3GYKA

The crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
174
structure length
174
Chain Sequence
NANRDSLFNDPNAPVLGNPEGDVTVVEFFDYNCPYCRRAMAEVQGLVDADPNVRLVYREWPILGEGSDFAARAALAARQQGKYEAFHWALMGMSGKANETGVLRIAREVGLDTEQLQRDMEAPEVTAHIAQSMALAQKLGFNGTPSFVVEDALVPGFVEQSQLQDAVDRARKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 27kDa outer membrane protein
publication title The crystal structure of a thioredoxin-like oxidoreductase from Silicibacter pomeroyi DSS-3
rcsb
source organism Silicibacter pomeroyi
molecule tags Oxidoreductase
total genus 62
structure length 174
sequence length 174
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gykA00
1OE7A 5C00A 3ERFA 1W89A 3NOFA 4HU9A 5EY6A 2VM1A 3BOAA 2H76A 2ZUPA 2PPTA 2TRXA 5G2ZA 4MK3A 2LRNA 2GLRA 3KH9A 2FUG2 3M9JA 4X1UA 3IHQA 4MJAA 8GSSA 3IE3A 4MH2A 2O85A 1TRUA 4BPYA 5IOWA 4XS6A 5A4UA 2L59A 1A0FA 3CTGA 1ERTA 2QKEA 4I97A 2RM6A 1SL1B 2HNLA 2C0DA 2LNSA 3BD2A 1GWCA 2F51A 2JSZA 5E4WA 5G5FA 5J5NA 5IQYA 3GTUA 5GSSA 4BWSA 1W4VA 2H70A 1FB6A 2VO4A 3IOSA 4BWQA 4HQSA 1ZGNA 5F07A 2GZYA 3FZ4A 1ST9A 2EIRA 3DKSA 1A2MA 4JBBA 1GTBA 3GX0A 3M1GA 5JWQB 1O8XA 3AY8A 2LV3A 5DALA 1K3OA 2F8FA 2KLXA 1B9YC 1C72A 2H66A 4WR5A 1GNEA 2PVOC 5D73A 4AJ8A 3GN3A 1MTCA 3VK9A 1ZYQB 2A2SA 4ZL8A 1GTUA 4IELA 4YQUA 2H0GA 3CBUA 5IMZA 1AXDA 1BAYA 4I8BA 1A23A 2LQOA 1U3AA 5GSTA 3O3TA 5ECMB 4AJ6A 4EDYA 5INYA 2GT6A 4KA0A 3L9SA 2VL2A 1OC9A 1TK8B 2WZ9A 5B6NA 1EOHA 5HR2A 2AV4A 2MMOA 5DJMA 5LCZA 4JZQA 5D8IA 2ON7A 4F2IA 2VD0A 1ON4A 3F63A 4TXOA 1OYJA 3IR4A 3HVXA 4WXTA 3A2WA 2DJ3A 4N0ZA 4WEYA 2JZRA 1T3BA 2OE0A 2OE3A 4L0UA 4EXJA 3ZFLA 4BA7A 3ZVJD 1F2EA 2JU5A 1G0TA 4GXZA 2DJ1A 2O87A 4ZBDA 3I6AA 4ECJA 2B6MA 2XPEA 1VF2A 5DVBA 4BVXA 5CAXA 2PMTA 1THOA 2WDUA 5GZZB 1G7EA 1BQ7A 20GSA 1IYIA 3H4KA 3I69A 5A4VA 2ZCTA 4KCAA 2VM2A 2KHPA 1PMTA 2YOIA 1Z7PA 1TI3A 4AGSA 1NW2A 2M72A 2OA7A 3GHAA 2CT6A 5ECSA 2B7JA 1PKZA 4L8EA 1YJ6A 1YEPA 1X5CA 18GSA 3C1RA 2PUKC 2IFQB 22GSA 4HU7A 4K8MA 1BYEA 3GYKA 2VCXA 4ZXGA 2B5EA 3APSA 4XS4A 2DSAA 4HZ2A 1PQNA 2HE3A 4HQZA 3MWHA 2LJKA 4K9ZA 2N5BA 1OE8A 3A5WA 4N30A 4ML1A 1PA3A 3FYGA 2O7KA 1GH2A 2MBTA 3LYKA 3TRQA 1FOVA 1SYXA 3P90A 1XWBA 2ON5A 2IJYA 3QOUA 1YY7A 2MYGA 4E8EA 4WBRD 4EVMA 3KXOA 3FR9A 5ELAA 2MMZA 1QMVA 3HA9A 3LWAA 1X5EA 1VRSD 3KIJA 5D9VA 2M80A 4H86A 4XHMA 1GSFA 2IWTA 3UBKA 2J23A 2H1GA 1KEBA 2CQ9A 5HQPA 4GSSA 4V2MA 1SKRB 3UJ1A 3V1WA 2VCQA 3LSZA 1EGOA 2YJ7A 12GSA 13GSA 4NV5A 1PKWA 2NBSA 2YWOA 3QR6A 4I6XA 2QC7A 4KNDA 1J0FA 5B8BA 4MMMA 3ERWA 4JR6A 3UEMA 3E3EA 2F8AA 3TKPA 1ZYEA 1E6BA 1GSUA 1DBYA 3UIWA 2AUVA 3GIXA 2XBIA 2HXKA 3GL3A 3EU4A 1WRYA 3F3QA 3A3TA 1ZCPA 3HHVA 3N9JA 1Z6NA 4NHWA 3W8JA 2PVQA 3GFKA 1FW1A 3Q18A 4KUNA 5DCGA 1XWGA 1YEXA 2L6DA 2LEGA 5IMFA 5GAPD 1XWAA 3VWXA 2LKUA 3ME8A 1O81A 1WMJA 1BG5A 2GZPA 4IW9A 2QGVA 5DJLA 3F6FA 5HFGA 2C3TA 2K8SA 5JCGA 1GUKA 3QCPA 1GLQA 2X8CA 2R5GA 1ILOA 2F3MA 1TJDA 1PD21 4HDEA 1S3AA 3VFIA 3APQA 1O7UA 4TR3A 5IO0A 1JZRA 3BJ5A 1AQWA 1PX7A 1T4YA 1UN2A 1TI1A 2C4JA 3TUEA 3DGQA 3Q19A 1FG4A 3ZITA 5IOXA 4XIHA 2JSYA 4DSRA 5ID2B 1MEKA 2YV7A 4DVCA 1XW5A 2CVBA 1V9WA 1UVZA 3TGZA 2CX3A 3GA4A 2M46A 1GSDA 2GS3A 1TRSA 1GSQA 1GRXA 3MSZA 2DMMA 4K6XA 5CRDA 5AN1A 5G1KA 2VL3A 2DJ0A 3DEXA 4N10A 3RHBA 1FHEA 1TP9A 5B7CA 4MJEA 4NAXA 2V41A 1VF3A 2E2GA 5DAKB 3EU3A 2OBIA 1XIYA 1RQMA 4Q5FA 4EKZA 1GUHA 4ECIA 2KUCA 3ZIJA 5G1LA 6GSVA 5COHA 1Z9HA 1CQGA 4XCSA 1I5GA 2C1YA 4YAVA 4CW9A 2GVPA 2KP1A 1JHBA 2TIRA 1QK8A 4LL1B 4I2UA 3WT1A 4GSTA 2L4QA 2GQLA 7GSSA 4PUFC 4GRFA 2PERA 2X99A 3LGCA 3IAM2 3PGTA 2OE1A 3KMOA 2AB6A 4DEJA 3HYPA 4L5OA 4Q5RA 5KN3A 2RUEA 3E9JB 4WR4A 1DSBA 2G2QA 2IMFA 2JL4A 5A4WA 1EWXA 2R6KA 2VUPA 5IMVA 4FO5A 5IMDA 3C1SA 3CSIA 5CRWA 2AAWA 3HJPA 2VD1A 3W8SA 4FYCA 1SENA 2NPBA 2XBQA 4OCEA 4PQIA 2VL9A 1WOUA 1YQ1A 2WJUA 2XHFA 3ZIVA 5ECPB 2HRNA 1K0DA 5ABRA 1M7TA 1B4QA 4RQXA 2ALBA 2ES7A 3IK9A 1S3DA 5ECLB 3APOA 1QFNA 3H93A 4F82A 5ECRB 3GMFA 3RPPA 3UARA 3UBLA 4V1Ag 1JZWA 5G31A 3UOMA 3FKFA 4AF2A 3TJKA 10GSA 5L71A 5KN1A 3I43A 3EWLA 3WD6A 2CAQA 2K9FA 4GQFA 4V2LA 4NMUA 4KSOA 1X5DA 2PU9C 3P7XA 1WP0A 1K0OA 4EF0A 3TJFA 4HI7A 3HVSA 5IPHA 4KE3A 2B5XA 4BVYA 4CHSA 1SL0B 1THXA 1G6WA 5B6MA 3ZFBA 2X8GA 2AHEA 3F6DA 2DJ2A 3LYPA 3U6VA 5J41A 4ML6A 2YCDA 1U88A 2DC5A 3HJMA 1SK0A 2R4VA 2F9SA 4MPFA 5ID2A 3F3RA 3FHKA 3EINA 2LJRA 3TJBA 5D96A 1Y6EA 3KP9A 1SD8A 4OWYA 4IGJA 3TB2A 4PXOA 5G5EA 4POMA 5DQSA 4IQAA 1JLVA 3D4TA 3DD3A 3PR8A 2HT9A 4D73A 1DE1A 1OKDA 5B8AA 4JE1A 2C0GA 3LG6A 1Z7RA 1AAZA 1EZKA 4ECCA 3C73A 2VCVA 3QAVA 1ZZYA 9GSSA 4OO5A 2JZTA 4EDZA 5J9BA 5EVOA 4POBA 3IRAA 1Y25A 3UAPA 4LMVA 4K7IA 1EOGA 4CDOA 2DJKA 4GQCA 3GKMA 1F9MA 5JWOB 2L4CA 1X0RA 3GSSA 4OFTA 2C0EA 1OC3A 5H5RA 5D9XA 4V1Ap 3KEBA 1I9DA 3WYWA 2VAFA 4O5RA 3RAZA 5ECHB 4K7OA 1B9XC 5ECNB 3GH6A 1TTZA 5CRGA 4QL7A 5AGYA 1V98A 1K0MA 1ERWA 2L5LA 1Z5YE 3LFLA 2A4VA 1K0AA 1MDKA 1URMA 4RI6A 5DCHA 2IMKA 3C71A 3F4TA 4KSMA 2DJJA 1M0UA 2H6ZA 4J57E 2H75A 3EYTA 1WJKA 2G0FA 3L0HA 2EIOA 2VCTA 2PN8A 4XRDA 4IJIA 4MF5A 4HOJA 2GSSA 2PBJA 3DYRA 5DDLA 3FY7A 1M9BA 1N8JA 1UA5A 4LL4B 1RW1A 1NHOA 1EV4A 4MZCA 2IL3A 4MLYA 5IMAA 3VWWA 1T1VA 3DIEA 1OVNA 2HRFA 1K0NA 1ACVA 1HD2A 2OADA 1XPVA 1VGLA 5ECQB 5IIZA 3PINA 4ILFA 3CRTA 3TKSC 3PH9A 2B1LA 3QFAC 4J56E 2VLVA 2DBCA 5CYYA 3J7Yb 2RUFA 2FGXA 2H30A 1YKAA 2KP2A 5CNWA 5HR0A 3GKXA 3GX8A 4F0BA 2H72A 4IP6A 5EPFA 4O92A 3GL5A 3L9VA 1E2YA 4XRAA 2V6KA 3KTLA 1CQHA 2H73A 2H01A 3WGDA 2CZ3A 4X43A 2H19A 2HSYA 4KX4A 1XWCA 4IBPA 3MNGA 1A8LA 3GURA 5JWRB 1O73A 1AQVA 1WPIA 3QD9A 4K7NA 1OAZA 4OCFA 2L57A 4TW5A 1MD4A 3GH9A 2FY6A 4IP1A 3TJGA 2P0GA 2HZEB 4GTUA 4KB3A 1PL2A 5J9CA 1HNAA 2E0QA 4GWRA 2B7KA 3RBTA 2LRTA 5DQYA 5J4UA 3F4SA 3ZRDA 3KP8A 5HR1A 2VIMA 1NHYA 3LORA 2K6VA 1TXXA 2LTKA 1R7HA 1GL8A 14GSA 2O89A 4QL9A 2X64A 3GRXA 3OR5A 11GSA 1RK4A 3EVIA 1GTAA 1N2AA 2RLIA 4ZB8A 3L4NA 2E2MA 3J7Yk 3TKRA 3SBCA 4K2DA 3P8WA 3WT2A 2B3SA 4DSSB 5ELGA 2GQMA 1XFLA 3M8NA 3DRNA 1YDKA 4G9HA 5HFIA 3H8QA 3U5RE 1SJ6A 5H5SA 3TOUA 2IMDA 4KAEA 1M2DA 1XXUA 2VLUA 4GLTA 1FVJA 3Q74A 2DIZA 2OKAA 5LNKe 5CREA 1EV9A 2JZSA 1BJXA 1BX9A 1TDIA 3UVHA 3DWVA 3VPTA 3F9UA 2WS2A 2NDOA 5FWGA 4ZILA 1EP8A 2LUSA 1UC7A 2K18A 1J08A 5JCUA 5J3RA 1V57A 3FZ9A 1GULA 2HSHA 4WKWA 2N5AA 3FR6A 2E7PA 4MP4A 1Z6MA 1GSYA 1QXHA 1OC8A 1R26A 1K0BA 3L78A 1ML6A 5DALB 1XVQA 1YF0A 2EIQA 4WF5A 1A2LA 2C80A 2IFQA 3D6IA 4IKHA 1H4OA 4NV2A 1XBSA 4HUAA 1AUCA 1T00A 2WFCA 3RDWA 2FWFA 2LS5A 1GSEA 2XPDA 4I2TA 2L5OA 1FAAA 2C0FA 4X0XA 1TU8A 1LJRA 5FT3A 4G10A 2MMNA 3IA1A 3H79A 1TOFA 3L9UA 1GLPA 1GSSA 1T4ZA 1OC9B 3US3A 2WRTA 3HY2A 2FWHA 1Q98A 3O6TA 1XCCA 1FB0A 4FYUA 1A2JA 4OO4A 1USBA 1SJZA 4OFMA 1X9WB 6GSSA 2OACA 4NHZA 4EO3A 2H71A 4ULXA 2VCZA 4HZ4A 1ERVA 3D4MA 1KBNA 1PN9A 2H1AA 2YNXA 4I5QA 4L5LA 3UMAA 1JLWA 1M9AA 4KDXA 3TKQA 3M9KA 2PGTA 2DIYA 1KTEA 2YJHA 3R2QA 1OKTA 3KTBA 3IDVA 4LLRA 3UL3A 2YWNA 4POLA 2YPMA 1DUGA 5CO3A 3CSHA 1R5PA 1ABAA 2NTOA 3KD0A 4NWYA 1X9SB 3EE2A 4MF7A 4WF4A 1XZOA 2CVDA 1TW9A 1JZOA 1KNGA 1G6YA 3BBYA 3EMXA 2FLSA 3F0IA 3TJJA 2CAIA 3ISOA 5IM9A 5A5KA 3ZZXA 5HR3A 4JEDA 2CVKA 3EURA 2GSRA 4MF6A 3DVWA 1GUMA 2I3YA 2RM5A 1BEDA 3F4RA 4J2FA 3W6GA 1A8YA 2FCHA 4E8HA 1EEJA 4XS4B 4KH7A 2Z9SA 3D5JA 3MAKA 3N5OA 3QAWA 4ZB6A 3HDCA 2LSTA 5F8BA 3NZNA 2HLSA 3VI5A 1U6TA 2HZFA 2B5YA 2P5QA 2WCIA 1FVKA 3FRCA 1O85A 5F05A 4ISDA 3VWUA 4PNFA 4EC0A 2VCWA 2EC4A 1QQ2A 5IPGA 2V2GA 3H1NA 1SKSB 1PL1A 3DVXA 4GF0A 4F0CA 1FO5A 5KN0A 4IVFA 1ZMAA 1NM3A 4MZBA 4K1FA 3BCIA 3KJYA 3QAGA 4MCUA 4YQVA 4QQ7A 2KOKA 3JCML 1O6JA 2XC2A 4IJ3A 2N5FA 4EL1A 3A2VA 2A2RA 2C3QA 3VWVA 3IC4A 4XS1A 4XTSA 2CV4A 4FH8A 4F9ZA 3G7YA 1H75A 4TXVA 6GSUA 5DBQA 4MJBA 1SL2B 3ERGA 4KGIA 1VF1A 5DAKA 1V58A 3O76A 1XW9A 1ZL9A 3KZQA 3IK7A 1WIKA 1GNWA 5GAND 4LMWA 4JRRA 3IAS2 2DLXA 1O8WA 3ZYWA 5G30A 4RQRA 1JZDA 4ZBBA 4KCEA 4K0GA 2BTOT 4HS1A 1DE2A 1GP1A 4JU5A 4PURA 2I9HA 2JADA 2YWIA 5KEJA 1AQXA 2GZZA 2VL2C 5ENUA 4RI7A 3LJRA 4ZB9A 3MDKA 1B4PA 4IS0A 2HI7A 2WULA 1M2BA 2YV9A 1PRXA 3GKNA 2R3XA 1F3BA 2IMEA 1IYHA 3WGXA 2LRCA 4MA9A 3A2XA 2PWJA 2LQQA 2MZCA 1QUWA 5KN2A 4GCIA 1T7PB 1K3LA 4PQHA 3ZMKA 2IPAA 2V6OA 2GSQA 1U3IA 2NVLA 3TRXA 4TN8A 3TOTA 1Q4JA 1WE0A 3HCZA 2C8UA 2OJLA 4Z7XA 3CTFA 3GUSA 2P31A 4N0VA 1M99A 3QPMA 4PUAA 1HQOA 4AJ7A 3SWLA 3HKRA 4DSQA 1EP7A 3TKSA 2MBSA 2FA4A 5EL8A 1GTIA 2GGTA 3D21A 3ME7A 3KH7A 1X9MB 3KMNA 4P3YB 2HFDA 4OMVA 2LJAA 2FD3A 3EMPA 2H1DA 4HEA2 1SKWB 3ZVJA 1HNCA 3HJOA 4RUVA 3G7IA 4MJCA 1XOAA 1HNBA 4IHUA 5AIXA 2YZUA 3I9V2 3GV1A 1LU4A 1PSQA 2GDRA 3G7JA 1AIUA 2YN1A 2WGRA 4N11A 1TRVA 2IMIA 2ZNMA 2FHEA 1SU9A 3VI7A 3D0ZA 4V2NA 2P5RA 3LQ7A 5D9WA 4O7HA 3GKKA 3ZTLA 3ZLPA 2H0HA 4TR1B 2BMXA 1MDIA 4PGTA 1F37A 2DMLA 2MMAA 2OBKA 2I1UA 2BJXA 3P2AA 2I81A 2RIIA 1EEMA 5D93A 3HZ8A 3VURA 4TOPA 3ZMLA 5IMCA 5AIVA 1TK0B 2H0IA 2CA8A 3CYNA 1B48A 5CP1A 2R37A 3CXGA 6GSWA 1XOBA 1SD9A 3D22A 2CZ2A 3TKSE 1NSWA 2GQKA 4OD7A 1ERUA 2REMA 2VLTA 3FK8A 1K3YA 4TKYA 2FA8A 2I4AA 3UVTA 5C04A 4Q5NA 3C8EA 4NPBA 2FWEA 4G19A 1V2AA 6GSYA 4IN0A 2CX4A 1B8XA 4HJ2A 5FHIA 4MZWA 2LNTA 17GSA 3BCKA 3ED3A 1F6MC 2H6YA 1JFUA 4TR4A 3QFBC 4ECBA 1LBKA 2FWGA 1SK1A 1SYRA 4K0NA 19GSA 4FIWA 5F0GA 4BL7A 16GSA 2FNOA 2O8VB 3M0FA 3FEUA 4Q5QA 2H1BA 5F06A 4EUYA 4F03A 6GSXA 3FR3A 1TU7A 3FZ5A 3TRPA 1WWJA 4POKA 3DMLA 2HYXA 3M3MA 4WBJA 3GTUB 2V32A 1TRWA 4MH3A 2H6XA 3KGKA 3ZREA 2GSTA 1A0RP 5E59A 5AISA 1MD3A 1XW6A 2X8HA 3HZ4A 4ZL7A 1Z3EA 1PGTA 4ID0A 2VOCA 1U87A 3K8NA 3LXTA 4HJMA 5ECKB 4ZIJA 1YF1A 2B1KA 4PNGA 4ACSA 1G7OA 3IPZA 5CRHA 3CSJA 3LEFA 6GSTA 1YZXA 2YWMA 4TR0A 3NIVA 4EE0A 4ZL9A 5H5QA 1T8EB 4WETA 5D9TA 4ZBAA 3RPNA 4D73B 4KDUA 4KW6A 1TKDB 5JCWA 1AC1A 1XWKA 2K8VA 5ECOB 2D2ZA 2L6CA 3FW2A 3HD5A 4KDYA 1QGVA 1F3AA 4OFNA 3ZL5A 5ECIB 4PX1A 5HFKA 2YANA 1PX6A 2IN3A 2WB9A 3WGEA 3GSTA 1A24A 2J9HA 2AJQB 3IBHA 3F8UA 3QMXA 4TXOB 1XVWA 3EC3A 1SK2A 4G2EA 4MDCA 4GSNA 3E0UA 1R4WA 2YZHA 4MABA 1MDJA 4FYBA 3IXRA 4YQMA 1S3CA 3S9FA 3HXSA 4TR1A 2HZEA 3Q6OA 3TDGA 2H8LA 2GTUA 2QSIA 1R5AA 3CRUA 3C7MA 1J9BA 2GT5A 3FZAA 4TRXA 2H74A 1M2AA 1YKCA 3KM6A 3GNJA 3VPQA 5IO2A 1K0CA 1AW9A 3CMIA 4LA1A 5LD0A 1TK5B 4NXIA 2V1MA 1VF4A 3QDNA 3KCMA 4IQ1A 2TRCP 2YP6A 2IIYA 1SJIA 4YAPA 1ZOFA 3DXBA 3LXZA 2C3NA 4JR4A 3VLNA 2R2JA 2AYTA 4O32A 3RHCA 2JACA 3HVVA 3IV4A 4TVEA 4MPGA 4L0WA 1V40A 3G9BA 1EGRA 3TCOA 4PQ1A 4DSSA 4YH2A 1HYUA
chains in the Genus database with same CATH superfamily
1OE7A 5C00A 3ERFA 1W89A 3NOFA 4HU9A 5EY6A 2VM1A 3BOAA 2H76A 2ZUPA 2PPTA 2TRXA 5G2ZA 4MK3A 2LRNA 2GLRA 3KH9A 2FUG2 3M9JA 4X1UA 3IHQA 4MJAA 8GSSA 3IE3A 4MH2A 2O85A 1TRUA 4BPYA 2DKHA 5IOWA 4XS6A 5A4UA 2L59A 1A0FA 3CTGA 1ERTA 2QKEA 3IC8A 1PFOA 4I97A 2RM6A 1SL1B 2HNLA 2C0DA 2LNSA 3BD2A 1GWCA 2F51A 2JSZA 5E4WA 5G5FA 5J5NA 5IQYA 3GTUA 5GSSA 4BWSA 1W4VA 2H70A 1FB6A 2VO4A 3IOSA 4BWQA 4HQSA 1ZGNA 5F07A 2GZYA 3FZ4A 1ST9A 2EIRA 3DKSA 1A2MA 4JBBA 1GTBA 3GX0A 3M1GA 5JWQB 1O8XA 3AY8A 2LV3A 5DALA 1K3OA 2F8FA 2KLXA 1B9YC 1C72A 2H66A 4WR5A 1GNEA 2PVOC 5D73A 4AJ8A 3GN3A 1MTCA 3VK9A 1ZYQB 2A2SA 4ZL8A 1GTUA 4IELA 4YQUA 2H0GA 3CBUA 5IMZA 1AXDA 1BAYA 4I8BA 1A23A 2LQOA 1U3AA 5GSTA 3O3TA 5ECMB 4AJ6A 4EDYA 5INYA 2GT6A 4KA0A 3L9SA 2VL2A 1OC9A 1TK8B 2WZ9A 5B6NA 1EOHA 5HR2A 2AV4A 2MMOA 5DJMA 5LCZA 4JZQA 5D8IA 2ON7A 4F2IA 2VD0A 1ON4A 3F63A 4TXOA 1OYJA 3IR4A 3HVXA 4WXTA 3A2WA 2DJ3A 4N0ZA 4WEYA 2JZRA 1T3BA 2OE0A 2OE3A 4L0UA 4EXJA 3ZFLA 4BA7A 3ZVJD 1F2EA 2JU5A 1G0TA 4GXZA 2DJ1A 2O87A 4ZBDA 3I6AA 4ECJA 2B6MA 2XPEA 1VF2A 5DVBA 4BVXA 5CAXA 2PMTA 1THOA 2WDUA 5GZZB 1G7EA 1BQ7A 20GSA 1IYIA 3H4KA 3I69A 5A4VA 2ZCTA 4KCAA 2VM2A 2KHPA 1PMTA 2YOIA 1Z7PA 1TI3A 4AGSA 1NW2A 2M72A 2OA7A 3GHAA 4K2XA 2CT6A 5ECSA 2B7JA 1PKZA 4L8EA 1YJ6A 1YEPA 1X5CA 18GSA 3C1RA 2PUKC 2IFQB 22GSA 4HU7A 4K8MA 1BYEA 3GYKA 2VCXA 4ZXGA 2B5EA 3APSA 4XS4A 2DSAA 4HZ2A 1PQNA 2HE3A 4HQZA 3MWHA 2LJKA 4K9ZA 2N5BA 1OE8A 3A5WA 4N30A 4HSCX 4ML1A 1PA3A 3FYGA 2O7KA 1GH2A 2MBTA 3LYKA 3TRQA 3MIXA 1FOVA 1SYXA 3P90A 1XWBA 2ON5A 2IJYA 3QOUA 1YY7A 2MYGA 4E8EA 4WBRD 4EVMA 3KXOA 3FR9A 5ELAA 2MMZA 1QMVA 3HA9A 3LWAA 1X5EA 1VRSD 3KIJA 5D9VA 2M80A 4H86A 4XHMA 1GSFA 2IWTA 3UBKA 2J23A 2H1GA 1KEBA 2CQ9A 5HQPA 4GSSA 4V2MA 1SKRB 3UJ1A 3V1WA 2VCQA 3LSZA 1EGOA 2YJ7A 12GSA 13GSA 4NV5A 1PKWA 2NBSA 2YWOA 3QR6A 4I6XA 2QC7A 4KNDA 1J0FA 5B8BA 4MMMA 3ERWA 4JR6A 3UEMA 3E3EA 2F8AA 3TKPA 1ZYEA 1E6BA 1GSUA 1DBYA 3UIWA 4G0LA 2AUVA 3GIXA 2XBIA 2HXKA 3GL3A 3EU4A 1WRYA 3F3QA 3A3TA 1ZCPA 2A4HA 3HHVA 3N9JA 1Z6NA 4NHWA 3W8JA 2PVQA 3GFKA 1FW1A 3Q18A 4KUNA 5DCGA 1XWGA 1YEXA 2L6DA 2LEGA 5IMFA 5GAPD 4MNNA 1XWAA 3VWXA 2LKUA 3ME8A 1O81A 1WMJA 1BG5A 2GZPA 4IW9A 2QGVA 5DJLA 3F6FA 5HFGA 2C3TA 2K8SA 4O5UA 1GUKA 3QCPA 5JCGA 1GLQA 2X8CA 2R5GA 1ILOA 2F3MA 1TJDA 1PD21 4HDEA 1S3AA 3VFIA 3APQA 4BVYB 1O7UA 4TR3A 5IO0A 1JZRA 3BJ5A 1AQWA 1PX7A 1T4YA 1UN2A 1TI1A 2C4JA 3TUEA 3DGQA 3Q19A 1FG4A 3ZITA 5IOXA 4XIHA 2JSYA 4DSRA 5ID2B 1MEKA 2YV7A 4DVCA 1XW5A 2CVBA 1V9WA 1UVZA 3TGZA 2CX3A 3GA4A 2R0PA 2M46A 1GSDA 4YKGA 4K5RA 2GS3A 1TRSA 1GSQA 1GRXA 3MSZA 2DMMA 2QA1A 4K6XA 5CRDA 5AN1A 5G1KA 2VL3A 2DJ0A 3DEXA 4N10A 3RHBA 1FHEA 1TP9A 5B7CA 4MJEA 4NAXA 5BRTA 2V41A 1VF3A 2E2GA 4USSA 5DAKB 3EU3A 2OBIA 1XIYA 1RQMA 4Q5FA 4EKZA 1GUHA 4ECIA 2KUCA 3ZIJA 5G1LA 6GSVA 5COHA 1Z9HA 1CQGA 4XCSA 1I5GA 2C1YA 4YAVA 4CW9A 2GVPA 2KP1A 1JHBA 2TIRA 1QK8A 4LL1B 4I2UA 3WT1A 4GSTA 2L4QA 2GQLA 7GSSA 4PUFC 4GRFA 2PERA 2X4AA 2X99A 3LGCA 4K5SA 3IAM2 3PGTA 2OE1A 3KMOA 2AB6A 4DEJA 3HYPA 4L5OA 4Q5RA 5KN3A 2RUEA 3E9JB 4WR4A 1DSBA 2G2QA 1ZYPA 2IMFA 2JL4A 5A4WA 1EWXA 2R6KA 2VUPA 5IMVA 4FO5A 5IMDA 3C1SA 3CSIA 5CRWA 2AAWA 3HJPA 2VD1A 3W8SA 4FYCA 1SENA 2NPBA 2XBQA 4OCEA 4PQIA 2VL9A 1WOUA 1YQ1A 2WJUA 2XHFA 3ZIVA 5ECPB 2HRNA 1K0DA 5ABRA 1M7TA 1B4QA 4RQXA 2ALBA 2ES7A 3IK9A 1S3DA 5ECLB 3APOA 1QFNA 3H93A 4F82A 5ECRB 3GMFA 3RPPA 3UARA 3UBLA 4V1Ag 1JZWA 5G31A 3UOMA 3FKFA 4AF2A 3TJKA 10GSA 5L71A 5KN1A 3I43A 3EWLA 3WD6A 2CAQA 2K9FA 4V2LA 4GQFA 3IHGA 4NMUA 4KSOA 1X5DA 2PU9C 1M3JA 3P7XA 1WP0A 1K0OA 4EF0A 3TJFA 4HI7A 3HVSA 5IPHA 4KE3A 2B5XA 4BVYA 4CHSA 1SL0B 1THXA 1G6WA 5B6MA 3ZFBA 2X8GA 2AHEA 3F6DA 2DJ2A 3LYPA 3U6VA 5J41A 4ML6A 2YCDA 1U88A 2DC5A 3HJMA 1SK0A 2R4VA 2F9SA 4MPFA 5ID2A 3F3RA 3FHKA 4PTSA 3EINA 2LJRA 3TJBA 5D96A 1Y6EA 3KP9A 1SD8A 4OWYA 4IGJA 3TB2A 4PXOA 5G5EA 4POMA 5DQSA 4IQAA 1JLVA 3D4TA 3DD3A 3PR8A 2HT9A 4D73A 1DE1A 2UZ8A 1OKDA 5B8AA 4JE1A 4Z2UA 4X4JA 1XG8A 2C0GA 3LG6A 1Z7RA 1AAZA 1EZKA 4ECCA 3C73A 2VCVA 3QAVA 1ZZYA 9GSSA 4OO5A 2JZTA 4EDZA 5J9BA 5EVOA 4POBA 3IRAA 4EIPA 1Y25A 3UAPA 4LMVA 4K7IA 4A5PA 1EOGA 4CDOA 2DJKA 4GQCA 3GKMA 1F9MA 5JWOB 2L4CA 1X0RA 3GSSA 4OFTA 2C0EA 1OC3A 5H5RA 5D9XA 4V1Ap 3KEBA 1I9DA 3WYWA 2VAFA 4O5RA 3RAZA 5ECHB 4K7OA 2R0CA 1B9XC 5ECNB 3GH6A 1TTZA 5CRGA 4QL7A 5AGYA 1V98A 1K0MA 1ERWA 2L5LA 1Z5YE 3LFLA 2A4VA 1K0AA 1MDKA 1URMA 4RI6A 5DCHA 2IMKA 3C71A 3F4TA 4KSMA 2DJJA 1M0UA 2H6ZA 4J57E 2H75A 3EYTA 1WJKA 2X49A 2G0FA 3L0HA 2EIOA 2VCTA 2PN8A 4XRDA 4IJIA 4MF5A 4HOJA 2GSSA 2PBJA 3DYRA 5DDLA 3FY7A 1M9BA 1N8JA 1UA5A 4LL4B 1RW1A 1NHOA 1EV4A 4MZCA 2IL3A 4MLYA 5IMAA 3VWWA 1T1VA 3DIEA 1OVNA 2HRFA 1K0NA 1ACVA 1HD2A 2OADA 1XPVA 4YKFA 1VGLA 5ECQB 5IIZA 3PINA 4ILFA 3CRTA 3TKSC 3PH9A 2B1LA 3QFAC 4J56E 2VLVA 2DBCA 5CYYA 3J7Yb 2RUFA 4CY8A 2FGXA 2H30A 1YKAA 2KP2A 4KF9A 5CNWA 5HR0A 3GKXA 3GX8A 4F0BA 2H72A 4IP6A 5EPFA 4O92A 3GL5A 5BMUA 3L9VA 1E2YA 4XRAA 2V6KA 3KTLA 1CQHA 2H73A 2H01A 3WGDA 2CZ3A 4X43A 2H19A 2HSYA 4KX4A 1XWCA 4IBPA 3MNGA 1A8LA 3GURA 5JWRB 1O73A 1AQVA 1WPIA 3QD9A 4K7NA 1OAZA 4OCFA 2L57A 4TW5A 1MD4A 3GH9A 2FY6A 4IP1A 3TJGA 2P0GA 2HZEB 4GTUA 4KB3A 1PL2A 5J9CA 1HNAA 2E0QA 4GWRA 2B7KA 3RBTA 2LRTA 5DQYA 5J4UA 3F4SA 3ZRDA 3KP8A 5HR1A 2VIMA 1NHYA 3LORA 2K6VA 1TXXA 2LTKA 1R7HA 1GL8A 14GSA 2O89A 4QL9A 2X64A 3GRXA 3OR5A 11GSA 1RK4A 3EVIA 1GTAA 1N2AA 2RLIA 3A5IA 4ZB8A 3L4NA 2E2MA 3J7Yk 3TKRA 3SBCA 4K2DA 3P8WA 3WT2A 2B3SA 4DSSB 5ELGA 2GQMA 1XFLA 3M8NA 3DRNA 1YDKA 4G9HA 5HFIA 3H8QA 3U5RE 1SJ6A 5H5SA 3TOUA 2IMDA 4KAEA 1M2DA 1XXUA 2VLUA 4GLTA 1FVJA 3Q74A 2DIZA 2OKAA 5LNKe 5CREA 1EV9A 2JZSA 1BJXA 1BX9A 1TDIA 3UVHA 3DWVA 3VPTA 3F9UA 2WS2A 2NDOA 5FWGA 4ZILA 1EP8A 2LUSA 1UC7A 2K18A 5KOWA 1J08A 5JCUA 5J3RA 1V57A 3FZ9A 1GULA 2HSHA 4WKWA 2N5AA 3FR6A 2E7PA 4MP4A 1Z6MA 1GSYA 1QXHA 1OC8A 1R26A 1K0BA 3L78A 1ML6A 5DALB 1XVQA 1YF0A 2EIQA 4WF5A 1A2LA 2C80A 2IFQA 3D6IA 4IKHA 1H4OA 4NV2A 1XBSA 4HUAA 1AUCA 1T00A 2WFCA 3RDWA 4G0KA 2FWFA 2LS5A 1GSEA 2XPDA 4I2TA 2L5OA 1FAAA 2C0FA 4X0XA 1TU8A 1LJRA 5FT3A 4G10A 2MMNA 3IA1A 3H79A 1TOFA 3L9UA 1GLPA 1GSSA 1T4ZA 1OC9B 3US3A 2WRTA 3HY2A 3PPUA 2FWHA 1Q98A 3O6TA 1XCCA 1FB0A 4FYUA 4O5QA 1A2JA 4OO4A 1USBA 1SJZA 3HVNA 4OFMA 1X9WB 6GSSA 2OACA 4NHZA 4EO3A 2H71A 4ULXA 2VCZA 4HZ4A 1ERVA 3D4MA 1KBNA 1PN9A 2H1AA 2YNXA 4I5QA 4L5LA 3UMAA 1JLWA 1M9AA 4KDXA 3TKQA 3M9KA 2PGTA 2DIYA 1KTEA 2YJHA 3R2QA 1OKTA 3KTBA 3IDVA 2HSMA 4LLRA 3UL3A 4BVXB 2YWNA 4POLA 2YPMA 1DUGA 5CO3A 3CSHA 1FOHA 1R5PA 1ABAA 2NTOA 3KD0A 4NWYA 1X9SB 3EE2A 4MF7A 4WF4A 3CQFA 1XZOA 2CVDA 1TW9A 1JZOA 1KNGA 1G6YA 3BBYA 3EMXA 2FLSA 3F0IA 3TJJA 2CAIA 1ZYNA 3ISOA 5IM9A 5A5KA 3ZZXA 5HR3A 4JEDA 2CVKA 3EURA 2GSRA 4MF6A 3DVWA 1GUMA 2I3YA 2RM5A 1BEDA 3F4RA 4J2FA 3W6GA 1A8YA 2FCHA 4E8HA 1EEJA 4XS4B 4KH7A 2Z9SA 3D5JA 3MAKA 3N5OA 3QAWA 4ZB6A 3HDCA 2LSTA 5F8BA 3NZNA 2HLSA 3VI5A 1U6TA 2HZFA 2B5YA 2P5QA 2WCIA 1FVKA 3FRCA 1O85A 5F05A 4ISDA 3VWUA 4PNFA 4EC0A 2VCWA 2EC4A 4BIKA 1QQ2A 5IPGA 2V2GA 3H1NA 1SKSB 1PL1A 3R3EA 3DVXA 4GF0A 4F0CA 1FO5A 5KN0A 1S3RA 4IVFA 1ZMAA 1NM3A 4MZBA 4K1FA 3BCIA 3KJYA 3QAGA 4MCUA 4YQVA 4QQ7A 2KOKA 3JCML 1O6JA 2XC2A 4IJ3A 2N5FA 4EL1A 3A2VA 2A2RA 2C3QA 3VWVA 4G0IA 3IC4A 4XS1A 4XTSA 2CV4A 4FH8A 4F9ZA 1PN0A 3G7YA 1H75A 4TXVA 6GSUA 5DBQA 4MJBA 1SL2B 3ERGA 4KGIA 1VF1A 5DAKA 1V58A 3O76A 1XW9A 1ZL9A 3KZQA 3IK7A 1WIKA 1GNWA 4Z2TA 5GAND 4LMWA 4JRRA 3IAS2 2DLXA 1O8WA 3ZYWA 5G30A 4RQRA 1JZDA 4CY6A 4BL7B 4ZBBA 4KCEA 4K0GA 2BTOT 4HS1A 1DE2A 1GP1A 4JU5A 4PURA 2I9HA 2JADA 2YWIA 5KEJA 1AQXA 2GZZA 2VL2C 5ENUA 4RI7A 3LJRA 4ZB9A 3MDKA 1B4PA 2R0GA 4IS0A 2HI7A 2WULA 1M2BA 2YV9A 1PRXA 3GKNA 2R3XA 1F3BA 2IMEA 1M3IA 2HRKA 1IYHA 3WGXA 2LRCA 4MA9A 3A2XA 2PWJA 2LQQA 2MZCA 1QUWA 5KN2A 4GCIA 1T7PB 1K3LA 4PQHA 3ZMKA 2IPAA 2V6OA 2GSQA 1U3IA 2NVLA 3TRXA 2DKIA 4TN8A 3TOTA 1Q4JA 1WE0A 3HCZA 2C8UA 2OJLA 4Z7XA 3CTFA 3GUSA 2P31A 4N0VA 1M99A 3QPMA 4PUAA 1HQOA 4AJ7A 3SWLA 3HKRA 4DSQA 1EP7A 3TKSA 2MBSA 2FA4A 5EL8A 1GTIA 2GGTA 3LW9A 3D21A 3ME7A 3KH7A 1X9MB 3KMNA 4P3YB 2HFDA 4OMVA 2LJAA 2FD3A 3EMPA 2H1DA 4HEA2 1SKWB 3ZVJA 1HNCA 3HJOA 4RUVA 3G7IA 4MJCA 1XOAA 1HNBA 4IHUA 5AIXA 2YZUA 4FQUA 3I9V2 3GV1A 1LU4A 1PSQA 2GDRA 3G7JA 1AIUA 2YN1A 2WGRA 4N11A 3MYDA 1TRVA 2IMIA 2ZNMA 2FHEA 1SU9A 3VI7A 3D0ZA 4V2NA 4ICYA 2P5RA 3LQ7A 5D9WA 4O7HA 3GKKA 3ZTLA 3ZLPA 2H0HA 4TR1B 2BMXA 1MDIA 4PGTA 1F37A 2DMLA 2MMAA 2OBKA 2I1UA 2BJXA 3P2AA 2I81A 2RIIA 1EEMA 5D93A 3HZ8A 3VURA 4TOPA 3ZMLA 5IMCA 5AIVA 1TK0B 4Z2RA 2H0IA 3FMWA 2CA8A 3CYNA 1B48A 5CP1A 2R37A 3CXGA 6GSWA 1XOBA 1SD9A 3D22A 2CZ2A 3TKSE 1NSWA 2GQKA 4OD7A 1ERUA 2REMA 2VLTA 3FK8A 1K3YA 5KOXA 4TKYA 2FA8A 2I4AA 3UVTA 5C04A 4Q5NA 3C8EA 4NPBA 2FWEA 4G19A 1V2AA 6GSYA 4IN0A 2CX4A 1B8XA 4HJ2A 5FHIA 4MZWA 2LNTA 17GSA 3BCKA 3ED3A 1F6MC 2H6YA 1JFUA 4TR4A 3QFBC 4ECBA 1LBKA 2FWGA 2A2PA 1SK1A 1SYRA 4K0NA 19GSA 4FIWA 5F0GA 4BL7A 16GSA 2FNOA 2O8VB 3M0FA 3FEUA 4Q5QA 2H1BA 5F06A 4EUYA 4F03A 6GSXA 3FR3A 1TU7A 3FZ5A 3TRPA 1WWJA 4POKA 3DMLA 2HYXA 3M3MA 4WBJA 3GTUB 2V32A 1TRWA 4MH3A 2H6XA 3KGKA 3ZREA 2GSTA 1A0RP 5E59A 5AISA 1MD3A 1XW6A 2X8HA 2QA2A 3HZ4A 4ZL7A 1Z3EA 1PGTA 4ID0A 2VOCA 1U87A 3K8NA 3LXTA 4HJMA 5ECKB 4ZIJA 1YF1A 2B1KA 4PNGA 4ACSA 1G7OA 3IPZA 5CRHA 3CSJA 3LEFA 6GSTA 1YZXA 2YWMA 4TR0A 3NIVA 4EE0A 4ZL9A 5H5QA 1T8EB 4WETA 5D9TA 4ZBAA 3RPNA 4D73B 4KDUA 4KW6A 1TKDB 5JCWA 1AC1A 1XWKA 2K8VA 5ECOB 2D2ZA 2L6CA 3FW2A 3HD5A 4KDYA 1QGVA 1F3AA 4OFNA 3ZL5A 5ECIB 4PX1A 5HFKA 2YANA 1PX6A 2IN3A 2WB9A 3WGEA 3GSTA 1A24A 2J9HA 2AJQB 3IBHA 2HRAA 3F8UA 3QMXA 4TXOB 1XVWA 3EC3A 1SK2A 4G2EA 4MDCA 4GSNA 3E0UA 1R4WA 2YZHA 4MABA 1MDJA 4FYBA 3IXRA 4YQMA 1S3CA 3S9FA 3HXSA 4TR1A 2HZEA 3Q6OA 3TDGA 2H8LA 2GTUA 2QSIA 1R5AA 3CRUA 3C7MA 1J9BA 2GT5A 3FZAA 4TRXA 2H74A 1M2AA 1YKCA 3KM6A 3GNJA 3VPQA 5IO2A 1K0CA 1AW9A 3CMIA 4LA1A 5LD0A 1TK5B 4NXIA 2V1MA 1VF4A 3QDNA 3KCMA 4IQ1A 2TRCP 2YP6A 2IIYA 1SJIA 4YAPA 1ZOFA 3DXBA 3LXZA 2C3NA 4JR4A 3VLNA 2R2JA 2AYTA 4O32A 3RHCA 2JACA 3HVVA 3IV4A 3EPTA 4TVEA 4MPGA 4EIQA 4L0WA 1V40A 3G9BA 1EGRA 3TCOA 4PQ1A 4DSSA 4YH2A 1HYUA
chains in the Genus database with same CATH topology
1OE7A 5C00A 3ERFA 1W89A 3NOFA 4HU9A 5EY6A 2VM1A 3BOAA 2H76A 2ZUPA 2PPTA 2TRXA 5G2ZA 4MK3A 2LRNA 2GLRA 3KH9A 2FUG2 3M9JA 4X1UA 3IHQA 4MJAA 8GSSA 3IE3A 4MH2A 2O85A 1TRUA 4BPYA 2DKHA 5IOWA 4XS6A 5A4UA 2L59A 1A0FA 3CTGA 1ERTA 2QKEA 3IC8A 4I97A 2RM6A 1SL1B 2HNLA 2C0DA 2LNSA 3BD2A 1GWCA 2F51A 2JSZA 5E4WA 5G5FA 5J5NA 5IQYA 3GTUA 5GSSA 4BWSA 1W4VA 2H70A 1FB6A 2VO4A 3IOSA 4BWQA 4HQSA 1ZGNA 5F07A 2GZYA 3FZ4A 1ST9A 2EIRA 3DKSA 1A2MA 4JBBA 1GTBA 3GX0A 3M1GA 5JWQB 1O8XA 3AY8A 2LV3A 5DALA 1K3OA 2F8FA 2KLXA 1B9YC 1C72A 2H66A 4WR5A 1GNEA 2PVOC 5D73A 4AJ8A 3GN3A 1MTCA 3VK9A 1ZYQB 2A2SA 4ZL8A 1GTUA 4IELA 4YQUA 2H0GA 3CBUA 5IMZA 1AXDA 1BAYA 4I8BA 1A23A 2LQOA 1U3AA 5GSTA 3O3TA 5ECMB 4AJ6A 4EDYA 5INYA 2GT6A 4KA0A 3L9SA 2VL2A 1OC9A 1TK8B 2WZ9A 5B6NA 1EOHA 5HR2A 2AV4A 2MMOA 5DJMA 5LCZA 4JZQA 5D8IA 2ON7A 4F2IA 2VD0A 1ON4A 3F63A 4TXOA 1OYJA 3IR4A 3HVXA 4WXTA 3A2WA 2DJ3A 4N0ZA 4WEYA 2JZRA 1T3BA 2OE0A 2OE3A 4L0UA 4EXJA 3ZFLA 4BA7A 3ZVJD 1F2EA 2JU5A 1G0TA 4GXZA 2DJ1A 2O87A 4ZBDA 3I6AA 4ECJA 2B6MA 2XPEA 1VF2A 5DVBA 4BVXA 5CAXA 2PMTA 1THOA 2WDUA 5GZZB 1G7EA 1BQ7A 20GSA 1IYIA 3H4KA 3I69A 5A4VA 2ZCTA 4KCAA 2VM2A 2KHPA 1PMTA 2YOIA 1Z7PA 1TI3A 4AGSA 1NW2A 2M72A 2OA7A 3GHAA 4K2XA 2CT6A 5ECSA 2B7JA 1PKZA 4L8EA 1YJ6A 1YEPA 1X5CA 18GSA 3C1RA 2PUKC 2IFQB 22GSA 4HU7A 4K8MA 1BYEA 3GYKA 2VCXA 4ZXGA 2B5EA 3APSA 4XS4A 2DSAA 4HZ2A 1PQNA 2HE3A 4HQZA 3MWHA 2LJKA 4K9ZA 2N5BA 1OE8A 3A5WA 4N30A 4ML1A 1PA3A 3FYGA 2O7KA 1GH2A 2MBTA 3LYKA 3TRQA 3MIXA 1FOVA 1SYXA 3P90A 1XWBA 2ON5A 2IJYA 3QOUA 1YY7A 2MYGA 4E8EA 4WBRD 4EVMA 3KXOA 3FR9A 5ELAA 2MMZA 1QMVA 3HA9A 3LWAA 1X5EA 1VRSD 3KIJA 5D9VA 2M80A 4H86A 4XHMA 1GSFA 2IWTA 3UBKA 2J23A 2H1GA 1KEBA 2CQ9A 5HQPA 4GSSA 4V2MA 1SKRB 3UJ1A 3V1WA 2VCQA 3LSZA 1EGOA 2YJ7A 12GSA 13GSA 4NV5A 1PKWA 2NBSA 2YWOA 3QR6A 4I6XA 2QC7A 4KNDA 1J0FA 5B8BA 4MMMA 3ERWA 4JR6A 3UEMA 3E3EA 2F8AA 3TKPA 1ZYEA 1E6BA 1GSUA 1DBYA 3UIWA 4G0LA 2AUVA 3GIXA 2XBIA 2HXKA 3GL3A 3EU4A 1WRYA 3F3QA 3A3TA 1ZCPA 2A4HA 3HHVA 3N9JA 1Z6NA 4NHWA 3W8JA 2PVQA 3GFKA 1FW1A 3Q18A 4KUNA 5DCGA 1XWGA 1YEXA 2L6DA 2LEGA 5IMFA 5GAPD 4MNNA 1XWAA 3VWXA 2LKUA 3ME8A 1O81A 1WMJA 1BG5A 2GZPA 4IW9A 2QGVA 5DJLA 3F6FA 5HFGA 2C3TA 2K8SA 4O5UA 1GUKA 3QCPA 5JCGA 1GLQA 2X8CA 2R5GA 1ILOA 2F3MA 1TJDA 1PD21 4HDEA 1S3AA 3VFIA 3APQA 4BVYB 1O7UA 4TR3A 5IO0A 1JZRA 3BJ5A 1AQWA 1PX7A 1T4YA 1UN2A 1TI1A 2C4JA 3TUEA 3DGQA 3Q19A 1FG4A 3ZITA 5IOXA 4XIHA 2JSYA 4DSRA 5ID2B 1MEKA 2YV7A 4DVCA 1XW5A 2CVBA 1V9WA 1UVZA 3TGZA 2CX3A 3GA4A 2R0PA 2M46A 1GSDA 4YKGA 4K5RA 2GS3A 1TRSA 1GSQA 1GRXA 3MSZA 2DMMA 2QA1A 4K6XA 5CRDA 5AN1A 5G1KA 2VL3A 2DJ0A 3DEXA 4N10A 3RHBA 1FHEA 1TP9A 5B7CA 4MJEA 4NAXA 5BRTA 2V41A 1VF3A 2E2GA 4USSA 5DAKB 3EU3A 2OBIA 1XIYA 1RQMA 4Q5FA 4EKZA 1GUHA 4ECIA 2KUCA 3ZIJA 5G1LA 6GSVA 5COHA 1Z9HA 1CQGA 4XCSA 1I5GA 2C1YA 4YAVA 4CW9A 2GVPA 2KP1A 1JHBA 2TIRA 1QK8A 4LL1B 4I2UA 3WT1A 4GSTA 2L4QA 2GQLA 7GSSA 4PUFC 4GRFA 2PERA 2X4AA 2X99A 3LGCA 4K5SA 3IAM2 3PGTA 2OE1A 3KMOA 2AB6A 4DEJA 3HYPA 4L5OA 4Q5RA 5KN3A 2RUEA 3E9JB 4WR4A 1DSBA 2G2QA 1ZYPA 2IMFA 2JL4A 5A4WA 1EWXA 2R6KA 2VUPA 5IMVA 4FO5A 5IMDA 3C1SA 3CSIA 5CRWA 2AAWA 3HJPA 2VD1A 3W8SA 4FYCA 1SENA 2NPBA 2XBQA 4OCEA 4PQIA 2VL9A 1WOUA 1YQ1A 2WJUA 2XHFA 3ZIVA 5ECPB 2HRNA 1K0DA 5ABRA 1M7TA 1B4QA 4RQXA 2ALBA 2ES7A 3IK9A 1S3DA 5ECLB 3APOA 1QFNA 3H93A 4F82A 5ECRB 3GMFA 3RPPA 3UARA 3UBLA 4V1Ag 1JZWA 5G31A 3UOMA 3FKFA 4AF2A 3TJKA 10GSA 5L71A 5KN1A 3I43A 3EWLA 3WD6A 2CAQA 2K9FA 4V2LA 4GQFA 3IHGA 4NMUA 4KSOA 1X5DA 2PU9C 3P7XA 1WP0A 1K0OA 4EF0A 3TJFA 4HI7A 3HVSA 5IPHA 4KE3A 2B5XA 4BVYA 4CHSA 1SL0B 1THXA 1G6WA 5B6MA 3ZFBA 2X8GA 2AHEA 3F6DA 2DJ2A 3LYPA 3U6VA 5J41A 4ML6A 2YCDA 1U88A 2DC5A 3HJMA 1SK0A 2R4VA 2F9SA 4MPFA 5ID2A 3F3RA 3FHKA 4PTSA 3EINA 2LJRA 3TJBA 5D96A 1Y6EA 3KP9A 1SD8A 4OWYA 4IGJA 3TB2A 4PXOA 5G5EA 4POMA 5DQSA 4IQAA 1JLVA 3D4TA 3DD3A 3PR8A 2HT9A 4D73A 1DE1A 2UZ8A 1OKDA 5B8AA 4JE1A 4Z2UA 4X4JA 2C0GA 3LG6A 1Z7RA 1AAZA 1EZKA 4ECCA 3C73A 2VCVA 3QAVA 1ZZYA 9GSSA 4OO5A 2JZTA 4EDZA 5J9BA 5EVOA 4POBA 3IRAA 4EIPA 1Y25A 3UAPA 4LMVA 4K7IA 4A5PA 1EOGA 4CDOA 2DJKA 4GQCA 3GKMA 1F9MA 5JWOB 2L4CA 1X0RA 3GSSA 4OFTA 2C0EA 1OC3A 5H5RA 5D9XA 4V1Ap 3KEBA 1I9DA 3WYWA 2VAFA 4O5RA 3RAZA 5ECHB 4K7OA 2R0CA 1B9XC 5ECNB 3GH6A 1TTZA 5CRGA 4QL7A 5AGYA 1V98A 1K0MA 1ERWA 2L5LA 1Z5YE 3LFLA 2A4VA 1K0AA 1MDKA 1URMA 4RI6A 5DCHA 2IMKA 3C71A 3F4TA 4KSMA 2DJJA 1M0UA 2H6ZA 4J57E 2H75A 3EYTA 1WJKA 2X49A 2G0FA 3L0HA 2EIOA 2VCTA 2PN8A 4XRDA 4IJIA 4MF5A 4HOJA 2GSSA 2PBJA 3DYRA 5DDLA 3FY7A 1M9BA 1N8JA 1UA5A 4LL4B 1RW1A 1NHOA 1EV4A 4MZCA 2IL3A 4MLYA 5IMAA 3VWWA 1T1VA 3DIEA 1OVNA 2HRFA 1K0NA 1ACVA 1HD2A 2OADA 1XPVA 4YKFA 1VGLA 5ECQB 5IIZA 3PINA 4ILFA 3CRTA 3TKSC 3PH9A 2B1LA 3QFAC 4J56E 2VLVA 2DBCA 5CYYA 3J7Yb 2RUFA 4CY8A 2FGXA 2H30A 1YKAA 2KP2A 4KF9A 5CNWA 5HR0A 3GKXA 3GX8A 4F0BA 2H72A 4IP6A 5EPFA 4O92A 3GL5A 5BMUA 3L9VA 1E2YA 4XRAA 2V6KA 3KTLA 1CQHA 2H73A 2H01A 3WGDA 2CZ3A 4X43A 2H19A 2HSYA 4KX4A 1XWCA 4IBPA 3MNGA 1A8LA 3GURA 5JWRB 1O73A 1AQVA 1WPIA 3QD9A 4K7NA 1OAZA 4OCFA 2L57A 4TW5A 1MD4A 3GH9A 2FY6A 4IP1A 3TJGA 2P0GA 2HZEB 4GTUA 4KB3A 1PL2A 5J9CA 1HNAA 2E0QA 4GWRA 2B7KA 3RBTA 2LRTA 5DQYA 5J4UA 3F4SA 3ZRDA 3KP8A 5HR1A 2VIMA 1NHYA 3LORA 2K6VA 1TXXA 2LTKA 1R7HA 1GL8A 14GSA 2O89A 4QL9A 2X64A 3GRXA 3OR5A 11GSA 1RK4A 3EVIA 1GTAA 1N2AA 2RLIA 3A5IA 4ZB8A 3L4NA 2E2MA 3J7Yk 3TKRA 3SBCA 4K2DA 3P8WA 3WT2A 2B3SA 4DSSB 5ELGA 2GQMA 1XFLA 3M8NA 3DRNA 1YDKA 4G9HA 5HFIA 3H8QA 3U5RE 1SJ6A 5H5SA 3TOUA 2IMDA 4KAEA 1M2DA 1XXUA 2VLUA 4GLTA 1FVJA 3Q74A 2DIZA 2OKAA 5LNKe 5CREA 1EV9A 2JZSA 1BJXA 1BX9A 1TDIA 3UVHA 3DWVA 3VPTA 3F9UA 2WS2A 2NDOA 5FWGA 4ZILA 1EP8A 2LUSA 1UC7A 2K18A 5KOWA 1J08A 5JCUA 5J3RA 1V57A 3FZ9A 1GULA 2HSHA 4WKWA 2N5AA 3FR6A 2E7PA 4MP4A 1Z6MA 1GSYA 1QXHA 1OC8A 1R26A 1K0BA 3L78A 1ML6A 5DALB 1XVQA 1YF0A 2EIQA 4WF5A 1A2LA 2C80A 2IFQA 3D6IA 4IKHA 1H4OA 4NV2A 1XBSA 4HUAA 1AUCA 1T00A 2WFCA 3RDWA 4G0KA 2FWFA 2LS5A 1GSEA 2XPDA 4I2TA 2L5OA 1FAAA 2C0FA 4X0XA 1TU8A 1LJRA 5FT3A 4G10A 2MMNA 3IA1A 3H79A 1TOFA 3L9UA 1GLPA 1GSSA 1T4ZA 1OC9B 3US3A 2WRTA 3HY2A 3PPUA 2FWHA 1Q98A 3O6TA 1XCCA 1FB0A 4FYUA 4O5QA 1A2JA 4OO4A 1USBA 1SJZA 4OFMA 1X9WB 6GSSA 2OACA 4NHZA 4EO3A 2H71A 4ULXA 2VCZA 4HZ4A 1ERVA 3D4MA 1KBNA 1PN9A 2H1AA 2YNXA 4I5QA 4L5LA 3UMAA 1JLWA 1M9AA 4KDXA 3TKQA 3M9KA 2PGTA 2DIYA 1KTEA 2YJHA 3R2QA 1OKTA 3KTBA 3IDVA 2HSMA 4LLRA 3UL3A 4BVXB 2YWNA 4POLA 2YPMA 1DUGA 5CO3A 3CSHA 1FOHA 1R5PA 1ABAA 2NTOA 3KD0A 4NWYA 1X9SB 3EE2A 4MF7A 4WF4A 1XZOA 2CVDA 1TW9A 1JZOA 1KNGA 1G6YA 3BBYA 3EMXA 2FLSA 3F0IA 3TJJA 2CAIA 1ZYNA 3ISOA 5IM9A 5A5KA 3ZZXA 5HR3A 4JEDA 2CVKA 3EURA 2GSRA 4MF6A 3DVWA 1GUMA 2I3YA 2RM5A 1BEDA 3F4RA 4J2FA 3W6GA 1A8YA 2FCHA 4E8HA 1EEJA 4XS4B 4KH7A 2Z9SA 3D5JA 3MAKA 3N5OA 3QAWA 4ZB6A 3HDCA 2LSTA 5F8BA 3NZNA 2HLSA 3VI5A 1U6TA 2HZFA 2B5YA 2P5QA 2WCIA 1FVKA 3FRCA 1O85A 5F05A 4ISDA 3VWUA 4PNFA 4EC0A 2VCWA 2EC4A 1QQ2A 5IPGA 2V2GA 3H1NA 1SKSB 1PL1A 3R3EA 3DVXA 4GF0A 4F0CA 1FO5A 5KN0A 4IVFA 1ZMAA 1NM3A 4MZBA 4K1FA 3BCIA 3KJYA 3QAGA 4MCUA 4YQVA 4QQ7A 2KOKA 3JCML 1O6JA 2XC2A 4IJ3A 2N5FA 4EL1A 3A2VA 2A2RA 2C3QA 3VWVA 4G0IA 3IC4A 4XS1A 4XTSA 2CV4A 4FH8A 4F9ZA 1PN0A 3G7YA 1H75A 4TXVA 6GSUA 5DBQA 4MJBA 1SL2B 3ERGA 4KGIA 1VF1A 5DAKA 1V58A 3O76A 1XW9A 1ZL9A 3KZQA 3IK7A 1WIKA 1GNWA 4Z2TA 5GAND 4LMWA 4JRRA 3IAS2 2DLXA 1O8WA 3ZYWA 5G30A 4RQRA 1JZDA 4CY6A 4BL7B 4ZBBA 4KCEA 4K0GA 2BTOT 4HS1A 1DE2A 1GP1A 4JU5A 4PURA 2I9HA 2JADA 2YWIA 5KEJA 1AQXA 2GZZA 2VL2C 5ENUA 4RI7A 3LJRA 4ZB9A 3MDKA 1B4PA 2R0GA 4IS0A 2HI7A 2WULA 1M2BA 2YV9A 1PRXA 3GKNA 2R3XA 1F3BA 2IMEA 2HRKA 1IYHA 3WGXA 2LRCA 4MA9A 3A2XA 2PWJA 2LQQA 2MZCA 1QUWA 5KN2A 4GCIA 1T7PB 1K3LA 4PQHA 3ZMKA 2IPAA 2V6OA 2GSQA 1U3IA 2NVLA 3TRXA 2DKIA 4TN8A 3TOTA 1Q4JA 1WE0A 3HCZA 2C8UA 2OJLA 4Z7XA 3CTFA 3GUSA 2P31A 4N0VA 1M99A 3QPMA 4PUAA 1HQOA 4AJ7A 3SWLA 3HKRA 4DSQA 1EP7A 3TKSA 2MBSA 2FA4A 5EL8A 1GTIA 2GGTA 3LW9A 3D21A 3ME7A 3KH7A 1X9MB 3KMNA 4P3YB 2HFDA 4OMVA 2LJAA 2FD3A 3EMPA 2H1DA 4HEA2 1SKWB 3ZVJA 1HNCA 3HJOA 4RUVA 3G7IA 4MJCA 1XOAA 1HNBA 4IHUA 5AIXA 2YZUA 4FQUA 3I9V2 3GV1A 1LU4A 1PSQA 2GDRA 3G7JA 1AIUA 2YN1A 2WGRA 4N11A 3MYDA 1TRVA 2IMIA 2ZNMA 2FHEA 1SU9A 3VI7A 3D0ZA 4V2NA 4ICYA 2P5RA 3LQ7A 5D9WA 4O7HA 3GKKA 3ZTLA 3ZLPA 2H0HA 4TR1B 2BMXA 1MDIA 4PGTA 1F37A 2DMLA 2MMAA 2OBKA 2I1UA 2BJXA 3P2AA 2I81A 2RIIA 1EEMA 5D93A 3HZ8A 3VURA 4TOPA 3ZMLA 5IMCA 5AIVA 1TK0B 4Z2RA 2H0IA 3FMWA 2CA8A 3CYNA 1B48A 5CP1A 2R37A 3CXGA 6GSWA 1XOBA 1SD9A 3D22A 2CZ2A 3TKSE 1NSWA 2GQKA 4OD7A 1ERUA 2REMA 2VLTA 3FK8A 1K3YA 5KOXA 4TKYA 2FA8A 2I4AA 3UVTA 5C04A 4Q5NA 3C8EA 4NPBA 2FWEA 4G19A 1V2AA 6GSYA 4IN0A 2CX4A 1B8XA 4HJ2A 5FHIA 4MZWA 2LNTA 17GSA 3BCKA 3ED3A 1F6MC 2H6YA 1JFUA 4TR4A 3QFBC 4ECBA 1LBKA 2FWGA 2A2PA 1SK1A 1SYRA 4K0NA 19GSA 4FIWA 5F0GA 4BL7A 16GSA 2FNOA 2O8VB 3M0FA 3FEUA 4Q5QA 2H1BA 5F06A 4EUYA 4F03A 6GSXA 3FR3A 1TU7A 3FZ5A 3TRPA 1WWJA 4POKA 3DMLA 2HYXA 3M3MA 4WBJA 3GTUB 2V32A 1TRWA 4MH3A 2H6XA 3KGKA 3ZREA 2GSTA 1A0RP 5E59A 5AISA 1MD3A 1XW6A 2X8HA 2QA2A 3HZ4A 4ZL7A 1Z3EA 1PGTA 4ID0A 2VOCA 1U87A 3K8NA 3LXTA 4HJMA 5ECKB 4ZIJA 1YF1A 2B1KA 4PNGA 4ACSA 1G7OA 3IPZA 5CRHA 3CSJA 3LEFA 6GSTA 1YZXA 2YWMA 4TR0A 3NIVA 4EE0A 4ZL9A 5H5QA 1T8EB 4WETA 5D9TA 4ZBAA 3RPNA 4D73B 4KDUA 4KW6A 1TKDB 5JCWA 1AC1A 1XWKA 2K8VA 5ECOB 2D2ZA 2L6CA 3FW2A 3HD5A 4KDYA 1QGVA 1F3AA 4OFNA 3ZL5A 5ECIB 4PX1A 5HFKA 2YANA 1PX6A 2IN3A 2WB9A 3WGEA 3GSTA 1A24A 2J9HA 2AJQB 3IBHA 2HRAA 3F8UA 3QMXA 4TXOB 1XVWA 3EC3A 1SK2A 4G2EA 4MDCA 4GSNA 3E0UA 1R4WA 2YZHA 4MABA 1MDJA 4FYBA 3IXRA 4YQMA 1S3CA 3S9FA 3HXSA 4TR1A 2HZEA 3Q6OA 3TDGA 2H8LA 2GTUA 2QSIA 1R5AA 3CRUA 3C7MA 1J9BA 2GT5A 3FZAA 4TRXA 2H74A 1M2AA 1YKCA 3KM6A 3GNJA 3VPQA 5IO2A 1K0CA 1AW9A 3CMIA 4LA1A 5LD0A 1TK5B 4NXIA 2V1MA 1VF4A 3QDNA 3KCMA 4IQ1A 2TRCP 2YP6A 2IIYA 1SJIA 4YAPA 1ZOFA 3DXBA 3LXZA 2C3NA 4JR4A 3VLNA 2R2JA 2AYTA 4O32A 3RHCA 2JACA 3HVVA 3IV4A 3EPTA 4TVEA 4MPGA 4EIQA 4L0WA 1V40A 3G9BA 1EGRA 3TCOA 4PQ1A 4DSSA 4YH2A 1HYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OE7 A;  5C00 A;  3ERF A;  1W89 A;  3NOF A;  4HU9 A;  5EY6 A;  2VM1 A;  3BOA A;  2H76 A;  2ZUP A;  2PPT A;  2TRX A;  5G2Z A;  4MK3 A;  2LRN A;  2GLR A;  3KH9 A;  2FUG 2;  3M9J A;  4X1U A;  3IHQ A;  4MJA A;  8GSS A;  3IE3 A;  4MH2 A;  2O85 A;  1TRU A;  4BPY A;  5IOW A;  4XS6 A;  5A4U A;  2L59 A;  1A0F A;  3CTG A;  1ERT A;  2QKE A;  4I97 A;  2RM6 A;  1SL1 B;  2HNL A;  2C0D A;  2LNS A;  3BD2 A;  1GWC A;  2F51 A;  2JSZ A;  5E4W A;  5G5F A;  5J5N A;  5IQY A;  3GTU A;  5GSS A;  4BWS A;  1W4V A;  2H70 A;  1FB6 A;  2VO4 A;  3IOS A;  4BWQ A;  4HQS A;  1ZGN A;  5F07 A;  2GZY A;  3FZ4 A;  1ST9 A;  2EIR A;  3DKS A;  1A2M A;  4JBB A;  1GTB A;  3GX0 A;  3M1G A;  5JWQ B;  1O8X A;  3AY8 A;  2LV3 A;  5DAL A;  1K3O A;  2F8F A;  2KLX A;  1B9Y C;  1C72 A;  2H66 A;  4WR5 A;  1GNE A;  2PVO C;  5D73 A;  4AJ8 A;  3GN3 A;  1MTC A;  3VK9 A;  1ZYQ B;  2A2S A;  4ZL8 A;  1GTU A;  4IEL A;  4YQU A;  2H0G A;  3CBU A;  5IMZ A;  1AXD A;  1BAY A;  4I8B A;  1A23 A;  2LQO A;  1U3A A;  5GST A;  3O3T A;  5ECM B;  4AJ6 A;  4EDY A;  5INY A;  2GT6 A;  4KA0 A;  3L9S A;  2VL2 A;  1OC9 A;  1TK8 B;  2WZ9 A;  5B6N A;  1EOH A;  5HR2 A;  2AV4 A;  2MMO A;  5DJM A;  5LCZ A;  4JZQ A;  5D8I A;  2ON7 A;  4F2I A;  2VD0 A;  1ON4 A;  3F63 A;  4TXO A;  1OYJ A;  3IR4 A;  3HVX A;  4WXT A;  3A2W A;  2DJ3 A;  4N0Z A;  4WEY A;  2JZR A;  1T3B A;  2OE0 A;  2OE3 A;  4L0U A;  4EXJ A;  3ZFL A;  4BA7 A;  3ZVJ D;  1F2E A;  2JU5 A;  1G0T A;  4GXZ A;  2DJ1 A;  2O87 A;  4ZBD A;  3I6A A;  4ECJ A;  2B6M A;  2XPE A;  1VF2 A;  5DVB A;  4BVX A;  5CAX A;  2PMT A;  1THO A;  2WDU A;  5GZZ B;  1G7E A;  1BQ7 A;  20GS A;  1IYI A;  3H4K A;  3I69 A;  5A4V A;  2ZCT A;  4KCA A;  2VM2 A;  2KHP A;  1PMT A;  2YOI A;  1Z7P A;  1TI3 A;  4AGS A;  1NW2 A;  2M72 A;  2OA7 A;  3GHA A;  2CT6 A;  5ECS A;  2B7J A;  1PKZ A;  4L8E A;  1YJ6 A;  1YEP A;  1X5C A;  18GS A;  3C1R A;  2PUK C;  2IFQ B;  22GS A;  4HU7 A;  4K8M A;  1BYE A;  3GYK A;  2VCX A;  4ZXG A;  2B5E A;  3APS A;  4XS4 A;  2DSA A;  4HZ2 A;  1PQN A;  2HE3 A;  4HQZ A;  3MWH A;  2LJK A;  4K9Z A;  2N5B A;  1OE8 A;  3A5W A;  4N30 A;  4ML1 A;  1PA3 A;  3FYG A;  2O7K A;  1GH2 A;  2MBT A;  3LYK A;  3TRQ A;  1FOV A;  1SYX A;  3P90 A;  1XWB A;  2ON5 A;  2IJY A;  3QOU A;  1YY7 A;  2MYG A;  4E8E A;  4WBR D;  4EVM A;  3KXO A;  3FR9 A;  5ELA A;  2MMZ A;  1QMV A;  3HA9 A;  3LWA A;  1X5E A;  1VRS D;  3KIJ A;  5D9V A;  2M80 A;  4H86 A;  4XHM A;  1GSF A;  2IWT A;  3UBK A;  2J23 A;  2H1G A;  1KEB A;  2CQ9 A;  5HQP A;  4GSS A;  4V2M A;  1SKR B;  3UJ1 A;  3V1W A;  2VCQ A;  3LSZ A;  1EGO A;  2YJ7 A;  12GS A;  13GS A;  4NV5 A;  1PKW A;  2NBS A;  2YWO A;  3QR6 A;  4I6X A;  2QC7 A;  4KND A;  1J0F A;  5B8B A;  4MMM A;  3ERW A;  4JR6 A;  3UEM A;  3E3E A;  2F8A A;  3TKP A;  1ZYE A;  1E6B A;  1GSU A;  1DBY A;  3UIW A;  2AUV A;  3GIX A;  2XBI A;  2HXK A;  3GL3 A;  3EU4 A;  1WRY A;  3F3Q A;  3A3T A;  1ZCP A;  3HHV A;  3N9J A;  1Z6N A;  4NHW A;  3W8J A;  2PVQ A;  3GFK A;  1FW1 A;  3Q18 A;  4KUN A;  5DCG A;  1XWG A;  1YEX A;  2L6D A;  2LEG A;  5IMF A;  5GAP D;  1XWA A;  3VWX A;  2LKU A;  3ME8 A;  1O81 A;  1WMJ A;  1BG5 A;  2GZP A;  4IW9 A;  2QGV A;  5DJL A;  3F6F A;  5HFG A;  2C3T A;  2K8S A;  5JCG A;  1GUK A;  3QCP A;  1GLQ A;  2X8C A;  2R5G A;  1ILO A;  2F3M A;  1TJD A;  1PD2 1;  4HDE A;  1S3A A;  3VFI A;  3APQ A;  1O7U A;  4TR3 A;  5IO0 A;  1JZR A;  3BJ5 A;  1AQW A;  1PX7 A;  1T4Y A;  1UN2 A;  1TI1 A;  2C4J A;  3TUE A;  3DGQ A;  3Q19 A;  1FG4 A;  3ZIT A;  5IOX A;  4XIH A;  2JSY A;  4DSR A;  5ID2 B;  1MEK A;  2YV7 A;  4DVC A;  1XW5 A;  2CVB A;  1V9W A;  1UVZ A;  3TGZ A;  2CX3 A;  3GA4 A;  2M46 A;  1GSD A;  2GS3 A;  1TRS A;  1GSQ A;  1GRX A;  3MSZ A;  2DMM A;  4K6X A;  5CRD A;  5AN1 A;  5G1K A;  2VL3 A;  2DJ0 A;  3DEX A;  4N10 A;  3RHB A;  1FHE A;  1TP9 A;  5B7C A;  4MJE A;  4NAX A;  2V41 A;  1VF3 A;  2E2G A;  5DAK B;  3EU3 A;  2OBI A;  1XIY A;  1RQM A;  4Q5F A;  4EKZ A;  1GUH A;  4ECI A;  2KUC A;  3ZIJ A;  5G1L A;  6GSV A;  5COH A;  1Z9H A;  1CQG A;  4XCS A;  1I5G A;  2C1Y A;  4YAV A;  4CW9 A;  2GVP A;  2KP1 A;  1JHB A;  2TIR A;  1QK8 A;  4LL1 B;  4I2U A;  3WT1 A;  4GST A;  2L4Q A;  2GQL A;  7GSS A;  4PUF C;  4GRF A;  2PER A;  2X99 A;  3LGC A;  3IAM 2;  3PGT A;  2OE1 A;  3KMO A;  2AB6 A;  4DEJ A;  3HYP A;  4L5O A;  4Q5R A;  5KN3 A;  2RUE A;  3E9J B;  4WR4 A;  1DSB A;  2G2Q A;  2IMF A;  2JL4 A;  5A4W A;  1EWX A;  2R6K A;  2VUP A;  5IMV A;  4FO5 A;  5IMD A;  3C1S A;  3CSI A;  5CRW A;  2AAW A;  3HJP A;  2VD1 A;  3W8S A;  4FYC A;  1SEN A;  2NPB A;  2XBQ A;  4OCE A;  4PQI A;  2VL9 A;  1WOU A;  1YQ1 A;  2WJU A;  2XHF A;  3ZIV A;  5ECP B;  2HRN A;  1K0D A;  5ABR A;  1M7T A;  1B4Q A;  4RQX A;  2ALB A;  2ES7 A;  3IK9 A;  1S3D A;  5ECL B;  3APO A;  1QFN A;  3H93 A;  4F82 A;  5ECR B;  3GMF A;  3RPP A;  3UAR A;  3UBL A;  4V1A g;  1JZW A;  5G31 A;  3UOM A;  3FKF A;  4AF2 A;  3TJK A;  10GS A;  5L71 A;  5KN1 A;  3I43 A;  3EWL A;  3WD6 A;  2CAQ A;  2K9F A;  4GQF A;  4V2L A;  4NMU A;  4KSO A;  1X5D A;  2PU9 C;  3P7X A;  1WP0 A;  1K0O A;  4EF0 A;  3TJF A;  4HI7 A;  3HVS A;  5IPH A;  4KE3 A;  2B5X A;  4BVY A;  4CHS A;  1SL0 B;  1THX A;  1G6W A;  5B6M A;  3ZFB A;  2X8G A;  2AHE A;  3F6D A;  2DJ2 A;  3LYP A;  3U6V A;  5J41 A;  4ML6 A;  2YCD A;  1U88 A;  2DC5 A;  3HJM A;  1SK0 A;  2R4V A;  2F9S A;  4MPF A;  5ID2 A;  3F3R A;  3FHK A;  3EIN A;  2LJR A;  3TJB A;  5D96 A;  1Y6E A;  3KP9 A;  1SD8 A;  4OWY A;  4IGJ A;  3TB2 A;  4PXO A;  5G5E A;  4POM A;  5DQS A;  4IQA A;  1JLV A;  3D4T A;  3DD3 A;  3PR8 A;  2HT9 A;  4D73 A;  1DE1 A;  1OKD A;  5B8A A;  4JE1 A;  2C0G A;  3LG6 A;  1Z7R A;  1AAZ A;  1EZK A;  4ECC A;  3C73 A;  2VCV A;  3QAV A;  1ZZY A;  9GSS A;  4OO5 A;  2JZT A;  4EDZ A;  5J9B A;  5EVO A;  4POB A;  3IRA A;  1Y25 A;  3UAP A;  4LMV A;  4K7I A;  1EOG A;  4CDO A;  2DJK A;  4GQC A;  3GKM A;  1F9M A;  5JWO B;  2L4C A;  1X0R A;  3GSS A;  4OFT A;  2C0E A;  1OC3 A;  5H5R A;  5D9X A;  4V1A p;  3KEB A;  1I9D A;  3WYW A;  2VAF A;  4O5R A;  3RAZ A;  5ECH B;  4K7O A;  1B9X C;  5ECN B;  3GH6 A;  1TTZ A;  5CRG A;  4QL7 A;  5AGY A;  1V98 A;  1K0M A;  1ERW A;  2L5L A;  1Z5Y E;  3LFL A;  2A4V A;  1K0A A;  1MDK A;  1URM A;  4RI6 A;  5DCH A;  2IMK A;  3C71 A;  3F4T A;  4KSM A;  2DJJ A;  1M0U A;  2H6Z A;  4J57 E;  2H75 A;  3EYT A;  1WJK A;  2G0F A;  3L0H A;  2EIO A;  2VCT A;  2PN8 A;  4XRD A;  4IJI A;  4MF5 A;  4HOJ A;  2GSS A;  2PBJ A;  3DYR A;  5DDL A;  3FY7 A;  1M9B A;  1N8J A;  1UA5 A;  4LL4 B;  1RW1 A;  1NHO A;  1EV4 A;  4MZC A;  2IL3 A;  4MLY A;  5IMA A;  3VWW A;  1T1V A;  3DIE A;  1OVN A;  2HRF A;  1K0N A;  1ACV A;  1HD2 A;  2OAD A;  1XPV A;  1VGL A;  5ECQ B;  5IIZ A;  3PIN A;  4ILF A;  3CRT A;  3TKS C;  3PH9 A;  2B1L A;  3QFA C;  4J56 E;  2VLV A;  2DBC A;  5CYY A;  3J7Y b;  2RUF A;  2FGX A;  2H30 A;  1YKA A;  2KP2 A;  5CNW A;  5HR0 A;  3GKX A;  3GX8 A;  4F0B A;  2H72 A;  4IP6 A;  5EPF A;  4O92 A;  3GL5 A;  3L9V A;  1E2Y A;  4XRA A;  2V6K A;  3KTL A;  1CQH A;  2H73 A;  2H01 A;  3WGD A;  2CZ3 A;  4X43 A;  2H19 A;  2HSY A;  4KX4 A;  1XWC A;  4IBP A;  3MNG A;  1A8L A;  3GUR A;  5JWR B;  1O73 A;  1AQV A;  1WPI A;  3QD9 A;  4K7N A;  1OAZ A;  4OCF A;  2L57 A;  4TW5 A;  1MD4 A;  3GH9 A;  2FY6 A;  4IP1 A;  3TJG A;  2P0G A;  2HZE B;  4GTU A;  4KB3 A;  1PL2 A;  5J9C A;  1HNA A;  2E0Q A;  4GWR A;  2B7K A;  3RBT A;  2LRT A;  5DQY A;  5J4U A;  3F4S A;  3ZRD A;  3KP8 A;  5HR1 A;  2VIM A;  1NHY A;  3LOR A;  2K6V A;  1TXX A;  2LTK A;  1R7H A;  1GL8 A;  14GS A;  2O89 A;  4QL9 A;  2X64 A;  3GRX A;  3OR5 A;  11GS A;  1RK4 A;  3EVI A;  1GTA A;  1N2A A;  2RLI A;  4ZB8 A;  3L4N A;  2E2M A;  3J7Y k;  3TKR A;  3SBC A;  4K2D A;  3P8W A;  3WT2 A;  2B3S A;  4DSS B;  5ELG A;  2GQM A;  1XFL A;  3M8N A;  3DRN A;  1YDK A;  4G9H A;  5HFI A;  3H8Q A;  3U5R E;  1SJ6 A;  5H5S A;  3TOU A;  2IMD A;  4KAE A;  1M2D A;  1XXU A;  2VLU A;  4GLT A;  1FVJ A;  3Q74 A;  2DIZ A;  2OKA A;  5LNK e;  5CRE A;  1EV9 A;  2JZS A;  1BJX A;  1BX9 A;  1TDI A;  3UVH A;  3DWV A;  3VPT A;  3F9U A;  2WS2 A;  2NDO A;  5FWG A;  4ZIL A;  1EP8 A;  2LUS A;  1UC7 A;  2K18 A;  1J08 A;  5JCU A;  5J3R A;  1V57 A;  3FZ9 A;  1GUL A;  2HSH A;  4WKW A;  2N5A A;  3FR6 A;  2E7P A;  4MP4 A;  1Z6M A;  1GSY A;  1QXH A;  1OC8 A;  1R26 A;  1K0B A;  3L78 A;  1ML6 A;  5DAL B;  1XVQ A;  1YF0 A;  2EIQ A;  4WF5 A;  1A2L A;  2C80 A;  2IFQ A;  3D6I A;  4IKH A;  1H4O A;  4NV2 A;  1XBS A;  4HUA A;  1AUC A;  1T00 A;  2WFC A;  3RDW A;  2FWF A;  2LS5 A;  1GSE A;  2XPD A;  4I2T A;  2L5O A;  1FAA A;  2C0F A;  4X0X A;  1TU8 A;  1LJR A;  5FT3 A;  4G10 A;  2MMN A;  3IA1 A;  3H79 A;  1TOF A;  3L9U A;  1GLP A;  1GSS A;  1T4Z A;  1OC9 B;  3US3 A;  2WRT A;  3HY2 A;  2FWH A;  1Q98 A;  3O6T A;  1XCC A;  1FB0 A;  4FYU A;  1A2J A;  4OO4 A;  1USB A;  1SJZ A;  4OFM A;  1X9W B;  6GSS A;  2OAC A;  4NHZ A;  4EO3 A;  2H71 A;  4ULX A;  2VCZ A;  4HZ4 A;  1ERV A;  3D4M A;  1KBN A;  1PN9 A;  2H1A A;  2YNX A;  4I5Q A;  4L5L A;  3UMA A;  1JLW A;  1M9A A;  4KDX A;  3TKQ A;  3M9K A;  2PGT A;  2DIY A;  1KTE A;  2YJH A;  3R2Q A;  1OKT A;  3KTB A;  3IDV A;  4LLR A;  3UL3 A;  2YWN A;  4POL A;  2YPM A;  1DUG A;  5CO3 A;  3CSH A;  1R5P A;  1ABA A;  2NTO A;  3KD0 A;  4NWY A;  1X9S B;  3EE2 A;  4MF7 A;  4WF4 A;  1XZO A;  2CVD A;  1TW9 A;  1JZO A;  1KNG A;  1G6Y A;  3BBY A;  3EMX A;  2FLS A;  3F0I A;  3TJJ A;  2CAI A;  3ISO A;  5IM9 A;  5A5K A;  3ZZX A;  5HR3 A;  4JED A;  2CVK A;  3EUR A;  2GSR A;  4MF6 A;  3DVW A;  1GUM A;  2I3Y A;  2RM5 A;  1BED A;  3F4R A;  4J2F A;  3W6G A;  1A8Y A;  2FCH A;  4E8H A;  1EEJ A;  4XS4 B;  4KH7 A;  2Z9S A;  3D5J A;  3MAK A;  3N5O A;  3QAW A;  4ZB6 A;  3HDC A;  2LST A;  5F8B A;  3NZN A;  2HLS A;  3VI5 A;  1U6T A;  2HZF A;  2B5Y A;  2P5Q A;  2WCI A;  1FVK A;  3FRC A;  1O85 A;  5F05 A;  4ISD A;  3VWU A;  4PNF A;  4EC0 A;  2VCW A;  2EC4 A;  1QQ2 A;  5IPG A;  2V2G A;  3H1N A;  1SKS B;  1PL1 A;  3DVX A;  4GF0 A;  4F0C A;  1FO5 A;  5KN0 A;  4IVF A;  1ZMA A;  1NM3 A;  4MZB A;  4K1F A;  3BCI A;  3KJY A;  3QAG A;  4MCU A;  4YQV A;  4QQ7 A;  2KOK A;  3JCM L;  1O6J A;  2XC2 A;  4IJ3 A;  2N5F A;  4EL1 A;  3A2V A;  2A2R A;  2C3Q A;  3VWV A;  3IC4 A;  4XS1 A;  4XTS A;  2CV4 A;  4FH8 A;  4F9Z A;  3G7Y A;  1H75 A;  4TXV A;  6GSU A;  5DBQ A;  4MJB A;  1SL2 B;  3ERG A;  4KGI A;  1VF1 A;  5DAK A;  1V58 A;  3O76 A;  1XW9 A;  1ZL9 A;  3KZQ A;  3IK7 A;  1WIK A;  1GNW A;  5GAN D;  4LMW A;  4JRR A;  3IAS 2;  2DLX A;  1O8W A;  3ZYW A;  5G30 A;  4RQR A;  1JZD A;  4ZBB A;  4KCE A;  4K0G A;  2BTO T;  4HS1 A;  1DE2 A;  1GP1 A;  4JU5 A;  4PUR A;  2I9H A;  2JAD A;  2YWI A;  5KEJ A;  1AQX A;  2GZZ A;  2VL2 C;  5ENU A;  4RI7 A;  3LJR A;  4ZB9 A;  3MDK A;  1B4P A;  4IS0 A;  2HI7 A;  2WUL A;  1M2B A;  2YV9 A;  1PRX A;  3GKN A;  2R3X A;  1F3B A;  2IME A;  1IYH A;  3WGX A;  2LRC A;  4MA9 A;  3A2X A;  2PWJ A;  2LQQ A;  2MZC A;  1QUW A;  5KN2 A;  4GCI A;  1T7P B;  1K3L A;  4PQH A;  3ZMK A;  2IPA A;  2V6O A;  2GSQ A;  1U3I A;  2NVL A;  3TRX A;  4TN8 A;  3TOT A;  1Q4J A;  1WE0 A;  3HCZ A;  2C8U A;  2OJL A;  4Z7X A;  3CTF A;  3GUS A;  2P31 A;  4N0V A;  1M99 A;  3QPM A;  4PUA A;  1HQO A;  4AJ7 A;  3SWL A;  3HKR A;  4DSQ A;  1EP7 A;  3TKS A;  2MBS A;  2FA4 A;  5EL8 A;  1GTI A;  2GGT A;  3D21 A;  3ME7 A;  3KH7 A;  1X9M B;  3KMN A;  4P3Y B;  2HFD A;  4OMV A;  2LJA A;  2FD3 A;  3EMP A;  2H1D A;  4HEA 2;  1SKW B;  3ZVJ A;  1HNC A;  3HJO A;  4RUV A;  3G7I A;  4MJC A;  1XOA A;  1HNB A;  4IHU A;  5AIX A;  2YZU A;  3I9V 2;  3GV1 A;  1LU4 A;  1PSQ A;  2GDR A;  3G7J A;  1AIU A;  2YN1 A;  2WGR A;  4N11 A;  1TRV A;  2IMI A;  2ZNM A;  2FHE A;  1SU9 A;  3VI7 A;  3D0Z A;  4V2N A;  2P5R A;  3LQ7 A;  5D9W A;  4O7H A;  3GKK A;  3ZTL A;  3ZLP A;  2H0H A;  4TR1 B;  2BMX A;  1MDI A;  4PGT A;  1F37 A;  2DML A;  2MMA A;  2OBK A;  2I1U A;  2BJX A;  3P2A A;  2I81 A;  2RII A;  1EEM A;  5D93 A;  3HZ8 A;  3VUR A;  4TOP A;  3ZML A;  5IMC A;  5AIV A;  1TK0 B;  2H0I A;  2CA8 A;  3CYN A;  1B48 A;  5CP1 A;  2R37 A;  3CXG A;  6GSW A;  1XOB A;  1SD9 A;  3D22 A;  2CZ2 A;  3TKS E;  1NSW A;  2GQK A;  4OD7 A;  1ERU A;  2REM A;  2VLT A;  3FK8 A;  1K3Y A;  4TKY A;  2FA8 A;  2I4A A;  3UVT A;  5C04 A;  4Q5N A;  3C8E A;  4NPB A;  2FWE A;  4G19 A;  1V2A A;  6GSY A;  4IN0 A;  2CX4 A;  1B8X A;  4HJ2 A;  5FHI A;  4MZW A;  2LNT A;  17GS A;  3BCK A;  3ED3 A;  1F6M C;  2H6Y A;  1JFU A;  4TR4 A;  3QFB C;  4ECB A;  1LBK A;  2FWG A;  1SK1 A;  1SYR A;  4K0N A;  19GS A;  4FIW A;  5F0G A;  4BL7 A;  16GS A;  2FNO A;  2O8V B;  3M0F A;  3FEU A;  4Q5Q A;  2H1B A;  5F06 A;  4EUY A;  4F03 A;  6GSX A;  3FR3 A;  1TU7 A;  3FZ5 A;  3TRP A;  1WWJ A;  4POK A;  3DML A;  2HYX A;  3M3M A;  4WBJ A;  3GTU B;  2V32 A;  1TRW A;  4MH3 A;  2H6X A;  3KGK A;  3ZRE A;  2GST A;  1A0R P;  5E59 A;  5AIS A;  1MD3 A;  1XW6 A;  2X8H A;  3HZ4 A;  4ZL7 A;  1Z3E A;  1PGT A;  4ID0 A;  2VOC A;  1U87 A;  3K8N A;  3LXT A;  4HJM A;  5ECK B;  4ZIJ A;  1YF1 A;  2B1K A;  4PNG A;  4ACS A;  1G7O A;  3IPZ A;  5CRH A;  3CSJ A;  3LEF A;  6GST A;  1YZX A;  2YWM A;  4TR0 A;  3NIV A;  4EE0 A;  4ZL9 A;  5H5Q A;  1T8E B;  4WET A;  5D9T A;  4ZBA A;  3RPN A;  4D73 B;  4KDU A;  4KW6 A;  1TKD B;  5JCW A;  1AC1 A;  1XWK A;  2K8V A;  5ECO B;  2D2Z A;  2L6C A;  3FW2 A;  3HD5 A;  4KDY A;  1QGV A;  1F3A A;  4OFN A;  3ZL5 A;  5ECI B;  4PX1 A;  5HFK A;  2YAN A;  1PX6 A;  2IN3 A;  2WB9 A;  3WGE A;  3GST A;  1A24 A;  2J9H A;  2AJQ B;  3IBH A;  3F8U A;  3QMX A;  4TXO B;  1XVW A;  3EC3 A;  1SK2 A;  4G2E A;  4MDC A;  4GSN A;  3E0U A;  1R4W A;  2YZH A;  4MAB A;  1MDJ A;  4FYB A;  3IXR A;  4YQM A;  1S3C A;  3S9F A;  3HXS A;  4TR1 A;  2HZE A;  3Q6O A;  3TDG A;  2H8L A;  2GTU A;  2QSI A;  1R5A A;  3CRU A;  3C7M A;  1J9B A;  2GT5 A;  3FZA A;  4TRX A;  2H74 A;  1M2A A;  1YKC A;  3KM6 A;  3GNJ A;  3VPQ A;  5IO2 A;  1K0C A;  1AW9 A;  3CMI A;  4LA1 A;  5LD0 A;  1TK5 B;  4NXI A;  2V1M A;  1VF4 A;  3QDN A;  3KCM A;  4IQ1 A;  2TRC P;  2YP6 A;  2IIY A;  1SJI A;  4YAP A;  1ZOF A;  3DXB A;  3LXZ A;  2C3N A;  4JR4 A;  3VLN A;  2R2J A;  2AYT A;  4O32 A;  3RHC A;  2JAC A;  3HVV A;  3IV4 A;  4TVE A;  4MPG A;  4L0W A;  1V40 A;  3G9B A;  1EGR A;  3TCO A;  4PQ1 A;  4DSS A;  4YH2 A;  1HYU A; 
#chains in the Genus database with same CATH topology
 1OE7 A;  5C00 A;  3ERF A;  1W89 A;  3NOF A;  4HU9 A;  5EY6 A;  2VM1 A;  3BOA A;  2H76 A;  2ZUP A;  2PPT A;  2TRX A;  5G2Z A;  4MK3 A;  2LRN A;  2GLR A;  3KH9 A;  2FUG 2;  3M9J A;  4X1U A;  3IHQ A;  4MJA A;  8GSS A;  3IE3 A;  4MH2 A;  2O85 A;  1TRU A;  4BPY A;  2DKH A;  5IOW A;  4XS6 A;  5A4U A;  2L59 A;  1A0F A;  3CTG A;  1ERT A;  2QKE A;  3IC8 A;  1PFO A;  4I97 A;  2RM6 A;  1SL1 B;  2HNL A;  2C0D A;  2LNS A;  3BD2 A;  1GWC A;  2F51 A;  2JSZ A;  5E4W A;  5G5F A;  5J5N A;  5IQY A;  3GTU A;  5GSS A;  4BWS A;  1W4V A;  2H70 A;  1FB6 A;  2VO4 A;  3IOS A;  4BWQ A;  4HQS A;  1ZGN A;  5F07 A;  2GZY A;  3FZ4 A;  1ST9 A;  2EIR A;  3DKS A;  1A2M A;  4JBB A;  1GTB A;  3GX0 A;  3M1G A;  5JWQ B;  1O8X A;  3AY8 A;  2LV3 A;  5DAL A;  1K3O A;  2F8F A;  2KLX A;  1B9Y C;  1C72 A;  2H66 A;  4WR5 A;  1GNE A;  2PVO C;  5D73 A;  4AJ8 A;  3GN3 A;  1MTC A;  3VK9 A;  1ZYQ B;  2A2S A;  4ZL8 A;  1GTU A;  4IEL A;  4YQU A;  2H0G A;  3CBU A;  5IMZ A;  1AXD A;  1BAY A;  4I8B A;  1A23 A;  2LQO A;  1U3A A;  5GST A;  3O3T A;  5ECM B;  4AJ6 A;  4EDY A;  5INY A;  2GT6 A;  4KA0 A;  3L9S A;  2VL2 A;  1OC9 A;  1TK8 B;  2WZ9 A;  5B6N A;  1EOH A;  5HR2 A;  2AV4 A;  2MMO A;  5DJM A;  5LCZ A;  4JZQ A;  5D8I A;  2ON7 A;  4F2I A;  2VD0 A;  1ON4 A;  3F63 A;  4TXO A;  1OYJ A;  3IR4 A;  3HVX A;  4WXT A;  3A2W A;  2DJ3 A;  4N0Z A;  4WEY A;  2JZR A;  1T3B A;  2OE0 A;  2OE3 A;  4L0U A;  4EXJ A;  3ZFL A;  4BA7 A;  3ZVJ D;  1F2E A;  2JU5 A;  1G0T A;  4GXZ A;  2DJ1 A;  2O87 A;  4ZBD A;  3I6A A;  4ECJ A;  2B6M A;  2XPE A;  1VF2 A;  5DVB A;  4BVX A;  5CAX A;  2PMT A;  1THO A;  2WDU A;  5GZZ B;  1G7E A;  1BQ7 A;  20GS A;  1IYI A;  3H4K A;  3I69 A;  5A4V A;  2ZCT A;  4KCA A;  2VM2 A;  2KHP A;  1PMT A;  2YOI A;  1Z7P A;  1TI3 A;  4AGS A;  1NW2 A;  2M72 A;  2OA7 A;  3GHA A;  4K2X A;  2CT6 A;  5ECS A;  2B7J A;  1PKZ A;  4L8E A;  1YJ6 A;  1YEP A;  1X5C A;  18GS A;  3C1R A;  2PUK C;  2IFQ B;  22GS A;  4HU7 A;  4K8M A;  1BYE A;  3GYK A;  2VCX A;  4ZXG A;  2B5E A;  3APS A;  4XS4 A;  2DSA A;  4HZ2 A;  1PQN A;  2HE3 A;  4HQZ A;  3MWH A;  2LJK A;  4K9Z A;  2N5B A;  1OE8 A;  3A5W A;  4N30 A;  4HSC X;  4ML1 A;  1PA3 A;  3FYG A;  2O7K A;  1GH2 A;  2MBT A;  3LYK A;  3TRQ A;  3MIX A;  1FOV A;  1SYX A;  3P90 A;  1XWB A;  2ON5 A;  2IJY A;  3QOU A;  1YY7 A;  2MYG A;  4E8E A;  4WBR D;  4EVM A;  3KXO A;  3FR9 A;  5ELA A;  2MMZ A;  1QMV A;  3HA9 A;  3LWA A;  1X5E A;  1VRS D;  3KIJ A;  5D9V A;  2M80 A;  4H86 A;  4XHM A;  1GSF A;  2IWT A;  3UBK A;  2J23 A;  2H1G A;  1KEB A;  2CQ9 A;  5HQP A;  4GSS A;  4V2M A;  1SKR B;  3UJ1 A;  3V1W A;  2VCQ A;  3LSZ A;  1EGO A;  2YJ7 A;  12GS A;  13GS A;  4NV5 A;  1PKW A;  2NBS A;  2YWO A;  3QR6 A;  4I6X A;  2QC7 A;  4KND A;  1J0F A;  5B8B A;  4MMM A;  3ERW A;  4JR6 A;  3UEM A;  3E3E A;  2F8A A;  3TKP A;  1ZYE A;  1E6B A;  1GSU A;  1DBY A;  3UIW A;  4G0L A;  2AUV A;  3GIX A;  2XBI A;  2HXK A;  3GL3 A;  3EU4 A;  1WRY A;  3F3Q A;  3A3T A;  1ZCP A;  2A4H A;  3HHV A;  3N9J A;  1Z6N A;  4NHW A;  3W8J A;  2PVQ A;  3GFK A;  1FW1 A;  3Q18 A;  4KUN A;  5DCG A;  1XWG A;  1YEX A;  2L6D A;  2LEG A;  5IMF A;  5GAP D;  4MNN A;  1XWA A;  3VWX A;  2LKU A;  3ME8 A;  1O81 A;  1WMJ A;  1BG5 A;  2GZP A;  4IW9 A;  2QGV A;  5DJL A;  3F6F A;  5HFG A;  2C3T A;  2K8S A;  4O5U A;  1GUK A;  3QCP A;  5JCG A;  1GLQ A;  2X8C A;  2R5G A;  1ILO A;  2F3M A;  1TJD A;  1PD2 1;  4HDE A;  1S3A A;  3VFI A;  3APQ A;  4BVY B;  1O7U A;  4TR3 A;  5IO0 A;  1JZR A;  3BJ5 A;  1AQW A;  1PX7 A;  1T4Y A;  1UN2 A;  1TI1 A;  2C4J A;  3TUE A;  3DGQ A;  3Q19 A;  1FG4 A;  3ZIT A;  5IOX A;  4XIH A;  2JSY A;  4DSR A;  5ID2 B;  1MEK A;  2YV7 A;  4DVC A;  1XW5 A;  2CVB A;  1V9W A;  1UVZ A;  3TGZ A;  2CX3 A;  3GA4 A;  2R0P A;  2M46 A;  1GSD A;  4YKG A;  4K5R A;  2GS3 A;  1TRS A;  1GSQ A;  1GRX A;  3MSZ A;  2DMM A;  2QA1 A;  4K6X A;  5CRD A;  5AN1 A;  5G1K A;  2VL3 A;  2DJ0 A;  3DEX A;  4N10 A;  3RHB A;  1FHE A;  1TP9 A;  5B7C A;  4MJE A;  4NAX A;  5BRT A;  2V41 A;  1VF3 A;  2E2G A;  4USS A;  5DAK B;  3EU3 A;  2OBI A;  1XIY A;  1RQM A;  4Q5F A;  4EKZ A;  1GUH A;  4ECI A;  2KUC A;  3ZIJ A;  5G1L A;  6GSV A;  5COH A;  1Z9H A;  1CQG A;  4XCS A;  1I5G A;  2C1Y A;  4YAV A;  4CW9 A;  2GVP A;  2KP1 A;  1JHB A;  2TIR A;  1QK8 A;  4LL1 B;  4I2U A;  3WT1 A;  4GST A;  2L4Q A;  2GQL A;  7GSS A;  4PUF C;  4GRF A;  2PER A;  2X4A A;  2X99 A;  3LGC A;  4K5S A;  3IAM 2;  3PGT A;  2OE1 A;  3KMO A;  2AB6 A;  4DEJ A;  3HYP A;  4L5O A;  4Q5R A;  5KN3 A;  2RUE A;  3E9J B;  4WR4 A;  1DSB A;  2G2Q A;  1ZYP A;  2IMF A;  2JL4 A;  5A4W A;  1EWX A;  2R6K A;  2VUP A;  5IMV A;  4FO5 A;  5IMD A;  3C1S A;  3CSI A;  5CRW A;  2AAW A;  3HJP A;  2VD1 A;  3W8S A;  4FYC A;  1SEN A;  2NPB A;  2XBQ A;  4OCE A;  4PQI A;  2VL9 A;  1WOU A;  1YQ1 A;  2WJU A;  2XHF A;  3ZIV A;  5ECP B;  2HRN A;  1K0D A;  5ABR A;  1M7T A;  1B4Q A;  4RQX A;  2ALB A;  2ES7 A;  3IK9 A;  1S3D A;  5ECL B;  3APO A;  1QFN A;  3H93 A;  4F82 A;  5ECR B;  3GMF A;  3RPP A;  3UAR A;  3UBL A;  4V1A g;  1JZW A;  5G31 A;  3UOM A;  3FKF A;  4AF2 A;  3TJK A;  10GS A;  5L71 A;  5KN1 A;  3I43 A;  3EWL A;  3WD6 A;  2CAQ A;  2K9F A;  4V2L A;  4GQF A;  3IHG A;  4NMU A;  4KSO A;  1X5D A;  2PU9 C;  1M3J A;  3P7X A;  1WP0 A;  1K0O A;  4EF0 A;  3TJF A;  4HI7 A;  3HVS A;  5IPH A;  4KE3 A;  2B5X A;  4BVY A;  4CHS A;  1SL0 B;  1THX A;  1G6W A;  5B6M A;  3ZFB A;  2X8G A;  2AHE A;  3F6D A;  2DJ2 A;  3LYP A;  3U6V A;  5J41 A;  4ML6 A;  2YCD A;  1U88 A;  2DC5 A;  3HJM A;  1SK0 A;  2R4V A;  2F9S A;  4MPF A;  5ID2 A;  3F3R A;  3FHK A;  4PTS A;  3EIN A;  2LJR A;  3TJB A;  5D96 A;  1Y6E A;  3KP9 A;  1SD8 A;  4OWY A;  4IGJ A;  3TB2 A;  4PXO A;  5G5E A;  4POM A;  5DQS A;  4IQA A;  1JLV A;  3D4T A;  3DD3 A;  3PR8 A;  2HT9 A;  4D73 A;  1DE1 A;  2UZ8 A;  1OKD A;  5B8A A;  4JE1 A;  4Z2U A;  4X4J A;  1XG8 A;  2C0G A;  3LG6 A;  1Z7R A;  1AAZ A;  1EZK A;  4ECC A;  3C73 A;  2VCV A;  3QAV A;  1ZZY A;  9GSS A;  4OO5 A;  2JZT A;  4EDZ A;  5J9B A;  5EVO A;  4POB A;  3IRA A;  4EIP A;  1Y25 A;  3UAP A;  4LMV A;  4K7I A;  4A5P A;  1EOG A;  4CDO A;  2DJK A;  4GQC A;  3GKM A;  1F9M A;  5JWO B;  2L4C A;  1X0R A;  3GSS A;  4OFT A;  2C0E A;  1OC3 A;  5H5R A;  5D9X A;  4V1A p;  3KEB A;  1I9D A;  3WYW A;  2VAF A;  4O5R A;  3RAZ A;  5ECH B;  4K7O A;  2R0C A;  1B9X C;  5ECN B;  3GH6 A;  1TTZ A;  5CRG A;  4QL7 A;  5AGY A;  1V98 A;  1K0M A;  1ERW A;  2L5L A;  1Z5Y E;  3LFL A;  2A4V A;  1K0A A;  1MDK A;  1URM A;  4RI6 A;  5DCH A;  2IMK A;  3C71 A;  3F4T A;  4KSM A;  2DJJ A;  1M0U A;  2H6Z A;  4J57 E;  2H75 A;  3EYT A;  1WJK A;  2X49 A;  2G0F A;  3L0H A;  2EIO A;  2VCT A;  2PN8 A;  4XRD A;  4IJI A;  4MF5 A;  4HOJ A;  2GSS A;  2PBJ A;  3DYR A;  5DDL A;  3FY7 A;  1M9B A;  1N8J A;  1UA5 A;  4LL4 B;  1RW1 A;  1NHO A;  1EV4 A;  4MZC A;  2IL3 A;  4MLY A;  5IMA A;  3VWW A;  1T1V A;  3DIE A;  1OVN A;  2HRF A;  1K0N A;  1ACV A;  1HD2 A;  2OAD A;  1XPV A;  4YKF A;  1VGL A;  5ECQ B;  5IIZ A;  3PIN A;  4ILF A;  3CRT A;  3TKS C;  3PH9 A;  2B1L A;  3QFA C;  4J56 E;  2VLV A;  2DBC A;  5CYY A;  3J7Y b;  2RUF A;  4CY8 A;  2FGX A;  2H30 A;  1YKA A;  2KP2 A;  4KF9 A;  5CNW A;  5HR0 A;  3GKX A;  3GX8 A;  4F0B A;  2H72 A;  4IP6 A;  5EPF A;  4O92 A;  3GL5 A;  5BMU A;  3L9V A;  1E2Y A;  4XRA A;  2V6K A;  3KTL A;  1CQH A;  2H73 A;  2H01 A;  3WGD A;  2CZ3 A;  4X43 A;  2H19 A;  2HSY A;  4KX4 A;  1XWC A;  4IBP A;  3MNG A;  1A8L A;  3GUR A;  5JWR B;  1O73 A;  1AQV A;  1WPI A;  3QD9 A;  4K7N A;  1OAZ A;  4OCF A;  2L57 A;  4TW5 A;  1MD4 A;  3GH9 A;  2FY6 A;  4IP1 A;  3TJG A;  2P0G A;  2HZE B;  4GTU A;  4KB3 A;  1PL2 A;  5J9C A;  1HNA A;  2E0Q A;  4GWR A;  2B7K A;  3RBT A;  2LRT A;  5DQY A;  5J4U A;  3F4S A;  3ZRD A;  3KP8 A;  5HR1 A;  2VIM A;  1NHY A;  3LOR A;  2K6V A;  1TXX A;  2LTK A;  1R7H A;  1GL8 A;  14GS A;  2O89 A;  4QL9 A;  2X64 A;  3GRX A;  3OR5 A;  11GS A;  1RK4 A;  3EVI A;  1GTA A;  1N2A A;  2RLI A;  3A5I A;  4ZB8 A;  3L4N A;  2E2M A;  3J7Y k;  3TKR A;  3SBC A;  4K2D A;  3P8W A;  3WT2 A;  2B3S A;  4DSS B;  5ELG A;  2GQM A;  1XFL A;  3M8N A;  3DRN A;  1YDK A;  4G9H A;  5HFI A;  3H8Q A;  3U5R E;  1SJ6 A;  5H5S A;  3TOU A;  2IMD A;  4KAE A;  1M2D A;  1XXU A;  2VLU A;  4GLT A;  1FVJ A;  3Q74 A;  2DIZ A;  2OKA A;  5LNK e;  5CRE A;  1EV9 A;  2JZS A;  1BJX A;  1BX9 A;  1TDI A;  3UVH A;  3DWV A;  3VPT A;  3F9U A;  2WS2 A;  2NDO A;  5FWG A;  4ZIL A;  1EP8 A;  2LUS A;  1UC7 A;  2K18 A;  5KOW A;  1J08 A;  5JCU A;  5J3R A;  1V57 A;  3FZ9 A;  1GUL A;  2HSH A;  4WKW A;  2N5A A;  3FR6 A;  2E7P A;  4MP4 A;  1Z6M A;  1GSY A;  1QXH A;  1OC8 A;  1R26 A;  1K0B A;  3L78 A;  1ML6 A;  5DAL B;  1XVQ A;  1YF0 A;  2EIQ A;  4WF5 A;  1A2L A;  2C80 A;  2IFQ A;  3D6I A;  4IKH A;  1H4O A;  4NV2 A;  1XBS A;  4HUA A;  1AUC A;  1T00 A;  2WFC A;  3RDW A;  4G0K A;  2FWF A;  2LS5 A;  1GSE A;  2XPD A;  4I2T A;  2L5O A;  1FAA A;  2C0F A;  4X0X A;  1TU8 A;  1LJR A;  5FT3 A;  4G10 A;  2MMN A;  3IA1 A;  3H79 A;  1TOF A;  3L9U A;  1GLP A;  1GSS A;  1T4Z A;  1OC9 B;  3US3 A;  2WRT A;  3HY2 A;  3PPU A;  2FWH A;  1Q98 A;  3O6T A;  1XCC A;  1FB0 A;  4FYU A;  4O5Q A;  1A2J A;  4OO4 A;  1USB A;  1SJZ A;  3HVN A;  4OFM A;  1X9W B;  6GSS A;  2OAC A;  4NHZ A;  4EO3 A;  2H71 A;  4ULX A;  2VCZ A;  4HZ4 A;  1ERV A;  3D4M A;  1KBN A;  1PN9 A;  2H1A A;  2YNX A;  4I5Q A;  4L5L A;  3UMA A;  1JLW A;  1M9A A;  4KDX A;  3TKQ A;  3M9K A;  2PGT A;  2DIY A;  1KTE A;  2YJH A;  3R2Q A;  1OKT A;  3KTB A;  3IDV A;  2HSM A;  4LLR A;  3UL3 A;  4BVX B;  2YWN A;  4POL A;  2YPM A;  1DUG A;  5CO3 A;  3CSH A;  1FOH A;  1R5P A;  1ABA A;  2NTO A;  3KD0 A;  4NWY A;  1X9S B;  3EE2 A;  4MF7 A;  4WF4 A;  3CQF A;  1XZO A;  2CVD A;  1TW9 A;  1JZO A;  1KNG A;  1G6Y A;  3BBY A;  3EMX A;  2FLS A;  3F0I A;  3TJJ A;  2CAI A;  1ZYN A;  3ISO A;  5IM9 A;  5A5K A;  3ZZX A;  5HR3 A;  4JED A;  2CVK A;  3EUR A;  2GSR A;  4MF6 A;  3DVW A;  1GUM A;  2I3Y A;  2RM5 A;  1BED A;  3F4R A;  4J2F A;  3W6G A;  1A8Y A;  2FCH A;  4E8H A;  1EEJ A;  4XS4 B;  4KH7 A;  2Z9S A;  3D5J A;  3MAK A;  3N5O A;  3QAW A;  4ZB6 A;  3HDC A;  2LST A;  5F8B A;  3NZN A;  2HLS A;  3VI5 A;  1U6T A;  2HZF A;  2B5Y A;  2P5Q A;  2WCI A;  1FVK A;  3FRC A;  1O85 A;  5F05 A;  4ISD A;  3VWU A;  4PNF A;  4EC0 A;  2VCW A;  2EC4 A;  4BIK A;  1QQ2 A;  5IPG A;  2V2G A;  3H1N A;  1SKS B;  1PL1 A;  3R3E A;  3DVX A;  4GF0 A;  4F0C A;  1FO5 A;  5KN0 A;  1S3R A;  4IVF A;  1ZMA A;  1NM3 A;  4MZB A;  4K1F A;  3BCI A;  3KJY A;  3QAG A;  4MCU A;  4YQV A;  4QQ7 A;  2KOK A;  3JCM L;  1O6J A;  2XC2 A;  4IJ3 A;  2N5F A;  4EL1 A;  3A2V A;  2A2R A;  2C3Q A;  3VWV A;  4G0I A;  3IC4 A;  4XS1 A;  4XTS A;  2CV4 A;  4FH8 A;  4F9Z A;  1PN0 A;  3G7Y A;  1H75 A;  4TXV A;  6GSU A;  5DBQ A;  4MJB A;  1SL2 B;  3ERG A;  4KGI A;  1VF1 A;  5DAK A;  1V58 A;  3O76 A;  1XW9 A;  1ZL9 A;  3KZQ A;  3IK7 A;  1WIK A;  1GNW A;  4Z2T A;  5GAN D;  4LMW A;  4JRR A;  3IAS 2;  2DLX A;  1O8W A;  3ZYW A;  5G30 A;  4RQR A;  1JZD A;  4CY6 A;  4BL7 B;  4ZBB A;  4KCE A;  4K0G A;  2BTO T;  4HS1 A;  1DE2 A;  1GP1 A;  4JU5 A;  4PUR A;  2I9H A;  2JAD A;  2YWI A;  5KEJ A;  1AQX A;  2GZZ A;  2VL2 C;  5ENU A;  4RI7 A;  3LJR A;  4ZB9 A;  3MDK A;  1B4P A;  2R0G A;  4IS0 A;  2HI7 A;  2WUL A;  1M2B A;  2YV9 A;  1PRX A;  3GKN A;  2R3X A;  1F3B A;  2IME A;  1M3I A;  2HRK A;  1IYH A;  3WGX A;  2LRC A;  4MA9 A;  3A2X A;  2PWJ A;  2LQQ A;  2MZC A;  1QUW A;  5KN2 A;  4GCI A;  1T7P B;  1K3L A;  4PQH A;  3ZMK A;  2IPA A;  2V6O A;  2GSQ A;  1U3I A;  2NVL A;  3TRX A;  2DKI A;  4TN8 A;  3TOT A;  1Q4J A;  1WE0 A;  3HCZ A;  2C8U A;  2OJL A;  4Z7X A;  3CTF A;  3GUS A;  2P31 A;  4N0V A;  1M99 A;  3QPM A;  4PUA A;  1HQO A;  4AJ7 A;  3SWL A;  3HKR A;  4DSQ A;  1EP7 A;  3TKS A;  2MBS A;  2FA4 A;  5EL8 A;  1GTI A;  2GGT A;  3LW9 A;  3D21 A;  3ME7 A;  3KH7 A;  1X9M B;  3KMN A;  4P3Y B;  2HFD A;  4OMV A;  2LJA A;  2FD3 A;  3EMP A;  2H1D A;  4HEA 2;  1SKW B;  3ZVJ A;  1HNC A;  3HJO A;  4RUV A;  3G7I A;  4MJC A;  1XOA A;  1HNB A;  4IHU A;  5AIX A;  2YZU A;  4FQU A;  3I9V 2;  3GV1 A;  1LU4 A;  1PSQ A;  2GDR A;  3G7J A;  1AIU A;  2YN1 A;  2WGR A;  4N11 A;  3MYD A;  1TRV A;  2IMI A;  2ZNM A;  2FHE A;  1SU9 A;  3VI7 A;  3D0Z A;  4V2N A;  4ICY A;  2P5R A;  3LQ7 A;  5D9W A;  4O7H A;  3GKK A;  3ZTL A;  3ZLP A;  2H0H A;  4TR1 B;  2BMX A;  1MDI A;  4PGT A;  1F37 A;  2DML A;  2MMA A;  2OBK A;  2I1U A;  2BJX A;  3P2A A;  2I81 A;  2RII A;  1EEM A;  5D93 A;  3HZ8 A;  3VUR A;  4TOP A;  3ZML A;  5IMC A;  5AIV A;  1TK0 B;  4Z2R A;  2H0I A;  3FMW A;  2CA8 A;  3CYN A;  1B48 A;  5CP1 A;  2R37 A;  3CXG A;  6GSW A;  1XOB A;  1SD9 A;  3D22 A;  2CZ2 A;  3TKS E;  1NSW A;  2GQK A;  4OD7 A;  1ERU A;  2REM A;  2VLT A;  3FK8 A;  1K3Y A;  5KOX A;  4TKY A;  2FA8 A;  2I4A A;  3UVT A;  5C04 A;  4Q5N A;  3C8E A;  4NPB A;  2FWE A;  4G19 A;  1V2A A;  6GSY A;  4IN0 A;  2CX4 A;  1B8X A;  4HJ2 A;  5FHI A;  4MZW A;  2LNT A;  17GS A;  3BCK A;  3ED3 A;  1F6M C;  2H6Y A;  1JFU A;  4TR4 A;  3QFB C;  4ECB A;  1LBK A;  2FWG A;  2A2P A;  1SK1 A;  1SYR A;  4K0N A;  19GS A;  4FIW A;  5F0G A;  4BL7 A;  16GS A;  2FNO A;  2O8V B;  3M0F A;  3FEU A;  4Q5Q A;  2H1B A;  5F06 A;  4EUY A;  4F03 A;  6GSX A;  3FR3 A;  1TU7 A;  3FZ5 A;  3TRP A;  1WWJ A;  4POK A;  3DML A;  2HYX A;  3M3M A;  4WBJ A;  3GTU B;  2V32 A;  1TRW A;  4MH3 A;  2H6X A;  3KGK A;  3ZRE A;  2GST A;  1A0R P;  5E59 A;  5AIS A;  1MD3 A;  1XW6 A;  2X8H A;  2QA2 A;  3HZ4 A;  4ZL7 A;  1Z3E A;  1PGT A;  4ID0 A;  2VOC A;  1U87 A;  3K8N A;  3LXT A;  4HJM A;  5ECK B;  4ZIJ A;  1YF1 A;  2B1K A;  4PNG A;  4ACS A;  1G7O A;  3IPZ A;  5CRH A;  3CSJ A;  3LEF A;  6GST A;  1YZX A;  2YWM A;  4TR0 A;  3NIV A;  4EE0 A;  4ZL9 A;  5H5Q A;  1T8E B;  4WET A;  5D9T A;  4ZBA A;  3RPN A;  4D73 B;  4KDU A;  4KW6 A;  1TKD B;  5JCW A;  1AC1 A;  1XWK A;  2K8V A;  5ECO B;  2D2Z A;  2L6C A;  3FW2 A;  3HD5 A;  4KDY A;  1QGV A;  1F3A A;  4OFN A;  3ZL5 A;  5ECI B;  4PX1 A;  5HFK A;  2YAN A;  1PX6 A;  2IN3 A;  2WB9 A;  3WGE A;  3GST A;  1A24 A;  2J9H A;  2AJQ B;  3IBH A;  2HRA A;  3F8U A;  3QMX A;  4TXO B;  1XVW A;  3EC3 A;  1SK2 A;  4G2E A;  4MDC A;  4GSN A;  3E0U A;  1R4W A;  2YZH A;  4MAB A;  1MDJ A;  4FYB A;  3IXR A;  4YQM A;  1S3C A;  3S9F A;  3HXS A;  4TR1 A;  2HZE A;  3Q6O A;  3TDG A;  2H8L A;  2GTU A;  2QSI A;  1R5A A;  3CRU A;  3C7M A;  1J9B A;  2GT5 A;  3FZA A;  4TRX A;  2H74 A;  1M2A A;  1YKC A;  3KM6 A;  3GNJ A;  3VPQ A;  5IO2 A;  1K0C A;  1AW9 A;  3CMI A;  4LA1 A;  5LD0 A;  1TK5 B;  4NXI A;  2V1M A;  1VF4 A;  3QDN A;  3KCM A;  4IQ1 A;  2TRC P;  2YP6 A;  2IIY A;  1SJI A;  4YAP A;  1ZOF A;  3DXB A;  3LXZ A;  2C3N A;  4JR4 A;  3VLN A;  2R2J A;  2AYT A;  4O32 A;  3RHC A;  2JAC A;  3HVV A;  3IV4 A;  3EPT A;  4TVE A;  4MPG A;  4EIQ A;  4L0W A;  1V40 A;  3G9B A;  1EGR A;  3TCO A;  4PQ1 A;  4DSS A;  4YH2 A;  1HYU A; 
#chains in the Genus database with same CATH homology
 1OE7 A;  5C00 A;  3ERF A;  1W89 A;  3NOF A;  4HU9 A;  5EY6 A;  2VM1 A;  3BOA A;  2H76 A;  2ZUP A;  2PPT A;  2TRX A;  5G2Z A;  4MK3 A;  2LRN A;  2GLR A;  3KH9 A;  2FUG 2;  3M9J A;  4X1U A;  3IHQ A;  4MJA A;  8GSS A;  3IE3 A;  4MH2 A;  2O85 A;  1TRU A;  4BPY A;  2DKH A;  5IOW A;  4XS6 A;  5A4U A;  2L59 A;  1A0F A;  3CTG A;  1ERT A;  2QKE A;  3IC8 A;  4I97 A;  2RM6 A;  1SL1 B;  2HNL A;  2C0D A;  2LNS A;  3BD2 A;  1GWC A;  2F51 A;  2JSZ A;  5E4W A;  5G5F A;  5J5N A;  5IQY A;  3GTU A;  5GSS A;  4BWS A;  1W4V A;  2H70 A;  1FB6 A;  2VO4 A;  3IOS A;  4BWQ A;  4HQS A;  1ZGN A;  5F07 A;  2GZY A;  3FZ4 A;  1ST9 A;  2EIR A;  3DKS A;  1A2M A;  4JBB A;  1GTB A;  3GX0 A;  3M1G A;  5JWQ B;  1O8X A;  3AY8 A;  2LV3 A;  5DAL A;  1K3O A;  2F8F A;  2KLX A;  1B9Y C;  1C72 A;  2H66 A;  4WR5 A;  1GNE A;  2PVO C;  5D73 A;  4AJ8 A;  3GN3 A;  1MTC A;  3VK9 A;  1ZYQ B;  2A2S A;  4ZL8 A;  1GTU A;  4IEL A;  4YQU A;  2H0G A;  3CBU A;  5IMZ A;  1AXD A;  1BAY A;  4I8B A;  1A23 A;  2LQO A;  1U3A A;  5GST A;  3O3T A;  5ECM B;  4AJ6 A;  4EDY A;  5INY A;  2GT6 A;  4KA0 A;  3L9S A;  2VL2 A;  1OC9 A;  1TK8 B;  2WZ9 A;  5B6N A;  1EOH A;  5HR2 A;  2AV4 A;  2MMO A;  5DJM A;  5LCZ A;  4JZQ A;  5D8I A;  2ON7 A;  4F2I A;  2VD0 A;  1ON4 A;  3F63 A;  4TXO A;  1OYJ A;  3IR4 A;  3HVX A;  4WXT A;  3A2W A;  2DJ3 A;  4N0Z A;  4WEY A;  2JZR A;  1T3B A;  2OE0 A;  2OE3 A;  4L0U A;  4EXJ A;  3ZFL A;  4BA7 A;  3ZVJ D;  1F2E A;  2JU5 A;  1G0T A;  4GXZ A;  2DJ1 A;  2O87 A;  4ZBD A;  3I6A A;  4ECJ A;  2B6M A;  2XPE A;  1VF2 A;  5DVB A;  4BVX A;  5CAX A;  2PMT A;  1THO A;  2WDU A;  5GZZ B;  1G7E A;  1BQ7 A;  20GS A;  1IYI A;  3H4K A;  3I69 A;  5A4V A;  2ZCT A;  4KCA A;  2VM2 A;  2KHP A;  1PMT A;  2YOI A;  1Z7P A;  1TI3 A;  4AGS A;  1NW2 A;  2M72 A;  2OA7 A;  3GHA A;  4K2X A;  2CT6 A;  5ECS A;  2B7J A;  1PKZ A;  4L8E A;  1YJ6 A;  1YEP A;  1X5C A;  18GS A;  3C1R A;  2PUK C;  2IFQ B;  22GS A;  4HU7 A;  4K8M A;  1BYE A;  3GYK A;  2VCX A;  4ZXG A;  2B5E A;  3APS A;  4XS4 A;  2DSA A;  4HZ2 A;  1PQN A;  2HE3 A;  4HQZ A;  3MWH A;  2LJK A;  4K9Z A;  2N5B A;  1OE8 A;  3A5W A;  4N30 A;  4ML1 A;  1PA3 A;  3FYG A;  2O7K A;  1GH2 A;  2MBT A;  3LYK A;  3TRQ A;  3MIX A;  1FOV A;  1SYX A;  3P90 A;  1XWB A;  2ON5 A;  2IJY A;  3QOU A;  1YY7 A;  2MYG A;  4E8E A;  4WBR D;  4EVM A;  3KXO A;  3FR9 A;  5ELA A;  2MMZ A;  1QMV A;  3HA9 A;  3LWA A;  1X5E A;  1VRS D;  3KIJ A;  5D9V A;  2M80 A;  4H86 A;  4XHM A;  1GSF A;  2IWT A;  3UBK A;  2J23 A;  2H1G A;  1KEB A;  2CQ9 A;  5HQP A;  4GSS A;  4V2M A;  1SKR B;  3UJ1 A;  3V1W A;  2VCQ A;  3LSZ A;  1EGO A;  2YJ7 A;  12GS A;  13GS A;  4NV5 A;  1PKW A;  2NBS A;  2YWO A;  3QR6 A;  4I6X A;  2QC7 A;  4KND A;  1J0F A;  5B8B A;  4MMM A;  3ERW A;  4JR6 A;  3UEM A;  3E3E A;  2F8A A;  3TKP A;  1ZYE A;  1E6B A;  1GSU A;  1DBY A;  3UIW A;  4G0L A;  2AUV A;  3GIX A;  2XBI A;  2HXK A;  3GL3 A;  3EU4 A;  1WRY A;  3F3Q A;  3A3T A;  1ZCP A;  2A4H A;  3HHV A;  3N9J A;  1Z6N A;  4NHW A;  3W8J A;  2PVQ A;  3GFK A;  1FW1 A;  3Q18 A;  4KUN A;  5DCG A;  1XWG A;  1YEX A;  2L6D A;  2LEG A;  5IMF A;  5GAP D;  4MNN A;  1XWA A;  3VWX A;  2LKU A;  3ME8 A;  1O81 A;  1WMJ A;  1BG5 A;  2GZP A;  4IW9 A;  2QGV A;  5DJL A;  3F6F A;  5HFG A;  2C3T A;  2K8S A;  4O5U A;  1GUK A;  3QCP A;  5JCG A;  1GLQ A;  2X8C A;  2R5G A;  1ILO A;  2F3M A;  1TJD A;  1PD2 1;  4HDE A;  1S3A A;  3VFI A;  3APQ A;  4BVY B;  1O7U A;  4TR3 A;  5IO0 A;  1JZR A;  3BJ5 A;  1AQW A;  1PX7 A;  1T4Y A;  1UN2 A;  1TI1 A;  2C4J A;  3TUE A;  3DGQ A;  3Q19 A;  1FG4 A;  3ZIT A;  5IOX A;  4XIH A;  2JSY A;  4DSR A;  5ID2 B;  1MEK A;  2YV7 A;  4DVC A;  1XW5 A;  2CVB A;  1V9W A;  1UVZ A;  3TGZ A;  2CX3 A;  3GA4 A;  2R0P A;  2M46 A;  1GSD A;  4YKG A;  4K5R A;  2GS3 A;  1TRS A;  1GSQ A;  1GRX A;  3MSZ A;  2DMM A;  2QA1 A;  4K6X A;  5CRD A;  5AN1 A;  5G1K A;  2VL3 A;  2DJ0 A;  3DEX A;  4N10 A;  3RHB A;  1FHE A;  1TP9 A;  5B7C A;  4MJE A;  4NAX A;  5BRT A;  2V41 A;  1VF3 A;  2E2G A;  4USS A;  5DAK B;  3EU3 A;  2OBI A;  1XIY A;  1RQM A;  4Q5F A;  4EKZ A;  1GUH A;  4ECI A;  2KUC A;  3ZIJ A;  5G1L A;  6GSV A;  5COH A;  1Z9H A;  1CQG A;  4XCS A;  1I5G A;  2C1Y A;  4YAV A;  4CW9 A;  2GVP A;  2KP1 A;  1JHB A;  2TIR A;  1QK8 A;  4LL1 B;  4I2U A;  3WT1 A;  4GST A;  2L4Q A;  2GQL A;  7GSS A;  4PUF C;  4GRF A;  2PER A;  2X4A A;  2X99 A;  3LGC A;  4K5S A;  3IAM 2;  3PGT A;  2OE1 A;  3KMO A;  2AB6 A;  4DEJ A;  3HYP A;  4L5O A;  4Q5R A;  5KN3 A;  2RUE A;  3E9J B;  4WR4 A;  1DSB A;  2G2Q A;  1ZYP A;  2IMF A;  2JL4 A;  5A4W A;  1EWX A;  2R6K A;  2VUP A;  5IMV A;  4FO5 A;  5IMD A;  3C1S A;  3CSI A;  5CRW A;  2AAW A;  3HJP A;  2VD1 A;  3W8S A;  4FYC A;  1SEN A;  2NPB A;  2XBQ A;  4OCE A;  4PQI A;  2VL9 A;  1WOU A;  1YQ1 A;  2WJU A;  2XHF A;  3ZIV A;  5ECP B;  2HRN A;  1K0D A;  5ABR A;  1M7T A;  1B4Q A;  4RQX A;  2ALB A;  2ES7 A;  3IK9 A;  1S3D A;  5ECL B;  3APO A;  1QFN A;  3H93 A;  4F82 A;  5ECR B;  3GMF A;  3RPP A;  3UAR A;  3UBL A;  4V1A g;  1JZW A;  5G31 A;  3UOM A;  3FKF A;  4AF2 A;  3TJK A;  10GS A;  5L71 A;  5KN1 A;  3I43 A;  3EWL A;  3WD6 A;  2CAQ A;  2K9F A;  4V2L A;  4GQF A;  3IHG A;  4NMU A;  4KSO A;  1X5D A;  2PU9 C;  3P7X A;  1WP0 A;  1K0O A;  4EF0 A;  3TJF A;  4HI7 A;  3HVS A;  5IPH A;  4KE3 A;  2B5X A;  4BVY A;  4CHS A;  1SL0 B;  1THX A;  1G6W A;  5B6M A;  3ZFB A;  2X8G A;  2AHE A;  3F6D A;  2DJ2 A;  3LYP A;  3U6V A;  5J41 A;  4ML6 A;  2YCD A;  1U88 A;  2DC5 A;  3HJM A;  1SK0 A;  2R4V A;  2F9S A;  4MPF A;  5ID2 A;  3F3R A;  3FHK A;  4PTS A;  3EIN A;  2LJR A;  3TJB A;  5D96 A;  1Y6E A;  3KP9 A;  1SD8 A;  4OWY A;  4IGJ A;  3TB2 A;  4PXO A;  5G5E A;  4POM A;  5DQS A;  4IQA A;  1JLV A;  3D4T A;  3DD3 A;  3PR8 A;  2HT9 A;  4D73 A;  1DE1 A;  2UZ8 A;  1OKD A;  5B8A A;  4JE1 A;  4Z2U A;  4X4J A;  2C0G A;  3LG6 A;  1Z7R A;  1AAZ A;  1EZK A;  4ECC A;  3C73 A;  2VCV A;  3QAV A;  1ZZY A;  9GSS A;  4OO5 A;  2JZT A;  4EDZ A;  5J9B A;  5EVO A;  4POB A;  3IRA A;  4EIP A;  1Y25 A;  3UAP A;  4LMV A;  4K7I A;  4A5P A;  1EOG A;  4CDO A;  2DJK A;  4GQC A;  3GKM A;  1F9M A;  5JWO B;  2L4C A;  1X0R A;  3GSS A;  4OFT A;  2C0E A;  1OC3 A;  5H5R A;  5D9X A;  4V1A p;  3KEB A;  1I9D A;  3WYW A;  2VAF A;  4O5R A;  3RAZ A;  5ECH B;  4K7O A;  2R0C A;  1B9X C;  5ECN B;  3GH6 A;  1TTZ A;  5CRG A;  4QL7 A;  5AGY A;  1V98 A;  1K0M A;  1ERW A;  2L5L A;  1Z5Y E;  3LFL A;  2A4V A;  1K0A A;  1MDK A;  1URM A;  4RI6 A;  5DCH A;  2IMK A;  3C71 A;  3F4T A;  4KSM A;  2DJJ A;  1M0U A;  2H6Z A;  4J57 E;  2H75 A;  3EYT A;  1WJK A;  2X49 A;  2G0F A;  3L0H A;  2EIO A;  2VCT A;  2PN8 A;  4XRD A;  4IJI A;  4MF5 A;  4HOJ A;  2GSS A;  2PBJ A;  3DYR A;  5DDL A;  3FY7 A;  1M9B A;  1N8J A;  1UA5 A;  4LL4 B;  1RW1 A;  1NHO A;  1EV4 A;  4MZC A;  2IL3 A;  4MLY A;  5IMA A;  3VWW A;  1T1V A;  3DIE A;  1OVN A;  2HRF A;  1K0N A;  1ACV A;  1HD2 A;  2OAD A;  1XPV A;  4YKF A;  1VGL A;  5ECQ B;  5IIZ A;  3PIN A;  4ILF A;  3CRT A;  3TKS C;  3PH9 A;  2B1L A;  3QFA C;  4J56 E;  2VLV A;  2DBC A;  5CYY A;  3J7Y b;  2RUF A;  4CY8 A;  2FGX A;  2H30 A;  1YKA A;  2KP2 A;  4KF9 A;  5CNW A;  5HR0 A;  3GKX A;  3GX8 A;  4F0B A;  2H72 A;  4IP6 A;  5EPF A;  4O92 A;  3GL5 A;  5BMU A;  3L9V A;  1E2Y A;  4XRA A;  2V6K A;  3KTL A;  1CQH A;  2H73 A;  2H01 A;  3WGD A;  2CZ3 A;  4X43 A;  2H19 A;  2HSY A;  4KX4 A;  1XWC A;  4IBP A;  3MNG A;  1A8L A;  3GUR A;  5JWR B;  1O73 A;  1AQV A;  1WPI A;  3QD9 A;  4K7N A;  1OAZ A;  4OCF A;  2L57 A;  4TW5 A;  1MD4 A;  3GH9 A;  2FY6 A;  4IP1 A;  3TJG A;  2P0G A;  2HZE B;  4GTU A;  4KB3 A;  1PL2 A;  5J9C A;  1HNA A;  2E0Q A;  4GWR A;  2B7K A;  3RBT A;  2LRT A;  5DQY A;  5J4U A;  3F4S A;  3ZRD A;  3KP8 A;  5HR1 A;  2VIM A;  1NHY A;  3LOR A;  2K6V A;  1TXX A;  2LTK A;  1R7H A;  1GL8 A;  14GS A;  2O89 A;  4QL9 A;  2X64 A;  3GRX A;  3OR5 A;  11GS A;  1RK4 A;  3EVI A;  1GTA A;  1N2A A;  2RLI A;  3A5I A;  4ZB8 A;  3L4N A;  2E2M A;  3J7Y k;  3TKR A;  3SBC A;  4K2D A;  3P8W A;  3WT2 A;  2B3S A;  4DSS B;  5ELG A;  2GQM A;  1XFL A;  3M8N A;  3DRN A;  1YDK A;  4G9H A;  5HFI A;  3H8Q A;  3U5R E;  1SJ6 A;  5H5S A;  3TOU A;  2IMD A;  4KAE A;  1M2D A;  1XXU A;  2VLU A;  4GLT A;  1FVJ A;  3Q74 A;  2DIZ A;  2OKA A;  5LNK e;  5CRE A;  1EV9 A;  2JZS A;  1BJX A;  1BX9 A;  1TDI A;  3UVH A;  3DWV A;  3VPT A;  3F9U A;  2WS2 A;  2NDO A;  5FWG A;  4ZIL A;  1EP8 A;  2LUS A;  1UC7 A;  2K18 A;  5KOW A;  1J08 A;  5JCU A;  5J3R A;  1V57 A;  3FZ9 A;  1GUL A;  2HSH A;  4WKW A;  2N5A A;  3FR6 A;  2E7P A;  4MP4 A;  1Z6M A;  1GSY A;  1QXH A;  1OC8 A;  1R26 A;  1K0B A;  3L78 A;  1ML6 A;  5DAL B;  1XVQ A;  1YF0 A;  2EIQ A;  4WF5 A;  1A2L A;  2C80 A;  2IFQ A;  3D6I A;  4IKH A;  1H4O A;  4NV2 A;  1XBS A;  4HUA A;  1AUC A;  1T00 A;  2WFC A;  3RDW A;  4G0K A;  2FWF A;  2LS5 A;  1GSE A;  2XPD A;  4I2T A;  2L5O A;  1FAA A;  2C0F A;  4X0X A;  1TU8 A;  1LJR A;  5FT3 A;  4G10 A;  2MMN A;  3IA1 A;  3H79 A;  1TOF A;  3L9U A;  1GLP A;  1GSS A;  1T4Z A;  1OC9 B;  3US3 A;  2WRT A;  3HY2 A;  3PPU A;  2FWH A;  1Q98 A;  3O6T A;  1XCC A;  1FB0 A;  4FYU A;  4O5Q A;  1A2J A;  4OO4 A;  1USB A;  1SJZ A;  4OFM A;  1X9W B;  6GSS A;  2OAC A;  4NHZ A;  4EO3 A;  2H71 A;  4ULX A;  2VCZ A;  4HZ4 A;  1ERV A;  3D4M A;  1KBN A;  1PN9 A;  2H1A A;  2YNX A;  4I5Q A;  4L5L A;  3UMA A;  1JLW A;  1M9A A;  4KDX A;  3TKQ A;  3M9K A;  2PGT A;  2DIY A;  1KTE A;  2YJH A;  3R2Q A;  1OKT A;  3KTB A;  3IDV A;  2HSM A;  4LLR A;  3UL3 A;  4BVX B;  2YWN A;  4POL A;  2YPM A;  1DUG A;  5CO3 A;  3CSH A;  1FOH A;  1R5P A;  1ABA A;  2NTO A;  3KD0 A;  4NWY A;  1X9S B;  3EE2 A;  4MF7 A;  4WF4 A;  1XZO A;  2CVD A;  1TW9 A;  1JZO A;  1KNG A;  1G6Y A;  3BBY A;  3EMX A;  2FLS A;  3F0I A;  3TJJ A;  2CAI A;  1ZYN A;  3ISO A;  5IM9 A;  5A5K A;  3ZZX A;  5HR3 A;  4JED A;  2CVK A;  3EUR A;  2GSR A;  4MF6 A;  3DVW A;  1GUM A;  2I3Y A;  2RM5 A;  1BED A;  3F4R A;  4J2F A;  3W6G A;  1A8Y A;  2FCH A;  4E8H A;  1EEJ A;  4XS4 B;  4KH7 A;  2Z9S A;  3D5J A;  3MAK A;  3N5O A;  3QAW A;  4ZB6 A;  3HDC A;  2LST A;  5F8B A;  3NZN A;  2HLS A;  3VI5 A;  1U6T A;  2HZF A;  2B5Y A;  2P5Q A;  2WCI A;  1FVK A;  3FRC A;  1O85 A;  5F05 A;  4ISD A;  3VWU A;  4PNF A;  4EC0 A;  2VCW A;  2EC4 A;  1QQ2 A;  5IPG A;  2V2G A;  3H1N A;  1SKS B;  1PL1 A;  3R3E A;  3DVX A;  4GF0 A;  4F0C A;  1FO5 A;  5KN0 A;  4IVF A;  1ZMA A;  1NM3 A;  4MZB A;  4K1F A;  3BCI A;  3KJY A;  3QAG A;  4MCU A;  4YQV A;  4QQ7 A;  2KOK A;  3JCM L;  1O6J A;  2XC2 A;  4IJ3 A;  2N5F A;  4EL1 A;  3A2V A;  2A2R A;  2C3Q A;  3VWV A;  4G0I A;  3IC4 A;  4XS1 A;  4XTS A;  2CV4 A;  4FH8 A;  4F9Z A;  1PN0 A;  3G7Y A;  1H75 A;  4TXV A;  6GSU A;  5DBQ A;  4MJB A;  1SL2 B;  3ERG A;  4KGI A;  1VF1 A;  5DAK A;  1V58 A;  3O76 A;  1XW9 A;  1ZL9 A;  3KZQ A;  3IK7 A;  1WIK A;  1GNW A;  4Z2T A;  5GAN D;  4LMW A;  4JRR A;  3IAS 2;  2DLX A;  1O8W A;  3ZYW A;  5G30 A;  4RQR A;  1JZD A;  4CY6 A;  4BL7 B;  4ZBB A;  4KCE A;  4K0G A;  2BTO T;  4HS1 A;  1DE2 A;  1GP1 A;  4JU5 A;  4PUR A;  2I9H A;  2JAD A;  2YWI A;  5KEJ A;  1AQX A;  2GZZ A;  2VL2 C;  5ENU A;  4RI7 A;  3LJR A;  4ZB9 A;  3MDK A;  1B4P A;  2R0G A;  4IS0 A;  2HI7 A;  2WUL A;  1M2B A;  2YV9 A;  1PRX A;  3GKN A;  2R3X A;  1F3B A;  2IME A;  2HRK A;  1IYH A;  3WGX A;  2LRC A;  4MA9 A;  3A2X A;  2PWJ A;  2LQQ A;  2MZC A;  1QUW A;  5KN2 A;  4GCI A;  1T7P B;  1K3L A;  4PQH A;  3ZMK A;  2IPA A;  2V6O A;  2GSQ A;  1U3I A;  2NVL A;  3TRX A;  2DKI A;  4TN8 A;  3TOT A;  1Q4J A;  1WE0 A;  3HCZ A;  2C8U A;  2OJL A;  4Z7X A;  3CTF A;  3GUS A;  2P31 A;  4N0V A;  1M99 A;  3QPM A;  4PUA A;  1HQO A;  4AJ7 A;  3SWL A;  3HKR A;  4DSQ A;  1EP7 A;  3TKS A;  2MBS A;  2FA4 A;  5EL8 A;  1GTI A;  2GGT A;  3LW9 A;  3D21 A;  3ME7 A;  3KH7 A;  1X9M B;  3KMN A;  4P3Y B;  2HFD A;  4OMV A;  2LJA A;  2FD3 A;  3EMP A;  2H1D A;  4HEA 2;  1SKW B;  3ZVJ A;  1HNC A;  3HJO A;  4RUV A;  3G7I A;  4MJC A;  1XOA A;  1HNB A;  4IHU A;  5AIX A;  2YZU A;  4FQU A;  3I9V 2;  3GV1 A;  1LU4 A;  1PSQ A;  2GDR A;  3G7J A;  1AIU A;  2YN1 A;  2WGR A;  4N11 A;  3MYD A;  1TRV A;  2IMI A;  2ZNM A;  2FHE A;  1SU9 A;  3VI7 A;  3D0Z A;  4V2N A;  4ICY A;  2P5R A;  3LQ7 A;  5D9W A;  4O7H A;  3GKK A;  3ZTL A;  3ZLP A;  2H0H A;  4TR1 B;  2BMX A;  1MDI A;  4PGT A;  1F37 A;  2DML A;  2MMA A;  2OBK A;  2I1U A;  2BJX A;  3P2A A;  2I81 A;  2RII A;  1EEM A;  5D93 A;  3HZ8 A;  3VUR A;  4TOP A;  3ZML A;  5IMC A;  5AIV A;  1TK0 B;  4Z2R A;  2H0I A;  3FMW A;  2CA8 A;  3CYN A;  1B48 A;  5CP1 A;  2R37 A;  3CXG A;  6GSW A;  1XOB A;  1SD9 A;  3D22 A;  2CZ2 A;  3TKS E;  1NSW A;  2GQK A;  4OD7 A;  1ERU A;  2REM A;  2VLT A;  3FK8 A;  1K3Y A;  5KOX A;  4TKY A;  2FA8 A;  2I4A A;  3UVT A;  5C04 A;  4Q5N A;  3C8E A;  4NPB A;  2FWE A;  4G19 A;  1V2A A;  6GSY A;  4IN0 A;  2CX4 A;  1B8X A;  4HJ2 A;  5FHI A;  4MZW A;  2LNT A;  17GS A;  3BCK A;  3ED3 A;  1F6M C;  2H6Y A;  1JFU A;  4TR4 A;  3QFB C;  4ECB A;  1LBK A;  2FWG A;  2A2P A;  1SK1 A;  1SYR A;  4K0N A;  19GS A;  4FIW A;  5F0G A;  4BL7 A;  16GS A;  2FNO A;  2O8V B;  3M0F A;  3FEU A;  4Q5Q A;  2H1B A;  5F06 A;  4EUY A;  4F03 A;  6GSX A;  3FR3 A;  1TU7 A;  3FZ5 A;  3TRP A;  1WWJ A;  4POK A;  3DML A;  2HYX A;  3M3M A;  4WBJ A;  3GTU B;  2V32 A;  1TRW A;  4MH3 A;  2H6X A;  3KGK A;  3ZRE A;  2GST A;  1A0R P;  5E59 A;  5AIS A;  1MD3 A;  1XW6 A;  2X8H A;  2QA2 A;  3HZ4 A;  4ZL7 A;  1Z3E A;  1PGT A;  4ID0 A;  2VOC A;  1U87 A;  3K8N A;  3LXT A;  4HJM A;  5ECK B;  4ZIJ A;  1YF1 A;  2B1K A;  4PNG A;  4ACS A;  1G7O A;  3IPZ A;  5CRH A;  3CSJ A;  3LEF A;  6GST A;  1YZX A;  2YWM A;  4TR0 A;  3NIV A;  4EE0 A;  4ZL9 A;  5H5Q A;  1T8E B;  4WET A;  5D9T A;  4ZBA A;  3RPN A;  4D73 B;  4KDU A;  4KW6 A;  1TKD B;  5JCW A;  1AC1 A;  1XWK A;  2K8V A;  5ECO B;  2D2Z A;  2L6C A;  3FW2 A;  3HD5 A;  4KDY A;  1QGV A;  1F3A A;  4OFN A;  3ZL5 A;  5ECI B;  4PX1 A;  5HFK A;  2YAN A;  1PX6 A;  2IN3 A;  2WB9 A;  3WGE A;  3GST A;  1A24 A;  2J9H A;  2AJQ B;  3IBH A;  2HRA A;  3F8U A;  3QMX A;  4TXO B;  1XVW A;  3EC3 A;  1SK2 A;  4G2E A;  4MDC A;  4GSN A;  3E0U A;  1R4W A;  2YZH A;  4MAB A;  1MDJ A;  4FYB A;  3IXR A;  4YQM A;  1S3C A;  3S9F A;  3HXS A;  4TR1 A;  2HZE A;  3Q6O A;  3TDG A;  2H8L A;  2GTU A;  2QSI A;  1R5A A;  3CRU A;  3C7M A;  1J9B A;  2GT5 A;  3FZA A;  4TRX A;  2H74 A;  1M2A A;  1YKC A;  3KM6 A;  3GNJ A;  3VPQ A;  5IO2 A;  1K0C A;  1AW9 A;  3CMI A;  4LA1 A;  5LD0 A;  1TK5 B;  4NXI A;  2V1M A;  1VF4 A;  3QDN A;  3KCM A;  4IQ1 A;  2TRC P;  2YP6 A;  2IIY A;  1SJI A;  4YAP A;  1ZOF A;  3DXB A;  3LXZ A;  2C3N A;  4JR4 A;  3VLN A;  2R2J A;  2AYT A;  4O32 A;  3RHC A;  2JAC A;  3HVV A;  3IV4 A;  3EPT A;  4TVE A;  4MPG A;  4EIQ A;  4L0W A;  1V40 A;  3G9B A;  1EGR A;  3TCO A;  4PQ1 A;  4DSS A;  4YH2 A;  1HYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...