z9H A;  1AXD A;  2FWH A;  4K8M A;  5EY6 A;  4K0N A;  3V1W A;  3VI7 A;  1M9B A;  2RM5 A;  2CAI A;  4F82 A;  4BVY A;  3DWV A;  4HUA A;  1V40 A;  3N5O A;  5B8B A;  2IWT A;  3UVT A;  2FCH A;  2H1G A;  5DJM A;  3QMX A;  1M7T A;  20GS A;  5IMV A;  3SBC A;  2ALB A;  3N9J A;  5IO0 A;  3CSJ A;  3PR8 A;  3EWL A;  1Q98 A;  3CRT A;  3HHV A;  1PMT A;  2WB9 A;  1TRW A;  4OFM A;  1G7O A;  2MZC A;  2C3Q A;  2DC5 A;  1XOA A;  2LST A;  2GTU A;  1WPI A;  1U6T A;  2P0G A;  3UJ1 A;  3VWX A;  1ZMA A;  3L9S A;  1ZL9 A;  3UMA A;  4F9Z A;  2AUV A;  2YNX A;  4K5S A;  1XW6 A;  4GCI A;  1Z6M A;  1K0A A;  4J57 E;  5JWO B;  1SKW B;  1VF4 A;  3EMX A;  3J7Y b;  3ERF A;  5HFI A;  1GSF A;  1A2L A;  2EIR A;  5KOW A;  4NMU A;  3WD6 A;  3RBT A;  1SYR A;  2N5F A;  4J56 E;  2ZCT A;  4BWQ A;  2M46 A;  1B8X A;  2HLS A;  2OKA A;  1WP0 A;  4K9Z A;  4BL7 A;  5AIX A;  3F3Q A;  2TIR A;  3GL5 A;  2E7P A;  5D8I A;  1PA3 A;  2YZH A;  1HNC A;  2LNS A;  2LS5 A;  3ZLP A;  2CVK A;  2X8H A;  4OWY A;  1R5P A;  1F6M C;  4L5O A;  1K0C A;  3EIN A;  1K0M A;  5J4U A;  4IVF A;  1A8Y A;  1Z3E A;  3HJO A;  3QPM A;  4K2D A;  2ES7 A;  3UAP A;  2YWN A;  2XBI A;  1B9X C;  2L4Q A;  2B7K A;  1QMV A;  2FA4 A;  1A24 A;  4ZB9 A;  2I9H A;  3H4K A;  2AHE A;  3G7J A;  3C8E A;  3GV1 A;  2C80 A;  3ME7 A;  1FOH A;  2F3M A;  1PN9 A;  3HZ8 A;  2R3X A;  4V1A g;  2MYG A;  1GTA A;  5BRT A;  1A0R P;  5ECO B;  2VO4 A;  4EUY A;  3WGX A;  1SJZ A;  2I3Y A;  4G19 A;  1YF1 A;  4IQ1 A;  3KCM A;  3Q19 A;  1AW9 A;  5D9T A;  3FHK A;  2BJX A;  5H5S A;  2YN1 A;  4EIP A;  5CP1 A;  1SEN A;  5D9W A;  3WT2 A;  1V98 A;  3LEF A;  1JLV A;  6GSY A;  3HVX A;  2B1L A;  3F63 A;  4DEJ A;  2LRT A;  6GST A;  2G2Q A;  2EC4 A;  1FVJ A;  1MD3 A;  1R26 A;  3QD9 A;  5DCH A;  4MA9 A;  1PD2 1;  3L78 A;  1QGV A;  2VOC A;  2KHP A;  1A8L A;  2H1D A;  3KJY A;  3GH6 A;  3VK9 A;  3LYP A;  2RII A;  2V1M A;  1BG5 A;  4O32 A;  3KIJ A;  3F6D A;  3MSZ A;  2HZE B;  4QL7 A;  5KN0 A;  1N8J A;  5CRW A;  2HE3 A;  1TK0 B;  3MDK A;  2AJQ B;  3LQ7 A;  3D22 A;  1ZYE A;  1VF2 A;  4MF5 A;  1AQV A;  3IHQ A;  3O6T A;  2JAC A;  2PGT A;  1B4Q A;  1QQ2 A;  4MDC A;  2QA1 A;  6GSV A;  4YKF A;  1GLP A;  5G1L A;  4PUR A;  1QXH A;  3ZFL A;  3NZN A;  3QFB C;  3DGQ A;  4IJ3 A;  5J9B A;  10GS A;  4L8E A;  1ZOF A;  4TKY A;  1X5C A;  1XG8 A;  4MCU A;  2UZ8 A;  5JWR B;  4BA7 A;  4KB3 A;  3MWH A;  2NVL A;  2AV4 A;  1TOF A;  1KEB A;  1XWK A;  7GSS A;  3GL3 A;  5CYY A;  2GZP A;  4WR5 A;  1THX A;  2C3T A;  1M2B A;  3KP8 A;  3US3 A;  1URM A;  5B6M A;  4V1A p;  3TKS A;  5FWG A;  3DVX A;  5ECS A;  2GGT A;  4G0I A;  3GUS A;  6GSU A;  3EMP A;  3F4T A;  4OFT A;  4GRF A;  1M3I A;  3CTG A;  4EDZ A;  1K3L A;  4K0G A;  2VL2 A;  3IXR A;  2RUE A;  1AIU A;  1FVK A;  3A5I A;  3IPZ A;  1AUC A;  1PFO A;  1XW5 A;  3UAR A;  1PQN A;  2CT6 A;  3IAM 2;  3TRX A;  1AC1 A;  4IP1 A;  2RUF A;  2LRC A;  3F4R A;  1TKD B;  1VF3 A;  3ZIT A;  3UEM A;  3FRC A;  2LQO A;  2RLI A;  4YQV A;  1LJR A;  2IFQ A;  3LW9 A;  3C1S A;  1O8X A;  3UOM A;  4ZBB A;  4K7O A;  1ZCP A;  3L4N A;  1GUH A;  2R5G A;  2H1A A;  2I1U A;  1S3A A;  1TI3 A;  3IBH A;  4TR3 A;  4RQR A;  4USS A;  2PWJ A;  3A2X A;  3HZ4 A;  2PVQ A;  4BPY A;  1GTU A;  1EV4 A;  2X8G A;  4EKZ A;  2C0F A;  2FD3 A;  4G0L A;  1THO A;  1EP7 A;  1JZR A;  1PSQ A;  2FGX A;  2NDO A;  13GS A;  4HZ4 A;  3GN3 A;  5DDL A;  2JZT A;  4IHU A;  3D21 A;  2L57 A;  3KTL A;  3VWW A;  2GDR A;  2HYX A;  1FO5 A;  3G7Y A;  1WWJ A;  2H70 A;  1N2A A;  1OC9 B;  2GT5 A;  1C72 A;  5IMA A;  3DML A;  1ST9 A;  4EC0 A;  1JZO A;  4V2N A;  3EUR A;  5CRH A;  5IPH A;  2H1B A;  4NXI A;  5G30 A;  4LL4 B;  3FZ4 A;  2FWG A;  3KZQ A;  4IQA A;  1WMJ A;  1GLQ A;  3CQF A;  18GS A;  2DJJ A;  3Q18 A;  1XIY A;  3VFI A;  4N0Z A;  4K2X A;  4WF5 A;  2IMD A;  2V6O A;  1ILO A;  2P31 A;  1BQ7 A;  3ZL5 A;  1MEK A;  4ZB8 A;  2GSS A;  1J9B A;  3QOU A;  1G7E A;  1PRX A;  3BBY A;  4Q5R A;  2B5Y A;  2X64 A;  3TJJ A;  2JZS A;  5ELG A;  1BAY A;  3RPN A;  3KMO A;  1EZK A;  4X0X A;  3IAS 2;  3IHG A;  1JLW A;  3FKF A;  4MP4 A;  4RQX A;  2VUP A;  2L6D A;  1DBY A;  5IM9 A;  4AJ6 A;  1GSQ A;  1U3A A;  4PQH A;  1UC7 A;  2FUG 2;  5ID2 B;  3D6I A;  3KP9 A;  4K7I A;  3GSS A;  2K6V A;  4CY6 A;  2OA7 A;  4XCS A;  1MDJ A;  4ZIJ A;  1TU8 A;  3QAW A;  5E4W A;  1OC3 A;  3RHC A;  5CAX A;  3E3E A;  5ID2 A;  1F2E A;  4BVX B;  3KH7 A;  4CHS A;  4KUN A;  2GQM A;  3IRA A;  3GTU B;  1GTI A;  4P3Y B;  3TRQ A;  2LJA A;  3TKP A;  5LNK e;  2FNO A;  4BVX A;  1YY7 A;  1Z6N A;  3A2V A;  1TU7 A;  4TR0 A;  4ZL9 A;  4TR4 A;  1SK2 A;  3GTU A;  2YCD A;  3U6V A;  4POL A;  4GF0 A;  3QAV A;  1H75 A;  4ECB A;  3FYG A;  3VWU A;  3APS A;  5HR2 A;  2A2R A;  1GNE A;  4MK3 A;  4IJI A;  2HT9 A;  4AJ8 A;  3PH9 A;  3ZRD A;  2G0F A;  5J41 A;  1I9D A;  4EXJ A;  4WET A;  2C0E A;  3H93 A;  2AAW A;  2WJU A;  3TJG A;  3ERG A;  3GST A;  4MZB A;  2CZ3 A;  2YWM A;  3H8Q A;  1A2J A;  4N10 A;  4ZXG A;  1TXX A;  3FZ5 A;  3HJM A;  4NPB A;  3ZML A;  5CNW A;  2H75 A;  1GP1 A;  1F3A A;  1AAZ A;  2IL3 A;  4KDY A;  4HSC X;  2KP1 A;  4FIW A;  2LJK A;  4MF7 A;  2H76 A;  3W8S A;  4EF0 A;  3APQ A;  2TRX A;  1I5G A;  1GH2 A;  2KLX A;  3MYD A;  2HZF A;  5F05 A;  1R5A A;  4XS6 A;  1J0F A;  3LXZ A;  3D4T A;  4I5Q A;  5C00 A;  5DQS A;  5ECK B;  4I2T A;  4ZB6 A;  4N0V A;  1FB6 A;  4POM A;  5IIZ A;  4GXZ A;  4MZC A;  2IJY A;  5AIS A;  3FR6 A;  2FWF A;  1K0N A;  2REM A;  3HXS A;  5EVO A;  3TOU A;  1J08 A;  2GT6 A;  3F3R A;  1U88 A;  2IMI A;  2XHF A;  4MPF A;  2O87 A;  3PIN A;  1GSE A;  2GS3 A;  4DSR A;  4ACS A;  2F9S A;  4Q5F A;  5IMZ A;  3KMN A;  4DVC A;  2F8F A;  4KAE A;  2R0C A;  3Q6O A;  1TTZ A;  2LNT A;  3F9U A;  3HVN A;  4MH2 A;  1OYJ A;  2R0P A;  2DJ0 A;  1XFL A;  1XBS A;  2LV3 A;  2WRT A;  1R4W A;  3KTB A;  2H0H A;  4G9H A;  4K6X A;  4NAX A;  2R2J A;  4MNN A;  2VCQ A;  19GS A;  2PVO C;  2VCX A;  1YKA A;  2DSA A;  4HEA 2;  3TGZ A;  4NHW A;  2YV9 A;  3BOA A;  1JHB A;  1B4P A;  5COH A;  1SKS B;  3MIX A;  4L0U A;  1EOG A;  1SD9 A;  5D9V A;  3IOS A;  2HSY A;  3LOR A;  4TN8 A;  5DJL A;  2V41 A;  5G5F A;  3SWL A;  4WR4 A;  22GS A;  4LLR A;  3QR6 A;  3HYP A;  2HFD A;  1DE2 A;  1ERT A;  3ZIV A;  1OE8 A;  1FHE A;  2MMN A;  1T4Z A;  5FHI A;  3VI5 A;  4ID0 A;  4L0W A;  2O7K A;  1E6B A;  1RQM A;  1O85 A;  5BMU A;  2K8V A;  3ZIJ A;  4CY8 A;  3RHB A;  3U5R E;  1Z5Y E;  4X43 A;  2JZR A;  3AY8 A;  1X9W B;  4NV2 A;  4BIK A;  2CA8 A;  1GL8 A;  5LCZ A;  2OE1 A;  2WS2 A;  3TKS C;  3DD3 A;  1OKT A;  4RI6 A;  2O89 A;  2MMA A;  4IGJ A;  2LRN A;  2V32 A;  2ZNM A;  3FMW A;  4HU9 A;  4TXV A;  2P5Q A;  4KE3 A;  4YQU A;  5ELA A;  1FG4 A;  1OKD A;  2CQ9 A;  5DAK B;  2JSY A;  1TK5 B;  1TRU A;  2VL2 C;  1ERU A;  3LWA A;  1PKZ A;  1BJX A;  3CMI A;  2NBS A;  1ON4 A;  4BWS A;  2QGV A;  1QUW A;  4V2L A;  1M3J A;  2O8V B;  5CRG A;  4FO5 A;  4HS1 A;  1GWC A;  2V6K A;  1ML6 A;  1DSB A;  2VLV A;  1YEX A;  2VLT A;  2QA2 A;  3KGK A;  3UVH A;  5ECI B;  5E59 A;  1PX7 A;  1GSD A;  3ZVJ D;  2WZ9 A;  4I2U A;  2HZE A;  4Q5Q A;  4ZL8 A;  1T4Y A;  3EYT A;  2OAC A;  4KX4 A;  4Z2U A;  3TUE A;  3L0H A;  4E8E A;  4GLT A;  5ECN B;  1UN2 A;  1T7P B;  1IYH A;  4GSS A;  1VGL A;  3ERW A;  1XWA A;  1USB A;  2C8U A;  2LJR A;  1HQO A;  1NW2 A;  1TJD A;  1W89 A;  1Z7P A;  5G5E A;  4TRX A;  1OC8 A;  2K9F A;  2E0Q A;  3R3E A;  16GS A;  4MH3 A;  2A4H A;  3ZTL A;  3P2A A;  3KEB A;  4LL1 B;  3ME8 A;  1HD2 A;  2C3N A;  2YV7 A;  5HR0 A;  1G6Y A;  2KOK A;  2HRN A;  4GQC A;  3DVW A;  1NSW A;  2C0G A;  2OBK A;  1SD8 A;  1R7H A;  2HRA A;  3VWV A;  1M0U A;  3RDW A;  1IYI A;  2B7J A;  4HOJ A;  5FT3 A;  3GX0 A;  3VPQ A;  3W6G A;  4POK A;  4O5R A;  2IMK A;  5KN1 A;  1T8E B;  1EV9 A;  3NIV A;  1PL2 A;  4ML6 A;  3QCP A;  4D73 B;  4FH8 A;  5IMD A;  1Q4J A;  4V2M A;  5HFK A;  3NOF A;  1HYU A;  1GSY A;  2PPT A;  3RPP A;  2CZ2 A;  1TRV A;  1KNG A;  2C1Y A;  3I69 A;  4G0K A;  2HXK A;  4D73 A;  2EIO A;  2QKE A;  4CDO A;  2HRF A;  1SK0 A;  3TJB A;  4ULX A;  4MJC A;  4XS1 A;  4NWY A;  5IO2 A;  3QFA C;  2GZZ A;  4K1F A;  2MBT A;  2WDU A;  2ON7 A;  4N30 A;  3FR9 A;  3LXT A;  3GX8 A;  4GQF A;  4YKG A;  2VCV A;  3HKR A;  4IBP A;  5AIV A;  4EIQ A;  3F8U A;  3OR5 A;  3UBK A;  1AQW A;  1V9W A;  3ZMK A;  5IQY A;  2OBI A;  4F2I A;  3M1G A;  1Y6E A;  1SYX A;  4ZBD A;  4JR6 A;  3ZYW A;  2YZU A;  2JL4 A;  4ZBA A;  1QFN A;  2VAF A;  4MJE A;  3WGE A;  5G2Z A;  4PX1 A;  1M2A A;  5F06 A;  3GHA A;  1GUM A;  1GTB A;  2OE0 A;  2AYT A;  1YZX A;  1ZZY A;  2YP6 A;  4HJM A;  2MMZ A;  5ECM B;  2DJ2 A;  3IE3 A;  4PXO A;  1TW9 A;  4CW9 A;  1OC9 A;  2H30 A;  3H1N A;  2NTO A;  5DCG A;  3VUR A;  4KSO A;  11GS A;  3IK9 A;  2B5X A;  5DBQ A;  3CRU A;  3UIW A;  4JR4 A;  3HD5 A;  4FQU A;  3BD2 A;  4E8H A;  2ON5 A;  1K3O A;  3LYK A;  3APO A;  2GQK A;  3WGD A;  2OAD A;  1XPV A;  4OD7 A;  5HFG A;  2J23 A;  1TI1 A;  2VCW A;  2QC7 A;  4EE0 A;  2R4V A;  4PNG A;  4TR1 B;  3W8J A;  1XZO A;  2CVD A;  2NPB A;  1FB0 A;  2DLX A;  2FLS A;  4Z7X A;  1TK8 B;  1K0O A;  2L59 A;  2HI7 A;  4X1U A;  4XS4 B;  4JZQ A;  5J5N A;  4ECJ A;  5A4W A;  3EU3 A;  4KA0 A;  4JE1 A;  3A5W A;  4TR1 A;  1GUK A;  4ECC A;  5D9X A;  2DJK A;  5IOW A;  4XS4 A;  3KH9 A;  5KOX A;  1G6W A;  2DJ3 A;  1EGR A;  3DYR A;  3KD0 A;  3J7Y k;  4F03 A;  1MDK A;  3MNG A;  2H8L A;  1M9A A;  2E2G A;  3CSH A;  3ZFB A;  2DJ1 A;  1YJ6 A;  2L4C A;  2BMX A;  4YAV A;  5HR1 A;  4EVM A;  1JZW A;  1M2D A;  4AJ7 A;  2H72 A;  3GKN A;  4IW9 A;  3HDC A;  4FYB A;  4WBJ A;  14GS A;  1BED A;  2YJ7 A;  5A4U A;  1ERW A;  3I6A A;  4POB A;  2R6K A;  3KXO A;  2VL3 A;  5DQY A;  2DKH A;  3TKR A;  1OAZ A;  2FHE A;  4LMW A;  5DVB A;  4ICY A;  1U3I A;  3HVV A;  4ZIL A;  1XVW A;  1GUL A;  1PN0 A;  3CSI A;  3FY7 A;  1SKR B;  2CV4 A;  4X4J A;  3E0U A;  1B9Y C;  3WYW A;  3GRX A;  4EL1 A;  3EVI A;  2TRC P;  2B6M A;  3IR4 A;  3MAK A;  2DML A;  1VF1 A;  2O85 A;  1MDI A;  5F0G A;  1A2M A;  3TJF A;  1SL0 B;  2JU5 A;  3CTF A;  4RUV A;  1YDK A;  4KW6 A;  3H79 A;  4ILF A;  2L6C A;  2VIM A;  5ECQ B;  3EE2 A;  2I81 A;  4BVY B;  3HJP A;  4AGS A;  4OO4 A;  4Z2R A;  2X8C A; 
#chains in the Genus database with same CATH homology
 4K7N A;  1SK1 A;  4F0C A;  5INY A;  1K0B A;  2R37 A;  2H74 A;  3M9J A;  5JCU A;  3BCK A;  4IEL A;  3A2W A;  1YF0 A;  3G7I A;  3EU4 A;  1X5D A;  3GH9 A;  2IN3 A;  4GTU A;  1A0F A;  2N5B A;  2VL9 A;  4KCE A;  4OMV A;  4PQI A;  2C0D A;  3DEX A;  3ZVJ A;  3HCZ A;  4NV5 A;  5JWQ B;  1M99 A;  1O81 A;  1O7U A;  3M9K A;  1SJI A;  1AQX A;  2FA8 A;  4I6X A;  4HI7 A;  2HSM A;  3F6F A;  1X9M B;  4G2E A;  4PUA A;  4WF4 A;  5ENU A;  4TVE A;  4MJA A;  4HZ2 A;  1BYE A;  1X0R A;  2JSZ A;  2F51 A;  3P8W A;  4XTS A;  5CRE A;  3JCM L;  2WUL A;  4GST A;  5G31 A;  1U87 A;  3D4M A;  3LSZ A;  4QL9 A;  2VD0 A;  2H01 A;  1Z7R A;  3IK7 A;  2X4A A;  2PU9 C;  4DSQ A;  3C1R A;  4BL7 B;  2XBQ A;  4PUF C;  1FW1 A;  2F8A A;  2PMT A;  4NHZ A;  1RK4 A;  1JZD A;  2CAQ A;  1TP9 A;  4RI7 A;  5KN2 A;  1UVZ A;  3FR3 A;  1OE7 A;  2AB6 A;  2E2M A;  3FZ9 A;  2VLU A;  3I43 A;  1SJ6 A;  3GFK A;  5DAL B;  4ISD A;  1UA5 A;  3GNJ A;  2VD1 A;  5H5Q A;  1O8W A;  5JCW A;  1YEP A;  4WBR D;  3D5J A;  5AGY A;  5DAL A;  2PER A;  5KEJ A;  1T1V A;  8GSS A;  4TW5 A;  4A5P A;  2H6Z A;  3S9F A;  1XW9 A;  3M3M A;  4FYU A;  4KDX A;  17GS A;  5A5K A;  3R2Q A;  1KTE A;  4L5L A;  3C71 A;  2PN8 A;  12GS A;  3L9U A;  4ECI A;  1ABA A;  5HR3 A;  3M8N A;  5IMF A;  1K3Y A;  3IA1 A;  1GRX A;  5B6N A;  3LG6 A;  5J3R A;  1K0D A;  3EPT A;  3P90 A;  5D96 A;  2K18 A;  3L9V A;  2CX4 A;  3QAG A;  4XIH A;  4KND A;  1DE1 A;  1PGT A;  1X5E A;  2C4J A;  4GWR A;  3GKX A;  4HQS A;  2CVB A;  2RM6 A;  3TCO A;  5ECP B;  4KCA A;  4KSM A;  3HVS A;  5EPF A;  4OFN A;  3PGT A;  1EP8 A;  1PKW A;  2X49 A;  4IN0 A;  3TKS E;  3LGC A;  1FOV A;  4ZL7 A;  2B1K A;  1EWX A;  4KF9 A;  1CQG A;  5DAK A;  5ECH B;  3E9J B;  3C7M A;  4H86 A;  1X9S B;  3LJR A;  4JBB A;  4WXT A;  1YQ1 A;  4MAB A;  3P7X A;  3TRP A;  1TDI A;  3GKM A;  2H71 A;  3HA9 A;  3IV4 A;  2GLR A;  3UL3 A;  4J2F A;  1XWG A;  3DRN A;  1XVQ A;  2WCI A;  1SL2 B;  4PTS A;  2H0G A;  1WJK A;  5L71 A;  1YKC A;  4YQM A;  4EO3 A;  1EEM A;  3FZA A;  4JU5 A;  5IMC A;  4KDU A;  3O76 A;  4XRD A;  5B7C A;  4WEY A;  3VLN A;  2M72 A;  3GUR A;  1WOU A;  2DBC A;  3CBU A;  4MMM A;  6GSS A;  3C73 A;  5H5R A;  2WGR A;  2J9H A;  4AF2 A;  2N5A A;  1V58 A;  2PUK C;  2VM1 A;  4G10 A;  4HJ2 A;  1V57 A;  2YAN A;  5ABR A;  4MPG A;  4HU7 A;  1EEJ A;  5KN3 A;  1A23 A;  2HNL A;  1RW1 A;  3DXB A;  5GAN D;  3EC3 A;  2OE3 A;  3GKK A;  3GIX A;  1W4V A;  4IP6 A;  3Q74 A;  2YPM A;  2ZUP A;  4MF6 A;  1NHO A;  3FK8 A;  2DIY A;  2LQQ A;  2YJH A;  4GSN A;  3G9B A;  1GSU A;  1XCC A;  2GSR A;  1EGO A;  2XC2 A;  3K8N A;  1PX6 A;  2A2S A;  2HRK A;  1WRY A;  2P5R A;  3FEU A;  4I8B A;  4IKH A;  2OJL A;  1VRS D;  1S3D A;  4YAP A;  1ERV A;  3TDG A;  4OO5 A;  2B5E A;  1Y25 A;  1XOB A;  2K8S A;  4K5R A;  2FY6 A;  5CRD A;  1O6J A;  1EOH A;  2R0G A;  2IFQ B;  1B48 A;  2IIY A;  2PBJ A;  4TOP A;  4MZW A;  1GNW A;  3ISO A;  3KM6 A;  2KUC A;  2A2P A;  4MLY A;  2LUS A;  4OCE A;  2DKI A;  5LD0 A;  2M80 A;  2IME A;  3A3T A;  2YWI A;  1XWC A;  2B3S A;  2X99 A;  4F0B A;  4FYC A;  1V2A A;  2JAD A;  4IS0 A;  3O3T A;  1F3B A;  1MD4 A;  5J9C A;  1LU4 A;  4JRR A;  3PPU A;  1ACV A;  4O5U A;  2L5L A;  3GYK A;  4LA1 A;  6GSX A;  2QSI A;  5JCG A;  1MTC A;  3LFL A;  5IOX A;  5C04 A;  1ZYQ B;  2H66 A;  1SU9 A;  3ZZX A;  2H0I A;  2VCT A;  4O92 A;  1QK8 A;  1GSS A;  1ZYP A;  2IMF A;  1FAA A;  9GSS A;  5B8A A;  4KH7 A;  1NHY A;  2GZY A;  5GZZ B;  1ZGN A;  4HDE A;  4DSS B;  4TXO B;  2IPA A;  2GQL A;  1WE0 A;  3UBL A;  3TOT A;  6GSW A;  2WFC A;  4DSS A;  4TXO A;  2CX3 A;  2A4V A;  2Z9S A;  2EIQ A;  5A4V A;  3D0Z A;  1E2Y A;  3DKS A;  4Q5N A;  1ZYN A;  1TRS A;  5F8B A;  3RAZ A;  5GAP D;  2DIZ A;  5ECR B;  3GA4 A;  5GSS A;  5ECL B;  3IC8 A;  1HNA A;  4HQZ A;  1SL1 B;  2I4A A;  2MMO A;  3VPT A;  1BX9 A;  1F37 A;  1H4O A;  4ML1 A;  2XPE A;  4LMV A;  4YH2 A;  2LKU A;  2GVP A;  1JFU A;  4PNF A;  1F9M A;  5GST A;  4WKW A;  2GSQ A;  4OCF A;  4QQ7 A;  3TJK A;  2YWO A;  1DUG A;  3BJ5 A;  3CXG A;  3HY2 A;  4N11 A;  4MJB A;  1CQH A;  5F07 A;  3M0F A;  3BCI A;  4Z2T A;  5G1K A;  2L5O A;  1O73 A;  2LEG A;  2H6Y A;  2VM2 A;  3CYN A;  2GST A;  4PGT A;  3GMF A;  4PQ1 A;  5D73 A;  4XRA A;  3IC4 A;  3TB2 A;  3TKQ A;  2H19 A;  4XHM A;  5AN1 A;  4EDY A;  3F0I A;  4O7H A;  3WT1 A;  2HSH A;  2VCZ A;  2H6X A;  1LBK A;  1G0T A;  1XXU A;  3QDN A;  2LTK A;  1WIK A;  1KBN A;  4KGI A;  1T00 A;  2MBS A;  1S3C A;  5EL8 A;  4I97 A;  3IDV A;  2KP2 A;  3ZRE A;  1XWB A;  2V2G A;  2YOI A;  3F4S A;  2D2Z A;  5IPG A;  3FW2 A;  1T3B A;  2H73 A;  1OVN A;  4O5Q A;  1HNB A;  2DMM A;  2BTO T;  3I9V 2;  4JED A;  3DIE A;  1PL1 A;  5CO3 A;  5HQP A;  5D93 A;  1NM3 A;  2FWE A;  2XPD A;  3ED3 A;  1Z9H A;  1AXD A;  2FWH A;  4K8M A;  5EY6 A;  4K0N A;  3V1W A;  3VI7 A;  1M9B A;  2RM5 A;  2CAI A;  4F82 A;  4BVY A;  3DWV A;  4HUA A;  1V40 A;  3N5O A;  5B8B A;  2IWT A;  3UVT A;  2FCH A;  2H1G A;  5DJM A;  3QMX A;  1M7T A;  20GS A;  5IMV A;  3SBC A;  2ALB A;  3N9J A;  5IO0 A;  3CSJ A;  3PR8 A;  3EWL A;  1Q98 A;  3CRT A;  3HHV A;  1PMT A;  2WB9 A;  1TRW A;  4OFM A;  1G7O A;  2MZC A;  2C3Q A;  2DC5 A;  1XOA A;  2LST A;  2GTU A;  1WPI A;  1U6T A;  2P0G A;  3UJ1 A;  3VWX A;  1ZMA A;  3L9S A;  1ZL9 A;  3UMA A;  4F9Z A;  2AUV A;  2YNX A;  4K5S A;  1XW6 A;  4GCI A;  1Z6M A;  1K0A A;  4J57 E;  5JWO B;  1SKW B;  1VF4 A;  3EMX A;  3J7Y b;  3ERF A;  5HFI A;  1GSF A;  1A2L A;  2EIR A;  5KOW A;  4NMU A;  3WD6 A;  3RBT A;  1SYR A;  2N5F A;  4J56 E;  2ZCT A;  4BWQ A;  2M46 A;  1B8X A;  2HLS A;  2OKA A;  1WP0 A;  4K9Z A;  4BL7 A;  5AIX A;  3F3Q A;  2TIR A;  3GL5 A;  2E7P A;  5D8I A;  1PA3 A;  2YZH A;  1HNC A;  2LNS A;  2LS5 A;  3ZLP A;  2CVK A;  2X8H A;  4OWY A;  1R5P A;  1F6M C;  4L5O A;  1K0C A;  3EIN A;  1K0M A;  5J4U A;  4IVF A;  1A8Y A;  1Z3E A;  3HJO A;  3QPM A;  4K2D A;  2ES7 A;  3UAP A;  2YWN A;  2XBI A;  1B9X C;  2L4Q A;  2B7K A;  1QMV A;  2FA4 A;  1A24 A;  4ZB9 A;  2I9H A;  3H4K A;  2AHE A;  3G7J A;  3C8E A;  3GV1 A;  2C80 A;  3ME7 A;  1FOH A;  2F3M A;  1PN9 A;  3HZ8 A;  2R3X A;  4V1A g;  2MYG A;  1GTA A;  5BRT A;  1A0R P;  5ECO B;  2VO4 A;  4EUY A;  3WGX A;  1SJZ A;  2I3Y A;  4G19 A;  1YF1 A;  4IQ1 A;  3KCM A;  3Q19 A;  1AW9 A;  5D9T A;  3FHK A;  2BJX A;  5H5S A;  2YN1 A;  4EIP A;  5CP1 A;  1SEN A;  5D9W A;  3WT2 A;  1V98 A;  3LEF A;  1JLV A;  6GSY A;  3HVX A;  2B1L A;  3F63 A;  4DEJ A;  2LRT A;  6GST A;  2G2Q A;  2EC4 A;  1FVJ A;  1MD3 A;  1R26 A;  3QD9 A;  5DCH A;  4MA9 A;  1PD2 1;  3L78 A;  1QGV A;  2VOC A;  2KHP A;  1A8L A;  2H1D A;  3KJY A;  3GH6 A;  3VK9 A;  3LYP A;  2RII A;  2V1M A;  1BG5 A;  4O32 A;  3KIJ A;  3F6D A;  3MSZ A;  2HZE B;  4QL7 A;  5KN0 A;  1N8J A;  5CRW A;  2HE3 A;  1TK0 B;  3MDK A;  2AJQ B;  3LQ7 A;  3D22 A;  1ZYE A;  1VF2 A;  4MF5 A;  1AQV A;  3IHQ A;  3O6T A;  2JAC A;  2PGT A;  1B4Q A;  1QQ2 A;  4MDC A;  2QA1 A;  6GSV A;  4YKF A;  1GLP A;  5G1L A;  4PUR A;  1QXH A;  3ZFL A;  3NZN A;  3QFB C;  3DGQ A;  4IJ3 A;  5J9B A;  10GS A;  4L8E A;  1ZOF A;  4TKY A;  1X5C A;  4MCU A;  2UZ8 A;  5JWR B;  4BA7 A;  4KB3 A;  3MWH A;  2NVL A;  2AV4 A;  1TOF A;  1KEB A;  1XWK A;  7GSS A;  3GL3 A;  5CYY A;  2GZP A;  4WR5 A;  1THX A;  2C3T A;  1M2B A;  3KP8 A;  3US3 A;  1URM A;  5B6M A;  4V1A p;  3TKS A;  5FWG A;  3DVX A;  5ECS A;  2GGT A;  4G0I A;  3GUS A;  6GSU A;  3EMP A;  3F4T A;  4OFT A;  4GRF A;  4EDZ A;  3CTG A;  1K3L A;  4K0G A;  2VL2 A;  3IXR A;  2RUE A;  1AIU A;  1FVK A;  3A5I A;  3IPZ A;  1AUC A;  1XW5 A;  3UAR A;  1PQN A;  2CT6 A;  3IAM 2;  3TRX A;  1AC1 A;  4IP1 A;  2RUF A;  2LRC A;  3F4R A;  1TKD B;  1VF3 A;  3ZIT A;  3UEM A;  3FRC A;  2LQO A;  2RLI A;  4YQV A;  1LJR A;  2IFQ A;  3LW9 A;  3C1S A;  1O8X A;  3UOM A;  4ZBB A;  4K7O A;  1ZCP A;  3L4N A;  1GUH A;  2R5G A;  2H1A A;  2I1U A;  1S3A A;  1TI3 A;  3IBH A;  4TR3 A;  4RQR A;  4USS A;  2PWJ A;  3A2X A;  3HZ4 A;  2PVQ A;  4BPY A;  1GTU A;  1EV4 A;  2X8G A;  4EKZ A;  2C0F A;  2FD3 A;  4G0L A;  1THO A;  1EP7 A;  1JZR A;  1PSQ A;  2FGX A;  2NDO A;  13GS A;  4HZ4 A;  3GN3 A;  5DDL A;  2JZT A;  4IHU A;  3D21 A;  2L57 A;  3KTL A;  3VWW A;  2GDR A;  2HYX A;  1FO5 A;  3G7Y A;  1WWJ A;  2H70 A;  1N2A A;  1OC9 B;  2GT5 A;  1C72 A;  5IMA A;  3DML A;  1ST9 A;  4EC0 A;  1JZO A;  4V2N A;  3EUR A;  5CRH A;  5IPH A;  2H1B A;  4NXI A;  5G30 A;  4LL4 B;  3FZ4 A;  2FWG A;  3KZQ A;  4IQA A;  1WMJ A;  1GLQ A;  18GS A;  2DJJ A;  3Q18 A;  1XIY A;  3VFI A;  4N0Z A;  4K2X A;  4WF5 A;  2IMD A;  2V6O A;  1ILO A;  2P31 A;  1BQ7 A;  3ZL5 A;  1MEK A;  4ZB8 A;  2GSS A;  1J9B A;  3QOU A;  1G7E A;  1PRX A;  3BBY A;  4Q5R A;  2B5Y A;  2X64 A;  3TJJ A;  2JZS A;  5ELG A;  1BAY A;  3RPN A;  3KMO A;  1EZK A;  4X0X A;  3IAS 2;  3IHG A;  1JLW A;  3FKF A;  4MP4 A;  4RQX A;  2VUP A;  2L6D A;  1DBY A;  5IM9 A;  4AJ6 A;  1GSQ A;  1U3A A;  4PQH A;  1UC7 A;  2FUG 2;  5ID2 B;  3D6I A;  3KP9 A;  4K7I A;  3GSS A;  2K6V A;  4CY6 A;  2OA7 A;  4XCS A;  1MDJ A;  4ZIJ A;  1TU8 A;  3QAW A;  5E4W A;  1OC3 A;  3RHC A;  5CAX A;  3E3E A;  5ID2 A;  1F2E A;  4BVX B;  3KH7 A;  4CHS A;  4KUN A;  2GQM A;  3IRA A;  3GTU B;  1GTI A;  4P3Y B;  3TRQ A;  2LJA A;  3TKP A;  5LNK e;  2FNO A;  4BVX A;  1YY7 A;  1Z6N A;  3A2V A;  1TU7 A;  4TR0 A;  4ZL9 A;  4TR4 A;  1SK2 A;  3GTU A;  2YCD A;  3U6V A;  4POL A;  4GF0 A;  3QAV A;  1H75 A;  4ECB A;  3FYG A;  3VWU A;  3APS A;  5HR2 A;  2A2R A;  1GNE A;  4MK3 A;  4IJI A;  2HT9 A;  4AJ8 A;  3PH9 A;  3ZRD A;  2G0F A;  5J41 A;  1I9D A;  4EXJ A;  4WET A;  2C0E A;  3H93 A;  2AAW A;  2WJU A;  3TJG A;  3ERG A;  3GST A;  4MZB A;  2CZ3 A;  2YWM A;  3H8Q A;  1A2J A;  4N10 A;  4ZXG A;  1TXX A;  3FZ5 A;  3HJM A;  4NPB A;  3ZML A;  5CNW A;  2H75 A;  1GP1 A;  1F3A A;  1AAZ A;  2IL3 A;  4KDY A;  2KP1 A;  4FIW A;  2LJK A;  4MF7 A;  2H76 A;  3W8S A;  4EF0 A;  3APQ A;  2TRX A;  1I5G A;  1GH2 A;  2KLX A;  3MYD A;  2HZF A;  5F05 A;  1R5A A;  4XS6 A;  1J0F A;  3LXZ A;  3D4T A;  4I5Q A;  5C00 A;  5DQS A;  5ECK B;  4I2T A;  4ZB6 A;  4N0V A;  1FB6 A;  4POM A;  5IIZ A;  4GXZ A;  4MZC A;  2IJY A;  5AIS A;  3FR6 A;  2FWF A;  1K0N A;  2REM A;  3HXS A;  5EVO A;  3TOU A;  1J08 A;  2GT6 A;  3F3R A;  1U88 A;  2IMI A;  2XHF A;  4MPF A;  2O87 A;  3PIN A;  1GSE A;  2GS3 A;  4DSR A;  4ACS A;  2F9S A;  4Q5F A;  5IMZ A;  3KMN A;  4DVC A;  2F8F A;  4KAE A;  2R0C A;  3Q6O A;  1TTZ A;  2LNT A;  3F9U A;  4MH2 A;  1OYJ A;  2R0P A;  2DJ0 A;  1XFL A;  1XBS A;  2LV3 A;  2WRT A;  1R4W A;  3KTB A;  2H0H A;  4G9H A;  4K6X A;  4NAX A;  2R2J A;  4MNN A;  2VCQ A;  19GS A;  2PVO C;  2VCX A;  1YKA A;  2DSA A;  4HEA 2;  3TGZ A;  4NHW A;  2YV9 A;  3BOA A;  1JHB A;  1B4P A;  5COH A;  1SKS B;  3MIX A;  4L0U A;  1EOG A;  1SD9 A;  5D9V A;  3IOS A;  2HSY A;  3LOR A;  4TN8 A;  5DJL A;  2V41 A;  5G5F A;  3SWL A;  4WR4 A;  22GS A;  4LLR A;  3QR6 A;  3HYP A;  2HFD A;  1DE2 A;  1ERT A;  3ZIV A;  1OE8 A;  1FHE A;  2MMN A;  1T4Z A;  5FHI A;  3VI5 A;  4ID0 A;  4L0W A;  2O7K A;  1E6B A;  1RQM A;  1O85 A;  5BMU A;  2K8V A;  3ZIJ A;  4CY8 A;  3RHB A;  3U5R E;  1Z5Y E;  4X43 A;  2JZR A;  3AY8 A;  1X9W B;  4NV2 A;  2CA8 A;  1GL8 A;  5LCZ A;  2OE1 A;  2WS2 A;  3TKS C;  3DD3 A;  1OKT A;  4RI6 A;  2O89 A;  2MMA A;  4IGJ A;  2LRN A;  2V32 A;  2ZNM A;  3FMW A;  4HU9 A;  4TXV A;  2P5Q A;  4KE3 A;  4YQU A;  5ELA A;  1FG4 A;  1OKD A;  2CQ9 A;  5DAK B;  2JSY A;  1TK5 B;  1TRU A;  2VL2 C;  1ERU A;  3LWA A;  1PKZ A;  1BJX A;  3CMI A;  2NBS A;  1ON4 A;  4BWS A;  2QGV A;  1QUW A;  4V2L A;  2O8V B;  5CRG A;  4FO5 A;  4HS1 A;  1GWC A;  2V6K A;  1ML6 A;  1DSB A;  2VLV A;  1YEX A;  2VLT A;  2QA2 A;  3KGK A;  3UVH A;  5ECI B;  5E59 A;  1PX7 A;  1GSD A;  3ZVJ D;  2WZ9 A;  4I2U A;  2HZE A;  4Q5Q A;  4ZL8 A;  1T4Y A;  3EYT A;  2OAC A;  4KX4 A;  4Z2U A;  3TUE A;  3L0H A;  4E8E A;  4GLT A;  5ECN B;  1UN2 A;  1T7P B;  1IYH A;  4GSS A;  1VGL A;  3ERW A;  1XWA A;  1USB A;  2C8U A;  2LJR A;  1HQO A;  1NW2 A;  1TJD A;  1W89 A;  1Z7P A;  5G5E A;  4TRX A;  1OC8 A;  2K9F A;  2E0Q A;  3R3E A;  16GS A;  4MH3 A;  2A4H A;  3ZTL A;  3P2A A;  3KEB A;  4LL1 B;  3ME8 A;  1HD2 A;  2C3N A;  2YV7 A;  5HR0 A;  1G6Y A;  2KOK A;  2HRN A;  4GQC A;  3DVW A;  1NSW A;  2C0G A;  2OBK A;  1SD8 A;  1R7H A;  2HRA A;  3VWV A;  1M0U A;  3RDW A;  1IYI A;  2B7J A;  4HOJ A;  5FT3 A;  3GX0 A;  3VPQ A;  3W6G A;  4POK A;  4O5R A;  2IMK A;  5KN1 A;  1T8E B;  1EV9 A;  3NIV A;  1PL2 A;  4ML6 A;  3QCP A;  4D73 B;  4FH8 A;  5IMD A;  1Q4J A;  4V2M A;  5HFK A;  3NOF A;  1HYU A;  1GSY A;  2PPT A;  3RPP A;  2CZ2 A;  1TRV A;  1KNG A;  2C1Y A;  3I69 A;  4G0K A;  2HXK A;  4D73 A;  2EIO A;  2QKE A;  4CDO A;  2HRF A;  1SK0 A;  3TJB A;  4ULX A;  4MJC A;  4XS1 A;  4NWY A;  5IO2 A;  3QFA C;  2GZZ A;  4K1F A;  2MBT A;  2WDU A;  2ON7 A;  4N30 A;  3FR9 A;  3LXT A;  3GX8 A;  4GQF A;  4YKG A;  2VCV A;  3HKR A;  4IBP A;  5AIV A;  4EIQ A;  3F8U A;  3OR5 A;  3UBK A;  1AQW A;  1V9W A;  3ZMK A;  5IQY A;  2OBI A;  4F2I A;  3M1G A;  1Y6E A;  1SYX A;  4ZBD A;  4JR6 A;  3ZYW A;  2YZU A;  2JL4 A;  4ZBA A;  1QFN A;  2VAF A;  4MJE A;  3WGE A;  5G2Z A;  4PX1 A;  1M2A A;  5F06 A;  3GHA A;  1GUM A;  1GTB A;  2OE0 A;  2AYT A;  1YZX A;  1ZZY A;  2YP6 A;  4HJM A;  2MMZ A;  5ECM B;  2DJ2 A;  3IE3 A;  4PXO A;  1TW9 A;  4CW9 A;  1OC9 A;  2H30 A;  3H1N A;  2NTO A;  5DCG A;  3VUR A;  4KSO A;  11GS A;  3IK9 A;  2B5X A;  5DBQ A;  3CRU A;  3UIW A;  4JR4 A;  3HD5 A;  4FQU A;  3BD2 A;  4E8H A;  2ON5 A;  1K3O A;  3LYK A;  3APO A;  2GQK A;  3WGD A;  2OAD A;  1XPV A;  4OD7 A;  5HFG A;  2J23 A;  1TI1 A;  2VCW A;  2QC7 A;  4EE0 A;  2R4V A;  4PNG A;  4TR1 B;  3W8J A;  1XZO A;  2CVD A;  2NPB A;  1FB0 A;  2DLX A;  2FLS A;  4Z7X A;  1TK8 B;  1K0O A;  2L59 A;  2HI7 A;  4X1U A;  4XS4 B;  4JZQ A;  5J5N A;  4ECJ A;  5A4W A;  3EU3 A;  4KA0 A;  4JE1 A;  3A5W A;  4TR1 A;  1GUK A;  4ECC A;  5D9X A;  2DJK A;  5IOW A;  4XS4 A;  3KH9 A;  5KOX A;  1G6W A;  2DJ3 A;  1EGR A;  3DYR A;  3KD0 A;  3J7Y k;  4F03 A;  1MDK A;  3MNG A;  2H8L A;  1M9A A;  2E2G A;  3CSH A;  3ZFB A;  2DJ1 A;  1YJ6 A;  2L4C A;  2BMX A;  4YAV A;  5HR1 A;  4EVM A;  1JZW A;  1M2D A;  4AJ7 A;  2H72 A;  3GKN A;  4IW9 A;  3HDC A;  4FYB A;  4WBJ A;  14GS A;  1BED A;  2YJ7 A;  5A4U A;  1ERW A;  3I6A A;  4POB A;  2R6K A;  3KXO A;  2VL3 A;  5DQY A;  2DKH A;  3TKR A;  1OAZ A;  2FHE A;  4LMW A;  5DVB A;  4ICY A;  1U3I A;  3HVV A;  4ZIL A;  1XVW A;  1GUL A;  1PN0 A;  3CSI A;  3FY7 A;  1SKR B;  2CV4 A;  4X4J A;  3E0U A;  1B9Y C;  3WYW A;  3GRX A;  4EL1 A;  3EVI A;  2TRC P;  2B6M A;  3IR4 A;  3MAK A;  2DML A;  1VF1 A;  2O85 A;  1MDI A;  5F0G A;  1A2M A;  3TJF A;  1SL0 B;  2JU5 A;  3CTF A;  4RUV A;  1YDK A;  4KW6 A;  3H79 A;  4ILF A;  2L6C A;  2VIM A;  5ECQ B;  3EE2 A;  2I81 A;  4BVY B;  3HJP A;  4AGS A;  4OO4 A;  4Z2R A;  2X8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...