3F3RA

Crystal structure of yeast thioredoxin1-glutathione mixed disulfide complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
HHHMVTQFKTASEFDSAIAQDKLVVVDFYATWCGPSKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin-1
publication title Structural and kinetic analysis of Saccharomyces cerevisiae thioredoxin Trx1: implications for the catalytic mechanism of GSSG reduced by the thioredoxin system
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 28
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f3rA00
1O6JA 2P31A 1SKWB 3VWWA 1FB0A 3WT2A 2PBJA 2BTOT 1XW6A 3BD2A 2C3QA 2VM2A 3FR3A 2H74A 1M2AA 2JU5A 2C0DA 2TIRA 4HJMA 1ERWA 1XWBA 2GS3A 3C71A 2N5BA 3KCMA 1WWJA 1THXA 1TW9A 1MTCA 4GRFA 5A5KA 4EVMA 1DE2A 4GCIA 2YJ7A 1HNAA 1V98A 1ZCPA 3IR4A 3CSHA 3C1SA 4KDYA 3GHAA 1XWKA 3O6TA 2GVPA 4WF5A 1KBNA 2R3XA 3R2QA 5F0GA 2AYTA 1R4WA 2MMOA 5IQYA 1S3CA 4KNDA 3KM6A 2XBQA 2RUFA 10GSA 1B8XA 2G2QA 1BG5A 2CAIA 4L5OA 1V9WA 2JSYA 4ILFA 2O87A 3F3QA 4ISDA 1EV4A 2QGVA 2HLSA 3DGQA 2H66A 1XIYA 3Q6OA 2JADA 4I97A 2NVLA 1RW1A 1GUMA 3US3A 3GKXA 2ZUPA 1AQXA 4BVYA 1YJ6A 2MMZA 2FCHA 3F6DA 2CQ9A 3SBCA 3E0UA 1F37A 3F8UA 1WMJA 4MLYA 4RI6A 4Q5RA 4MPGA 2VOCA 4K2DA 1TK5B 2H73A 3KTLA 2XPEA 19GSA 3FY7A 5DJLA 2YCDA 3GMFA 2IL3A 3HD5A 4GQFA 4I6XA 4ZL9A 2BMXA 3HY2A 2YP6A 2CZ3A 3FRCA 1OKTA 4HQSA 4HS1A 1C72A 1V58A 3L4NA 4N30A 2RM5A 1A2JA 3HYPA 1XWCA 4N0ZA 4IQAA 5ELAA 2GGTA 2WFCA 1JHBA 2CVDA 4TR4A 5HR0A 1FO5A 1AQWA 1M0UA 2R37A 3C7MA 3IA1A 4TN8A 2LRNA 2X99A 3TUEA 4K7NA 5HFKA 2X64A 6GSVA 4XHMA 3A3TA 4Q5NA 2DLXA 2IIYA 2LJKA 3LGCA 2MYGA 1UC7A 3CSIA 1SKSB 2GQMA 3VLNA 4LMVA 3VWVA 1X9MB 4G10A 1K3OA 3LEFA 3EWLA 2HZEB 3H79A 3HZ4A 4YAVA 3IPZA 1USBA 3FR9A 2DIZA 1WPIA 3ZYWA 2FD3A 1GRXA 2V6KA 3GH6A 6GSYA 2R2JA 4K0NA 1XVWA 2CVKA 4K0GA 1EEMA 5CRGA 3QR6A 4MF7A 4ECIA 1PKZA 1XXUA 4KE3A 2QKEA 3TCOA 1JFUA 4ML6A 3CSJA 1SD9A 5H5RA 4MJCA 1TI1A 4JBBA 1CQHA 4MZBA 3AY8A 1YQ1A 1GWCA 3DYRA 3WT1A 3IBHA 2FWGA 1YEPA 5GZZB 3ERWA 2CX3A 2YOIA 4JRRA 3DVXA 3BOAA 2H6ZA 5CAXA 1M7TA 2FWHA 1K0NA 4ZB9A 4J56E 3EE2A 4BVXA 1M9BA 2IMEA 4MJBA 2F8AA 3F4SA 1AXDA 4CW9A 3WD6A 1E6BA 1XWAA 1SJZA 3E3EA 6GSWA 2C4JA 2IMKA 5CYYA 2VCXA 3A5WA 2MMNA 4HEA2 3GRXA 4OFMA 4PXOA 4PGTA 1GUHA 1FVKA 2RM6A 3LXTA 4TRXA 5IPGA 1YKAA 3GTUB 2NTOA 3HZ8A 3RAZA 3TB2A 3L9SA 1XOBA 2B5XA 5EL8A 3H8QA 4GQCA 2GSRA 2OBKA 2FA4A 2JACA 2VL2C 2VLVA 4NXIA 4LL1B 6GSSA 4NAXA 2D2ZA 3D0ZA 4JE1A 2WCIA 2H70A 3TRQA 1GTUA 2JZRA 4ML1A 1GSEA 2EIOA 1IYHA 5ECKB 4FO5A 2V41A 4G19A 4I2TA 1V2AA 1WRYA 2L57A 3D21A 4LA1A 2OBIA 4TXOA 5G1KA 4IJIA 1X0RA 4KA0A 3L9VA 3KMOA 4AGSA 2PUKC 1URMA 2A4VA 2YN1A 4L8EA 3CYNA 1TJDA 4MDCA 3RHCA 1W89A 5HR2A 3VPTA 2M80A 3QMXA 3F3RA 4WF4A 1GTIA 1NHOA 5G31A 3F6FA 3GKNA 3DVWA 5IPHA 3TRPA 2GQKA 4MABA 1FAAA 2OACA 1GSYA 3G7YA 4ZBDA 5LCZA 1MDJA 1Z7RA 5F06A 2H72A 2H1DA 2H76A 1YEXA 4Q5FA 1S3AA 3TKQA 2O7KA 5B8BA 1EGOA 3UVHA 4RQXA 1T1VA 1GSSA 2LNTA 2I3YA 2DJ3A 5ID2B 4O5RA 1TTZA 4EC0A 1QUWA 5DALB 3P90A 1GLQA 5JWQB 1GLPA 2EC4A 2KP1A 3ZVJA 3W8SA 2K8VA 3KP9A 1VF1A 2OE1A 4KDUA 2H1GA 5HR1A 3TDGA 4PNFA 2YJHA 3WGEA 1DBYA 2WDUA 2A2SA 4XS6A 2FA8A 2AHEA 5AIVA 4IVFA 2H1AA 4KGIA 4IGJA 3HVXA 2OKAA 2HRFA 4GSSA 3CRUA 3FZ4A 4WR4A 1TXXA 2HI7A 1J0FA 3KTBA 1O8WA 4XS4B 3RPNA 1KTEA 4GWRA 1OVNA 2H0IA 1UN2A 3LYKA 3HJOA 3FK8A 3VURA 4P3YB 4KSMA 4WETA 18GSA 1F9MA 3GL5A 1KNGA 5GAND 5IMVA 3J7Yb 2HFDA 1FW1A 3GIXA 2B5EA 3QFBC 2LRCA 2GSTA 20GSA 5B8AA 1U6TA 2FGXA 3KJYA 4TOPA 3L0HA 3CMIA 1JLVA 1LJRA 1OKDA 2B1LA 1K0CA 1KEBA 5B7CA 2HZFA 2B6MA 5DJMA 3KH9A 3I6AA 1K0DA 3EMPA 2C8UA 4KX4A 2GZZA 4ID0A 1Z6MA 2E2GA 5J5NA 2YPMA 2HNLA 1J08A 2JL4A 6GSXA 4WBJA 9GSSA 5IMFA 4HI7A 2KUCA 3UMAA 2X8GA 4TVEA 5JCGA 2PMTA 5DCGA 2OE3A 5ECOB 5ENUA 1XWGA 2LV3A 4HZ4A 4DSSA 1TU8A 1ZYQB 1R26A 4MA9A 3UL3A 1M2DA 2P5RA 2DJ2A 1A23A 5KN3A 2EIQA 1VRSD 1Y25A 1HQOA 1B48A 5JCUA 3ZL5A 1A24A 4MF5A 2LJRA 1XZOA 4OO4A 1PKWA 2B7JA 2B3SA 2L6DA 3NIVA 3ZITA 1VGLA 5GSTA 2DJ0A 4JZQA 3GX8A 1O73A 1ZOFA 1PA3A 1YY7A 1YKCA 1B4QA 2KP2A 1CQGA 1O7UA 1VF4A 4I2UA 1W4VA 1YF1A 2LSTA 1M2BA 1O85A 1GH2A 1MDIA 3NOFA 4EKZA 5ECQB 3GNJA 2JZTA 4ECCA 4CHSA 1OYJA 3LYPA 3IAS2 1MD3A 3EINA 2BJXA 1TK0B 1A2MA 1PGTA 4YQVA 4OCEA 1YF0A 1PN9A 1R5AA 2GZPA 4O32A 3HDCA 4J2FA 1MDKA 1IYIA 14GSA 3H4KA 3EC3A 4X0XA 2H8LA 3KIJA 3UOMA 1A8LA 5D9XA 2I1UA 3BCKA 3CXGA 3W8JA 5LNKe 2WZ9A 2VCQA 4MZWA 2XHFA 2IJYA 3FZAA 4EL1A 1WOUA 2L59A 2H71A 3KH7A 4ZXGA 1TRSA 1ERTA 2RUEA 3QCPA 1BJXA 4RUVA 4FYUA 4X1UA 2CX4A 2PVQA 2F8FA 3I69A 1U3IA 2R5GA 1GULA 5ECPB 3MWHA 3LQ7A 1O8XA 5KEJA 2YZUA 5EPFA 2WRTA 4OMVA 3EURA 4QQ7A 1ZZYA 1Z3EA 2HT9A 4ZBBA 2TRXA 3A2XA 1SK1A 4TR0A 2LJAA 3UVTA 3VWUA 1E2YA 2B5YA 2TRCP 2C3NA 1QK8A 3GYKA 1OAZA 4XTSA 4JU5A 4TR1B 2HZEA 4D73A 3DXBA 5J41A 4IP6A 2GQLA 3VK9A 4IJ3A 1SL1B 2NBSA 2ZNMA 3F4RA 2VCTA 4G9HA 4AF2A 1J9BA 1G7OA 5EVOA 2YNXA 2FWFA 1TP9A 4IQ1A 3ME7A 4MPFA 3U5RE 1I5GA 1NM3A 3I43A 3OR5A 1RK4A 2LUSA 2OE0A 4EF0A 2AAWA 3LJRA 1GSFA 4WR5A 3JCML 3EVIA 4V2NA 1T3BA 4NV2A 2CT6A 5F07A 2A2RA 4TXVA 2H30A 1Z6NA 1DE1A 4K7OA 1JZRA 5G2ZA 1HNBA 4PUFC 5DBQA 3LXZA 3J7Yk 4PQ1A 2WGRA 4MJEA 4L0UA 3MSZA 5ECIB 2IFQB 1X5DA 3RDWA 5L71A 1AUCA 4N11A 1TRVA 4H86A 3PR8A 2YWOA 2DC5A 1T4YA 3L78A 2X8CA 5A4VA 4DVCA 8GSSA 2C1YA 3TGZA 2B7KA 3VPQA 2R6KA 3D6IA 1FOVA 4PNGA 4EXJA 4EDZA 2K8SA 2VCVA 3ZMKA 2DSAA 3O76A 2AV4A 1QFNA 1Y6EA 2HRNA 1HD2A 2YWMA 3EU4A 2IWTA 3GTUA 2MBSA 1EV9A 2V6OA 2VCZA 1EWXA 4OFTA 3VFIA 1ACVA 2OA7A 5IM9A 3UBLA 3UIWA 5ECMB 2K18A 3QDNA 2O89A 6GSUA 4E8HA 3A2WA 5KN1A 3HCZA 5IMCA 1M99A 1EZKA 5EY6A 3ZRDA 2ON5A 3MAKA 1ERVA 4LMWA 3KGKA 3M1GA 3KZQA 2XPDA 4Z7XA 3HXSA 1AC1A 4ZB8A 2IMFA 3TOUA 2ES7A 2E0QA 5DVBA 2GDRA 2FNOA 1VF2A 2X8HA 1FHEA 3QAGA 3DD3A 5C04A 5ECNB 4WXTA 2L5LA 3ZFBA 2ZCTA 4ACSA 2FWEA 5CRWA 1OE8A 2LRTA 2PERA 1YZXA 1XW5A 1Z5YE 2GLRA 1K3LA 1UA5A 4AJ7A 2K6VA 2N5AA 4IS0A 2LKUA 3DWVA 3NZNA 7GSSA 2MMAA 3KP8A 11GSA 2AB6A 2NDOA 3SWLA 3WGXA 2VL3A 6GSTA 1ILOA 3QPMA 1PX7A 2P5QA 1K0AA 1SD8A 4G2EA 4NV5A 1JLWA 1AIUA 5CRHA 5AISA 4AJ8A 4ECJA 4TXOB 2ON7A 4ULXA 1SU9A 2WJUA 3PINA 5D9TA 5FWGA 3GFKA 1AQVA 4KCEA 1X5CA 1M9AA 1X5EA 4I8BA 5DALA 4ZL8A 3RBTA 3HVVA 3FYGA 1T4ZA 1EP8A 3GSSA 4HZ2A 3F9UA 2GSQA 5J4UA 5KN0A 5H5QA 3ZIVA 5ABRA 3I9V2 2YV7A 1GSDA 2JZSA 1SJIA 4K7IA 3U6VA 2F9SA 2O85A 1B9YC 3Q19A 1PL1A 3GKKA 4TKYA 1A8YA 2E7PA 3MDKA 3GX0A 4KSOA 4OCFA 3IV4A 4JEDA 3RPPA 1BAYA 2C80A 2RIIA 4MZCA 3FHKA 1WIKA 1PQNA 3ZMLA 4K6XA 2VAFA 2H75A 1WE0A 3M0FA 4O92A 4KH7A 1FB6A 5AGYA 4MH2A 2HXKA 4LLRA 2EIRA 2YWNA 3LFLA 3LWAA 1NW2A 3FR6A 1F3AA 1XFLA 1B9XC 4V1Ag 1I9DA 4NWYA 4F0CA 2VLUA 4PQIA 3FKFA 1K0BA 4PQHA 2J23A 4F82A 4NHWA 1EGRA 3APQA 3GA4A 4K1FA 3TJJA 2LEGA 1Z9HA 5DAKA 3KMNA 1U3AA 5J9CA 1FG4A 2ALBA 1GSQA 3BBYA 2VLTA 1K0OA 5ECSA 3GSTA 3LG6A 4MH3A 5IO0A 3FW2A 1MD4A 2H1BA 5JCWA 3CRTA 5E59A 3UBKA 3ZTLA 1S3DA 2VO4A 2CA8A 1TOFA 1HNCA 4QL7A 4BL7A 4WKWA 3BJ5A 2CV4A 1ERUA 5GSSA 12GSA 5ECRB 1YDKA 4FH8A 4GXZA 1T7PB 2H0GA 3F0IA 1GNEA 3TKPA 4BPYA 5G30A 2C0GA 2VIMA 1G0TA 1OC3A 5IMAA 3F4TA 3CTFA 1OC9B 3KD0A 3TKSE 3HKRA 2LQQA 4OWYA 3H1NA 2E2MA 5JWRB 2J9HA 3ISOA 1NSWA 1TRUA 4HU9A 1ON4A 1ZL9A 3APOA 4XS1A 1MEKA 1SK2A 1SENA 2YV9A 2IPAA 4ZIJA 4FIWA 4GSTA 2VL2A 1ZMAA 2YWIA 3GL3A 4PX1A 3QOUA 1TK8B 5HFGA 3F63A 4K9ZA 4DSSB 3C1RA 1N2AA 3GN3A 3TRXA 2DJKA 3EYTA 3D5JA 4IW9A 1Q98A 3Q18A 3VWXA 1WP0A 2H01A 3IAM2 1F3BA 5DQSA 5G5FA 1XOAA 4V2LA 3IC4A 1SYXA 3M9KA 4GLTA 3UEMA 1TI3A 1QXHA 2P0GA 4PUAA 4MMMA 3M8NA 2L6CA 5GAPD 1AW9A 4BA7A 2I4AA 2PGTA 4GSNA 2FLSA 1SJ6A 3FZ5A 4F9ZA 2JSZA 2GT6A 5IOXA 1EP7A 2AJQB 2LTKA 2V2GA 5IO2A 4CDOA 2QC7A 3ERFA 4YQMA 1Z7PA 3WYWA 3EU3A 4KW6A 2QSIA 5FT3A 4N0VA 2RLIA 2YANA 3KEBA 2GT5A 2WULA 2MZCA 1GUKA 4ZB6A 2AUVA 2PU9C 5A4WA 5AN1A 5ECLB 3GURA 3Q74A 3APSA 2VL9A 3TKRA 4YH2A 4HUAA 2H6XA 3IOSA 1GTAA 1K0MA 3K8NA 1ML6A 2WB9A 1QQ2A 5ELGA 2DMLA 1BYEA 1XW9A 5FHIA 3KXOA 3IK7A 4HJ2A 2DJJA 2DJ1A 3UAPA 3TKSA 4F2IA 2IN3A 4K8MA 4JR6A 5LD0A 1XVQA 2DBCA 5IOWA 4V2MA 5AIXA 3C73A 3HJMA 2FY6A 4BWQA 3ME8A 2I9HA 2NPBA 3TOTA 2OJLA 4TR1A 3UARA 4NHZA 2LS5A 2VCWA 3WGDA 1DUGA 1PSQA 1EOHA 1PRXA 4MK3A 4I5QA 3TJBA 4X43A 4N10A 3ERGA 2L4QA 3W6GA 1O81A 1SYRA 1TRWA 4KB3A 2G0FA 4WBRD 4Q5QA 1TU7A 3GKMA 4JR4A 1LBKA 4EE0A 3N9JA 1BEDA 1AAZA 5HQPA 4NMUA 4EDYA 2V32A 4ZILA 3G9BA 4D73B 3D4TA 1T8EB 1F6MC 3VI5A 5D9WA 5CREA 1SL0B 4F0BA 1PL2A 2LNSA 1X9WB 3C8EA 1ZGNA 4XRAA 1K3YA 3PH9A 3HVSA 2M46A 3IE3A 2KOKA 4KCAA 1THOA 2O8VB 4HOJA 3G7IA 2IFQA 5INYA 5DDLA 4TW5A 4EO3A 1TKDB 3DIEA 1JZDA 5IIZA 5JWOB 4L5LA 1QMVA 3H93A 3D4MA 1F2EA 4HDEA 3UJ1A 2GSSA 3M3MA 4PURA 2FHEA 2GTUA 5CP1A 2PPTA 1FVJA 5DCHA 4E8EA 3EMXA 1PX6A 4AJ6A 2PVOC 4MJAA 1T00A 3HJPA 4XIHA 1GSUA 5E4WA 1EEJA 4O7HA 3ZFLA 1SL2B 3TJKA 1G7EA 4DEJA 4IP1A 4OO5A 1SKRB 3IHQA 1GNWA 3IRAA 3BCIA 4L0WA 2MBTA 2FUG2 4NPBA 3RHBA 3IXRA 16GSA 3ZLPA 1V57A 4DSRA 4QL9A 4IHUA 1GP1A 3S9FA 5A4UA 2XBIA 3TJGA 3ZREA 2V1MA 1N8JA 5HR3A 1TDIA 2HSYA 2CVBA 1A0RP 2REMA 3MNGA 4KUNA 1G6YA 5B6MA 4MF6A 17GSA 2CZ2A 5C00A 5HFIA 5COHA 2C0EA 4ECBA 1NHYA 3GUSA 5G1LA 2IMDA 5DQYA 5IMZA 2K9FA 3VI7A 4YAPA 4HU7A 4ZBAA 2HE3A 3IK9A 1GTBA 5F05A 3E9JB 3QAWA 1JZOA 4LL4B 4RI7A 5D93A 3LSZA 1PMTA 2IMIA 2H19A 3ZIJA 13GSA 3L9UA 3FZ9A 3DMLA 3QFAC 3D22A 5ECHB 2VD0A 5KN2A 3ZZXA 3QAVA 2PN8A 2VUPA 3HHVA 1ABAA 2F3MA 4J57E 4IELA 4RQRA 4XCSA 3A2VA 4POBA 3CBUA 3G7JA 1U87A 4FYBA 2C0FA 5ID2A 5B6NA 2GZYA 5CNWA 2PWJA 4KAEA 3M9JA 3N5OA 1DSBA 2C3TA 3P2AA 1H4OA 4HQZA 3LORA 5CO3A 5D9VA 1QGVA 1XPVA 4IBPA 2H0HA 5J3RA 1U88A 4V1Ap 3TJFA 2B1KA 2OADA 3CTGA 1BX9A 4YQUA 3P7XA 2VM1A 3P8WA 2L5OA 1A2LA 2DIYA 2Z9SA 1PD21 1ST9A 2VD1A 1B4PA 22GSA 4POMA 4KDXA 5D73A 3O3TA 4GF0A 4BWSA 5G5EA 5CRDA 2F51A 4MP4A 3ED3A 1VF3A 5J9BA 1XBSA 2KLXA 1RQMA 1G6WA 1V40A 3DEXA 3IDVA 3DRNA 4F03A 3TKSC 4WEYA 2R4VA 4XS4A 2I81A 4OD7A 5H5SA 2DMMA 1HYUA 4EUYA 4OFNA 4IN0A 2H6YA 1Q4JA 5IMDA 1XCCA 3ZVJD 4FYCA 4IKHA 1OC8A 1UVZA 1BQ7A 2L4CA 3HA9A 5F8BA 4ZL7A 4GTUA 2LQOA 5D8IA 1EOGA 3QD9A 2N5FA 1ZYEA 2WS2A 3PGTA 2CAQA 1A0FA 1X9SB 2M72A 1JZWA 2HSHA 2KHPA 2HYXA 1R5PA 4POKA 2XC2A 1SK0A 4XRDA 3DKSA 1R7HA 1WJKA 1LU4A 3GH9A 1H75A 2YZHA 4TR3A 4MCUA 1OE7A 1OC9A 4DSQA 3GV1A 3FEUA 5DAKB 1GL8A 5D96A 3V1WA 4POLA
chains in the Genus database with same CATH superfamily
2X4AA 1O6JA 2P31A 1SKWB 3VWWA 1FB0A 3WT2A 2PBJA 2BTOT 1XW6A 3BD2A 2C3QA 2VM2A 3FR3A 2H74A 1M2AA 2JU5A 2C0DA 2TIRA 4HJMA 1ERWA 1XWBA 2GS3A 3C71A 2N5BA 3KCMA 1WWJA 1THXA 1TW9A 1MTCA 4GRFA 5A5KA 4EVMA 1DE2A 4GCIA 2YJ7A 1HNAA 1V98A 1ZCPA 3IR4A 3CSHA 2A2PA 3C1SA 4KDYA 3GHAA 1XWKA 3O6TA 2GVPA 4WF5A 1KBNA 2R3XA 3R2QA 5F0GA 2AYTA 1R4WA 2MMOA 5IQYA 1S3CA 4KNDA 3KM6A 2XBQA 2RUFA 10GSA 1B8XA 2G2QA 1BG5A 2CAIA 4L5OA 1V9WA 2JSYA 4ILFA 2O87A 3F3QA 4ISDA 1EV4A 2QGVA 2HLSA 3DGQA 2H66A 1XIYA 3Q6OA 2JADA 4I97A 2NVLA 1RW1A 1GUMA 3US3A 3GKXA 2ZUPA 1AQXA 4BVYA 1YJ6A 2MMZA 1PN0A 2FCHA 3F6DA 2CQ9A 3SBCA 4YKFA 3E0UA 1F37A 3F8UA 1WMJA 4MLYA 4RI6A 4Q5RA 4MPGA 2VOCA 4K2DA 1TK5B 2H73A 3KTLA 2XPEA 19GSA 3FY7A 5DJLA 2YCDA 3GMFA 2IL3A 3HD5A 4GQFA 4I6XA 4ZL9A 2BMXA 3HY2A 2YP6A 2CZ3A 3FRCA 1OKTA 4HQSA 4HS1A 1C72A 1V58A 3L4NA 4N30A 2RM5A 1A2JA 3HYPA 1XWCA 4N0ZA 4IQAA 5ELAA 2GGTA 2WFCA 1JHBA 2CVDA 4TR4A 5HR0A 1FO5A 1AQWA 1M0UA 2R37A 3C7MA 3IA1A 4TN8A 2LRNA 2X99A 3TUEA 4K7NA 5HFKA 2X64A 6GSVA 4XHMA 3A3TA 4Q5NA 2DLXA 2IIYA 2LJKA 3LGCA 2MYGA 1UC7A 3CSIA 1SKSB 2GQMA 3VLNA 4LMVA 3VWVA 1X9MB 4G10A 1K3OA 3LEFA 3EWLA 2HZEB 3H79A 3HZ4A 4YAVA 3IPZA 1USBA 3FR9A 2DIZA 1WPIA 3ZYWA 2FD3A 1GRXA 2V6KA 3GH6A 6GSYA 2R2JA 4K0NA 1XVWA 2CVKA 4K0GA 1EEMA 5CRGA 3QR6A 4MF7A 2HSMA 4ECIA 1PKZA 1XXUA 4KE3A 2QKEA 3TCOA 1JFUA 4ML6A 3CSJA 1SD9A 5H5RA 4MJCA 1TI1A 4JBBA 1CQHA 4MZBA 3AY8A 1YQ1A 1GWCA 3DYRA 3WT1A 3IBHA 2FWGA 1YEPA 5GZZB 3ERWA 4EIPA 2CX3A 2YOIA 4JRRA 3DVXA 3BOAA 2H6ZA 5CAXA 1M7TA 2FWHA 1K0NA 4ZB9A 4J56E 3EE2A 4BVXA 1M9BA 2IMEA 4MJBA 3MIXA 2F8AA 3F4SA 2UZ8A 1AXDA 4CW9A 3WD6A 1E6BA 1XWAA 5BRTA 1SJZA 3E3EA 6GSWA 2C4JA 2IMKA 5CYYA 2VCXA 3A5WA 2MMNA 4HEA2 3GRXA 4OFMA 4PXOA 4PGTA 1GUHA 1FVKA 2RM6A 3LXTA 4TRXA 5IPGA 1YKAA 3GTUB 2NTOA 4K5SA 3HZ8A 3RAZA 3TB2A 1M3IA 3L9SA 1XOBA 2B5XA 5EL8A 3H8QA 4GQCA 2GSRA 2OBKA 2FA4A 2JACA 2VL2C 2VLVA 4NXIA 4LL1B 6GSSA 4NAXA 2D2ZA 3D0ZA 4Z2TA 4JE1A 2WCIA 2H70A 3TRQA 1GTUA 2JZRA 4ML1A 1GSEA 2EIOA 1IYHA 2QA2A 5ECKB 4FO5A 2V41A 4G19A 4I2TA 1V2AA 4O5UA 4USSA 1WRYA 2L57A 3D21A 4LA1A 2OBIA 4TXOA 5G1KA 4IJIA 1X0RA 4KA0A 3L9VA 3KMOA 4AGSA 2PUKC 1URMA 2A4VA 2YN1A 4L8EA 3CYNA 1TJDA 4CY8A 4MDCA 3RHCA 1W89A 4MNNA 5HR2A 3VPTA 2M80A 3QMXA 3F3RA 4WF4A 1GTIA 1NHOA 5G31A 3F6FA 3GKNA 3DVWA 5IPHA 3TRPA 2GQKA 4MABA 1FAAA 2OACA 1GSYA 3G7YA 4ZBDA 5LCZA 1MDJA 1Z7RA 5F06A 2H72A 2H1DA 5KOXA 2H76A 1YEXA 4Q5FA 1S3AA 3TKQA 2O7KA 5B8BA 1EGOA 3UVHA 4RQXA 1T1VA 1GSSA 2LNTA 2I3YA 2DJ3A 5ID2B 4O5RA 5KOWA 1TTZA 2R0PA 4EC0A 1QUWA 5DALB 3P90A 1GLQA 5JWQB 1GLPA 2EC4A 2KP1A 3ZVJA 3W8SA 2K8VA 3KP9A 1VF1A 2OE1A 3R3EA 4KDUA 2H1GA 5HR1A 3TDGA 4PNFA 2YJHA 3WGEA 1DBYA 2WDUA 2A2SA 4XS6A 2FA8A 2AHEA 5AIVA 4IVFA 2H1AA 4KGIA 4IGJA 3HVXA 2OKAA 2HRFA 4GSSA 3CRUA 3CQFA 3FZ4A 4WR4A 1TXXA 2HI7A 1J0FA 3KTBA 1O8WA 4XS4B 3RPNA 1KTEA 4GWRA 1OVNA 2H0IA 1UN2A 3LYKA 3HJOA 3FK8A 2R0CA 3VURA 4P3YB 4KSMA 4WETA 18GSA 1F9MA 3GL5A 1KNGA 5GAND 5IMVA 3J7Yb 2HFDA 1FW1A 3GIXA 2B5EA 3QFBC 2LRCA 2GSTA 20GSA 5B8AA 1U6TA 1ZYPA 2FGXA 3KJYA 4TOPA 3L0HA 3CMIA 1JLVA 1LJRA 1OKDA 2B1LA 1K0CA 1KEBA 5B7CA 2HZFA 2B6MA 5DJMA 3KH9A 3I6AA 1K0DA 3EMPA 2C8UA 4KX4A 2GZZA 4ID0A 2QA1A 1Z6MA 2E2GA 5J5NA 2YPMA 2HNLA 1J08A 2JL4A 6GSXA 4WBJA 9GSSA 5IMFA 4HI7A 2KUCA 3UMAA 2X8GA 4BL7B 4TVEA 5JCGA 2PMTA 5DCGA 2OE3A 5ECOB 5ENUA 1XWGA 2LV3A 4HZ4A 4DSSA 1TU8A 1ZYQB 1R26A 4MA9A 3UL3A 1M2DA 2P5RA 2DJ2A 1A23A 5KN3A 2EIQA 1VRSD 1Y25A 1HQOA 1B48A 5JCUA 3ZL5A 1A24A 4MF5A 2LJRA 1XZOA 4OO4A 1PKWA 2B7JA 2B3SA 2L6DA 3NIVA 2DKHA 3ZITA 1VGLA 5GSTA 2DJ0A 4JZQA 3GX8A 1O73A 1ZOFA 1PA3A 1YY7A 1YKCA 1B4QA 2KP2A 1CQGA 1O7UA 1VF4A 4I2UA 1W4VA 1YF1A 2LSTA 1M2BA 1O85A 1GH2A 1MDIA 3NOFA 4EKZA 4ICYA 5ECQB 3GNJA 2JZTA 4ECCA 4CHSA 1OYJA 3LYPA 3IAS2 1MD3A 3EINA 2BJXA 1TK0B 1A2MA 1PGTA 4YQVA 4OCEA 1YF0A 1PN9A 1R5AA 2GZPA 4O32A 3HDCA 4J2FA 1MDKA 1IYIA 14GSA 3H4KA 3EC3A 4X0XA 2H8LA 3KIJA 3UOMA 1A8LA 5D9XA 2I1UA 3BCKA 3CXGA 4Z2RA 3W8JA 5LNKe 2WZ9A 2VCQA 4MZWA 2XHFA 2IJYA 3FZAA 4EL1A 1WOUA 2L59A 2H71A 3KH7A 4ZXGA 1TRSA 1ERTA 2RUEA 3QCPA 1BJXA 4RUVA 4FYUA 4CY6A 4X1UA 4BVYB 2CX4A 2PVQA 2F8FA 3I69A 1U3IA 2R5GA 1GULA 5ECPB 3MWHA 3LQ7A 1O8XA 5KEJA 2YZUA 5EPFA 2WRTA 4OMVA 3EURA 3MYDA 4QQ7A 1ZZYA 1Z3EA 2HT9A 4ZBBA 2TRXA 3A2XA 1SK1A 4TR0A 2LJAA 3UVTA 3VWUA 1E2YA 2B5YA 4X4JA 2TRCP 2C3NA 1QK8A 3GYKA 1OAZA 4XTSA 4JU5A 4TR1B 2HZEA 3EPTA 4D73A 3DXBA 5J41A 4IP6A 2GQLA 3VK9A 4IJ3A 1SL1B 2NBSA 4G0IA 2ZNMA 3F4RA 2VCTA 4G9HA 4AF2A 1J9BA 1G7OA 5EVOA 2YNXA 2FWFA 1TP9A 4IQ1A 3ME7A 4MPFA 3U5RE 1I5GA 1NM3A 3I43A 3OR5A 1RK4A 2LUSA 2OE0A 4EF0A 2AAWA 3LJRA 1GSFA 4WR5A 3JCML 3EVIA 4V2NA 1T3BA 4NV2A 2CT6A 5F07A 2A2RA 4TXVA 2H30A 1Z6NA 1DE1A 4K7OA 1JZRA 5G2ZA 1HNBA 4PUFC 5DBQA 3LXZA 3J7Yk 4PQ1A 2WGRA 4MJEA 4L0UA 3MSZA 5ECIB 2IFQB 4K2XA 2HRAA 1X5DA 3RDWA 5L71A 1AUCA 4N11A 1TRVA 4H86A 3PR8A 2YWOA 2DC5A 1T4YA 3L78A 2X8CA 5A4VA 4DVCA 8GSSA 2C1YA 3TGZA 2B7KA 4K5RA 3VPQA 2R6KA 3D6IA 1FOVA 4PNGA 4EXJA 4EDZA 2K8SA 2VCVA 3ZMKA 2DSAA 3O76A 2AV4A 1QFNA 1Y6EA 2HRNA 1HD2A 2YWMA 3EU4A 2IWTA 3GTUA 2MBSA 1EV9A 2V6OA 2VCZA 1EWXA 4BVXB 4OFTA 3VFIA 1ACVA 2OA7A 5IM9A 3UBLA 3UIWA 5ECMB 2K18A 3QDNA 2O89A 6GSUA 4E8HA 3A2WA 5KN1A 3HCZA 1M3JA 5IMCA 1M99A 1EZKA 5EY6A 3ZRDA 2ON5A 3MAKA 1ERVA 4LMWA 3KGKA 3M1GA 3KZQA 2XPDA 4Z7XA 3HXSA 1AC1A 4ZB8A 2IMFA 3TOUA 2ES7A 2E0QA 5DVBA 2GDRA 2FNOA 1VF2A 2X8HA 1FHEA 3QAGA 3DD3A 5C04A 5ECNB 4WXTA 2L5LA 3ZFBA 4A5PA 2ZCTA 4ACSA 2FWEA 5CRWA 1OE8A 2LRTA 2PERA 1YZXA 1XW5A 1Z5YE 2GLRA 1K3LA 1UA5A 4AJ7A 2K6VA 2N5AA 4IS0A 2LKUA 3DWVA 3NZNA 7GSSA 2MMAA 3KP8A 11GSA 2AB6A 2NDOA 3SWLA 3WGXA 2VL3A 6GSTA 1ILOA 3QPMA 1PX7A 2P5QA 1K0AA 1SD8A 4G2EA 4NV5A 1JLWA 1AIUA 5CRHA 5AISA 4AJ8A 4ECJA 4TXOB 2ON7A 4ULXA 1SU9A 2WJUA 3PINA 5D9TA 5FWGA 3GFKA 1AQVA 4KCEA 1X5CA 1M9AA 1X5EA 4I8BA 5DALA 4ZL8A 3RBTA 3HVVA 3FYGA 1T4ZA 1EP8A 4FQUA 3GSSA 4HZ2A 3F9UA 2GSQA 5J4UA 5KN0A 5H5QA 3ZIVA 4G0KA 5ABRA 2X49A 3I9V2 2YV7A 1GSDA 2JZSA 1SJIA 4K7IA 3U6VA 2F9SA 2O85A 1B9YC 3Q19A 1PL1A 3GKKA 4TKYA 1A8YA 2E7PA 3MDKA 3GX0A 4KSOA 4OCFA 3IV4A 4JEDA 3RPPA 1BAYA 2C80A 2RIIA 4MZCA 3FHKA 1WIKA 1PQNA 3ZMLA 4K6XA 2VAFA 2H75A 1WE0A 3M0FA 4O92A 4KH7A 1FB6A 5AGYA 4MH2A 2HXKA 4LLRA 2EIRA 2YWNA 3LFLA 3LWAA 1NW2A 3FR6A 1F3AA 1XFLA 1B9XC 4V1Ag 1I9DA 4NWYA 4F0CA 2VLUA 4PQIA 3FKFA 1K0BA 4PQHA 2J23A 4F82A 4NHWA 1EGRA 2R0GA 3APQA 3GA4A 4K1FA 3TJJA 2LEGA 1Z9HA 5DAKA 3KMNA 1U3AA 5J9CA 1FG4A 2ALBA 1GSQA 3BBYA 2VLTA 1K0OA 5ECSA 3GSTA 3LG6A 4MH3A 5IO0A 3FW2A 1MD4A 2H1BA 5JCWA 3CRTA 5E59A 3UBKA 3ZTLA 1S3DA 2VO4A 2CA8A 1TOFA 1HNCA 4QL7A 4BL7A 4WKWA 3BJ5A 2CV4A 1ERUA 5GSSA 12GSA 5ECRB 1YDKA 4FH8A 4GXZA 1T7PB 2H0GA 3F0IA 1GNEA 3TKPA 4BPYA 5G30A 2C0GA 2VIMA 1G0TA 1OC3A 5IMAA 3F4TA 3CTFA 3KD0A 1OC9B 3A5IA 3TKSE 3HKRA 2LQQA 4OWYA 1FOHA 3H1NA 5BMUA 2E2MA 5JWRB 2J9HA 3ISOA 1NSWA 1TRUA 4HU9A 1ON4A 1ZL9A 3APOA 4XS1A 1MEKA 1SK2A 1SENA 2YV9A 2IPAA 4ZIJA 4FIWA 4GSTA 2VL2A 1ZMAA 2YWIA 3GL3A 4PX1A 3QOUA 1TK8B 5HFGA 3F63A 4K9ZA 4DSSB 3C1RA 1N2AA 3GN3A 3TRXA 2DJKA 3EYTA 3D5JA 4IW9A 1Q98A 3Q18A 3VWXA 1WP0A 2H01A 3IAM2 1F3BA 5DQSA 5G5FA 1XOAA 4V2LA 3IC4A 1SYXA 3M9KA 4GLTA 3UEMA 1TI3A 4EIQA 1QXHA 2P0GA 4PUAA 4MMMA 3M8NA 2L6CA 5GAPD 1AW9A 4BA7A 2I4AA 2PGTA 4GSNA 2FLSA 1SJ6A 3FZ5A 4F9ZA 2JSZA 2GT6A 5IOXA 1EP7A 2AJQB 2LTKA 2V2GA 5IO2A 4CDOA 2QC7A 3ERFA 4YQMA 1Z7PA 3WYWA 3EU3A 4KW6A 2QSIA 5FT3A 4N0VA 2RLIA 2YANA 3KEBA 2GT5A 2WULA 2MZCA 1GUKA 4ZB6A 2AUVA 2PU9C 5A4WA 5AN1A 5ECLB 3GURA 3Q74A 3APSA 2VL9A 3TKRA 4YH2A 4HUAA 2H6XA 3IOSA 1GTAA 1K0MA 3K8NA 1ML6A 2WB9A 1QQ2A 5ELGA 2DMLA 1BYEA 1XW9A 5FHIA 3KXOA 3IK7A 4G0LA 4HJ2A 2DJJA 2DJ1A 3UAPA 3TKSA 4F2IA 2IN3A 4K8MA 4JR6A 5LD0A 1XVQA 2DBCA 5IOWA 4V2MA 5AIXA 3C73A 3HJMA 2FY6A 4BWQA 3ME8A 2I9HA 2NPBA 3TOTA 2OJLA 4TR1A 3UARA 4NHZA 1PFOA 2HRKA 2LS5A 2VCWA 3WGDA 1DUGA 1PSQA 1EOHA 1PRXA 4MK3A 4I5QA 3TJBA 4X43A 4N10A 3ERGA 2L4QA 3W6GA 1O81A 1SYRA 1TRWA 4KB3A 2G0FA 4WBRD 4Q5QA 1TU7A 3GKMA 4JR4A 1LBKA 4EE0A 3N9JA 1BEDA 1AAZA 5HQPA 4NMUA 4EDYA 2V32A 4ZILA 3G9BA 4D73B 3D4TA 1T8EB 1F6MC 3VI5A 3IC8A 5D9WA 5CREA 1SL0B 4F0BA 1PL2A 2LNSA 1X9WB 3C8EA 1ZGNA 4XRAA 1K3YA 3PH9A 3HVSA 2M46A 3IE3A 2KOKA 4KCAA 1THOA 2O8VB 4HOJA 3G7IA 2IFQA 5INYA 5DDLA 4TW5A 4EO3A 1TKDB 3DIEA 1JZDA 5IIZA 5JWOB 4L5LA 1QMVA 3H93A 3D4MA 1F2EA 4HDEA 3UJ1A 2GSSA 3HVNA 3M3MA 4PURA 2FHEA 2GTUA 5CP1A 2PPTA 1FVJA 5DCHA 3LW9A 4E8EA 3EMXA 1PX6A 4AJ6A 2PVOC 4MJAA 1T00A 3HJPA 4XIHA 1GSUA 5E4WA 1EEJA 4O7HA 3ZFLA 1SL2B 3TJKA 1G7EA 4DEJA 4IP1A 4OO5A 1SKRB 3IHQA 1GNWA 1ZYNA 3IRAA 3PPUA 3BCIA 4L0WA 2MBTA 2FUG2 4NPBA 3RHBA 3IXRA 16GSA 3ZLPA 1V57A 4DSRA 4BIKA 4QL9A 4IHUA 1GP1A 3S9FA 5A4UA 2XBIA 3TJGA 3ZREA 2V1MA 1N8JA 5HR3A 1TDIA 2HSYA 2CVBA 1A0RP 2REMA 3MNGA 4KUNA 1G6YA 5B6MA 4MF6A 17GSA 2CZ2A 5C00A 5HFIA 5COHA 1XG8A 2C0EA 4ECBA 1NHYA 3GUSA 5G1LA 2IMDA 5DQYA 5IMZA 2K9FA 3VI7A 4YAPA 4HU7A 4ZBAA 2HE3A 3IK9A 1GTBA 5F05A 3E9JB 3QAWA 1JZOA 4LL4B 4RI7A 5D93A 3LSZA 1PMTA 2IMIA 2H19A 3ZIJA 13GSA 3L9UA 3FZ9A 3DMLA 3QFAC 3D22A 5ECHB 2VD0A 5KN2A 3ZZXA 3QAVA 2PN8A 2VUPA 3HHVA 1ABAA 2F3MA 1S3RA 4J57E 4PTSA 4IELA 4RQRA 4XCSA 3A2VA 4POBA 3CBUA 3G7JA 1U87A 4O5QA 4FYBA 2C0FA 5ID2A 5B6NA 2GZYA 5CNWA 2PWJA 4KAEA 3M9JA 3N5OA 1DSBA 2C3TA 3P2AA 1H4OA 4HQZA 3LORA 5CO3A 5D9VA 1QGVA 1XPVA 4IBPA 2H0HA 5J3RA 1U88A 4V1Ap 3TJFA 2DKIA 2B1KA 2OADA 3CTGA 1BX9A 4KF9A 3P7XA 4YQUA 2VM1A 3P8WA 2L5OA 1A2LA 2DIYA 2Z9SA 1PD21 1ST9A 2VD1A 1B4PA 22GSA 4POMA 4KDXA 5D73A 3IHGA 3O3TA 4GF0A 4BWSA 5G5EA 5CRDA 2F51A 4MP4A 3ED3A 1VF3A 3FMWA 5J9BA 1XBSA 2KLXA 1RQMA 1G6WA 1V40A 3DEXA 3IDVA 3DRNA 4F03A 3TKSC 4WEYA 2R4VA 4XS4A 2I81A 4OD7A 5H5SA 2DMMA 1HYUA 4EUYA 4Z2UA 4OFNA 4IN0A 2H6YA 1Q4JA 5IMDA 1XCCA 3ZVJD 4FYCA 4IKHA 1OC8A 1UVZA 1BQ7A 2L4CA 3HA9A 5F8BA 4ZL7A 4GTUA 2LQOA 5D8IA 1EOGA 3QD9A 2N5FA 1ZYEA 2WS2A 3PGTA 2CAQA 1A0FA 1X9SB 2M72A 1JZWA 4YKGA 2HSHA 2KHPA 2HYXA 1R5PA 4POKA 2XC2A 1SK0A 4XRDA 3DKSA 4HSCX 1R7HA 1WJKA 1LU4A 3GH9A 1H75A 2YZHA 4TR3A 2A4HA 4MCUA 1OE7A 1OC9A 4DSQA 3GV1A 3FEUA 5DAKB 1GL8A 5D96A 3V1WA 4POLA
chains in the Genus database with same CATH topology
2X4AA 1O6JA 2P31A 1SKWB 3VWWA 1FB0A 3WT2A 2PBJA 2BTOT 1XW6A 3BD2A 2C3QA 2VM2A 3FR3A 2H74A 1M2AA 2JU5A 2C0DA 2TIRA 4HJMA 1ERWA 1XWBA 2GS3A 3C71A 2N5BA 3KCMA 1WWJA 1THXA 1TW9A 1MTCA 4GRFA 5A5KA 4EVMA 1DE2A 4GCIA 2YJ7A 1HNAA 1V98A 1ZCPA 3IR4A 3CSHA 2A2PA 3C1SA 4KDYA 3GHAA 1XWKA 3O6TA 2GVPA 4WF5A 1KBNA 2R3XA 3R2QA 5F0GA 2AYTA 1R4WA 2MMOA 5IQYA 1S3CA 4KNDA 3KM6A 2XBQA 2RUFA 10GSA 1B8XA 2G2QA 1BG5A 2CAIA 4L5OA 1V9WA 2JSYA 4ILFA 2O87A 3F3QA 4ISDA 1EV4A 2QGVA 2HLSA 3DGQA 2H66A 1XIYA 3Q6OA 2JADA 4I97A 2NVLA 1RW1A 1GUMA 3US3A 3GKXA 2ZUPA 1AQXA 4BVYA 1YJ6A 2MMZA 1PN0A 2FCHA 3F6DA 2CQ9A 3SBCA 4YKFA 3E0UA 1F37A 3F8UA 1WMJA 4MLYA 4RI6A 4Q5RA 4MPGA 2VOCA 4K2DA 1TK5B 2H73A 3KTLA 2XPEA 19GSA 3FY7A 5DJLA 2YCDA 3GMFA 2IL3A 3HD5A 4GQFA 4I6XA 4ZL9A 2BMXA 3HY2A 2YP6A 2CZ3A 3FRCA 1OKTA 4HQSA 4HS1A 1C72A 1V58A 3L4NA 4N30A 2RM5A 1A2JA 3HYPA 1XWCA 4N0ZA 4IQAA 5ELAA 2GGTA 2WFCA 1JHBA 2CVDA 4TR4A 5HR0A 1FO5A 1AQWA 1M0UA 2R37A 3C7MA 3IA1A 4TN8A 2LRNA 2X99A 3TUEA 4K7NA 5HFKA 2X64A 6GSVA 4XHMA 3A3TA 4Q5NA 2DLXA 2IIYA 2LJKA 3LGCA 2MYGA 1UC7A 3CSIA 1SKSB 2GQMA 3VLNA 4LMVA 3VWVA 1X9MB 4G10A 1K3OA 3LEFA 3EWLA 2HZEB 3H79A 3HZ4A 4YAVA 3IPZA 1USBA 3FR9A 2DIZA 1WPIA 3ZYWA 2FD3A 1GRXA 2V6KA 3GH6A 6GSYA 2R2JA 4K0NA 1XVWA 2CVKA 4K0GA 1EEMA 5CRGA 3QR6A 4MF7A 2HSMA 4ECIA 1PKZA 1XXUA 4KE3A 2QKEA 3TCOA 1JFUA 4ML6A 3CSJA 1SD9A 5H5RA 4MJCA 1TI1A 4JBBA 1CQHA 4MZBA 3AY8A 1YQ1A 1GWCA 3DYRA 3WT1A 3IBHA 2FWGA 1YEPA 5GZZB 3ERWA 4EIPA 2CX3A 2YOIA 4JRRA 3DVXA 3BOAA 2H6ZA 5CAXA 1M7TA 2FWHA 1K0NA 4ZB9A 4J56E 3EE2A 4BVXA 1M9BA 2IMEA 4MJBA 3MIXA 2F8AA 3F4SA 2UZ8A 1AXDA 4CW9A 3WD6A 1E6BA 1XWAA 5BRTA 1SJZA 3E3EA 6GSWA 2C4JA 2IMKA 5CYYA 2VCXA 3A5WA 2MMNA 4HEA2 3GRXA 4OFMA 4PXOA 4PGTA 1GUHA 1FVKA 2RM6A 3LXTA 4TRXA 5IPGA 1YKAA 3GTUB 2NTOA 4K5SA 3HZ8A 3RAZA 3TB2A 3L9SA 1XOBA 2B5XA 5EL8A 3H8QA 4GQCA 2GSRA 2OBKA 2FA4A 2JACA 2VL2C 2VLVA 4NXIA 4LL1B 6GSSA 4NAXA 2D2ZA 3D0ZA 4Z2TA 4JE1A 2WCIA 2H70A 3TRQA 1GTUA 2JZRA 4ML1A 1GSEA 2EIOA 1IYHA 2QA2A 5ECKB 4FO5A 2V41A 4G19A 4I2TA 1V2AA 4O5UA 4USSA 1WRYA 2L57A 3D21A 4LA1A 2OBIA 4TXOA 5G1KA 4IJIA 1X0RA 4KA0A 3L9VA 3KMOA 4AGSA 2PUKC 1URMA 2A4VA 2YN1A 4L8EA 3CYNA 1TJDA 4CY8A 4MDCA 3RHCA 1W89A 4MNNA 5HR2A 3VPTA 2M80A 3QMXA 3F3RA 4WF4A 1GTIA 1NHOA 5G31A 3F6FA 3GKNA 3DVWA 5IPHA 3TRPA 2GQKA 4MABA 1FAAA 2OACA 1GSYA 3G7YA 4ZBDA 5LCZA 1MDJA 1Z7RA 5F06A 2H72A 2H1DA 5KOXA 2H76A 1YEXA 4Q5FA 1S3AA 3TKQA 2O7KA 5B8BA 1EGOA 3UVHA 4RQXA 1T1VA 1GSSA 2LNTA 2I3YA 2DJ3A 5ID2B 4O5RA 5KOWA 1TTZA 2R0PA 4EC0A 1QUWA 5DALB 3P90A 1GLQA 5JWQB 1GLPA 2EC4A 2KP1A 3ZVJA 3W8SA 2K8VA 3KP9A 1VF1A 2OE1A 3R3EA 4KDUA 2H1GA 5HR1A 3TDGA 4PNFA 2YJHA 3WGEA 1DBYA 2WDUA 2A2SA 4XS6A 2FA8A 2AHEA 5AIVA 4IVFA 2H1AA 4KGIA 4IGJA 3HVXA 2OKAA 2HRFA 4GSSA 3CRUA 3FZ4A 4WR4A 1TXXA 2HI7A 1J0FA 3KTBA 1O8WA 4XS4B 3RPNA 1KTEA 4GWRA 1OVNA 2H0IA 1UN2A 3LYKA 3HJOA 3FK8A 2R0CA 3VURA 4P3YB 4KSMA 4WETA 18GSA 1F9MA 3GL5A 1KNGA 5GAND 5IMVA 3J7Yb 2HFDA 1FW1A 3GIXA 2B5EA 3QFBC 2LRCA 2GSTA 20GSA 5B8AA 1U6TA 1ZYPA 2FGXA 3KJYA 4TOPA 3L0HA 3CMIA 1JLVA 1LJRA 1OKDA 2B1LA 1K0CA 1KEBA 5B7CA 2HZFA 2B6MA 5DJMA 3KH9A 3I6AA 1K0DA 3EMPA 2C8UA 4KX4A 2GZZA 4ID0A 2QA1A 1Z6MA 2E2GA 5J5NA 2YPMA 2HNLA 1J08A 2JL4A 6GSXA 4WBJA 9GSSA 5IMFA 4HI7A 2KUCA 3UMAA 2X8GA 4BL7B 4TVEA 5JCGA 2PMTA 5DCGA 2OE3A 5ECOB 5ENUA 1XWGA 2LV3A 4HZ4A 4DSSA 1TU8A 1ZYQB 1R26A 4MA9A 3UL3A 1M2DA 2P5RA 2DJ2A 1A23A 5KN3A 2EIQA 1VRSD 1Y25A 1HQOA 1B48A 5JCUA 3ZL5A 1A24A 4MF5A 2LJRA 1XZOA 4OO4A 1PKWA 2B7JA 2B3SA 2L6DA 3NIVA 2DKHA 3ZITA 1VGLA 5GSTA 2DJ0A 4JZQA 3GX8A 1O73A 1ZOFA 1PA3A 1YY7A 1YKCA 1B4QA 2KP2A 1CQGA 1O7UA 1VF4A 4I2UA 1W4VA 1YF1A 2LSTA 1M2BA 1O85A 1GH2A 1MDIA 3NOFA 4EKZA 4ICYA 5ECQB 3GNJA 2JZTA 4ECCA 4CHSA 1OYJA 3LYPA 3IAS2 1MD3A 3EINA 2BJXA 1TK0B 1A2MA 1PGTA 4YQVA 4OCEA 1YF0A 1PN9A 1R5AA 2GZPA 4O32A 3HDCA 4J2FA 1MDKA 1IYIA 14GSA 3H4KA 3EC3A 4X0XA 2H8LA 3KIJA 3UOMA 1A8LA 5D9XA 2I1UA 3BCKA 3CXGA 4Z2RA 3W8JA 5LNKe 2WZ9A 2VCQA 4MZWA 2XHFA 2IJYA 3FZAA 4EL1A 1WOUA 2L59A 2H71A 3KH7A 4ZXGA 1TRSA 1ERTA 2RUEA 3QCPA 1BJXA 4RUVA 4FYUA 4CY6A 4X1UA 4BVYB 2CX4A 2PVQA 2F8FA 3I69A 1U3IA 2R5GA 1GULA 5ECPB 3MWHA 3LQ7A 1O8XA 5KEJA 2YZUA 5EPFA 2WRTA 4OMVA 3EURA 3MYDA 4QQ7A 1ZZYA 1Z3EA 2HT9A 4ZBBA 2TRXA 3A2XA 1SK1A 4TR0A 2LJAA 3UVTA 3VWUA 1E2YA 2B5YA 4X4JA 2TRCP 2C3NA 1QK8A 3GYKA 1OAZA 4XTSA 4JU5A 4TR1B 2HZEA 3EPTA 4D73A 3DXBA 5J41A 4IP6A 2GQLA 3VK9A 4IJ3A 1SL1B 2NBSA 4G0IA 2ZNMA 3F4RA 2VCTA 4G9HA 4AF2A 1J9BA 1G7OA 5EVOA 2YNXA 2FWFA 1TP9A 4IQ1A 3ME7A 4MPFA 3U5RE 1I5GA 1NM3A 3I43A 3OR5A 1RK4A 2LUSA 2OE0A 4EF0A 2AAWA 3LJRA 1GSFA 4WR5A 3JCML 3EVIA 4V2NA 1T3BA 4NV2A 2CT6A 5F07A 2A2RA 4TXVA 2H30A 1Z6NA 1DE1A 4K7OA 1JZRA 5G2ZA 1HNBA 4PUFC 5DBQA 3LXZA 3J7Yk 4PQ1A 2WGRA 4MJEA 4L0UA 3MSZA 5ECIB 2IFQB 4K2XA 2HRAA 1X5DA 3RDWA 5L71A 1AUCA 4N11A 1TRVA 4H86A 3PR8A 2YWOA 2DC5A 1T4YA 3L78A 2X8CA 5A4VA 4DVCA 8GSSA 2C1YA 3TGZA 2B7KA 4K5RA 3VPQA 2R6KA 3D6IA 1FOVA 4PNGA 4EXJA 4EDZA 2K8SA 2VCVA 3ZMKA 2DSAA 3O76A 2AV4A 1QFNA 1Y6EA 2HRNA 1HD2A 2YWMA 3EU4A 2IWTA 3GTUA 2MBSA 1EV9A 2V6OA 2VCZA 1EWXA 4BVXB 4OFTA 3VFIA 1ACVA 2OA7A 5IM9A 3UBLA 3UIWA 5ECMB 2K18A 3QDNA 2O89A 6GSUA 4E8HA 3A2WA 5KN1A 3HCZA 5IMCA 1M99A 1EZKA 5EY6A 3ZRDA 2ON5A 3MAKA 1ERVA 4LMWA 3KGKA 3M1GA 3KZQA 2XPDA 4Z7XA 3HXSA 1AC1A 4ZB8A 2IMFA 3TOUA 2ES7A 2E0QA 5DVBA 2GDRA 2FNOA 1VF2A 2X8HA 1FHEA 3QAGA 3DD3A 5C04A 5ECNB 4WXTA 2L5LA 3ZFBA 4A5PA 2ZCTA 4ACSA 2FWEA 5CRWA 1OE8A 2LRTA 2PERA 1YZXA 1XW5A 1Z5YE 2GLRA 1K3LA 1UA5A 4AJ7A 2K6VA 2N5AA 4IS0A 2LKUA 3DWVA 3NZNA 7GSSA 2MMAA 3KP8A 11GSA 2AB6A 2NDOA 3SWLA 3WGXA 2VL3A 6GSTA 1ILOA 3QPMA 1PX7A 2P5QA 1K0AA 1SD8A 4G2EA 4NV5A 1JLWA 1AIUA 5CRHA 5AISA 4AJ8A 4ECJA 4TXOB 2ON7A 4ULXA 1SU9A 2WJUA 3PINA 5D9TA 5FWGA 3GFKA 1AQVA 4KCEA 1X5CA 1M9AA 1X5EA 4I8BA 5DALA 4ZL8A 3RBTA 3HVVA 3FYGA 1T4ZA 1EP8A 4FQUA 3GSSA 4HZ2A 3F9UA 2GSQA 5J4UA 5KN0A 5H5QA 3ZIVA 4G0KA 5ABRA 2X49A 3I9V2 2YV7A 1GSDA 2JZSA 1SJIA 4K7IA 3U6VA 2F9SA 2O85A 1B9YC 3Q19A 1PL1A 3GKKA 4TKYA 1A8YA 2E7PA 3MDKA 3GX0A 4KSOA 4OCFA 3IV4A 4JEDA 3RPPA 1BAYA 2C80A 2RIIA 4MZCA 3FHKA 1WIKA 1PQNA 3ZMLA 4K6XA 2VAFA 2H75A 1WE0A 3M0FA 4O92A 4KH7A 1FB6A 5AGYA 4MH2A 2HXKA 4LLRA 2EIRA 2YWNA 3LFLA 3LWAA 1NW2A 3FR6A 1F3AA 1XFLA 1B9XC 4V1Ag 1I9DA 4NWYA 4F0CA 2VLUA 4PQIA 3FKFA 1K0BA 4PQHA 2J23A 4F82A 4NHWA 1EGRA 2R0GA 3APQA 3GA4A 4K1FA 3TJJA 2LEGA 1Z9HA 5DAKA 3KMNA 1U3AA 5J9CA 1FG4A 2ALBA 1GSQA 3BBYA 2VLTA 1K0OA 5ECSA 3GSTA 3LG6A 4MH3A 5IO0A 3FW2A 1MD4A 2H1BA 5JCWA 3CRTA 5E59A 3UBKA 3ZTLA 1S3DA 2VO4A 2CA8A 1TOFA 1HNCA 4QL7A 4BL7A 4WKWA 3BJ5A 2CV4A 1ERUA 5GSSA 12GSA 5ECRB 1YDKA 4FH8A 4GXZA 1T7PB 2H0GA 3F0IA 1GNEA 3TKPA 4BPYA 5G30A 2C0GA 2VIMA 1G0TA 1OC3A 5IMAA 3F4TA 3CTFA 3KD0A 1OC9B 3A5IA 3TKSE 3HKRA 2LQQA 4OWYA 1FOHA 3H1NA 5BMUA 2E2MA 5JWRB 2J9HA 3ISOA 1NSWA 1TRUA 4HU9A 1ON4A 1ZL9A 3APOA 4XS1A 1MEKA 1SK2A 1SENA 2YV9A 2IPAA 4ZIJA 4FIWA 4GSTA 2VL2A 1ZMAA 2YWIA 3GL3A 4PX1A 3QOUA 1TK8B 5HFGA 3F63A 4K9ZA 4DSSB 3C1RA 1N2AA 3GN3A 3TRXA 2DJKA 3EYTA 3D5JA 4IW9A 1Q98A 3Q18A 3VWXA 1WP0A 2H01A 3IAM2 1F3BA 5DQSA 5G5FA 1XOAA 4V2LA 3IC4A 1SYXA 3M9KA 4GLTA 3UEMA 1TI3A 4EIQA 1QXHA 2P0GA 4PUAA 4MMMA 3M8NA 2L6CA 5GAPD 1AW9A 4BA7A 2I4AA 2PGTA 4GSNA 2FLSA 1SJ6A 3FZ5A 4F9ZA 2JSZA 2GT6A 5IOXA 1EP7A 2AJQB 2LTKA 2V2GA 5IO2A 4CDOA 2QC7A 3ERFA 4YQMA 1Z7PA 3WYWA 3EU3A 4KW6A 2QSIA 5FT3A 4N0VA 2RLIA 2YANA 3KEBA 2GT5A 2WULA 2MZCA 1GUKA 4ZB6A 2AUVA 2PU9C 5A4WA 5AN1A 5ECLB 3GURA 3Q74A 3APSA 2VL9A 3TKRA 4YH2A 4HUAA 2H6XA 3IOSA 1GTAA 1K0MA 3K8NA 1ML6A 2WB9A 1QQ2A 5ELGA 2DMLA 1BYEA 1XW9A 5FHIA 3KXOA 3IK7A 4G0LA 4HJ2A 2DJJA 2DJ1A 3UAPA 3TKSA 4F2IA 2IN3A 4K8MA 4JR6A 5LD0A 1XVQA 2DBCA 5IOWA 4V2MA 5AIXA 3C73A 3HJMA 2FY6A 4BWQA 3ME8A 2I9HA 2NPBA 3TOTA 2OJLA 4TR1A 3UARA 4NHZA 2HRKA 2LS5A 2VCWA 3WGDA 1DUGA 1PSQA 1EOHA 1PRXA 4MK3A 4I5QA 3TJBA 4X43A 4N10A 3ERGA 2L4QA 3W6GA 1O81A 1SYRA 1TRWA 4KB3A 2G0FA 4WBRD 4Q5QA 1TU7A 3GKMA 4JR4A 1LBKA 4EE0A 3N9JA 1BEDA 1AAZA 5HQPA 4NMUA 4EDYA 2V32A 4ZILA 3G9BA 4D73B 3D4TA 1T8EB 1F6MC 3VI5A 3IC8A 5D9WA 5CREA 1SL0B 4F0BA 1PL2A 2LNSA 1X9WB 3C8EA 1ZGNA 4XRAA 1K3YA 3PH9A 3HVSA 2M46A 3IE3A 2KOKA 4KCAA 1THOA 2O8VB 4HOJA 3G7IA 2IFQA 5INYA 5DDLA 4TW5A 4EO3A 1TKDB 3DIEA 1JZDA 5IIZA 5JWOB 4L5LA 1QMVA 3H93A 3D4MA 1F2EA 4HDEA 3UJ1A 2GSSA 3M3MA 4PURA 2FHEA 2GTUA 5CP1A 2PPTA 1FVJA 5DCHA 3LW9A 4E8EA 3EMXA 1PX6A 4AJ6A 2PVOC 4MJAA 1T00A 3HJPA 4XIHA 1GSUA 5E4WA 1EEJA 4O7HA 3ZFLA 1SL2B 3TJKA 1G7EA 4DEJA 4IP1A 4OO5A 1SKRB 3IHQA 1GNWA 1ZYNA 3IRAA 3PPUA 3BCIA 4L0WA 2MBTA 2FUG2 4NPBA 3RHBA 3IXRA 16GSA 3ZLPA 1V57A 4DSRA 4QL9A 4IHUA 1GP1A 3S9FA 5A4UA 2XBIA 3TJGA 3ZREA 2V1MA 1N8JA 5HR3A 1TDIA 2HSYA 2CVBA 1A0RP 2REMA 3MNGA 4KUNA 1G6YA 5B6MA 4MF6A 17GSA 2CZ2A 5C00A 5HFIA 5COHA 2C0EA 4ECBA 1NHYA 3GUSA 5G1LA 2IMDA 5DQYA 5IMZA 2K9FA 3VI7A 4YAPA 4HU7A 4ZBAA 2HE3A 3IK9A 1GTBA 5F05A 3E9JB 3QAWA 1JZOA 4LL4B 4RI7A 5D93A 3LSZA 1PMTA 2IMIA 2H19A 3ZIJA 13GSA 3L9UA 3FZ9A 3DMLA 3QFAC 3D22A 5ECHB 2VD0A 5KN2A 3ZZXA 3QAVA 2PN8A 2VUPA 3HHVA 1ABAA 2F3MA 4J57E 4PTSA 4IELA 4RQRA 4XCSA 3A2VA 4POBA 3CBUA 3G7JA 1U87A 4O5QA 4FYBA 2C0FA 5ID2A 5B6NA 2GZYA 5CNWA 2PWJA 4KAEA 3M9JA 3N5OA 1DSBA 2C3TA 3P2AA 1H4OA 4HQZA 3LORA 5CO3A 5D9VA 1QGVA 1XPVA 4IBPA 2H0HA 5J3RA 1U88A 4V1Ap 3TJFA 2DKIA 2B1KA 2OADA 3CTGA 1BX9A 4KF9A 3P7XA 4YQUA 2VM1A 3P8WA 2L5OA 1A2LA 2DIYA 2Z9SA 1PD21 1ST9A 2VD1A 1B4PA 22GSA 4POMA 4KDXA 5D73A 3IHGA 3O3TA 4GF0A 4BWSA 5G5EA 5CRDA 2F51A 4MP4A 3ED3A 1VF3A 3FMWA 5J9BA 1XBSA 2KLXA 1RQMA 1G6WA 1V40A 3DEXA 3IDVA 3DRNA 4F03A 3TKSC 4WEYA 2R4VA 4XS4A 2I81A 4OD7A 5H5SA 2DMMA 1HYUA 4EUYA 4Z2UA 4OFNA 4IN0A 2H6YA 1Q4JA 5IMDA 1XCCA 3ZVJD 4FYCA 4IKHA 1OC8A 1UVZA 1BQ7A 2L4CA 3HA9A 5F8BA 4ZL7A 4GTUA 2LQOA 5D8IA 1EOGA 3QD9A 2N5FA 1ZYEA 2WS2A 3PGTA 2CAQA 1A0FA 1X9SB 2M72A 1JZWA 4YKGA 2HSHA 2KHPA 2HYXA 1R5PA 4POKA 2XC2A 1SK0A 4XRDA 3DKSA 1R7HA 1WJKA 1LU4A 3GH9A 1H75A 2YZHA 4TR3A 2A4HA 4MCUA 1OE7A 1OC9A 4DSQA 3GV1A 3FEUA 5DAKB 1GL8A 5D96A 3V1WA 4POLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O6J A;  2P31 A;  1SKW B;  3VWW A;  1FB0 A;  3WT2 A;  2PBJ A;  2BTO T;  1XW6 A;  3BD2 A;  2C3Q A;  2VM2 A;  3FR3 A;  2H74 A;  1M2A A;  2JU5 A;  2C0D A;  2TIR A;  4HJM A;  1ERW A;  1XWB A;  2GS3 A;  3C71 A;  2N5B A;  3KCM A;  1WWJ A;  1THX A;  1TW9 A;  1MTC A;  4GRF A;  5A5K A;  4EVM A;  1DE2 A;  4GCI A;  2YJ7 A;  1HNA A;  1V98 A;  1ZCP A;  3IR4 A;  3CSH A;  3C1S A;  4KDY A;  3GHA A;  1XWK A;  3O6T A;  2GVP A;  4WF5 A;  1KBN A;  2R3X A;  3R2Q A;  5F0G A;  2AYT A;  1R4W A;  2MMO A;  5IQY A;  1S3C A;  4KND A;  3KM6 A;  2XBQ A;  2RUF A;  10GS A;  1B8X A;  2G2Q A;  1BG5 A;  2CAI A;  4L5O A;  1V9W A;  2JSY A;  4ILF A;  2O87 A;  3F3Q A;  4ISD A;  1EV4 A;  2QGV A;  2HLS A;  3DGQ A;  2H66 A;  1XIY A;  3Q6O A;  2JAD A;  4I97 A;  2NVL A;  1RW1 A;  1GUM A;  3US3 A;  3GKX A;  2ZUP A;  1AQX A;  4BVY A;  1YJ6 A;  2MMZ A;  2FCH A;  3F6D A;  2CQ9 A;  3SBC A;  3E0U A;  1F37 A;  3F8U A;  1WMJ A;  4MLY A;  4RI6 A;  4Q5R A;  4MPG A;  2VOC A;  4K2D A;  1TK5 B;  2H73 A;  3KTL A;  2XPE A;  19GS A;  3FY7 A;  5DJL A;  2YCD A;  3GMF A;  2IL3 A;  3HD5 A;  4GQF A;  4I6X A;  4ZL9 A;  2BMX A;  3HY2 A;  2YP6 A;  2CZ3 A;  3FRC A;  1OKT A;  4HQS A;  4HS1 A;  1C72 A;  1V58 A;  3L4N A;  4N30 A;  2RM5 A;  1A2J A;  3HYP A;  1XWC A;  4N0Z A;  4IQA A;  5ELA A;  2GGT A;  2WFC A;  1JHB A;  2CVD A;  4TR4 A;  5HR0 A;  1FO5 A;  1AQW A;  1M0U A;  2R37 A;  3C7M A;  3IA1 A;  4TN8 A;  2LRN A;  2X99 A;  3TUE A;  4K7N A;  5HFK A;  2X64 A;  6GSV A;  4XHM A;  3A3T A;  4Q5N A;  2DLX A;  2IIY A;  2LJK A;  3LGC A;  2MYG A;  1UC7 A;  3CSI A;  1SKS B;  2GQM A;  3VLN A;  4LMV A;  3VWV A;  1X9M B;  4G10 A;  1K3O A;  3LEF A;  3EWL A;  2HZE B;  3H79 A;  3HZ4 A;  4YAV A;  3IPZ A;  1USB A;  3FR9 A;  2DIZ A;  1WPI A;  3ZYW A;  2FD3 A;  1GRX A;  2V6K A;  3GH6 A;  6GSY A;  2R2J A;  4K0N A;  1XVW A;  2CVK A;  4K0G A;  1EEM A;  5CRG A;  3QR6 A;  4MF7 A;  4ECI A;  1PKZ A;  1XXU A;  4KE3 A;  2QKE A;  3TCO A;  1JFU A;  4ML6 A;  3CSJ A;  1SD9 A;  5H5R A;  4MJC A;  1TI1 A;  4JBB A;  1CQH A;  4MZB A;  3AY8 A;  1YQ1 A;  1GWC A;  3DYR A;  3WT1 A;  3IBH A;  2FWG A;  1YEP A;  5GZZ B;  3ERW A;  2CX3 A;  2YOI A;  4JRR A;  3DVX A;  3BOA A;  2H6Z A;  5CAX A;  1M7T A;  2FWH A;  1K0N A;  4ZB9 A;  4J56 E;  3EE2 A;  4BVX A;  1M9B A;  2IME A;  4MJB A;  2F8A A;  3F4S A;  1AXD A;  4CW9 A;  3WD6 A;  1E6B A;  1XWA A;  1SJZ A;  3E3E A;  6GSW A;  2C4J A;  2IMK A;  5CYY A;  2VCX A;  3A5W A;  2MMN A;  4HEA 2;  3GRX A;  4OFM A;  4PXO A;  4PGT A;  1GUH A;  1FVK A;  2RM6 A;  3LXT A;  4TRX A;  5IPG A;  1YKA A;  3GTU B;  2NTO A;  3HZ8 A;  3RAZ A;  3TB2 A;  3L9S A;  1XOB A;  2B5X A;  5EL8 A;  3H8Q A;  4GQC A;  2GSR A;  2OBK A;  2FA4 A;  2JAC A;  2VL2 C;  2VLV A;  4NXI A;  4LL1 B;  6GSS A;  4NAX A;  2D2Z A;  3D0Z A;  4JE1 A;  2WCI A;  2H70 A;  3TRQ A;  1GTU A;  2JZR A;  4ML1 A;  1GSE A;  2EIO A;  1IYH A;  5ECK B;  4FO5 A;  2V41 A;  4G19 A;  4I2T A;  1V2A A;  1WRY A;  2L57 A;  3D21 A;  4LA1 A;  2OBI A;  4TXO A;  5G1K A;  4IJI A;  1X0R A;  4KA0 A;  3L9V A;  3KMO A;  4AGS A;  2PUK C;  1URM A;  2A4V A;  2YN1 A;  4L8E A;  3CYN A;  1TJD A;  4MDC A;  3RHC A;  1W89 A;  5HR2 A;  3VPT A;  2M80 A;  3QMX A;  3F3R A;  4WF4 A;  1GTI A;  1NHO A;  5G31 A;  3F6F A;  3GKN A;  3DVW A;  5IPH A;  3TRP A;  2GQK A;  4MAB A;  1FAA A;  2OAC A;  1GSY A;  3G7Y A;  4ZBD A;  5LCZ A;  1MDJ A;  1Z7R A;  5F06 A;  2H72 A;  2H1D A;  2H76 A;  1YEX A;  4Q5F A;  1S3A A;  3TKQ A;  2O7K A;  5B8B A;  1EGO A;  3UVH A;  4RQX A;  1T1V A;  1GSS A;  2LNT A;  2I3Y A;  2DJ3 A;  5ID2 B;  4O5R A;  1TTZ A;  4EC0 A;  1QUW A;  5DAL B;  3P90 A;  1GLQ A;  5JWQ B;  1GLP A;  2EC4 A;  2KP1 A;  3ZVJ A;  3W8S A;  2K8V A;  3KP9 A;  1VF1 A;  2OE1 A;  4KDU A;  2H1G A;  5HR1 A;  3TDG A;  4PNF A;  2YJH A;  3WGE A;  1DBY A;  2WDU A;  2A2S A;  4XS6 A;  2FA8 A;  2AHE A;  5AIV A;  4IVF A;  2H1A A;  4KGI A;  4IGJ A;  3HVX A;  2OKA A;  2HRF A;  4GSS A;  3CRU A;  3FZ4 A;  4WR4 A;  1TXX A;  2HI7 A;  1J0F A;  3KTB A;  1O8W A;  4XS4 B;  3RPN A;  1KTE A;  4GWR A;  1OVN A;  2H0I A;  1UN2 A;  3LYK A;  3HJO A;  3FK8 A;  3VUR A;  4P3Y B;  4KSM A;  4WET A;  18GS A;  1F9M A;  3GL5 A;  1KNG A;  5GAN D;  5IMV A;  3J7Y b;  2HFD A;  1FW1 A;  3GIX A;  2B5E A;  3QFB C;  2LRC A;  2GST A;  20GS A;  5B8A A;  1U6T A;  2FGX A;  3KJY A;  4TOP A;  3L0H A;  3CMI A;  1JLV A;  1LJR A;  1OKD A;  2B1L A;  1K0C A;  1KEB A;  5B7C A;  2HZF A;  2B6M A;  5DJM A;  3KH9 A;  3I6A A;  1K0D A;  3EMP A;  2C8U A;  4KX4 A;  2GZZ A;  4ID0 A;  1Z6M A;  2E2G A;  5J5N A;  2YPM A;  2HNL A;  1J08 A;  2JL4 A;  6GSX A;  4WBJ A;  9GSS A;  5IMF A;  4HI7 A;  2KUC A;  3UMA A;  2X8G A;  4TVE A;  5JCG A;  2PMT A;  5DCG A;  2OE3 A;  5ECO B;  5ENU A;  1XWG A;  2LV3 A;  4HZ4 A;  4DSS A;  1TU8 A;  1ZYQ B;  1R26 A;  4MA9 A;  3UL3 A;  1M2D A;  2P5R A;  2DJ2 A;  1A23 A;  5KN3 A;  2EIQ A;  1VRS D;  1Y25 A;  1HQO A;  1B48 A;  5JCU A;  3ZL5 A;  1A24 A;  4MF5 A;  2LJR A;  1XZO A;  4OO4 A;  1PKW A;  2B7J A;  2B3S A;  2L6D A;  3NIV A;  3ZIT A;  1VGL A;  5GST A;  2DJ0 A;  4JZQ A;  3GX8 A;  1O73 A;  1ZOF A;  1PA3 A;  1YY7 A;  1YKC A;  1B4Q A;  2KP2 A;  1CQG A;  1O7U A;  1VF4 A;  4I2U A;  1W4V A;  1YF1 A;  2LST A;  1M2B A;  1O85 A;  1GH2 A;  1MDI A;  3NOF A;  4EKZ A;  5ECQ B;  3GNJ A;  2JZT A;  4ECC A;  4CHS A;  1OYJ A;  3LYP A;  3IAS 2;  1MD3 A;  3EIN A;  2BJX A;  1TK0 B;  1A2M A;  1PGT A;  4YQV A;  4OCE A;  1YF0 A;  1PN9 A;  1R5A A;  2GZP A;  4O32 A;  3HDC A;  4J2F A;  1MDK A;  1IYI A;  14GS A;  3H4K A;  3EC3 A;  4X0X A;  2H8L A;  3KIJ A;  3UOM A;  1A8L A;  5D9X A;  2I1U A;  3BCK A;  3CXG A;  3W8J A;  5LNK e;  2WZ9 A;  2VCQ A;  4MZW A;  2XHF A;  2IJY A;  3FZA A;  4EL1 A;  1WOU A;  2L59 A;  2H71 A;  3KH7 A;  4ZXG A;  1TRS A;  1ERT A;  2RUE A;  3QCP A;  1BJX A;  4RUV A;  4FYU A;  4X1U A;  2CX4 A;  2PVQ A;  2F8F A;  3I69 A;  1U3I A;  2R5G A;  1GUL A;  5ECP B;  3MWH A;  3LQ7 A;  1O8X A;  5KEJ A;  2YZU A;  5EPF A;  2WRT A;  4OMV A;  3EUR A;  4QQ7 A;  1ZZY A;  1Z3E A;  2HT9 A;  4ZBB A;  2TRX A;  3A2X A;  1SK1 A;  4TR0 A;  2LJA A;  3UVT A;  3VWU A;  1E2Y A;  2B5Y A;  2TRC P;  2C3N A;  1QK8 A;  3GYK A;  1OAZ A;  4XTS A;  4JU5 A;  4TR1 B;  2HZE A;  4D73 A;  3DXB A;  5J41 A;  4IP6 A;  2GQL A;  3VK9 A;  4IJ3 A;  1SL1 B;  2NBS A;  2ZNM A;  3F4R A;  2VCT A;  4G9H A;  4AF2 A;  1J9B A;  1G7O A;  5EVO A;  2YNX A;  2FWF A;  1TP9 A;  4IQ1 A;  3ME7 A;  4MPF A;  3U5R E;  1I5G A;  1NM3 A;  3I43 A;  3OR5 A;  1RK4 A;  2LUS A;  2OE0 A;  4EF0 A;  2AAW A;  3LJR A;  1GSF A;  4WR5 A;  3JCM L;  3EVI A;  4V2N A;  1T3B A;  4NV2 A;  2CT6 A;  5F07 A;  2A2R A;  4TXV A;  2H30 A;  1Z6N A;  1DE1 A;  4K7O A;  1JZR A;  5G2Z A;  1HNB A;  4PUF C;  5DBQ A;  3LXZ A;  3J7Y k;  4PQ1 A;  2WGR A;  4MJE A;  4L0U A;  3MSZ A;  5ECI B;  2IFQ B;  1X5D A;  3RDW A;  5L71 A;  1AUC A;  4N11 A;  1TRV A;  4H86 A;  3PR8 A;  2YWO A;  2DC5 A;  1T4Y A;  3L78 A;  2X8C A;  5A4V A;  4DVC A;  8GSS A;  2C1Y A;  3TGZ A;  2B7K A;  3VPQ A;  2R6K A;  3D6I A;  1FOV A;  4PNG A;  4EXJ A;  4EDZ A;  2K8S A;  2VCV A;  3ZMK A;  2DSA A;  3O76 A;  2AV4 A;  1QFN A;  1Y6E A;  2HRN A;  1HD2 A;  2YWM A;  3EU4 A;  2IWT A;  3GTU A;  2MBS A;  1EV9 A;  2V6O A;  2VCZ A;  1EWX A;  4OFT A;  3VFI A;  1ACV A;  2OA7 A;  5IM9 A;  3UBL A;  3UIW A;  5ECM B;  2K18 A;  3QDN A;  2O89 A;  6GSU A;  4E8H A;  3A2W A;  5KN1 A;  3HCZ A;  5IMC A;  1M99 A;  1EZK A;  5EY6 A;  3ZRD A;  2ON5 A;  3MAK A;  1ERV A;  4LMW A;  3KGK A;  3M1G A;  3KZQ A;  2XPD A;  4Z7X A;  3HXS A;  1AC1 A;  4ZB8 A;  2IMF A;  3TOU A;  2ES7 A;  2E0Q A;  5DVB A;  2GDR A;  2FNO A;  1VF2 A;  2X8H A;  1FHE A;  3QAG A;  3DD3 A;  5C04 A;  5ECN B;  4WXT A;  2L5L A;  3ZFB A;  2ZCT A;  4ACS A;  2FWE A;  5CRW A;  1OE8 A;  2LRT A;  2PER A;  1YZX A;  1XW5 A;  1Z5Y E;  2GLR A;  1K3L A;  1UA5 A;  4AJ7 A;  2K6V A;  2N5A A;  4IS0 A;  2LKU A;  3DWV A;  3NZN A;  7GSS A;  2MMA A;  3KP8 A;  11GS A;  2AB6 A;  2NDO A;  3SWL A;  3WGX A;  2VL3 A;  6GST A;  1ILO A;  3QPM A;  1PX7 A;  2P5Q A;  1K0A A;  1SD8 A;  4G2E A;  4NV5 A;  1JLW A;  1AIU A;  5CRH A;  5AIS A;  4AJ8 A;  4ECJ A;  4TXO B;  2ON7 A;  4ULX A;  1SU9 A;  2WJU A;  3PIN A;  5D9T A;  5FWG A;  3GFK A;  1AQV A;  4KCE A;  1X5C A;  1M9A A;  1X5E A;  4I8B A;  5DAL A;  4ZL8 A;  3RBT A;  3HVV A;  3FYG A;  1T4Z A;  1EP8 A;  3GSS A;  4HZ2 A;  3F9U A;  2GSQ A;  5J4U A;  5KN0 A;  5H5Q A;  3ZIV A;  5ABR A;  3I9V 2;  2YV7 A;  1GSD A;  2JZS A;  1SJI A;  4K7I A;  3U6V A;  2F9S A;  2O85 A;  1B9Y C;  3Q19 A;  1PL1 A;  3GKK A;  4TKY A;  1A8Y A;  2E7P A;  3MDK A;  3GX0 A;  4KSO A;  4OCF A;  3IV4 A;  4JED A;  3RPP A;  1BAY A;  2C80 A;  2RII A;  4MZC A;  3FHK A;  1WIK A;  1PQN A;  3ZML A;  4K6X A;  2VAF A;  2H75 A;  1WE0 A;  3M0F A;  4O92 A;  4KH7 A;  1FB6 A;  5AGY A;  4MH2 A;  2HXK A;  4LLR A;  2EIR A;  2YWN A;  3LFL A;  3LWA A;  1NW2 A;  3FR6 A;  1F3A A;  1XFL A;  1B9X C;  4V1A g;  1I9D A;  4NWY A;  4F0C A;  2VLU A;  4PQI A;  3FKF A;  1K0B A;  4PQH A;  2J23 A;  4F82 A;  4NHW A;  1EGR A;  3APQ A;  3GA4 A;  4K1F A;  3TJJ A;  2LEG A;  1Z9H A;  5DAK A;  3KMN A;  1U3A A;  5J9C A;  1FG4 A;  2ALB A;  1GSQ A;  3BBY A;  2VLT A;  1K0O A;  5ECS A;  3GST A;  3LG6 A;  4MH3 A;  5IO0 A;  3FW2 A;  1MD4 A;  2H1B A;  5JCW A;  3CRT A;  5E59 A;  3UBK A;  3ZTL A;  1S3D A;  2VO4 A;  2CA8 A;  1TOF A;  1HNC A;  4QL7 A;  4BL7 A;  4WKW A;  3BJ5 A;  2CV4 A;  1ERU A;  5GSS A;  12GS A;  5ECR B;  1YDK A;  4FH8 A;  4GXZ A;  1T7P B;  2H0G A;  3F0I A;  1GNE A;  3TKP A;  4BPY A;  5G30 A;  2C0G A;  2VIM A;  1G0T A;  1OC3 A;  5IMA A;  3F4T A;  3CTF A;  1OC9 B;  3KD0 A;  3TKS E;  3HKR A;  2LQQ A;  4OWY A;  3H1N A;  2E2M A;  5JWR B;  2J9H A;  3ISO A;  1NSW A;  1TRU A;  4HU9 A;  1ON4 A;  1ZL9 A;  3APO A;  4XS1 A;  1MEK A;  1SK2 A;  1SEN A;  2YV9 A;  2IPA A;  4ZIJ A;  4FIW A;  4GST A;  2VL2 A;  1ZMA A;  2YWI A;  3GL3 A;  4PX1 A;  3QOU A;  1TK8 B;  5HFG A;  3F63 A;  4K9Z A;  4DSS B;  3C1R A;  1N2A A;  3GN3 A;  3TRX A;  2DJK A;  3EYT A;  3D5J A;  4IW9 A;  1Q98 A;  3Q18 A;  3VWX A;  1WP0 A;  2H01 A;  3IAM 2;  1F3B A;  5DQS A;  5G5F A;  1XOA A;  4V2L A;  3IC4 A;  1SYX A;  3M9K A;  4GLT A;  3UEM A;  1TI3 A;  1QXH A;  2P0G A;  4PUA A;  4MMM A;  3M8N A;  2L6C A;  5GAP D;  1AW9 A;  4BA7 A;  2I4A A;  2PGT A;  4GSN A;  2FLS A;  1SJ6 A;  3FZ5 A;  4F9Z A;  2JSZ A;  2GT6 A;  5IOX A;  1EP7 A;  2AJQ B;  2LTK A;  2V2G A;  5IO2 A;  4CDO A;  2QC7 A;  3ERF A;  4YQM A;  1Z7P A;  3WYW A;  3EU3 A;  4KW6 A;  2QSI A;  5FT3 A;  4N0V A;  2RLI A;  2YAN A;  3KEB A;  2GT5 A;  2WUL A;  2MZC A;  1GUK A;  4ZB6 A;  2AUV A;  2PU9 C;  5A4W A;  5AN1 A;  5ECL B;  3GUR A;  3Q74 A;  3APS A;  2VL9 A;  3TKR A;  4YH2 A;  4HUA A;  2H6X A;  3IOS A;  1GTA A;  1K0M A;  3K8N A;  1ML6 A;  2WB9 A;  1QQ2 A;  5ELG A;  2DML A;  1BYE A;  1XW9 A;  5FHI A;  3KXO A;  3IK7 A;  4HJ2 A;  2DJJ A;  2DJ1 A;  3UAP A;  3TKS A;  4F2I A;  2IN3 A;  4K8M A;  4JR6 A;  5LD0 A;  1XVQ A;  2DBC A;  5IOW A;  4V2M A;  5AIX A;  3C73 A;  3HJM A;  2FY6 A;  4BWQ A;  3ME8 A;  2I9H A;  2NPB A;  3TOT A;  2OJL A;  4TR1 A;  3UAR A;  4NHZ A;  2LS5 A;  2VCW A;  3WGD A;  1DUG A;  1PSQ A;  1EOH A;  1PRX A;  4MK3 A;  4I5Q A;  3TJB A;  4X43 A;  4N10 A;  3ERG A;  2L4Q A;  3W6G A;  1O81 A;  1SYR A;  1TRW A;  4KB3 A;  2G0F A;  4WBR D;  4Q5Q A;  1TU7 A;  3GKM A;  4JR4 A;  1LBK A;  4EE0 A;  3N9J A;  1BED A;  1AAZ A;  5HQP A;  4NMU A;  4EDY A;  2V32 A;  4ZIL A;  3G9B A;  4D73 B;  3D4T A;  1T8E B;  1F6M C;  3VI5 A;  5D9W A;  5CRE A;  1SL0 B;  4F0B A;  1PL2 A;  2LNS A;  1X9W B;  3C8E A;  1ZGN A;  4XRA A;  1K3Y A;  3PH9 A;  3HVS A;  2M46 A;  3IE3 A;  2KOK A;  4KCA A;  1THO A;  2O8V B;  4HOJ A;  3G7I A;  2IFQ A;  5INY A;  5DDL A;  4TW5 A;  4EO3 A;  1TKD B;  3DIE A;  1JZD A;  5IIZ A;  5JWO B;  4L5L A;  1QMV A;  3H93 A;  3D4M A;  1F2E A;  4HDE A;  3UJ1 A;  2GSS A;  3M3M A;  4PUR A;  2FHE A;  2GTU A;  5CP1 A;  2PPT A;  1FVJ A;  5DCH A;  4E8E A;  3EMX A;  1PX6 A;  4AJ6 A;  2PVO C;  4MJA A;  1T00 A;  3HJP A;  4XIH A;  1GSU A;  5E4W A;  1EEJ A;  4O7H A;  3ZFL A;  1SL2 B;  3TJK A;  1G7E A;  4DEJ A;  4IP1 A;  4OO5 A;  1SKR B;  3IHQ A;  1GNW A;  3IRA A;  3BCI A;  4L0W A;  2MBT A;  2FUG 2;  4NPB A;  3RHB A;  3IXR A;  16GS A;  3ZLP A;  1V57 A;  4DSR A;  4QL9 A;  4IHU A;  1GP1 A;  3S9F A;  5A4U A;  2XBI A;  3TJG A;  3ZRE A;  2V1M A;  1N8J A;  5HR3 A;  1TDI A;  2HSY A;  2CVB A;  1A0R P;  2REM A;  3MNG A;  4KUN A;  1G6Y A;  5B6M A;  4MF6 A;  17GS A;  2CZ2 A;  5C00 A;  5HFI A;  5COH A;  2C0E A;  4ECB A;  1NHY A;  3GUS A;  5G1L A;  2IMD A;  5DQY A;  5IMZ A;  2K9F A;  3VI7 A;  4YAP A;  4HU7 A;  4ZBA A;  2HE3 A;  3IK9 A;  1GTB A;  5F05 A;  3E9J B;  3QAW A;  1JZO A;  4LL4 B;  4RI7 A;  5D93 A;  3LSZ A;  1PMT A;  2IMI A;  2H19 A;  3ZIJ A;  13GS A;  3L9U A;  3FZ9 A;  3DML A;  3QFA C;  3D22 A;  5ECH B;  2VD0 A;  5KN2 A;  3ZZX A;  3QAV A;  2PN8 A;  2VUP A;  3HHV A;  1ABA A;  2F3M A;  4J57 E;  4IEL A;  4RQR A;  4XCS A;  3A2V A;  4POB A;  3CBU A;  3G7J A;  1U87 A;  4FYB A;  2C0F A;  5ID2 A;  5B6N A;  2GZY A;  5CNW A;  2PWJ A;  4KAE A;  3M9J A;  3N5O A;  1DSB A;  2C3T A;  3P2A A;  1H4O A;  4HQZ A;  3LOR A;  5CO3 A;  5D9V A;  1QGV A;  1XPV A;  4IBP A;  2H0H A;  5J3R A;  1U88 A;  4V1A p;  3TJF A;  2B1K A;  2OAD A;  3CTG A;  1BX9 A;  4YQU A;  3P7X A;  2VM1 A;  3P8W A;  2L5O A;  1A2L A;  2DIY A;  2Z9S A;  1PD2 1;  1ST9 A;  2VD1 A;  1B4P A;  22GS A;  4POM A;  4KDX A;  5D73 A;  3O3T A;  4GF0 A;  4BWS A;  5G5E A;  5CRD A;  2F51 A;  4MP4 A;  3ED3 A;  1VF3 A;  5J9B A;  1XBS A;  2KLX A;  1RQM A;  1G6W A;  1V40 A;  3DEX A;  3IDV A;  3DRN A;  4F03 A;  3TKS C;  4WEY A;  2R4V A;  4XS4 A;  2I81 A;  4OD7 A;  5H5S A;  2DMM A;  1HYU A;  4EUY A;  4OFN A;  4IN0 A;  2H6Y A;  1Q4J A;  5IMD A;  1XCC A;  3ZVJ D;  4FYC A;  4IKH A;  1OC8 A;  1UVZ A;  1BQ7 A;  2L4C A;  3HA9 A;  5F8B A;  4ZL7 A;  4GTU A;  2LQO A;  5D8I A;  1EOG A;  3QD9 A;  2N5F A;  1ZYE A;  2WS2 A;  3PGT A;  2CAQ A;  1A0F A;  1X9S B;  2M72 A;  1JZW A;  2HSH A;  2KHP A;  2HYX A;  1R5P A;  4POK A;  2XC2 A;  1SK0 A;  4XRD A;  3DKS A;  1R7H A;  1WJK A;  1LU4 A;  3GH9 A;  1H75 A;  2YZH A;  4TR3 A;  4MCU A;  1OE7 A;  1OC9 A;  4DSQ A;  3GV1 A;  3FEU A;  5DAK B;  1GL8 A;  5D96 A;  3V1W A;  4POL A; 
#chains in the Genus database with same CATH topology
 2X4A A;  1O6J A;  2P31 A;  1SKW B;  3VWW A;  1FB0 A;  3WT2 A;  2PBJ A;  2BTO T;  1XW6 A;  3BD2 A;  2C3Q A;  2VM2 A;  3FR3 A;  2H74 A;  1M2A A;  2JU5 A;  2C0D A;  2TIR A;  4HJM A;  1ERW A;  1XWB A;  2GS3 A;  3C71 A;  2N5B A;  3KCM A;  1WWJ A;  1THX A;  1TW9 A;  1MTC A;  4GRF A;  5A5K A;  4EVM A;  1DE2 A;  4GCI A;  2YJ7 A;  1HNA A;  1V98 A;  1ZCP A;  3IR4 A;  3CSH A;  2A2P A;  3C1S A;  4KDY A;  3GHA A;  1XWK A;  3O6T A;  2GVP A;  4WF5 A;  1KBN A;  2R3X A;  3R2Q A;  5F0G A;  2AYT A;  1R4W A;  2MMO A;  5IQY A;  1S3C A;  4KND A;  3KM6 A;  2XBQ A;  2RUF A;  10GS A;  1B8X A;  2G2Q A;  1BG5 A;  2CAI A;  4L5O A;  1V9W A;  2JSY A;  4ILF A;  2O87 A;  3F3Q A;  4ISD A;  1EV4 A;  2QGV A;  2HLS A;  3DGQ A;  2H66 A;  1XIY A;  3Q6O A;  2JAD A;  4I97 A;  2NVL A;  1RW1 A;  1GUM A;  3US3 A;  3GKX A;  2ZUP A;  1AQX A;  4BVY A;  1YJ6 A;  2MMZ A;  1PN0 A;  2FCH A;  3F6D A;  2CQ9 A;  3SBC A;  4YKF A;  3E0U A;  1F37 A;  3F8U A;  1WMJ A;  4MLY A;  4RI6 A;  4Q5R A;  4MPG A;  2VOC A;  4K2D A;  1TK5 B;  2H73 A;  3KTL A;  2XPE A;  19GS A;  3FY7 A;  5DJL A;  2YCD A;  3GMF A;  2IL3 A;  3HD5 A;  4GQF A;  4I6X A;  4ZL9 A;  2BMX A;  3HY2 A;  2YP6 A;  2CZ3 A;  3FRC A;  1OKT A;  4HQS A;  4HS1 A;  1C72 A;  1V58 A;  3L4N A;  4N30 A;  2RM5 A;  1A2J A;  3HYP A;  1XWC A;  4N0Z A;  4IQA A;  5ELA A;  2GGT A;  2WFC A;  1JHB A;  2CVD A;  4TR4 A;  5HR0 A;  1FO5 A;  1AQW A;  1M0U A;  2R37 A;  3C7M A;  3IA1 A;  4TN8 A;  2LRN A;  2X99 A;  3TUE A;  4K7N A;  5HFK A;  2X64 A;  6GSV A;  4XHM A;  3A3T A;  4Q5N A;  2DLX A;  2IIY A;  2LJK A;  3LGC A;  2MYG A;  1UC7 A;  3CSI A;  1SKS B;  2GQM A;  3VLN A;  4LMV A;  3VWV A;  1X9M B;  4G10 A;  1K3O A;  3LEF A;  3EWL A;  2HZE B;  3H79 A;  3HZ4 A;  4YAV A;  3IPZ A;  1USB A;  3FR9 A;  2DIZ A;  1WPI A;  3ZYW A;  2FD3 A;  1GRX A;  2V6K A;  3GH6 A;  6GSY A;  2R2J A;  4K0N A;  1XVW A;  2CVK A;  4K0G A;  1EEM A;  5CRG A;  3QR6 A;  4MF7 A;  2HSM A;  4ECI A;  1PKZ A;  1XXU A;  4KE3 A;  2QKE A;  3TCO A;  1JFU A;  4ML6 A;  3CSJ A;  1SD9 A;  5H5R A;  4MJC A;  1TI1 A;  4JBB A;  1CQH A;  4MZB A;  3AY8 A;  1YQ1 A;  1GWC A;  3DYR A;  3WT1 A;  3IBH A;  2FWG A;  1YEP A;  5GZZ B;  3ERW A;  4EIP A;  2CX3 A;  2YOI A;  4JRR A;  3DVX A;  3BOA A;  2H6Z A;  5CAX A;  1M7T A;  2FWH A;  1K0N A;  4ZB9 A;  4J56 E;  3EE2 A;  4BVX A;  1M9B A;  2IME A;  4MJB A;  3MIX A;  2F8A A;  3F4S A;  2UZ8 A;  1AXD A;  4CW9 A;  3WD6 A;  1E6B A;  1XWA A;  5BRT A;  1SJZ A;  3E3E A;  6GSW A;  2C4J A;  2IMK A;  5CYY A;  2VCX A;  3A5W A;  2MMN A;  4HEA 2;  3GRX A;  4OFM A;  4PXO A;  4PGT A;  1GUH A;  1FVK A;  2RM6 A;  3LXT A;  4TRX A;  5IPG A;  1YKA A;  3GTU B;  2NTO A;  4K5S A;  3HZ8 A;  3RAZ A;  3TB2 A;  1M3I A;  3L9S A;  1XOB A;  2B5X A;  5EL8 A;  3H8Q A;  4GQC A;  2GSR A;  2OBK A;  2FA4 A;  2JAC A;  2VL2 C;  2VLV A;  4NXI A;  4LL1 B;  6GSS A;  4NAX A;  2D2Z A;  3D0Z A;  4Z2T A;  4JE1 A;  2WCI A;  2H70 A;  3TRQ A;  1GTU A;  2JZR A;  4ML1 A;  1GSE A;  2EIO A;  1IYH A;  2QA2 A;  5ECK B;  4FO5 A;  2V41 A;  4G19 A;  4I2T A;  1V2A A;  4O5U A;  4USS A;  1WRY A;  2L57 A;  3D21 A;  4LA1 A;  2OBI A;  4TXO A;  5G1K A;  4IJI A;  1X0R A;  4KA0 A;  3L9V A;  3KMO A;  4AGS A;  2PUK C;  1URM A;  2A4V A;  2YN1 A;  4L8E A;  3CYN A;  1TJD A;  4CY8 A;  4MDC A;  3RHC A;  1W89 A;  4MNN A;  5HR2 A;  3VPT A;  2M80 A;  3QMX A;  3F3R A;  4WF4 A;  1GTI A;  1NHO A;  5G31 A;  3F6F A;  3GKN A;  3DVW A;  5IPH A;  3TRP A;  2GQK A;  4MAB A;  1FAA A;  2OAC A;  1GSY A;  3G7Y A;  4ZBD A;  5LCZ A;  1MDJ A;  1Z7R A;  5F06 A;  2H72 A;  2H1D A;  5KOX A;  2H76 A;  1YEX A;  4Q5F A;  1S3A A;  3TKQ A;  2O7K A;  5B8B A;  1EGO A;  3UVH A;  4RQX A;  1T1V A;  1GSS A;  2LNT A;  2I3Y A;  2DJ3 A;  5ID2 B;  4O5R A;  5KOW A;  1TTZ A;  2R0P A;  4EC0 A;  1QUW A;  5DAL B;  3P90 A;  1GLQ A;  5JWQ B;  1GLP A;  2EC4 A;  2KP1 A;  3ZVJ A;  3W8S A;  2K8V A;  3KP9 A;  1VF1 A;  2OE1 A;  3R3E A;  4KDU A;  2H1G A;  5HR1 A;  3TDG A;  4PNF A;  2YJH A;  3WGE A;  1DBY A;  2WDU A;  2A2S A;  4XS6 A;  2FA8 A;  2AHE A;  5AIV A;  4IVF A;  2H1A A;  4KGI A;  4IGJ A;  3HVX A;  2OKA A;  2HRF A;  4GSS A;  3CRU A;  3CQF A;  3FZ4 A;  4WR4 A;  1TXX A;  2HI7 A;  1J0F A;  3KTB A;  1O8W A;  4XS4 B;  3RPN A;  1KTE A;  4GWR A;  1OVN A;  2H0I A;  1UN2 A;  3LYK A;  3HJO A;  3FK8 A;  2R0C A;  3VUR A;  4P3Y B;  4KSM A;  4WET A;  18GS A;  1F9M A;  3GL5 A;  1KNG A;  5GAN D;  5IMV A;  3J7Y b;  2HFD A;  1FW1 A;  3GIX A;  2B5E A;  3QFB C;  2LRC A;  2GST A;  20GS A;  5B8A A;  1U6T A;  1ZYP A;  2FGX A;  3KJY A;  4TOP A;  3L0H A;  3CMI A;  1JLV A;  1LJR A;  1OKD A;  2B1L A;  1K0C A;  1KEB A;  5B7C A;  2HZF A;  2B6M A;  5DJM A;  3KH9 A;  3I6A A;  1K0D A;  3EMP A;  2C8U A;  4KX4 A;  2GZZ A;  4ID0 A;  2QA1 A;  1Z6M A;  2E2G A;  5J5N A;  2YPM A;  2HNL A;  1J08 A;  2JL4 A;  6GSX A;  4WBJ A;  9GSS A;  5IMF A;  4HI7 A;  2KUC A;  3UMA A;  2X8G A;  4BL7 B;  4TVE A;  5JCG A;  2PMT A;  5DCG A;  2OE3 A;  5ECO B;  5ENU A;  1XWG A;  2LV3 A;  4HZ4 A;  4DSS A;  1TU8 A;  1ZYQ B;  1R26 A;  4MA9 A;  3UL3 A;  1M2D A;  2P5R A;  2DJ2 A;  1A23 A;  5KN3 A;  2EIQ A;  1VRS D;  1Y25 A;  1HQO A;  1B48 A;  5JCU A;  3ZL5 A;  1A24 A;  4MF5 A;  2LJR A;  1XZO A;  4OO4 A;  1PKW A;  2B7J A;  2B3S A;  2L6D A;  3NIV A;  2DKH A;  3ZIT A;  1VGL A;  5GST A;  2DJ0 A;  4JZQ A;  3GX8 A;  1O73 A;  1ZOF A;  1PA3 A;  1YY7 A;  1YKC A;  1B4Q A;  2KP2 A;  1CQG A;  1O7U A;  1VF4 A;  4I2U A;  1W4V A;  1YF1 A;  2LST A;  1M2B A;  1O85 A;  1GH2 A;  1MDI A;  3NOF A;  4EKZ A;  4ICY A;  5ECQ B;  3GNJ A;  2JZT A;  4ECC A;  4CHS A;  1OYJ A;  3LYP A;  3IAS 2;  1MD3 A;  3EIN A;  2BJX A;  1TK0 B;  1A2M A;  1PGT A;  4YQV A;  4OCE A;  1YF0 A;  1PN9 A;  1R5A A;  2GZP A;  4O32 A;  3HDC A;  4J2F A;  1MDK A;  1IYI A;  14GS A;  3H4K A;  3EC3 A;  4X0X A;  2H8L A;  3KIJ A;  3UOM A;  1A8L A;  5D9X A;  2I1U A;  3BCK A;  3CXG A;  4Z2R A;  3W8J A;  5LNK e;  2WZ9 A;  2VCQ A;  4MZW A;  2XHF A;  2IJY A;  3FZA A;  4EL1 A;  1WOU A;  2L59 A;  2H71 A;  3KH7 A;  4ZXG A;  1TRS A;  1ERT A;  2RUE A;  3QCP A;  1BJX A;  4RUV A;  4FYU A;  4CY6 A;  4X1U A;  4BVY B;  2CX4 A;  2PVQ A;  2F8F A;  3I69 A;  1U3I A;  2R5G A;  1GUL A;  5ECP B;  3MWH A;  3LQ7 A;  1O8X A;  5KEJ A;  2YZU A;  5EPF A;  2WRT A;  4OMV A;  3EUR A;  3MYD A;  4QQ7 A;  1ZZY A;  1Z3E A;  2HT9 A;  4ZBB A;  2TRX A;  3A2X A;  1SK1 A;  4TR0 A;  2LJA A;  3UVT A;  3VWU A;  1E2Y A;  2B5Y A;  4X4J A;  2TRC P;  2C3N A;  1QK8 A;  3GYK A;  1OAZ A;  4XTS A;  4JU5 A;  4TR1 B;  2HZE A;  3EPT A;  4D73 A;  3DXB A;  5J41 A;  4IP6 A;  2GQL A;  3VK9 A;  4IJ3 A;  1SL1 B;  2NBS A;  4G0I A;  2ZNM A;  3F4R A;  2VCT A;  4G9H A;  4AF2 A;  1J9B A;  1G7O A;  5EVO A;  2YNX A;  2FWF A;  1TP9 A;  4IQ1 A;  3ME7 A;  4MPF A;  3U5R E;  1I5G A;  1NM3 A;  3I43 A;  3OR5 A;  1RK4 A;  2LUS A;  2OE0 A;  4EF0 A;  2AAW A;  3LJR A;  1GSF A;  4WR5 A;  3JCM L;  3EVI A;  4V2N A;  1T3B A;  4NV2 A;  2CT6 A;  5F07 A;  2A2R A;  4TXV A;  2H30 A;  1Z6N A;  1DE1 A;  4K7O A;  1JZR A;  5G2Z A;  1HNB A;  4PUF C;  5DBQ A;  3LXZ A;  3J7Y k;  4PQ1 A;  2WGR A;  4MJE A;  4L0U A;  3MSZ A;  5ECI B;  2IFQ B;  4K2X A;  2HRA A;  1X5D A;  3RDW A;  5L71 A;  1AUC A;  4N11 A;  1TRV A;  4H86 A;  3PR8 A;  2YWO A;  2DC5 A;  1T4Y A;  3L78 A;  2X8C A;  5A4V A;  4DVC A;  8GSS A;  2C1Y A;  3TGZ A;  2B7K A;  4K5R A;  3VPQ A;  2R6K A;  3D6I A;  1FOV A;  4PNG A;  4EXJ A;  4EDZ A;  2K8S A;  2VCV A;  3ZMK A;  2DSA A;  3O76 A;  2AV4 A;  1QFN A;  1Y6E A;  2HRN A;  1HD2 A;  2YWM A;  3EU4 A;  2IWT A;  3GTU A;  2MBS A;  1EV9 A;  2V6O A;  2VCZ A;  1EWX A;  4BVX B;  4OFT A;  3VFI A;  1ACV A;  2OA7 A;  5IM9 A;  3UBL A;  3UIW A;  5ECM B;  2K18 A;  3QDN A;  2O89 A;  6GSU A;  4E8H A;  3A2W A;  5KN1 A;  3HCZ A;  1M3J A;  5IMC A;  1M99 A;  1EZK A;  5EY6 A;  3ZRD A;  2ON5 A;  3MAK A;  1ERV A;  4LMW A;  3KGK A;  3M1G A;  3KZQ A;  2XPD A;  4Z7X A;  3HXS A;  1AC1 A;  4ZB8 A;  2IMF A;  3TOU A;  2ES7 A;  2E0Q A;  5DVB A;  2GDR A;  2FNO A;  1VF2 A;  2X8H A;  1FHE A;  3QAG A;  3DD3 A;  5C04 A;  5ECN B;  4WXT A;  2L5L A;  3ZFB A;  4A5P A;  2ZCT A;  4ACS A;  2FWE A;  5CRW A;  1OE8 A;  2LRT A;  2PER A;  1YZX A;  1XW5 A;  1Z5Y E;  2GLR A;  1K3L A;  1UA5 A;  4AJ7 A;  2K6V A;  2N5A A;  4IS0 A;  2LKU A;  3DWV A;  3NZN A;  7GSS A;  2MMA A;  3KP8 A;  11GS A;  2AB6 A;  2NDO A;  3SWL A;  3WGX A;  2VL3 A;  6GST A;  1ILO A;  3QPM A;  1PX7 A;  2P5Q A;  1K0A A;  1SD8 A;  4G2E A;  4NV5 A;  1JLW A;  1AIU A;  5CRH A;  5AIS A;  4AJ8 A;  4ECJ A;  4TXO B;  2ON7 A;  4ULX A;  1SU9 A;  2WJU A;  3PIN A;  5D9T A;  5FWG A;  3GFK A;  1AQV A;  4KCE A;  1X5C A;  1M9A A;  1X5E A;  4I8B A;  5DAL A;  4ZL8 A;  3RBT A;  3HVV A;  3FYG A;  1T4Z A;  1EP8 A;  4FQU A;  3GSS A;  4HZ2 A;  3F9U A;  2GSQ A;  5J4U A;  5KN0 A;  5H5Q A;  3ZIV A;  4G0K A;  5ABR A;  2X49 A;  3I9V 2;  2YV7 A;  1GSD A;  2JZS A;  1SJI A;  4K7I A;  3U6V A;  2F9S A;  2O85 A;  1B9Y C;  3Q19 A;  1PL1 A;  3GKK A;  4TKY A;  1A8Y A;  2E7P A;  3MDK A;  3GX0 A;  4KSO A;  4OCF A;  3IV4 A;  4JED A;  3RPP A;  1BAY A;  2C80 A;  2RII A;  4MZC A;  3FHK A;  1WIK A;  1PQN A;  3ZML A;  4K6X A;  2VAF A;  2H75 A;  1WE0 A;  3M0F A;  4O92 A;  4KH7 A;  1FB6 A;  5AGY A;  4MH2 A;  2HXK A;  4LLR A;  2EIR A;  2YWN A;  3LFL A;  3LWA A;  1NW2 A;  3FR6 A;  1F3A A;  1XFL A;  1B9X C;  4V1A g;  1I9D A;  4NWY A;  4F0C A;  2VLU A;  4PQI A;  3FKF A;  1K0B A;  4PQH A;  2J23 A;  4F82 A;  4NHW A;  1EGR A;  2R0G A;  3APQ A;  3GA4 A;  4K1F A;  3TJJ A;  2LEG A;  1Z9H A;  5DAK A;  3KMN A;  1U3A A;  5J9C A;  1FG4 A;  2ALB A;  1GSQ A;  3BBY A;  2VLT A;  1K0O A;  5ECS A;  3GST A;  3LG6 A;  4MH3 A;  5IO0 A;  3FW2 A;  1MD4 A;  2H1B A;  5JCW A;  3CRT A;  5E59 A;  3UBK A;  3ZTL A;  1S3D A;  2VO4 A;  2CA8 A;  1TOF A;  1HNC A;  4QL7 A;  4BL7 A;  4WKW A;  3BJ5 A;  2CV4 A;  1ERU A;  5GSS A;  12GS A;  5ECR B;  1YDK A;  4FH8 A;  4GXZ A;  1T7P B;  2H0G A;  3F0I A;  1GNE A;  3TKP A;  4BPY A;  5G30 A;  2C0G A;  2VIM A;  1G0T A;  1OC3 A;  5IMA A;  3F4T A;  3CTF A;  3KD0 A;  1OC9 B;  3A5I A;  3TKS E;  3HKR A;  2LQQ A;  4OWY A;  1FOH A;  3H1N A;  5BMU A;  2E2M A;  5JWR B;  2J9H A;  3ISO A;  1NSW A;  1TRU A;  4HU9 A;  1ON4 A;  1ZL9 A;  3APO A;  4XS1 A;  1MEK A;  1SK2 A;  1SEN A;  2YV9 A;  2IPA A;  4ZIJ A;  4FIW A;  4GST A;  2VL2 A;  1ZMA A;  2YWI A;  3GL3 A;  4PX1 A;  3QOU A;  1TK8 B;  5HFG A;  3F63 A;  4K9Z A;  4DSS B;  3C1R A;  1N2A A;  3GN3 A;  3TRX A;  2DJK A;  3EYT A;  3D5J A;  4IW9 A;  1Q98 A;  3Q18 A;  3VWX A;  1WP0 A;  2H01 A;  3IAM 2;  1F3B A;  5DQS A;  5G5F A;  1XOA A;  4V2L A;  3IC4 A;  1SYX A;  3M9K A;  4GLT A;  3UEM A;  1TI3 A;  4EIQ A;  1QXH A;  2P0G A;  4PUA A;  4MMM A;  3M8N A;  2L6C A;  5GAP D;  1AW9 A;  4BA7 A;  2I4A A;  2PGT A;  4GSN A;  2FLS A;  1SJ6 A;  3FZ5 A;  4F9Z A;  2JSZ A;  2GT6 A;  5IOX A;  1EP7 A;  2AJQ B;  2LTK A;  2V2G A;  5IO2 A;  4CDO A;  2QC7 A;  3ERF A;  4YQM A;  1Z7P A;  3WYW A;  3EU3 A;  4KW6 A;  2QSI A;  5FT3 A;  4N0V A;  2RLI A;  2YAN A;  3KEB A;  2GT5 A;  2WUL A;  2MZC A;  1GUK A;  4ZB6 A;  2AUV A;  2PU9 C;  5A4W A;  5AN1 A;  5ECL B;  3GUR A;  3Q74 A;  3APS A;  2VL9 A;  3TKR A;  4YH2 A;  4HUA A;  2H6X A;  3IOS A;  1GTA A;  1K0M A;  3K8N A;  1ML6 A;  2WB9 A;  1QQ2 A;  5ELG A;  2DML A;  1BYE A;  1XW9 A;  5FHI A;  3KXO A;  3IK7 A;  4G0L A;  4HJ2 A;  2DJJ A;  2DJ1 A;  3UAP A;  3TKS A;  4F2I A;  2IN3 A;  4K8M A;  4JR6 A;  5LD0 A;  1XVQ A;  2DBC A;  5IOW A;  4V2M A;  5AIX A;  3C73 A;  3HJM A;  2FY6 A;  4BWQ A;  3ME8 A;  2I9H A;  2NPB A;  3TOT A;  2OJL A;  4TR1 A;  3UAR A;  4NHZ A;  1PFO A;  2HRK A;  2LS5 A;  2VCW A;  3WGD A;  1DUG A;  1PSQ A;  1EOH A;  1PRX A;  4MK3 A;  4I5Q A;  3TJB A;  4X43 A;  4N10 A;  3ERG A;  2L4Q A;  3W6G A;  1O81 A;  1SYR A;  1TRW A;  4KB3 A;  2G0F A;  4WBR D;  4Q5Q A;  1TU7 A;  3GKM A;  4JR4 A;  1LBK A;  4EE0 A;  3N9J A;  1BED A;  1AAZ A;  5HQP A;  4NMU A;  4EDY A;  2V32 A;  4ZIL A;  3G9B A;  4D73 B;  3D4T A;  1T8E B;  1F6M C;  3VI5 A;  3IC8 A;  5D9W A;  5CRE A;  1SL0 B;  4F0B A;  1PL2 A;  2LNS A;  1X9W B;  3C8E A;  1ZGN A;  4XRA A;  1K3Y A;  3PH9 A;  3HVS A;  2M46 A;  3IE3 A;  2KOK A;  4KCA A;  1THO A;  2O8V B;  4HOJ A;  3G7I A;  2IFQ A;  5INY A;  5DDL A;  4TW5 A;  4EO3 A;  1TKD B;  3DIE A;  1JZD A;  5IIZ A;  5JWO B;  4L5L A;  1QMV A;  3H93 A;  3D4M A;  1F2E A;  4HDE A;  3UJ1 A;  2GSS A;  3HVN A;  3M3M A;  4PUR A;  2FHE A;  2GTU A;  5CP1 A;  2PPT A;  1FVJ A;  5DCH A;  3LW9 A;  4E8E A;  3EMX A;  1PX6 A;  4AJ6 A;  2PVO C;  4MJA A;  1T00 A;  3HJP A;  4XIH A;  1GSU A;  5E4W A;  1EEJ A;  4O7H A;  3ZFL A;  1SL2 B;  3TJK A;  1G7E A;  4DEJ A;  4IP1 A;  4OO5 A;  1SKR B;  3IHQ A;  1GNW A;  1ZYN A;  3IRA A;  3PPU A;  3BCI A;  4L0W A;  2MBT A;  2FUG 2;  4NPB A;  3RHB A;  3IXR A;  16GS A;  3ZLP A;  1V57 A;  4DSR A;  4BIK A;  4QL9 A;  4IHU A;  1GP1 A;  3S9F A;  5A4U A;  2XBI A;  3TJG A;  3ZRE A;  2V1M A;  1N8J A;  5HR3 A;  1TDI A;  2HSY A;  2CVB A;  1A0R P;  2REM A;  3MNG A;  4KUN A;  1G6Y A;  5B6M A;  4MF6 A;  17GS A;  2CZ2 A;  5C00 A;  5HFI A;  5COH A;  1XG8 A;  2C0E A;  4ECB A;  1NHY A;  3GUS A;  5G1L A;  2IMD A;  5DQY A;  5IMZ A;  2K9F A;  3VI7 A;  4YAP A;  4HU7 A;  4ZBA A;  2HE3 A;  3IK9 A;  1GTB A;  5F05 A;  3E9J B;  3QAW A;  1JZO A;  4LL4 B;  4RI7 A;  5D93 A;  3LSZ A;  1PMT A;  2IMI A;  2H19 A;  3ZIJ A;  13GS A;  3L9U A;  3FZ9 A;  3DML A;  3QFA C;  3D22 A;  5ECH B;  2VD0 A;  5KN2 A;  3ZZX A;  3QAV A;  2PN8 A;  2VUP A;  3HHV A;  1ABA A;  2F3M A;  1S3R A;  4J57 E;  4PTS A;  4IEL A;  4RQR A;  4XCS A;  3A2V A;  4POB A;  3CBU A;  3G7J A;  1U87 A;  4O5Q A;  4FYB A;  2C0F A;  5ID2 A;  5B6N A;  2GZY A;  5CNW A;  2PWJ A;  4KAE A;  3M9J A;  3N5O A;  1DSB A;  2C3T A;  3P2A A;  1H4O A;  4HQZ A;  3LOR A;  5CO3 A;  5D9V A;  1QGV A;  1XPV A;  4IBP A;  2H0H A;  5J3R A;  1U88 A;  4V1A p;  3TJF A;  2DKI A;  2B1K A;  2OAD A;  3CTG A;  1BX9 A;  4KF9 A;  3P7X A;  4YQU A;  2VM1 A;  3P8W A;  2L5O A;  1A2L A;  2DIY A;  2Z9S A;  1PD2 1;  1ST9 A;  2VD1 A;  1B4P A;  22GS A;  4POM A;  4KDX A;  5D73 A;  3IHG A;  3O3T A;  4GF0 A;  4BWS A;  5G5E A;  5CRD A;  2F51 A;  4MP4 A;  3ED3 A;  1VF3 A;  3FMW A;  5J9B A;  1XBS A;  2KLX A;  1RQM A;  1G6W A;  1V40 A;  3DEX A;  3IDV A;  3DRN A;  4F03 A;  3TKS C;  4WEY A;  2R4V A;  4XS4 A;  2I81 A;  4OD7 A;  5H5S A;  2DMM A;  1HYU A;  4EUY A;  4Z2U A;  4OFN A;  4IN0 A;  2H6Y A;  1Q4J A;  5IMD A;  1XCC A;  3ZVJ D;  4FYC A;  4IKH A;  1OC8 A;  1UVZ A;  1BQ7 A;  2L4C A;  3HA9 A;  5F8B A;  4ZL7 A;  4GTU A;  2LQO A;  5D8I A;  1EOG A;  3QD9 A;  2N5F A;  1ZYE A;  2WS2 A;  3PGT A;  2CAQ A;  1A0F A;  1X9S B;  2M72 A;  1JZW A;  4YKG A;  2HSH A;  2KHP A;  2HYX A;  1R5P A;  4POK A;  2XC2 A;  1SK0 A;  4XRD A;  3DKS A;  4HSC X;  1R7H A;  1WJK A;  1LU4 A;  3GH9 A;  1H75 A;  2YZH A;  4TR3 A;  2A4H A;  4MCU A;  1OE7 A;  1OC9 A;  4DSQ A;  3GV1 A;  3FEU A;  5DAK B;  1GL8 A;  5D96 A;  3V1W A;  4POL A; 
#chains in the Genus database with same CATH homology
 2X4A A;  1O6J A;  2P31 A;  1SKW B;  3VWW A;  1FB0 A;  3WT2 A;  2PBJ A;  2BTO T;  1XW6 A;  3BD2 A;  2C3Q A;  2VM2 A;  3FR3 A;  2H74 A;  1M2A A;  2JU5 A;  2C0D A;  2TIR A;  4HJM A;  1ERW A;  1XWB A;  2GS3 A;  3C71 A;  2N5B A;  3KCM A;  1WWJ A;  1THX A;  1TW9 A;  1MTC A;  4GRF A;  5A5K A;  4EVM A;  1DE2 A;  4GCI A;  2YJ7 A;  1HNA A;  1V98 A;  1ZCP A;  3IR4 A;  3CSH A;  2A2P A;  3C1S A;  4KDY A;  3GHA A;  1XWK A;  3O6T A;  2GVP A;  4WF5 A;  1KBN A;  2R3X A;  3R2Q A;  5F0G A;  2AYT A;  1R4W A;  2MMO A;  5IQY A;  1S3C A;  4KND A;  3KM6 A;  2XBQ A;  2RUF A;  10GS A;  1B8X A;  2G2Q A;  1BG5 A;  2CAI A;  4L5O A;  1V9W A;  2JSY A;  4ILF A;  2O87 A;  3F3Q A;  4ISD A;  1EV4 A;  2QGV A;  2HLS A;  3DGQ A;  2H66 A;  1XIY A;  3Q6O A;  2JAD A;  4I97 A;  2NVL A;  1RW1 A;  1GUM A;  3US3 A;  3GKX A;  2ZUP A;  1AQX A;  4BVY A;  1YJ6 A;  2MMZ A;  1PN0 A;  2FCH A;  3F6D A;  2CQ9 A;  3SBC A;  4YKF A;  3E0U A;  1F37 A;  3F8U A;  1WMJ A;  4MLY A;  4RI6 A;  4Q5R A;  4MPG A;  2VOC A;  4K2D A;  1TK5 B;  2H73 A;  3KTL A;  2XPE A;  19GS A;  3FY7 A;  5DJL A;  2YCD A;  3GMF A;  2IL3 A;  3HD5 A;  4GQF A;  4I6X A;  4ZL9 A;  2BMX A;  3HY2 A;  2YP6 A;  2CZ3 A;  3FRC A;  1OKT A;  4HQS A;  4HS1 A;  1C72 A;  1V58 A;  3L4N A;  4N30 A;  2RM5 A;  1A2J A;  3HYP A;  1XWC A;  4N0Z A;  4IQA A;  5ELA A;  2GGT A;  2WFC A;  1JHB A;  2CVD A;  4TR4 A;  5HR0 A;  1FO5 A;  1AQW A;  1M0U A;  2R37 A;  3C7M A;  3IA1 A;  4TN8 A;  2LRN A;  2X99 A;  3TUE A;  4K7N A;  5HFK A;  2X64 A;  6GSV A;  4XHM A;  3A3T A;  4Q5N A;  2DLX A;  2IIY A;  2LJK A;  3LGC A;  2MYG A;  1UC7 A;  3CSI A;  1SKS B;  2GQM A;  3VLN A;  4LMV A;  3VWV A;  1X9M B;  4G10 A;  1K3O A;  3LEF A;  3EWL A;  2HZE B;  3H79 A;  3HZ4 A;  4YAV A;  3IPZ A;  1USB A;  3FR9 A;  2DIZ A;  1WPI A;  3ZYW A;  2FD3 A;  1GRX A;  2V6K A;  3GH6 A;  6GSY A;  2R2J A;  4K0N A;  1XVW A;  2CVK A;  4K0G A;  1EEM A;  5CRG A;  3QR6 A;  4MF7 A;  2HSM A;  4ECI A;  1PKZ A;  1XXU A;  4KE3 A;  2QKE A;  3TCO A;  1JFU A;  4ML6 A;  3CSJ A;  1SD9 A;  5H5R A;  4MJC A;  1TI1 A;  4JBB A;  1CQH A;  4MZB A;  3AY8 A;  1YQ1 A;  1GWC A;  3DYR A;  3WT1 A;  3IBH A;  2FWG A;  1YEP A;  5GZZ B;  3ERW A;  4EIP A;  2CX3 A;  2YOI A;  4JRR A;  3DVX A;  3BOA A;  2H6Z A;  5CAX A;  1M7T A;  2FWH A;  1K0N A;  4ZB9 A;  4J56 E;  3EE2 A;  4BVX A;  1M9B A;  2IME A;  4MJB A;  3MIX A;  2F8A A;  3F4S A;  2UZ8 A;  1AXD A;  4CW9 A;  3WD6 A;  1E6B A;  1XWA A;  5BRT A;  1SJZ A;  3E3E A;  6GSW A;  2C4J A;  2IMK A;  5CYY A;  2VCX A;  3A5W A;  2MMN A;  4HEA 2;  3GRX A;  4OFM A;  4PXO A;  4PGT A;  1GUH A;  1FVK A;  2RM6 A;  3LXT A;  4TRX A;  5IPG A;  1YKA A;  3GTU B;  2NTO A;  4K5S A;  3HZ8 A;  3RAZ A;  3TB2 A;  3L9S A;  1XOB A;  2B5X A;  5EL8 A;  3H8Q A;  4GQC A;  2GSR A;  2OBK A;  2FA4 A;  2JAC A;  2VL2 C;  2VLV A;  4NXI A;  4LL1 B;  6GSS A;  4NAX A;  2D2Z A;  3D0Z A;  4Z2T A;  4JE1 A;  2WCI A;  2H70 A;  3TRQ A;  1GTU A;  2JZR A;  4ML1 A;  1GSE A;  2EIO A;  1IYH A;  2QA2 A;  5ECK B;  4FO5 A;  2V41 A;  4G19 A;  4I2T A;  1V2A A;  4O5U A;  4USS A;  1WRY A;  2L57 A;  3D21 A;  4LA1 A;  2OBI A;  4TXO A;  5G1K A;  4IJI A;  1X0R A;  4KA0 A;  3L9V A;  3KMO A;  4AGS A;  2PUK C;  1URM A;  2A4V A;  2YN1 A;  4L8E A;  3CYN A;  1TJD A;  4CY8 A;  4MDC A;  3RHC A;  1W89 A;  4MNN A;  5HR2 A;  3VPT A;  2M80 A;  3QMX A;  3F3R A;  4WF4 A;  1GTI A;  1NHO A;  5G31 A;  3F6F A;  3GKN A;  3DVW A;  5IPH A;  3TRP A;  2GQK A;  4MAB A;  1FAA A;  2OAC A;  1GSY A;  3G7Y A;  4ZBD A;  5LCZ A;  1MDJ A;  1Z7R A;  5F06 A;  2H72 A;  2H1D A;  5KOX A;  2H76 A;  1YEX A;  4Q5F A;  1S3A A;  3TKQ A;  2O7K A;  5B8B A;  1EGO A;  3UVH A;  4RQX A;  1T1V A;  1GSS A;  2LNT A;  2I3Y A;  2DJ3 A;  5ID2 B;  4O5R A;  5KOW A;  1TTZ A;  2R0P A;  4EC0 A;  1QUW A;  5DAL B;  3P90 A;  1GLQ A;  5JWQ B;  1GLP A;  2EC4 A;  2KP1 A;  3ZVJ A;  3W8S A;  2K8V A;  3KP9 A;  1VF1 A;  2OE1 A;  3R3E A;  4KDU A;  2H1G A;  5HR1 A;  3TDG A;  4PNF A;  2YJH A;  3WGE A;  1DBY A;  2WDU A;  2A2S A;  4XS6 A;  2FA8 A;  2AHE A;  5AIV A;  4IVF A;  2H1A A;  4KGI A;  4IGJ A;  3HVX A;  2OKA A;  2HRF A;  4GSS A;  3CRU A;  3FZ4 A;  4WR4 A;  1TXX A;  2HI7 A;  1J0F A;  3KTB A;  1O8W A;  4XS4 B;  3RPN A;  1KTE A;  4GWR A;  1OVN A;  2H0I A;  1UN2 A;  3LYK A;  3HJO A;  3FK8 A;  2R0C A;  3VUR A;  4P3Y B;  4KSM A;  4WET A;  18GS A;  1F9M A;  3GL5 A;  1KNG A;  5GAN D;  5IMV A;  3J7Y b;  2HFD A;  1FW1 A;  3GIX A;  2B5E A;  3QFB C;  2LRC A;  2GST A;  20GS A;  5B8A A;  1U6T A;  1ZYP A;  2FGX A;  3KJY A;  4TOP A;  3L0H A;  3CMI A;  1JLV A;  1LJR A;  1OKD A;  2B1L A;  1K0C A;  1KEB A;  5B7C A;  2HZF A;  2B6M A;  5DJM A;  3KH9 A;  3I6A A;  1K0D A;  3EMP A;  2C8U A;  4KX4 A;  2GZZ A;  4ID0 A;  2QA1 A;  1Z6M A;  2E2G A;  5J5N A;  2YPM A;  2HNL A;  1J08 A;  2JL4 A;  6GSX A;  4WBJ A;  9GSS A;  5IMF A;  4HI7 A;  2KUC A;  3UMA A;  2X8G A;  4BL7 B;  4TVE A;  5JCG A;  2PMT A;  5DCG A;  2OE3 A;  5ECO B;  5ENU A;  1XWG A;  2LV3 A;  4HZ4 A;  4DSS A;  1TU8 A;  1ZYQ B;  1R26 A;  4MA9 A;  3UL3 A;  1M2D A;  2P5R A;  2DJ2 A;  1A23 A;  5KN3 A;  2EIQ A;  1VRS D;  1Y25 A;  1HQO A;  1B48 A;  5JCU A;  3ZL5 A;  1A24 A;  4MF5 A;  2LJR A;  1XZO A;  4OO4 A;  1PKW A;  2B7J A;  2B3S A;  2L6D A;  3NIV A;  2DKH A;  3ZIT A;  1VGL A;  5GST A;  2DJ0 A;  4JZQ A;  3GX8 A;  1O73 A;  1ZOF A;  1PA3 A;  1YY7 A;  1YKC A;  1B4Q A;  2KP2 A;  1CQG A;  1O7U A;  1VF4 A;  4I2U A;  1W4V A;  1YF1 A;  2LST A;  1M2B A;  1O85 A;  1GH2 A;  1MDI A;  3NOF A;  4EKZ A;  4ICY A;  5ECQ B;  3GNJ A;  2JZT A;  4ECC A;  4CHS A;  1OYJ A;  3LYP A;  3IAS 2;  1MD3 A;  3EIN A;  2BJX A;  1TK0 B;  1A2M A;  1PGT A;  4YQV A;  4OCE A;  1YF0 A;  1PN9 A;  1R5A A;  2GZP A;  4O32 A;  3HDC A;  4J2F A;  1MDK A;  1IYI A;  14GS A;  3H4K A;  3EC3 A;  4X0X A;  2H8L A;  3KIJ A;  3UOM A;  1A8L A;  5D9X A;  2I1U A;  3BCK A;  3CXG A;  4Z2R A;  3W8J A;  5LNK e;  2WZ9 A;  2VCQ A;  4MZW A;  2XHF A;  2IJY A;  3FZA A;  4EL1 A;  1WOU A;  2L59 A;  2H71 A;  3KH7 A;  4ZXG A;  1TRS A;  1ERT A;  2RUE A;  3QCP A;  1BJX A;  4RUV A;  4FYU A;  4CY6 A;  4X1U A;  4BVY B;  2CX4 A;  2PVQ A;  2F8F A;  3I69 A;  1U3I A;  2R5G A;  1GUL A;  5ECP B;  3MWH A;  3LQ7 A;  1O8X A;  5KEJ A;  2YZU A;  5EPF A;  2WRT A;  4OMV A;  3EUR A;  3MYD A;  4QQ7 A;  1ZZY A;  1Z3E A;  2HT9 A;  4ZBB A;  2TRX A;  3A2X A;  1SK1 A;  4TR0 A;  2LJA A;  3UVT A;  3VWU A;  1E2Y A;  2B5Y A;  4X4J A;  2TRC P;  2C3N A;  1QK8 A;  3GYK A;  1OAZ A;  4XTS A;  4JU5 A;  4TR1 B;  2HZE A;  3EPT A;  4D73 A;  3DXB A;  5J41 A;  4IP6 A;  2GQL A;  3VK9 A;  4IJ3 A;  1SL1 B;  2NBS A;  4G0I A;  2ZNM A;  3F4R A;  2VCT A;  4G9H A;  4AF2 A;  1J9B A;  1G7O A;  5EVO A;  2YNX A;  2FWF A;  1TP9 A;  4IQ1 A;  3ME7 A;  4MPF A;  3U5R E;  1I5G A;  1NM3 A;  3I43 A;  3OR5 A;  1RK4 A;  2LUS A;  2OE0 A;  4EF0 A;  2AAW A;  3LJR A;  1GSF A;  4WR5 A;  3JCM L;  3EVI A;  4V2N A;  1T3B A;  4NV2 A;  2CT6 A;  5F07 A;  2A2R A;  4TXV A;  2H30 A;  1Z6N A;  1DE1 A;  4K7O A;  1JZR A;  5G2Z A;  1HNB A;  4PUF C;  5DBQ A;  3LXZ A;  3J7Y k;  4PQ1 A;  2WGR A;  4MJE A;  4L0U A;  3MSZ A;  5ECI B;  2IFQ B;  4K2X A;  2HRA A;  1X5D A;  3RDW A;  5L71 A;  1AUC A;  4N11 A;  1TRV A;  4H86 A;  3PR8 A;  2YWO A;  2DC5 A;  1T4Y A;  3L78 A;  2X8C A;  5A4V A;  4DVC A;  8GSS A;  2C1Y A;  3TGZ A;  2B7K A;  4K5R A;  3VPQ A;  2R6K A;  3D6I A;  1FOV A;  4PNG A;  4EXJ A;  4EDZ A;  2K8S A;  2VCV A;  3ZMK A;  2DSA A;  3O76 A;  2AV4 A;  1QFN A;  1Y6E A;  2HRN A;  1HD2 A;  2YWM A;  3EU4 A;  2IWT A;  3GTU A;  2MBS A;  1EV9 A;  2V6O A;  2VCZ A;  1EWX A;  4BVX B;  4OFT A;  3VFI A;  1ACV A;  2OA7 A;  5IM9 A;  3UBL A;  3UIW A;  5ECM B;  2K18 A;  3QDN A;  2O89 A;  6GSU A;  4E8H A;  3A2W A;  5KN1 A;  3HCZ A;  5IMC A;  1M99 A;  1EZK A;  5EY6 A;  3ZRD A;  2ON5 A;  3MAK A;  1ERV A;  4LMW A;  3KGK A;  3M1G A;  3KZQ A;  2XPD A;  4Z7X A;  3HXS A;  1AC1 A;  4ZB8 A;  2IMF A;  3TOU A;  2ES7 A;  2E0Q A;  5DVB A;  2GDR A;  2FNO A;  1VF2 A;  2X8H A;  1FHE A;  3QAG A;  3DD3 A;  5C04 A;  5ECN B;  4WXT A;  2L5L A;  3ZFB A;  4A5P A;  2ZCT A;  4ACS A;  2FWE A;  5CRW A;  1OE8 A;  2LRT A;  2PER A;  1YZX A;  1XW5 A;  1Z5Y E;  2GLR A;  1K3L A;  1UA5 A;  4AJ7 A;  2K6V A;  2N5A A;  4IS0 A;  2LKU A;  3DWV A;  3NZN A;  7GSS A;  2MMA A;  3KP8 A;  11GS A;  2AB6 A;  2NDO A;  3SWL A;  3WGX A;  2VL3 A;  6GST A;  1ILO A;  3QPM A;  1PX7 A;  2P5Q A;  1K0A A;  1SD8 A;  4G2E A;  4NV5 A;  1JLW A;  1AIU A;  5CRH A;  5AIS A;  4AJ8 A;  4ECJ A;  4TXO B;  2ON7 A;  4ULX A;  1SU9 A;  2WJU A;  3PIN A;  5D9T A;  5FWG A;  3GFK A;  1AQV A;  4KCE A;  1X5C A;  1M9A A;  1X5E A;  4I8B A;  5DAL A;  4ZL8 A;  3RBT A;  3HVV A;  3FYG A;  1T4Z A;  1EP8 A;  4FQU A;  3GSS A;  4HZ2 A;  3F9U A;  2GSQ A;  5J4U A;  5KN0 A;  5H5Q A;  3ZIV A;  4G0K A;  5ABR A;  2X49 A;  3I9V 2;  2YV7 A;  1GSD A;  2JZS A;  1SJI A;  4K7I A;  3U6V A;  2F9S A;  2O85 A;  1B9Y C;  3Q19 A;  1PL1 A;  3GKK A;  4TKY A;  1A8Y A;  2E7P A;  3MDK A;  3GX0 A;  4KSO A;  4OCF A;  3IV4 A;  4JED A;  3RPP A;  1BAY A;  2C80 A;  2RII A;  4MZC A;  3FHK A;  1WIK A;  1PQN A;  3ZML A;  4K6X A;  2VAF A;  2H75 A;  1WE0 A;  3M0F A;  4O92 A;  4KH7 A;  1FB6 A;  5AGY A;  4MH2 A;  2HXK A;  4LLR A;  2EIR A;  2YWN A;  3LFL A;  3LWA A;  1NW2 A;  3FR6 A;  1F3A A;  1XFL A;  1B9X C;  4V1A g;  1I9D A;  4NWY A;  4F0C A;  2VLU A;  4PQI A;  3FKF A;  1K0B A;  4PQH A;  2J23 A;  4F82 A;  4NHW A;  1EGR A;  2R0G A;  3APQ A;  3GA4 A;  4K1F A;  3TJJ A;  2LEG A;  1Z9H A;  5DAK A;  3KMN A;  1U3A A;  5J9C A;  1FG4 A;  2ALB A;  1GSQ A;  3BBY A;  2VLT A;  1K0O A;  5ECS A;  3GST A;  3LG6 A;  4MH3 A;  5IO0 A;  3FW2 A;  1MD4 A;  2H1B A;  5JCW A;  3CRT A;  5E59 A;  3UBK A;  3ZTL A;  1S3D A;  2VO4 A;  2CA8 A;  1TOF A;  1HNC A;  4QL7 A;  4BL7 A;  4WKW A;  3BJ5 A;  2CV4 A;  1ERU A;  5GSS A;  12GS A;  5ECR B;  1YDK A;  4FH8 A;  4GXZ A;  1T7P B;  2H0G A;  3F0I A;  1GNE A;  3TKP A;  4BPY A;  5G30 A;  2C0G A;  2VIM A;  1G0T A;  1OC3 A;  5IMA A;  3F4T A;  3CTF A;  3KD0 A;  1OC9 B;  3A5I A;  3TKS E;  3HKR A;  2LQQ A;  4OWY A;  1FOH A;  3H1N A;  5BMU A;  2E2M A;  5JWR B;  2J9H A;  3ISO A;  1NSW A;  1TRU A;  4HU9 A;  1ON4 A;  1ZL9 A;  3APO A;  4XS1 A;  1MEK A;  1SK2 A;  1SEN A;  2YV9 A;  2IPA A;  4ZIJ A;  4FIW A;  4GST A;  2VL2 A;  1ZMA A;  2YWI A;  3GL3 A;  4PX1 A;  3QOU A;  1TK8 B;  5HFG A;  3F63 A;  4K9Z A;  4DSS B;  3C1R A;  1N2A A;  3GN3 A;  3TRX A;  2DJK A;  3EYT A;  3D5J A;  4IW9 A;  1Q98 A;  3Q18 A;  3VWX A;  1WP0 A;  2H01 A;  3IAM 2;  1F3B A;  5DQS A;  5G5F A;  1XOA A;  4V2L A;  3IC4 A;  1SYX A;  3M9K A;  4GLT A;  3UEM A;  1TI3 A;  4EIQ A;  1QXH A;  2P0G A;  4PUA A;  4MMM A;  3M8N A;  2L6C A;  5GAP D;  1AW9 A;  4BA7 A;  2I4A A;  2PGT A;  4GSN A;  2FLS A;  1SJ6 A;  3FZ5 A;  4F9Z A;  2JSZ A;  2GT6 A;  5IOX A;  1EP7 A;  2AJQ B;  2LTK A;  2V2G A;  5IO2 A;  4CDO A;  2QC7 A;  3ERF A;  4YQM A;  1Z7P A;  3WYW A;  3EU3 A;  4KW6 A;  2QSI A;  5FT3 A;  4N0V A;  2RLI A;  2YAN A;  3KEB A;  2GT5 A;  2WUL A;  2MZC A;  1GUK A;  4ZB6 A;  2AUV A;  2PU9 C;  5A4W A;  5AN1 A;  5ECL B;  3GUR A;  3Q74 A;  3APS A;  2VL9 A;  3TKR A;  4YH2 A;  4HUA A;  2H6X A;  3IOS A;  1GTA A;  1K0M A;  3K8N A;  1ML6 A;  2WB9 A;  1QQ2 A;  5ELG A;  2DML A;  1BYE A;  1XW9 A;  5FHI A;  3KXO A;  3IK7 A;  4G0L A;  4HJ2 A;  2DJJ A;  2DJ1 A;  3UAP A;  3TKS A;  4F2I A;  2IN3 A;  4K8M A;  4JR6 A;  5LD0 A;  1XVQ A;  2DBC A;  5IOW A;  4V2M A;  5AIX A;  3C73 A;  3HJM A;  2FY6 A;  4BWQ A;  3ME8 A;  2I9H A;  2NPB A;  3TOT A;  2OJL A;  4TR1 A;  3UAR A;  4NHZ A;  2HRK A;  2LS5 A;  2VCW A;  3WGD A;  1DUG A;  1PSQ A;  1EOH A;  1PRX A;  4MK3 A;  4I5Q A;  3TJB A;  4X43 A;  4N10 A;  3ERG A;  2L4Q A;  3W6G A;  1O81 A;  1SYR A;  1TRW A;  4KB3 A;  2G0F A;  4WBR D;  4Q5Q A;  1TU7 A;  3GKM A;  4JR4 A;  1LBK A;  4EE0 A;  3N9J A;  1BED A;  1AAZ A;  5HQP A;  4NMU A;  4EDY A;  2V32 A;  4ZIL A;  3G9B A;  4D73 B;  3D4T A;  1T8E B;  1F6M C;  3VI5 A;  3IC8 A;  5D9W A;  5CRE A;  1SL0 B;  4F0B A;  1PL2 A;  2LNS A;  1X9W B;  3C8E A;  1ZGN A;  4XRA A;  1K3Y A;  3PH9 A;  3HVS A;  2M46 A;  3IE3 A;  2KOK A;  4KCA A;  1THO A;  2O8V B;  4HOJ A;  3G7I A;  2IFQ A;  5INY A;  5DDL A;  4TW5 A;  4EO3 A;  1TKD B;  3DIE A;  1JZD A;  5IIZ A;  5JWO B;  4L5L A;  1QMV A;  3H93 A;  3D4M A;  1F2E A;  4HDE A;  3UJ1 A;  2GSS A;  3M3M A;  4PUR A;  2FHE A;  2GTU A;  5CP1 A;  2PPT A;  1FVJ A;  5DCH A;  3LW9 A;  4E8E A;  3EMX A;  1PX6 A;  4AJ6 A;  2PVO C;  4MJA A;  1T00 A;  3HJP A;  4XIH A;  1GSU A;  5E4W A;  1EEJ A;  4O7H A;  3ZFL A;  1SL2 B;  3TJK A;  1G7E A;  4DEJ A;  4IP1 A;  4OO5 A;  1SKR B;  3IHQ A;  1GNW A;  1ZYN A;  3IRA A;  3PPU A;  3BCI A;  4L0W A;  2MBT A;  2FUG 2;  4NPB A;  3RHB A;  3IXR A;  16GS A;  3ZLP A;  1V57 A;  4DSR A;  4QL9 A;  4IHU A;  1GP1 A;  3S9F A;  5A4U A;  2XBI A;  3TJG A;  3ZRE A;  2V1M A;  1N8J A;  5HR3 A;  1TDI A;  2HSY A;  2CVB A;  1A0R P;  2REM A;  3MNG A;  4KUN A;  1G6Y A;  5B6M A;  4MF6 A;  17GS A;  2CZ2 A;  5C00 A;  5HFI A;  5COH A;  2C0E A;  4ECB A;  1NHY A;  3GUS A;  5G1L A;  2IMD A;  5DQY A;  5IMZ A;  2K9F A;  3VI7 A;  4YAP A;  4HU7 A;  4ZBA A;  2HE3 A;  3IK9 A;  1GTB A;  5F05 A;  3E9J B;  3QAW A;  1JZO A;  4LL4 B;  4RI7 A;  5D93 A;  3LSZ A;  1PMT A;  2IMI A;  2H19 A;  3ZIJ A;  13GS A;  3L9U A;  3FZ9 A;  3DML A;  3QFA C;  3D22 A;  5ECH B;  2VD0 A;  5KN2 A;  3ZZX A;  3QAV A;  2PN8 A;  2VUP A;  3HHV A;  1ABA A;  2F3M A;  4J57 E;  4PTS A;  4IEL A;  4RQR A;  4XCS A;  3A2V A;  4POB A;  3CBU A;  3G7J A;  1U87 A;  4O5Q A;  4FYB A;  2C0F A;  5ID2 A;  5B6N A;  2GZY A;  5CNW A;  2PWJ A;  4KAE A;  3M9J A;  3N5O A;  1DSB A;  2C3T A;  3P2A A;  1H4O A;  4HQZ A;  3LOR A;  5CO3 A;  5D9V A;  1QGV A;  1XPV A;  4IBP A;  2H0H A;  5J3R A;  1U88 A;  4V1A p;  3TJF A;  2DKI A;  2B1K A;  2OAD A;  3CTG A;  1BX9 A;  4KF9 A;  3P7X A;  4YQU A;  2VM1 A;  3P8W A;  2L5O A;  1A2L A;  2DIY A;  2Z9S A;  1PD2 1;  1ST9 A;  2VD1 A;  1B4P A;  22GS A;  4POM A;  4KDX A;  5D73 A;  3IHG A;  3O3T A;  4GF0 A;  4BWS A;  5G5E A;  5CRD A;  2F51 A;  4MP4 A;  3ED3 A;  1VF3 A;  3FMW A;  5J9B A;  1XBS A;  2KLX A;  1RQM A;  1G6W A;  1V40 A;  3DEX A;  3IDV A;  3DRN A;  4F03 A;  3TKS C;  4WEY A;  2R4V A;  4XS4 A;  2I81 A;  4OD7 A;  5H5S A;  2DMM A;  1HYU A;  4EUY A;  4Z2U A;  4OFN A;  4IN0 A;  2H6Y A;  1Q4J A;  5IMD A;  1XCC A;  3ZVJ D;  4FYC A;  4IKH A;  1OC8 A;  1UVZ A;  1BQ7 A;  2L4C A;  3HA9 A;  5F8B A;  4ZL7 A;  4GTU A;  2LQO A;  5D8I A;  1EOG A;  3QD9 A;  2N5F A;  1ZYE A;  2WS2 A;  3PGT A;  2CAQ A;  1A0F A;  1X9S B;  2M72 A;  1JZW A;  4YKG A;  2HSH A;  2KHP A;  2HYX A;  1R5P A;  4POK A;  2XC2 A;  1SK0 A;  4XRD A;  3DKS A;  1R7H A;  1WJK A;  1LU4 A;  3GH9 A;  1H75 A;  2YZH A;  4TR3 A;  2A4H A;  4MCU A;  1OE7 A;  1OC9 A;  4DSQ A;  3GV1 A;  3FEU A;  5DAK B;  1GL8 A;  5D96 A;  3V1W A;  4POL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...