1U3AA

Mutant dsba
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
187
structure length
187
Chain Sequence
QYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHAYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol: disulfide interchange protein dsbA
publication title Intriguing conformation changes associated with the trans/cis isomerization of a prolyl residue in the active site of the DsbA C33A mutant
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 64
structure length 187
sequence length 187
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1u3aA00
2OE0A 3HVSA 3H1NA 3GH6A 1AXDA 3HZ4A 2DJJA 2RUEA 1O6JA 3KH9A 1SD8A 1EEJA 5JWQB 1BJXA 3VK9A 3M9KA 2XC2A 2B3SA 3D0ZA 3D22A 1XWGA 4F9ZA 2QSIA 2FA8A 2C0GA 1DBYA 3EVIA 5CAXA 4DSSB 2AYTA 3LGCA 4TR4A 1K0CA 4K7NA 2DJ3A 4MDCA 4ZBAA 3GL5A 5B8BA 1EOHA 4KDYA 3GYKA 2XPDA 4KSMA 2CX3A 5H5RA 2JSYA 2HI7A 3F63A 4PQIA 4HU7A 1ZL9A 2YWOA 2VM2A 3UARA 1WPIA 5DALB 2WRTA 1K0AA 3ERWA 2FUG2 4G2EA 2AJQB 3UBLA 2N5AA 1TK0B 2ON7A 3RDWA 2VAFA 1GSYA 2YNXA 4TXOA 2YOIA 1EWXA 5KEJA 4IP6A 4MZBA 1M99A 3DEXA 4ECCA 2HXKA 3U5RE 1OC3A 3ZREA 3BBYA 4XRAA 1VGLA 3IR4A 1PKZA 2L4CA 3C71A 4GQFA 5ECKB 3ZMKA 2E7PA 4MABA 1J0FA 2NVLA 5D9XA 1JZOA 1NHOA 1V98A 1XW5A 3CRUA 4QQ7A 4K7IA 3GH9A 3QAGA 1SJ6A 3KTBA 2PUKC 3F0IA 3ISOA 5CRDA 2IPAA 4ZBBA 2HFDA 4V1Ap 4IHUA 4FH8A 4MMMA 4F2IA 2RM5A 2H71A 4OCEA 3KM6A 4MLYA 4E8EA 4V1Ag 1NW2A 3HA9A 4LLRA 3IRAA 4KDXA 4YH2A 3KIJA 1DUGA 1USBA 1U87A 2WULA 3HJOA 2EIQA 1K0NA 2V2GA 2I9HA 3E9JB 5DJMA 1A2MA 2PU9C 1XXUA 2C3QA 2LRNA 5ELGA 1EGOA 1TXXA 3D21A 2R2JA 1V2AA 3C8EA 2PVQA 3L9VA 4NHWA 2IFQB 5C04A 5EVOA 5EL8A 5LCZA 4Q5RA 1MEKA 4MJBA 3TOTA 11GSA 2PMTA 3D5JA 4EVMA 2FD3A 2CVDA 1GTIA 2DJ1A 4ID0A 4NV5A 4KE3A 1A2JA 3MSZA 2LSTA 4L0UA 5GZZB 4FYCA 1F6MC 2LQOA 4ECIA 4HU9A 4KDUA 4IGJA 3GMFA 1TOFA 4J57E 4KUNA 1TI1A 1S3DA 1T7PB 1GTBA 1O73A 2MBSA 3UEMA 2MMZA 4IJ3A 1SJZA 2P0GA 3DIEA 1RQMA 2C0DA 1RK4A 2O87A 4KH7A 3EE2A 7GSSA 2X8GA 4KA0A 1M2BA 4DSRA 4ZXGA 4XS1A 2I3YA 1MD4A 1JFUA 4GLTA 1XOBA 2OBKA 3LORA 4ZL8A 3HDCA 3O3TA 4TW5A 1ON4A 4NV2A 5H5SA 1SL0B 4OO4A 1NM3A 4XS6A 2VD0A 3FZ5A 1Z7PA 2JZRA 2DJ2A 2GDRA 3H79A 2PWJA 3EWLA 4GTUA 2H6YA 4MJEA 2N5FA 3FZ4A 3VLNA 6GSTA 1SKWB 1BX9A 4TXOB 2H0IA 1TU8A 1VF4A 4DEJA 4MF6A 4TKYA 4L5LA 3TKQA 4PUFC 5D9VA 5KN0A 3F3RA 2H76A 1FVKA 2VCQA 2E2GA 2HRFA 4NMUA 3O76A 3G7JA 2LJKA 1BG5A 1X5EA 3TKSC 2QKEA 2YN1A 5DCGA 1URMA 4ZL7A 3KP9A 2VLVA 2C8UA 1AAZA 2R6KA 5F05A 3HYPA 5JCGA 3BCIA 2OA7A 1SKRB 4YQMA 1G7OA 2H01A 2B5EA 1MTCA 1XOAA 5LNKe 4WXTA 4WKWA 1NHYA 3IK7A 4XHMA 2PN8A 3ZVJD 3GRXA 1EP8A 2O89A 1G6WA 1A0FA 5LD0A 1LBKA 4IBPA 4AJ7A 4DSSA 4WETA 1U3AA 4DSQA 1FB6A 4I5QA 2BMXA 5B7CA 3CYNA 3WT2A 2O85A 1J9BA 1U3IA 1Y6EA 3VWUA 2PERA 2MYGA 1QXHA 5G30A 5JCWA 2L4QA 3IPZA 16GSA 1HNBA 4KGIA 1SD9A 3PGTA 1X5CA 2OJLA 2EIRA 1WRYA 1R5PA 3DVWA 3E0UA 2WJUA 5J41A 4I6XA 4IKHA 1AUCA 2H8LA 2R3XA 3BCKA 4ILFA 1R26A 1PSQA 1FG4A 3M8NA 2H70A 1X0RA 2FY6A 2B5XA 1PL1A 3VWWA 2OE3A 1C72A 1SYRA 4KAEA 3TJKA 5KN1A 3EMPA 2YANA 3D4TA 1TI3A 1KNGA 2GT5A 1EZKA 2FWGA 1GUMA 2O7KA 4ACSA 1GSSA 2MMNA 4Q5QA 4MZCA 2AAWA 2F9SA 3APOA 1TRVA 1XWCA 2LRTA 3RHCA 1T00A 5B8AA 1ML6A 2IMKA 5D8IA 2VLTA 2XHFA 5AISA 1PA3A 2KLXA 1ACVA 3ZTLA 4IVFA 3PH9A 3ZRDA 1PD21 4HDEA 2KOKA 2WCIA 1S3AA 1YF1A 2K6VA 2VL2A 1A8LA 4KB3A 3QAWA 1GSDA 1Z5YE 2F3MA 2NBSA 2IFQA 2V6OA 1SENA 3DXBA 3CSHA 5HFIA 4NAXA 4GRFA 2H6ZA 4WEYA 5CRWA 5DBQA 3W8JA 4XIHA 1NSWA 2GSRA 2KHPA 3MWHA 5CREA 6GSXA 5CRGA 3KEBA 1OAZA 3ME8A 5J9CA 5HR0A 4PGTA 5AGYA 1TDIA 4L5OA 3ZLPA 3FRCA 1F37A 2GQLA 2MMAA 2X8HA 1X9MB 5E59A 1PRXA 2JACA 4OMVA 3HCZA 2VCZA 4V2LA 1EGRA 3DVXA 4WR4A 1GSQA 2F8FA 2MMOA 1Q98A 3K8NA 1Y25A 3LJRA 4CW9A 2P31A 5FT3A 2FWEA 5J5NA 3LXZA 2HT9A 2RM6A 2NTOA 3Q19A 1XFLA 2ZNMA 5DVBA 3G9BA 19GSA 3UOMA 4FO5A 3KZQA 1OC8A 4HJMA 4N0VA 2FHEA 3IA1A 1ST9A 3FEUA 1E2YA 2LEGA 4PNFA 2VCVA 5DDLA 2DMMA 4AJ6A 3GKMA 1OC9A 3DYRA 5JWOB 1A0RP 1VF3A 1XPVA 2VOCA 5ECPB 5H5QA 4GSNA 3ZFBA 2IMEA 4EL1A 4F82A 2GSTA 2IMFA 1EP7A 2HZEB 4WR5A 3EMXA 1TJDA 2DJKA 3EURA 1O81A 1QK8A 4NPBA 1E6BA 1JZWA 3VPQA 1ZMAA 3BOAA 2VO4A 4K9ZA 2OE1A 3AY8A 3FK8A 3TJFA 5IOWA 2YPMA 5ECOB 2M46A 5EY6A 5F0GA 2GVPA 2R5GA 3ME7A 2FGXA 2B1KA 2L6DA 1TRSA 3TCOA 5AIXA 2IMIA 2LV3A 1T4YA 3HKRA 1QUWA 3ED3A 1W89A 3GSSA 1EOGA 2FA4A 1F2EA 4GSSA 5IPGA 4ZILA 18GSA 3QR6A 5ABRA 3ZIJA 1Q4JA 5DQYA 4HI7A 4POMA 1WIKA 1UC7A 3LFLA 1SK0A 2X8CA 1F3AA 2G0FA 5IM9A 5GAND 3IAM2 4HOJA 2YWNA 2DIZA 3Q74A 1UA5A 2KUCA 1BEDA 1B9XC 2YWMA 2AB6A 1QMVA 3IBHA 17GSA 3GURA 4IQ1A 1TK8B 3VPTA 1MD3A 3F6DA 5GSTA 3F3QA 2LJAA 2AUVA 2L57A 3DD3A 4MK3A 4BVXA 2OADA 3LWAA 1H4OA 1TKDB 5FHIA 2O8VB 2D2ZA 6GSSA 1YZXA 2MZCA 3A2XA 3TOUA 4YAVA 3FR3A 1GUHA 1VRSD 3IHQA 5G1LA 4POKA 2ALBA 4F0BA 1XWAA 1GP1A 2FWFA 4TVEA 1K0OA 4GF0A 2IN3A 3HVVA 1PKWA 3TRQA 1TTZA 3HXSA 3LYKA 2ZUPA 2AHEA 3KGKA 3P90A 5ID2B 2WDUA 3IAS2 4AF2A 3LSZA 3U6VA 1U88A 3KH7A 3GTUB 4MH2A 3ZVJA 5JWRB 3G7IA 14GSA 2H1DA 2PGTA 3DMLA 1M9AA 5G5EA 4LL1B 1H75A 1GH2A 4O92A 2OACA 2VIMA 2VCXA 2LTKA 2GZYA 3VWXA 2YZHA 3C7MA 3EU4A 3MAKA 1QFNA 1ZOFA 3QD9A 3RBTA 3W8SA 5FWGA 4F0CA 2HRNA 1VF2A 2F8AA 3W6GA 1Z7RA 2HZFA 1FB0A 1Z6NA 1ZYEA 3NIVA 3I9V2 1OKTA 2YV7A 1GLQA 4LMVA 1YQ1A 4PXOA 3EC3A 1TU7A 4OO5A 1OC9B 5ENUA 1ILOA 1GLPA 2VL9A 4PX1A 4RI6A 1OE7A 3L9SA 1HYUA 4HEA2 5EPFA 4KNDA 3CXGA 2C3NA 1HNCA 3PR8A 3DRNA 1A2LA 3ZITA 3RPPA 5ECIB 1AC1A 5E4WA 2WZ9A 4K6XA 5ECHB 4J56E 1ERUA 2GT6A 4J2FA 4IW9A 4RQRA 2OBIA 3I6AA 1PGTA 1T4ZA 2B7KA 4D73A 3GKKA 4PUAA 4CHSA 1F3BA 4TXVA 2I1UA 3P2AA 1PX6A 1J08A 3HJPA 2VD1A 5A5KA 4XTSA 1SL1B 2CAQA 1KEBA 3IXRA 4HS1A 3QAVA 2P5RA 4ZIJA 3UBKA 1XCCA 3QDNA 4QL7A 1F9MA 3TKPA 1M2DA 1XIYA 2C80A 4MP4A 1GSUA 1GULA 4EDZA 1JLVA 3M3MA 1OE8A 4KCEA 4G10A 2C1YA 2Z9SA 4K0NA 2L59A 3FHKA 1IYHA 1A23A 2V41A 1XWBA 4TRXA 1T1VA 2YCDA 1A24A 4ZB6A 1V57A 5G2ZA 3D6IA 4N0ZA 1YY7A 1SKSB 4OFMA 2VL2C 5G1KA 4HZ2A 3F9UA 3NZNA 2FNOA 2H66A 3DGQA 2F51A 1B9YC 4KW6A 2JZTA 2CQ9A 4YQVA 3A2VA 1THXA 2REMA 2B6MA 4H86A 3L0HA 4IELA 2RIIA 3FZAA 1MDIA 3FZ9A 2JL4A 4IS0A 2HZEA 5C00A 1N2AA 2A2RA 4YAPA 1X5DA 5IMFA 2HSYA 5JCUA 3UAPA 4WBJA 2TRCP 3IE3A 1GUKA 3O6TA 3FY7A 4TR1A 4MPFA 3S9FA 3SBCA 1UVZA 2WFCA 1S3CA 4AGSA 1RW1A 3RPNA 3BD2A 5GAPD 4IJIA 4X0XA 2B7JA 1PN9A 2P5QA 4OD7A 3GL3A 2H6XA 4ULXA 2VL3A 5ECRB 2H1GA 2V6KA 5HR1A 4PQHA 5A4UA 3N5OA 1T3BA 1KBNA 3ZYWA 3C1SA 2G2QA 3KCMA 3GHAA 3KJYA 2IIYA 1FW1A 3WT1A 2PBJA 5ECLB 2RUFA 1R4WA 3APQA 6GSUA 3VI5A 5DJLA 4MF5A 3UVHA 3FW2A 1M9BA 1TW9A 3QCPA 2HNLA 3LXTA 1GNWA 2GSSA 2GQKA 3QMXA 1XZOA 3DWVA 1B48A 3UMAA 1GL8A 4POLA 4G19A 2GS3A 4MF7A 4ISDA 3HZ8A 4MCUA 3V1WA 4HQZA 2K8SA 4Z7XA 1I9DA 3TUEA 1GSEA 2ON5A 1U6TA 1YEPA 3MDKA 1R7HA 2L5OA 3GNJA 5IQYA 3M1GA 4Q5FA 2LNSA 2V32A 1GTAA 3M9JA 4EKZA 2VCTA 1EV4A 2B1LA 5L71A 3WGXA 3HVXA 5A4VA 4MA9A 1CQGA 2FLSA 4MJAA 2K18A 2LRCA 3Q6OA 2K8VA 2N5BA 10GSA 5DCHA 4D73B 1TP9A 5ID2A 4TR0A 4EO3A 3GV1A 1XW9A 4IQAA 4I2TA 5A4WA 3GTUA 1X9SB 1R5AA 3GIXA 3ZFLA 3TRXA 2L5LA 4K8MA 6GSVA 3UIWA 4K1FA 4LL4B 2IJYA 2E2MA 1N8JA 5HQPA 3DKSA 1ZCPA 2X64A 1TRWA 4HQSA 3LYPA 4TOPA 2C4JA 2AV4A 3F6FA 2JSZA 4V2MA 4GCIA 1AQXA 2J23A 2YJ7A 5IO0A 4RUVA 3WGEA 2GLRA 2WGRA 3HHVA 3TKSE 4EC0A 3J7Yk 4MH3A 1THOA 2R4VA 4TN8A 4NWYA 1WJKA 2H72A 3QFBC 5ECMB 5ECSA 4XS4A 1BAYA 3CTGA 3ERGA 2H75A 4L8EA 3ZL5A 2JU5A 3GKXA 5DAKB 2VLUA 1WOUA 3BJ5A 1X9WB 1IYIA 5D96A 4MZWA 1AQVA 2HLSA 4ZB8A 3F8UA 3TKRA 4PNGA 3TJJA 3J7Yb 5IOXA 4TR1B 2VCWA 3UJ1A 5B6MA 4XRDA 2CZ2A 3GKNA 2C3TA 3LG6A 3CRTA 4G9HA 4LMWA 4JZQA 2X99A 2CT6A 1SL2B 4ML1A 2YJHA 3D4MA 4CDOA 2CAIA 5F06A 2M80A 2I81A 1WMJA 2IMDA 3GFKA 2HSHA 4KCAA 1WP0A 4V2NA 4ML6A 4F03A 2CVBA 4QL9A 3GN3A 5CP1A 5HR2A 4GQCA 4AJ8A 1VF1A 3VWVA 1M2AA 1XBSA 3KD0A 1JHBA 4OFTA 4X43A 3TDGA 3TGZA 2YZUA 3P8WA 4WF5A 3APSA 3UVTA 3A3TA 2M72A 5IMDA 1DE1A 4NHZA 4OFNA 1K0DA 5KN3A 1M0UA 2YWIA 3A2WA 2IL3A 4JU5A 2HE3A 2FWHA 2GQMA 3F4RA 2LKUA 5AN1A 3TB2A 4I97A 2DMLA 4YQUA 2I4AA 3ZMLA 1B8XA 2DIYA 4OCFA 1A8YA 1XWKA 4ECJA 4O7HA 2H1BA 4PQ1A 4JRRA 4EE0A 4N11A 4JR6A 1B4PA 5IMAA 4TR3A 1Z3EA 3QPMA 2CX4A 3E3EA 4XCSA 1OKDA 3UL3A 3VURA 4K0GA 1ERVA 20GSA 4MPGA 5J4UA 1G6YA 5ECNB 4FIWA 4MJCA 3RAZA 1FOVA 1GWCA 3MNGA 5IMZA 3CBUA 9GSSA 1ZZYA 1V9WA 2TIRA 4EXJA 1QGVA 4BL7A 3TRPA 2LS5A 3KMNA 2GZPA 2DSAA 5IIZA 2C0EA 1SJIA 3FYGA 4GWRA 1UN2A 3JCML 3SWLA 3TJBA 5HFKA 1CQHA 1HD2A 1M7TA 4KX4A 2ZCTA 4X1UA 1JLWA 3CSJA 5CRHA 2EC4A 1G0TA 2LUSA 2QC7A 3HD5A 1ZYQB 1TRUA 4E8HA 1OYJA 2EIOA 2PVOC 2R37A 4BPYA 1V40A 4JR4A 1AIUA 5COHA 4N10A 1EEMA 2V1MA 1W4VA 4XS4B 3WYWA 2DJ0A 3CSIA 4ZL9A 2RLIA 1Z9HA 1ERWA 3IV4A 4EDYA 6GSYA 2CA8A 4BA7A 4RQXA 1K3LA 3I43A 5IMVA 2A2SA 2FCHA 1FHEA 1ABAA 3KXOA 3CMIA 3EYTA 1WE0A 1O85A 1HNAA 2JZSA 1O8XA 3GX8A 4Q5NA 1I5GA 3QFAC 3Q18A 3A5WA 3LEFA 2E0QA 4OWYA 5DQSA 3HY2A 3TJGA 1PL2A 4LA1A 2L6CA 1YDKA 4I2UA 3C73A 3IC4A 2IWTA 1MDJA 1AW9A 3IOSA 5G31A 1DE2A 4JEDA 1LJRA 2LJRA 1K0MA 3EINA 3C1RA 1V58A 2YV9A 3GA4A 5G5FA 3ZZXA 2QGVA 4FYUA 4POBA 4HZ4A 2J9HA 2NDOA 2HYXA 4PURA 3H4KA 2VM1A 5CYYA 1XVQA 3CTFA 1GSFA 1XW6A 1BYEA 1ZGNA 5D9WA 3L4NA 1Z6MA 5D93A 1JZDA 2PPTA 1GRXA 2GTUA 1JZRA 2BTOT 3M0FA 4P3YB 3VFIA 1SK2A 1YEXA 4IN0A 1PX7A 4DVCA 3GSTA 1FVJA 2XBQA 5CO3A 5HR3A 5KN2A 1GTUA 8GSSA 1LU4A 3LQ7A 5DAKA 3FR9A 5AIVA 1TK5B 2H19A 3FR6A 3KP8A 2XBIA 1YKAA 4JE1A 1O7UA 4BVYA 1FAAA 3HJMA 1GNEA 5ECQB 2DBCA 2H30A 4GSTA 12GSA 2H0GA 4FYBA 2CVKA 5DALA 5INYA 2LNTA 1WWJA 4IP1A 4ZBDA 5CNWA 1K3OA 2B5YA 4O32A 3IK9A 2CZ3A 5D73A 2DC5A 4BWSA 1YF0A 2LQQA 4K2DA 4NXIA 1SU9A 4HJ2A 3IDVA 1O8WA 3H93A 2A4VA 4ECBA 2GSQA 2CV4A 1BQ7A 3FKFA 2TRXA 4BWQA 1ERTA 3G7YA 4EUYA 1HQOA 2K9FA 4GXZA 5HFGA 3TKSA 2WB9A 2JADA 3R2QA 4L0WA 4WF4A 2GGTA 5IO2A 2BJXA 3F4SA 1FO5A 2WS2A 3KMOA 4WBRD 2MBTA 1SYXA 2GZZA 2KP2A 3ERFA 1G7EA 1XVWA 2H0HA 13GSA 1T8EB 3KTLA 4RI7A 3WGDA 1OVNA 2C0FA 3P7XA 3ZIVA 1K3YA 2KP1A 4O5RA 4N30A 2YP6A 2DLXA 3L9UA 1K0BA 1PMTA 5F8BA 5IMCA 4ZB9A 5F07A 4EF0A 1YKCA 1MDKA 4JBBA 2XPEA 3F4TA 2H74A 2ES7A 1KTEA 5GSSA 3H8QA 1AQWA 3EU3A 6GSWA 22GSA 3GX0A 4K7OA 5ELAA 2NPBA 3PINA 3VI7A 1QQ2A 4I8BA 4HUAA 1PQNA 1EV9A 5J3RA 3L78A 1DSBA 2OKAA 5D9TA 3I69A 3NOFA 1B4QA 5J9BA 4KSOA 3GUSA 3N9JA 5IPHA 2VUPA 1YJ6A 3WD6A 1SK1A 3RHBA 3QOUA 3US3A 5B6NA 2H73A 3OR5A 2H1AA
chains in the Genus database with same CATH superfamily
2OE0A 3HVSA 3H1NA 3GH6A 1AXDA 3HZ4A 2DJJA 2RUEA 1O6JA 3MYDA 3KH9A 1SD8A 1EEJA 5JWQB 1BJXA 3VK9A 3M9KA 2XC2A 2B3SA 3D0ZA 3D22A 1XWGA 4FQUA 4F9ZA 2QSIA 2FA8A 2C0GA 1DBYA 3EVIA 5CAXA 4DSSB 3LW9A 2AYTA 1ZYPA 3LGCA 4TR4A 1K0CA 4K7NA 2DJ3A 4MDCA 4ZBAA 3GL5A 5B8BA 1EOHA 4KDYA 4BVYB 3GYKA 2XPDA 4KSMA 2CX3A 5H5RA 2JSYA 2HI7A 3F63A 4PQIA 4HU7A 1ZL9A 2YWOA 2VM2A 3UARA 1WPIA 5DALB 2WRTA 1K0AA 3ERWA 2FUG2 4G2EA 2AJQB 3UBLA 2N5AA 1TK0B 2ON7A 3RDWA 2VAFA 1GSYA 2YNXA 3MIXA 4TXOA 2YOIA 1EWXA 5KEJA 4IP6A 4MZBA 1M99A 3DEXA 4ECCA 2HXKA 3U5RE 1OC3A 3ZREA 3BBYA 4XRAA 1VGLA 3IR4A 1PKZA 2L4CA 3C71A 4GQFA 5ECKB 3ZMKA 2E7PA 4MABA 1J0FA 2NVLA 5D9XA 1JZOA 1NHOA 1V98A 1XW5A 3CRUA 4QQ7A 4K7IA 3GH9A 3QAGA 1SJ6A 3KTBA 2PUKC 3F0IA 3ISOA 5CRDA 2IPAA 4ZBBA 2HFDA 4V1Ap 4IHUA 4FH8A 4MMMA 4F2IA 2RM5A 2H71A 4OCEA 3KM6A 4MLYA 4E8EA 4V1Ag 4YKFA 1NW2A 3HA9A 4LLRA 3IRAA 4KDXA 4YH2A 3KIJA 1DUGA 1USBA 1U87A 2WULA 3HJOA 2EIQA 1K0NA 2V2GA 2I9HA 3E9JB 5DJMA 1A2MA 2PU9C 1XXUA 2C3QA 2LRNA 5ELGA 1EGOA 1TXXA 4G0IA 3D21A 2R2JA 1V2AA 3C8EA 2PVQA 3L9VA 4NHWA 2IFQB 5C04A 5EVOA 5EL8A 5LCZA 4Q5RA 1MEKA 4MJBA 3TOTA 11GSA 2PMTA 3D5JA 4EVMA 2FD3A 2CVDA 4G0KA 1GTIA 2DJ1A 4ID0A 4NV5A 4KE3A 1A2JA 3MSZA 2LSTA 4L0UA 5GZZB 4FYCA 1F6MC 2LQOA 4ECIA 4HU9A 4KDUA 4IGJA 3GMFA 1TOFA 4J57E 4KUNA 1TI1A 1S3DA 1T7PB 1GTBA 1O73A 2MBSA 3UEMA 2MMZA 4IJ3A 5KOXA 1SJZA 2P0GA 3R3EA 4X4JA 3DIEA 1RQMA 2C0DA 1RK4A 2O87A 4KH7A 3EE2A 7GSSA 2X8GA 4KA0A 1M2BA 4DSRA 4ZXGA 4XS1A 2I3YA 1MD4A 1JFUA 4GLTA 1XOBA 3FMWA 2OBKA 3LORA 4ZL8A 3HDCA 3O3TA 4TW5A 1ON4A 4NV2A 5H5SA 1SL0B 4XS6A 1NM3A 4OO4A 2VD0A 3FZ5A 1Z7PA 2JZRA 2DJ2A 2GDRA 3H79A 2PWJA 3EWLA 4GTUA 2H6YA 4MJEA 2N5FA 3FZ4A 3VLNA 6GSTA 1SKWB 1BX9A 4TXOB 2H0IA 1TU8A 1VF4A 4DEJA 4MF6A 4TKYA 4L5LA 3TKQA 4PUFC 5D9VA 5KN0A 3F3RA 4MNNA 2H76A 1FVKA 2VCQA 2E2GA 2HRFA 4NMUA 3O76A 3G7JA 2LJKA 1BG5A 1X5EA 3TKSC 2QKEA 2YN1A 5DCGA 1URMA 4ZL7A 3KP9A 2VLVA 2C8UA 1AAZA 2R6KA 5F05A 3HYPA 5JCGA 3BCIA 2OA7A 1SKRB 4YQMA 1G7OA 2H01A 2B5EA 1MTCA 1XOAA 5LNKe 4WXTA 4WKWA 1NHYA 3IK7A 4XHMA 2PN8A 3ZVJD 3GRXA 1EP8A 2O89A 1G6WA 2X49A 1A0FA 5LD0A 1LBKA 4IBPA 4AJ7A 4DSSA 4WETA 1U3AA 4DSQA 1FB6A 4I5QA 2BMXA 5B7CA 3CYNA 3WT2A 2O85A 1J9BA 1U3IA 1Y6EA 3VWUA 2PERA 2MYGA 1QXHA 5G30A 5JCWA 2L4QA 3IPZA 16GSA 1HNBA 4KGIA 1SD9A 3PGTA 1X5CA 2OJLA 2EIRA 1WRYA 1R5PA 3DVWA 3E0UA 2WJUA 5J41A 4I6XA 4IKHA 4K2XA 1AUCA 2H8LA 2R3XA 3BCKA 4ILFA 1R26A 1PSQA 1FG4A 3M8NA 2H70A 1X0RA 2FY6A 2B5XA 1PL1A 3VWWA 2OE3A 1C72A 1SYRA 4KAEA 3TJKA 2X4AA 5KN1A 3EMPA 2YANA 3D4TA 1TI3A 1KNGA 2GT5A 1EZKA 2FWGA 1GUMA 2O7KA 4ACSA 1GSSA 2MMNA 4EIPA 4Q5QA 4MZCA 2AAWA 2F9SA 3APOA 1TRVA 1XWCA 2LRTA 3RHCA 1T00A 5B8AA 1ML6A 2IMKA 5D8IA 2VLTA 2XHFA 5AISA 1PA3A 2KLXA 1ACVA 3ZTLA 4IVFA 3PH9A 3ZRDA 1PD21 4HDEA 2KOKA 2WCIA 1S3AA 1YF1A 2K6VA 2VL2A 1A8LA 4KB3A 3QAWA 1GSDA 1Z5YE 2F3MA 2NBSA 2HSMA 2IFQA 2V6OA 1SENA 3DXBA 3CSHA 5HFIA 4NAXA 4GRFA 2H6ZA 4WEYA 5CRWA 5DBQA 3W8JA 4XIHA 1NSWA 2GSRA 2KHPA 3MWHA 5CREA 6GSXA 5CRGA 3KEBA 1OAZA 3ME8A 5J9CA 5HR0A 4PGTA 5AGYA 1TDIA 1PN0A 4L5OA 3ZLPA 3FRCA 1F37A 2GQLA 2MMAA 2X8HA 1X9MB 5E59A 1PRXA 2JACA 4OMVA 3HCZA 2VCZA 4V2LA 1EGRA 3DVXA 5KOWA 3EPTA 4WR4A 1GSQA 2F8FA 2MMOA 1Q98A 3K8NA 1Y25A 3LJRA 4CW9A 2P31A 5FT3A 2FWEA 5J5NA 3LXZA 2HT9A 2RM6A 2NTOA 3Q19A 1XFLA 2ZNMA 5DVBA 3G9BA 19GSA 3UOMA 4FO5A 3KZQA 1OC8A 4HJMA 4N0VA 2FHEA 3IA1A 1ST9A 3FEUA 4KF9A 1E2YA 2LEGA 4G0LA 4PNFA 2VCVA 5DDLA 2DMMA 4AJ6A 5BMUA 3GKMA 1OC9A 3DYRA 5JWOB 1A0RP 1VF3A 1XPVA 2VOCA 5ECPB 5H5QA 4GSNA 3ZFBA 2IMEA 4EL1A 4F82A 2GSTA 2IMFA 1ZYNA 1EP7A 2HZEB 4WR5A 3EMXA 1TJDA 4USSA 2DJKA 3EURA 1O81A 1QK8A 4NPBA 1E6BA 1JZWA 3VPQA 1ZMAA 3BOAA 2VO4A 4K9ZA 2OE1A 3AY8A 3FK8A 3TJFA 5IOWA 2YPMA 5ECOB 2M46A 5EY6A 5F0GA 2GVPA 2R5GA 3ME7A 2FGXA 2B1KA 2L6DA 1TRSA 3TCOA 5AIXA 2IMIA 2LV3A 1T4YA 3HKRA 1QUWA 3ED3A 1W89A 3GSSA 3A5IA 1EOGA 2FA4A 3PPUA 1F2EA 4GSSA 5IPGA 4ZILA 18GSA 3QR6A 5ABRA 3ZIJA 1Q4JA 5DQYA 4HI7A 4POMA 1WIKA 1UC7A 3LFLA 1SK0A 2X8CA 1F3AA 2G0FA 5IM9A 5GAND 3IAM2 4HOJA 2YWNA 2DIZA 3Q74A 1UA5A 2KUCA 1BEDA 1B9XC 2YWMA 4BIKA 2AB6A 1QMVA 3IBHA 17GSA 3GURA 4IQ1A 1TK8B 3VPTA 1MD3A 3F6DA 5GSTA 3F3QA 2LJAA 2AUVA 2L57A 3DD3A 4MK3A 4BVXA 2OADA 3LWAA 1H4OA 1TKDB 5FHIA 2O8VB 2D2ZA 6GSSA 1YZXA 2MZCA 3A2XA 4CY8A 3TOUA 4YAVA 3FR3A 1GUHA 1VRSD 3IHQA 5G1LA 4POKA 2ALBA 4F0BA 1XWAA 1GP1A 2FWFA 4TVEA 1K0OA 4GF0A 2IN3A 3HVVA 1PKWA 3TRQA 1TTZA 3HXSA 3LYKA 2ZUPA 2AHEA 3KGKA 3P90A 5ID2B 2WDUA 3IAS2 4AF2A 3LSZA 3U6VA 2HRAA 1U88A 3KH7A 3GTUB 4MH2A 3ZVJA 5JWRB 3G7IA 14GSA 2H1DA 2PGTA 3DMLA 1M9AA 5G5EA 4LL1B 1H75A 1GH2A 4O92A 2OACA 2VIMA 2VCXA 2LTKA 2GZYA 3VWXA 2YZHA 3C7MA 3EU4A 3MAKA 1QFNA 1ZOFA 3QD9A 3RBTA 3W8SA 5FWGA 4F0CA 2HRNA 1VF2A 2F8AA 3W6GA 1Z7RA 2HZFA 1FB0A 1Z6NA 1ZYEA 3NIVA 3I9V2 1OKTA 2YV7A 1GLQA 4LMVA 1YQ1A 4PXOA 3EC3A 1TU7A 4OO5A 1OC9B 5ENUA 1ILOA 1GLPA 2VL9A 4PX1A 4RI6A 1S3RA 1OE7A 3L9SA 1HYUA 4HEA2 5EPFA 4KNDA 3CXGA 2C3NA 1HNCA 3PR8A 3DRNA 1A2LA 3ZITA 3RPPA 1AC1A 5ECIB 5E4WA 2WZ9A 4K6XA 5ECHB 4J56E 1ERUA 2GT6A 4J2FA 4IW9A 4RQRA 2OBIA 3I6AA 1PGTA 1T4ZA 2B7KA 4D73A 3GKKA 2DKIA 4PUAA 4CHSA 1F3BA 4TXVA 2I1UA 3P2AA 1PX6A 1J08A 3HJPA 2VD1A 5A5KA 4XTSA 1SL1B 4HSCX 2CAQA 1KEBA 3IXRA 4HS1A 3QAVA 2P5RA 4ZIJA 3UBKA 1XCCA 3QDNA 4QL7A 1F9MA 3TKPA 1M2DA 1XIYA 2C80A 4MP4A 1GSUA 1GULA 4EDZA 1JLVA 3M3MA 1OE8A 4KCEA 4G10A 2C1YA 2Z9SA 4K0NA 2L59A 3FHKA 1IYHA 1A23A 2V41A 1XWBA 4TRXA 1T1VA 2YCDA 1A24A 4ZB6A 1V57A 5G2ZA 3D6IA 4N0ZA 1YY7A 1SKSB 4OFMA 2VL2C 5G1KA 4HZ2A 3F9UA 3NZNA 2FNOA 2H66A 3DGQA 2F51A 1B9YC 4KW6A 2JZTA 2CQ9A 4YQVA 3A2VA 1THXA 2REMA 2B6MA 4H86A 4BVXB 3L0HA 4IELA 2RIIA 3FZAA 1MDIA 3FZ9A 2JL4A 4IS0A 2HZEA 5C00A 1N2AA 2A2RA 4YAPA 1X5DA 5IMFA 2HSYA 4PTSA 5JCUA 3UAPA 4WBJA 2TRCP 3IE3A 1GUKA 3O6TA 3FY7A 4TR1A 4MPFA 3S9FA 3SBCA 1UVZA 2WFCA 1S3CA 4AGSA 1RW1A 3RPNA 3BD2A 5GAPD 4IJIA 4X0XA 2B7JA 5BRTA 1PN9A 2P5QA 4OD7A 3GL3A 2H6XA 4ULXA 2VL3A 5ECRB 2H1GA 2V6KA 5HR1A 4PQHA 5A4UA 3N5OA 1T3BA 1KBNA 3ZYWA 3C1SA 2G2QA 3KCMA 3GHAA 3KJYA 2IIYA 1FW1A 4O5UA 4BL7B 3WT1A 2PBJA 5ECLB 2RUFA 1R4WA 3APQA 6GSUA 3VI5A 5DJLA 4MF5A 3UVHA 3FW2A 1M9BA 1TW9A 3QCPA 2HNLA 3LXTA 1GNWA 2GSSA 2GQKA 3QMXA 1XZOA 3DWVA 1B48A 3UMAA 1GL8A 4POLA 4G19A 2GS3A 4MF7A 4ISDA 3HZ8A 4MCUA 3V1WA 4HQZA 2K8SA 4Z7XA 1I9DA 3TUEA 1GSEA 2ON5A 1U6TA 1YEPA 3MDKA 1R7HA 2L5OA 3GNJA 5IQYA 3M1GA 4Q5FA 2LNSA 4O5QA 2V32A 1GTAA 3M9JA 4EKZA 2VCTA 1EV4A 2B1LA 5L71A 4YKGA 3WGXA 3HVXA 5A4VA 2A4HA 4MA9A 4ICYA 1CQGA 2FLSA 4MJAA 2K18A 2LRCA 3Q6OA 2K8VA 2N5BA 10GSA 5DCHA 4D73B 1TP9A 5ID2A 4TR0A 4EO3A 3GV1A 1XW9A 4IQAA 4I2TA 5A4WA 3GTUA 1X9SB 1R5AA 3GIXA 3ZFLA 3TRXA 2L5LA 4K8MA 6GSVA 3UIWA 4K1FA 4LL4B 2IJYA 2E2MA 1N8JA 5HQPA 4CY6A 3DKSA 1ZCPA 2X64A 1TRWA 4HQSA 3LYPA 4TOPA 2C4JA 2AV4A 3F6FA 2JSZA 4V2MA 4GCIA 1AQXA 2J23A 2YJ7A 5IO0A 4RUVA 3WGEA 2GLRA 2WGRA 3HHVA 3TKSE 4EC0A 3J7Yk 4MH3A 1THOA 2R4VA 4TN8A 4NWYA 1WJKA 2H72A 3QFBC 5ECMB 5ECSA 4XS4A 1BAYA 3CTGA 3ERGA 2H75A 4L8EA 3ZL5A 2JU5A 3GKXA 5DAKB 2VLUA 1WOUA 3BJ5A 2R0PA 1X9WB 1PFOA 1IYIA 5D96A 4MZWA 1AQVA 2HLSA 4ZB8A 3F8UA 3TKRA 4PNGA 3TJJA 3J7Yb 3HVNA 5IOXA 4TR1B 2VCWA 2DKHA 3UJ1A 5B6MA 4XRDA 2CZ2A 3GKNA 2C3TA 3LG6A 3CRTA 4G9HA 4LMWA 4JZQA 2X99A 2CT6A 1SL2B 4ML1A 2YJHA 3D4MA 4CDOA 2CAIA 5F06A 2M80A 2I81A 1WMJA 2IMDA 3GFKA 1M3IA 2HSHA 4KCAA 1WP0A 4V2NA 4ML6A 1XG8A 4F03A 2CVBA 4QL9A 3GN3A 5CP1A 5HR2A 4GQCA 4AJ8A 1VF1A 3VWVA 1M2AA 1XBSA 3KD0A 1JHBA 4OFTA 4X43A 3TDGA 3TGZA 2YZUA 3P8WA 4WF5A 3APSA 3UVTA 3A3TA 2M72A 5IMDA 1DE1A 4NHZA 4OFNA 1K0DA 5KN3A 1M0UA 2YWIA 3A2WA 2IL3A 4JU5A 2HE3A 2FWHA 2GQMA 3F4RA 2LKUA 5AN1A 3TB2A 4I97A 2DMLA 4YQUA 2I4AA 3ZMLA 1B8XA 2DIYA 4OCFA 1A8YA 1XWKA 2QA2A 4ECJA 4O7HA 2H1BA 4PQ1A 4JRRA 4EE0A 4N11A 4JR6A 1B4PA 5IMAA 4TR3A 1Z3EA 3QPMA 2CX4A 4Z2RA 3E3EA 4XCSA 1OKDA 3UL3A 3VURA 4K0GA 1ERVA 20GSA 4MPGA 5J4UA 1G6YA 5ECNB 2R0CA 4FIWA 4MJCA 3RAZA 1FOVA 1GWCA 3MNGA 5IMZA 3CBUA 9GSSA 1ZZYA 1V9WA 2TIRA 4EXJA 1QGVA 4BL7A 3TRPA 2LS5A 3KMNA 2GZPA 2DSAA 5IIZA 2C0EA 3IC8A 1SJIA 3FYGA 4GWRA 1UN2A 3JCML 3SWLA 3TJBA 5HFKA 1CQHA 1HD2A 1M7TA 4KX4A 2ZCTA 4X1UA 1JLWA 3CSJA 5CRHA 2EC4A 1G0TA 2LUSA 2QC7A 3HD5A 1ZYQB 1TRUA 4E8HA 1OYJA 2EIOA 2PVOC 2QA1A 2R37A 4BPYA 1V40A 4JR4A 1AIUA 5COHA 4N10A 1EEMA 4EIQA 2V1MA 1W4VA 4XS4B 3WYWA 2DJ0A 3CSIA 4ZL9A 2RLIA 1Z9HA 1ERWA 3IV4A 4EDYA 6GSYA 2CA8A 4BA7A 4RQXA 1K3LA 3I43A 5IMVA 2A2SA 2FCHA 1FHEA 1ABAA 3KXOA 3CMIA 3EYTA 1WE0A 1O85A 1HNAA 2JZSA 1O8XA 3GX8A 4Q5NA 1I5GA 3QFAC 3Q18A 3A5WA 3LEFA 2E0QA 4OWYA 5DQSA 3HY2A 3TJGA 1PL2A 4LA1A 2L6CA 1YDKA 4I2UA 3C73A 3IC4A 2IWTA 1MDJA 1AW9A 3IOSA 5G31A 1DE2A 4JEDA 1LJRA 2LJRA 1K0MA 3EINA 3C1RA 1V58A 2YV9A 3GA4A 5G5FA 3ZZXA 2QGVA 4FYUA 4POBA 4HZ4A 2J9HA 2NDOA 2HRKA 2HYXA 4PURA 3H4KA 2VM1A 1M3JA 5CYYA 1XVQA 3CTFA 1GSFA 1XW6A 1BYEA 1ZGNA 5D9WA 3L4NA 1Z6MA 5D93A 1JZDA 2PPTA 4Z2TA 1GRXA 2GTUA 1JZRA 2BTOT 4K5RA 3M0FA 4P3YB 3VFIA 1SK2A 1YEXA 4IN0A 1PX7A 4DVCA 3GSTA 1FVJA 2XBQA 5CO3A 5HR3A 5KN2A 1GTUA 8GSSA 1LU4A 3LQ7A 5DAKA 3FR9A 5AIVA 1TK5B 2H19A 3FR6A 3KP8A 2XBIA 1YKAA 4JE1A 1O7UA 4BVYA 1FAAA 3HJMA 1GNEA 4A5PA 5ECQB 2DBCA 2A2PA 2H30A 4GSTA 12GSA 2H0GA 4FYBA 2CVKA 5DALA 5INYA 2LNTA 1WWJA 4IP1A 4ZBDA 5CNWA 1K3OA 2B5YA 4O32A 3IK9A 2CZ3A 5D73A 2DC5A 2R0GA 4BWSA 1YF0A 4K5SA 2LQQA 4K2DA 4NXIA 1SU9A 4HJ2A 3IDVA 1O8WA 3H93A 2A4VA 4ECBA 2GSQA 2CV4A 1BQ7A 3FKFA 2TRXA 4BWQA 1ERTA 3G7YA 4EUYA 1HQOA 2K9FA 4GXZA 5HFGA 3TKSA 2WB9A 2JADA 3R2QA 4L0WA 4WF4A 2GGTA 1FOHA 5IO2A 2BJXA 3F4SA 1FO5A 2WS2A 3KMOA 4WBRD 2MBTA 1SYXA 2GZZA 2KP2A 3ERFA 1G7EA 1XVWA 2H0HA 13GSA 3CQFA 1T8EB 3KTLA 4RI7A 3WGDA 1OVNA 2C0FA 3P7XA 3ZIVA 1K3YA 2KP1A 4O5RA 4N30A 2YP6A 2DLXA 3L9UA 1K0BA 1PMTA 5F8BA 5IMCA 4ZB9A 5F07A 4EF0A 1YKCA 1MDKA 4JBBA 2XPEA 3F4TA 2H74A 2ES7A 4Z2UA 2UZ8A 1KTEA 5GSSA 3H8QA 3IHGA 1AQWA 3EU3A 6GSWA 22GSA 3GX0A 4K7OA 5ELAA 2NPBA 3PINA 3VI7A 1QQ2A 4I8BA 4HUAA 1PQNA 1EV9A 5J3RA 3L78A 1DSBA 2OKAA 5D9TA 3I69A 3NOFA 1B4QA 5J9BA 4KSOA 3GUSA 3N9JA 5IPHA 2VUPA 1YJ6A 3WD6A 1SK1A 3RHBA 3QOUA 3US3A 5B6NA 2H73A 3OR5A 2H1AA
chains in the Genus database with same CATH topology
2OE0A 3HVSA 3H1NA 3GH6A 1AXDA 3HZ4A 2DJJA 2RUEA 1O6JA 3MYDA 3KH9A 1SD8A 1EEJA 5JWQB 1BJXA 3VK9A 3M9KA 2XC2A 2B3SA 3D0ZA 3D22A 1XWGA 4FQUA 4F9ZA 2QSIA 2FA8A 2C0GA 1DBYA 3EVIA 5CAXA 4DSSB 3LW9A 2AYTA 1ZYPA 3LGCA 4TR4A 1K0CA 4K7NA 2DJ3A 4MDCA 4ZBAA 3GL5A 5B8BA 1EOHA 4KDYA 4BVYB 3GYKA 2XPDA 4KSMA 2CX3A 5H5RA 2JSYA 2HI7A 3F63A 4PQIA 4HU7A 1ZL9A 2YWOA 2VM2A 3UARA 1WPIA 5DALB 2WRTA 1K0AA 3ERWA 2FUG2 4G2EA 2AJQB 3UBLA 2N5AA 1TK0B 2ON7A 3RDWA 2VAFA 1GSYA 2YNXA 3MIXA 4TXOA 2YOIA 1EWXA 5KEJA 4IP6A 4MZBA 1M99A 3DEXA 4ECCA 2HXKA 3U5RE 1OC3A 3ZREA 3BBYA 4XRAA 1VGLA 3IR4A 1PKZA 2L4CA 3C71A 4GQFA 5ECKB 3ZMKA 2E7PA 4MABA 1J0FA 2NVLA 5D9XA 1JZOA 1NHOA 1V98A 1XW5A 3CRUA 4QQ7A 4K7IA 3GH9A 3QAGA 1SJ6A 3KTBA 2PUKC 3F0IA 3ISOA 5CRDA 2IPAA 4ZBBA 2HFDA 4V1Ap 4IHUA 4FH8A 4MMMA 4F2IA 2RM5A 2H71A 4OCEA 3KM6A 4MLYA 4E8EA 4V1Ag 4YKFA 1NW2A 3HA9A 4LLRA 3IRAA 4KDXA 4YH2A 3KIJA 1DUGA 1USBA 1U87A 2WULA 3HJOA 2EIQA 1K0NA 2V2GA 2I9HA 3E9JB 5DJMA 1A2MA 2PU9C 1XXUA 2C3QA 2LRNA 5ELGA 1EGOA 1TXXA 4G0IA 3D21A 2R2JA 1V2AA 3C8EA 2PVQA 3L9VA 4NHWA 2IFQB 5C04A 5EVOA 5EL8A 5LCZA 4Q5RA 1MEKA 4MJBA 3TOTA 11GSA 2PMTA 3D5JA 4EVMA 2FD3A 2CVDA 4G0KA 1GTIA 2DJ1A 4ID0A 4NV5A 4KE3A 1A2JA 3MSZA 2LSTA 4L0UA 5GZZB 4FYCA 1F6MC 2LQOA 4ECIA 4HU9A 4KDUA 4IGJA 3GMFA 1TOFA 4J57E 4KUNA 1TI1A 1S3DA 1T7PB 1GTBA 1O73A 2MBSA 3UEMA 2MMZA 4IJ3A 5KOXA 1SJZA 2P0GA 3R3EA 4X4JA 3DIEA 1RQMA 2C0DA 1RK4A 2O87A 4KH7A 3EE2A 7GSSA 2X8GA 4KA0A 1M2BA 4DSRA 4ZXGA 4XS1A 2I3YA 1MD4A 1JFUA 4GLTA 1XOBA 3FMWA 2OBKA 3LORA 4ZL8A 3HDCA 3O3TA 4TW5A 1ON4A 4NV2A 5H5SA 1SL0B 4XS6A 1NM3A 4OO4A 2VD0A 3FZ5A 1Z7PA 2JZRA 2DJ2A 2GDRA 3H79A 2PWJA 3EWLA 4GTUA 2H6YA 4MJEA 2N5FA 3FZ4A 3VLNA 6GSTA 1SKWB 1BX9A 4TXOB 2H0IA 1TU8A 1VF4A 4DEJA 4MF6A 4TKYA 4L5LA 3TKQA 4PUFC 5D9VA 5KN0A 3F3RA 4MNNA 2H76A 1FVKA 2VCQA 2E2GA 2HRFA 4NMUA 3O76A 3G7JA 2LJKA 1BG5A 1X5EA 3TKSC 2QKEA 2YN1A 5DCGA 1URMA 4ZL7A 3KP9A 2VLVA 2C8UA 1AAZA 2R6KA 5F05A 3HYPA 5JCGA 3BCIA 2OA7A 1SKRB 4YQMA 1G7OA 2H01A 2B5EA 1MTCA 1XOAA 5LNKe 4WXTA 4WKWA 1NHYA 3IK7A 4XHMA 2PN8A 3ZVJD 3GRXA 1EP8A 2O89A 1G6WA 2X49A 1A0FA 5LD0A 1LBKA 4IBPA 4AJ7A 4DSSA 4WETA 1U3AA 4DSQA 1FB6A 4I5QA 2BMXA 5B7CA 3CYNA 3WT2A 2O85A 1J9BA 1U3IA 1Y6EA 3VWUA 2PERA 2MYGA 1QXHA 5G30A 5JCWA 2L4QA 3IPZA 16GSA 1HNBA 4KGIA 1SD9A 3PGTA 1X5CA 2OJLA 2EIRA 1WRYA 1R5PA 3DVWA 3E0UA 2WJUA 5J41A 4I6XA 4IKHA 4K2XA 1AUCA 2H8LA 2R3XA 3BCKA 4ILFA 1R26A 1PSQA 1FG4A 3M8NA 2H70A 1X0RA 2FY6A 2B5XA 1PL1A 3VWWA 2OE3A 1C72A 1SYRA 4KAEA 3TJKA 2X4AA 5KN1A 3EMPA 2YANA 3D4TA 1TI3A 1KNGA 2GT5A 1EZKA 2FWGA 1GUMA 2O7KA 4ACSA 1GSSA 2MMNA 4EIPA 4Q5QA 4MZCA 2AAWA 2F9SA 3APOA 1TRVA 1XWCA 2LRTA 3RHCA 1T00A 5B8AA 1ML6A 2IMKA 5D8IA 2VLTA 2XHFA 5AISA 1PA3A 2KLXA 1ACVA 3ZTLA 4IVFA 3PH9A 3ZRDA 1PD21 4HDEA 2KOKA 2WCIA 1S3AA 1YF1A 2K6VA 2VL2A 1A8LA 4KB3A 3QAWA 1GSDA 1Z5YE 2F3MA 2NBSA 2HSMA 2IFQA 2V6OA 1SENA 3DXBA 3CSHA 5HFIA 4NAXA 4GRFA 2H6ZA 4WEYA 5CRWA 5DBQA 3W8JA 4XIHA 1NSWA 2GSRA 2KHPA 3MWHA 5CREA 6GSXA 5CRGA 3KEBA 1OAZA 3ME8A 5J9CA 5HR0A 4PGTA 5AGYA 1TDIA 1PN0A 4L5OA 3ZLPA 3FRCA 1F37A 2GQLA 2MMAA 2X8HA 1X9MB 5E59A 1PRXA 2JACA 4OMVA 3HCZA 2VCZA 4V2LA 1EGRA 3DVXA 5KOWA 3EPTA 4WR4A 1GSQA 2F8FA 2MMOA 1Q98A 3K8NA 1Y25A 3LJRA 4CW9A 2P31A 5FT3A 2FWEA 5J5NA 3LXZA 2HT9A 2RM6A 2NTOA 3Q19A 1XFLA 2ZNMA 5DVBA 3G9BA 19GSA 3UOMA 4FO5A 3KZQA 1OC8A 4HJMA 4N0VA 2FHEA 3IA1A 1ST9A 3FEUA 4KF9A 1E2YA 2LEGA 4G0LA 4PNFA 2VCVA 5DDLA 2DMMA 4AJ6A 5BMUA 3GKMA 1OC9A 3DYRA 5JWOB 1A0RP 1VF3A 1XPVA 2VOCA 5ECPB 5H5QA 4GSNA 3ZFBA 2IMEA 4EL1A 4F82A 2GSTA 2IMFA 1ZYNA 1EP7A 2HZEB 4WR5A 3EMXA 1TJDA 4USSA 2DJKA 3EURA 1O81A 1QK8A 4NPBA 1E6BA 1JZWA 3VPQA 1ZMAA 3BOAA 2VO4A 4K9ZA 2OE1A 3AY8A 3FK8A 3TJFA 5IOWA 2YPMA 5ECOB 2M46A 5EY6A 5F0GA 2GVPA 2R5GA 3ME7A 2FGXA 2B1KA 2L6DA 1TRSA 3TCOA 5AIXA 2IMIA 2LV3A 1T4YA 3HKRA 1QUWA 3ED3A 1W89A 3GSSA 3A5IA 1EOGA 2FA4A 3PPUA 1F2EA 4GSSA 5IPGA 4ZILA 18GSA 3QR6A 5ABRA 3ZIJA 1Q4JA 5DQYA 4HI7A 4POMA 1WIKA 1UC7A 3LFLA 1SK0A 2X8CA 1F3AA 2G0FA 5IM9A 5GAND 3IAM2 4HOJA 2YWNA 2DIZA 3Q74A 1UA5A 2KUCA 1BEDA 1B9XC 2YWMA 2AB6A 1QMVA 3IBHA 17GSA 3GURA 4IQ1A 1TK8B 3VPTA 1MD3A 3F6DA 5GSTA 3F3QA 2LJAA 2AUVA 2L57A 3DD3A 4MK3A 4BVXA 2OADA 3LWAA 1H4OA 1TKDB 5FHIA 2O8VB 2D2ZA 6GSSA 1YZXA 2MZCA 3A2XA 4CY8A 3TOUA 4YAVA 3FR3A 1GUHA 1VRSD 3IHQA 5G1LA 4POKA 2ALBA 4F0BA 1XWAA 1GP1A 2FWFA 4TVEA 1K0OA 4GF0A 2IN3A 3HVVA 1PKWA 3TRQA 1TTZA 3HXSA 3LYKA 2ZUPA 2AHEA 3KGKA 3P90A 5ID2B 2WDUA 3IAS2 4AF2A 3LSZA 3U6VA 2HRAA 1U88A 3KH7A 3GTUB 4MH2A 3ZVJA 5JWRB 3G7IA 14GSA 2H1DA 2PGTA 3DMLA 1M9AA 5G5EA 4LL1B 1H75A 1GH2A 4O92A 2OACA 2VIMA 2VCXA 2LTKA 2GZYA 3VWXA 2YZHA 3C7MA 3EU4A 3MAKA 1QFNA 1ZOFA 3QD9A 3RBTA 3W8SA 5FWGA 4F0CA 2HRNA 1VF2A 2F8AA 3W6GA 1Z7RA 2HZFA 1FB0A 1Z6NA 1ZYEA 3NIVA 3I9V2 1OKTA 2YV7A 1GLQA 4LMVA 1YQ1A 4PXOA 3EC3A 1TU7A 4OO5A 1OC9B 5ENUA 1ILOA 1GLPA 2VL9A 4PX1A 4RI6A 1OE7A 3L9SA 1HYUA 4HEA2 5EPFA 4KNDA 3CXGA 2C3NA 1HNCA 3PR8A 3DRNA 1A2LA 3ZITA 3RPPA 1AC1A 5ECIB 5E4WA 2WZ9A 4K6XA 5ECHB 4J56E 1ERUA 2GT6A 4J2FA 4IW9A 4RQRA 2OBIA 3I6AA 1PGTA 1T4ZA 2B7KA 4D73A 3GKKA 2DKIA 4PUAA 4CHSA 1F3BA 4TXVA 2I1UA 3P2AA 1PX6A 1J08A 3HJPA 2VD1A 5A5KA 4XTSA 1SL1B 2CAQA 1KEBA 3IXRA 4HS1A 3QAVA 2P5RA 4ZIJA 3UBKA 1XCCA 3QDNA 4QL7A 1F9MA 3TKPA 1M2DA 1XIYA 2C80A 4MP4A 1GSUA 1GULA 4EDZA 1JLVA 3M3MA 1OE8A 4KCEA 4G10A 2C1YA 2Z9SA 4K0NA 2L59A 3FHKA 1IYHA 1A23A 2V41A 1XWBA 4TRXA 1T1VA 2YCDA 1A24A 4ZB6A 1V57A 5G2ZA 3D6IA 4N0ZA 1YY7A 1SKSB 4OFMA 2VL2C 5G1KA 4HZ2A 3F9UA 3NZNA 2FNOA 2H66A 3DGQA 2F51A 1B9YC 4KW6A 2JZTA 2CQ9A 4YQVA 3A2VA 1THXA 2REMA 2B6MA 4H86A 4BVXB 3L0HA 4IELA 2RIIA 3FZAA 1MDIA 3FZ9A 2JL4A 4IS0A 2HZEA 5C00A 1N2AA 2A2RA 4YAPA 1X5DA 5IMFA 2HSYA 4PTSA 5JCUA 3UAPA 4WBJA 2TRCP 3IE3A 1GUKA 3O6TA 3FY7A 4TR1A 4MPFA 3S9FA 3SBCA 1UVZA 2WFCA 1S3CA 4AGSA 1RW1A 3RPNA 3BD2A 5GAPD 4IJIA 4X0XA 2B7JA 5BRTA 1PN9A 2P5QA 4OD7A 3GL3A 2H6XA 4ULXA 2VL3A 5ECRB 2H1GA 2V6KA 5HR1A 4PQHA 5A4UA 3N5OA 1T3BA 1KBNA 3ZYWA 3C1SA 2G2QA 3KCMA 3GHAA 3KJYA 2IIYA 1FW1A 4O5UA 4BL7B 3WT1A 2PBJA 5ECLB 2RUFA 1R4WA 3APQA 6GSUA 3VI5A 5DJLA 4MF5A 3UVHA 3FW2A 1M9BA 1TW9A 3QCPA 2HNLA 3LXTA 1GNWA 2GSSA 2GQKA 3QMXA 1XZOA 3DWVA 1B48A 3UMAA 1GL8A 4POLA 4G19A 2GS3A 4MF7A 4ISDA 3HZ8A 4MCUA 3V1WA 4HQZA 2K8SA 4Z7XA 1I9DA 3TUEA 1GSEA 2ON5A 1U6TA 1YEPA 3MDKA 1R7HA 2L5OA 3GNJA 5IQYA 3M1GA 4Q5FA 2LNSA 4O5QA 2V32A 1GTAA 3M9JA 4EKZA 2VCTA 1EV4A 2B1LA 5L71A 4YKGA 3WGXA 3HVXA 5A4VA 2A4HA 4MA9A 4ICYA 1CQGA 2FLSA 4MJAA 2K18A 2LRCA 3Q6OA 2K8VA 2N5BA 10GSA 5DCHA 4D73B 1TP9A 5ID2A 4TR0A 4EO3A 3GV1A 1XW9A 4IQAA 4I2TA 5A4WA 3GTUA 1X9SB 1R5AA 3GIXA 3ZFLA 3TRXA 2L5LA 4K8MA 6GSVA 3UIWA 4K1FA 4LL4B 2IJYA 2E2MA 1N8JA 5HQPA 4CY6A 3DKSA 1ZCPA 2X64A 1TRWA 4HQSA 3LYPA 4TOPA 2C4JA 2AV4A 3F6FA 2JSZA 4V2MA 4GCIA 1AQXA 2J23A 2YJ7A 5IO0A 4RUVA 3WGEA 2GLRA 2WGRA 3HHVA 3TKSE 4EC0A 3J7Yk 4MH3A 1THOA 2R4VA 4TN8A 4NWYA 1WJKA 2H72A 3QFBC 5ECMB 5ECSA 4XS4A 1BAYA 3CTGA 3ERGA 2H75A 4L8EA 3ZL5A 2JU5A 3GKXA 5DAKB 2VLUA 1WOUA 3BJ5A 2R0PA 1X9WB 1IYIA 5D96A 4MZWA 1AQVA 2HLSA 4ZB8A 3F8UA 3TKRA 4PNGA 3TJJA 3J7Yb 5IOXA 4TR1B 2VCWA 2DKHA 3UJ1A 5B6MA 4XRDA 2CZ2A 3GKNA 2C3TA 3LG6A 3CRTA 4G9HA 4LMWA 4JZQA 2X99A 2CT6A 1SL2B 4ML1A 2YJHA 3D4MA 4CDOA 2CAIA 5F06A 2M80A 2I81A 1WMJA 2IMDA 3GFKA 2HSHA 4KCAA 1WP0A 4V2NA 4ML6A 4F03A 2CVBA 4QL9A 3GN3A 5CP1A 5HR2A 4GQCA 4AJ8A 1VF1A 3VWVA 1M2AA 1XBSA 3KD0A 1JHBA 4OFTA 4X43A 3TDGA 3TGZA 2YZUA 3P8WA 4WF5A 3APSA 3UVTA 3A3TA 2M72A 5IMDA 1DE1A 4NHZA 4OFNA 1K0DA 5KN3A 1M0UA 2YWIA 3A2WA 2IL3A 4JU5A 2HE3A 2FWHA 2GQMA 3F4RA 2LKUA 5AN1A 3TB2A 4I97A 2DMLA 4YQUA 2I4AA 3ZMLA 1B8XA 2DIYA 4OCFA 1A8YA 1XWKA 2QA2A 4ECJA 4O7HA 2H1BA 4PQ1A 4JRRA 4EE0A 4N11A 4JR6A 1B4PA 5IMAA 4TR3A 1Z3EA 3QPMA 2CX4A 4Z2RA 3E3EA 4XCSA 1OKDA 3UL3A 3VURA 4K0GA 1ERVA 20GSA 4MPGA 5J4UA 1G6YA 5ECNB 2R0CA 4FIWA 4MJCA 3RAZA 1FOVA 1GWCA 3MNGA 5IMZA 3CBUA 9GSSA 1ZZYA 1V9WA 2TIRA 4EXJA 1QGVA 4BL7A 3TRPA 2LS5A 3KMNA 2GZPA 2DSAA 5IIZA 2C0EA 3IC8A 1SJIA 3FYGA 4GWRA 1UN2A 3JCML 3SWLA 3TJBA 5HFKA 1CQHA 1HD2A 1M7TA 4KX4A 2ZCTA 4X1UA 1JLWA 3CSJA 5CRHA 2EC4A 1G0TA 2LUSA 2QC7A 3HD5A 1ZYQB 1TRUA 4E8HA 1OYJA 2EIOA 2PVOC 2QA1A 2R37A 4BPYA 1V40A 4JR4A 1AIUA 5COHA 4N10A 1EEMA 4EIQA 2V1MA 1W4VA 4XS4B 3WYWA 2DJ0A 3CSIA 4ZL9A 2RLIA 1Z9HA 1ERWA 3IV4A 4EDYA 6GSYA 2CA8A 4BA7A 4RQXA 1K3LA 3I43A 5IMVA 2A2SA 2FCHA 1FHEA 1ABAA 3KXOA 3CMIA 3EYTA 1WE0A 1O85A 1HNAA 2JZSA 1O8XA 3GX8A 4Q5NA 1I5GA 3QFAC 3Q18A 3A5WA 3LEFA 2E0QA 4OWYA 5DQSA 3HY2A 3TJGA 1PL2A 4LA1A 2L6CA 1YDKA 4I2UA 3C73A 3IC4A 2IWTA 1MDJA 1AW9A 3IOSA 5G31A 1DE2A 4JEDA 1LJRA 2LJRA 1K0MA 3EINA 3C1RA 1V58A 2YV9A 3GA4A 5G5FA 3ZZXA 2QGVA 4FYUA 4POBA 4HZ4A 2J9HA 2NDOA 2HRKA 2HYXA 4PURA 3H4KA 2VM1A 5CYYA 1XVQA 3CTFA 1GSFA 1XW6A 1BYEA 1ZGNA 5D9WA 3L4NA 1Z6MA 5D93A 1JZDA 2PPTA 4Z2TA 1GRXA 2GTUA 1JZRA 2BTOT 4K5RA 3M0FA 4P3YB 3VFIA 1SK2A 1YEXA 4IN0A 1PX7A 4DVCA 3GSTA 1FVJA 2XBQA 5CO3A 5HR3A 5KN2A 1GTUA 8GSSA 1LU4A 3LQ7A 5DAKA 3FR9A 5AIVA 1TK5B 2H19A 3FR6A 3KP8A 2XBIA 1YKAA 4JE1A 1O7UA 4BVYA 1FAAA 3HJMA 1GNEA 4A5PA 5ECQB 2DBCA 2A2PA 2H30A 4GSTA 12GSA 2H0GA 4FYBA 2CVKA 5DALA 5INYA 2LNTA 1WWJA 4IP1A 4ZBDA 5CNWA 1K3OA 2B5YA 4O32A 3IK9A 2CZ3A 5D73A 2DC5A 2R0GA 4BWSA 1YF0A 4K5SA 2LQQA 4K2DA 4NXIA 1SU9A 4HJ2A 3IDVA 1O8WA 3H93A 2A4VA 4ECBA 2GSQA 2CV4A 1BQ7A 3FKFA 2TRXA 4BWQA 1ERTA 3G7YA 4EUYA 1HQOA 2K9FA 4GXZA 5HFGA 3TKSA 2WB9A 2JADA 3R2QA 4L0WA 4WF4A 2GGTA 1FOHA 5IO2A 2BJXA 3F4SA 1FO5A 2WS2A 3KMOA 4WBRD 2MBTA 1SYXA 2GZZA 2KP2A 3ERFA 1G7EA 1XVWA 2H0HA 13GSA 1T8EB 3KTLA 4RI7A 3WGDA 1OVNA 2C0FA 3P7XA 3ZIVA 1K3YA 2KP1A 4O5RA 4N30A 2YP6A 2DLXA 3L9UA 1K0BA 1PMTA 5F8BA 5IMCA 4ZB9A 5F07A 4EF0A 1YKCA 1MDKA 4JBBA 2XPEA 3F4TA 2H74A 2ES7A 4Z2UA 2UZ8A 1KTEA 5GSSA 3H8QA 3IHGA 1AQWA 3EU3A 6GSWA 22GSA 3GX0A 4K7OA 5ELAA 2NPBA 3PINA 3VI7A 1QQ2A 4I8BA 4HUAA 1PQNA 1EV9A 5J3RA 3L78A 1DSBA 2OKAA 5D9TA 3I69A 3NOFA 1B4QA 5J9BA 4KSOA 3GUSA 3N9JA 5IPHA 2VUPA 1YJ6A 3WD6A 1SK1A 3RHBA 3QOUA 3US3A 5B6NA 2H73A 3OR5A 2H1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OE0 A;  3HVS A;  3H1N A;  3GH6 A;  1AXD A;  3HZ4 A;  2DJJ A;  2RUE A;  1O6J A;  3KH9 A;  1SD8 A;  1EEJ A;  5JWQ B;  1BJX A;  3VK9 A;  3M9K A;  2XC2 A;  2B3S A;  3D0Z A;  3D22 A;  1XWG A;  4F9Z A;  2QSI A;  2FA8 A;  2C0G A;  1DBY A;  3EVI A;  5CAX A;  4DSS B;  2AYT A;  3LGC A;  4TR4 A;  1K0C A;  4K7N A;  2DJ3 A;  4MDC A;  4ZBA A;  3GL5 A;  5B8B A;  1EOH A;  4KDY A;  3GYK A;  2XPD A;  4KSM A;  2CX3 A;  5H5R A;  2JSY A;  2HI7 A;  3F63 A;  4PQI A;  4HU7 A;  1ZL9 A;  2YWO A;  2VM2 A;  3UAR A;  1WPI A;  5DAL B;  2WRT A;  1K0A A;  3ERW A;  2FUG 2;  4G2E A;  2AJQ B;  3UBL A;  2N5A A;  1TK0 B;  2ON7 A;  3RDW A;  2VAF A;  1GSY A;  2YNX A;  4TXO A;  2YOI A;  1EWX A;  5KEJ A;  4IP6 A;  4MZB A;  1M99 A;  3DEX A;  4ECC A;  2HXK A;  3U5R E;  1OC3 A;  3ZRE A;  3BBY A;  4XRA A;  1VGL A;  3IR4 A;  1PKZ A;  2L4C A;  3C71 A;  4GQF A;  5ECK B;  3ZMK A;  2E7P A;  4MAB A;  1J0F A;  2NVL A;  5D9X A;  1JZO A;  1NHO A;  1V98 A;  1XW5 A;  3CRU A;  4QQ7 A;  4K7I A;  3GH9 A;  3QAG A;  1SJ6 A;  3KTB A;  2PUK C;  3F0I A;  3ISO A;  5CRD A;  2IPA A;  4ZBB A;  2HFD A;  4V1A p;  4IHU A;  4FH8 A;  4MMM A;  4F2I A;  2RM5 A;  2H71 A;  4OCE A;  3KM6 A;  4MLY A;  4E8E A;  4V1A g;  1NW2 A;  3HA9 A;  4LLR A;  3IRA A;  4KDX A;  4YH2 A;  3KIJ A;  1DUG A;  1USB A;  1U87 A;  2WUL A;  3HJO A;  2EIQ A;  1K0N A;  2V2G A;  2I9H A;  3E9J B;  5DJM A;  1A2M A;  2PU9 C;  1XXU A;  2C3Q A;  2LRN A;  5ELG A;  1EGO A;  1TXX A;  3D21 A;  2R2J A;  1V2A A;  3C8E A;  2PVQ A;  3L9V A;  4NHW A;  2IFQ B;  5C04 A;  5EVO A;  5EL8 A;  5LCZ A;  4Q5R A;  1MEK A;  4MJB A;  3TOT A;  11GS A;  2PMT A;  3D5J A;  4EVM A;  2FD3 A;  2CVD A;  1GTI A;  2DJ1 A;  4ID0 A;  4NV5 A;  4KE3 A;  1A2J A;  3MSZ A;  2LST A;  4L0U A;  5GZZ B;  4FYC A;  1F6M C;  2LQO A;  4ECI A;  4HU9 A;  4KDU A;  4IGJ A;  3GMF A;  1TOF A;  4J57 E;  4KUN A;  1TI1 A;  1S3D A;  1T7P B;  1GTB A;  1O73 A;  2MBS A;  3UEM A;  2MMZ A;  4IJ3 A;  1SJZ A;  2P0G A;  3DIE A;  1RQM A;  2C0D A;  1RK4 A;  2O87 A;  4KH7 A;  3EE2 A;  7GSS A;  2X8G A;  4KA0 A;  1M2B A;  4DSR A;  4ZXG A;  4XS1 A;  2I3Y A;  1MD4 A;  1JFU A;  4GLT A;  1XOB A;  2OBK A;  3LOR A;  4ZL8 A;  3HDC A;  3O3T A;  4TW5 A;  1ON4 A;  4NV2 A;  5H5S A;  1SL0 B;  4OO4 A;  1NM3 A;  4XS6 A;  2VD0 A;  3FZ5 A;  1Z7P A;  2JZR A;  2DJ2 A;  2GDR A;  3H79 A;  2PWJ A;  3EWL A;  4GTU A;  2H6Y A;  4MJE A;  2N5F A;  3FZ4 A;  3VLN A;  6GST A;  1SKW B;  1BX9 A;  4TXO B;  2H0I A;  1TU8 A;  1VF4 A;  4DEJ A;  4MF6 A;  4TKY A;  4L5L A;  3TKQ A;  4PUF C;  5D9V A;  5KN0 A;  3F3R A;  2H76 A;  1FVK A;  2VCQ A;  2E2G A;  2HRF A;  4NMU A;  3O76 A;  3G7J A;  2LJK A;  1BG5 A;  1X5E A;  3TKS C;  2QKE A;  2YN1 A;  5DCG A;  1URM A;  4ZL7 A;  3KP9 A;  2VLV A;  2C8U A;  1AAZ A;  2R6K A;  5F05 A;  3HYP A;  5JCG A;  3BCI A;  2OA7 A;  1SKR B;  4YQM A;  1G7O A;  2H01 A;  2B5E A;  1MTC A;  1XOA A;  5LNK e;  4WXT A;  4WKW A;  1NHY A;  3IK7 A;  4XHM A;  2PN8 A;  3ZVJ D;  3GRX A;  1EP8 A;  2O89 A;  1G6W A;  1A0F A;  5LD0 A;  1LBK A;  4IBP A;  4AJ7 A;  4DSS A;  4WET A;  1U3A A;  4DSQ A;  1FB6 A;  4I5Q A;  2BMX A;  5B7C A;  3CYN A;  3WT2 A;  2O85 A;  1J9B A;  1U3I A;  1Y6E A;  3VWU A;  2PER A;  2MYG A;  1QXH A;  5G30 A;  5JCW A;  2L4Q A;  3IPZ A;  16GS A;  1HNB A;  4KGI A;  1SD9 A;  3PGT A;  1X5C A;  2OJL A;  2EIR A;  1WRY A;  1R5P A;  3DVW A;  3E0U A;  2WJU A;  5J41 A;  4I6X A;  4IKH A;  1AUC A;  2H8L A;  2R3X A;  3BCK A;  4ILF A;  1R26 A;  1PSQ A;  1FG4 A;  3M8N A;  2H70 A;  1X0R A;  2FY6 A;  2B5X A;  1PL1 A;  3VWW A;  2OE3 A;  1C72 A;  1SYR A;  4KAE A;  3TJK A;  5KN1 A;  3EMP A;  2YAN A;  3D4T A;  1TI3 A;  1KNG A;  2GT5 A;  1EZK A;  2FWG A;  1GUM A;  2O7K A;  4ACS A;  1GSS A;  2MMN A;  4Q5Q A;  4MZC A;  2AAW A;  2F9S A;  3APO A;  1TRV A;  1XWC A;  2LRT A;  3RHC A;  1T00 A;  5B8A A;  1ML6 A;  2IMK A;  5D8I A;  2VLT A;  2XHF A;  5AIS A;  1PA3 A;  2KLX A;  1ACV A;  3ZTL A;  4IVF A;  3PH9 A;  3ZRD A;  1PD2 1;  4HDE A;  2KOK A;  2WCI A;  1S3A A;  1YF1 A;  2K6V A;  2VL2 A;  1A8L A;  4KB3 A;  3QAW A;  1GSD A;  1Z5Y E;  2F3M A;  2NBS A;  2IFQ A;  2V6O A;  1SEN A;  3DXB A;  3CSH A;  5HFI A;  4NAX A;  4GRF A;  2H6Z A;  4WEY A;  5CRW A;  5DBQ A;  3W8J A;  4XIH A;  1NSW A;  2GSR A;  2KHP A;  3MWH A;  5CRE A;  6GSX A;  5CRG A;  3KEB A;  1OAZ A;  3ME8 A;  5J9C A;  5HR0 A;  4PGT A;  5AGY A;  1TDI A;  4L5O A;  3ZLP A;  3FRC A;  1F37 A;  2GQL A;  2MMA A;  2X8H A;  1X9M B;  5E59 A;  1PRX A;  2JAC A;  4OMV A;  3HCZ A;  2VCZ A;  4V2L A;  1EGR A;  3DVX A;  4WR4 A;  1GSQ A;  2F8F A;  2MMO A;  1Q98 A;  3K8N A;  1Y25 A;  3LJR A;  4CW9 A;  2P31 A;  5FT3 A;  2FWE A;  5J5N A;  3LXZ A;  2HT9 A;  2RM6 A;  2NTO A;  3Q19 A;  1XFL A;  2ZNM A;  5DVB A;  3G9B A;  19GS A;  3UOM A;  4FO5 A;  3KZQ A;  1OC8 A;  4HJM A;  4N0V A;  2FHE A;  3IA1 A;  1ST9 A;  3FEU A;  1E2Y A;  2LEG A;  4PNF A;  2VCV A;  5DDL A;  2DMM A;  4AJ6 A;  3GKM A;  1OC9 A;  3DYR A;  5JWO B;  1A0R P;  1VF3 A;  1XPV A;  2VOC A;  5ECP B;  5H5Q A;  4GSN A;  3ZFB A;  2IME A;  4EL1 A;  4F82 A;  2GST A;  2IMF A;  1EP7 A;  2HZE B;  4WR5 A;  3EMX A;  1TJD A;  2DJK A;  3EUR A;  1O81 A;  1QK8 A;  4NPB A;  1E6B A;  1JZW A;  3VPQ A;  1ZMA A;  3BOA A;  2VO4 A;  4K9Z A;  2OE1 A;  3AY8 A;  3FK8 A;  3TJF A;  5IOW A;  2YPM A;  5ECO B;  2M46 A;  5EY6 A;  5F0G A;  2GVP A;  2R5G A;  3ME7 A;  2FGX A;  2B1K A;  2L6D A;  1TRS A;  3TCO A;  5AIX A;  2IMI A;  2LV3 A;  1T4Y A;  3HKR A;  1QUW A;  3ED3 A;  1W89 A;  3GSS A;  1EOG A;  2FA4 A;  1F2E A;  4GSS A;  5IPG A;  4ZIL A;  18GS A;  3QR6 A;  5ABR A;  3ZIJ A;  1Q4J A;  5DQY A;  4HI7 A;  4POM A;  1WIK A;  1UC7 A;  3LFL A;  1SK0 A;  2X8C A;  1F3A A;  2G0F A;  5IM9 A;  5GAN D;  3IAM 2;  4HOJ A;  2YWN A;  2DIZ A;  3Q74 A;  1UA5 A;  2KUC A;  1BED A;  1B9X C;  2YWM A;  2AB6 A;  1QMV A;  3IBH A;  17GS A;  3GUR A;  4IQ1 A;  1TK8 B;  3VPT A;  1MD3 A;  3F6D A;  5GST A;  3F3Q A;  2LJA A;  2AUV A;  2L57 A;  3DD3 A;  4MK3 A;  4BVX A;  2OAD A;  3LWA A;  1H4O A;  1TKD B;  5FHI A;  2O8V B;  2D2Z A;  6GSS A;  1YZX A;  2MZC A;  3A2X A;  3TOU A;  4YAV A;  3FR3 A;  1GUH A;  1VRS D;  3IHQ A;  5G1L A;  4POK A;  2ALB A;  4F0B A;  1XWA A;  1GP1 A;  2FWF A;  4TVE A;  1K0O A;  4GF0 A;  2IN3 A;  3HVV A;  1PKW A;  3TRQ A;  1TTZ A;  3HXS A;  3LYK A;  2ZUP A;  2AHE A;  3KGK A;  3P90 A;  5ID2 B;  2WDU A;  3IAS 2;  4AF2 A;  3LSZ A;  3U6V A;  1U88 A;  3KH7 A;  3GTU B;  4MH2 A;  3ZVJ A;  5JWR B;  3G7I A;  14GS A;  2H1D A;  2PGT A;  3DML A;  1M9A A;  5G5E A;  4LL1 B;  1H75 A;  1GH2 A;  4O92 A;  2OAC A;  2VIM A;  2VCX A;  2LTK A;  2GZY A;  3VWX A;  2YZH A;  3C7M A;  3EU4 A;  3MAK A;  1QFN A;  1ZOF A;  3QD9 A;  3RBT A;  3W8S A;  5FWG A;  4F0C A;  2HRN A;  1VF2 A;  2F8A A;  3W6G A;  1Z7R A;  2HZF A;  1FB0 A;  1Z6N A;  1ZYE A;  3NIV A;  3I9V 2;  1OKT A;  2YV7 A;  1GLQ A;  4LMV A;  1YQ1 A;  4PXO A;  3EC3 A;  1TU7 A;  4OO5 A;  1OC9 B;  5ENU A;  1ILO A;  1GLP A;  2VL9 A;  4PX1 A;  4RI6 A;  1OE7 A;  3L9S A;  1HYU A;  4HEA 2;  5EPF A;  4KND A;  3CXG A;  2C3N A;  1HNC A;  3PR8 A;  3DRN A;  1A2L A;  3ZIT A;  3RPP A;  5ECI B;  1AC1 A;  5E4W A;  2WZ9 A;  4K6X A;  5ECH B;  4J56 E;  1ERU A;  2GT6 A;  4J2F A;  4IW9 A;  4RQR A;  2OBI A;  3I6A A;  1PGT A;  1T4Z A;  2B7K A;  4D73 A;  3GKK A;  4PUA A;  4CHS A;  1F3B A;  4TXV A;  2I1U A;  3P2A A;  1PX6 A;  1J08 A;  3HJP A;  2VD1 A;  5A5K A;  4XTS A;  1SL1 B;  2CAQ A;  1KEB A;  3IXR A;  4HS1 A;  3QAV A;  2P5R A;  4ZIJ A;  3UBK A;  1XCC A;  3QDN A;  4QL7 A;  1F9M A;  3TKP A;  1M2D A;  1XIY A;  2C80 A;  4MP4 A;  1GSU A;  1GUL A;  4EDZ A;  1JLV A;  3M3M A;  1OE8 A;  4KCE A;  4G10 A;  2C1Y A;  2Z9S A;  4K0N A;  2L59 A;  3FHK A;  1IYH A;  1A23 A;  2V41 A;  1XWB A;  4TRX A;  1T1V A;  2YCD A;  1A24 A;  4ZB6 A;  1V57 A;  5G2Z A;  3D6I A;  4N0Z A;  1YY7 A;  1SKS B;  4OFM A;  2VL2 C;  5G1K A;  4HZ2 A;  3F9U A;  3NZN A;  2FNO A;  2H66 A;  3DGQ A;  2F51 A;  1B9Y C;  4KW6 A;  2JZT A;  2CQ9 A;  4YQV A;  3A2V A;  1THX A;  2REM A;  2B6M A;  4H86 A;  3L0H A;  4IEL A;  2RII A;  3FZA A;  1MDI A;  3FZ9 A;  2JL4 A;  4IS0 A;  2HZE A;  5C00 A;  1N2A A;  2A2R A;  4YAP A;  1X5D A;  5IMF A;  2HSY A;  5JCU A;  3UAP A;  4WBJ A;  2TRC P;  3IE3 A;  1GUK A;  3O6T A;  3FY7 A;  4TR1 A;  4MPF A;  3S9F A;  3SBC A;  1UVZ A;  2WFC A;  1S3C A;  4AGS A;  1RW1 A;  3RPN A;  3BD2 A;  5GAP D;  4IJI A;  4X0X A;  2B7J A;  1PN9 A;  2P5Q A;  4OD7 A;  3GL3 A;  2H6X A;  4ULX A;  2VL3 A;  5ECR B;  2H1G A;  2V6K A;  5HR1 A;  4PQH A;  5A4U A;  3N5O A;  1T3B A;  1KBN A;  3ZYW A;  3C1S A;  2G2Q A;  3KCM A;  3GHA A;  3KJY A;  2IIY A;  1FW1 A;  3WT1 A;  2PBJ A;  5ECL B;  2RUF A;  1R4W A;  3APQ A;  6GSU A;  3VI5 A;  5DJL A;  4MF5 A;  3UVH A;  3FW2 A;  1M9B A;  1TW9 A;  3QCP A;  2HNL A;  3LXT A;  1GNW A;  2GSS A;  2GQK A;  3QMX A;  1XZO A;  3DWV A;  1B48 A;  3UMA A;  1GL8 A;  4POL A;  4G19 A;  2GS3 A;  4MF7 A;  4ISD A;  3HZ8 A;  4MCU A;  3V1W A;  4HQZ A;  2K8S A;  4Z7X A;  1I9D A;  3TUE A;  1GSE A;  2ON5 A;  1U6T A;  1YEP A;  3MDK A;  1R7H A;  2L5O A;  3GNJ A;  5IQY A;  3M1G A;  4Q5F A;  2LNS A;  2V32 A;  1GTA A;  3M9J A;  4EKZ A;  2VCT A;  1EV4 A;  2B1L A;  5L71 A;  3WGX A;  3HVX A;  5A4V A;  4MA9 A;  1CQG A;  2FLS A;  4MJA A;  2K18 A;  2LRC A;  3Q6O A;  2K8V A;  2N5B A;  10GS A;  5DCH A;  4D73 B;  1TP9 A;  5ID2 A;  4TR0 A;  4EO3 A;  3GV1 A;  1XW9 A;  4IQA A;  4I2T A;  5A4W A;  3GTU A;  1X9S B;  1R5A A;  3GIX A;  3ZFL A;  3TRX A;  2L5L A;  4K8M A;  6GSV A;  3UIW A;  4K1F A;  4LL4 B;  2IJY A;  2E2M A;  1N8J A;  5HQP A;  3DKS A;  1ZCP A;  2X64 A;  1TRW A;  4HQS A;  3LYP A;  4TOP A;  2C4J A;  2AV4 A;  3F6F A;  2JSZ A;  4V2M A;  4GCI A;  1AQX A;  2J23 A;  2YJ7 A;  5IO0 A;  4RUV A;  3WGE A;  2GLR A;  2WGR A;  3HHV A;  3TKS E;  4EC0 A;  3J7Y k;  4MH3 A;  1THO A;  2R4V A;  4TN8 A;  4NWY A;  1WJK A;  2H72 A;  3QFB C;  5ECM B;  5ECS A;  4XS4 A;  1BAY A;  3CTG A;  3ERG A;  2H75 A;  4L8E A;  3ZL5 A;  2JU5 A;  3GKX A;  5DAK B;  2VLU A;  1WOU A;  3BJ5 A;  1X9W B;  1IYI A;  5D96 A;  4MZW A;  1AQV A;  2HLS A;  4ZB8 A;  3F8U A;  3TKR A;  4PNG A;  3TJJ A;  3J7Y b;  5IOX A;  4TR1 B;  2VCW A;  3UJ1 A;  5B6M A;  4XRD A;  2CZ2 A;  3GKN A;  2C3T A;  3LG6 A;  3CRT A;  4G9H A;  4LMW A;  4JZQ A;  2X99 A;  2CT6 A;  1SL2 B;  4ML1 A;  2YJH A;  3D4M A;  4CDO A;  2CAI A;  5F06 A;  2M80 A;  2I81 A;  1WMJ A;  2IMD A;  3GFK A;  2HSH A;  4KCA A;  1WP0 A;  4V2N A;  4ML6 A;  4F03 A;  2CVB A;  4QL9 A;  3GN3 A;  5CP1 A;  5HR2 A;  4GQC A;  4AJ8 A;  1VF1 A;  3VWV A;  1M2A A;  1XBS A;  3KD0 A;  1JHB A;  4OFT A;  4X43 A;  3TDG A;  3TGZ A;  2YZU A;  3P8W A;  4WF5 A;  3APS A;  3UVT A;  3A3T A;  2M72 A;  5IMD A;  1DE1 A;  4NHZ A;  4OFN A;  1K0D A;  5KN3 A;  1M0U A;  2YWI A;  3A2W A;  2IL3 A;  4JU5 A;  2HE3 A;  2FWH A;  2GQM A;  3F4R A;  2LKU A;  5AN1 A;  3TB2 A;  4I97 A;  2DML A;  4YQU A;  2I4A A;  3ZML A;  1B8X A;  2DIY A;  4OCF A;  1A8Y A;  1XWK A;  4ECJ A;  4O7H A;  2H1B A;  4PQ1 A;  4JRR A;  4EE0 A;  4N11 A;  4JR6 A;  1B4P A;  5IMA A;  4TR3 A;  1Z3E A;  3QPM A;  2CX4 A;  3E3E A;  4XCS A;  1OKD A;  3UL3 A;  3VUR A;  4K0G A;  1ERV A;  20GS A;  4MPG A;  5J4U A;  1G6Y A;  5ECN B;  4FIW A;  4MJC A;  3RAZ A;  1FOV A;  1GWC A;  3MNG A;  5IMZ A;  3CBU A;  9GSS A;  1ZZY A;  1V9W A;  2TIR A;  4EXJ A;  1QGV A;  4BL7 A;  3TRP A;  2LS5 A;  3KMN A;  2GZP A;  2DSA A;  5IIZ A;  2C0E A;  1SJI A;  3FYG A;  4GWR A;  1UN2 A;  3JCM L;  3SWL A;  3TJB A;  5HFK A;  1CQH A;  1HD2 A;  1M7T A;  4KX4 A;  2ZCT A;  4X1U A;  1JLW A;  3CSJ A;  5CRH A;  2EC4 A;  1G0T A;  2LUS A;  2QC7 A;  3HD5 A;  1ZYQ B;  1TRU A;  4E8H A;  1OYJ A;  2EIO A;  2PVO C;  2R37 A;  4BPY A;  1V40 A;  4JR4 A;  1AIU A;  5COH A;  4N10 A;  1EEM A;  2V1M A;  1W4V A;  4XS4 B;  3WYW A;  2DJ0 A;  3CSI A;  4ZL9 A;  2RLI A;  1Z9H A;  1ERW A;  3IV4 A;  4EDY A;  6GSY A;  2CA8 A;  4BA7 A;  4RQX A;  1K3L A;  3I43 A;  5IMV A;  2A2S A;  2FCH A;  1FHE A;  1ABA A;  3KXO A;  3CMI A;  3EYT A;  1WE0 A;  1O85 A;  1HNA A;  2JZS A;  1O8X A;  3GX8 A;  4Q5N A;  1I5G A;  3QFA C;  3Q18 A;  3A5W A;  3LEF A;  2E0Q A;  4OWY A;  5DQS A;  3HY2 A;  3TJG A;  1PL2 A;  4LA1 A;  2L6C A;  1YDK A;  4I2U A;  3C73 A;  3IC4 A;  2IWT A;  1MDJ A;  1AW9 A;  3IOS A;  5G31 A;  1DE2 A;  4JED A;  1LJR A;  2LJR A;  1K0M A;  3EIN A;  3C1R A;  1V58 A;  2YV9 A;  3GA4 A;  5G5F A;  3ZZX A;  2QGV A;  4FYU A;  4POB A;  4HZ4 A;  2J9H A;  2NDO A;  2HYX A;  4PUR A;  3H4K A;  2VM1 A;  5CYY A;  1XVQ A;  3CTF A;  1GSF A;  1XW6 A;  1BYE A;  1ZGN A;  5D9W A;  3L4N A;  1Z6M A;  5D93 A;  1JZD A;  2PPT A;  1GRX A;  2GTU A;  1JZR A;  2BTO T;  3M0F A;  4P3Y B;  3VFI A;  1SK2 A;  1YEX A;  4IN0 A;  1PX7 A;  4DVC A;  3GST A;  1FVJ A;  2XBQ A;  5CO3 A;  5HR3 A;  5KN2 A;  1GTU A;  8GSS A;  1LU4 A;  3LQ7 A;  5DAK A;  3FR9 A;  5AIV A;  1TK5 B;  2H19 A;  3FR6 A;  3KP8 A;  2XBI A;  1YKA A;  4JE1 A;  1O7U A;  4BVY A;  1FAA A;  3HJM A;  1GNE A;  5ECQ B;  2DBC A;  2H30 A;  4GST A;  12GS A;  2H0G A;  4FYB A;  2CVK A;  5DAL A;  5INY A;  2LNT A;  1WWJ A;  4IP1 A;  4ZBD A;  5CNW A;  1K3O A;  2B5Y A;  4O32 A;  3IK9 A;  2CZ3 A;  5D73 A;  2DC5 A;  4BWS A;  1YF0 A;  2LQQ A;  4K2D A;  4NXI A;  1SU9 A;  4HJ2 A;  3IDV A;  1O8W A;  3H93 A;  2A4V A;  4ECB A;  2GSQ A;  2CV4 A;  1BQ7 A;  3FKF A;  2TRX A;  4BWQ A;  1ERT A;  3G7Y A;  4EUY A;  1HQO A;  2K9F A;  4GXZ A;  5HFG A;  3TKS A;  2WB9 A;  2JAD A;  3R2Q A;  4L0W A;  4WF4 A;  2GGT A;  5IO2 A;  2BJX A;  3F4S A;  1FO5 A;  2WS2 A;  3KMO A;  4WBR D;  2MBT A;  1SYX A;  2GZZ A;  2KP2 A;  3ERF A;  1G7E A;  1XVW A;  2H0H A;  13GS A;  1T8E B;  3KTL A;  4RI7 A;  3WGD A;  1OVN A;  2C0F A;  3P7X A;  3ZIV A;  1K3Y A;  2KP1 A;  4O5R A;  4N30 A;  2YP6 A;  2DLX A;  3L9U A;  1K0B A;  1PMT A;  5F8B A;  5IMC A;  4ZB9 A;  5F07 A;  4EF0 A;  1YKC A;  1MDK A;  4JBB A;  2XPE A;  3F4T A;  2H74 A;  2ES7 A;  1KTE A;  5GSS A;  3H8Q A;  1AQW A;  3EU3 A;  6GSW A;  22GS A;  3GX0 A;  4K7O A;  5ELA A;  2NPB A;  3PIN A;  3VI7 A;  1QQ2 A;  4I8B A;  4HUA A;  1PQN A;  1EV9 A;  5J3R A;  3L78 A;  1DSB A;  2OKA A;  5D9T A;  3I69 A;  3NOF A;  1B4Q A;  5J9B A;  4KSO A;  3GUS A;  3N9J A;  5IPH A;  2VUP A;  1YJ6 A;  3WD6 A;  1SK1 A;  3RHB A;  3QOU A;  3US3 A;  5B6N A;  2H73 A;  3OR5 A;  2H1A A; 
#chains in the Genus database with same CATH topology
 2OE0 A;  3HVS A;  3H1N A;  3GH6 A;  1AXD A;  3HZ4 A;  2DJJ A;  2RUE A;  1O6J A;  3MYD A;  3KH9 A;  1SD8 A;  1EEJ A;  5JWQ B;  1BJX A;  3VK9 A;  3M9K A;  2XC2 A;  2B3S A;  3D0Z A;  3D22 A;  1XWG A;  4FQU A;  4F9Z A;  2QSI A;  2FA8 A;  2C0G A;  1DBY A;  3EVI A;  5CAX A;  4DSS B;  3LW9 A;  2AYT A;  1ZYP A;  3LGC A;  4TR4 A;  1K0C A;  4K7N A;  2DJ3 A;  4MDC A;  4ZBA A;  3GL5 A;  5B8B A;  1EOH A;  4KDY A;  4BVY B;  3GYK A;  2XPD A;  4KSM A;  2CX3 A;  5H5R A;  2JSY A;  2HI7 A;  3F63 A;  4PQI A;  4HU7 A;  1ZL9 A;  2YWO A;  2VM2 A;  3UAR A;  1WPI A;  5DAL B;  2WRT A;  1K0A A;  3ERW A;  2FUG 2;  4G2E A;  2AJQ B;  3UBL A;  2N5A A;  1TK0 B;  2ON7 A;  3RDW A;  2VAF A;  1GSY A;  2YNX A;  3MIX A;  4TXO A;  2YOI A;  1EWX A;  5KEJ A;  4IP6 A;  4MZB A;  1M99 A;  3DEX A;  4ECC A;  2HXK A;  3U5R E;  1OC3 A;  3ZRE A;  3BBY A;  4XRA A;  1VGL A;  3IR4 A;  1PKZ A;  2L4C A;  3C71 A;  4GQF A;  5ECK B;  3ZMK A;  2E7P A;  4MAB A;  1J0F A;  2NVL A;  5D9X A;  1JZO A;  1NHO A;  1V98 A;  1XW5 A;  3CRU A;  4QQ7 A;  4K7I A;  3GH9 A;  3QAG A;  1SJ6 A;  3KTB A;  2PUK C;  3F0I A;  3ISO A;  5CRD A;  2IPA A;  4ZBB A;  2HFD A;  4V1A p;  4IHU A;  4FH8 A;  4MMM A;  4F2I A;  2RM5 A;  2H71 A;  4OCE A;  3KM6 A;  4MLY A;  4E8E A;  4V1A g;  4YKF A;  1NW2 A;  3HA9 A;  4LLR A;  3IRA A;  4KDX A;  4YH2 A;  3KIJ A;  1DUG A;  1USB A;  1U87 A;  2WUL A;  3HJO A;  2EIQ A;  1K0N A;  2V2G A;  2I9H A;  3E9J B;  5DJM A;  1A2M A;  2PU9 C;  1XXU A;  2C3Q A;  2LRN A;  5ELG A;  1EGO A;  1TXX A;  4G0I A;  3D21 A;  2R2J A;  1V2A A;  3C8E A;  2PVQ A;  3L9V A;  4NHW A;  2IFQ B;  5C04 A;  5EVO A;  5EL8 A;  5LCZ A;  4Q5R A;  1MEK A;  4MJB A;  3TOT A;  11GS A;  2PMT A;  3D5J A;  4EVM A;  2FD3 A;  2CVD A;  4G0K A;  1GTI A;  2DJ1 A;  4ID0 A;  4NV5 A;  4KE3 A;  1A2J A;  3MSZ A;  2LST A;  4L0U A;  5GZZ B;  4FYC A;  1F6M C;  2LQO A;  4ECI A;  4HU9 A;  4KDU A;  4IGJ A;  3GMF A;  1TOF A;  4J57 E;  4KUN A;  1TI1 A;  1S3D A;  1T7P B;  1GTB A;  1O73 A;  2MBS A;  3UEM A;  2MMZ A;  4IJ3 A;  5KOX A;  1SJZ A;  2P0G A;  3R3E A;  4X4J A;  3DIE A;  1RQM A;  2C0D A;  1RK4 A;  2O87 A;  4KH7 A;  3EE2 A;  7GSS A;  2X8G A;  4KA0 A;  1M2B A;  4DSR A;  4ZXG A;  4XS1 A;  2I3Y A;  1MD4 A;  1JFU A;  4GLT A;  1XOB A;  3FMW A;  2OBK A;  3LOR A;  4ZL8 A;  3HDC A;  3O3T A;  4TW5 A;  1ON4 A;  4NV2 A;  5H5S A;  1SL0 B;  4XS6 A;  1NM3 A;  4OO4 A;  2VD0 A;  3FZ5 A;  1Z7P A;  2JZR A;  2DJ2 A;  2GDR A;  3H79 A;  2PWJ A;  3EWL A;  4GTU A;  2H6Y A;  4MJE A;  2N5F A;  3FZ4 A;  3VLN A;  6GST A;  1SKW B;  1BX9 A;  4TXO B;  2H0I A;  1TU8 A;  1VF4 A;  4DEJ A;  4MF6 A;  4TKY A;  4L5L A;  3TKQ A;  4PUF C;  5D9V A;  5KN0 A;  3F3R A;  4MNN A;  2H76 A;  1FVK A;  2VCQ A;  2E2G A;  2HRF A;  4NMU A;  3O76 A;  3G7J A;  2LJK A;  1BG5 A;  1X5E A;  3TKS C;  2QKE A;  2YN1 A;  5DCG A;  1URM A;  4ZL7 A;  3KP9 A;  2VLV A;  2C8U A;  1AAZ A;  2R6K A;  5F05 A;  3HYP A;  5JCG A;  3BCI A;  2OA7 A;  1SKR B;  4YQM A;  1G7O A;  2H01 A;  2B5E A;  1MTC A;  1XOA A;  5LNK e;  4WXT A;  4WKW A;  1NHY A;  3IK7 A;  4XHM A;  2PN8 A;  3ZVJ D;  3GRX A;  1EP8 A;  2O89 A;  1G6W A;  2X49 A;  1A0F A;  5LD0 A;  1LBK A;  4IBP A;  4AJ7 A;  4DSS A;  4WET A;  1U3A A;  4DSQ A;  1FB6 A;  4I5Q A;  2BMX A;  5B7C A;  3CYN A;  3WT2 A;  2O85 A;  1J9B A;  1U3I A;  1Y6E A;  3VWU A;  2PER A;  2MYG A;  1QXH A;  5G30 A;  5JCW A;  2L4Q A;  3IPZ A;  16GS A;  1HNB A;  4KGI A;  1SD9 A;  3PGT A;  1X5C A;  2OJL A;  2EIR A;  1WRY A;  1R5P A;  3DVW A;  3E0U A;  2WJU A;  5J41 A;  4I6X A;  4IKH A;  4K2X A;  1AUC A;  2H8L A;  2R3X A;  3BCK A;  4ILF A;  1R26 A;  1PSQ A;  1FG4 A;  3M8N A;  2H70 A;  1X0R A;  2FY6 A;  2B5X A;  1PL1 A;  3VWW A;  2OE3 A;  1C72 A;  1SYR A;  4KAE A;  3TJK A;  2X4A A;  5KN1 A;  3EMP A;  2YAN A;  3D4T A;  1TI3 A;  1KNG A;  2GT5 A;  1EZK A;  2FWG A;  1GUM A;  2O7K A;  4ACS A;  1GSS A;  2MMN A;  4EIP A;  4Q5Q A;  4MZC A;  2AAW A;  2F9S A;  3APO A;  1TRV A;  1XWC A;  2LRT A;  3RHC A;  1T00 A;  5B8A A;  1ML6 A;  2IMK A;  5D8I A;  2VLT A;  2XHF A;  5AIS A;  1PA3 A;  2KLX A;  1ACV A;  3ZTL A;  4IVF A;  3PH9 A;  3ZRD A;  1PD2 1;  4HDE A;  2KOK A;  2WCI A;  1S3A A;  1YF1 A;  2K6V A;  2VL2 A;  1A8L A;  4KB3 A;  3QAW A;  1GSD A;  1Z5Y E;  2F3M A;  2NBS A;  2HSM A;  2IFQ A;  2V6O A;  1SEN A;  3DXB A;  3CSH A;  5HFI A;  4NAX A;  4GRF A;  2H6Z A;  4WEY A;  5CRW A;  5DBQ A;  3W8J A;  4XIH A;  1NSW A;  2GSR A;  2KHP A;  3MWH A;  5CRE A;  6GSX A;  5CRG A;  3KEB A;  1OAZ A;  3ME8 A;  5J9C A;  5HR0 A;  4PGT A;  5AGY A;  1TDI A;  1PN0 A;  4L5O A;  3ZLP A;  3FRC A;  1F37 A;  2GQL A;  2MMA A;  2X8H A;  1X9M B;  5E59 A;  1PRX A;  2JAC A;  4OMV A;  3HCZ A;  2VCZ A;  4V2L A;  1EGR A;  3DVX A;  5KOW A;  3EPT A;  4WR4 A;  1GSQ A;  2F8F A;  2MMO A;  1Q98 A;  3K8N A;  1Y25 A;  3LJR A;  4CW9 A;  2P31 A;  5FT3 A;  2FWE A;  5J5N A;  3LXZ A;  2HT9 A;  2RM6 A;  2NTO A;  3Q19 A;  1XFL A;  2ZNM A;  5DVB A;  3G9B A;  19GS A;  3UOM A;  4FO5 A;  3KZQ A;  1OC8 A;  4HJM A;  4N0V A;  2FHE A;  3IA1 A;  1ST9 A;  3FEU A;  4KF9 A;  1E2Y A;  2LEG A;  4G0L A;  4PNF A;  2VCV A;  5DDL A;  2DMM A;  4AJ6 A;  5BMU A;  3GKM A;  1OC9 A;  3DYR A;  5JWO B;  1A0R P;  1VF3 A;  1XPV A;  2VOC A;  5ECP B;  5H5Q A;  4GSN A;  3ZFB A;  2IME A;  4EL1 A;  4F82 A;  2GST A;  2IMF A;  1ZYN A;  1EP7 A;  2HZE B;  4WR5 A;  3EMX A;  1TJD A;  4USS A;  2DJK A;  3EUR A;  1O81 A;  1QK8 A;  4NPB A;  1E6B A;  1JZW A;  3VPQ A;  1ZMA A;  3BOA A;  2VO4 A;  4K9Z A;  2OE1 A;  3AY8 A;  3FK8 A;  3TJF A;  5IOW A;  2YPM A;  5ECO B;  2M46 A;  5EY6 A;  5F0G A;  2GVP A;  2R5G A;  3ME7 A;  2FGX A;  2B1K A;  2L6D A;  1TRS A;  3TCO A;  5AIX A;  2IMI A;  2LV3 A;  1T4Y A;  3HKR A;  1QUW A;  3ED3 A;  1W89 A;  3GSS A;  3A5I A;  1EOG A;  2FA4 A;  3PPU A;  1F2E A;  4GSS A;  5IPG A;  4ZIL A;  18GS A;  3QR6 A;  5ABR A;  3ZIJ A;  1Q4J A;  5DQY A;  4HI7 A;  4POM A;  1WIK A;  1UC7 A;  3LFL A;  1SK0 A;  2X8C A;  1F3A A;  2G0F A;  5IM9 A;  5GAN D;  3IAM 2;  4HOJ A;  2YWN A;  2DIZ A;  3Q74 A;  1UA5 A;  2KUC A;  1BED A;  1B9X C;  2YWM A;  4BIK A;  2AB6 A;  1QMV A;  3IBH A;  17GS A;  3GUR A;  4IQ1 A;  1TK8 B;  3VPT A;  1MD3 A;  3F6D A;  5GST A;  3F3Q A;  2LJA A;  2AUV A;  2L57 A;  3DD3 A;  4MK3 A;  4BVX A;  2OAD A;  3LWA A;  1H4O A;  1TKD B;  5FHI A;  2O8V B;  2D2Z A;  6GSS A;  1YZX A;  2MZC A;  3A2X A;  4CY8 A;  3TOU A;  4YAV A;  3FR3 A;  1GUH A;  1VRS D;  3IHQ A;  5G1L A;  4POK A;  2ALB A;  4F0B A;  1XWA A;  1GP1 A;  2FWF A;  4TVE A;  1K0O A;  4GF0 A;  2IN3 A;  3HVV A;  1PKW A;  3TRQ A;  1TTZ A;  3HXS A;  3LYK A;  2ZUP A;  2AHE A;  3KGK A;  3P90 A;  5ID2 B;  2WDU A;  3IAS 2;  4AF2 A;  3LSZ A;  3U6V A;  2HRA A;  1U88 A;  3KH7 A;  3GTU B;  4MH2 A;  3ZVJ A;  5JWR B;  3G7I A;  14GS A;  2H1D A;  2PGT A;  3DML A;  1M9A A;  5G5E A;  4LL1 B;  1H75 A;  1GH2 A;  4O92 A;  2OAC A;  2VIM A;  2VCX A;  2LTK A;  2GZY A;  3VWX A;  2YZH A;  3C7M A;  3EU4 A;  3MAK A;  1QFN A;  1ZOF A;  3QD9 A;  3RBT A;  3W8S A;  5FWG A;  4F0C A;  2HRN A;  1VF2 A;  2F8A A;  3W6G A;  1Z7R A;  2HZF A;  1FB0 A;  1Z6N A;  1ZYE A;  3NIV A;  3I9V 2;  1OKT A;  2YV7 A;  1GLQ A;  4LMV A;  1YQ1 A;  4PXO A;  3EC3 A;  1TU7 A;  4OO5 A;  1OC9 B;  5ENU A;  1ILO A;  1GLP A;  2VL9 A;  4PX1 A;  4RI6 A;  1S3R A;  1OE7 A;  3L9S A;  1HYU A;  4HEA 2;  5EPF A;  4KND A;  3CXG A;  2C3N A;  1HNC A;  3PR8 A;  3DRN A;  1A2L A;  3ZIT A;  3RPP A;  1AC1 A;  5ECI B;  5E4W A;  2WZ9 A;  4K6X A;  5ECH B;  4J56 E;  1ERU A;  2GT6 A;  4J2F A;  4IW9 A;  4RQR A;  2OBI A;  3I6A A;  1PGT A;  1T4Z A;  2B7K A;  4D73 A;  3GKK A;  2DKI A;  4PUA A;  4CHS A;  1F3B A;  4TXV A;  2I1U A;  3P2A A;  1PX6 A;  1J08 A;  3HJP A;  2VD1 A;  5A5K A;  4XTS A;  1SL1 B;  4HSC X;  2CAQ A;  1KEB A;  3IXR A;  4HS1 A;  3QAV A;  2P5R A;  4ZIJ A;  3UBK A;  1XCC A;  3QDN A;  4QL7 A;  1F9M A;  3TKP A;  1M2D A;  1XIY A;  2C80 A;  4MP4 A;  1GSU A;  1GUL A;  4EDZ A;  1JLV A;  3M3M A;  1OE8 A;  4KCE A;  4G10 A;  2C1Y A;  2Z9S A;  4K0N A;  2L59 A;  3FHK A;  1IYH A;  1A23 A;  2V41 A;  1XWB A;  4TRX A;  1T1V A;  2YCD A;  1A24 A;  4ZB6 A;  1V57 A;  5G2Z A;  3D6I A;  4N0Z A;  1YY7 A;  1SKS B;  4OFM A;  2VL2 C;  5G1K A;  4HZ2 A;  3F9U A;  3NZN A;  2FNO A;  2H66 A;  3DGQ A;  2F51 A;  1B9Y C;  4KW6 A;  2JZT A;  2CQ9 A;  4YQV A;  3A2V A;  1THX A;  2REM A;  2B6M A;  4H86 A;  4BVX B;  3L0H A;  4IEL A;  2RII A;  3FZA A;  1MDI A;  3FZ9 A;  2JL4 A;  4IS0 A;  2HZE A;  5C00 A;  1N2A A;  2A2R A;  4YAP A;  1X5D A;  5IMF A;  2HSY A;  4PTS A;  5JCU A;  3UAP A;  4WBJ A;  2TRC P;  3IE3 A;  1GUK A;  3O6T A;  3FY7 A;  4TR1 A;  4MPF A;  3S9F A;  3SBC A;  1UVZ A;  2WFC A;  1S3C A;  4AGS A;  1RW1 A;  3RPN A;  3BD2 A;  5GAP D;  4IJI A;  4X0X A;  2B7J A;  5BRT A;  1PN9 A;  2P5Q A;  4OD7 A;  3GL3 A;  2H6X A;  4ULX A;  2VL3 A;  5ECR B;  2H1G A;  2V6K A;  5HR1 A;  4PQH A;  5A4U A;  3N5O A;  1T3B A;  1KBN A;  3ZYW A;  3C1S A;  2G2Q A;  3KCM A;  3GHA A;  3KJY A;  2IIY A;  1FW1 A;  4O5U A;  4BL7 B;  3WT1 A;  2PBJ A;  5ECL B;  2RUF A;  1R4W A;  3APQ A;  6GSU A;  3VI5 A;  5DJL A;  4MF5 A;  3UVH A;  3FW2 A;  1M9B A;  1TW9 A;  3QCP A;  2HNL A;  3LXT A;  1GNW A;  2GSS A;  2GQK A;  3QMX A;  1XZO A;  3DWV A;  1B48 A;  3UMA A;  1GL8 A;  4POL A;  4G19 A;  2GS3 A;  4MF7 A;  4ISD A;  3HZ8 A;  4MCU A;  3V1W A;  4HQZ A;  2K8S A;  4Z7X A;  1I9D A;  3TUE A;  1GSE A;  2ON5 A;  1U6T A;  1YEP A;  3MDK A;  1R7H A;  2L5O A;  3GNJ A;  5IQY A;  3M1G A;  4Q5F A;  2LNS A;  4O5Q A;  2V32 A;  1GTA A;  3M9J A;  4EKZ A;  2VCT A;  1EV4 A;  2B1L A;  5L71 A;  4YKG A;  3WGX A;  3HVX A;  5A4V A;  2A4H A;  4MA9 A;  4ICY A;  1CQG A;  2FLS A;  4MJA A;  2K18 A;  2LRC A;  3Q6O A;  2K8V A;  2N5B A;  10GS A;  5DCH A;  4D73 B;  1TP9 A;  5ID2 A;  4TR0 A;  4EO3 A;  3GV1 A;  1XW9 A;  4IQA A;  4I2T A;  5A4W A;  3GTU A;  1X9S B;  1R5A A;  3GIX A;  3ZFL A;  3TRX A;  2L5L A;  4K8M A;  6GSV A;  3UIW A;  4K1F A;  4LL4 B;  2IJY A;  2E2M A;  1N8J A;  5HQP A;  4CY6 A;  3DKS A;  1ZCP A;  2X64 A;  1TRW A;  4HQS A;  3LYP A;  4TOP A;  2C4J A;  2AV4 A;  3F6F A;  2JSZ A;  4V2M A;  4GCI A;  1AQX A;  2J23 A;  2YJ7 A;  5IO0 A;  4RUV A;  3WGE A;  2GLR A;  2WGR A;  3HHV A;  3TKS E;  4EC0 A;  3J7Y k;  4MH3 A;  1THO A;  2R4V A;  4TN8 A;  4NWY A;  1WJK A;  2H72 A;  3QFB C;  5ECM B;  5ECS A;  4XS4 A;  1BAY A;  3CTG A;  3ERG A;  2H75 A;  4L8E A;  3ZL5 A;  2JU5 A;  3GKX A;  5DAK B;  2VLU A;  1WOU A;  3BJ5 A;  2R0P A;  1X9W B;  1PFO A;  1IYI A;  5D96 A;  4MZW A;  1AQV A;  2HLS A;  4ZB8 A;  3F8U A;  3TKR A;  4PNG A;  3TJJ A;  3J7Y b;  3HVN A;  5IOX A;  4TR1 B;  2VCW A;  2DKH A;  3UJ1 A;  5B6M A;  4XRD A;  2CZ2 A;  3GKN A;  2C3T A;  3LG6 A;  3CRT A;  4G9H A;  4LMW A;  4JZQ A;  2X99 A;  2CT6 A;  1SL2 B;  4ML1 A;  2YJH A;  3D4M A;  4CDO A;  2CAI A;  5F06 A;  2M80 A;  2I81 A;  1WMJ A;  2IMD A;  3GFK A;  1M3I A;  2HSH A;  4KCA A;  1WP0 A;  4V2N A;  4ML6 A;  1XG8 A;  4F03 A;  2CVB A;  4QL9 A;  3GN3 A;  5CP1 A;  5HR2 A;  4GQC A;  4AJ8 A;  1VF1 A;  3VWV A;  1M2A A;  1XBS A;  3KD0 A;  1JHB A;  4OFT A;  4X43 A;  3TDG A;  3TGZ A;  2YZU A;  3P8W A;  4WF5 A;  3APS A;  3UVT A;  3A3T A;  2M72 A;  5IMD A;  1DE1 A;  4NHZ A;  4OFN A;  1K0D A;  5KN3 A;  1M0U A;  2YWI A;  3A2W A;  2IL3 A;  4JU5 A;  2HE3 A;  2FWH A;  2GQM A;  3F4R A;  2LKU A;  5AN1 A;  3TB2 A;  4I97 A;  2DML A;  4YQU A;  2I4A A;  3ZML A;  1B8X A;  2DIY A;  4OCF A;  1A8Y A;  1XWK A;  2QA2 A;  4ECJ A;  4O7H A;  2H1B A;  4PQ1 A;  4JRR A;  4EE0 A;  4N11 A;  4JR6 A;  1B4P A;  5IMA A;  4TR3 A;  1Z3E A;  3QPM A;  2CX4 A;  4Z2R A;  3E3E A;  4XCS A;  1OKD A;  3UL3 A;  3VUR A;  4K0G A;  1ERV A;  20GS A;  4MPG A;  5J4U A;  1G6Y A;  5ECN B;  2R0C A;  4FIW A;  4MJC A;  3RAZ A;  1FOV A;  1GWC A;  3MNG A;  5IMZ A;  3CBU A;  9GSS A;  1ZZY A;  1V9W A;  2TIR A;  4EXJ A;  1QGV A;  4BL7 A;  3TRP A;  2LS5 A;  3KMN A;  2GZP A;  2DSA A;  5IIZ A;  2C0E A;  3IC8 A;  1SJI A;  3FYG A;  4GWR A;  1UN2 A;  3JCM L;  3SWL A;  3TJB A;  5HFK A;  1CQH A;  1HD2 A;  1M7T A;  4KX4 A;  2ZCT A;  4X1U A;  1JLW A;  3CSJ A;  5CRH A;  2EC4 A;  1G0T A;  2LUS A;  2QC7 A;  3HD5 A;  1ZYQ B;  1TRU A;  4E8H A;  1OYJ A;  2EIO A;  2PVO C;  2QA1 A;  2R37 A;  4BPY A;  1V40 A;  4JR4 A;  1AIU A;  5COH A;  4N10 A;  1EEM A;  4EIQ A;  2V1M A;  1W4V A;  4XS4 B;  3WYW A;  2DJ0 A;  3CSI A;  4ZL9 A;  2RLI A;  1Z9H A;  1ERW A;  3IV4 A;  4EDY A;  6GSY A;  2CA8 A;  4BA7 A;  4RQX A;  1K3L A;  3I43 A;  5IMV A;  2A2S A;  2FCH A;  1FHE A;  1ABA A;  3KXO A;  3CMI A;  3EYT A;  1WE0 A;  1O85 A;  1HNA A;  2JZS A;  1O8X A;  3GX8 A;  4Q5N A;  1I5G A;  3QFA C;  3Q18 A;  3A5W A;  3LEF A;  2E0Q A;  4OWY A;  5DQS A;  3HY2 A;  3TJG A;  1PL2 A;  4LA1 A;  2L6C A;  1YDK A;  4I2U A;  3C73 A;  3IC4 A;  2IWT A;  1MDJ A;  1AW9 A;  3IOS A;  5G31 A;  1DE2 A;  4JED A;  1LJR A;  2LJR A;  1K0M A;  3EIN A;  3C1R A;  1V58 A;  2YV9 A;  3GA4 A;  5G5F A;  3ZZX A;  2QGV A;  4FYU A;  4POB A;  4HZ4 A;  2J9H A;  2NDO A;  2HRK A;  2HYX A;  4PUR A;  3H4K A;  2VM1 A;  1M3J A;  5CYY A;  1XVQ A;  3CTF A;  1GSF A;  1XW6 A;  1BYE A;  1ZGN A;  5D9W A;  3L4N A;  1Z6M A;  5D93 A;  1JZD A;  2PPT A;  4Z2T A;  1GRX A;  2GTU A;  1JZR A;  2BTO T;  4K5R A;  3M0F A;  4P3Y B;  3VFI A;  1SK2 A;  1YEX A;  4IN0 A;  1PX7 A;  4DVC A;  3GST A;  1FVJ A;  2XBQ A;  5CO3 A;  5HR3 A;  5KN2 A;  1GTU A;  8GSS A;  1LU4 A;  3LQ7 A;  5DAK A;  3FR9 A;  5AIV A;  1TK5 B;  2H19 A;  3FR6 A;  3KP8 A;  2XBI A;  1YKA A;  4JE1 A;  1O7U A;  4BVY A;  1FAA A;  3HJM A;  1GNE A;  4A5P A;  5ECQ B;  2DBC A;  2A2P A;  2H30 A;  4GST A;  12GS A;  2H0G A;  4FYB A;  2CVK A;  5DAL A;  5INY A;  2LNT A;  1WWJ A;  4IP1 A;  4ZBD A;  5CNW A;  1K3O A;  2B5Y A;  4O32 A;  3IK9 A;  2CZ3 A;  5D73 A;  2DC5 A;  2R0G A;  4BWS A;  1YF0 A;  4K5S A;  2LQQ A;  4K2D A;  4NXI A;  1SU9 A;  4HJ2 A;  3IDV A;  1O8W A;  3H93 A;  2A4V A;  4ECB A;  2GSQ A;  2CV4 A;  1BQ7 A;  3FKF A;  2TRX A;  4BWQ A;  1ERT A;  3G7Y A;  4EUY A;  1HQO A;  2K9F A;  4GXZ A;  5HFG A;  3TKS A;  2WB9 A;  2JAD A;  3R2Q A;  4L0W A;  4WF4 A;  2GGT A;  1FOH A;  5IO2 A;  2BJX A;  3F4S A;  1FO5 A;  2WS2 A;  3KMO A;  4WBR D;  2MBT A;  1SYX A;  2GZZ A;  2KP2 A;  3ERF A;  1G7E A;  1XVW A;  2H0H A;  13GS A;  3CQF A;  1T8E B;  3KTL A;  4RI7 A;  3WGD A;  1OVN A;  2C0F A;  3P7X A;  3ZIV A;  1K3Y A;  2KP1 A;  4O5R A;  4N30 A;  2YP6 A;  2DLX A;  3L9U A;  1K0B A;  1PMT A;  5F8B A;  5IMC A;  4ZB9 A;  5F07 A;  4EF0 A;  1YKC A;  1MDK A;  4JBB A;  2XPE A;  3F4T A;  2H74 A;  2ES7 A;  4Z2U A;  2UZ8 A;  1KTE A;  5GSS A;  3H8Q A;  3IHG A;  1AQW A;  3EU3 A;  6GSW A;  22GS A;  3GX0 A;  4K7O A;  5ELA A;  2NPB A;  3PIN A;  3VI7 A;  1QQ2 A;  4I8B A;  4HUA A;  1PQN A;  1EV9 A;  5J3R A;  3L78 A;  1DSB A;  2OKA A;  5D9T A;  3I69 A;  3NOF A;  1B4Q A;  5J9B A;  4KSO A;  3GUS A;  3N9J A;  5IPH A;  2VUP A;  1YJ6 A;  3WD6 A;  1SK1 A;  3RHB A;  3QOU A;  3US3 A;  5B6N A;  2H73 A;  3OR5 A;  2H1A A; 
#chains in the Genus database with same CATH homology
 2OE0 A;  3HVS A;  3H1N A;  3GH6 A;  1AXD A;  3HZ4 A;  2DJJ A;  2RUE A;  1O6J A;  3MYD A;  3KH9 A;  1SD8 A;  1EEJ A;  5JWQ B;  1BJX A;  3VK9 A;  3M9K A;  2XC2 A;  2B3S A;  3D0Z A;  3D22 A;  1XWG A;  4FQU A;  4F9Z A;  2QSI A;  2FA8 A;  2C0G A;  1DBY A;  3EVI A;  5CAX A;  4DSS B;  3LW9 A;  2AYT A;  1ZYP A;  3LGC A;  4TR4 A;  1K0C A;  4K7N A;  2DJ3 A;  4MDC A;  4ZBA A;  3GL5 A;  5B8B A;  1EOH A;  4KDY A;  4BVY B;  3GYK A;  2XPD A;  4KSM A;  2CX3 A;  5H5R A;  2JSY A;  2HI7 A;  3F63 A;  4PQI A;  4HU7 A;  1ZL9 A;  2YWO A;  2VM2 A;  3UAR A;  1WPI A;  5DAL B;  2WRT A;  1K0A A;  3ERW A;  2FUG 2;  4G2E A;  2AJQ B;  3UBL A;  2N5A A;  1TK0 B;  2ON7 A;  3RDW A;  2VAF A;  1GSY A;  2YNX A;  3MIX A;  4TXO A;  2YOI A;  1EWX A;  5KEJ A;  4IP6 A;  4MZB A;  1M99 A;  3DEX A;  4ECC A;  2HXK A;  3U5R E;  1OC3 A;  3ZRE A;  3BBY A;  4XRA A;  1VGL A;  3IR4 A;  1PKZ A;  2L4C A;  3C71 A;  4GQF A;  5ECK B;  3ZMK A;  2E7P A;  4MAB A;  1J0F A;  2NVL A;  5D9X A;  1JZO A;  1NHO A;  1V98 A;  1XW5 A;  3CRU A;  4QQ7 A;  4K7I A;  3GH9 A;  3QAG A;  1SJ6 A;  3KTB A;  2PUK C;  3F0I A;  3ISO A;  5CRD A;  2IPA A;  4ZBB A;  2HFD A;  4V1A p;  4IHU A;  4FH8 A;  4MMM A;  4F2I A;  2RM5 A;  2H71 A;  4OCE A;  3KM6 A;  4MLY A;  4E8E A;  4V1A g;  4YKF A;  1NW2 A;  3HA9 A;  4LLR A;  3IRA A;  4KDX A;  4YH2 A;  3KIJ A;  1DUG A;  1USB A;  1U87 A;  2WUL A;  3HJO A;  2EIQ A;  1K0N A;  2V2G A;  2I9H A;  3E9J B;  5DJM A;  1A2M A;  2PU9 C;  1XXU A;  2C3Q A;  2LRN A;  5ELG A;  1EGO A;  1TXX A;  4G0I A;  3D21 A;  2R2J A;  1V2A A;  3C8E A;  2PVQ A;  3L9V A;  4NHW A;  2IFQ B;  5C04 A;  5EVO A;  5EL8 A;  5LCZ A;  4Q5R A;  1MEK A;  4MJB A;  3TOT A;  11GS A;  2PMT A;  3D5J A;  4EVM A;  2FD3 A;  2CVD A;  4G0K A;  1GTI A;  2DJ1 A;  4ID0 A;  4NV5 A;  4KE3 A;  1A2J A;  3MSZ A;  2LST A;  4L0U A;  5GZZ B;  4FYC A;  1F6M C;  2LQO A;  4ECI A;  4HU9 A;  4KDU A;  4IGJ A;  3GMF A;  1TOF A;  4J57 E;  4KUN A;  1TI1 A;  1S3D A;  1T7P B;  1GTB A;  1O73 A;  2MBS A;  3UEM A;  2MMZ A;  4IJ3 A;  5KOX A;  1SJZ A;  2P0G A;  3R3E A;  4X4J A;  3DIE A;  1RQM A;  2C0D A;  1RK4 A;  2O87 A;  4KH7 A;  3EE2 A;  7GSS A;  2X8G A;  4KA0 A;  1M2B A;  4DSR A;  4ZXG A;  4XS1 A;  2I3Y A;  1MD4 A;  1JFU A;  4GLT A;  1XOB A;  3FMW A;  2OBK A;  3LOR A;  4ZL8 A;  3HDC A;  3O3T A;  4TW5 A;  1ON4 A;  4NV2 A;  5H5S A;  1SL0 B;  4XS6 A;  1NM3 A;  4OO4 A;  2VD0 A;  3FZ5 A;  1Z7P A;  2JZR A;  2DJ2 A;  2GDR A;  3H79 A;  2PWJ A;  3EWL A;  4GTU A;  2H6Y A;  4MJE A;  2N5F A;  3FZ4 A;  3VLN A;  6GST A;  1SKW B;  1BX9 A;  4TXO B;  2H0I A;  1TU8 A;  1VF4 A;  4DEJ A;  4MF6 A;  4TKY A;  4L5L A;  3TKQ A;  4PUF C;  5D9V A;  5KN0 A;  3F3R A;  4MNN A;  2H76 A;  1FVK A;  2VCQ A;  2E2G A;  2HRF A;  4NMU A;  3O76 A;  3G7J A;  2LJK A;  1BG5 A;  1X5E A;  3TKS C;  2QKE A;  2YN1 A;  5DCG A;  1URM A;  4ZL7 A;  3KP9 A;  2VLV A;  2C8U A;  1AAZ A;  2R6K A;  5F05 A;  3HYP A;  5JCG A;  3BCI A;  2OA7 A;  1SKR B;  4YQM A;  1G7O A;  2H01 A;  2B5E A;  1MTC A;  1XOA A;  5LNK e;  4WXT A;  4WKW A;  1NHY A;  3IK7 A;  4XHM A;  2PN8 A;  3ZVJ D;  3GRX A;  1EP8 A;  2O89 A;  1G6W A;  2X49 A;  1A0F A;  5LD0 A;  1LBK A;  4IBP A;  4AJ7 A;  4DSS A;  4WET A;  1U3A A;  4DSQ A;  1FB6 A;  4I5Q A;  2BMX A;  5B7C A;  3CYN A;  3WT2 A;  2O85 A;  1J9B A;  1U3I A;  1Y6E A;  3VWU A;  2PER A;  2MYG A;  1QXH A;  5G30 A;  5JCW A;  2L4Q A;  3IPZ A;  16GS A;  1HNB A;  4KGI A;  1SD9 A;  3PGT A;  1X5C A;  2OJL A;  2EIR A;  1WRY A;  1R5P A;  3DVW A;  3E0U A;  2WJU A;  5J41 A;  4I6X A;  4IKH A;  4K2X A;  1AUC A;  2H8L A;  2R3X A;  3BCK A;  4ILF A;  1R26 A;  1PSQ A;  1FG4 A;  3M8N A;  2H70 A;  1X0R A;  2FY6 A;  2B5X A;  1PL1 A;  3VWW A;  2OE3 A;  1C72 A;  1SYR A;  4KAE A;  3TJK A;  2X4A A;  5KN1 A;  3EMP A;  2YAN A;  3D4T A;  1TI3 A;  1KNG A;  2GT5 A;  1EZK A;  2FWG A;  1GUM A;  2O7K A;  4ACS A;  1GSS A;  2MMN A;  4EIP A;  4Q5Q A;  4MZC A;  2AAW A;  2F9S A;  3APO A;  1TRV A;  1XWC A;  2LRT A;  3RHC A;  1T00 A;  5B8A A;  1ML6 A;  2IMK A;  5D8I A;  2VLT A;  2XHF A;  5AIS A;  1PA3 A;  2KLX A;  1ACV A;  3ZTL A;  4IVF A;  3PH9 A;  3ZRD A;  1PD2 1;  4HDE A;  2KOK A;  2WCI A;  1S3A A;  1YF1 A;  2K6V A;  2VL2 A;  1A8L A;  4KB3 A;  3QAW A;  1GSD A;  1Z5Y E;  2F3M A;  2NBS A;  2HSM A;  2IFQ A;  2V6O A;  1SEN A;  3DXB A;  3CSH A;  5HFI A;  4NAX A;  4GRF A;  2H6Z A;  4WEY A;  5CRW A;  5DBQ A;  3W8J A;  4XIH A;  1NSW A;  2GSR A;  2KHP A;  3MWH A;  5CRE A;  6GSX A;  5CRG A;  3KEB A;  1OAZ A;  3ME8 A;  5J9C A;  5HR0 A;  4PGT A;  5AGY A;  1TDI A;  1PN0 A;  4L5O A;  3ZLP A;  3FRC A;  1F37 A;  2GQL A;  2MMA A;  2X8H A;  1X9M B;  5E59 A;  1PRX A;  2JAC A;  4OMV A;  3HCZ A;  2VCZ A;  4V2L A;  1EGR A;  3DVX A;  5KOW A;  3EPT A;  4WR4 A;  1GSQ A;  2F8F A;  2MMO A;  1Q98 A;  3K8N A;  1Y25 A;  3LJR A;  4CW9 A;  2P31 A;  5FT3 A;  2FWE A;  5J5N A;  3LXZ A;  2HT9 A;  2RM6 A;  2NTO A;  3Q19 A;  1XFL A;  2ZNM A;  5DVB A;  3G9B A;  19GS A;  3UOM A;  4FO5 A;  3KZQ A;  1OC8 A;  4HJM A;  4N0V A;  2FHE A;  3IA1 A;  1ST9 A;  3FEU A;  4KF9 A;  1E2Y A;  2LEG A;  4G0L A;  4PNF A;  2VCV A;  5DDL A;  2DMM A;  4AJ6 A;  5BMU A;  3GKM A;  1OC9 A;  3DYR A;  5JWO B;  1A0R P;  1VF3 A;  1XPV A;  2VOC A;  5ECP B;  5H5Q A;  4GSN A;  3ZFB A;  2IME A;  4EL1 A;  4F82 A;  2GST A;  2IMF A;  1ZYN A;  1EP7 A;  2HZE B;  4WR5 A;  3EMX A;  1TJD A;  4USS A;  2DJK A;  3EUR A;  1O81 A;  1QK8 A;  4NPB A;  1E6B A;  1JZW A;  3VPQ A;  1ZMA A;  3BOA A;  2VO4 A;  4K9Z A;  2OE1 A;  3AY8 A;  3FK8 A;  3TJF A;  5IOW A;  2YPM A;  5ECO B;  2M46 A;  5EY6 A;  5F0G A;  2GVP A;  2R5G A;  3ME7 A;  2FGX A;  2B1K A;  2L6D A;  1TRS A;  3TCO A;  5AIX A;  2IMI A;  2LV3 A;  1T4Y A;  3HKR A;  1QUW A;  3ED3 A;  1W89 A;  3GSS A;  3A5I A;  1EOG A;  2FA4 A;  3PPU A;  1F2E A;  4GSS A;  5IPG A;  4ZIL A;  18GS A;  3QR6 A;  5ABR A;  3ZIJ A;  1Q4J A;  5DQY A;  4HI7 A;  4POM A;  1WIK A;  1UC7 A;  3LFL A;  1SK0 A;  2X8C A;  1F3A A;  2G0F A;  5IM9 A;  5GAN D;  3IAM 2;  4HOJ A;  2YWN A;  2DIZ A;  3Q74 A;  1UA5 A;  2KUC A;  1BED A;  1B9X C;  2YWM A;  2AB6 A;  1QMV A;  3IBH A;  17GS A;  3GUR A;  4IQ1 A;  1TK8 B;  3VPT A;  1MD3 A;  3F6D A;  5GST A;  3F3Q A;  2LJA A;  2AUV A;  2L57 A;  3DD3 A;  4MK3 A;  4BVX A;  2OAD A;  3LWA A;  1H4O A;  1TKD B;  5FHI A;  2O8V B;  2D2Z A;  6GSS A;  1YZX A;  2MZC A;  3A2X A;  4CY8 A;  3TOU A;  4YAV A;  3FR3 A;  1GUH A;  1VRS D;  3IHQ A;  5G1L A;  4POK A;  2ALB A;  4F0B A;  1XWA A;  1GP1 A;  2FWF A;  4TVE A;  1K0O A;  4GF0 A;  2IN3 A;  3HVV A;  1PKW A;  3TRQ A;  1TTZ A;  3HXS A;  3LYK A;  2ZUP A;  2AHE A;  3KGK A;  3P90 A;  5ID2 B;  2WDU A;  3IAS 2;  4AF2 A;  3LSZ A;  3U6V A;  2HRA A;  1U88 A;  3KH7 A;  3GTU B;  4MH2 A;  3ZVJ A;  5JWR B;  3G7I A;  14GS A;  2H1D A;  2PGT A;  3DML A;  1M9A A;  5G5E A;  4LL1 B;  1H75 A;  1GH2 A;  4O92 A;  2OAC A;  2VIM A;  2VCX A;  2LTK A;  2GZY A;  3VWX A;  2YZH A;  3C7M A;  3EU4 A;  3MAK A;  1QFN A;  1ZOF A;  3QD9 A;  3RBT A;  3W8S A;  5FWG A;  4F0C A;  2HRN A;  1VF2 A;  2F8A A;  3W6G A;  1Z7R A;  2HZF A;  1FB0 A;  1Z6N A;  1ZYE A;  3NIV A;  3I9V 2;  1OKT A;  2YV7 A;  1GLQ A;  4LMV A;  1YQ1 A;  4PXO A;  3EC3 A;  1TU7 A;  4OO5 A;  1OC9 B;  5ENU A;  1ILO A;  1GLP A;  2VL9 A;  4PX1 A;  4RI6 A;  1OE7 A;  3L9S A;  1HYU A;  4HEA 2;  5EPF A;  4KND A;  3CXG A;  2C3N A;  1HNC A;  3PR8 A;  3DRN A;  1A2L A;  3ZIT A;  3RPP A;  1AC1 A;  5ECI B;  5E4W A;  2WZ9 A;  4K6X A;  5ECH B;  4J56 E;  1ERU A;  2GT6 A;  4J2F A;  4IW9 A;  4RQR A;  2OBI A;  3I6A A;  1PGT A;  1T4Z A;  2B7K A;  4D73 A;  3GKK A;  2DKI A;  4PUA A;  4CHS A;  1F3B A;  4TXV A;  2I1U A;  3P2A A;  1PX6 A;  1J08 A;  3HJP A;  2VD1 A;  5A5K A;  4XTS A;  1SL1 B;  2CAQ A;  1KEB A;  3IXR A;  4HS1 A;  3QAV A;  2P5R A;  4ZIJ A;  3UBK A;  1XCC A;  3QDN A;  4QL7 A;  1F9M A;  3TKP A;  1M2D A;  1XIY A;  2C80 A;  4MP4 A;  1GSU A;  1GUL A;  4EDZ A;  1JLV A;  3M3M A;  1OE8 A;  4KCE A;  4G10 A;  2C1Y A;  2Z9S A;  4K0N A;  2L59 A;  3FHK A;  1IYH A;  1A23 A;  2V41 A;  1XWB A;  4TRX A;  1T1V A;  2YCD A;  1A24 A;  4ZB6 A;  1V57 A;  5G2Z A;  3D6I A;  4N0Z A;  1YY7 A;  1SKS B;  4OFM A;  2VL2 C;  5G1K A;  4HZ2 A;  3F9U A;  3NZN A;  2FNO A;  2H66 A;  3DGQ A;  2F51 A;  1B9Y C;  4KW6 A;  2JZT A;  2CQ9 A;  4YQV A;  3A2V A;  1THX A;  2REM A;  2B6M A;  4H86 A;  4BVX B;  3L0H A;  4IEL A;  2RII A;  3FZA A;  1MDI A;  3FZ9 A;  2JL4 A;  4IS0 A;  2HZE A;  5C00 A;  1N2A A;  2A2R A;  4YAP A;  1X5D A;  5IMF A;  2HSY A;  4PTS A;  5JCU A;  3UAP A;  4WBJ A;  2TRC P;  3IE3 A;  1GUK A;  3O6T A;  3FY7 A;  4TR1 A;  4MPF A;  3S9F A;  3SBC A;  1UVZ A;  2WFC A;  1S3C A;  4AGS A;  1RW1 A;  3RPN A;  3BD2 A;  5GAP D;  4IJI A;  4X0X A;  2B7J A;  5BRT A;  1PN9 A;  2P5Q A;  4OD7 A;  3GL3 A;  2H6X A;  4ULX A;  2VL3 A;  5ECR B;  2H1G A;  2V6K A;  5HR1 A;  4PQH A;  5A4U A;  3N5O A;  1T3B A;  1KBN A;  3ZYW A;  3C1S A;  2G2Q A;  3KCM A;  3GHA A;  3KJY A;  2IIY A;  1FW1 A;  4O5U A;  4BL7 B;  3WT1 A;  2PBJ A;  5ECL B;  2RUF A;  1R4W A;  3APQ A;  6GSU A;  3VI5 A;  5DJL A;  4MF5 A;  3UVH A;  3FW2 A;  1M9B A;  1TW9 A;  3QCP A;  2HNL A;  3LXT A;  1GNW A;  2GSS A;  2GQK A;  3QMX A;  1XZO A;  3DWV A;  1B48 A;  3UMA A;  1GL8 A;  4POL A;  4G19 A;  2GS3 A;  4MF7 A;  4ISD A;  3HZ8 A;  4MCU A;  3V1W A;  4HQZ A;  2K8S A;  4Z7X A;  1I9D A;  3TUE A;  1GSE A;  2ON5 A;  1U6T A;  1YEP A;  3MDK A;  1R7H A;  2L5O A;  3GNJ A;  5IQY A;  3M1G A;  4Q5F A;  2LNS A;  4O5Q A;  2V32 A;  1GTA A;  3M9J A;  4EKZ A;  2VCT A;  1EV4 A;  2B1L A;  5L71 A;  4YKG A;  3WGX A;  3HVX A;  5A4V A;  2A4H A;  4MA9 A;  4ICY A;  1CQG A;  2FLS A;  4MJA A;  2K18 A;  2LRC A;  3Q6O A;  2K8V A;  2N5B A;  10GS A;  5DCH A;  4D73 B;  1TP9 A;  5ID2 A;  4TR0 A;  4EO3 A;  3GV1 A;  1XW9 A;  4IQA A;  4I2T A;  5A4W A;  3GTU A;  1X9S B;  1R5A A;  3GIX A;  3ZFL A;  3TRX A;  2L5L A;  4K8M A;  6GSV A;  3UIW A;  4K1F A;  4LL4 B;  2IJY A;  2E2M A;  1N8J A;  5HQP A;  4CY6 A;  3DKS A;  1ZCP A;  2X64 A;  1TRW A;  4HQS A;  3LYP A;  4TOP A;  2C4J A;  2AV4 A;  3F6F A;  2JSZ A;  4V2M A;  4GCI A;  1AQX A;  2J23 A;  2YJ7 A;  5IO0 A;  4RUV A;  3WGE A;  2GLR A;  2WGR A;  3HHV A;  3TKS E;  4EC0 A;  3J7Y k;  4MH3 A;  1THO A;  2R4V A;  4TN8 A;  4NWY A;  1WJK A;  2H72 A;  3QFB C;  5ECM B;  5ECS A;  4XS4 A;  1BAY A;  3CTG A;  3ERG A;  2H75 A;  4L8E A;  3ZL5 A;  2JU5 A;  3GKX A;  5DAK B;  2VLU A;  1WOU A;  3BJ5 A;  2R0P A;  1X9W B;  1IYI A;  5D96 A;  4MZW A;  1AQV A;  2HLS A;  4ZB8 A;  3F8U A;  3TKR A;  4PNG A;  3TJJ A;  3J7Y b;  5IOX A;  4TR1 B;  2VCW A;  2DKH A;  3UJ1 A;  5B6M A;  4XRD A;  2CZ2 A;  3GKN A;  2C3T A;  3LG6 A;  3CRT A;  4G9H A;  4LMW A;  4JZQ A;  2X99 A;  2CT6 A;  1SL2 B;  4ML1 A;  2YJH A;  3D4M A;  4CDO A;  2CAI A;  5F06 A;  2M80 A;  2I81 A;  1WMJ A;  2IMD A;  3GFK A;  2HSH A;  4KCA A;  1WP0 A;  4V2N A;  4ML6 A;  4F03 A;  2CVB A;  4QL9 A;  3GN3 A;  5CP1 A;  5HR2 A;  4GQC A;  4AJ8 A;  1VF1 A;  3VWV A;  1M2A A;  1XBS A;  3KD0 A;  1JHB A;  4OFT A;  4X43 A;  3TDG A;  3TGZ A;  2YZU A;  3P8W A;  4WF5 A;  3APS A;  3UVT A;  3A3T A;  2M72 A;  5IMD A;  1DE1 A;  4NHZ A;  4OFN A;  1K0D A;  5KN3 A;  1M0U A;  2YWI A;  3A2W A;  2IL3 A;  4JU5 A;  2HE3 A;  2FWH A;  2GQM A;  3F4R A;  2LKU A;  5AN1 A;  3TB2 A;  4I97 A;  2DML A;  4YQU A;  2I4A A;  3ZML A;  1B8X A;  2DIY A;  4OCF A;  1A8Y A;  1XWK A;  2QA2 A;  4ECJ A;  4O7H A;  2H1B A;  4PQ1 A;  4JRR A;  4EE0 A;  4N11 A;  4JR6 A;  1B4P A;  5IMA A;  4TR3 A;  1Z3E A;  3QPM A;  2CX4 A;  4Z2R A;  3E3E A;  4XCS A;  1OKD A;  3UL3 A;  3VUR A;  4K0G A;  1ERV A;  20GS A;  4MPG A;  5J4U A;  1G6Y A;  5ECN B;  2R0C A;  4FIW A;  4MJC A;  3RAZ A;  1FOV A;  1GWC A;  3MNG A;  5IMZ A;  3CBU A;  9GSS A;  1ZZY A;  1V9W A;  2TIR A;  4EXJ A;  1QGV A;  4BL7 A;  3TRP A;  2LS5 A;  3KMN A;  2GZP A;  2DSA A;  5IIZ A;  2C0E A;  3IC8 A;  1SJI A;  3FYG A;  4GWR A;  1UN2 A;  3JCM L;  3SWL A;  3TJB A;  5HFK A;  1CQH A;  1HD2 A;  1M7T A;  4KX4 A;  2ZCT A;  4X1U A;  1JLW A;  3CSJ A;  5CRH A;  2EC4 A;  1G0T A;  2LUS A;  2QC7 A;  3HD5 A;  1ZYQ B;  1TRU A;  4E8H A;  1OYJ A;  2EIO A;  2PVO C;  2QA1 A;  2R37 A;  4BPY A;  1V40 A;  4JR4 A;  1AIU A;  5COH A;  4N10 A;  1EEM A;  4EIQ A;  2V1M A;  1W4V A;  4XS4 B;  3WYW A;  2DJ0 A;  3CSI A;  4ZL9 A;  2RLI A;  1Z9H A;  1ERW A;  3IV4 A;  4EDY A;  6GSY A;  2CA8 A;  4BA7 A;  4RQX A;  1K3L A;  3I43 A;  5IMV A;  2A2S A;  2FCH A;  1FHE A;  1ABA A;  3KXO A;  3CMI A;  3EYT A;  1WE0 A;  1O85 A;  1HNA A;  2JZS A;  1O8X A;  3GX8 A;  4Q5N A;  1I5G A;  3QFA C;  3Q18 A;  3A5W A;  3LEF A;  2E0Q A;  4OWY A;  5DQS A;  3HY2 A;  3TJG A;  1PL2 A;  4LA1 A;  2L6C A;  1YDK A;  4I2U A;  3C73 A;  3IC4 A;  2IWT A;  1MDJ A;  1AW9 A;  3IOS A;  5G31 A;  1DE2 A;  4JED A;  1LJR A;  2LJR A;  1K0M A;  3EIN A;  3C1R A;  1V58 A;  2YV9 A;  3GA4 A;  5G5F A;  3ZZX A;  2QGV A;  4FYU A;  4POB A;  4HZ4 A;  2J9H A;  2NDO A;  2HRK A;  2HYX A;  4PUR A;  3H4K A;  2VM1 A;  5CYY A;  1XVQ A;  3CTF A;  1GSF A;  1XW6 A;  1BYE A;  1ZGN A;  5D9W A;  3L4N A;  1Z6M A;  5D93 A;  1JZD A;  2PPT A;  4Z2T A;  1GRX A;  2GTU A;  1JZR A;  2BTO T;  4K5R A;  3M0F A;  4P3Y B;  3VFI A;  1SK2 A;  1YEX A;  4IN0 A;  1PX7 A;  4DVC A;  3GST A;  1FVJ A;  2XBQ A;  5CO3 A;  5HR3 A;  5KN2 A;  1GTU A;  8GSS A;  1LU4 A;  3LQ7 A;  5DAK A;  3FR9 A;  5AIV A;  1TK5 B;  2H19 A;  3FR6 A;  3KP8 A;  2XBI A;  1YKA A;  4JE1 A;  1O7U A;  4BVY A;  1FAA A;  3HJM A;  1GNE A;  4A5P A;  5ECQ B;  2DBC A;  2A2P A;  2H30 A;  4GST A;  12GS A;  2H0G A;  4FYB A;  2CVK A;  5DAL A;  5INY A;  2LNT A;  1WWJ A;  4IP1 A;  4ZBD A;  5CNW A;  1K3O A;  2B5Y A;  4O32 A;  3IK9 A;  2CZ3 A;  5D73 A;  2DC5 A;  2R0G A;  4BWS A;  1YF0 A;  4K5S A;  2LQQ A;  4K2D A;  4NXI A;  1SU9 A;  4HJ2 A;  3IDV A;  1O8W A;  3H93 A;  2A4V A;  4ECB A;  2GSQ A;  2CV4 A;  1BQ7 A;  3FKF A;  2TRX A;  4BWQ A;  1ERT A;  3G7Y A;  4EUY A;  1HQO A;  2K9F A;  4GXZ A;  5HFG A;  3TKS A;  2WB9 A;  2JAD A;  3R2Q A;  4L0W A;  4WF4 A;  2GGT A;  1FOH A;  5IO2 A;  2BJX A;  3F4S A;  1FO5 A;  2WS2 A;  3KMO A;  4WBR D;  2MBT A;  1SYX A;  2GZZ A;  2KP2 A;  3ERF A;  1G7E A;  1XVW A;  2H0H A;  13GS A;  1T8E B;  3KTL A;  4RI7 A;  3WGD A;  1OVN A;  2C0F A;  3P7X A;  3ZIV A;  1K3Y A;  2KP1 A;  4O5R A;  4N30 A;  2YP6 A;  2DLX A;  3L9U A;  1K0B A;  1PMT A;  5F8B A;  5IMC A;  4ZB9 A;  5F07 A;  4EF0 A;  1YKC A;  1MDK A;  4JBB A;  2XPE A;  3F4T A;  2H74 A;  2ES7 A;  4Z2U A;  2UZ8 A;  1KTE A;  5GSS A;  3H8Q A;  3IHG A;  1AQW A;  3EU3 A;  6GSW A;  22GS A;  3GX0 A;  4K7O A;  5ELA A;  2NPB A;  3PIN A;  3VI7 A;  1QQ2 A;  4I8B A;  4HUA A;  1PQN A;  1EV9 A;  5J3R A;  3L78 A;  1DSB A;  2OKA A;  5D9T A;  3I69 A;  3NOF A;  1B4Q A;  5J9B A;  4KSO A;  3GUS A;  3N9J A;  5IPH A;  2VUP A;  1YJ6 A;  3WD6 A;  1SK1 A;  3RHB A;  3QOU A;  3US3 A;  5B6N A;  2H73 A;  3OR5 A;  2H1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...