3GYKA

The crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
174
structure length
174
Chain Sequence
NANRDSLFNDPNAPVLGNPEGDVTVVEFFDYNCPYCRRAMAEVQGLVDADPNVRLVYREWPILGEGSDFAARAALAARQQGKYEAFHWALMGMSGKANETGVLRIAREVGLDTEQLQRDMEAPEVTAHIAQSMALAQKLGFNGTPSFVVEDALVPGFVEQSQLQDAVDRARKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 27kDa outer membrane protein
publication title The crystal structure of a thioredoxin-like oxidoreductase from Silicibacter pomeroyi DSS-3
rcsb
source organism Silicibacter pomeroyi
total genus 62
structure length 174
sequence length 174
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gykA00
4HZ4A 3EMPA 1A8YA 2PVOC 2VLVA 1A23A 5J4UA 1NW2A 2IMKA 1GULA 1GUMA 1GSDA 3KMNA 3G9BA 2V2GA 1GWCA 2RM5A 1M99A 4BVXA 4J56E 3KGKA 4POLA 3TJKA 1JFUA 2VLUA 1HNAA 3VI7A 1ERWA 3L9VA 3L78A 1I9DA 1HNCA 1PL1A 4CHSA 2L5LA 5KN2A 3HVXA 2JSYA 2L57A 1B8XA 4MF7A 4DSSB 2P5QA 1LU4A 5EVOA 3ERWA 4NXIA 4NWYA 2FWGA 1O7UA 22GSA 5CP1A 2ZCTA 1EGRA 1OC9B 2O89A 3TKSC 2X8CA 4V2MA 2OE3A 14GSA 3KEBA 2JZSA 4NMUA 3W6GA 2F8FA 1A2MA 1TTZA 2H6ZA 5KEJA 4HOJA 4ECBA 1SJIA 2AYTA 3UMAA 2HZEA 1PKWA 1QFNA 1XFLA 3GL3A 1YJ6A 3HA9A 2VL3A 3KCMA 2PGTA 1Z5YE 2FWEA 1B4PA 1GSUA 3EYTA 5FHIA 3APSA 1G6YA 1M2AA 4EE0A 5ECLB 1XWGA 3F3QA 4GXZA 4KE3A 1MD3A 4MJEA 2J9HA 4OFNA 2KHPA 3QAGA 4AGSA 4XS4A 1X9MB 3LXZA 3GL5A 5D9VA 2YWIA 1UVZA 2R37A 2R4VA 10GSA 1U87A 2WJUA 3KXOA 4KDYA 2WS2A 3BCIA 2HLSA 4TR4A 2VCTA 3HXSA 3GH9A 4Z7XA 2PUKC 2VOCA 2EIRA 3GURA 2RM6A 4PQ1A 1BJXA 1PKZA 1I5GA 4ZB8A 3GX8A 2FA8A 4RQRA 3WGXA 3E3EA 5B6NA 3CMIA 2DJ2A 3KP9A 5D9WA 2PU9C 2YWMA 1T7PB 4GF0A 4KDXA 3TJJA 2X99A 3ZMKA 3VPQA 1TU8A 1WIKA 4FYCA 3TKRA 5CO3A 3D4TA 2C0FA 2HRNA 1Z9HA 2XPDA 2GQLA 3UEMA 1W4VA 1ML6A 3QDNA 3GTUB 5B8BA 4XRAA 4CDOA 4WF4A 1GSFA 2L59A 1GNWA 1XW6A 2XHFA 4TXVA 1SL1B 1N8JA 2C0GA 2B1LA 4YQMA 4ZIJA 3MWHA 2MMNA 3GKMA 1GSYA 5IMAA 1IYHA 4IN0A 3F4SA 1EV4A 3GN3A 1GSQA 4O32A 3M3MA 4GSTA 2IIYA 4L8EA 4G10A 1XW5A 3TB2A 2LRCA 4GRFA 1O85A 3NIVA 5DQSA 1EV9A 5IMFA 3UVTA 1TRUA 3F6DA 1GNEA 4L0UA 1FO5A 4TR3A 1WOUA 3DKSA 1VRSD 2X8GA 3LGCA 6GSWA 5D93A 3EU3A 4PUAA 2R6KA 4O7HA 5DAKB 3IDVA 4IVFA 3KIJA 1YF1A 2OKAA 3KM6A 2WCIA 2DJJA 1LJRA 5ECRB 4WBJA 5HR1A 1PQNA 4PGTA 3FZAA 1AQVA 2LJKA 6GSSA 1BX9A 2VCVA 3Q19A 4EKZA 4ZB9A 2CVKA 4JU5A 1YEXA 4EL1A 3ZREA 1OE7A 5CAXA 1TI1A 1B9YC 2L6CA 4K7IA 5D73A 2JSZA 3WT2A 4YAPA 1WPIA 5JCUA 3CTGA 1QUWA 3C73A 1V57A 1ILOA 5D96A 2HYXA 3KZQA 3HJOA 2OBIA 3RBTA 5IOWA 3D0ZA 3TOTA 3TKQA 2ON5A 3F6FA 4JZQA 2WZ9A 3HKRA 5HFIA 5IMVA 3ZLPA 2H0HA 1JHBA 2JZRA 3VFIA 1XBSA 3M8NA 5ELAA 1U6TA 4LL4B 4HJMA 2AAWA 2DLXA 3G7IA 5G30A 3E0UA 3KH9A 3TOUA 1OYJA 3EC3A 3C71A 3D6IA 1SL0B 5JWRB 2DC5A 2FY6A 5INYA 3CSJA 2B7JA 5F0GA 4H86A 4WF5A 1EZKA 1NM3A 3DMLA 4EC0A 1F2EA 2G0FA 5DALA 4ILFA 4KW6A 1JZOA 5D9TA 2VO4A 3GUSA 4WBRD 1A8LA 1TRWA 2YNXA 2O7KA 2KOKA 4E8HA 5KN1A 2C80A 1EOGA 3U5RE 2DJKA 3PR8A 2M46A 3VWVA 2GSRA 3GSTA 8GSSA 3UAPA 1O81A 1X5CA 3FEUA 3IE3A 1F3AA 1ACVA 1CQHA 5ID2A 2IFQA 4HJ2A 3TGZA 2CX4A 4I5QA 3TRPA 4I8BA 1TKDB 4G2EA 2E2MA 1ERVA 4K7OA 3TCOA 2DIYA 2GDRA 1GTAA 4V1Ap 1Z7RA 4AJ7A 1XWCA 3F4TA 4MH2A 5H5SA 1EOHA 3M1GA 2JACA 4TR1B 3IK9A 1T1VA 4FH8A 1PL2A 1GL8A 1A0FA 5EPFA 3UOMA 2VM2A 1VGLA 4TRXA 3FW2A 2DSAA 5JWOB 1KNGA 1AC1A 5IO2A 1C72A 3C1SA 2B5EA 5HR0A 12GSA 4ML1A 2IMIA 2FNOA 3G7YA 1PX7A 2BJXA 1XOAA 3MDKA 1TK0B 3TKSE 4DSQA 2OE1A 2E0QA 3PH9A 2YPMA 3UBKA 5L71A 1TK5B 4JR4A 3NOFA 3UBLA 5IO0A 4MF6A 4QL9A 2LSTA 5KN3A 1A2JA 1FHEA 3DEXA 4Q5FA 2CQ9A 2IMFA 3KH7A 4HEA2 1GSSA 5EL8A 3WYWA 4RUVA 2C3QA 1TW9A 2EC4A 3FYGA 1URMA 4HS1A 1K0DA 1AW9A 1WWJA 18GSA 2FWHA 2GSTA 3QAVA 3M9KA 3GRXA 5ABRA 1K0OA 4YQUA 5JCGA 3BD2A 3ZVJD 4YH2A 4IQ1A 4KX4A 4AF2A 3H79A 2H19A 1SK0A 4ZL7A 4NHZA 1UA5A 3WD6A 4Q5RA 3FZ4A 3HJMA 1Y25A 3F9UA 2V1MA 3E9JB 1K3OA 5GSSA 2YWOA 3LXTA 4MPFA 1XCCA 4FYUA 1M2DA 1SK1A 2WGRA 4LMWA 2O85A 3ZVJA 1QGVA 3HHVA 4POBA 2DJ3A 1VF4A 4NPBA 3WGEA 1BAYA 1GLQA 2AJQB 3LG6A 4DSSA 2C4JA 2B1KA 4K6XA 2K9FA 3IRAA 4NAXA 3DGQA 1K0CA 4ZXGA 4POMA 1YY7A 1FOVA 5DCGA 1M0UA 2H73A 1E2YA 4N30A 3LYKA 1FVJA 4O92A 2GT5A 4IJIA 2AHEA 3F8UA 4OWYA 3ZFLA 3ZL5A 2PMTA 5ENUA 4BA7A 3JCML 4IP6A 4GSNA 2B5XA 4MLYA 4PNFA 1OVNA 1WJKA 3ZFBA 5LCZA 1PA3A 1Z7PA 1SKWB 3FR9A 2X8HA 5B8AA 5C00A 2GSSA 4X1UA 3QFAC 4KAEA 4EVMA 3UL3A 1XIYA 3L0HA 2FLSA 1FVKA 4TR0A 1DE1A 2LJRA 2YWNA 1SL2B 3MSZA 1YDKA 3EINA 1H75A 4ISDA 4GQFA 1W89A 4LMVA 3Q6OA 3ZTLA 1M7TA 2OACA 2I3YA 2PVQA 2ZUPA 3I6AA 1SD9A 5DJMA 1THOA 4HUAA 3D22A 3C7MA 1S3CA 3F4RA 1G7EA 2WRTA 2FHEA 3P2AA 4RI7A 2R3XA 2X64A 1Z6NA 2L4CA 3FRCA 1EGOA 3L9UA 4XCSA 4EF0A 1DBYA 2K18A 1V40A 3GV1A 13GSA 2H0GA 1JZWA 4QQ7A 2IJYA 2LRNA 1TI3A 2LRTA 4PQIA 4MPGA 2HNLA 1SU9A 2L6DA 2H30A 5J9CA 2JZTA 2YV7A 5DJLA 3FHKA 2XPEA 1BG5A 1TK8B 1GLPA 2LS5A 3WT1A 9GSSA 2DMLA 20GSA 3H8QA 1F3BA 1DSBA 5IQYA 1K0NA 1F6MC 5DBQA 1YF0A 5A4WA 2H71A 5ECPB 3TJBA 2N5AA 4K1FA 4MZWA 3GNJA 2AB6A 1T4YA 2I81A 1OC3A 3BBYA 3SWLA 3TJGA 2HI7A 3BOAA 3QPMA 2O8VB 4TXOB 5GSTA 3TDGA 4P3YB 1EEJA 2P31A 1ZGNA 1T00A 5IMCA 2CX3A 4I2UA 1R26A 2GVPA 2R2JA 4HQZA 3HD5A 5A5KA 4MJCA 1NSWA 1QQ2A 5J5NA 4KSMA 2ZNMA 3VLNA 3LJRA 2MMAA 3LORA 3W8JA 1GP1A 2YP6A 5DAKA 3CXGA 5FT3A 3O76A 2B5YA 2PWJA 2VL2A 1GRXA 1KTEA 5JCWA 2H8LA 1Q4JA 4HU7A 1TP9A 1WRYA 2F8AA 4J57E 4WXTA 4OCFA 2WB9A 1ON4A 2TIRA 2YV9A 5DCHA 1K0MA 4L0WA 1R5AA 5G31A 4ECIA 1GTIA 1ZMAA 3DD3A 3HVSA 3MAKA 2H1GA 3IC4A 4CW9A 4KCAA 1SJ6A 2CV4A 2QGVA 2FGXA 5ELGA 4RI6A 2WULA 5F8BA 5LNKe 3S9FA 2OADA 3QCPA 1THXA 1S3AA 3WGDA 4V2NA 2QC7A 5D8IA 3VWXA 2BTOT 5IMDA 3BCKA 4N10A 1TOFA 2LV3A 4MA9A 5E4WA 2V6KA 4MF5A 5IMZA 1ZCPA 2DBCA 1NHOA 4BWQA 1WP0A 3IAS2 3HJPA 4IHUA 2YCDA 3IPZA 5G1KA 2LTKA 2QSIA 3TUEA 3P7XA 2M80A 3VI5A 3IV4A 2YZUA 1YQ1A 2A2RA 3D4MA 4XS6A 1VF3A 3QFBC 4F2IA 4K7NA 4MZBA 2V32A 4F03A 2H01A 1U3AA 3UJ1A 5CRHA 4PX1A 4EUYA 3DRNA 3P90A 2YN1A 3H93A 4GLTA 4N0ZA 3GKXA 4HDEA 1G6WA 4JEDA 2C1YA 2C0DA 3DIEA 5COHA 2RUEA 2E2GA 3GH6A 1FW1A 2Z9SA 5GZZB 1Q98A 4I97A 2O87A 4ML6A 3KJYA 2IN3A 1M2BA 1XPVA 2C0EA 5CREA 4OD7A 5IOXA 1MD4A 1OAZA 3FY7A 1AQXA 2J23A 3CRTA 5ECIB 2VCWA 4EDZA 4TR1A 2AV4A 4X0XA 3SBCA 2H1DA 4OO5A 2FWFA 4HQSA 2C3NA 1BQ7A 2M72A 2VL2C 1SKRB 1RK4A 1FG4A 1G7OA 1TXXA 4JE1A 1YEPA 5DALB 1XOBA 4ZL9A 4ZILA 1GTUA 2RUFA 1AIUA 3RAZA 5HQPA 4K2DA 1E6BA 3RHCA 1N2AA 1X5EA 3FR6A 3M0FA 2PN8A 5G1LA 4D73B 4BL7A 6GSXA 1USBA 4K9ZA 5J41A 4OO4A 1XW9A 1HNBA 5JWQB 2REMA 1R5PA 3I9V2 1U88A 3QD9A 4I2TA 2MBTA 2RLIA 3ZIVA 3LQ7A 3IHQA 3NZNA 4WETA 1EP7A 2D2ZA 3IXRA 4ACSA 4ZBDA 3IBHA 1B9XC 1U3IA 3H1NA 4MDCA 1R4WA 2I1UA 2GTUA 1QMVA 1ABAA 3P8WA 2N5FA 4YQVA 2B7KA 3RDWA 4ECCA 1YZXA 4IELA 1AUCA 2CT6A 2JU5A 2BMXA 4O5RA 1MDJA 7GSSA 1GTBA 1JZRA 3UARA 1QK8A 2LQOA 4IKHA 2JADA 2CVDA 3PINA 4G19A 19GSA 2C8UA 2V6OA 4ZBBA 4EXJA 3ZRDA 4F82A 4XS1A 4MK3A 5J3RA 2FUG2 3ISOA 4XTSA 4BWSA 3GA4A 1YKAA 4KA0A 1SKSB 5AIVA 4X43A 3IOSA 4KSOA 1JZDA 1SD8A 2KLXA 2LQQA 1T8EB 5G5FA 3I43A 5ECNB 16GSA 3EWLA 5CRGA 5J9BA 1EEMA 1XWKA 4WR5A 2LNTA 2NPBA 2YZHA 4WKWA 1YKCA 3C8EA 3AY8A 3TKPA 4OCEA 1TJDA 4TOPA 2MMOA 2IMEA 3IK7A 11GSA 5DDLA 5AISA 2JL4A 1ERUA 2F9SA 1JLVA 4GSSA 1OC9A 2GSQA 2I9HA 1J9BA 4NV2A 3HZ8A 1J08A 2H66A 2MYGA 3I69A 3FR3A 4PXOA 1FAAA 3ZIJA 4KUNA 5ECSA 4GWRA 2MBSA 3BJ5A 1ZOFA 2HRFA 3O6TA 5HFKA 4PURA 3VWWA 4KDUA 5ECOB 2VD1A 3ME7A 1X0RA 3GFKA 2LKUA 3U6VA 4JRRA 3K8NA 3IAM2 3PGTA 1HQOA 2HXKA 6GSYA 3FZ5A 3EU4A 1X9WB 1GUKA 2IWTA 3VURA 1J0FA 4EO3A 5IPGA 3N5OA 3DWVA 2VLTA 4GTUA 3N9JA 4LL1B 4L5LA 3GHAA 3KTBA 1KBNA 1HD2A 3CSHA 4KGIA 1DUGA 5HFGA 2G2QA 3CRUA 1OKTA 3ERGA 2C3TA 3Q74A 3C1RA 4MP4A 2A4VA 2YANA 2OE0A 3UVHA 3GMFA 3EVIA 1X9SB 2CAIA 2GQMA 5H5QA 1ZL9A 1PGTA 2I4AA 4ZBAA 4BVYA 3CSIA 5GAND 4MMMA 1FB6A 2VIMA 1GSEA 1OE8A 3DXBA 3APOA 1O6JA 3UIWA 2H6XA 2KP1A 3F63A 4F0BA 2KUCA 3M9JA 4N0VA 2TRCP 4TXOA 1Z3EA 5B7CA 2GQKA 5IIZA 2HZEB 5FWGA 2DJ1A 3H4KA 5G5EA 1B48A 3Q18A 3GTUA 4ID0A 3A2WA 2GGTA 4Q5QA 2A2SA 4MH3A 3DYRA 2H74A 1O8WA 2MMZA 1SYRA 1F37A 4IP1A 3ZZXA 4Q5NA 1V98A 4KNDA 3US3A 4F9ZA 2VCQA 3FK8A 3ZMLA 2ALBA 4QL7A 1GUHA 4IJ3A 2XBIA 2LUSA 4XS4B 1OKDA 2GLRA 3FKFA 3APQA 2VM1A 3GSSA 2YJHA 2XC2A 1A2LA 3RPPA 3V1WA 2FA4A 1EP8A 1VF2A 2YJ7A 4IW9A 1UN2A 1CQGA 3LYPA 3EE2A 1K0AA 1VF1A 5H5RA 1O8XA 2HE3A 3GKKA 1T4ZA 1BEDA 3A5WA 2NBSA 3HZ4A 4WR4A 1MTCA 3GX0A 3D21A 1SJZA 2PERA 1ERTA 2GS3A 1QXHA 4K0NA 4PUFC 2B6MA 2VCXA 1FB0A 4OFMA 4NHWA 4IGJA 2WDUA 1TDIA 2K8VA 5LD0A 4LLRA 2LJAA 1AAZA 1RQMA 3TJFA 4MZCA 4TW5A 3CTFA 4XIHA 1IYIA 2KP2A 4GQCA 2VCZA 2CVBA 4V1Ag 1WE0A 2OJLA 2P5RA 1DE2A 3VWUA 3F0IA 3MNGA 2FD3A 1PX6A 2TRXA 3CYNA 2CA8A 2MZCA 4KB3A 1R7HA 2HSHA 2F51A 4J2FA 4N11A 2RIIA 2FCHA 2IL3A 3G7JA 1G0TA 1O73A 5AIXA 1TU7A 3KD0A 5KN0A 4JBBA 2DJ0A 5F06A 2B3SA 3J7Yk 2CZ2A 1LBKA 2GZZA 3IA1A 5F07A 2H75A 4EDYA 2VD0A 5ECMB 5AGYA 2EIOA 3LWAA 4POKA 2HT9A 2LNSA 3ZITA 5E59A 1B4QA 4FO5A 5CNWA 2L4QA 1AXDA 2H6YA 1EWXA 4TKYA 2ES7A 4TVEA 3GKNA 5D9XA 1XWBA 1ZZYA 1M9BA 2HSYA 3HVVA 6GSUA 4HI7A 4RQXA 1A0RP 3OR5A 5G2ZA 2H1BA 1ST9A 4FYBA 4MABA 2E7PA 3VPTA 4AJ8A 4OFTA 6GSVA 4L5OA 4IQAA 2WFCA 1X5DA 4DEJA 1T3BA 4AJ6A 3KTLA 1HYUA 1SK2A 1UC7A 4G9HA 2XBQA 3HDCA 17GSA 1ZYQB 2AUVA 1XZOA 2NVLA 5A4UA 2QKEA 3J7Yb 3DVWA 3RPNA 2LEGA 1JLWA 1WMJA 4D73A 3W8SA 2YOIA 2K8SA 3HYPA 1MDIA 5F05A 4XRDA 3VK9A 2IMDA 2H70A 2DMMA 3QR6A 3IR4A 4BPYA 3QMXA 1ZYEA 3F3RA 3LSZA 3RHBA 4KH7A 4MJAA 3QOUA 5IPHA 2CZ3A 2VUPA 2IPAA 5ECHB 1NHYA 2NTOA 1MEKA 2GZPA 1MDKA 1TRSA 3ERFA 1PD21 3LEFA 3GYKA 4V2LA 4IBPA 5GAPD 3ZYWA 2GT6A 1A24A 1M9AA 1XVQA 2PBJA 1V9WA 3KMOA 1PSQA 4HZ2A 1Y6EA 3ED3A 3LFLA 2PPTA 1RW1A 5ID2B 5DQYA 2IFQB 3A2XA 4ZL8A 1PMTA 4MCUA 4I6XA 3TKSA 5CYYA 1V2AA 1PRXA 2F3MA 4TN8A 5ECQB 2H72A 1BYEA 1TRVA 2OBKA 3DVXA 1XWAA 5IM9A 4YAVA 3R2QA 1V58A 5B6MA 4WEYA 5HR3A 1K3YA 3A2VA 3EMXA 3HY2A 4OMVA 1KEBA 4XHMA 1S3DA 4K8MA 4JR6A 6GSTA 1GH2A 3ME8A 2ON7A 2K6VA 4K0GA 4F0CA 5A4VA 2P0GA 4DVCA 3L4NA 1H4OA 1OC8A 1PN9A 3D5JA 1SENA 3KP8A 2CAQA 4FIWA 4HU9A 5HR2A 3TRQA 3HCZA 1AQWA 3EURA 5C04A 2R5GA 1XVWA 1K3LA 4KCEA 5CRDA 2V41A 4ULXA 4NV5A 4PQHA 2OA7A 1XXUA 2H1AA 3GIXA 2L5OA 2H76A 4GCIA 1F9MA 5DVBA 4E8EA 4MJBA 2DIZA 2HFDA 4IS0A 5CRWA 2VAFA 3CBUA 5AN1A 5EY6A 2GZYA 3FZ9A 4DSRA 3A3TA 3QAWA 4ECJA 5ECKB 2VL9A 2N5BA 3L9SA 2NDOA 2EIQA 4PNGA 3O3TA 1SYXA 1Z6MA 4ZB6A 4LA1A 2HZFA 2H0IA 3TRXA 1K0BA
chains in the Genus database with same CATH superfamily
4HZ4A 3EMPA 1A8YA 2PVOC 2VLVA 1A23A 5J4UA 1NW2A 2IMKA 1GULA 1GUMA 1GSDA 3KMNA 3G9BA 2V2GA 1GWCA 2RM5A 1M99A 4BVXA 4USSA 4J56E 3KGKA 4POLA 3TJKA 1JFUA 2VLUA 1HNAA 3VI7A 1ERWA 3L9VA 3L78A 1I9DA 1HNCA 1PL1A 4CHSA 2L5LA 5KN2A 3HVXA 2JSYA 2L57A 1B8XA 4MF7A 4DSSB 2P5QA 1LU4A 5EVOA 3ERWA 4NXIA 4NWYA 2FWGA 1O7UA 1PFOA 22GSA 5CP1A 2ZCTA 1EGRA 1OC9B 2O89A 3TKSC 3MYDA 2X8CA 4V2MA 2OE3A 14GSA 4EIQA 3KEBA 2JZSA 4NMUA 3W6GA 2F8FA 1A2MA 1TTZA 2H6ZA 5KEJA 4HOJA 4ECBA 1M3JA 1SJIA 2AYTA 3UMAA 2HZEA 1PKWA 1QFNA 1XFLA 3GL3A 1YJ6A 3HA9A 2VL3A 3KCMA 2PGTA 1Z5YE 2FWEA 1B4PA 1GSUA 3EYTA 5FHIA 3APSA 1G6YA 1M2AA 4EE0A 5ECLB 1XWGA 3F3QA 4GXZA 5KOXA 4KE3A 1MD3A 4MJEA 2J9HA 4OFNA 2KHPA 3QAGA 4AGSA 4XS4A 1X9MB 3LXZA 3GL5A 5D9VA 2YWIA 1UVZA 2R37A 2R4VA 10GSA 1U87A 2WJUA 3KXOA 4KDYA 2WS2A 3BCIA 2A4HA 2HLSA 4TR4A 2VCTA 3HXSA 3GH9A 4Z7XA 3CQFA 2PUKC 2VOCA 2EIRA 3GURA 2RM6A 4PQ1A 1BJXA 1PKZA 1I5GA 4ZB8A 3GX8A 2FA8A 4RQRA 3WGXA 3E3EA 3A5IA 2HRAA 5B6NA 3CMIA 2DJ2A 3KP9A 5D9WA 2PU9C 2YWMA 1T7PB 4GF0A 4KDXA 3TJJA 2X99A 3ZMKA 3VPQA 1TU8A 1WIKA 4FYCA 3TKRA 5CO3A 3D4TA 2C0FA 2HRNA 1Z9HA 2XPDA 2GQLA 3UEMA 1W4VA 1ML6A 3QDNA 3GTUB 5B8BA 4MNNA 4XRAA 4CDOA 4WF4A 1GSFA 2L59A 1GNWA 1XW6A 2XHFA 4TXVA 1SL1B 1N8JA 2C0GA 2B1LA 4YQMA 4ZIJA 3MWHA 2MMNA 3GKMA 1GSYA 5IMAA 1IYHA 4IN0A 3F4SA 1EV4A 3GN3A 1GSQA 4O32A 3M3MA 4GSTA 2IIYA 4L8EA 4G10A 1XW5A 3TB2A 2LRCA 4GRFA 1O85A 3NIVA 5DQSA 1EV9A 5IMFA 3UVTA 1TRUA 3F6DA 1GNEA 4L0UA 1FO5A 4TR3A 1WOUA 3DKSA 1VRSD 2X8GA 3LGCA 6GSWA 4PUAA 3EU3A 5D93A 2R6KA 4O7HA 1XG8A 5DAKB 3IDVA 4IVFA 3KIJA 1YF1A 2OKAA 3KM6A 2WCIA 2DJJA 1LJRA 5ECRB 4WBJA 5HR1A 1PQNA 4PGTA 3FZAA 1AQVA 2LJKA 6GSSA 1BX9A 2VCVA 3Q19A 3IHGA 4EKZA 4ZB9A 2CVKA 4JU5A 1YEXA 4EL1A 3ZREA 1OE7A 5CAXA 1TI1A 1B9YC 2L6CA 4K7IA 5D73A 2JSZA 3WT2A 4YAPA 1WPIA 5JCUA 3CTGA 1QUWA 3C73A 1V57A 1ILOA 5D96A 2HYXA 3KZQA 3HJOA 2OBIA 3RBTA 5IOWA 3D0ZA 3TOTA 3TKQA 2ON5A 3F6FA 4JZQA 2WZ9A 3HKRA 5HFIA 5IMVA 3ZLPA 2H0HA 1JHBA 2JZRA 3VFIA 1XBSA 3M8NA 4LL4B 1U6TA 5ELAA 4HJMA 2AAWA 2DLXA 3G7IA 5G30A 3E0UA 3KH9A 3TOUA 1OYJA 3EC3A 3C71A 3D6IA 1SL0B 5JWRB 2DC5A 2FY6A 3MIXA 5INYA 3CSJA 2B7JA 4K5RA 5F0GA 4H86A 4YKFA 4WF5A 1EZKA 2R0PA 1NM3A 3DMLA 4EC0A 1F2EA 2G0FA 5DALA 4ILFA 4KW6A 1JZOA 5D9TA 4K5SA 2VO4A 3GUSA 4WBRD 1A8LA 1TRWA 4FQUA 2YNXA 2O7KA 2KOKA 1ZYNA 4E8HA 5KN1A 2C80A 1EOGA 3U5RE 2DJKA 3PR8A 2M46A 3VWVA 2GSRA 3GSTA 8GSSA 3UAPA 1O81A 1X5CA 3FEUA 3IE3A 1F3AA 1ACVA 1CQHA 5ID2A 2IFQA 4HJ2A 3TGZA 2CX4A 4I5QA 3TRPA 4I8BA 1TKDB 4G2EA 2E2MA 1ERVA 4K7OA 3TCOA 2DIYA 2GDRA 1GTAA 4V1Ap 1Z7RA 4AJ7A 2R0GA 1XWCA 3F4TA 4MH2A 5H5SA 1EOHA 3M1GA 2JACA 4TR1B 3IK9A 1T1VA 4FH8A 1PL2A 1GL8A 1A0FA 5EPFA 3UOMA 2VM2A 1VGLA 4TRXA 3FW2A 2DSAA 5BMUA 5JWOB 1KNGA 1AC1A 5IO2A 1C72A 3C1SA 2B5EA 5HR0A 12GSA 4ML1A 2IMIA 2FNOA 3G7YA 1PX7A 1PN0A 2BJXA 1XOAA 3MDKA 1TK0B 3TKSE 4DSQA 2OE1A 2E0QA 3PH9A 2YPMA 3UBKA 5L71A 1TK5B 4JR4A 3NOFA 4BL7B 3UBLA 5IO0A 4MF6A 4QL9A 2LSTA 5KN3A 1A2JA 1FHEA 3DEXA 4Q5FA 2CQ9A 2R0CA 2IMFA 3KH7A 4HEA2 1GSSA 5EL8A 3WYWA 4RUVA 2C3QA 1TW9A 2EC4A 3FYGA 1URMA 4HS1A 1K0DA 1AW9A 1WWJA 18GSA 2FWHA 2GSTA 3QAVA 3M9KA 3GRXA 5ABRA 1K0OA 4YQUA 3PPUA 5JCGA 3BD2A 3ZVJD 4YH2A 4Z2TA 4IQ1A 4KX4A 4AF2A 3H79A 2H19A 1SK0A 4ZL7A 4NHZA 1UA5A 3WD6A 4Q5RA 3FZ4A 4Z2RA 3HJMA 1Y25A 3F9UA 2V1MA 3E9JB 1K3OA 5GSSA 2YWOA 3LXTA 4MPFA 1XCCA 4FYUA 1M2DA 1SK1A 2WGRA 4LMWA 2O85A 3ZVJA 2UZ8A 1QGVA 3HHVA 4POBA 2DJ3A 1VF4A 4NPBA 3WGEA 1BAYA 1GLQA 2AJQB 3LG6A 4DSSA 2C4JA 2B1KA 4K6XA 2K9FA 3IRAA 4NAXA 3DGQA 1K0CA 4ZXGA 4POMA 1YY7A 1FOVA 5DCGA 1M0UA 2H73A 1E2YA 4N30A 3LYKA 1FVJA 4O92A 2GT5A 4IJIA 2AHEA 3F8UA 4OWYA 3ZFLA 3ZL5A 2PMTA 5ENUA 4BA7A 3JCML 4IP6A 4GSNA 2B5XA 4MLYA 4PNFA 1OVNA 1WJKA 3ZFBA 5LCZA 1PA3A 1Z7PA 1SKWB 3FR9A 2X8HA 5B8AA 5C00A 2GSSA 4X1UA 3QFAC 4KAEA 4EVMA 3UL3A 1XIYA 3L0HA 2FLSA 1FVKA 4TR0A 1DE1A 2LJRA 2YWNA 1SL2B 3MSZA 1YDKA 3EINA 1H75A 4ISDA 4GQFA 1W89A 4LMVA 3Q6OA 3ZTLA 1M7TA 2OACA 2I3YA 2PVQA 2ZUPA 3I6AA 1SD9A 5DJMA 1THOA 4HUAA 3D22A 3C7MA 1S3CA 3F4RA 1G7EA 2WRTA 2FHEA 3P2AA 4RI7A 2R3XA 2X64A 1Z6NA 2L4CA 3FRCA 1EGOA 3L9UA 4XCSA 4EF0A 1DBYA 2K18A 1V40A 3GV1A 13GSA 2H0GA 1JZWA 4QQ7A 2IJYA 2LRNA 1TI3A 2LRTA 4PQIA 4MPGA 2HNLA 1SU9A 2L6DA 5KOWA 2H30A 5J9CA 2JZTA 2YV7A 5DJLA 3FHKA 2XPEA 4X4JA 1BG5A 1TK8B 1GLPA 2LS5A 3WT1A 9GSSA 2DMLA 20GSA 3H8QA 1F3BA 4BVYB 1DSBA 5IQYA 1K0NA 1F6MC 5DBQA 1YF0A 5A4WA 2H71A 5ECPB 3TJBA 2N5AA 4K1FA 4MZWA 3GNJA 1M3IA 2AB6A 1T4YA 2I81A 1OC3A 3BBYA 3SWLA 3TJGA 2HI7A 3BOAA 3QPMA 2O8VB 4TXOB 5GSTA 3TDGA 4P3YB 1EEJA 2P31A 1ZGNA 1T00A 5IMCA 2CX3A 4I2UA 1R26A 2GVPA 2R2JA 4HQZA 3HD5A 5A5KA 4MJCA 1NSWA 1QQ2A 5J5NA 4KSMA 2ZNMA 3VLNA 3LJRA 2MMAA 3LORA 1ZYPA 3W8JA 1GP1A 2YP6A 5DAKA 3CXGA 5FT3A 3O76A 2B5YA 2PWJA 2VL2A 1GRXA 1KTEA 5JCWA 2H8LA 1Q4JA 4HU7A 1TP9A 1WRYA 2F8AA 4J57E 4WXTA 4OCFA 2WB9A 1ON4A 2TIRA 2YV9A 5DCHA 1K0MA 4L0WA 1R5AA 5G31A 4ECIA 1GTIA 1ZMAA 3DD3A 3HVSA 3MAKA 2H1GA 3IC4A 4CW9A 4KCAA 1SJ6A 2CV4A 2QGVA 2FGXA 5ELGA 4RI6A 2WULA 5F8BA 5LNKe 3S9FA 2OADA 3QCPA 2HRKA 1THXA 1S3AA 3WGDA 4V2NA 2QC7A 5D8IA 3VWXA 2BTOT 5IMDA 3BCKA 4N10A 1TOFA 2LV3A 4MA9A 5E4WA 2V6KA 4MF5A 5IMZA 1ZCPA 2DBCA 1NHOA 4BWQA 1WP0A 3R3EA 3IAS2 4A5PA 3HJPA 4IHUA 2YCDA 3IPZA 5G1KA 2LTKA 2QSIA 3TUEA 3P7XA 2M80A 3VI5A 3IV4A 2YZUA 1YQ1A 2A2RA 3D4MA 4XS6A 1VF3A 3QFBC 4F2IA 4K7NA 4MZBA 2V32A 4F03A 2H01A 1U3AA 3UJ1A 5CRHA 4PX1A 4EUYA 4ICYA 4BIKA 3DRNA 3P90A 2YN1A 3H93A 4GLTA 4N0ZA 3GKXA 4HDEA 1G6WA 4JEDA 2C1YA 2C0DA 3DIEA 5COHA 2RUEA 2E2GA 3GH6A 1FW1A 2Z9SA 5GZZB 1Q98A 4I97A 2O87A 4ML6A 3KJYA 2IN3A 1M2BA 1XPVA 2C0EA 5CREA 4OD7A 5IOXA 1MD4A 1OAZA 3FY7A 1AQXA 2J23A 3CRTA 5ECIB 2VCWA 4EDZA 4TR1A 2AV4A 4X0XA 3SBCA 2H1DA 4OO5A 2FWFA 4HQSA 2C3NA 1BQ7A 2M72A 2VL2C 1SKRB 1RK4A 1FG4A 1G7OA 1TXXA 4JE1A 1YEPA 5DALB 1XOBA 4ZL9A 4ZILA 3LW9A 1GTUA 2RUFA 1AIUA 3RAZA 5HQPA 4K2DA 1E6BA 3RHCA 1N2AA 1X5EA 3HVNA 3FR6A 3M0FA 2PN8A 5G1LA 4D73B 4BL7A 6GSXA 1USBA 4K9ZA 5J41A 4OO4A 1XW9A 4CY6A 1HNBA 5JWQB 2REMA 1R5PA 3I9V2 1U88A 3QD9A 4I2TA 2MBTA 2RLIA 3ZIVA 3LQ7A 3IHQA 3NZNA 4WETA 1EP7A 2D2ZA 3IXRA 4ACSA 4ZBDA 3IBHA 1B9XC 1U3IA 3H1NA 4MDCA 1R4WA 2I1UA 2GTUA 1QMVA 1ABAA 3P8WA 2N5FA 4YQVA 2B7KA 3RDWA 4ECCA 1YZXA 4IELA 1AUCA 2CT6A 2JU5A 2BMXA 4O5RA 1MDJA 7GSSA 1GTBA 1JZRA 3UARA 1QK8A 2LQOA 4IKHA 2JADA 2CVDA 3PINA 1FOHA 4G19A 19GSA 2C8UA 2V6OA 4ZBBA 4EXJA 3ZRDA 4F82A 4XS1A 4MK3A 5J3RA 2FUG2 3ISOA 4XTSA 4BWSA 3GA4A 1YKAA 4KA0A 1SKSB 4K2XA 4X43A 5AIVA 4EIPA 3IOSA 4KSOA 1JZDA 1SD8A 2KLXA 2LQQA 1T8EB 4KF9A 5G5FA 3I43A 5ECNB 16GSA 3EWLA 5CRGA 5J9BA 1EEMA 1XWKA 4WR5A 2LNTA 2NPBA 4YKGA 2YZHA 4WKWA 1YKCA 3C8EA 3AY8A 3TKPA 4OCEA 2X49A 1TJDA 4TOPA 2MMOA 2IMEA 3IK7A 11GSA 5DDLA 5AISA 2JL4A 1ERUA 2F9SA 1JLVA 4GSSA 1OC9A 2GSQA 2I9HA 1J9BA 4NV2A 3HZ8A 1J08A 2H66A 2MYGA 3I69A 3FR3A 4PXOA 1FAAA 3ZIJA 4KUNA 5ECSA 4GWRA 2MBSA 3BJ5A 1ZOFA 2HRFA 3O6TA 5HFKA 4PURA 3VWWA 4KDUA 5ECOB 2VD1A 2HSMA 3ME7A 1X0RA 3GFKA 2LKUA 3U6VA 4JRRA 3K8NA 3IAM2 3PGTA 1HQOA 2HXKA 6GSYA 3FZ5A 3EU4A 1X9WB 1GUKA 2IWTA 3VURA 1J0FA 4EO3A 5IPGA 3N5OA 3DWVA 2VLTA 4GTUA 3N9JA 4BVXB 4LL1B 4L5LA 3GHAA 3KTBA 1KBNA 1HD2A 3CSHA 4KGIA 1DUGA 5HFGA 2G2QA 3CRUA 1OKTA 3ERGA 2C3TA 3Q74A 3C1RA 4MP4A 2A4VA 2YANA 2OE0A 3UVHA 3GMFA 3EVIA 1X9SB 2CAIA 2GQMA 5H5QA 1ZL9A 1PGTA 2I4AA 4ZBAA 4BVYA 3CSIA 5GAND 4MMMA 1FB6A 3FMWA 2VIMA 1GSEA 1OE8A 3DXBA 3APOA 1O6JA 3UIWA 3EPTA 2H6XA 2KP1A 3F63A 4F0BA 2KUCA 3M9JA 4N0VA 2TRCP 4TXOA 1Z3EA 5B7CA 1S3RA 2GQKA 5IIZA 2HZEB 5FWGA 2DJ1A 3H4KA 5G5EA 1B48A 3Q18A 3GTUA 4PTSA 4ID0A 3A2WA 2GGTA 4Q5QA 2A2SA 4MH3A 3DYRA 2H74A 1O8WA 2MMZA 1SYRA 1F37A 4IP1A 3ZZXA 4Q5NA 1V98A 4KNDA 3US3A 4F9ZA 2VCQA 3FK8A 3ZMLA 2QA2A 2ALBA 4QL7A 1GUHA 4IJ3A 2XBIA 2LUSA 4XS4B 1OKDA 2GLRA 3FKFA 3APQA 2VM1A 3GSSA 2YJHA 2XC2A 1A2LA 3RPPA 3V1WA 2FA4A 1EP8A 1VF2A 2YJ7A 4IW9A 1UN2A 1CQGA 3LYPA 3EE2A 1K0AA 1VF1A 2A2PA 5H5RA 5BRTA 1O8XA 2HE3A 3GKKA 1T4ZA 1BEDA 3A5WA 2NBSA 3HZ4A 4WR4A 1MTCA 3GX0A 3D21A 1SJZA 2PERA 1ERTA 2GS3A 1QXHA 4K0NA 4PUFC 2B6MA 2VCXA 1FB0A 4OFMA 4NHWA 4IGJA 2WDUA 1TDIA 2K8VA 5LD0A 4LLRA 2LJAA 1AAZA 1RQMA 3TJFA 4MZCA 4TW5A 3CTFA 4XIHA 4CY8A 1IYIA 2KP2A 4GQCA 2VCZA 2CVBA 4V1Ag 1WE0A 2OJLA 2P5RA 1DE2A 3VWUA 3F0IA 3MNGA 2FD3A 1PX6A 2TRXA 3CYNA 3IC8A 2QA1A 2CA8A 2MZCA 4KB3A 1R7HA 2HSHA 2F51A 4J2FA 4N11A 2RIIA 2FCHA 2IL3A 3G7JA 1G0TA 4G0KA 1O73A 5AIXA 1TU7A 3KD0A 5KN0A 4JBBA 2DJ0A 5F06A 2B3SA 3J7Yk 2CZ2A 1LBKA 2GZZA 3IA1A 5F07A 2H75A 4EDYA 2VD0A 5ECMB 5AGYA 2EIOA 3LWAA 4POKA 2HT9A 2LNSA 3ZITA 5E59A 1B4QA 4FO5A 5CNWA 2L4QA 1AXDA 2H6YA 1EWXA 4TKYA 2ES7A 4TVEA 3GKNA 5D9XA 1XWBA 1ZZYA 1M9BA 2HSYA 2X4AA 3HVVA 6GSUA 4HI7A 4RQXA 4HSCX 1A0RP 3OR5A 5G2ZA 2H1BA 1ST9A 4FYBA 4MABA 2E7PA 3VPTA 4AJ8A 4OFTA 6GSVA 4L5OA 4IQAA 2WFCA 1X5DA 4DEJA 1T3BA 4AJ6A 3KTLA 1HYUA 1SK2A 1UC7A 4G9HA 2XBQA 4O5QA 3HDCA 17GSA 1ZYQB 2AUVA 1XZOA 2NVLA 5A4UA 2QKEA 3J7Yb 3DVWA 3RPNA 2LEGA 1JLWA 1WMJA 4D73A 3W8SA 2DKHA 2YOIA 2K8SA 3HYPA 1MDIA 5F05A 4XRDA 3VK9A 2IMDA 4G0IA 2H70A 2DMMA 3QR6A 3IR4A 4BPYA 3QMXA 1ZYEA 3F3RA 3LSZA 3RHBA 4KH7A 4MJAA 3QOUA 5IPHA 2CZ3A 2VUPA 2IPAA 5ECHB 1NHYA 2NTOA 1MEKA 2GZPA 1MDKA 1TRSA 3ERFA 1PD21 3LEFA 3GYKA 4V2LA 4IBPA 4Z2UA 5GAPD 3ZYWA 2GT6A 1A24A 1M9AA 1XVQA 2PBJA 1V9WA 3KMOA 1PSQA 4HZ2A 1Y6EA 3ED3A 3LFLA 2PPTA 1RW1A 5ID2B 5DQYA 2IFQB 3A2XA 4ZL8A 1PMTA 4MCUA 4I6XA 3TKSA 5CYYA 1V2AA 1PRXA 2F3MA 4TN8A 5ECQB 2H72A 1BYEA 1TRVA 2OBKA 3DVXA 1XWAA 5IM9A 4YAVA 3R2QA 1V58A 5B6MA 4WEYA 5HR3A 1K3YA 3A2VA 3EMXA 3HY2A 4OMVA 1KEBA 4XHMA 1S3DA 4K8MA 4JR6A 6GSTA 1GH2A 3ME8A 2ON7A 2K6VA 4K0GA 4F0CA 5A4VA 2P0GA 4DVCA 4G0LA 3L4NA 1H4OA 1OC8A 1PN9A 3D5JA 1SENA 3KP8A 2CAQA 4FIWA 4HU9A 5HR2A 3TRQA 4O5UA 3HCZA 1AQWA 3EURA 5C04A 2R5GA 1XVWA 1K3LA 4KCEA 5CRDA 2V41A 4ULXA 4NV5A 4PQHA 2OA7A 1XXUA 2H1AA 3GIXA 2L5OA 2H76A 4GCIA 1F9MA 5DVBA 4E8EA 4MJBA 2DIZA 2HFDA 4IS0A 5CRWA 2VAFA 3CBUA 5AN1A 5EY6A 2GZYA 3FZ9A 4DSRA 3A3TA 3QAWA 4ECJA 5ECKB 2VL9A 2N5BA 3L9SA 2NDOA 2EIQA 4PNGA 3O3TA 1SYXA 1Z6MA 4ZB6A 4LA1A 2HZFA 2DKIA 2H0IA 3TRXA 1K0BA
chains in the Genus database with same CATH topology
4HZ4A 3EMPA 1A8YA 2PVOC 2VLVA 1A23A 5J4UA 1NW2A 2IMKA 1GULA 1GUMA 1GSDA 3KMNA 3G9BA 2V2GA 1GWCA 2RM5A 1M99A 4BVXA 4USSA 4J56E 3KGKA 4POLA 3TJKA 1JFUA 2VLUA 1HNAA 3VI7A 1ERWA 3L9VA 3L78A 1I9DA 1HNCA 1PL1A 4CHSA 2L5LA 5KN2A 3HVXA 2JSYA 2L57A 1B8XA 4MF7A 4DSSB 2P5QA 1LU4A 5EVOA 3ERWA 4NXIA 4NWYA 2FWGA 1O7UA 22GSA 5CP1A 2ZCTA 1EGRA 1OC9B 2O89A 3TKSC 3MYDA 2X8CA 4V2MA 2OE3A 14GSA 4EIQA 3KEBA 2JZSA 4NMUA 3W6GA 2F8FA 1A2MA 1TTZA 2H6ZA 5KEJA 4HOJA 4ECBA 1SJIA 2AYTA 3UMAA 2HZEA 1PKWA 1QFNA 1XFLA 3GL3A 1YJ6A 3HA9A 2VL3A 3KCMA 2PGTA 1Z5YE 2FWEA 1B4PA 1GSUA 3EYTA 5FHIA 3APSA 1G6YA 1M2AA 4EE0A 5ECLB 1XWGA 3F3QA 4GXZA 5KOXA 4KE3A 1MD3A 4MJEA 2J9HA 4OFNA 2KHPA 3QAGA 4AGSA 4XS4A 1X9MB 3LXZA 3GL5A 5D9VA 2YWIA 1UVZA 2R37A 2R4VA 10GSA 1U87A 2WJUA 3KXOA 4KDYA 2WS2A 3BCIA 2A4HA 2HLSA 4TR4A 2VCTA 3HXSA 3GH9A 4Z7XA 2PUKC 2VOCA 2EIRA 3GURA 2RM6A 4PQ1A 1BJXA 1PKZA 1I5GA 4ZB8A 3GX8A 2FA8A 4RQRA 3WGXA 3E3EA 3A5IA 2HRAA 5B6NA 3CMIA 2DJ2A 3KP9A 5D9WA 2PU9C 2YWMA 1T7PB 4GF0A 4KDXA 3TJJA 2X99A 3ZMKA 3VPQA 1TU8A 1WIKA 4FYCA 3TKRA 5CO3A 3D4TA 2C0FA 2HRNA 1Z9HA 2XPDA 2GQLA 3UEMA 1W4VA 1ML6A 3QDNA 3GTUB 5B8BA 4MNNA 4XRAA 4CDOA 4WF4A 1GSFA 2L59A 1GNWA 1XW6A 2XHFA 4TXVA 1SL1B 1N8JA 2C0GA 2B1LA 4YQMA 4ZIJA 3MWHA 2MMNA 3GKMA 1GSYA 5IMAA 1IYHA 4IN0A 3F4SA 1EV4A 3GN3A 1GSQA 4O32A 3M3MA 4GSTA 2IIYA 4L8EA 4G10A 1XW5A 3TB2A 2LRCA 4GRFA 1O85A 3NIVA 5DQSA 1EV9A 5IMFA 3UVTA 1TRUA 3F6DA 1GNEA 4L0UA 1FO5A 4TR3A 1WOUA 3DKSA 1VRSD 2X8GA 3LGCA 6GSWA 4PUAA 3EU3A 5D93A 2R6KA 4O7HA 5DAKB 3IDVA 4IVFA 3KIJA 1YF1A 2OKAA 3KM6A 2WCIA 2DJJA 1LJRA 5ECRB 4WBJA 5HR1A 1PQNA 4PGTA 3FZAA 1AQVA 2LJKA 6GSSA 1BX9A 2VCVA 3Q19A 3IHGA 4EKZA 4ZB9A 2CVKA 4JU5A 1YEXA 4EL1A 3ZREA 1OE7A 5CAXA 1TI1A 1B9YC 2L6CA 4K7IA 5D73A 2JSZA 3WT2A 4YAPA 1WPIA 5JCUA 3CTGA 1QUWA 3C73A 1V57A 1ILOA 5D96A 2HYXA 3KZQA 3HJOA 2OBIA 3RBTA 5IOWA 3D0ZA 3TOTA 3TKQA 2ON5A 3F6FA 4JZQA 2WZ9A 3HKRA 5HFIA 5IMVA 3ZLPA 2H0HA 1JHBA 2JZRA 3VFIA 1XBSA 3M8NA 4LL4B 1U6TA 5ELAA 4HJMA 2AAWA 2DLXA 3G7IA 5G30A 3E0UA 3KH9A 3TOUA 1OYJA 3EC3A 3C71A 3D6IA 1SL0B 5JWRB 2DC5A 2FY6A 3MIXA 5INYA 3CSJA 2B7JA 4K5RA 5F0GA 4H86A 4YKFA 4WF5A 1EZKA 2R0PA 1NM3A 3DMLA 4EC0A 1F2EA 2G0FA 5DALA 4ILFA 4KW6A 1JZOA 5D9TA 4K5SA 2VO4A 3GUSA 4WBRD 1A8LA 1TRWA 4FQUA 2YNXA 2O7KA 2KOKA 1ZYNA 4E8HA 5KN1A 2C80A 1EOGA 3U5RE 2DJKA 3PR8A 2M46A 3VWVA 2GSRA 3GSTA 8GSSA 3UAPA 1O81A 1X5CA 3FEUA 3IE3A 1F3AA 1ACVA 1CQHA 5ID2A 2IFQA 4HJ2A 3TGZA 2CX4A 4I5QA 3TRPA 4I8BA 1TKDB 4G2EA 2E2MA 1ERVA 4K7OA 3TCOA 2DIYA 2GDRA 1GTAA 4V1Ap 1Z7RA 4AJ7A 2R0GA 1XWCA 3F4TA 4MH2A 5H5SA 1EOHA 3M1GA 2JACA 4TR1B 3IK9A 1T1VA 4FH8A 1PL2A 1GL8A 1A0FA 5EPFA 3UOMA 2VM2A 1VGLA 4TRXA 3FW2A 2DSAA 5BMUA 5JWOB 1KNGA 1AC1A 5IO2A 1C72A 3C1SA 2B5EA 5HR0A 12GSA 4ML1A 2IMIA 2FNOA 3G7YA 1PX7A 1PN0A 2BJXA 1XOAA 3MDKA 1TK0B 3TKSE 4DSQA 2OE1A 2E0QA 3PH9A 2YPMA 3UBKA 5L71A 1TK5B 4JR4A 3NOFA 4BL7B 3UBLA 5IO0A 4MF6A 4QL9A 2LSTA 5KN3A 1A2JA 1FHEA 3DEXA 4Q5FA 2CQ9A 2R0CA 2IMFA 3KH7A 4HEA2 1GSSA 5EL8A 3WYWA 4RUVA 2C3QA 1TW9A 2EC4A 3FYGA 1URMA 4HS1A 1K0DA 1AW9A 1WWJA 18GSA 2FWHA 2GSTA 3QAVA 3M9KA 3GRXA 5ABRA 1K0OA 4YQUA 3PPUA 5JCGA 3BD2A 3ZVJD 4YH2A 4Z2TA 4IQ1A 4KX4A 4AF2A 3H79A 2H19A 1SK0A 4ZL7A 4NHZA 1UA5A 3WD6A 4Q5RA 3FZ4A 4Z2RA 3HJMA 1Y25A 3F9UA 2V1MA 3E9JB 1K3OA 5GSSA 2YWOA 3LXTA 4MPFA 1XCCA 4FYUA 1M2DA 1SK1A 2WGRA 4LMWA 2O85A 3ZVJA 2UZ8A 1QGVA 3HHVA 4POBA 2DJ3A 1VF4A 4NPBA 3WGEA 1BAYA 1GLQA 2AJQB 3LG6A 4DSSA 2C4JA 2B1KA 4K6XA 2K9FA 3IRAA 4NAXA 3DGQA 1K0CA 4ZXGA 4POMA 1YY7A 1FOVA 5DCGA 1M0UA 2H73A 1E2YA 4N30A 3LYKA 1FVJA 4O92A 2GT5A 4IJIA 2AHEA 3F8UA 4OWYA 3ZFLA 3ZL5A 2PMTA 5ENUA 4BA7A 3JCML 4IP6A 4GSNA 2B5XA 4MLYA 4PNFA 1OVNA 1WJKA 3ZFBA 5LCZA 1PA3A 1Z7PA 1SKWB 3FR9A 2X8HA 5B8AA 5C00A 2GSSA 4X1UA 3QFAC 4KAEA 4EVMA 3UL3A 1XIYA 3L0HA 2FLSA 1FVKA 4TR0A 1DE1A 2LJRA 2YWNA 1SL2B 3MSZA 1YDKA 3EINA 1H75A 4ISDA 4GQFA 1W89A 4LMVA 3Q6OA 3ZTLA 1M7TA 2OACA 2I3YA 2PVQA 2ZUPA 3I6AA 1SD9A 5DJMA 1THOA 4HUAA 3D22A 3C7MA 1S3CA 3F4RA 1G7EA 2WRTA 2FHEA 3P2AA 4RI7A 2R3XA 2X64A 1Z6NA 2L4CA 3FRCA 1EGOA 3L9UA 4XCSA 4EF0A 1DBYA 2K18A 1V40A 3GV1A 13GSA 2H0GA 1JZWA 4QQ7A 2IJYA 2LRNA 1TI3A 2LRTA 4PQIA 4MPGA 2HNLA 1SU9A 2L6DA 5KOWA 2H30A 5J9CA 2JZTA 2YV7A 5DJLA 3FHKA 2XPEA 4X4JA 1BG5A 1TK8B 1GLPA 2LS5A 3WT1A 9GSSA 2DMLA 20GSA 3H8QA 1F3BA 4BVYB 1DSBA 5IQYA 1K0NA 1F6MC 5DBQA 1YF0A 5A4WA 2H71A 5ECPB 3TJBA 2N5AA 4K1FA 4MZWA 3GNJA 2AB6A 1T4YA 2I81A 1OC3A 3BBYA 3SWLA 3TJGA 2HI7A 3BOAA 3QPMA 2O8VB 4TXOB 5GSTA 3TDGA 4P3YB 1EEJA 2P31A 1ZGNA 1T00A 5IMCA 2CX3A 4I2UA 1R26A 2GVPA 2R2JA 4HQZA 3HD5A 5A5KA 4MJCA 1NSWA 1QQ2A 5J5NA 4KSMA 2ZNMA 3VLNA 3LJRA 2MMAA 3LORA 1ZYPA 3W8JA 1GP1A 2YP6A 5DAKA 3CXGA 5FT3A 3O76A 2B5YA 2PWJA 2VL2A 1GRXA 1KTEA 5JCWA 2H8LA 1Q4JA 4HU7A 1TP9A 1WRYA 2F8AA 4J57E 4WXTA 4OCFA 2WB9A 1ON4A 2TIRA 2YV9A 5DCHA 1K0MA 4L0WA 1R5AA 5G31A 4ECIA 1GTIA 1ZMAA 3DD3A 3HVSA 3MAKA 2H1GA 3IC4A 4CW9A 4KCAA 1SJ6A 2CV4A 2QGVA 2FGXA 5ELGA 4RI6A 2WULA 5F8BA 5LNKe 3S9FA 2OADA 3QCPA 2HRKA 1THXA 1S3AA 3WGDA 4V2NA 2QC7A 5D8IA 3VWXA 2BTOT 5IMDA 3BCKA 4N10A 1TOFA 2LV3A 4MA9A 5E4WA 2V6KA 4MF5A 5IMZA 1ZCPA 2DBCA 1NHOA 4BWQA 1WP0A 3R3EA 3IAS2 4A5PA 3HJPA 4IHUA 2YCDA 3IPZA 5G1KA 2LTKA 2QSIA 3TUEA 3P7XA 2M80A 3VI5A 3IV4A 2YZUA 1YQ1A 2A2RA 3D4MA 4XS6A 1VF3A 3QFBC 4F2IA 4K7NA 4MZBA 2V32A 4F03A 2H01A 1U3AA 3UJ1A 5CRHA 4PX1A 4EUYA 4ICYA 3DRNA 3P90A 2YN1A 3H93A 4GLTA 4N0ZA 3GKXA 4HDEA 1G6WA 4JEDA 2C1YA 2C0DA 3DIEA 5COHA 2RUEA 2E2GA 3GH6A 1FW1A 2Z9SA 5GZZB 1Q98A 4I97A 2O87A 4ML6A 3KJYA 2IN3A 1M2BA 1XPVA 2C0EA 5CREA 4OD7A 5IOXA 1MD4A 1OAZA 3FY7A 1AQXA 2J23A 3CRTA 5ECIB 2VCWA 4EDZA 4TR1A 2AV4A 4X0XA 3SBCA 2H1DA 4OO5A 2FWFA 4HQSA 2C3NA 1BQ7A 2M72A 2VL2C 1SKRB 1RK4A 1FG4A 1G7OA 1TXXA 4JE1A 1YEPA 5DALB 1XOBA 4ZL9A 4ZILA 3LW9A 1GTUA 2RUFA 1AIUA 3RAZA 5HQPA 4K2DA 1E6BA 3RHCA 1N2AA 1X5EA 3FR6A 3M0FA 2PN8A 5G1LA 4D73B 4BL7A 6GSXA 1USBA 4K9ZA 5J41A 4OO4A 1XW9A 4CY6A 1HNBA 5JWQB 2REMA 1R5PA 3I9V2 1U88A 3QD9A 4I2TA 2MBTA 2RLIA 3ZIVA 3LQ7A 3IHQA 3NZNA 4WETA 1EP7A 2D2ZA 3IXRA 4ACSA 4ZBDA 3IBHA 1B9XC 1U3IA 3H1NA 4MDCA 1R4WA 2I1UA 2GTUA 1QMVA 1ABAA 3P8WA 2N5FA 4YQVA 2B7KA 3RDWA 4ECCA 1YZXA 4IELA 1AUCA 2CT6A 2JU5A 2BMXA 4O5RA 1MDJA 7GSSA 1GTBA 1JZRA 3UARA 1QK8A 2LQOA 4IKHA 2JADA 2CVDA 3PINA 1FOHA 4G19A 19GSA 2C8UA 2V6OA 4ZBBA 4EXJA 3ZRDA 4F82A 4XS1A 4MK3A 5J3RA 2FUG2 3ISOA 4XTSA 4BWSA 3GA4A 1YKAA 4KA0A 1SKSB 4K2XA 4X43A 5AIVA 4EIPA 3IOSA 4KSOA 1JZDA 1SD8A 2KLXA 2LQQA 1T8EB 4KF9A 5G5FA 3I43A 5ECNB 16GSA 3EWLA 5CRGA 5J9BA 1EEMA 1XWKA 4WR5A 2LNTA 2NPBA 4YKGA 2YZHA 4WKWA 1YKCA 3C8EA 3AY8A 3TKPA 4OCEA 2X49A 1TJDA 4TOPA 2MMOA 2IMEA 3IK7A 11GSA 5DDLA 5AISA 2JL4A 1ERUA 2F9SA 1JLVA 4GSSA 1OC9A 2GSQA 2I9HA 1J9BA 4NV2A 3HZ8A 1J08A 2H66A 2MYGA 3I69A 3FR3A 4PXOA 1FAAA 3ZIJA 4KUNA 5ECSA 4GWRA 2MBSA 3BJ5A 1ZOFA 2HRFA 3O6TA 5HFKA 4PURA 3VWWA 4KDUA 5ECOB 2VD1A 2HSMA 3ME7A 1X0RA 3GFKA 2LKUA 3U6VA 4JRRA 3K8NA 3IAM2 3PGTA 1HQOA 2HXKA 6GSYA 3FZ5A 3EU4A 1X9WB 1GUKA 2IWTA 3VURA 1J0FA 4EO3A 5IPGA 3N5OA 3DWVA 2VLTA 4GTUA 3N9JA 4BVXB 4LL1B 4L5LA 3GHAA 3KTBA 1KBNA 1HD2A 3CSHA 4KGIA 1DUGA 5HFGA 2G2QA 3CRUA 1OKTA 3ERGA 2C3TA 3Q74A 3C1RA 4MP4A 2A4VA 2YANA 2OE0A 3UVHA 3GMFA 3EVIA 1X9SB 2CAIA 2GQMA 5H5QA 1ZL9A 1PGTA 2I4AA 4ZBAA 4BVYA 3CSIA 5GAND 4MMMA 1FB6A 3FMWA 2VIMA 1GSEA 1OE8A 3DXBA 3APOA 1O6JA 3UIWA 3EPTA 2H6XA 2KP1A 3F63A 4F0BA 2KUCA 3M9JA 4N0VA 2TRCP 4TXOA 1Z3EA 5B7CA 2GQKA 5IIZA 2HZEB 5FWGA 2DJ1A 3H4KA 5G5EA 1B48A 3Q18A 3GTUA 4PTSA 4ID0A 3A2WA 2GGTA 4Q5QA 2A2SA 4MH3A 3DYRA 2H74A 1O8WA 2MMZA 1SYRA 1F37A 4IP1A 3ZZXA 4Q5NA 1V98A 4KNDA 3US3A 4F9ZA 2VCQA 3FK8A 3ZMLA 2QA2A 2ALBA 4QL7A 1GUHA 4IJ3A 2XBIA 2LUSA 4XS4B 1OKDA 2GLRA 3FKFA 3APQA 2VM1A 3GSSA 2YJHA 2XC2A 1A2LA 3RPPA 3V1WA 2FA4A 1EP8A 1VF2A 2YJ7A 4IW9A 1UN2A 1CQGA 3LYPA 3EE2A 1K0AA 1VF1A 2A2PA 5H5RA 5BRTA 1O8XA 2HE3A 3GKKA 1T4ZA 1BEDA 3A5WA 2NBSA 3HZ4A 4WR4A 1MTCA 3GX0A 3D21A 1SJZA 2PERA 1ERTA 2GS3A 1QXHA 4K0NA 4PUFC 2B6MA 2VCXA 1FB0A 4OFMA 4NHWA 4IGJA 2WDUA 1TDIA 2K8VA 5LD0A 4LLRA 2LJAA 1AAZA 1RQMA 3TJFA 4MZCA 4TW5A 3CTFA 4XIHA 4CY8A 1IYIA 2KP2A 4GQCA 2VCZA 2CVBA 4V1Ag 1WE0A 2OJLA 2P5RA 1DE2A 3VWUA 3F0IA 3MNGA 2FD3A 1PX6A 2TRXA 3CYNA 3IC8A 2QA1A 2CA8A 2MZCA 4KB3A 1R7HA 2HSHA 2F51A 4J2FA 4N11A 2RIIA 2FCHA 2IL3A 3G7JA 1G0TA 4G0KA 1O73A 5AIXA 1TU7A 3KD0A 5KN0A 4JBBA 2DJ0A 5F06A 2B3SA 3J7Yk 2CZ2A 1LBKA 2GZZA 3IA1A 5F07A 2H75A 4EDYA 2VD0A 5ECMB 5AGYA 2EIOA 3LWAA 4POKA 2HT9A 2LNSA 3ZITA 5E59A 1B4QA 4FO5A 5CNWA 2L4QA 1AXDA 2H6YA 1EWXA 4TKYA 2ES7A 4TVEA 3GKNA 5D9XA 1XWBA 1ZZYA 1M9BA 2HSYA 2X4AA 3HVVA 6GSUA 4HI7A 4RQXA 1A0RP 3OR5A 5G2ZA 2H1BA 1ST9A 4FYBA 4MABA 2E7PA 3VPTA 4AJ8A 4OFTA 6GSVA 4L5OA 4IQAA 2WFCA 1X5DA 4DEJA 1T3BA 4AJ6A 3KTLA 1HYUA 1SK2A 1UC7A 4G9HA 2XBQA 4O5QA 3HDCA 17GSA 1ZYQB 2AUVA 1XZOA 2NVLA 5A4UA 2QKEA 3J7Yb 3DVWA 3RPNA 2LEGA 1JLWA 1WMJA 4D73A 3W8SA 2DKHA 2YOIA 2K8SA 3HYPA 1MDIA 5F05A 4XRDA 3VK9A 2IMDA 4G0IA 2H70A 2DMMA 3QR6A 3IR4A 4BPYA 3QMXA 1ZYEA 3F3RA 3LSZA 3RHBA 4KH7A 4MJAA 3QOUA 5IPHA 2CZ3A 2VUPA 2IPAA 5ECHB 1NHYA 2NTOA 1MEKA 2GZPA 1MDKA 1TRSA 3ERFA 1PD21 3LEFA 3GYKA 4V2LA 4IBPA 4Z2UA 5GAPD 3ZYWA 2GT6A 1A24A 1M9AA 1XVQA 2PBJA 1V9WA 3KMOA 1PSQA 4HZ2A 1Y6EA 3ED3A 3LFLA 2PPTA 1RW1A 5ID2B 5DQYA 2IFQB 3A2XA 4ZL8A 1PMTA 4MCUA 4I6XA 3TKSA 5CYYA 1V2AA 1PRXA 2F3MA 4TN8A 5ECQB 2H72A 1BYEA 1TRVA 2OBKA 3DVXA 1XWAA 5IM9A 4YAVA 3R2QA 1V58A 5B6MA 4WEYA 5HR3A 1K3YA 3A2VA 3EMXA 3HY2A 4OMVA 1KEBA 4XHMA 1S3DA 4K8MA 4JR6A 6GSTA 1GH2A 3ME8A 2ON7A 2K6VA 4K0GA 4F0CA 5A4VA 2P0GA 4DVCA 4G0LA 3L4NA 1H4OA 1OC8A 1PN9A 3D5JA 1SENA 3KP8A 2CAQA 4FIWA 4HU9A 5HR2A 3TRQA 4O5UA 3HCZA 1AQWA 3EURA 5C04A 2R5GA 1XVWA 1K3LA 4KCEA 5CRDA 2V41A 4ULXA 4NV5A 4PQHA 2OA7A 1XXUA 2H1AA 3GIXA 2L5OA 2H76A 4GCIA 1F9MA 5DVBA 4E8EA 4MJBA 2DIZA 2HFDA 4IS0A 5CRWA 2VAFA 3CBUA 5AN1A 5EY6A 2GZYA 3FZ9A 4DSRA 3A3TA 3QAWA 4ECJA 5ECKB 2VL9A 2N5BA 3L9SA 2NDOA 2EIQA 4PNGA 3O3TA 1SYXA 1Z6MA 4ZB6A 4LA1A 2HZFA 2DKIA 2H0IA 3TRXA 1K0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HZ4 A;  3EMP A;  1A8Y A;  2PVO C;  2VLV A;  1A23 A;  5J4U A;  1NW2 A;  2IMK A;  1GUL A;  1GUM A;  1GSD A;  3KMN A;  3G9B A;  2V2G A;  1GWC A;  2RM5 A;  1M99 A;  4BVX A;  4J56 E;  3KGK A;  4POL A;  3TJK A;  1JFU A;  2VLU A;  1HNA A;  3VI7 A;  1ERW A;  3L9V A;  3L78 A;  1I9D A;  1HNC A;  1PL1 A;  4CHS A;  2L5L A;  5KN2 A;  3HVX A;  2JSY A;  2L57 A;  1B8X A;  4MF7 A;  4DSS B;  2P5Q A;  1LU4 A;  5EVO A;  3ERW A;  4NXI A;  4NWY A;  2FWG A;  1O7U A;  22GS A;  5CP1 A;  2ZCT A;  1EGR A;  1OC9 B;  2O89 A;  3TKS C;  2X8C A;  4V2M A;  2OE3 A;  14GS A;  3KEB A;  2JZS A;  4NMU A;  3W6G A;  2F8F A;  1A2M A;  1TTZ A;  2H6Z A;  5KEJ A;  4HOJ A;  4ECB A;  1SJI A;  2AYT A;  3UMA A;  2HZE A;  1PKW A;  1QFN A;  1XFL A;  3GL3 A;  1YJ6 A;  3HA9 A;  2VL3 A;  3KCM A;  2PGT A;  1Z5Y E;  2FWE A;  1B4P A;  1GSU A;  3EYT A;  5FHI A;  3APS A;  1G6Y A;  1M2A A;  4EE0 A;  5ECL B;  1XWG A;  3F3Q A;  4GXZ A;  4KE3 A;  1MD3 A;  4MJE A;  2J9H A;  4OFN A;  2KHP A;  3QAG A;  4AGS A;  4XS4 A;  1X9M B;  3LXZ A;  3GL5 A;  5D9V A;  2YWI A;  1UVZ A;  2R37 A;  2R4V A;  10GS A;  1U87 A;  2WJU A;  3KXO A;  4KDY A;  2WS2 A;  3BCI A;  2HLS A;  4TR4 A;  2VCT A;  3HXS A;  3GH9 A;  4Z7X A;  2PUK C;  2VOC A;  2EIR A;  3GUR A;  2RM6 A;  4PQ1 A;  1BJX A;  1PKZ A;  1I5G A;  4ZB8 A;  3GX8 A;  2FA8 A;  4RQR A;  3WGX A;  3E3E A;  5B6N A;  3CMI A;  2DJ2 A;  3KP9 A;  5D9W A;  2PU9 C;  2YWM A;  1T7P B;  4GF0 A;  4KDX A;  3TJJ A;  2X99 A;  3ZMK A;  3VPQ A;  1TU8 A;  1WIK A;  4FYC A;  3TKR A;  5CO3 A;  3D4T A;  2C0F A;  2HRN A;  1Z9H A;  2XPD A;  2GQL A;  3UEM A;  1W4V A;  1ML6 A;  3QDN A;  3GTU B;  5B8B A;  4XRA A;  4CDO A;  4WF4 A;  1GSF A;  2L59 A;  1GNW A;  1XW6 A;  2XHF A;  4TXV A;  1SL1 B;  1N8J A;  2C0G A;  2B1L A;  4YQM A;  4ZIJ A;  3MWH A;  2MMN A;  3GKM A;  1GSY A;  5IMA A;  1IYH A;  4IN0 A;  3F4S A;  1EV4 A;  3GN3 A;  1GSQ A;  4O32 A;  3M3M A;  4GST A;  2IIY A;  4L8E A;  4G10 A;  1XW5 A;  3TB2 A;  2LRC A;  4GRF A;  1O85 A;  3NIV A;  5DQS A;  1EV9 A;  5IMF A;  3UVT A;  1TRU A;  3F6D A;  1GNE A;  4L0U A;  1FO5 A;  4TR3 A;  1WOU A;  3DKS A;  1VRS D;  2X8G A;  3LGC A;  6GSW A;  5D93 A;  3EU3 A;  4PUA A;  2R6K A;  4O7H A;  5DAK B;  3IDV A;  4IVF A;  3KIJ A;  1YF1 A;  2OKA A;  3KM6 A;  2WCI A;  2DJJ A;  1LJR A;  5ECR B;  4WBJ A;  5HR1 A;  1PQN A;  4PGT A;  3FZA A;  1AQV A;  2LJK A;  6GSS A;  1BX9 A;  2VCV A;  3Q19 A;  4EKZ A;  4ZB9 A;  2CVK A;  4JU5 A;  1YEX A;  4EL1 A;  3ZRE A;  1OE7 A;  5CAX A;  1TI1 A;  1B9Y C;  2L6C A;  4K7I A;  5D73 A;  2JSZ A;  3WT2 A;  4YAP A;  1WPI A;  5JCU A;  3CTG A;  1QUW A;  3C73 A;  1V57 A;  1ILO A;  5D96 A;  2HYX A;  3KZQ A;  3HJO A;  2OBI A;  3RBT A;  5IOW A;  3D0Z A;  3TOT A;  3TKQ A;  2ON5 A;  3F6F A;  4JZQ A;  2WZ9 A;  3HKR A;  5HFI A;  5IMV A;  3ZLP A;  2H0H A;  1JHB A;  2JZR A;  3VFI A;  1XBS A;  3M8N A;  5ELA A;  1U6T A;  4LL4 B;  4HJM A;  2AAW A;  2DLX A;  3G7I A;  5G30 A;  3E0U A;  3KH9 A;  3TOU A;  1OYJ A;  3EC3 A;  3C71 A;  3D6I A;  1SL0 B;  5JWR B;  2DC5 A;  2FY6 A;  5INY A;  3CSJ A;  2B7J A;  5F0G A;  4H86 A;  4WF5 A;  1EZK A;  1NM3 A;  3DML A;  4EC0 A;  1F2E A;  2G0F A;  5DAL A;  4ILF A;  4KW6 A;  1JZO A;  5D9T A;  2VO4 A;  3GUS A;  4WBR D;  1A8L A;  1TRW A;  2YNX A;  2O7K A;  2KOK A;  4E8H A;  5KN1 A;  2C80 A;  1EOG A;  3U5R E;  2DJK A;  3PR8 A;  2M46 A;  3VWV A;  2GSR A;  3GST A;  8GSS A;  3UAP A;  1O81 A;  1X5C A;  3FEU A;  3IE3 A;  1F3A A;  1ACV A;  1CQH A;  5ID2 A;  2IFQ A;  4HJ2 A;  3TGZ A;  2CX4 A;  4I5Q A;  3TRP A;  4I8B A;  1TKD B;  4G2E A;  2E2M A;  1ERV A;  4K7O A;  3TCO A;  2DIY A;  2GDR A;  1GTA A;  4V1A p;  1Z7R A;  4AJ7 A;  1XWC A;  3F4T A;  4MH2 A;  5H5S A;  1EOH A;  3M1G A;  2JAC A;  4TR1 B;  3IK9 A;  1T1V A;  4FH8 A;  1PL2 A;  1GL8 A;  1A0F A;  5EPF A;  3UOM A;  2VM2 A;  1VGL A;  4TRX A;  3FW2 A;  2DSA A;  5JWO B;  1KNG A;  1AC1 A;  5IO2 A;  1C72 A;  3C1S A;  2B5E A;  5HR0 A;  12GS A;  4ML1 A;  2IMI A;  2FNO A;  3G7Y A;  1PX7 A;  2BJX A;  1XOA A;  3MDK A;  1TK0 B;  3TKS E;  4DSQ A;  2OE1 A;  2E0Q A;  3PH9 A;  2YPM A;  3UBK A;  5L71 A;  1TK5 B;  4JR4 A;  3NOF A;  3UBL A;  5IO0 A;  4MF6 A;  4QL9 A;  2LST A;  5KN3 A;  1A2J A;  1FHE A;  3DEX A;  4Q5F A;  2CQ9 A;  2IMF A;  3KH7 A;  4HEA 2;  1GSS A;  5EL8 A;  3WYW A;  4RUV A;  2C3Q A;  1TW9 A;  2EC4 A;  3FYG A;  1URM A;  4HS1 A;  1K0D A;  1AW9 A;  1WWJ A;  18GS A;  2FWH A;  2GST A;  3QAV A;  3M9K A;  3GRX A;  5ABR A;  1K0O A;  4YQU A;  5JCG A;  3BD2 A;  3ZVJ D;  4YH2 A;  4IQ1 A;  4KX4 A;  4AF2 A;  3H79 A;  2H19 A;  1SK0 A;  4ZL7 A;  4NHZ A;  1UA5 A;  3WD6 A;  4Q5R A;  3FZ4 A;  3HJM A;  1Y25 A;  3F9U A;  2V1M A;  3E9J B;  1K3O A;  5GSS A;  2YWO A;  3LXT A;  4MPF A;  1XCC A;  4FYU A;  1M2D A;  1SK1 A;  2WGR A;  4LMW A;  2O85 A;  3ZVJ A;  1QGV A;  3HHV A;  4POB A;  2DJ3 A;  1VF4 A;  4NPB A;  3WGE A;  1BAY A;  1GLQ A;  2AJQ B;  3LG6 A;  4DSS A;  2C4J A;  2B1K A;  4K6X A;  2K9F A;  3IRA A;  4NAX A;  3DGQ A;  1K0C A;  4ZXG A;  4POM A;  1YY7 A;  1FOV A;  5DCG A;  1M0U A;  2H73 A;  1E2Y A;  4N30 A;  3LYK A;  1FVJ A;  4O92 A;  2GT5 A;  4IJI A;  2AHE A;  3F8U A;  4OWY A;  3ZFL A;  3ZL5 A;  2PMT A;  5ENU A;  4BA7 A;  3JCM L;  4IP6 A;  4GSN A;  2B5X A;  4MLY A;  4PNF A;  1OVN A;  1WJK A;  3ZFB A;  5LCZ A;  1PA3 A;  1Z7P A;  1SKW B;  3FR9 A;  2X8H A;  5B8A A;  5C00 A;  2GSS A;  4X1U A;  3QFA C;  4KAE A;  4EVM A;  3UL3 A;  1XIY A;  3L0H A;  2FLS A;  1FVK A;  4TR0 A;  1DE1 A;  2LJR A;  2YWN A;  1SL2 B;  3MSZ A;  1YDK A;  3EIN A;  1H75 A;  4ISD A;  4GQF A;  1W89 A;  4LMV A;  3Q6O A;  3ZTL A;  1M7T A;  2OAC A;  2I3Y A;  2PVQ A;  2ZUP A;  3I6A A;  1SD9 A;  5DJM A;  1THO A;  4HUA A;  3D22 A;  3C7M A;  1S3C A;  3F4R A;  1G7E A;  2WRT A;  2FHE A;  3P2A A;  4RI7 A;  2R3X A;  2X64 A;  1Z6N A;  2L4C A;  3FRC A;  1EGO A;  3L9U A;  4XCS A;  4EF0 A;  1DBY A;  2K18 A;  1V40 A;  3GV1 A;  13GS A;  2H0G A;  1JZW A;  4QQ7 A;  2IJY A;  2LRN A;  1TI3 A;  2LRT A;  4PQI A;  4MPG A;  2HNL A;  1SU9 A;  2L6D A;  2H30 A;  5J9C A;  2JZT A;  2YV7 A;  5DJL A;  3FHK A;  2XPE A;  1BG5 A;  1TK8 B;  1GLP A;  2LS5 A;  3WT1 A;  9GSS A;  2DML A;  20GS A;  3H8Q A;  1F3B A;  1DSB A;  5IQY A;  1K0N A;  1F6M C;  5DBQ A;  1YF0 A;  5A4W A;  2H71 A;  5ECP B;  3TJB A;  2N5A A;  4K1F A;  4MZW A;  3GNJ A;  2AB6 A;  1T4Y A;  2I81 A;  1OC3 A;  3BBY A;  3SWL A;  3TJG A;  2HI7 A;  3BOA A;  3QPM A;  2O8V B;  4TXO B;  5GST A;  3TDG A;  4P3Y B;  1EEJ A;  2P31 A;  1ZGN A;  1T00 A;  5IMC A;  2CX3 A;  4I2U A;  1R26 A;  2GVP A;  2R2J A;  4HQZ A;  3HD5 A;  5A5K A;  4MJC A;  1NSW A;  1QQ2 A;  5J5N A;  4KSM A;  2ZNM A;  3VLN A;  3LJR A;  2MMA A;  3LOR A;  3W8J A;  1GP1 A;  2YP6 A;  5DAK A;  3CXG A;  5FT3 A;  3O76 A;  2B5Y A;  2PWJ A;  2VL2 A;  1GRX A;  1KTE A;  5JCW A;  2H8L A;  1Q4J A;  4HU7 A;  1TP9 A;  1WRY A;  2F8A A;  4J57 E;  4WXT A;  4OCF A;  2WB9 A;  1ON4 A;  2TIR A;  2YV9 A;  5DCH A;  1K0M A;  4L0W A;  1R5A A;  5G31 A;  4ECI A;  1GTI A;  1ZMA A;  3DD3 A;  3HVS A;  3MAK A;  2H1G A;  3IC4 A;  4CW9 A;  4KCA A;  1SJ6 A;  2CV4 A;  2QGV A;  2FGX A;  5ELG A;  4RI6 A;  2WUL A;  5F8B A;  5LNK e;  3S9F A;  2OAD A;  3QCP A;  1THX A;  1S3A A;  3WGD A;  4V2N A;  2QC7 A;  5D8I A;  3VWX A;  2BTO T;  5IMD A;  3BCK A;  4N10 A;  1TOF A;  2LV3 A;  4MA9 A;  5E4W A;  2V6K A;  4MF5 A;  5IMZ A;  1ZCP A;  2DBC A;  1NHO A;  4BWQ A;  1WP0 A;  3IAS 2;  3HJP A;  4IHU A;  2YCD A;  3IPZ A;  5G1K A;  2LTK A;  2QSI A;  3TUE A;  3P7X A;  2M80 A;  3VI5 A;  3IV4 A;  2YZU A;  1YQ1 A;  2A2R A;  3D4M A;  4XS6 A;  1VF3 A;  3QFB C;  4F2I A;  4K7N A;  4MZB A;  2V32 A;  4F03 A;  2H01 A;  1U3A A;  3UJ1 A;  5CRH A;  4PX1 A;  4EUY A;  3DRN A;  3P90 A;  2YN1 A;  3H93 A;  4GLT A;  4N0Z A;  3GKX A;  4HDE A;  1G6W A;  4JED A;  2C1Y A;  2C0D A;  3DIE A;  5COH A;  2RUE A;  2E2G A;  3GH6 A;  1FW1 A;  2Z9S A;  5GZZ B;  1Q98 A;  4I97 A;  2O87 A;  4ML6 A;  3KJY A;  2IN3 A;  1M2B A;  1XPV A;  2C0E A;  5CRE A;  4OD7 A;  5IOX A;  1MD4 A;  1OAZ A;  3FY7 A;  1AQX A;  2J23 A;  3CRT A;  5ECI B;  2VCW A;  4EDZ A;  4TR1 A;  2AV4 A;  4X0X A;  3SBC A;  2H1D A;  4OO5 A;  2FWF A;  4HQS A;  2C3N A;  1BQ7 A;  2M72 A;  2VL2 C;  1SKR B;  1RK4 A;  1FG4 A;  1G7O A;  1TXX A;  4JE1 A;  1YEP A;  5DAL B;  1XOB A;  4ZL9 A;  4ZIL A;  1GTU A;  2RUF A;  1AIU A;  3RAZ A;  5HQP A;  4K2D A;  1E6B A;  3RHC A;  1N2A A;  1X5E A;  3FR6 A;  3M0F A;  2PN8 A;  5G1L A;  4D73 B;  4BL7 A;  6GSX A;  1USB A;  4K9Z A;  5J41 A;  4OO4 A;  1XW9 A;  1HNB A;  5JWQ B;  2REM A;  1R5P A;  3I9V 2;  1U88 A;  3QD9 A;  4I2T A;  2MBT A;  2RLI A;  3ZIV A;  3LQ7 A;  3IHQ A;  3NZN A;  4WET A;  1EP7 A;  2D2Z A;  3IXR A;  4ACS A;  4ZBD A;  3IBH A;  1B9X C;  1U3I A;  3H1N A;  4MDC A;  1R4W A;  2I1U A;  2GTU A;  1QMV A;  1ABA A;  3P8W A;  2N5F A;  4YQV A;  2B7K A;  3RDW A;  4ECC A;  1YZX A;  4IEL A;  1AUC A;  2CT6 A;  2JU5 A;  2BMX A;  4O5R A;  1MDJ A;  7GSS A;  1GTB A;  1JZR A;  3UAR A;  1QK8 A;  2LQO A;  4IKH A;  2JAD A;  2CVD A;  3PIN A;  4G19 A;  19GS A;  2C8U A;  2V6O A;  4ZBB A;  4EXJ A;  3ZRD A;  4F82 A;  4XS1 A;  4MK3 A;  5J3R A;  2FUG 2;  3ISO A;  4XTS A;  4BWS A;  3GA4 A;  1YKA A;  4KA0 A;  1SKS B;  5AIV A;  4X43 A;  3IOS A;  4KSO A;  1JZD A;  1SD8 A;  2KLX A;  2LQQ A;  1T8E B;  5G5F A;  3I43 A;  5ECN B;  16GS A;  3EWL A;  5CRG A;  5J9B A;  1EEM A;  1XWK A;  4WR5 A;  2LNT A;  2NPB A;  2YZH A;  4WKW A;  1YKC A;  3C8E A;  3AY8 A;  3TKP A;  4OCE A;  1TJD A;  4TOP A;  2MMO A;  2IME A;  3IK7 A;  11GS A;  5DDL A;  5AIS A;  2JL4 A;  1ERU A;  2F9S A;  1JLV A;  4GSS A;  1OC9 A;  2GSQ A;  2I9H A;  1J9B A;  4NV2 A;  3HZ8 A;  1J08 A;  2H66 A;  2MYG A;  3I69 A;  3FR3 A;  4PXO A;  1FAA A;  3ZIJ A;  4KUN A;  5ECS A;  4GWR A;  2MBS A;  3BJ5 A;  1ZOF A;  2HRF A;  3O6T A;  5HFK A;  4PUR A;  3VWW A;  4KDU A;  5ECO B;  2VD1 A;  3ME7 A;  1X0R A;  3GFK A;  2LKU A;  3U6V A;  4JRR A;  3K8N A;  3IAM 2;  3PGT A;  1HQO A;  2HXK A;  6GSY A;  3FZ5 A;  3EU4 A;  1X9W B;  1GUK A;  2IWT A;  3VUR A;  1J0F A;  4EO3 A;  5IPG A;  3N5O A;  3DWV A;  2VLT A;  4GTU A;  3N9J A;  4LL1 B;  4L5L A;  3GHA A;  3KTB A;  1KBN A;  1HD2 A;  3CSH A;  4KGI A;  1DUG A;  5HFG A;  2G2Q A;  3CRU A;  1OKT A;  3ERG A;  2C3T A;  3Q74 A;  3C1R A;  4MP4 A;  2A4V A;  2YAN A;  2OE0 A;  3UVH A;  3GMF A;  3EVI A;  1X9S B;  2CAI A;  2GQM A;  5H5Q A;  1ZL9 A;  1PGT A;  2I4A A;  4ZBA A;  4BVY A;  3CSI A;  5GAN D;  4MMM A;  1FB6 A;  2VIM A;  1GSE A;  1OE8 A;  3DXB A;  3APO A;  1O6J A;  3UIW A;  2H6X A;  2KP1 A;  3F63 A;  4F0B A;  2KUC A;  3M9J A;  4N0V A;  2TRC P;  4TXO A;  1Z3E A;  5B7C A;  2GQK A;  5IIZ A;  2HZE B;  5FWG A;  2DJ1 A;  3H4K A;  5G5E A;  1B48 A;  3Q18 A;  3GTU A;  4ID0 A;  3A2W A;  2GGT A;  4Q5Q A;  2A2S A;  4MH3 A;  3DYR A;  2H74 A;  1O8W A;  2MMZ A;  1SYR A;  1F37 A;  4IP1 A;  3ZZX A;  4Q5N A;  1V98 A;  4KND A;  3US3 A;  4F9Z A;  2VCQ A;  3FK8 A;  3ZML A;  2ALB A;  4QL7 A;  1GUH A;  4IJ3 A;  2XBI A;  2LUS A;  4XS4 B;  1OKD A;  2GLR A;  3FKF A;  3APQ A;  2VM1 A;  3GSS A;  2YJH A;  2XC2 A;  1A2L A;  3RPP A;  3V1W A;  2FA4 A;  1EP8 A;  1VF2 A;  2YJ7 A;  4IW9 A;  1UN2 A;  1CQG A;  3LYP A;  3EE2 A;  1K0A A;  1VF1 A;  5H5R A;  1O8X A;  2HE3 A;  3GKK A;  1T4Z A;  1BED A;  3A5W A;  2NBS A;  3HZ4 A;  4WR4 A;  1MTC A;  3GX0 A;  3D21 A;  1SJZ A;  2PER A;  1ERT A;  2GS3 A;  1QXH A;  4K0N A;  4PUF C;  2B6M A;  2VCX A;  1FB0 A;  4OFM A;  4NHW A;  4IGJ A;  2WDU A;  1TDI A;  2K8V A;  5LD0 A;  4LLR A;  2LJA A;  1AAZ A;  1RQM A;  3TJF A;  4MZC A;  4TW5 A;  3CTF A;  4XIH A;  1IYI A;  2KP2 A;  4GQC A;  2VCZ A;  2CVB A;  4V1A g;  1WE0 A;  2OJL A;  2P5R A;  1DE2 A;  3VWU A;  3F0I A;  3MNG A;  2FD3 A;  1PX6 A;  2TRX A;  3CYN A;  2CA8 A;  2MZC A;  4KB3 A;  1R7H A;  2HSH A;  2F51 A;  4J2F A;  4N11 A;  2RII A;  2FCH A;  2IL3 A;  3G7J A;  1G0T A;  1O73 A;  5AIX A;  1TU7 A;  3KD0 A;  5KN0 A;  4JBB A;  2DJ0 A;  5F06 A;  2B3S A;  3J7Y k;  2CZ2 A;  1LBK A;  2GZZ A;  3IA1 A;  5F07 A;  2H75 A;  4EDY A;  2VD0 A;  5ECM B;  5AGY A;  2EIO A;  3LWA A;  4POK A;  2HT9 A;  2LNS A;  3ZIT A;  5E59 A;  1B4Q A;  4FO5 A;  5CNW A;  2L4Q A;  1AXD A;  2H6Y A;  1EWX A;  4TKY A;  2ES7 A;  4TVE A;  3GKN A;  5D9X A;  1XWB A;  1ZZY A;  1M9B A;  2HSY A;  3HVV A;  6GSU A;  4HI7 A;  4RQX A;  1A0R P;  3OR5 A;  5G2Z A;  2H1B A;  1ST9 A;  4FYB A;  4MAB A;  2E7P A;  3VPT A;  4AJ8 A;  4OFT A;  6GSV A;  4L5O A;  4IQA A;  2WFC A;  1X5D A;  4DEJ A;  1T3B A;  4AJ6 A;  3KTL A;  1HYU A;  1SK2 A;  1UC7 A;  4G9H A;  2XBQ A;  3HDC A;  17GS A;  1ZYQ B;  2AUV A;  1XZO A;  2NVL A;  5A4U A;  2QKE A;  3J7Y b;  3DVW A;  3RPN A;  2LEG A;  1JLW A;  1WMJ A;  4D73 A;  3W8S A;  2YOI A;  2K8S A;  3HYP A;  1MDI A;  5F05 A;  4XRD A;  3VK9 A;  2IMD A;  2H70 A;  2DMM A;  3QR6 A;  3IR4 A;  4BPY A;  3QMX A;  1ZYE A;  3F3R A;  3LSZ A;  3RHB A;  4KH7 A;  4MJA A;  3QOU A;  5IPH A;  2CZ3 A;  2VUP A;  2IPA A;  5ECH B;  1NHY A;  2NTO A;  1MEK A;  2GZP A;  1MDK A;  1TRS A;  3ERF A;  1PD2 1;  3LEF A;  3GYK A;  4V2L A;  4IBP A;  5GAP D;  3ZYW A;  2GT6 A;  1A24 A;  1M9A A;  1XVQ A;  2PBJ A;  1V9W A;  3KMO A;  1PSQ A;  4HZ2 A;  1Y6E A;  3ED3 A;  3LFL A;  2PPT A;  1RW1 A;  5ID2 B;  5DQY A;  2IFQ B;  3A2X A;  4ZL8 A;  1PMT A;  4MCU A;  4I6X A;  3TKS A;  5CYY A;  1V2A A;  1PRX A;  2F3M A;  4TN8 A;  5ECQ B;  2H72 A;  1BYE A;  1TRV A;  2OBK A;  3DVX A;  1XWA A;  5IM9 A;  4YAV A;  3R2Q A;  1V58 A;  5B6M A;  4WEY A;  5HR3 A;  1K3Y A;  3A2V A;  3EMX A;  3HY2 A;  4OMV A;  1KEB A;  4XHM A;  1S3D A;  4K8M A;  4JR6 A;  6GST A;  1GH2 A;  3ME8 A;  2ON7 A;  2K6V A;  4K0G A;  4F0C A;  5A4V A;  2P0G A;  4DVC A;  3L4N A;  1H4O A;  1OC8 A;  1PN9 A;  3D5J A;  1SEN A;  3KP8 A;  2CAQ A;  4FIW A;  4HU9 A;  5HR2 A;  3TRQ A;  3HCZ A;  1AQW A;  3EUR A;  5C04 A;  2R5G A;  1XVW A;  1K3L A;  4KCE A;  5CRD A;  2V41 A;  4ULX A;  4NV5 A;  4PQH A;  2OA7 A;  1XXU A;  2H1A A;  3GIX A;  2L5O A;  2H76 A;  4GCI A;  1F9M A;  5DVB A;  4E8E A;  4MJB A;  2DIZ A;  2HFD A;  4IS0 A;  5CRW A;  2VAF A;  3CBU A;  5AN1 A;  5EY6 A;  2GZY A;  3FZ9 A;  4DSR A;  3A3T A;  3QAW A;  4ECJ A;  5ECK B;  2VL9 A;  2N5B A;  3L9S A;  2NDO A;  2EIQ A;  4PNG A;  3O3T A;  1SYX A;  1Z6M A;  4ZB6 A;  4LA1 A;  2HZF A;  2H0I A;  3TRX A;  1K0B A; 
#chains in the Genus database with same CATH topology
 4HZ4 A;  3EMP A;  1A8Y A;  2PVO C;  2VLV A;  1A23 A;  5J4U A;  1NW2 A;  2IMK A;  1GUL A;  1GUM A;  1GSD A;  3KMN A;  3G9B A;  2V2G A;  1GWC A;  2RM5 A;  1M99 A;  4BVX A;  4USS A;  4J56 E;  3KGK A;  4POL A;  3TJK A;  1JFU A;  2VLU A;  1HNA A;  3VI7 A;  1ERW A;  3L9V A;  3L78 A;  1I9D A;  1HNC A;  1PL1 A;  4CHS A;  2L5L A;  5KN2 A;  3HVX A;  2JSY A;  2L57 A;  1B8X A;  4MF7 A;  4DSS B;  2P5Q A;  1LU4 A;  5EVO A;  3ERW A;  4NXI A;  4NWY A;  2FWG A;  1O7U A;  1PFO A;  22GS A;  5CP1 A;  2ZCT A;  1EGR A;  1OC9 B;  2O89 A;  3TKS C;  3MYD A;  2X8C A;  4V2M A;  2OE3 A;  14GS A;  4EIQ A;  3KEB A;  2JZS A;  4NMU A;  3W6G A;  2F8F A;  1A2M A;  1TTZ A;  2H6Z A;  5KEJ A;  4HOJ A;  4ECB A;  1M3J A;  1SJI A;  2AYT A;  3UMA A;  2HZE A;  1PKW A;  1QFN A;  1XFL A;  3GL3 A;  1YJ6 A;  3HA9 A;  2VL3 A;  3KCM A;  2PGT A;  1Z5Y E;  2FWE A;  1B4P A;  1GSU A;  3EYT A;  5FHI A;  3APS A;  1G6Y A;  1M2A A;  4EE0 A;  5ECL B;  1XWG A;  3F3Q A;  4GXZ A;  5KOX A;  4KE3 A;  1MD3 A;  4MJE A;  2J9H A;  4OFN A;  2KHP A;  3QAG A;  4AGS A;  4XS4 A;  1X9M B;  3LXZ A;  3GL5 A;  5D9V A;  2YWI A;  1UVZ A;  2R37 A;  2R4V A;  10GS A;  1U87 A;  2WJU A;  3KXO A;  4KDY A;  2WS2 A;  3BCI A;  2A4H A;  2HLS A;  4TR4 A;  2VCT A;  3HXS A;  3GH9 A;  4Z7X A;  3CQF A;  2PUK C;  2VOC A;  2EIR A;  3GUR A;  2RM6 A;  4PQ1 A;  1BJX A;  1PKZ A;  1I5G A;  4ZB8 A;  3GX8 A;  2FA8 A;  4RQR A;  3WGX A;  3E3E A;  3A5I A;  2HRA A;  5B6N A;  3CMI A;  2DJ2 A;  3KP9 A;  5D9W A;  2PU9 C;  2YWM A;  1T7P B;  4GF0 A;  4KDX A;  3TJJ A;  2X99 A;  3ZMK A;  3VPQ A;  1TU8 A;  1WIK A;  4FYC A;  3TKR A;  5CO3 A;  3D4T A;  2C0F A;  2HRN A;  1Z9H A;  2XPD A;  2GQL A;  3UEM A;  1W4V A;  1ML6 A;  3QDN A;  3GTU B;  5B8B A;  4MNN A;  4XRA A;  4CDO A;  4WF4 A;  1GSF A;  2L59 A;  1GNW A;  1XW6 A;  2XHF A;  4TXV A;  1SL1 B;  1N8J A;  2C0G A;  2B1L A;  4YQM A;  4ZIJ A;  3MWH A;  2MMN A;  3GKM A;  1GSY A;  5IMA A;  1IYH A;  4IN0 A;  3F4S A;  1EV4 A;  3GN3 A;  1GSQ A;  4O32 A;  3M3M A;  4GST A;  2IIY A;  4L8E A;  4G10 A;  1XW5 A;  3TB2 A;  2LRC A;  4GRF A;  1O85 A;  3NIV A;  5DQS A;  1EV9 A;  5IMF A;  3UVT A;  1TRU A;  3F6D A;  1GNE A;  4L0U A;  1FO5 A;  4TR3 A;  1WOU A;  3DKS A;  1VRS D;  2X8G A;  3LGC A;  6GSW A;  4PUA A;  3EU3 A;  5D93 A;  2R6K A;  4O7H A;  1XG8 A;  5DAK B;  3IDV A;  4IVF A;  3KIJ A;  1YF1 A;  2OKA A;  3KM6 A;  2WCI A;  2DJJ A;  1LJR A;  5ECR B;  4WBJ A;  5HR1 A;  1PQN A;  4PGT A;  3FZA A;  1AQV A;  2LJK A;  6GSS A;  1BX9 A;  2VCV A;  3Q19 A;  3IHG A;  4EKZ A;  4ZB9 A;  2CVK A;  4JU5 A;  1YEX A;  4EL1 A;  3ZRE A;  1OE7 A;  5CAX A;  1TI1 A;  1B9Y C;  2L6C A;  4K7I A;  5D73 A;  2JSZ A;  3WT2 A;  4YAP A;  1WPI A;  5JCU A;  3CTG A;  1QUW A;  3C73 A;  1V57 A;  1ILO A;  5D96 A;  2HYX A;  3KZQ A;  3HJO A;  2OBI A;  3RBT A;  5IOW A;  3D0Z A;  3TOT A;  3TKQ A;  2ON5 A;  3F6F A;  4JZQ A;  2WZ9 A;  3HKR A;  5HFI A;  5IMV A;  3ZLP A;  2H0H A;  1JHB A;  2JZR A;  3VFI A;  1XBS A;  3M8N A;  4LL4 B;  1U6T A;  5ELA A;  4HJM A;  2AAW A;  2DLX A;  3G7I A;  5G30 A;  3E0U A;  3KH9 A;  3TOU A;  1OYJ A;  3EC3 A;  3C71 A;  3D6I A;  1SL0 B;  5JWR B;  2DC5 A;  2FY6 A;  3MIX A;  5INY A;  3CSJ A;  2B7J A;  4K5R A;  5F0G A;  4H86 A;  4YKF A;  4WF5 A;  1EZK A;  2R0P A;  1NM3 A;  3DML A;  4EC0 A;  1F2E A;  2G0F A;  5DAL A;  4ILF A;  4KW6 A;  1JZO A;  5D9T A;  4K5S A;  2VO4 A;  3GUS A;  4WBR D;  1A8L A;  1TRW A;  4FQU A;  2YNX A;  2O7K A;  2KOK A;  1ZYN A;  4E8H A;  5KN1 A;  2C80 A;  1EOG A;  3U5R E;  2DJK A;  3PR8 A;  2M46 A;  3VWV A;  2GSR A;  3GST A;  8GSS A;  3UAP A;  1O81 A;  1X5C A;  3FEU A;  3IE3 A;  1F3A A;  1ACV A;  1CQH A;  5ID2 A;  2IFQ A;  4HJ2 A;  3TGZ A;  2CX4 A;  4I5Q A;  3TRP A;  4I8B A;  1TKD B;  4G2E A;  2E2M A;  1ERV A;  4K7O A;  3TCO A;  2DIY A;  2GDR A;  1GTA A;  4V1A p;  1Z7R A;  4AJ7 A;  2R0G A;  1XWC A;  3F4T A;  4MH2 A;  5H5S A;  1EOH A;  3M1G A;  2JAC A;  4TR1 B;  3IK9 A;  1T1V A;  4FH8 A;  1PL2 A;  1GL8 A;  1A0F A;  5EPF A;  3UOM A;  2VM2 A;  1VGL A;  4TRX A;  3FW2 A;  2DSA A;  5BMU A;  5JWO B;  1KNG A;  1AC1 A;  5IO2 A;  1C72 A;  3C1S A;  2B5E A;  5HR0 A;  12GS A;  4ML1 A;  2IMI A;  2FNO A;  3G7Y A;  1PX7 A;  1PN0 A;  2BJX A;  1XOA A;  3MDK A;  1TK0 B;  3TKS E;  4DSQ A;  2OE1 A;  2E0Q A;  3PH9 A;  2YPM A;  3UBK A;  5L71 A;  1TK5 B;  4JR4 A;  3NOF A;  4BL7 B;  3UBL A;  5IO0 A;  4MF6 A;  4QL9 A;  2LST A;  5KN3 A;  1A2J A;  1FHE A;  3DEX A;  4Q5F A;  2CQ9 A;  2R0C A;  2IMF A;  3KH7 A;  4HEA 2;  1GSS A;  5EL8 A;  3WYW A;  4RUV A;  2C3Q A;  1TW9 A;  2EC4 A;  3FYG A;  1URM A;  4HS1 A;  1K0D A;  1AW9 A;  1WWJ A;  18GS A;  2FWH A;  2GST A;  3QAV A;  3M9K A;  3GRX A;  5ABR A;  1K0O A;  4YQU A;  3PPU A;  5JCG A;  3BD2 A;  3ZVJ D;  4YH2 A;  4Z2T A;  4IQ1 A;  4KX4 A;  4AF2 A;  3H79 A;  2H19 A;  1SK0 A;  4ZL7 A;  4NHZ A;  1UA5 A;  3WD6 A;  4Q5R A;  3FZ4 A;  4Z2R A;  3HJM A;  1Y25 A;  3F9U A;  2V1M A;  3E9J B;  1K3O A;  5GSS A;  2YWO A;  3LXT A;  4MPF A;  1XCC A;  4FYU A;  1M2D A;  1SK1 A;  2WGR A;  4LMW A;  2O85 A;  3ZVJ A;  2UZ8 A;  1QGV A;  3HHV A;  4POB A;  2DJ3 A;  1VF4 A;  4NPB A;  3WGE A;  1BAY A;  1GLQ A;  2AJQ B;  3LG6 A;  4DSS A;  2C4J A;  2B1K A;  4K6X A;  2K9F A;  3IRA A;  4NAX A;  3DGQ A;  1K0C A;  4ZXG A;  4POM A;  1YY7 A;  1FOV A;  5DCG A;  1M0U A;  2H73 A;  1E2Y A;  4N30 A;  3LYK A;  1FVJ A;  4O92 A;  2GT5 A;  4IJI A;  2AHE A;  3F8U A;  4OWY A;  3ZFL A;  3ZL5 A;  2PMT A;  5ENU A;  4BA7 A;  3JCM L;  4IP6 A;  4GSN A;  2B5X A;  4MLY A;  4PNF A;  1OVN A;  1WJK A;  3ZFB A;  5LCZ A;  1PA3 A;  1Z7P A;  1SKW B;  3FR9 A;  2X8H A;  5B8A A;  5C00 A;  2GSS A;  4X1U A;  3QFA C;  4KAE A;  4EVM A;  3UL3 A;  1XIY A;  3L0H A;  2FLS A;  1FVK A;  4TR0 A;  1DE1 A;  2LJR A;  2YWN A;  1SL2 B;  3MSZ A;  1YDK A;  3EIN A;  1H75 A;  4ISD A;  4GQF A;  1W89 A;  4LMV A;  3Q6O A;  3ZTL A;  1M7T A;  2OAC A;  2I3Y A;  2PVQ A;  2ZUP A;  3I6A A;  1SD9 A;  5DJM A;  1THO A;  4HUA A;  3D22 A;  3C7M A;  1S3C A;  3F4R A;  1G7E A;  2WRT A;  2FHE A;  3P2A A;  4RI7 A;  2R3X A;  2X64 A;  1Z6N A;  2L4C A;  3FRC A;  1EGO A;  3L9U A;  4XCS A;  4EF0 A;  1DBY A;  2K18 A;  1V40 A;  3GV1 A;  13GS A;  2H0G A;  1JZW A;  4QQ7 A;  2IJY A;  2LRN A;  1TI3 A;  2LRT A;  4PQI A;  4MPG A;  2HNL A;  1SU9 A;  2L6D A;  5KOW A;  2H30 A;  5J9C A;  2JZT A;  2YV7 A;  5DJL A;  3FHK A;  2XPE A;  4X4J A;  1BG5 A;  1TK8 B;  1GLP A;  2LS5 A;  3WT1 A;  9GSS A;  2DML A;  20GS A;  3H8Q A;  1F3B A;  4BVY B;  1DSB A;  5IQY A;  1K0N A;  1F6M C;  5DBQ A;  1YF0 A;  5A4W A;  2H71 A;  5ECP B;  3TJB A;  2N5A A;  4K1F A;  4MZW A;  3GNJ A;  1M3I A;  2AB6 A;  1T4Y A;  2I81 A;  1OC3 A;  3BBY A;  3SWL A;  3TJG A;  2HI7 A;  3BOA A;  3QPM A;  2O8V B;  4TXO B;  5GST A;  3TDG A;  4P3Y B;  1EEJ A;  2P31 A;  1ZGN A;  1T00 A;  5IMC A;  2CX3 A;  4I2U A;  1R26 A;  2GVP A;  2R2J A;  4HQZ A;  3HD5 A;  5A5K A;  4MJC A;  1NSW A;  1QQ2 A;  5J5N A;  4KSM A;  2ZNM A;  3VLN A;  3LJR A;  2MMA A;  3LOR A;  1ZYP A;  3W8J A;  1GP1 A;  2YP6 A;  5DAK A;  3CXG A;  5FT3 A;  3O76 A;  2B5Y A;  2PWJ A;  2VL2 A;  1GRX A;  1KTE A;  5JCW A;  2H8L A;  1Q4J A;  4HU7 A;  1TP9 A;  1WRY A;  2F8A A;  4J57 E;  4WXT A;  4OCF A;  2WB9 A;  1ON4 A;  2TIR A;  2YV9 A;  5DCH A;  1K0M A;  4L0W A;  1R5A A;  5G31 A;  4ECI A;  1GTI A;  1ZMA A;  3DD3 A;  3HVS A;  3MAK A;  2H1G A;  3IC4 A;  4CW9 A;  4KCA A;  1SJ6 A;  2CV4 A;  2QGV A;  2FGX A;  5ELG A;  4RI6 A;  2WUL A;  5F8B A;  5LNK e;  3S9F A;  2OAD A;  3QCP A;  2HRK A;  1THX A;  1S3A A;  3WGD A;  4V2N A;  2QC7 A;  5D8I A;  3VWX A;  2BTO T;  5IMD A;  3BCK A;  4N10 A;  1TOF A;  2LV3 A;  4MA9 A;  5E4W A;  2V6K A;  4MF5 A;  5IMZ A;  1ZCP A;  2DBC A;  1NHO A;  4BWQ A;  1WP0 A;  3R3E A;  3IAS 2;  4A5P A;  3HJP A;  4IHU A;  2YCD A;  3IPZ A;  5G1K A;  2LTK A;  2QSI A;  3TUE A;  3P7X A;  2M80 A;  3VI5 A;  3IV4 A;  2YZU A;  1YQ1 A;  2A2R A;  3D4M A;  4XS6 A;  1VF3 A;  3QFB C;  4F2I A;  4K7N A;  4MZB A;  2V32 A;  4F03 A;  2H01 A;  1U3A A;  3UJ1 A;  5CRH A;  4PX1 A;  4EUY A;  4ICY A;  4BIK A;  3DRN A;  3P90 A;  2YN1 A;  3H93 A;  4GLT A;  4N0Z A;  3GKX A;  4HDE A;  1G6W A;  4JED A;  2C1Y A;  2C0D A;  3DIE A;  5COH A;  2RUE A;  2E2G A;  3GH6 A;  1FW1 A;  2Z9S A;  5GZZ B;  1Q98 A;  4I97 A;  2O87 A;  4ML6 A;  3KJY A;  2IN3 A;  1M2B A;  1XPV A;  2C0E A;  5CRE A;  4OD7 A;  5IOX A;  1MD4 A;  1OAZ A;  3FY7 A;  1AQX A;  2J23 A;  3CRT A;  5ECI B;  2VCW A;  4EDZ A;  4TR1 A;  2AV4 A;  4X0X A;  3SBC A;  2H1D A;  4OO5 A;  2FWF A;  4HQS A;  2C3N A;  1BQ7 A;  2M72 A;  2VL2 C;  1SKR B;  1RK4 A;  1FG4 A;  1G7O A;  1TXX A;  4JE1 A;  1YEP A;  5DAL B;  1XOB A;  4ZL9 A;  4ZIL A;  3LW9 A;  1GTU A;  2RUF A;  1AIU A;  3RAZ A;  5HQP A;  4K2D A;  1E6B A;  3RHC A;  1N2A A;  1X5E A;  3HVN A;  3FR6 A;  3M0F A;  2PN8 A;  5G1L A;  4D73 B;  4BL7 A;  6GSX A;  1USB A;  4K9Z A;  5J41 A;  4OO4 A;  1XW9 A;  4CY6 A;  1HNB A;  5JWQ B;  2REM A;  1R5P A;  3I9V 2;  1U88 A;  3QD9 A;  4I2T A;  2MBT A;  2RLI A;  3ZIV A;  3LQ7 A;  3IHQ A;  3NZN A;  4WET A;  1EP7 A;  2D2Z A;  3IXR A;  4ACS A;  4ZBD A;  3IBH A;  1B9X C;  1U3I A;  3H1N A;  4MDC A;  1R4W A;  2I1U A;  2GTU A;  1QMV A;  1ABA A;  3P8W A;  2N5F A;  4YQV A;  2B7K A;  3RDW A;  4ECC A;  1YZX A;  4IEL A;  1AUC A;  2CT6 A;  2JU5 A;  2BMX A;  4O5R A;  1MDJ A;  7GSS A;  1GTB A;  1JZR A;  3UAR A;  1QK8 A;  2LQO A;  4IKH A;  2JAD A;  2CVD A;  3PIN A;  1FOH A;  4G19 A;  19GS A;  2C8U A;  2V6O A;  4ZBB A;  4EXJ A;  3ZRD A;  4F82 A;  4XS1 A;  4MK3 A;  5J3R A;  2FUG 2;  3ISO A;  4XTS A;  4BWS A;  3GA4 A;  1YKA A;  4KA0 A;  1SKS B;  4K2X A;  4X43 A;  5AIV A;  4EIP A;  3IOS A;  4KSO A;  1JZD A;  1SD8 A;  2KLX A;  2LQQ A;  1T8E B;  4KF9 A;  5G5F A;  3I43 A;  5ECN B;  16GS A;  3EWL A;  5CRG A;  5J9B A;  1EEM A;  1XWK A;  4WR5 A;  2LNT A;  2NPB A;  4YKG A;  2YZH A;  4WKW A;  1YKC A;  3C8E A;  3AY8 A;  3TKP A;  4OCE A;  2X49 A;  1TJD A;  4TOP A;  2MMO A;  2IME A;  3IK7 A;  11GS A;  5DDL A;  5AIS A;  2JL4 A;  1ERU A;  2F9S A;  1JLV A;  4GSS A;  1OC9 A;  2GSQ A;  2I9H A;  1J9B A;  4NV2 A;  3HZ8 A;  1J08 A;  2H66 A;  2MYG A;  3I69 A;  3FR3 A;  4PXO A;  1FAA A;  3ZIJ A;  4KUN A;  5ECS A;  4GWR A;  2MBS A;  3BJ5 A;  1ZOF A;  2HRF A;  3O6T A;  5HFK A;  4PUR A;  3VWW A;  4KDU A;  5ECO B;  2VD1 A;  2HSM A;  3ME7 A;  1X0R A;  3GFK A;  2LKU A;  3U6V A;  4JRR A;  3K8N A;  3IAM 2;  3PGT A;  1HQO A;  2HXK A;  6GSY A;  3FZ5 A;  3EU4 A;  1X9W B;  1GUK A;  2IWT A;  3VUR A;  1J0F A;  4EO3 A;  5IPG A;  3N5O A;  3DWV A;  2VLT A;  4GTU A;  3N9J A;  4BVX B;  4LL1 B;  4L5L A;  3GHA A;  3KTB A;  1KBN A;  1HD2 A;  3CSH A;  4KGI A;  1DUG A;  5HFG A;  2G2Q A;  3CRU A;  1OKT A;  3ERG A;  2C3T A;  3Q74 A;  3C1R A;  4MP4 A;  2A4V A;  2YAN A;  2OE0 A;  3UVH A;  3GMF A;  3EVI A;  1X9S B;  2CAI A;  2GQM A;  5H5Q A;  1ZL9 A;  1PGT A;  2I4A A;  4ZBA A;  4BVY A;  3CSI A;  5GAN D;  4MMM A;  1FB6 A;  3FMW A;  2VIM A;  1GSE A;  1OE8 A;  3DXB A;  3APO A;  1O6J A;  3UIW A;  3EPT A;  2H6X A;  2KP1 A;  3F63 A;  4F0B A;  2KUC A;  3M9J A;  4N0V A;  2TRC P;  4TXO A;  1Z3E A;  5B7C A;  1S3R A;  2GQK A;  5IIZ A;  2HZE B;  5FWG A;  2DJ1 A;  3H4K A;  5G5E A;  1B48 A;  3Q18 A;  3GTU A;  4PTS A;  4ID0 A;  3A2W A;  2GGT A;  4Q5Q A;  2A2S A;  4MH3 A;  3DYR A;  2H74 A;  1O8W A;  2MMZ A;  1SYR A;  1F37 A;  4IP1 A;  3ZZX A;  4Q5N A;  1V98 A;  4KND A;  3US3 A;  4F9Z A;  2VCQ A;  3FK8 A;  3ZML A;  2QA2 A;  2ALB A;  4QL7 A;  1GUH A;  4IJ3 A;  2XBI A;  2LUS A;  4XS4 B;  1OKD A;  2GLR A;  3FKF A;  3APQ A;  2VM1 A;  3GSS A;  2YJH A;  2XC2 A;  1A2L A;  3RPP A;  3V1W A;  2FA4 A;  1EP8 A;  1VF2 A;  2YJ7 A;  4IW9 A;  1UN2 A;  1CQG A;  3LYP A;  3EE2 A;  1K0A A;  1VF1 A;  2A2P A;  5H5R A;  5BRT A;  1O8X A;  2HE3 A;  3GKK A;  1T4Z A;  1BED A;  3A5W A;  2NBS A;  3HZ4 A;  4WR4 A;  1MTC A;  3GX0 A;  3D21 A;  1SJZ A;  2PER A;  1ERT A;  2GS3 A;  1QXH A;  4K0N A;  4PUF C;  2B6M A;  2VCX A;  1FB0 A;  4OFM A;  4NHW A;  4IGJ A;  2WDU A;  1TDI A;  2K8V A;  5LD0 A;  4LLR A;  2LJA A;  1AAZ A;  1RQM A;  3TJF A;  4MZC A;  4TW5 A;  3CTF A;  4XIH A;  4CY8 A;  1IYI A;  2KP2 A;  4GQC A;  2VCZ A;  2CVB A;  4V1A g;  1WE0 A;  2OJL A;  2P5R A;  1DE2 A;  3VWU A;  3F0I A;  3MNG A;  2FD3 A;  1PX6 A;  2TRX A;  3CYN A;  3IC8 A;  2QA1 A;  2CA8 A;  2MZC A;  4KB3 A;  1R7H A;  2HSH A;  2F51 A;  4J2F A;  4N11 A;  2RII A;  2FCH A;  2IL3 A;  3G7J A;  1G0T A;  4G0K A;  1O73 A;  5AIX A;  1TU7 A;  3KD0 A;  5KN0 A;  4JBB A;  2DJ0 A;  5F06 A;  2B3S A;  3J7Y k;  2CZ2 A;  1LBK A;  2GZZ A;  3IA1 A;  5F07 A;  2H75 A;  4EDY A;  2VD0 A;  5ECM B;  5AGY A;  2EIO A;  3LWA A;  4POK A;  2HT9 A;  2LNS A;  3ZIT A;  5E59 A;  1B4Q A;  4FO5 A;  5CNW A;  2L4Q A;  1AXD A;  2H6Y A;  1EWX A;  4TKY A;  2ES7 A;  4TVE A;  3GKN A;  5D9X A;  1XWB A;  1ZZY A;  1M9B A;  2HSY A;  2X4A A;  3HVV A;  6GSU A;  4HI7 A;  4RQX A;  4HSC X;  1A0R P;  3OR5 A;  5G2Z A;  2H1B A;  1ST9 A;  4FYB A;  4MAB A;  2E7P A;  3VPT A;  4AJ8 A;  4OFT A;  6GSV A;  4L5O A;  4IQA A;  2WFC A;  1X5D A;  4DEJ A;  1T3B A;  4AJ6 A;  3KTL A;  1HYU A;  1SK2 A;  1UC7 A;  4G9H A;  2XBQ A;  4O5Q A;  3HDC A;  17GS A;  1ZYQ B;  2AUV A;  1XZO A;  2NVL A;  5A4U A;  2QKE A;  3J7Y b;  3DVW A;  3RPN A;  2LEG A;  1JLW A;  1WMJ A;  4D73 A;  3W8S A;  2DKH A;  2YOI A;  2K8S A;  3HYP A;  1MDI A;  5F05 A;  4XRD A;  3VK9 A;  2IMD A;  4G0I A;  2H70 A;  2DMM A;  3QR6 A;  3IR4 A;  4BPY A;  3QMX A;  1ZYE A;  3F3R A;  3LSZ A;  3RHB A;  4KH7 A;  4MJA A;  3QOU A;  5IPH A;  2CZ3 A;  2VUP A;  2IPA A;  5ECH B;  1NHY A;  2NTO A;  1MEK A;  2GZP A;  1MDK A;  1TRS A;  3ERF A;  1PD2 1;  3LEF A;  3GYK A;  4V2L A;  4IBP A;  4Z2U A;  5GAP D;  3ZYW A;  2GT6 A;  1A24 A;  1M9A A;  1XVQ A;  2PBJ A;  1V9W A;  3KMO A;  1PSQ A;  4HZ2 A;  1Y6E A;  3ED3 A;  3LFL A;  2PPT A;  1RW1 A;  5ID2 B;  5DQY A;  2IFQ B;  3A2X A;  4ZL8 A;  1PMT A;  4MCU A;  4I6X A;  3TKS A;  5CYY A;  1V2A A;  1PRX A;  2F3M A;  4TN8 A;  5ECQ B;  2H72 A;  1BYE A;  1TRV A;  2OBK A;  3DVX A;  1XWA A;  5IM9 A;  4YAV A;  3R2Q A;  1V58 A;  5B6M A;  4WEY A;  5HR3 A;  1K3Y A;  3A2V A;  3EMX A;  3HY2 A;  4OMV A;  1KEB A;  4XHM A;  1S3D A;  4K8M A;  4JR6 A;  6GST A;  1GH2 A;  3ME8 A;  2ON7 A;  2K6V A;  4K0G A;  4F0C A;  5A4V A;  2P0G A;  4DVC A;  4G0L A;  3L4N A;  1H4O A;  1OC8 A;  1PN9 A;  3D5J A;  1SEN A;  3KP8 A;  2CAQ A;  4FIW A;  4HU9 A;  5HR2 A;  3TRQ A;  4O5U A;  3HCZ A;  1AQW A;  3EUR A;  5C04 A;  2R5G A;  1XVW A;  1K3L A;  4KCE A;  5CRD A;  2V41 A;  4ULX A;  4NV5 A;  4PQH A;  2OA7 A;  1XXU A;  2H1A A;  3GIX A;  2L5O A;  2H76 A;  4GCI A;  1F9M A;  5DVB A;  4E8E A;  4MJB A;  2DIZ A;  2HFD A;  4IS0 A;  5CRW A;  2VAF A;  3CBU A;  5AN1 A;  5EY6 A;  2GZY A;  3FZ9 A;  4DSR A;  3A3T A;  3QAW A;  4ECJ A;  5ECK B;  2VL9 A;  2N5B A;  3L9S A;  2NDO A;  2EIQ A;  4PNG A;  3O3T A;  1SYX A;  1Z6M A;  4ZB6 A;  4LA1 A;  2HZF A;  2DKI A;  2H0I A;  3TRX A;  1K0B A; 
#chains in the Genus database with same CATH homology
 4HZ4 A;  3EMP A;  1A8Y A;  2PVO C;  2VLV A;  1A23 A;  5J4U A;  1NW2 A;  2IMK A;  1GUL A;  1GUM A;  1GSD A;  3KMN A;  3G9B A;  2V2G A;  1GWC A;  2RM5 A;  1M99 A;  4BVX A;  4USS A;  4J56 E;  3KGK A;  4POL A;  3TJK A;  1JFU A;  2VLU A;  1HNA A;  3VI7 A;  1ERW A;  3L9V A;  3L78 A;  1I9D A;  1HNC A;  1PL1 A;  4CHS A;  2L5L A;  5KN2 A;  3HVX A;  2JSY A;  2L57 A;  1B8X A;  4MF7 A;  4DSS B;  2P5Q A;  1LU4 A;  5EVO A;  3ERW A;  4NXI A;  4NWY A;  2FWG A;  1O7U A;  22GS A;  5CP1 A;  2ZCT A;  1EGR A;  1OC9 B;  2O89 A;  3TKS C;  3MYD A;  2X8C A;  4V2M A;  2OE3 A;  14GS A;  4EIQ A;  3KEB A;  2JZS A;  4NMU A;  3W6G A;  2F8F A;  1A2M A;  1TTZ A;  2H6Z A;  5KEJ A;  4HOJ A;  4ECB A;  1SJI A;  2AYT A;  3UMA A;  2HZE A;  1PKW A;  1QFN A;  1XFL A;  3GL3 A;  1YJ6 A;  3HA9 A;  2VL3 A;  3KCM A;  2PGT A;  1Z5Y E;  2FWE A;  1B4P A;  1GSU A;  3EYT A;  5FHI A;  3APS A;  1G6Y A;  1M2A A;  4EE0 A;  5ECL B;  1XWG A;  3F3Q A;  4GXZ A;  5KOX A;  4KE3 A;  1MD3 A;  4MJE A;  2J9H A;  4OFN A;  2KHP A;  3QAG A;  4AGS A;  4XS4 A;  1X9M B;  3LXZ A;  3GL5 A;  5D9V A;  2YWI A;  1UVZ A;  2R37 A;  2R4V A;  10GS A;  1U87 A;  2WJU A;  3KXO A;  4KDY A;  2WS2 A;  3BCI A;  2A4H A;  2HLS A;  4TR4 A;  2VCT A;  3HXS A;  3GH9 A;  4Z7X A;  2PUK C;  2VOC A;  2EIR A;  3GUR A;  2RM6 A;  4PQ1 A;  1BJX A;  1PKZ A;  1I5G A;  4ZB8 A;  3GX8 A;  2FA8 A;  4RQR A;  3WGX A;  3E3E A;  3A5I A;  2HRA A;  5B6N A;  3CMI A;  2DJ2 A;  3KP9 A;  5D9W A;  2PU9 C;  2YWM A;  1T7P B;  4GF0 A;  4KDX A;  3TJJ A;  2X99 A;  3ZMK A;  3VPQ A;  1TU8 A;  1WIK A;  4FYC A;  3TKR A;  5CO3 A;  3D4T A;  2C0F A;  2HRN A;  1Z9H A;  2XPD A;  2GQL A;  3UEM A;  1W4V A;  1ML6 A;  3QDN A;  3GTU B;  5B8B A;  4MNN A;  4XRA A;  4CDO A;  4WF4 A;  1GSF A;  2L59 A;  1GNW A;  1XW6 A;  2XHF A;  4TXV A;  1SL1 B;  1N8J A;  2C0G A;  2B1L A;  4YQM A;  4ZIJ A;  3MWH A;  2MMN A;  3GKM A;  1GSY A;  5IMA A;  1IYH A;  4IN0 A;  3F4S A;  1EV4 A;  3GN3 A;  1GSQ A;  4O32 A;  3M3M A;  4GST A;  2IIY A;  4L8E A;  4G10 A;  1XW5 A;  3TB2 A;  2LRC A;  4GRF A;  1O85 A;  3NIV A;  5DQS A;  1EV9 A;  5IMF A;  3UVT A;  1TRU A;  3F6D A;  1GNE A;  4L0U A;  1FO5 A;  4TR3 A;  1WOU A;  3DKS A;  1VRS D;  2X8G A;  3LGC A;  6GSW A;  4PUA A;  3EU3 A;  5D93 A;  2R6K A;  4O7H A;  5DAK B;  3IDV A;  4IVF A;  3KIJ A;  1YF1 A;  2OKA A;  3KM6 A;  2WCI A;  2DJJ A;  1LJR A;  5ECR B;  4WBJ A;  5HR1 A;  1PQN A;  4PGT A;  3FZA A;  1AQV A;  2LJK A;  6GSS A;  1BX9 A;  2VCV A;  3Q19 A;  3IHG A;  4EKZ A;  4ZB9 A;  2CVK A;  4JU5 A;  1YEX A;  4EL1 A;  3ZRE A;  1OE7 A;  5CAX A;  1TI1 A;  1B9Y C;  2L6C A;  4K7I A;  5D73 A;  2JSZ A;  3WT2 A;  4YAP A;  1WPI A;  5JCU A;  3CTG A;  1QUW A;  3C73 A;  1V57 A;  1ILO A;  5D96 A;  2HYX A;  3KZQ A;  3HJO A;  2OBI A;  3RBT A;  5IOW A;  3D0Z A;  3TOT A;  3TKQ A;  2ON5 A;  3F6F A;  4JZQ A;  2WZ9 A;  3HKR A;  5HFI A;  5IMV A;  3ZLP A;  2H0H A;  1JHB A;  2JZR A;  3VFI A;  1XBS A;  3M8N A;  4LL4 B;  1U6T A;  5ELA A;  4HJM A;  2AAW A;  2DLX A;  3G7I A;  5G30 A;  3E0U A;  3KH9 A;  3TOU A;  1OYJ A;  3EC3 A;  3C71 A;  3D6I A;  1SL0 B;  5JWR B;  2DC5 A;  2FY6 A;  3MIX A;  5INY A;  3CSJ A;  2B7J A;  4K5R A;  5F0G A;  4H86 A;  4YKF A;  4WF5 A;  1EZK A;  2R0P A;  1NM3 A;  3DML A;  4EC0 A;  1F2E A;  2G0F A;  5DAL A;  4ILF A;  4KW6 A;  1JZO A;  5D9T A;  4K5S A;  2VO4 A;  3GUS A;  4WBR D;  1A8L A;  1TRW A;  4FQU A;  2YNX A;  2O7K A;  2KOK A;  1ZYN A;  4E8H A;  5KN1 A;  2C80 A;  1EOG A;  3U5R E;  2DJK A;  3PR8 A;  2M46 A;  3VWV A;  2GSR A;  3GST A;  8GSS A;  3UAP A;  1O81 A;  1X5C A;  3FEU A;  3IE3 A;  1F3A A;  1ACV A;  1CQH A;  5ID2 A;  2IFQ A;  4HJ2 A;  3TGZ A;  2CX4 A;  4I5Q A;  3TRP A;  4I8B A;  1TKD B;  4G2E A;  2E2M A;  1ERV A;  4K7O A;  3TCO A;  2DIY A;  2GDR A;  1GTA A;  4V1A p;  1Z7R A;  4AJ7 A;  2R0G A;  1XWC A;  3F4T A;  4MH2 A;  5H5S A;  1EOH A;  3M1G A;  2JAC A;  4TR1 B;  3IK9 A;  1T1V A;  4FH8 A;  1PL2 A;  1GL8 A;  1A0F A;  5EPF A;  3UOM A;  2VM2 A;  1VGL A;  4TRX A;  3FW2 A;  2DSA A;  5BMU A;  5JWO B;  1KNG A;  1AC1 A;  5IO2 A;  1C72 A;  3C1S A;  2B5E A;  5HR0 A;  12GS A;  4ML1 A;  2IMI A;  2FNO A;  3G7Y A;  1PX7 A;  1PN0 A;  2BJX A;  1XOA A;  3MDK A;  1TK0 B;  3TKS E;  4DSQ A;  2OE1 A;  2E0Q A;  3PH9 A;  2YPM A;  3UBK A;  5L71 A;  1TK5 B;  4JR4 A;  3NOF A;  4BL7 B;  3UBL A;  5IO0 A;  4MF6 A;  4QL9 A;  2LST A;  5KN3 A;  1A2J A;  1FHE A;  3DEX A;  4Q5F A;  2CQ9 A;  2R0C A;  2IMF A;  3KH7 A;  4HEA 2;  1GSS A;  5EL8 A;  3WYW A;  4RUV A;  2C3Q A;  1TW9 A;  2EC4 A;  3FYG A;  1URM A;  4HS1 A;  1K0D A;  1AW9 A;  1WWJ A;  18GS A;  2FWH A;  2GST A;  3QAV A;  3M9K A;  3GRX A;  5ABR A;  1K0O A;  4YQU A;  3PPU A;  5JCG A;  3BD2 A;  3ZVJ D;  4YH2 A;  4Z2T A;  4IQ1 A;  4KX4 A;  4AF2 A;  3H79 A;  2H19 A;  1SK0 A;  4ZL7 A;  4NHZ A;  1UA5 A;  3WD6 A;  4Q5R A;  3FZ4 A;  4Z2R A;  3HJM A;  1Y25 A;  3F9U A;  2V1M A;  3E9J B;  1K3O A;  5GSS A;  2YWO A;  3LXT A;  4MPF A;  1XCC A;  4FYU A;  1M2D A;  1SK1 A;  2WGR A;  4LMW A;  2O85 A;  3ZVJ A;  2UZ8 A;  1QGV A;  3HHV A;  4POB A;  2DJ3 A;  1VF4 A;  4NPB A;  3WGE A;  1BAY A;  1GLQ A;  2AJQ B;  3LG6 A;  4DSS A;  2C4J A;  2B1K A;  4K6X A;  2K9F A;  3IRA A;  4NAX A;  3DGQ A;  1K0C A;  4ZXG A;  4POM A;  1YY7 A;  1FOV A;  5DCG A;  1M0U A;  2H73 A;  1E2Y A;  4N30 A;  3LYK A;  1FVJ A;  4O92 A;  2GT5 A;  4IJI A;  2AHE A;  3F8U A;  4OWY A;  3ZFL A;  3ZL5 A;  2PMT A;  5ENU A;  4BA7 A;  3JCM L;  4IP6 A;  4GSN A;  2B5X A;  4MLY A;  4PNF A;  1OVN A;  1WJK A;  3ZFB A;  5LCZ A;  1PA3 A;  1Z7P A;  1SKW B;  3FR9 A;  2X8H A;  5B8A A;  5C00 A;  2GSS A;  4X1U A;  3QFA C;  4KAE A;  4EVM A;  3UL3 A;  1XIY A;  3L0H A;  2FLS A;  1FVK A;  4TR0 A;  1DE1 A;  2LJR A;  2YWN A;  1SL2 B;  3MSZ A;  1YDK A;  3EIN A;  1H75 A;  4ISD A;  4GQF A;  1W89 A;  4LMV A;  3Q6O A;  3ZTL A;  1M7T A;  2OAC A;  2I3Y A;  2PVQ A;  2ZUP A;  3I6A A;  1SD9 A;  5DJM A;  1THO A;  4HUA A;  3D22 A;  3C7M A;  1S3C A;  3F4R A;  1G7E A;  2WRT A;  2FHE A;  3P2A A;  4RI7 A;  2R3X A;  2X64 A;  1Z6N A;  2L4C A;  3FRC A;  1EGO A;  3L9U A;  4XCS A;  4EF0 A;  1DBY A;  2K18 A;  1V40 A;  3GV1 A;  13GS A;  2H0G A;  1JZW A;  4QQ7 A;  2IJY A;  2LRN A;  1TI3 A;  2LRT A;  4PQI A;  4MPG A;  2HNL A;  1SU9 A;  2L6D A;  5KOW A;  2H30 A;  5J9C A;  2JZT A;  2YV7 A;  5DJL A;  3FHK A;  2XPE A;  4X4J A;  1BG5 A;  1TK8 B;  1GLP A;  2LS5 A;  3WT1 A;  9GSS A;  2DML A;  20GS A;  3H8Q A;  1F3B A;  4BVY B;  1DSB A;  5IQY A;  1K0N A;  1F6M C;  5DBQ A;  1YF0 A;  5A4W A;  2H71 A;  5ECP B;  3TJB A;  2N5A A;  4K1F A;  4MZW A;  3GNJ A;  2AB6 A;  1T4Y A;  2I81 A;  1OC3 A;  3BBY A;  3SWL A;  3TJG A;  2HI7 A;  3BOA A;  3QPM A;  2O8V B;  4TXO B;  5GST A;  3TDG A;  4P3Y B;  1EEJ A;  2P31 A;  1ZGN A;  1T00 A;  5IMC A;  2CX3 A;  4I2U A;  1R26 A;  2GVP A;  2R2J A;  4HQZ A;  3HD5 A;  5A5K A;  4MJC A;  1NSW A;  1QQ2 A;  5J5N A;  4KSM A;  2ZNM A;  3VLN A;  3LJR A;  2MMA A;  3LOR A;  1ZYP A;  3W8J A;  1GP1 A;  2YP6 A;  5DAK A;  3CXG A;  5FT3 A;  3O76 A;  2B5Y A;  2PWJ A;  2VL2 A;  1GRX A;  1KTE A;  5JCW A;  2H8L A;  1Q4J A;  4HU7 A;  1TP9 A;  1WRY A;  2F8A A;  4J57 E;  4WXT A;  4OCF A;  2WB9 A;  1ON4 A;  2TIR A;  2YV9 A;  5DCH A;  1K0M A;  4L0W A;  1R5A A;  5G31 A;  4ECI A;  1GTI A;  1ZMA A;  3DD3 A;  3HVS A;  3MAK A;  2H1G A;  3IC4 A;  4CW9 A;  4KCA A;  1SJ6 A;  2CV4 A;  2QGV A;  2FGX A;  5ELG A;  4RI6 A;  2WUL A;  5F8B A;  5LNK e;  3S9F A;  2OAD A;  3QCP A;  2HRK A;  1THX A;  1S3A A;  3WGD A;  4V2N A;  2QC7 A;  5D8I A;  3VWX A;  2BTO T;  5IMD A;  3BCK A;  4N10 A;  1TOF A;  2LV3 A;  4MA9 A;  5E4W A;  2V6K A;  4MF5 A;  5IMZ A;  1ZCP A;  2DBC A;  1NHO A;  4BWQ A;  1WP0 A;  3R3E A;  3IAS 2;  4A5P A;  3HJP A;  4IHU A;  2YCD A;  3IPZ A;  5G1K A;  2LTK A;  2QSI A;  3TUE A;  3P7X A;  2M80 A;  3VI5 A;  3IV4 A;  2YZU A;  1YQ1 A;  2A2R A;  3D4M A;  4XS6 A;  1VF3 A;  3QFB C;  4F2I A;  4K7N A;  4MZB A;  2V32 A;  4F03 A;  2H01 A;  1U3A A;  3UJ1 A;  5CRH A;  4PX1 A;  4EUY A;  4ICY A;  3DRN A;  3P90 A;  2YN1 A;  3H93 A;  4GLT A;  4N0Z A;  3GKX A;  4HDE A;  1G6W A;  4JED A;  2C1Y A;  2C0D A;  3DIE A;  5COH A;  2RUE A;  2E2G A;  3GH6 A;  1FW1 A;  2Z9S A;  5GZZ B;  1Q98 A;  4I97 A;  2O87 A;  4ML6 A;  3KJY A;  2IN3 A;  1M2B A;  1XPV A;  2C0E A;  5CRE A;  4OD7 A;  5IOX A;  1MD4 A;  1OAZ A;  3FY7 A;  1AQX A;  2J23 A;  3CRT A;  5ECI B;  2VCW A;  4EDZ A;  4TR1 A;  2AV4 A;  4X0X A;  3SBC A;  2H1D A;  4OO5 A;  2FWF A;  4HQS A;  2C3N A;  1BQ7 A;  2M72 A;  2VL2 C;  1SKR B;  1RK4 A;  1FG4 A;  1G7O A;  1TXX A;  4JE1 A;  1YEP A;  5DAL B;  1XOB A;  4ZL9 A;  4ZIL A;  3LW9 A;  1GTU A;  2RUF A;  1AIU A;  3RAZ A;  5HQP A;  4K2D A;  1E6B A;  3RHC A;  1N2A A;  1X5E A;  3FR6 A;  3M0F A;  2PN8 A;  5G1L A;  4D73 B;  4BL7 A;  6GSX A;  1USB A;  4K9Z A;  5J41 A;  4OO4 A;  1XW9 A;  4CY6 A;  1HNB A;  5JWQ B;  2REM A;  1R5P A;  3I9V 2;  1U88 A;  3QD9 A;  4I2T A;  2MBT A;  2RLI A;  3ZIV A;  3LQ7 A;  3IHQ A;  3NZN A;  4WET A;  1EP7 A;  2D2Z A;  3IXR A;  4ACS A;  4ZBD A;  3IBH A;  1B9X C;  1U3I A;  3H1N A;  4MDC A;  1R4W A;  2I1U A;  2GTU A;  1QMV A;  1ABA A;  3P8W A;  2N5F A;  4YQV A;  2B7K A;  3RDW A;  4ECC A;  1YZX A;  4IEL A;  1AUC A;  2CT6 A;  2JU5 A;  2BMX A;  4O5R A;  1MDJ A;  7GSS A;  1GTB A;  1JZR A;  3UAR A;  1QK8 A;  2LQO A;  4IKH A;  2JAD A;  2CVD A;  3PIN A;  1FOH A;  4G19 A;  19GS A;  2C8U A;  2V6O A;  4ZBB A;  4EXJ A;  3ZRD A;  4F82 A;  4XS1 A;  4MK3 A;  5J3R A;  2FUG 2;  3ISO A;  4XTS A;  4BWS A;  3GA4 A;  1YKA A;  4KA0 A;  1SKS B;  4K2X A;  4X43 A;  5AIV A;  4EIP A;  3IOS A;  4KSO A;  1JZD A;  1SD8 A;  2KLX A;  2LQQ A;  1T8E B;  4KF9 A;  5G5F A;  3I43 A;  5ECN B;  16GS A;  3EWL A;  5CRG A;  5J9B A;  1EEM A;  1XWK A;  4WR5 A;  2LNT A;  2NPB A;  4YKG A;  2YZH A;  4WKW A;  1YKC A;  3C8E A;  3AY8 A;  3TKP A;  4OCE A;  2X49 A;  1TJD A;  4TOP A;  2MMO A;  2IME A;  3IK7 A;  11GS A;  5DDL A;  5AIS A;  2JL4 A;  1ERU A;  2F9S A;  1JLV A;  4GSS A;  1OC9 A;  2GSQ A;  2I9H A;  1J9B A;  4NV2 A;  3HZ8 A;  1J08 A;  2H66 A;  2MYG A;  3I69 A;  3FR3 A;  4PXO A;  1FAA A;  3ZIJ A;  4KUN A;  5ECS A;  4GWR A;  2MBS A;  3BJ5 A;  1ZOF A;  2HRF A;  3O6T A;  5HFK A;  4PUR A;  3VWW A;  4KDU A;  5ECO B;  2VD1 A;  2HSM A;  3ME7 A;  1X0R A;  3GFK A;  2LKU A;  3U6V A;  4JRR A;  3K8N A;  3IAM 2;  3PGT A;  1HQO A;  2HXK A;  6GSY A;  3FZ5 A;  3EU4 A;  1X9W B;  1GUK A;  2IWT A;  3VUR A;  1J0F A;  4EO3 A;  5IPG A;  3N5O A;  3DWV A;  2VLT A;  4GTU A;  3N9J A;  4BVX B;  4LL1 B;  4L5L A;  3GHA A;  3KTB A;  1KBN A;  1HD2 A;  3CSH A;  4KGI A;  1DUG A;  5HFG A;  2G2Q A;  3CRU A;  1OKT A;  3ERG A;  2C3T A;  3Q74 A;  3C1R A;  4MP4 A;  2A4V A;  2YAN A;  2OE0 A;  3UVH A;  3GMF A;  3EVI A;  1X9S B;  2CAI A;  2GQM A;  5H5Q A;  1ZL9 A;  1PGT A;  2I4A A;  4ZBA A;  4BVY A;  3CSI A;  5GAN D;  4MMM A;  1FB6 A;  3FMW A;  2VIM A;  1GSE A;  1OE8 A;  3DXB A;  3APO A;  1O6J A;  3UIW A;  3EPT A;  2H6X A;  2KP1 A;  3F63 A;  4F0B A;  2KUC A;  3M9J A;  4N0V A;  2TRC P;  4TXO A;  1Z3E A;  5B7C A;  2GQK A;  5IIZ A;  2HZE B;  5FWG A;  2DJ1 A;  3H4K A;  5G5E A;  1B48 A;  3Q18 A;  3GTU A;  4PTS A;  4ID0 A;  3A2W A;  2GGT A;  4Q5Q A;  2A2S A;  4MH3 A;  3DYR A;  2H74 A;  1O8W A;  2MMZ A;  1SYR A;  1F37 A;  4IP1 A;  3ZZX A;  4Q5N A;  1V98 A;  4KND A;  3US3 A;  4F9Z A;  2VCQ A;  3FK8 A;  3ZML A;  2QA2 A;  2ALB A;  4QL7 A;  1GUH A;  4IJ3 A;  2XBI A;  2LUS A;  4XS4 B;  1OKD A;  2GLR A;  3FKF A;  3APQ A;  2VM1 A;  3GSS A;  2YJH A;  2XC2 A;  1A2L A;  3RPP A;  3V1W A;  2FA4 A;  1EP8 A;  1VF2 A;  2YJ7 A;  4IW9 A;  1UN2 A;  1CQG A;  3LYP A;  3EE2 A;  1K0A A;  1VF1 A;  2A2P A;  5H5R A;  5BRT A;  1O8X A;  2HE3 A;  3GKK A;  1T4Z A;  1BED A;  3A5W A;  2NBS A;  3HZ4 A;  4WR4 A;  1MTC A;  3GX0 A;  3D21 A;  1SJZ A;  2PER A;  1ERT A;  2GS3 A;  1QXH A;  4K0N A;  4PUF C;  2B6M A;  2VCX A;  1FB0 A;  4OFM A;  4NHW A;  4IGJ A;  2WDU A;  1TDI A;  2K8V A;  5LD0 A;  4LLR A;  2LJA A;  1AAZ A;  1RQM A;  3TJF A;  4MZC A;  4TW5 A;  3CTF A;  4XIH A;  4CY8 A;  1IYI A;  2KP2 A;  4GQC A;  2VCZ A;  2CVB A;  4V1A g;  1WE0 A;  2OJL A;  2P5R A;  1DE2 A;  3VWU A;  3F0I A;  3MNG A;  2FD3 A;  1PX6 A;  2TRX A;  3CYN A;  3IC8 A;  2QA1 A;  2CA8 A;  2MZC A;  4KB3 A;  1R7H A;  2HSH A;  2F51 A;  4J2F A;  4N11 A;  2RII A;  2FCH A;  2IL3 A;  3G7J A;  1G0T A;  4G0K A;  1O73 A;  5AIX A;  1TU7 A;  3KD0 A;  5KN0 A;  4JBB A;  2DJ0 A;  5F06 A;  2B3S A;  3J7Y k;  2CZ2 A;  1LBK A;  2GZZ A;  3IA1 A;  5F07 A;  2H75 A;  4EDY A;  2VD0 A;  5ECM B;  5AGY A;  2EIO A;  3LWA A;  4POK A;  2HT9 A;  2LNS A;  3ZIT A;  5E59 A;  1B4Q A;  4FO5 A;  5CNW A;  2L4Q A;  1AXD A;  2H6Y A;  1EWX A;  4TKY A;  2ES7 A;  4TVE A;  3GKN A;  5D9X A;  1XWB A;  1ZZY A;  1M9B A;  2HSY A;  2X4A A;  3HVV A;  6GSU A;  4HI7 A;  4RQX A;  1A0R P;  3OR5 A;  5G2Z A;  2H1B A;  1ST9 A;  4FYB A;  4MAB A;  2E7P A;  3VPT A;  4AJ8 A;  4OFT A;  6GSV A;  4L5O A;  4IQA A;  2WFC A;  1X5D A;  4DEJ A;  1T3B A;  4AJ6 A;  3KTL A;  1HYU A;  1SK2 A;  1UC7 A;  4G9H A;  2XBQ A;  4O5Q A;  3HDC A;  17GS A;  1ZYQ B;  2AUV A;  1XZO A;  2NVL A;  5A4U A;  2QKE A;  3J7Y b;  3DVW A;  3RPN A;  2LEG A;  1JLW A;  1WMJ A;  4D73 A;  3W8S A;  2DKH A;  2YOI A;  2K8S A;  3HYP A;  1MDI A;  5F05 A;  4XRD A;  3VK9 A;  2IMD A;  4G0I A;  2H70 A;  2DMM A;  3QR6 A;  3IR4 A;  4BPY A;  3QMX A;  1ZYE A;  3F3R A;  3LSZ A;  3RHB A;  4KH7 A;  4MJA A;  3QOU A;  5IPH A;  2CZ3 A;  2VUP A;  2IPA A;  5ECH B;  1NHY A;  2NTO A;  1MEK A;  2GZP A;  1MDK A;  1TRS A;  3ERF A;  1PD2 1;  3LEF A;  3GYK A;  4V2L A;  4IBP A;  4Z2U A;  5GAP D;  3ZYW A;  2GT6 A;  1A24 A;  1M9A A;  1XVQ A;  2PBJ A;  1V9W A;  3KMO A;  1PSQ A;  4HZ2 A;  1Y6E A;  3ED3 A;  3LFL A;  2PPT A;  1RW1 A;  5ID2 B;  5DQY A;  2IFQ B;  3A2X A;  4ZL8 A;  1PMT A;  4MCU A;  4I6X A;  3TKS A;  5CYY A;  1V2A A;  1PRX A;  2F3M A;  4TN8 A;  5ECQ B;  2H72 A;  1BYE A;  1TRV A;  2OBK A;  3DVX A;  1XWA A;  5IM9 A;  4YAV A;  3R2Q A;  1V58 A;  5B6M A;  4WEY A;  5HR3 A;  1K3Y A;  3A2V A;  3EMX A;  3HY2 A;  4OMV A;  1KEB A;  4XHM A;  1S3D A;  4K8M A;  4JR6 A;  6GST A;  1GH2 A;  3ME8 A;  2ON7 A;  2K6V A;  4K0G A;  4F0C A;  5A4V A;  2P0G A;  4DVC A;  4G0L A;  3L4N A;  1H4O A;  1OC8 A;  1PN9 A;  3D5J A;  1SEN A;  3KP8 A;  2CAQ A;  4FIW A;  4HU9 A;  5HR2 A;  3TRQ A;  4O5U A;  3HCZ A;  1AQW A;  3EUR A;  5C04 A;  2R5G A;  1XVW A;  1K3L A;  4KCE A;  5CRD A;  2V41 A;  4ULX A;  4NV5 A;  4PQH A;  2OA7 A;  1XXU A;  2H1A A;  3GIX A;  2L5O A;  2H76 A;  4GCI A;  1F9M A;  5DVB A;  4E8E A;  4MJB A;  2DIZ A;  2HFD A;  4IS0 A;  5CRW A;  2VAF A;  3CBU A;  5AN1 A;  5EY6 A;  2GZY A;  3FZ9 A;  4DSR A;  3A3T A;  3QAW A;  4ECJ A;  5ECK B;  2VL9 A;  2N5B A;  3L9S A;  2NDO A;  2EIQ A;  4PNG A;  3O3T A;  1SYX A;  1Z6M A;  4ZB6 A;  4LA1 A;  2HZF A;  2DKI A;  2H0I A;  3TRX A;  1K0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...