1U3AA

Mutant dsba
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
187
structure length
187
Chain Sequence
QYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHAYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol: disulfide interchange protein dsbA
publication title Intriguing conformation changes associated with the trans/cis isomerization of a prolyl residue in the active site of the DsbA C33A mutant
pubmed doi rcsb
source organism Escherichia coli
total genus 64
structure length 187
sequence length 187
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1u3aA00
2YANA 4TN8A 3D5JA 2IPAA 5JWQB 1PX6A 3M9KA 2YV7A 4ISDA 2CVBA 5IM9A 3ISOA 1SENA 5FHIA 1BQ7A 3U6VA 1XVWA 2CAQA 3M0FA 3GL3A 3TRXA 3GURA 3SWLA 4MZBA 5CO3A 1O7UA 1N2AA 3EU4A 2H1DA 4NMUA 1USBA 3UBKA 1AQVA 5IOXA 1B8XA 3UARA 3IHQA 3UJ1A 1T7PB 3W6GA 4XS1A 2FNOA 20GSA 2VCQA 2H1AA 1MDIA 4BWQA 4RQXA 3TRQA 5L71A 4HOJA 2FD3A 4I8BA 2VL3A 3GYKA 1SKRB 2IMDA 1FB0A 1HNCA 2WS2A 4MA9A 5AIVA 2PWJA 4YQMA 1T1VA 4XTSA 3QAVA 1K0AA 1XWGA 1A23A 2H0GA 2FUG2 1Z7PA 1H75A 5CRHA 5DAKA 4TR4A 5G1KA 1DSBA 2N5AA 3TUEA 3ERWA 4FO5A 3FZ5A 2GZYA 5AGYA 4KDYA 2RM6A 5LCZA 1TK5B 3CSIA 3KZQA 5DCHA 3RHBA 3KGKA 2WDUA 3LORA 3PGTA 3GTUB 4FYCA 3VWUA 3LYPA 2X99A 1TK8B 2OE1A 2R4VA 5C04A 3DIEA 5CAXA 4TRXA 4IP6A 3ZITA 1SL2B 3ZIJA 3GSTA 1A2JA 1T8EB 5F0GA 2M46A 3IRAA 4GSTA 2X8HA 4TR0A 2GSRA 3LEFA 2H6XA 1FAAA 2YP6A 1O8XA 1OC3A 2ZUPA 2H1BA 4N11A 4ID0A 4GTUA 3H93A 4F9ZA 3KEBA 3F0IA 2F3MA 1WWJA 2LRTA 1GUMA 1T00A 3R2QA 2DJ2A 2E2MA 2H30A 5HR0A 1FVJA 3TB2A 1WP0A 4MJBA 2BJXA 2LJAA 2C3TA 3G9BA 3P90A 2NVLA 3L78A 5IOWA 1MDKA 2R6KA 4FYUA 4HS1A 3ZFLA 5LD0A 5EVOA 1LJRA 2C0FA 2L59A 2H74A 4LMWA 2G2QA 4TR3A 6GSVA 3O76A 5HR3A 3F63A 2AHEA 1QGVA 2P5QA 2XHFA 1ACVA 4K1FA 4N0ZA 4ECJA 2LKUA 3CTFA 5J3RA 5ECOB 4F2IA 1G7OA 2OACA 3P2AA 1ZMAA 3A2XA 5C00A 4ECIA 3IK7A 4H86A 4ZBAA 2YWMA 5ID2B 4PXOA 1MD3A 1S3DA 1GUKA 1CQGA 3EC3A 3HVSA 2YCDA 5EY6A 2WB9A 1XZOA 3VURA 2VLVA 1J0FA 1B9XC 1MEKA 2IMKA 1K3YA 1SJZA 4ZBBA 4ZXGA 1OKTA 3CSHA 2JZSA 2F51A 3IAM2 1W4VA 3FEUA 5G5EA 1F37A 3IXRA 1DBYA 1OC9A 5LNKe 1G7EA 2DJ3A 2H19A 4QL7A 2L57A 1E2YA 5ECQB 1J08A 4TR1A 4PURA 2O89A 3CSJA 5GSSA 1ZYQB 2DLXA 1DE2A 3H79A 5CREA 3HVXA 4XS4A 1M9AA 2HI7A 3RAZA 4OO5A 2GQMA 5J4UA 1A2MA 3GSSA 2OBIA 1Z9HA 4EF0A 3UBLA 3JCML 2V6KA 2DMLA 5HQPA 4IJIA 5A4UA 1THOA 1KTEA 1GP1A 2H72A 3O3TA 1ST9A 2VD0A 2C80A 2C0GA 5IMCA 1SKSB 4YQUA 1H4OA 3DEXA 1VF1A 2K6VA 4KSOA 2GZPA 2XPEA 5G2ZA 1SK1A 5DVBA 5B8AA 1T3BA 4WR4A 1R26A 4MH3A 2H0IA 3TCOA 2CVKA 2L4CA 2P31A 3L9VA 4IGJA 2ON7A 5ECMB 2HLSA 4Q5NA 2L5LA 1N8JA 4KB3A 1TP9A 3GX8A 4TXVA 3LYKA 6GSYA 1SD8A 2VLTA 11GSA 1R5PA 3DMLA 4AGSA 2YNXA 4GQCA 2HRNA 1PD21 3ZFBA 1GRXA 3C7MA 5H5RA 2VCXA 3GTUA 3KMNA 3VWVA 3IC4A 3Q6OA 3ZYWA 2N5BA 4KUNA 1S3CA 4JEDA 2B5EA 1F2EA 3LSZA 4PNGA 3EMPA 1EGOA 4OMVA 1XWCA 2LTKA 3ED3A 2NTOA 2QGVA 3I43A 2VCTA 3TJKA 1PQNA 3ZIVA 2QC7A 4Z7XA 1EWXA 5D93A 3ME8A 2VUPA 1X5DA 2VIMA 10GSA 4ACSA 1GSSA 1J9BA 1GSEA 1V9WA 3QOUA 3A5WA 4NAXA 1O85A 3KCMA 2CZ2A 4WKWA 1O8WA 3ERGA 3FYGA 4HZ4A 3PH9A 3IAS2 1FHEA 3PINA 3HA9A 4OD7A 3IE3A 2LNSA 4DEJA 1Y25A 1JLWA 1MTCA 1K0BA 1ZGNA 4TXOB 5IMDA 1ML6A 5GAPD 1FOVA 4RI7A 3TKRA 3E3EA 5D96A 2P0GA 3QAGA 4PNFA 1XXUA 4NXIA 1BYEA 1GH2A 3VI7A 2X64A 1LBKA 2CAIA 1GSUA 1QQ2A 2IWTA 3QPMA 1EOGA 3NOFA 3HY2A 4G10A 3KIJA 5DBQA 4E8EA 1I9DA 4IS0A 5KN1A 2CQ9A 3WT2A 5ID2A 2MMOA 4MZWA 1XOBA 1XCCA 4NWYA 3EMXA 2HXKA 2YWIA 3TGZA 2AB6A 2FGXA 2ALBA 1YF1A 1F6MC 3TOUA 5GAND 2VO4A 3P8WA 2D2ZA 4GSSA 2XPDA 4WBJA 2N5FA 3MSZA 3TKQA 2L6CA 2PVOC 4WF4A 4O5RA 4HJMA 2HZFA 1K0MA 3DD3A 2IMIA 2O8VB 4IN0A 1PX7A 4XS4B 3WYWA 5E59A 4KA0A 4RUVA 5COHA 2JSZA 1PSQA 3MDKA 4IKHA 3ZMKA 1ZOFA 5D9WA 5J9CA 1X9SB 6GSWA 4KSMA 4J56E 1WMJA 4IP1A 2GZZA 1PL1A 5J41A 2ON5A 5AN1A 3ZREA 12GSA 3DYRA 4XCSA 1BX9A 4HU9A 5JWOB 2YWNA 1WOUA 3DVWA 1MDJA 1T4YA 2WZ9A 4L5OA 1XWBA 4N30A 2C8UA 5E4WA 4K0GA 2KP2A 3APSA 1XWAA 5HFGA 5GSTA 3GHAA 2WJUA 1X5EA 2AAWA 2QKEA 3IA1A 4LL4B 2PU9C 4L5LA 1YQ1A 3DKSA 2E2GA 3BOAA 2J9HA 1F3AA 4JBBA 2GSQA 3GA4A 5CP1A 1BAYA 2NDOA 4MZCA 1YJ6A 3M9JA 2B5YA 1M99A 1QMVA 5DALB 4XS6A 4K8MA 2VM1A 3TKSC 4GSNA 4MP4A 1A8LA 2YJHA 1DUGA 2YZHA 2PUKC 3IR4A 2GDRA 5JCWA 4TVEA 3VLNA 2HZEB 3L0HA 2CVDA 4DSQA 1F9MA 1Z3EA 4L0WA 3EWLA 1Q4JA 2EIRA 3IBHA 4WF5A 2VL2A 1XIYA 1FG4A 2VM2A 2K8VA 2DIYA 1XFLA 2PMTA 5F06A 3VWWA 2X8GA 3FKFA 1ERTA 4KDXA 3RBTA 2OKAA 2FY6A 1ERWA 3HZ4A 3TKSE 1VF2A 2GGTA 1TRUA 1EZKA 3HYPA 4MF7A 1TOFA 1GTUA 4F82A 2OBKA 4WR5A 2PERA 4GWRA 4K0NA 2LRCA 3DXBA 1TKDB 1EV9A 3QR6A 1SKWB 1K3LA 3V1WA 1VRSD 1XOAA 3KH9A 2G0FA 5ECLB 2H73A 1UVZA 4N10A 1TU8A 2C3QA 1SJ6A 3CTGA 3TJBA 4KGIA 4BVYA 1ON4A 3HZ8A 3NZNA 2H01A 3GH9A 4TXOA 2LSTA 3N9JA 3C73A 8GSSA 3CBUA 2K9FA 1YEPA 5GZZB 2AJQB 1V98A 3KTBA 1TRSA 3GKNA 1K0OA 2R2JA 3EE2A 2YZUA 4GQFA 1V58A 3GN3A 3VFIA 1TI3A 3G7IA 2R37A 1K0CA 3IK9A 5HR2A 1GTBA 1HD2A 4NHZA 3L4NA 1U88A 3IDVA 3Q18A 5D73A 3WD6A 2HSHA 3SBCA 4OFNA 2I3YA 4ZB9A 4Q5FA 4IELA 2B3SA 3TDGA 4IJ3A 6GSSA 3VPQA 1O73A 1U3AA 1TK0B 4NV2A 3P7XA 2C1YA 4L8EA 4YQVA 1UA5A 1JFUA 4EUYA 4MK3A 1TRVA 2LS5A 5H5QA 2FHEA 2JU5A 3UIWA 3RHCA 3TRPA 4G9HA 2REMA 1B4PA 1I5GA 1KEBA 2DJJA 3BCKA 4MABA 2GSSA 1Z6NA 5CRWA 2VL9A 4ZIJA 4NHWA 3QFBC 4KCEA 3W8SA 3LGCA 5IMVA 3VWXA 1AQWA 5B6NA 2C4JA 2K8SA 14GSA 1QUWA 1NHOA 3APQA 5KN2A 3VI5A 2BTOT 2H6YA 2AUVA 1XWKA 4HI7A 1PL2A 2F8AA 1SU9A 1ZZYA 3HJMA 4V2LA 3TJGA 1GUHA 2DSAA 3QCPA 3VPTA 4EVMA 1K0DA 3RPPA 1EP8A 1YEXA 2JACA 3GMFA 4LA1A 1XBSA 1ZL9A 2A2SA 5DCGA 4G19A 4ZL8A 1PMTA 3OR5A 2IFQB 3D4MA 1M7TA 3BD2A 3RDWA 3D6IA 4WBRD 1QK8A 1JLVA 3Q74A 2IL3A 4JU5A 5IMFA 4F0CA 3LWAA 3D22A 3TKPA 3IPZA 2RM5A 18GSA 6GSXA 1BG5A 1HYUA 4IW9A 1A0FA 1WPIA 3ZLPA 4IBPA 2I81A 5KN3A 2YPMA 3ZVJD 4OO4A 3DGQA 2GQKA 3F3QA 2B1LA 5F05A 3FHKA 4PUAA 5FT3A 3KTLA 4JE1A 1M2DA 1W89A 3FK8A 3FZ4A 1TRWA 3F4TA 2M80A 2HFDA 2FCHA 4OFTA 4HDEA 5DALA 1AQXA 2H70A 4EO3A 2AV4A 4MDCA 1TTZA 4LMVA 3M8NA 4YAPA 5IO0A 2OADA 3WT1A 2OJLA 4BA7A 2YJ7A 2VCWA 2MZCA 5IPHA 2KUCA 2HZEA 3GV1A 1XVQA 1GWCA 1LU4A 1GL8A 1VGLA 4V2MA 4POLA 2YWOA 3LJRA 5CNWA 1GTAA 5ABRA 3A2WA 4EKZA 2B5XA 2FA8A 2PBJA 2ES7A 3C1SA 4DSSB 3K8NA 2O7KA 4WEYA 2HNLA 1A8YA 4EL1A 4CDOA 1RK4A 1A24A 3F4SA 3KH7A 5IMAA 4ECBA 2LV3A 3C8EA 4DVCA 2WCIA 1U3IA 3A3TA 3M3MA 2H66A 5G5FA 1SL1B 3WGEA 3FW2A 2HT9A 4IHUA 1AW9A 5B8BA 3FY7A 5G1LA 4PQHA 2LEGA 2CX3A 2C3NA 2PVQA 2DC5A 1U87A 2KOKA 4I97A 2BMXA 4AJ7A 2V1MA 3H1NA 2DBCA 5ELGA 3CMIA 2EIQA 4HEA2 2GVPA 1JZDA 1Z7RA 1R5AA 2VD1A 2RLIA 1WJKA 1UC7A 1AXDA 3MWHA 1GNWA 3LG6A 3EURA 4ECCA 4X1UA 2E0QA 2XBIA 5DQYA 3FZ9A 2LJKA 3L9SA 2EC4A 5ELAA 3EVIA 2A4VA 2YV9A 2H6ZA 3DWVA 1M9BA 1B9YC 1EGRA 2MBSA 3GKMA 5AIXA 4RQRA 1A0RP 2DJKA 2NBSA 1SJIA 3HDCA 2K18A 2VCZA 2O85A 4ZL9A 2KHPA 3GKKA 1Q98A 2QSIA 1EEMA 1PA3A 4OCEA 1HQOA 1M2AA 3GL5A 3HXSA 5J9BA 4Q5QA 2PGTA 4O32A 4BWSA 3J7Yk 4J2FA 1GNEA 3FR6A 4EDYA 3GIXA 1OYJA 3ZMLA 3APOA 1G6WA 4GXZA 1B4QA 7GSSA 5EL8A 4XHMA 4KCAA 3F4RA 4KDUA 3FR9A 1EP7A 2B7JA 2I4AA 1VF4A 3UVTA 4HJ2A 1R4WA 1KNGA 3A2VA 3CRUA 1CQHA 2O87A 4KNDA 1AIUA 4X0XA 3EYTA 4OFMA 2FWEA 4GCIA 1X9MB 1XW9A 2VCVA 3F6FA 3GKXA 1E6BA 1AAZA 2FA4A 1V2AA 3G7JA 3F9UA 3KJYA 1BJXA 4EXJA 2H76A 3GNJA 1TDIA 1GLPA 1Y6EA 2EIOA 1ILOA 3ME7A 2IFQA 1GLQA 2IMEA 1OKDA 3KP9A 3QFAC 2M72A 1G6YA 4QQ7A 1YZXA 5IPGA 3FZAA 3I6AA 5KEJA 2FLSA 3DRNA 2CZ3A 4JR6A 3KMOA 2R3XA 1XW5A 2I1UA 5CRGA 1YDKA 4GLTA 2FWHA 5D8IA 1OVNA 4CHSA 3D0ZA 3D21A 1JHBA 4EC0A 2H1GA 2C0EA 2C0DA 2DJ0A 4AJ8A 4BVXA 1TI1A 3GUSA 4ML6A 3DVXA 2B7KA 3RPNA 3GRXA 5ECPB 4FYBA 1AC1A 2V6OA 1OE7A 4PQ1A 2OA7A 1X0RA 4I2UA 13GSA 5AISA 4POKA 2PN8A 2TRXA 1SYRA 3KXOA 2LUSA 3HHVA 5ENUA 3QMXA 6GSTA 2L5OA 3LXZA 5HR1A 5A4VA 2HSYA 3LXTA 3ZL5A 2CX4A 4PX1A 3QDNA 5ECIB 4N0VA 4RI6A 1TW9A 3F6DA 3ZTLA 1VF3A 4EDZA 4XIHA 5IQYA 3KD0A 1X9WB 1FO5A 1GSDA 3WGXA 5IO2A 4TW5A 3AY8A 3F8UA 4IQAA 3N5OA 4OWYA 1URMA 5G31A 3GFKA 5CRDA 2I9HA 1DE1A 1UN2A 4OCFA 1B48A 1K0NA 2DMMA 2B1KA 4DSSA 1EEJA 5FWGA 3KP8A 2MMZA 2MBTA 4FIWA 4GRFA 2H0HA 2WRTA 1Z5YE 1M2BA 1MD4A 4MMMA 1T4ZA 2FWFA 3G7YA 3US3A 1KBNA 2LRNA 2L4QA 4YAVA 4PGTA 4WETA 3O6TA 1AUCA 4KAEA 3QD9A 3EINA 1YY7A 5IIZA 4Q5RA 4MF5A 2LQQA 5KN0A 1GULA 1EOHA 4I2TA 3UMAA 4ZB8A 1SYXA 2GSTA 3C1RA 5ECKB 2VLUA 4K7IA 4QL9A 2YN1A 3EU3A 2R5GA 2VOCA 2JSYA 3F3RA 1YKCA 5IMZA 5JCGA 9GSSA 1A2LA 3S9FA 5D9VA 1NHYA 2V32A 4BL7A 3L9UA 4PQIA 2LQOA 4AF2A 4HQSA 1IYHA 2YOIA 1GTIA 2RIIA 4KW6A 3J7Yb 19GSA 2TRCP 3HVVA 5F07A 3MAKA 4D73B 4X43A 5B7CA 4ZBDA 3BJ5A 4KH7A 4K6XA 4IQ1A 2RUFA 4LL1B 3VK9A 1SD9A 1XW6A 3LFLA 1OE8A 1K3OA 3CXGA 4J57E 1OC8A 2CT6A 2GQLA 4V1Ap 2P5RA 2CA8A 3IOSA 5DDLA 2WFCA 2H8LA 5DJMA 3TKSA 4ZB6A 1PKZA 4XRDA 3BCIA 2DJ1A 1RW1A 5JWRB 4DSRA 1V57A 4JR4A 3HCZA 4O7HA 3HJPA 1PN9A 2GTUA 3H4KA 5A4WA 3KM6A 3ZVJA 4CW9A 1QXHA 4XRAA 3E0UA 1HNBA 1GSYA 5J5NA 1C72A 2H71A 3NIVA 2HE3A 3TJJA 1FVKA 4FH8A 2TIRA 2JADA 2JL4A 1Z6MA 2IIYA 3BBYA 5DQSA 4K2DA 2DIZA 4ILFA 4POMA 3HKRA 4LLRA 2MMAA 2V41A 2LJRA 2V2GA 3C71A 3ZZXA 1ERUA 1O81A 1ZYEA 4TOPA 1SL0B 1EV4A 1FW1A 16GSA 1SK2A 4ZL7A 1X5CA 1G0TA 2J23A 1WIKA 4KX4A 1V40A 3UEMA 3WGDA 3ERFA 2VAFA 1ABAA 1TU7A 4K7NA 3MNGA 5INYA 1XPVA 2ZCTA 1PGTA 4YH2A 5DAKB 2KP1A 2KLXA 1NW2A 5A5KA 2FWGA 1NSWA 3GH6A 5HFKA 2XC2A 2WGRA 4MJCA 1ZCPA 1WRYA 3Q19A 1BEDA 2IMFA 1THXA 3HD5A 3IV4A 2IJYA 2HRFA 4WXTA 4POBA 3H8QA 1JZOA 1JZRA 2MYGA 4V1Ag 1S3AA 2X8CA 4MH2A 1SK0A 5ECRB 2NPBA 2WULA 5D9TA 4TKYA 3D4TA 3W8JA 4MJAA 1YKAA 4P3YB 1FB6A 1U6TA 4HU7A 4G2EA 22GSA 1YF0A 4ULXA 4HQZA 3TOTA 4IVFA 1WE0A 4PUFC 5F8BA 2MMNA 3TJFA 3UAPA 4JRRA 4MF6A 4V2NA 3UL3A 2Z9SA 2PPTA 3PR8A 2GT6A 4GF0A 4O92A 1O6JA 5ECHB 3U5RE 6GSUA 5EPFA 2GS3A 1QFNA 4KE3A 2JZTA 4F0BA 4NPBA 4K7OA 5ECNB 1GSFA 4MCUA 4MLYA 1ERVA 5ECSA 2CV4A 1GSQA 3UVHA 3I69A 1HNAA 1JZWA 5G30A 2GLRA 4L0UA 4AJ6A 3HJOA 4I6XA 3CYNA 4NV5A 2IN3A 4EE0A 2A2RA 2XBQA 1F3BA 2OE0A 5DJLA 4E8HA 5D9XA 4ZILA 2AYTA 1NM3A 4JZQA 5H5SA 3QAWA 1TXXA 1PRXA 2H75A 2E7PA 1OAZA 2F9SA 4MPFA 5JCUA 2RUEA 2GT5A 2LNTA 3ZRDA 2L6DA 5HFIA 4F03A 2ZNMA 3I9V2 2HYXA 4BPYA 4D73A 4HUAA 4MJEA 5B6MA 2VL2C 4I5QA 4HZ2A 3CRTA 1RQMA 2F8FA 4MPGA 3FRCA 3UOMA 2B6MA 1M0UA 1R7HA 3LQ7A 1OC9B 1IYIA 1TJDA 3M1GA 2OE3A 3FR3A 2JZRA 17GSA 1PKWA 4K9ZA 3E9JB 4ML1A 4TR1B 3GX0A 5CYYA
chains in the Genus database with same CATH superfamily
2YANA 4CY8A 4TN8A 3D5JA 2IPAA 5JWQB 1PX6A 3M9KA 2YV7A 4ISDA 2CVBA 5IM9A 3ISOA 1SENA 5FHIA 1BQ7A 3U6VA 1XVWA 2CAQA 3M0FA 3GL3A 3TRXA 3GURA 3SWLA 4MZBA 5CO3A 1O7UA 1N2AA 3EU4A 4G0LA 2H1DA 4NMUA 1USBA 3UBKA 1AQVA 5IOXA 1B8XA 3UARA 3IHQA 3UJ1A 1T7PB 3W6GA 4XS1A 2FNOA 20GSA 2VCQA 2H1AA 1MDIA 4BWQA 4RQXA 3TRQA 5L71A 4HOJA 2FD3A 4I8BA 2VL3A 3GYKA 1SKRB 2IMDA 1FB0A 1HNCA 2WS2A 4MA9A 5AIVA 4BIKA 2PWJA 4YQMA 1T1VA 4XTSA 3QAVA 1K0AA 1XWGA 1A23A 2H0GA 2FUG2 1Z7PA 1H75A 5CRHA 5DAKA 4TR4A 5G1KA 1DSBA 2N5AA 3TUEA 3ERWA 4FO5A 3FZ5A 2GZYA 4USSA 5AGYA 4HSCX 4KDYA 2RM6A 3PPUA 5LCZA 1TK5B 3CSIA 3KZQA 5DCHA 3RHBA 3KGKA 2WDUA 3LORA 2A2PA 3PGTA 3GTUB 4FYCA 3VWUA 3LYPA 2X99A 1TK8B 2OE1A 2R4VA 5C04A 3DIEA 5CAXA 4TRXA 4IP6A 3ZITA 1SL2B 3ZIJA 3GSTA 1A2JA 1T8EB 5F0GA 2M46A 3IRAA 4GSTA 2X8HA 4TR0A 2GSRA 3LEFA 2H6XA 1FAAA 2YP6A 1O8XA 1OC3A 2ZUPA 2H1BA 4N11A 4ID0A 4GTUA 3H93A 4F9ZA 3KEBA 3F0IA 2F3MA 1WWJA 2LRTA 1GUMA 1T00A 3R2QA 2DJ2A 2E2MA 2H30A 5HR0A 1FVJA 3TB2A 1WP0A 4MJBA 2BJXA 2LJAA 2C3TA 3G9BA 3P90A 2NVLA 3L78A 5IOWA 1MDKA 2R6KA 4FYUA 4HS1A 3ZFLA 5LD0A 5EVOA 1LJRA 2C0FA 2L59A 2H74A 4LMWA 2G2QA 4TR3A 6GSVA 3O76A 4EIQA 5HR3A 3F63A 2AHEA 1QGVA 2P5QA 2XHFA 1ACVA 4K1FA 4N0ZA 4ECJA 2LKUA 3CTFA 5J3RA 5ECOB 4F2IA 1G7OA 2OACA 3P2AA 1ZMAA 3A2XA 5C00A 4ECIA 3IK7A 4H86A 4ZBAA 2YWMA 5ID2B 1M3IA 4PXOA 1MD3A 1S3DA 1GUKA 1CQGA 2HRKA 3EC3A 3HVSA 4G0IA 2YCDA 5EY6A 2WB9A 1XZOA 3VURA 2VLVA 1J0FA 1B9XC 1MEKA 2IMKA 1K3YA 1SJZA 4ZBBA 4ZXGA 1OKTA 3CSHA 2JZSA 2F51A 3IAM2 1W4VA 3FEUA 5G5EA 1F37A 3IXRA 1XG8A 1DBYA 1OC9A 5LNKe 1G7EA 2DJ3A 2H19A 4QL7A 2L57A 1E2YA 5ECQB 1J08A 4TR1A 4PURA 2O89A 3CSJA 5GSSA 1ZYQB 2DLXA 1DE2A 3H79A 5CREA 3HVXA 4XS4A 1M9AA 2HI7A 3RAZA 4OO5A 2GQMA 5J4UA 1A2MA 3GSSA 2OBIA 1Z9HA 4EF0A 3UBLA 3JCML 2V6KA 2DMLA 5HQPA 4IJIA 5A4UA 1THOA 1KTEA 1GP1A 3HVNA 2H72A 3O3TA 1ST9A 2VD0A 2C80A 2C0GA 5IMCA 1SKSB 4YQUA 1H4OA 3DEXA 1VF1A 2K6VA 4KSOA 2GZPA 2XPEA 5G2ZA 1SK1A 5DVBA 5B8AA 1T3BA 4WR4A 1R26A 4MH3A 2H0IA 3TCOA 2CVKA 2L4CA 2P31A 4Z2RA 3L9VA 4IGJA 2ON7A 5ECMB 2HLSA 4Q5NA 2L5LA 1N8JA 4KB3A 1TP9A 3GX8A 4TXVA 3LYKA 6GSYA 1SD8A 2VLTA 4K5RA 11GSA 4X4JA 1R5PA 3DMLA 4AGSA 2YNXA 4GQCA 2HRNA 1PD21 3ZFBA 1GRXA 3C7MA 5H5RA 2VCXA 3GTUA 3KMNA 3VWVA 3IC4A 3Q6OA 3ZYWA 2N5BA 4K5SA 4KUNA 1S3CA 4JEDA 2B5EA 1F2EA 3LSZA 4PNGA 3EMPA 1EGOA 4OMVA 1XWCA 2LTKA 3ED3A 2NTOA 2QGVA 3I43A 2VCTA 3TJKA 1PQNA 3ZIVA 2QC7A 4Z7XA 1EWXA 5D93A 3ME8A 2VUPA 1X5DA 2VIMA 10GSA 4ACSA 1GSSA 1J9BA 1GSEA 1V9WA 3QOUA 3A5WA 4NAXA 1O85A 3KCMA 2CZ2A 4WKWA 1O8WA 3ERGA 2HRAA 3FYGA 4HZ4A 3PH9A 3IAS2 1FHEA 3PINA 3HA9A 4OD7A 3IE3A 2LNSA 4DEJA 1Y25A 1JLWA 4BVYB 1MTCA 1K0BA 1ZGNA 4TXOB 5IMDA 1ML6A 5GAPD 1FOVA 4RI7A 3TKRA 3E3EA 5D96A 2P0GA 2X49A 3QAGA 4PNFA 1XXUA 4NXIA 1BYEA 1GH2A 3VI7A 2X64A 1LBKA 2CAIA 1GSUA 1QQ2A 2IWTA 3QPMA 1EOGA 3NOFA 3HY2A 4G10A 3KIJA 5DBQA 4E8EA 1I9DA 2HSMA 4IS0A 5KN1A 2CQ9A 3WT2A 5ID2A 2MMOA 4MZWA 1XOBA 1XCCA 4NWYA 3EMXA 2HXKA 2YWIA 3TGZA 2AB6A 2FGXA 2ALBA 1YF1A 1F6MC 3TOUA 5GAND 2VO4A 3P8WA 2D2ZA 4GSSA 2XPDA 4WBJA 2N5FA 3MSZA 3TKQA 2L6CA 3IC8A 2PVOC 4WF4A 4O5RA 4HJMA 2HZFA 1K0MA 3DD3A 2IMIA 2O8VB 4IN0A 1PX7A 4XS4B 3WYWA 5E59A 4KA0A 4RUVA 5COHA 2JSZA 1PSQA 3MDKA 4IKHA 3ZMKA 1ZOFA 1PN0A 5D9WA 5J9CA 1X9SB 6GSWA 4KSMA 4J56E 1WMJA 4IP1A 2GZZA 4YKGA 1PL1A 5J41A 2ON5A 5AN1A 3ZREA 12GSA 3DYRA 4XCSA 1BX9A 4HU9A 5JWOB 2YWNA 1WOUA 3DVWA 1MDJA 1T4YA 2WZ9A 3EPTA 4L5OA 1XWBA 2DKIA 4N30A 2C8UA 5E4WA 4K0GA 2KP2A 3APSA 1XWAA 5HFGA 5GSTA 3GHAA 2WJUA 1X5EA 2AAWA 2QKEA 3IA1A 4LL4B 2PU9C 4L5LA 1YQ1A 3DKSA 2E2GA 3BOAA 2J9HA 1F3AA 4JBBA 2GSQA 3GA4A 5CP1A 1BAYA 2NDOA 4MZCA 1YJ6A 3M9JA 2B5YA 1M99A 1QMVA 4K2XA 5DALB 4XS6A 4K8MA 2VM1A 3TKSC 4GSNA 4MP4A 1A8LA 2YJHA 1DUGA 2YZHA 2PUKC 3IR4A 2GDRA 5JCWA 4TVEA 3VLNA 2HZEB 3L0HA 2CVDA 1M3JA 4DSQA 1F9MA 1Z3EA 4L0WA 3EWLA 1Q4JA 2EIRA 3IBHA 4WF5A 2VL2A 1XIYA 1FG4A 2VM2A 2K8VA 2DIYA 1XFLA 2PMTA 5F06A 3VWWA 2X8GA 3FKFA 3MIXA 1ERTA 4KDXA 3RBTA 2OKAA 2FY6A 1ERWA 3HZ4A 3TKSE 5KOXA 1VF2A 2GGTA 1TRUA 1EZKA 3HYPA 4MF7A 1TOFA 5BRTA 1GTUA 4F82A 2OBKA 4WR5A 2PERA 4GWRA 4K0NA 2LRCA 3DXBA 1TKDB 1EV9A 3QR6A 1SKWB 1K3LA 3V1WA 1VRSD 1XOAA 3KH9A 2G0FA 5ECLB 2H73A 1UVZA 1S3RA 4N10A 1TU8A 2C3QA 1SJ6A 3CTGA 3TJBA 4KGIA 4BVYA 1ON4A 3HZ8A 3NZNA 2H01A 3GH9A 4TXOA 2LSTA 3N9JA 3C73A 8GSSA 3CBUA 2K9FA 3LW9A 1YEPA 5GZZB 2AJQB 1V98A 3KTBA 1TRSA 3GKNA 1K0OA 2R2JA 3EE2A 2YZUA 4GQFA 1V58A 3GN3A 3VFIA 1TI3A 3G7IA 2R37A 1K0CA 3IK9A 5HR2A 1GTBA 1HD2A 4NHZA 3L4NA 1U88A 3IDVA 3Q18A 5D73A 3WD6A 2HSHA 3SBCA 4OFNA 2I3YA 4ZB9A 4Q5FA 4IELA 2B3SA 3TDGA 4IJ3A 6GSSA 3VPQA 1O73A 1U3AA 4O5UA 1TK0B 4NV2A 3P7XA 2C1YA 4L8EA 4YQVA 1UA5A 1JFUA 4EUYA 4MK3A 1TRVA 2LS5A 5H5QA 2FHEA 2JU5A 3UIWA 3RHCA 3TRPA 4G9HA 2REMA 1B4PA 1I5GA 1KEBA 2DJJA 3BCKA 4MABA 2GSSA 1Z6NA 5CRWA 2VL9A 4ZIJA 4NHWA 3QFBC 4KCEA 3W8SA 3LGCA 5IMVA 3VWXA 1AQWA 5B6NA 2C4JA 2K8SA 14GSA 1QUWA 1NHOA 3APQA 5KN2A 3VI5A 2BTOT 2H6YA 3R3EA 2AUVA 1XWKA 4HI7A 1PL2A 2F8AA 1SU9A 1ZZYA 3HJMA 4V2LA 3TJGA 1GUHA 2DSAA 3QCPA 3VPTA 4EVMA 1K0DA 3RPPA 1EP8A 1YEXA 2JACA 3GMFA 4LA1A 1XBSA 1ZL9A 2A2SA 5DCGA 3IHGA 4G19A 4KF9A 4ZL8A 1PMTA 3OR5A 2IFQB 3D4MA 1M7TA 3BD2A 3RDWA 3D6IA 4WBRD 1QK8A 1JLVA 3Q74A 2IL3A 4JU5A 5IMFA 4F0CA 3LWAA 3D22A 3TKPA 3IPZA 2RM5A 18GSA 6GSXA 1BG5A 1HYUA 4IW9A 1A0FA 1WPIA 3ZLPA 4IBPA 2I81A 5KN3A 2YPMA 3ZVJD 4OO4A 3DGQA 2GQKA 3F3QA 2B1LA 4BVXB 5F05A 3FHKA 4PUAA 5FT3A 3KTLA 4JE1A 1M2DA 1W89A 3FK8A 3FZ4A 1TRWA 3F4TA 2M80A 2HFDA 2FCHA 4OFTA 4HDEA 5DALA 1AQXA 2H70A 4EO3A 2AV4A 4MDCA 1TTZA 4LMVA 3M8NA 4YAPA 1PFOA 5IO0A 2OADA 3WT1A 2OJLA 4BA7A 2YJ7A 2VCWA 2MZCA 5IPHA 2KUCA 2HZEA 3GV1A 1XVQA 1GWCA 1LU4A 1GL8A 1VGLA 4V2MA 4POLA 2YWOA 3LJRA 5CNWA 1GTAA 5ABRA 3A2WA 4EKZA 2B5XA 2FA8A 2PBJA 2ES7A 3C1SA 4DSSB 3K8NA 2O7KA 4WEYA 2HNLA 1A8YA 4EL1A 4CDOA 1RK4A 1A24A 3F4SA 3KH7A 5IMAA 4ECBA 2LV3A 3C8EA 4DVCA 2WCIA 1U3IA 3A3TA 3M3MA 4A5PA 2H66A 5G5FA 1SL1B 3WGEA 3FW2A 2HT9A 4IHUA 1AW9A 5B8BA 3FY7A 5G1LA 4PQHA 2LEGA 2CX3A 2C3NA 2PVQA 2DC5A 1U87A 2KOKA 4I97A 2BMXA 4AJ7A 2V1MA 3H1NA 2DBCA 5ELGA 3CMIA 2EIQA 2R0CA 4HEA2 2GVPA 1JZDA 1Z7RA 1R5AA 2VD1A 2RLIA 1WJKA 1UC7A 1AXDA 3MWHA 1GNWA 3LG6A 3EURA 4ECCA 4X1UA 2E0QA 2XBIA 5DQYA 3FZ9A 2LJKA 3L9SA 4BL7B 2EC4A 5ELAA 3EVIA 2A4VA 5KOWA 2YV9A 2H6ZA 3DWVA 1M9BA 1B9YC 1EGRA 2MBSA 3GKMA 5AIXA 4RQRA 1A0RP 2DJKA 2NBSA 1SJIA 3HDCA 2K18A 1ZYNA 2VCZA 2O85A 4ZL9A 2KHPA 3GKKA 1Q98A 2QSIA 1EEMA 1PA3A 4OCEA 1HQOA 1M2AA 3GL5A 3HXSA 5J9BA 4Q5QA 2PGTA 4O32A 4BWSA 3J7Yk 4J2FA 1GNEA 3FR6A 4EDYA 3GIXA 1OYJA 3ZMLA 3APOA 1G6WA 4GXZA 1B4QA 7GSSA 5EL8A 4XHMA 4KCAA 3F4RA 4KDUA 2R0GA 3FR9A 1EP7A 2B7JA 2I4AA 1VF4A 3UVTA 4HJ2A 1R4WA 1KNGA 2QA1A 3A2VA 3CRUA 1CQHA 2O87A 4KNDA 1AIUA 4X0XA 3EYTA 4OFMA 2FWEA 4GCIA 1X9MB 1XW9A 2VCVA 3F6FA 3GKXA 1E6BA 1AAZA 2FA4A 1V2AA 3G7JA 3F9UA 3KJYA 1BJXA 4EXJA 2H76A 3GNJA 1TDIA 1GLPA 1Y6EA 2EIOA 1ILOA 3ME7A 2IFQA 1GLQA 2IMEA 1OKDA 3KP9A 3QFAC 2M72A 1G6YA 4QQ7A 1YZXA 5IPGA 3FZAA 3I6AA 5KEJA 2FLSA 3DRNA 2CZ3A 4JR6A 3KMOA 2R3XA 1XW5A 2I1UA 5CRGA 1YDKA 4GLTA 2FWHA 5D8IA 1OVNA 4CHSA 3D0ZA 3D21A 1JHBA 4EC0A 2H1GA 2C0EA 2C0DA 2DJ0A 4AJ8A 4BVXA 1TI1A 3GUSA 4ML6A 3DVXA 2B7KA 2X4AA 3RPNA 3GRXA 5ECPB 4FYBA 1AC1A 2V6OA 1OE7A 4PQ1A 2UZ8A 2OA7A 1X0RA 4I2UA 13GSA 5AISA 4POKA 2PN8A 2TRXA 1SYRA 3KXOA 2LUSA 3HHVA 5ENUA 3QMXA 6GSTA 2L5OA 3LXZA 5HR1A 5A4VA 2HSYA 3LXTA 3ZL5A 2CX4A 4PX1A 3QDNA 5ECIB 4N0VA 4RI6A 1TW9A 3F6DA 3ZTLA 1VF3A 4EDZA 4XIHA 5IQYA 3KD0A 1X9WB 1FO5A 1GSDA 3WGXA 5IO2A 4TW5A 3AY8A 3F8UA 4IQAA 3N5OA 4OWYA 1URMA 5G31A 3GFKA 5CRDA 2I9HA 1DE1A 1UN2A 4OCFA 1B48A 1K0NA 2DMMA 2B1KA 4DSSA 1EEJA 5FWGA 3KP8A 4CY6A 2MMZA 2MBTA 4FIWA 4GRFA 2H0HA 2WRTA 1Z5YE 1M2BA 1MD4A 4MMMA 1T4ZA 2FWFA 3G7YA 3US3A 1KBNA 2LRNA 2L4QA 4YAVA 4PGTA 4WETA 3O6TA 1AUCA 4KAEA 3QD9A 3EINA 1YY7A 5IIZA 4Q5RA 4MF5A 2LQQA 4Z2TA 5KN0A 1GULA 1EOHA 4I2TA 3UMAA 4ZB8A 1SYXA 2GSTA 3C1RA 5ECKB 2VLUA 4K7IA 4QL9A 2YN1A 3EU3A 2R5GA 2VOCA 2JSYA 3F3RA 1YKCA 5IMZA 5JCGA 9GSSA 1A2LA 3S9FA 4ICYA 5D9VA 1NHYA 2V32A 4BL7A 3L9UA 4PQIA 2LQOA 4AF2A 4HQSA 1IYHA 2YOIA 1GTIA 2RIIA 4KW6A 3J7Yb 19GSA 4Z2UA 2TRCP 3HVVA 5F07A 3MAKA 4D73B 3A5IA 4X43A 5B7CA 4ZBDA 3BJ5A 4KH7A 1FOHA 4K6XA 4IQ1A 2RUFA 4LL1B 3VK9A 1SD9A 1XW6A 3LFLA 1OE8A 1K3OA 3CXGA 4J57E 1OC8A 2CT6A 2GQLA 4V1Ap 2P5RA 2CA8A 3IOSA 5DDLA 2WFCA 4EIPA 2H8LA 5DJMA 3TKSA 4ZB6A 1PKZA 4XRDA 3BCIA 2DJ1A 1RW1A 5JWRB 4DSRA 1V57A 4FQUA 4JR4A 3HCZA 4O7HA 3HJPA 1PN9A 2GTUA 3CQFA 3H4KA 5A4WA 4YKFA 3KM6A 3ZVJA 4CW9A 1QXHA 4XRAA 3E0UA 4G0KA 1HNBA 1GSYA 5J5NA 1C72A 2H71A 3NIVA 2HE3A 3TJJA 1FVKA 4FH8A 2TIRA 2JADA 2JL4A 1Z6MA 2IIYA 3BBYA 5DQSA 4K2DA 2DIZA 4ILFA 4POMA 3HKRA 4LLRA 2MMAA 2V41A 2LJRA 2V2GA 3C71A 3ZZXA 1ERUA 1O81A 1ZYEA 4O5QA 4TOPA 1SL0B 1EV4A 1FW1A 16GSA 1SK2A 4ZL7A 1X5CA 1G0TA 2J23A 1WIKA 4KX4A 1V40A 3UEMA 3WGDA 3ERFA 2VAFA 1ABAA 1TU7A 4K7NA 3MNGA 5INYA 1XPVA 2ZCTA 1PGTA 4YH2A 5DAKB 2KP1A 2KLXA 1NW2A 5A5KA 2FWGA 1NSWA 3GH6A 5HFKA 2XC2A 2WGRA 4MJCA 1ZCPA 1WRYA 3Q19A 1BEDA 2DKHA 2IMFA 1THXA 3HD5A 3IV4A 2IJYA 2HRFA 4WXTA 4POBA 3H8QA 1JZOA 1JZRA 2A4HA 2MYGA 4V1Ag 1S3AA 2X8CA 4MH2A 1SK0A 5ECRB 2NPBA 2WULA 5D9TA 4TKYA 3D4TA 3W8JA 4MJAA 1YKAA 4P3YB 1FB6A 1U6TA 4HU7A 4G2EA 22GSA 1YF0A 4ULXA 4HQZA 3TOTA 4IVFA 4PTSA 1WE0A 2R0PA 4PUFC 5F8BA 2MMNA 3TJFA 3UAPA 4JRRA 4MF6A 4V2NA 3UL3A 2Z9SA 2PPTA 3PR8A 2GT6A 4GF0A 4O92A 1O6JA 5ECHB 3U5RE 6GSUA 5EPFA 2GS3A 1QFNA 4KE3A 2JZTA 4F0BA 3MYDA 4NPBA 4K7OA 5ECNB 1GSFA 4MCUA 4MLYA 1ERVA 5ECSA 2CV4A 1GSQA 3UVHA 3I69A 1HNAA 1JZWA 5G30A 2GLRA 4L0UA 4AJ6A 3HJOA 4I6XA 3CYNA 4NV5A 2IN3A 4EE0A 2A2RA 2XBQA 1F3BA 2OE0A 5DJLA 4E8HA 5D9XA 4ZILA 4MNNA 2AYTA 1NM3A 2QA2A 4JZQA 5H5SA 3QAWA 1TXXA 1PRXA 2H75A 2E7PA 1OAZA 2F9SA 4MPFA 5JCUA 2RUEA 2GT5A 2LNTA 3ZRDA 2L6DA 5HFIA 4F03A 2ZNMA 3I9V2 2HYXA 4BPYA 4D73A 4HUAA 4MJEA 5B6MA 2VL2C 4I5QA 4HZ2A 5BMUA 3CRTA 1RQMA 2F8FA 4MPGA 3FRCA 3UOMA 2B6MA 1ZYPA 1M0UA 1R7HA 3LQ7A 1OC9B 1IYIA 1TJDA 3M1GA 2OE3A 3FR3A 2JZRA 3FMWA 17GSA 1PKWA 4K9ZA 3E9JB 4ML1A 4TR1B 3GX0A 5CYYA
chains in the Genus database with same CATH topology
2YANA 4CY8A 4TN8A 3D5JA 2IPAA 5JWQB 1PX6A 3M9KA 2YV7A 4ISDA 2CVBA 5IM9A 3ISOA 1SENA 5FHIA 1BQ7A 3U6VA 1XVWA 2CAQA 3M0FA 3GL3A 3TRXA 3GURA 3SWLA 4MZBA 5CO3A 1O7UA 1N2AA 3EU4A 4G0LA 2H1DA 4NMUA 1USBA 3UBKA 1AQVA 5IOXA 1B8XA 3UARA 3IHQA 3UJ1A 1T7PB 3W6GA 4XS1A 2FNOA 20GSA 2VCQA 2H1AA 1MDIA 4BWQA 4RQXA 3TRQA 5L71A 4HOJA 2FD3A 4I8BA 2VL3A 3GYKA 1SKRB 2IMDA 1FB0A 1HNCA 2WS2A 4MA9A 5AIVA 2PWJA 4YQMA 1T1VA 4XTSA 3QAVA 1K0AA 1XWGA 1A23A 2H0GA 2FUG2 1Z7PA 1H75A 5CRHA 5DAKA 4TR4A 5G1KA 1DSBA 2N5AA 3TUEA 3ERWA 4FO5A 3FZ5A 2GZYA 4USSA 5AGYA 4KDYA 2RM6A 3PPUA 5LCZA 1TK5B 3CSIA 3KZQA 5DCHA 3RHBA 3KGKA 2WDUA 3LORA 2A2PA 3PGTA 3GTUB 4FYCA 3VWUA 3LYPA 2X99A 1TK8B 2OE1A 2R4VA 5C04A 3DIEA 5CAXA 4TRXA 4IP6A 3ZITA 1SL2B 3ZIJA 3GSTA 1A2JA 1T8EB 5F0GA 2M46A 3IRAA 4GSTA 2X8HA 4TR0A 2GSRA 3LEFA 2H6XA 1FAAA 2YP6A 1O8XA 1OC3A 2ZUPA 2H1BA 4N11A 4ID0A 4GTUA 3H93A 4F9ZA 3KEBA 3F0IA 2F3MA 1WWJA 2LRTA 1GUMA 1T00A 3R2QA 2DJ2A 2E2MA 2H30A 5HR0A 1FVJA 3TB2A 1WP0A 4MJBA 2BJXA 2LJAA 2C3TA 3G9BA 3P90A 2NVLA 3L78A 5IOWA 1MDKA 2R6KA 4FYUA 4HS1A 3ZFLA 5LD0A 5EVOA 1LJRA 2C0FA 2L59A 2H74A 4LMWA 2G2QA 4TR3A 6GSVA 3O76A 4EIQA 5HR3A 3F63A 2AHEA 1QGVA 2P5QA 2XHFA 1ACVA 4K1FA 4N0ZA 4ECJA 2LKUA 3CTFA 5J3RA 5ECOB 4F2IA 1G7OA 2OACA 3P2AA 1ZMAA 3A2XA 5C00A 4ECIA 3IK7A 4H86A 4ZBAA 2YWMA 5ID2B 4PXOA 1MD3A 1S3DA 1GUKA 1CQGA 2HRKA 3EC3A 3HVSA 4G0IA 2YCDA 5EY6A 2WB9A 1XZOA 3VURA 2VLVA 1J0FA 1B9XC 1MEKA 2IMKA 1K3YA 1SJZA 4ZBBA 4ZXGA 1OKTA 3CSHA 2JZSA 2F51A 3IAM2 1W4VA 3FEUA 5G5EA 1F37A 3IXRA 1DBYA 1OC9A 5LNKe 1G7EA 2DJ3A 2H19A 4QL7A 2L57A 1E2YA 5ECQB 1J08A 4TR1A 4PURA 2O89A 3CSJA 5GSSA 1ZYQB 2DLXA 1DE2A 3H79A 5CREA 3HVXA 4XS4A 1M9AA 2HI7A 3RAZA 4OO5A 2GQMA 5J4UA 1A2MA 3GSSA 2OBIA 1Z9HA 4EF0A 3UBLA 3JCML 2V6KA 2DMLA 5HQPA 4IJIA 5A4UA 1THOA 1KTEA 1GP1A 2H72A 3O3TA 1ST9A 2VD0A 2C80A 2C0GA 5IMCA 1SKSB 4YQUA 1H4OA 3DEXA 1VF1A 2K6VA 4KSOA 2GZPA 2XPEA 5G2ZA 1SK1A 5DVBA 5B8AA 1T3BA 4WR4A 1R26A 4MH3A 2H0IA 3TCOA 2CVKA 2L4CA 2P31A 4Z2RA 3L9VA 4IGJA 2ON7A 5ECMB 2HLSA 4Q5NA 2L5LA 1N8JA 4KB3A 1TP9A 3GX8A 4TXVA 3LYKA 6GSYA 1SD8A 2VLTA 4K5RA 11GSA 4X4JA 1R5PA 3DMLA 4AGSA 2YNXA 4GQCA 2HRNA 1PD21 3ZFBA 1GRXA 3C7MA 5H5RA 2VCXA 3GTUA 3KMNA 3VWVA 3IC4A 3Q6OA 3ZYWA 2N5BA 4K5SA 4KUNA 1S3CA 4JEDA 2B5EA 1F2EA 3LSZA 4PNGA 3EMPA 1EGOA 4OMVA 1XWCA 2LTKA 3ED3A 2NTOA 2QGVA 3I43A 2VCTA 3TJKA 1PQNA 3ZIVA 2QC7A 4Z7XA 1EWXA 5D93A 3ME8A 2VUPA 1X5DA 2VIMA 10GSA 4ACSA 1GSSA 1J9BA 1GSEA 1V9WA 3QOUA 3A5WA 4NAXA 1O85A 3KCMA 2CZ2A 4WKWA 1O8WA 3ERGA 2HRAA 3FYGA 4HZ4A 3PH9A 3IAS2 1FHEA 3PINA 3HA9A 4OD7A 3IE3A 2LNSA 4DEJA 1Y25A 1JLWA 4BVYB 1MTCA 1K0BA 1ZGNA 4TXOB 5IMDA 1ML6A 5GAPD 1FOVA 4RI7A 3TKRA 3E3EA 5D96A 2P0GA 2X49A 3QAGA 4PNFA 1XXUA 4NXIA 1BYEA 1GH2A 3VI7A 2X64A 1LBKA 2CAIA 1GSUA 1QQ2A 2IWTA 3QPMA 1EOGA 3NOFA 3HY2A 4G10A 3KIJA 5DBQA 4E8EA 1I9DA 2HSMA 4IS0A 5KN1A 2CQ9A 3WT2A 5ID2A 2MMOA 4MZWA 1XOBA 1XCCA 4NWYA 3EMXA 2HXKA 2YWIA 3TGZA 2AB6A 2FGXA 2ALBA 1YF1A 1F6MC 3TOUA 5GAND 2VO4A 3P8WA 2D2ZA 4GSSA 2XPDA 4WBJA 2N5FA 3MSZA 3TKQA 2L6CA 3IC8A 2PVOC 4WF4A 4O5RA 4HJMA 2HZFA 1K0MA 3DD3A 2IMIA 2O8VB 4IN0A 1PX7A 4XS4B 3WYWA 5E59A 4KA0A 4RUVA 5COHA 2JSZA 1PSQA 3MDKA 4IKHA 3ZMKA 1ZOFA 1PN0A 5D9WA 5J9CA 1X9SB 6GSWA 4KSMA 4J56E 1WMJA 4IP1A 2GZZA 4YKGA 1PL1A 5J41A 2ON5A 5AN1A 3ZREA 12GSA 3DYRA 4XCSA 1BX9A 4HU9A 5JWOB 2YWNA 1WOUA 3DVWA 1MDJA 1T4YA 2WZ9A 3EPTA 4L5OA 1XWBA 2DKIA 4N30A 2C8UA 5E4WA 4K0GA 2KP2A 3APSA 1XWAA 5HFGA 5GSTA 3GHAA 2WJUA 1X5EA 2AAWA 2QKEA 3IA1A 4LL4B 2PU9C 4L5LA 1YQ1A 3DKSA 2E2GA 3BOAA 2J9HA 1F3AA 4JBBA 2GSQA 3GA4A 5CP1A 1BAYA 2NDOA 4MZCA 1YJ6A 3M9JA 2B5YA 1M99A 1QMVA 4K2XA 5DALB 4XS6A 4K8MA 2VM1A 3TKSC 4GSNA 4MP4A 1A8LA 2YJHA 1DUGA 2YZHA 2PUKC 3IR4A 2GDRA 5JCWA 4TVEA 3VLNA 2HZEB 3L0HA 2CVDA 4DSQA 1F9MA 1Z3EA 4L0WA 3EWLA 1Q4JA 2EIRA 3IBHA 4WF5A 2VL2A 1XIYA 1FG4A 2VM2A 2K8VA 2DIYA 1XFLA 2PMTA 5F06A 3VWWA 2X8GA 3FKFA 3MIXA 1ERTA 4KDXA 3RBTA 2OKAA 2FY6A 1ERWA 3HZ4A 3TKSE 5KOXA 1VF2A 2GGTA 1TRUA 1EZKA 3HYPA 4MF7A 1TOFA 5BRTA 1GTUA 4F82A 2OBKA 4WR5A 2PERA 4GWRA 4K0NA 2LRCA 3DXBA 1TKDB 1EV9A 3QR6A 1SKWB 1K3LA 3V1WA 1VRSD 1XOAA 3KH9A 2G0FA 5ECLB 2H73A 1UVZA 4N10A 1TU8A 2C3QA 1SJ6A 3CTGA 3TJBA 4KGIA 4BVYA 1ON4A 3HZ8A 3NZNA 2H01A 3GH9A 4TXOA 2LSTA 3N9JA 3C73A 8GSSA 3CBUA 2K9FA 3LW9A 1YEPA 5GZZB 2AJQB 1V98A 3KTBA 1TRSA 3GKNA 1K0OA 2R2JA 3EE2A 2YZUA 4GQFA 1V58A 3GN3A 3VFIA 1TI3A 3G7IA 2R37A 1K0CA 3IK9A 5HR2A 1GTBA 1HD2A 4NHZA 3L4NA 1U88A 3IDVA 3Q18A 5D73A 3WD6A 2HSHA 3SBCA 4OFNA 2I3YA 4ZB9A 4Q5FA 4IELA 2B3SA 3TDGA 4IJ3A 6GSSA 3VPQA 1O73A 1U3AA 4O5UA 1TK0B 4NV2A 3P7XA 2C1YA 4L8EA 4YQVA 1UA5A 1JFUA 4EUYA 4MK3A 1TRVA 2LS5A 5H5QA 2FHEA 2JU5A 3UIWA 3RHCA 3TRPA 4G9HA 2REMA 1B4PA 1I5GA 1KEBA 2DJJA 3BCKA 4MABA 2GSSA 1Z6NA 5CRWA 2VL9A 4ZIJA 4NHWA 3QFBC 4KCEA 3W8SA 3LGCA 5IMVA 3VWXA 1AQWA 5B6NA 2C4JA 2K8SA 14GSA 1QUWA 1NHOA 3APQA 5KN2A 3VI5A 2BTOT 2H6YA 3R3EA 2AUVA 1XWKA 4HI7A 1PL2A 2F8AA 1SU9A 1ZZYA 3HJMA 4V2LA 3TJGA 1GUHA 2DSAA 3QCPA 3VPTA 4EVMA 1K0DA 3RPPA 1EP8A 1YEXA 2JACA 3GMFA 4LA1A 1XBSA 1ZL9A 2A2SA 5DCGA 3IHGA 4G19A 4KF9A 4ZL8A 1PMTA 3OR5A 2IFQB 3D4MA 1M7TA 3BD2A 3RDWA 3D6IA 4WBRD 1QK8A 1JLVA 3Q74A 2IL3A 4JU5A 5IMFA 4F0CA 3LWAA 3D22A 3TKPA 3IPZA 2RM5A 18GSA 6GSXA 1BG5A 1HYUA 4IW9A 1A0FA 1WPIA 3ZLPA 4IBPA 2I81A 5KN3A 2YPMA 3ZVJD 4OO4A 3DGQA 2GQKA 3F3QA 2B1LA 4BVXB 5F05A 3FHKA 4PUAA 5FT3A 3KTLA 4JE1A 1M2DA 1W89A 3FK8A 3FZ4A 1TRWA 3F4TA 2M80A 2HFDA 2FCHA 4OFTA 4HDEA 5DALA 1AQXA 2H70A 4EO3A 2AV4A 4MDCA 1TTZA 4LMVA 3M8NA 4YAPA 5IO0A 2OADA 3WT1A 2OJLA 4BA7A 2YJ7A 2VCWA 2MZCA 5IPHA 2KUCA 2HZEA 3GV1A 1XVQA 1GWCA 1LU4A 1GL8A 1VGLA 4V2MA 4POLA 2YWOA 3LJRA 5CNWA 1GTAA 5ABRA 3A2WA 4EKZA 2B5XA 2FA8A 2PBJA 2ES7A 3C1SA 4DSSB 3K8NA 2O7KA 4WEYA 2HNLA 1A8YA 4EL1A 4CDOA 1RK4A 1A24A 3F4SA 3KH7A 5IMAA 4ECBA 2LV3A 3C8EA 4DVCA 2WCIA 1U3IA 3A3TA 3M3MA 4A5PA 2H66A 5G5FA 1SL1B 3WGEA 3FW2A 2HT9A 4IHUA 1AW9A 5B8BA 3FY7A 5G1LA 4PQHA 2LEGA 2CX3A 2C3NA 2PVQA 2DC5A 1U87A 2KOKA 4I97A 2BMXA 4AJ7A 2V1MA 3H1NA 2DBCA 5ELGA 3CMIA 2EIQA 2R0CA 4HEA2 2GVPA 1JZDA 1Z7RA 1R5AA 2VD1A 2RLIA 1WJKA 1UC7A 1AXDA 3MWHA 1GNWA 3LG6A 3EURA 4ECCA 4X1UA 2E0QA 2XBIA 5DQYA 3FZ9A 2LJKA 3L9SA 4BL7B 2EC4A 5ELAA 3EVIA 2A4VA 5KOWA 2YV9A 2H6ZA 3DWVA 1M9BA 1B9YC 1EGRA 2MBSA 3GKMA 5AIXA 4RQRA 1A0RP 2DJKA 2NBSA 1SJIA 3HDCA 2K18A 1ZYNA 2VCZA 2O85A 4ZL9A 2KHPA 3GKKA 1Q98A 2QSIA 1EEMA 1PA3A 4OCEA 1HQOA 1M2AA 3GL5A 3HXSA 5J9BA 4Q5QA 2PGTA 4O32A 4BWSA 3J7Yk 4J2FA 1GNEA 3FR6A 4EDYA 3GIXA 1OYJA 3ZMLA 3APOA 1G6WA 4GXZA 1B4QA 7GSSA 5EL8A 4XHMA 4KCAA 3F4RA 4KDUA 2R0GA 3FR9A 1EP7A 2B7JA 2I4AA 1VF4A 3UVTA 4HJ2A 1R4WA 1KNGA 2QA1A 3A2VA 3CRUA 1CQHA 2O87A 4KNDA 1AIUA 4X0XA 3EYTA 4OFMA 2FWEA 4GCIA 1X9MB 1XW9A 2VCVA 3F6FA 3GKXA 1E6BA 1AAZA 2FA4A 1V2AA 3G7JA 3F9UA 3KJYA 1BJXA 4EXJA 2H76A 3GNJA 1TDIA 1GLPA 1Y6EA 2EIOA 1ILOA 3ME7A 2IFQA 1GLQA 2IMEA 1OKDA 3KP9A 3QFAC 2M72A 1G6YA 4QQ7A 1YZXA 5IPGA 3FZAA 3I6AA 5KEJA 2FLSA 3DRNA 2CZ3A 4JR6A 3KMOA 2R3XA 1XW5A 2I1UA 5CRGA 1YDKA 4GLTA 2FWHA 5D8IA 1OVNA 4CHSA 3D0ZA 3D21A 1JHBA 4EC0A 2H1GA 2C0EA 2C0DA 2DJ0A 4AJ8A 4BVXA 1TI1A 3GUSA 4ML6A 3DVXA 2B7KA 2X4AA 3RPNA 3GRXA 5ECPB 4FYBA 1AC1A 2V6OA 1OE7A 4PQ1A 2UZ8A 2OA7A 1X0RA 4I2UA 13GSA 5AISA 4POKA 2PN8A 2TRXA 1SYRA 3KXOA 2LUSA 3HHVA 5ENUA 3QMXA 6GSTA 2L5OA 3LXZA 5HR1A 5A4VA 2HSYA 3LXTA 3ZL5A 2CX4A 4PX1A 3QDNA 5ECIB 4N0VA 4RI6A 1TW9A 3F6DA 3ZTLA 1VF3A 4EDZA 4XIHA 5IQYA 3KD0A 1X9WB 1FO5A 1GSDA 3WGXA 5IO2A 4TW5A 3AY8A 3F8UA 4IQAA 3N5OA 4OWYA 1URMA 5G31A 3GFKA 5CRDA 2I9HA 1DE1A 1UN2A 4OCFA 1B48A 1K0NA 2DMMA 2B1KA 4DSSA 1EEJA 5FWGA 3KP8A 4CY6A 2MMZA 2MBTA 4FIWA 4GRFA 2H0HA 2WRTA 1Z5YE 1M2BA 1MD4A 4MMMA 1T4ZA 2FWFA 3G7YA 3US3A 1KBNA 2LRNA 2L4QA 4YAVA 4PGTA 4WETA 3O6TA 1AUCA 4KAEA 3QD9A 3EINA 1YY7A 5IIZA 4Q5RA 4MF5A 2LQQA 4Z2TA 5KN0A 1GULA 1EOHA 4I2TA 3UMAA 4ZB8A 1SYXA 2GSTA 3C1RA 5ECKB 2VLUA 4K7IA 4QL9A 2YN1A 3EU3A 2R5GA 2VOCA 2JSYA 3F3RA 1YKCA 5IMZA 5JCGA 9GSSA 1A2LA 3S9FA 4ICYA 5D9VA 1NHYA 2V32A 4BL7A 3L9UA 4PQIA 2LQOA 4AF2A 4HQSA 1IYHA 2YOIA 1GTIA 2RIIA 4KW6A 3J7Yb 19GSA 4Z2UA 2TRCP 3HVVA 5F07A 3MAKA 4D73B 3A5IA 4X43A 5B7CA 4ZBDA 3BJ5A 4KH7A 1FOHA 4K6XA 4IQ1A 2RUFA 4LL1B 3VK9A 1SD9A 1XW6A 3LFLA 1OE8A 1K3OA 3CXGA 4J57E 1OC8A 2CT6A 2GQLA 4V1Ap 2P5RA 2CA8A 3IOSA 5DDLA 2WFCA 4EIPA 2H8LA 5DJMA 3TKSA 4ZB6A 1PKZA 4XRDA 3BCIA 2DJ1A 1RW1A 5JWRB 4DSRA 1V57A 4FQUA 4JR4A 3HCZA 4O7HA 3HJPA 1PN9A 2GTUA 3H4KA 5A4WA 4YKFA 3KM6A 3ZVJA 4CW9A 1QXHA 4XRAA 3E0UA 4G0KA 1HNBA 1GSYA 5J5NA 1C72A 2H71A 3NIVA 2HE3A 3TJJA 1FVKA 4FH8A 2TIRA 2JADA 2JL4A 1Z6MA 2IIYA 3BBYA 5DQSA 4K2DA 2DIZA 4ILFA 4POMA 3HKRA 4LLRA 2MMAA 2V41A 2LJRA 2V2GA 3C71A 3ZZXA 1ERUA 1O81A 1ZYEA 4O5QA 4TOPA 1SL0B 1EV4A 1FW1A 16GSA 1SK2A 4ZL7A 1X5CA 1G0TA 2J23A 1WIKA 4KX4A 1V40A 3UEMA 3WGDA 3ERFA 2VAFA 1ABAA 1TU7A 4K7NA 3MNGA 5INYA 1XPVA 2ZCTA 1PGTA 4YH2A 5DAKB 2KP1A 2KLXA 1NW2A 5A5KA 2FWGA 1NSWA 3GH6A 5HFKA 2XC2A 2WGRA 4MJCA 1ZCPA 1WRYA 3Q19A 1BEDA 2DKHA 2IMFA 1THXA 3HD5A 3IV4A 2IJYA 2HRFA 4WXTA 4POBA 3H8QA 1JZOA 1JZRA 2A4HA 2MYGA 4V1Ag 1S3AA 2X8CA 4MH2A 1SK0A 5ECRB 2NPBA 2WULA 5D9TA 4TKYA 3D4TA 3W8JA 4MJAA 1YKAA 4P3YB 1FB6A 1U6TA 4HU7A 4G2EA 22GSA 1YF0A 4ULXA 4HQZA 3TOTA 4IVFA 4PTSA 1WE0A 2R0PA 4PUFC 5F8BA 2MMNA 3TJFA 3UAPA 4JRRA 4MF6A 4V2NA 3UL3A 2Z9SA 2PPTA 3PR8A 2GT6A 4GF0A 4O92A 1O6JA 5ECHB 3U5RE 6GSUA 5EPFA 2GS3A 1QFNA 4KE3A 2JZTA 4F0BA 3MYDA 4NPBA 4K7OA 5ECNB 1GSFA 4MCUA 4MLYA 1ERVA 5ECSA 2CV4A 1GSQA 3UVHA 3I69A 1HNAA 1JZWA 5G30A 2GLRA 4L0UA 4AJ6A 3HJOA 4I6XA 3CYNA 4NV5A 2IN3A 4EE0A 2A2RA 2XBQA 1F3BA 2OE0A 5DJLA 4E8HA 5D9XA 4ZILA 4MNNA 2AYTA 1NM3A 2QA2A 4JZQA 5H5SA 3QAWA 1TXXA 1PRXA 2H75A 2E7PA 1OAZA 2F9SA 4MPFA 5JCUA 2RUEA 2GT5A 2LNTA 3ZRDA 2L6DA 5HFIA 4F03A 2ZNMA 3I9V2 2HYXA 4BPYA 4D73A 4HUAA 4MJEA 5B6MA 2VL2C 4I5QA 4HZ2A 5BMUA 3CRTA 1RQMA 2F8FA 4MPGA 3FRCA 3UOMA 2B6MA 1ZYPA 1M0UA 1R7HA 3LQ7A 1OC9B 1IYIA 1TJDA 3M1GA 2OE3A 3FR3A 2JZRA 3FMWA 17GSA 1PKWA 4K9ZA 3E9JB 4ML1A 4TR1B 3GX0A 5CYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YAN A;  4TN8 A;  3D5J A;  2IPA A;  5JWQ B;  1PX6 A;  3M9K A;  2YV7 A;  4ISD A;  2CVB A;  5IM9 A;  3ISO A;  1SEN A;  5FHI A;  1BQ7 A;  3U6V A;  1XVW A;  2CAQ A;  3M0F A;  3GL3 A;  3TRX A;  3GUR A;  3SWL A;  4MZB A;  5CO3 A;  1O7U A;  1N2A A;  3EU4 A;  2H1D A;  4NMU A;  1USB A;  3UBK A;  1AQV A;  5IOX A;  1B8X A;  3UAR A;  3IHQ A;  3UJ1 A;  1T7P B;  3W6G A;  4XS1 A;  2FNO A;  20GS A;  2VCQ A;  2H1A A;  1MDI A;  4BWQ A;  4RQX A;  3TRQ A;  5L71 A;  4HOJ A;  2FD3 A;  4I8B A;  2VL3 A;  3GYK A;  1SKR B;  2IMD A;  1FB0 A;  1HNC A;  2WS2 A;  4MA9 A;  5AIV A;  2PWJ A;  4YQM A;  1T1V A;  4XTS A;  3QAV A;  1K0A A;  1XWG A;  1A23 A;  2H0G A;  2FUG 2;  1Z7P A;  1H75 A;  5CRH A;  5DAK A;  4TR4 A;  5G1K A;  1DSB A;  2N5A A;  3TUE A;  3ERW A;  4FO5 A;  3FZ5 A;  2GZY A;  5AGY A;  4KDY A;  2RM6 A;  5LCZ A;  1TK5 B;  3CSI A;  3KZQ A;  5DCH A;  3RHB A;  3KGK A;  2WDU A;  3LOR A;  3PGT A;  3GTU B;  4FYC A;  3VWU A;  3LYP A;  2X99 A;  1TK8 B;  2OE1 A;  2R4V A;  5C04 A;  3DIE A;  5CAX A;  4TRX A;  4IP6 A;  3ZIT A;  1SL2 B;  3ZIJ A;  3GST A;  1A2J A;  1T8E B;  5F0G A;  2M46 A;  3IRA A;  4GST A;  2X8H A;  4TR0 A;  2GSR A;  3LEF A;  2H6X A;  1FAA A;  2YP6 A;  1O8X A;  1OC3 A;  2ZUP A;  2H1B A;  4N11 A;  4ID0 A;  4GTU A;  3H93 A;  4F9Z A;  3KEB A;  3F0I A;  2F3M A;  1WWJ A;  2LRT A;  1GUM A;  1T00 A;  3R2Q A;  2DJ2 A;  2E2M A;  2H30 A;  5HR0 A;  1FVJ A;  3TB2 A;  1WP0 A;  4MJB A;  2BJX A;  2LJA A;  2C3T A;  3G9B A;  3P90 A;  2NVL A;  3L78 A;  5IOW A;  1MDK A;  2R6K A;  4FYU A;  4HS1 A;  3ZFL A;  5LD0 A;  5EVO A;  1LJR A;  2C0F A;  2L59 A;  2H74 A;  4LMW A;  2G2Q A;  4TR3 A;  6GSV A;  3O76 A;  5HR3 A;  3F63 A;  2AHE A;  1QGV A;  2P5Q A;  2XHF A;  1ACV A;  4K1F A;  4N0Z A;  4ECJ A;  2LKU A;  3CTF A;  5J3R A;  5ECO B;  4F2I A;  1G7O A;  2OAC A;  3P2A A;  1ZMA A;  3A2X A;  5C00 A;  4ECI A;  3IK7 A;  4H86 A;  4ZBA A;  2YWM A;  5ID2 B;  4PXO A;  1MD3 A;  1S3D A;  1GUK A;  1CQG A;  3EC3 A;  3HVS A;  2YCD A;  5EY6 A;  2WB9 A;  1XZO A;  3VUR A;  2VLV A;  1J0F A;  1B9X C;  1MEK A;  2IMK A;  1K3Y A;  1SJZ A;  4ZBB A;  4ZXG A;  1OKT A;  3CSH A;  2JZS A;  2F51 A;  3IAM 2;  1W4V A;  3FEU A;  5G5E A;  1F37 A;  3IXR A;  1DBY A;  1OC9 A;  5LNK e;  1G7E A;  2DJ3 A;  2H19 A;  4QL7 A;  2L57 A;  1E2Y A;  5ECQ B;  1J08 A;  4TR1 A;  4PUR A;  2O89 A;  3CSJ A;  5GSS A;  1ZYQ B;  2DLX A;  1DE2 A;  3H79 A;  5CRE A;  3HVX A;  4XS4 A;  1M9A A;  2HI7 A;  3RAZ A;  4OO5 A;  2GQM A;  5J4U A;  1A2M A;  3GSS A;  2OBI A;  1Z9H A;  4EF0 A;  3UBL A;  3JCM L;  2V6K A;  2DML A;  5HQP A;  4IJI A;  5A4U A;  1THO A;  1KTE A;  1GP1 A;  2H72 A;  3O3T A;  1ST9 A;  2VD0 A;  2C80 A;  2C0G A;  5IMC A;  1SKS B;  4YQU A;  1H4O A;  3DEX A;  1VF1 A;  2K6V A;  4KSO A;  2GZP A;  2XPE A;  5G2Z A;  1SK1 A;  5DVB A;  5B8A A;  1T3B A;  4WR4 A;  1R26 A;  4MH3 A;  2H0I A;  3TCO A;  2CVK A;  2L4C A;  2P31 A;  3L9V A;  4IGJ A;  2ON7 A;  5ECM B;  2HLS A;  4Q5N A;  2L5L A;  1N8J A;  4KB3 A;  1TP9 A;  3GX8 A;  4TXV A;  3LYK A;  6GSY A;  1SD8 A;  2VLT A;  11GS A;  1R5P A;  3DML A;  4AGS A;  2YNX A;  4GQC A;  2HRN A;  1PD2 1;  3ZFB A;  1GRX A;  3C7M A;  5H5R A;  2VCX A;  3GTU A;  3KMN A;  3VWV A;  3IC4 A;  3Q6O A;  3ZYW A;  2N5B A;  4KUN A;  1S3C A;  4JED A;  2B5E A;  1F2E A;  3LSZ A;  4PNG A;  3EMP A;  1EGO A;  4OMV A;  1XWC A;  2LTK A;  3ED3 A;  2NTO A;  2QGV A;  3I43 A;  2VCT A;  3TJK A;  1PQN A;  3ZIV A;  2QC7 A;  4Z7X A;  1EWX A;  5D93 A;  3ME8 A;  2VUP A;  1X5D A;  2VIM A;  10GS A;  4ACS A;  1GSS A;  1J9B A;  1GSE A;  1V9W A;  3QOU A;  3A5W A;  4NAX A;  1O85 A;  3KCM A;  2CZ2 A;  4WKW A;  1O8W A;  3ERG A;  3FYG A;  4HZ4 A;  3PH9 A;  3IAS 2;  1FHE A;  3PIN A;  3HA9 A;  4OD7 A;  3IE3 A;  2LNS A;  4DEJ A;  1Y25 A;  1JLW A;  1MTC A;  1K0B A;  1ZGN A;  4TXO B;  5IMD A;  1ML6 A;  5GAP D;  1FOV A;  4RI7 A;  3TKR A;  3E3E A;  5D96 A;  2P0G A;  3QAG A;  4PNF A;  1XXU A;  4NXI A;  1BYE A;  1GH2 A;  3VI7 A;  2X64 A;  1LBK A;  2CAI A;  1GSU A;  1QQ2 A;  2IWT A;  3QPM A;  1EOG A;  3NOF A;  3HY2 A;  4G10 A;  3KIJ A;  5DBQ A;  4E8E A;  1I9D A;  4IS0 A;  5KN1 A;  2CQ9 A;  3WT2 A;  5ID2 A;  2MMO A;  4MZW A;  1XOB A;  1XCC A;  4NWY A;  3EMX A;  2HXK A;  2YWI A;  3TGZ A;  2AB6 A;  2FGX A;  2ALB A;  1YF1 A;  1F6M C;  3TOU A;  5GAN D;  2VO4 A;  3P8W A;  2D2Z A;  4GSS A;  2XPD A;  4WBJ A;  2N5F A;  3MSZ A;  3TKQ A;  2L6C A;  2PVO C;  4WF4 A;  4O5R A;  4HJM A;  2HZF A;  1K0M A;  3DD3 A;  2IMI A;  2O8V B;  4IN0 A;  1PX7 A;  4XS4 B;  3WYW A;  5E59 A;  4KA0 A;  4RUV A;  5COH A;  2JSZ A;  1PSQ A;  3MDK A;  4IKH A;  3ZMK A;  1ZOF A;  5D9W A;  5J9C A;  1X9S B;  6GSW A;  4KSM A;  4J56 E;  1WMJ A;  4IP1 A;  2GZZ A;  1PL1 A;  5J41 A;  2ON5 A;  5AN1 A;  3ZRE A;  12GS A;  3DYR A;  4XCS A;  1BX9 A;  4HU9 A;  5JWO B;  2YWN A;  1WOU A;  3DVW A;  1MDJ A;  1T4Y A;  2WZ9 A;  4L5O A;  1XWB A;  4N30 A;  2C8U A;  5E4W A;  4K0G A;  2KP2 A;  3APS A;  1XWA A;  5HFG A;  5GST A;  3GHA A;  2WJU A;  1X5E A;  2AAW A;  2QKE A;  3IA1 A;  4LL4 B;  2PU9 C;  4L5L A;  1YQ1 A;  3DKS A;  2E2G A;  3BOA A;  2J9H A;  1F3A A;  4JBB A;  2GSQ A;  3GA4 A;  5CP1 A;  1BAY A;  2NDO A;  4MZC A;  1YJ6 A;  3M9J A;  2B5Y A;  1M99 A;  1QMV A;  5DAL B;  4XS6 A;  4K8M A;  2VM1 A;  3TKS C;  4GSN A;  4MP4 A;  1A8L A;  2YJH A;  1DUG A;  2YZH A;  2PUK C;  3IR4 A;  2GDR A;  5JCW A;  4TVE A;  3VLN A;  2HZE B;  3L0H A;  2CVD A;  4DSQ A;  1F9M A;  1Z3E A;  4L0W A;  3EWL A;  1Q4J A;  2EIR A;  3IBH A;  4WF5 A;  2VL2 A;  1XIY A;  1FG4 A;  2VM2 A;  2K8V A;  2DIY A;  1XFL A;  2PMT A;  5F06 A;  3VWW A;  2X8G A;  3FKF A;  1ERT A;  4KDX A;  3RBT A;  2OKA A;  2FY6 A;  1ERW A;  3HZ4 A;  3TKS E;  1VF2 A;  2GGT A;  1TRU A;  1EZK A;  3HYP A;  4MF7 A;  1TOF A;  1GTU A;  4F82 A;  2OBK A;  4WR5 A;  2PER A;  4GWR A;  4K0N A;  2LRC A;  3DXB A;  1TKD B;  1EV9 A;  3QR6 A;  1SKW B;  1K3L A;  3V1W A;  1VRS D;  1XOA A;  3KH9 A;  2G0F A;  5ECL B;  2H73 A;  1UVZ A;  4N10 A;  1TU8 A;  2C3Q A;  1SJ6 A;  3CTG A;  3TJB A;  4KGI A;  4BVY A;  1ON4 A;  3HZ8 A;  3NZN A;  2H01 A;  3GH9 A;  4TXO A;  2LST A;  3N9J A;  3C73 A;  8GSS A;  3CBU A;  2K9F A;  1YEP A;  5GZZ B;  2AJQ B;  1V98 A;  3KTB A;  1TRS A;  3GKN A;  1K0O A;  2R2J A;  3EE2 A;  2YZU A;  4GQF A;  1V58 A;  3GN3 A;  3VFI A;  1TI3 A;  3G7I A;  2R37 A;  1K0C A;  3IK9 A;  5HR2 A;  1GTB A;  1HD2 A;  4NHZ A;  3L4N A;  1U88 A;  3IDV A;  3Q18 A;  5D73 A;  3WD6 A;  2HSH A;  3SBC A;  4OFN A;  2I3Y A;  4ZB9 A;  4Q5F A;  4IEL A;  2B3S A;  3TDG A;  4IJ3 A;  6GSS A;  3VPQ A;  1O73 A;  1U3A A;  1TK0 B;  4NV2 A;  3P7X A;  2C1Y A;  4L8E A;  4YQV A;  1UA5 A;  1JFU A;  4EUY A;  4MK3 A;  1TRV A;  2LS5 A;  5H5Q A;  2FHE A;  2JU5 A;  3UIW A;  3RHC A;  3TRP A;  4G9H A;  2REM A;  1B4P A;  1I5G A;  1KEB A;  2DJJ A;  3BCK A;  4MAB A;  2GSS A;  1Z6N A;  5CRW A;  2VL9 A;  4ZIJ A;  4NHW A;  3QFB C;  4KCE A;  3W8S A;  3LGC A;  5IMV A;  3VWX A;  1AQW A;  5B6N A;  2C4J A;  2K8S A;  14GS A;  1QUW A;  1NHO A;  3APQ A;  5KN2 A;  3VI5 A;  2BTO T;  2H6Y A;  2AUV A;  1XWK A;  4HI7 A;  1PL2 A;  2F8A A;  1SU9 A;  1ZZY A;  3HJM A;  4V2L A;  3TJG A;  1GUH A;  2DSA A;  3QCP A;  3VPT A;  4EVM A;  1K0D A;  3RPP A;  1EP8 A;  1YEX A;  2JAC A;  3GMF A;  4LA1 A;  1XBS A;  1ZL9 A;  2A2S A;  5DCG A;  4G19 A;  4ZL8 A;  1PMT A;  3OR5 A;  2IFQ B;  3D4M A;  1M7T A;  3BD2 A;  3RDW A;  3D6I A;  4WBR D;  1QK8 A;  1JLV A;  3Q74 A;  2IL3 A;  4JU5 A;  5IMF A;  4F0C A;  3LWA A;  3D22 A;  3TKP A;  3IPZ A;  2RM5 A;  18GS A;  6GSX A;  1BG5 A;  1HYU A;  4IW9 A;  1A0F A;  1WPI A;  3ZLP A;  4IBP A;  2I81 A;  5KN3 A;  2YPM A;  3ZVJ D;  4OO4 A;  3DGQ A;  2GQK A;  3F3Q A;  2B1L A;  5F05 A;  3FHK A;  4PUA A;  5FT3 A;  3KTL A;  4JE1 A;  1M2D A;  1W89 A;  3FK8 A;  3FZ4 A;  1TRW A;  3F4T A;  2M80 A;  2HFD A;  2FCH A;  4OFT A;  4HDE A;  5DAL A;  1AQX A;  2H70 A;  4EO3 A;  2AV4 A;  4MDC A;  1TTZ A;  4LMV A;  3M8N A;  4YAP A;  5IO0 A;  2OAD A;  3WT1 A;  2OJL A;  4BA7 A;  2YJ7 A;  2VCW A;  2MZC A;  5IPH A;  2KUC A;  2HZE A;  3GV1 A;  1XVQ A;  1GWC A;  1LU4 A;  1GL8 A;  1VGL A;  4V2M A;  4POL A;  2YWO A;  3LJR A;  5CNW A;  1GTA A;  5ABR A;  3A2W A;  4EKZ A;  2B5X A;  2FA8 A;  2PBJ A;  2ES7 A;  3C1S A;  4DSS B;  3K8N A;  2O7K A;  4WEY A;  2HNL A;  1A8Y A;  4EL1 A;  4CDO A;  1RK4 A;  1A24 A;  3F4S A;  3KH7 A;  5IMA A;  4ECB A;  2LV3 A;  3C8E A;  4DVC A;  2WCI A;  1U3I A;  3A3T A;  3M3M A;  2H66 A;  5G5F A;  1SL1 B;  3WGE A;  3FW2 A;  2HT9 A;  4IHU A;  1AW9 A;  5B8B A;  3FY7 A;  5G1L A;  4PQH A;  2LEG A;  2CX3 A;  2C3N A;  2PVQ A;  2DC5 A;  1U87 A;  2KOK A;  4I97 A;  2BMX A;  4AJ7 A;  2V1M A;  3H1N A;  2DBC A;  5ELG A;  3CMI A;  2EIQ A;  4HEA 2;  2GVP A;  1JZD A;  1Z7R A;  1R5A A;  2VD1 A;  2RLI A;  1WJK A;  1UC7 A;  1AXD A;  3MWH A;  1GNW A;  3LG6 A;  3EUR A;  4ECC A;  4X1U A;  2E0Q A;  2XBI A;  5DQY A;  3FZ9 A;  2LJK A;  3L9S A;  2EC4 A;  5ELA A;  3EVI A;  2A4V A;  2YV9 A;  2H6Z A;  3DWV A;  1M9B A;  1B9Y C;  1EGR A;  2MBS A;  3GKM A;  5AIX A;  4RQR A;  1A0R P;  2DJK A;  2NBS A;  1SJI A;  3HDC A;  2K18 A;  2VCZ A;  2O85 A;  4ZL9 A;  2KHP A;  3GKK A;  1Q98 A;  2QSI A;  1EEM A;  1PA3 A;  4OCE A;  1HQO A;  1M2A A;  3GL5 A;  3HXS A;  5J9B A;  4Q5Q A;  2PGT A;  4O32 A;  4BWS A;  3J7Y k;  4J2F A;  1GNE A;  3FR6 A;  4EDY A;  3GIX A;  1OYJ A;  3ZML A;  3APO A;  1G6W A;  4GXZ A;  1B4Q A;  7GSS A;  5EL8 A;  4XHM A;  4KCA A;  3F4R A;  4KDU A;  3FR9 A;  1EP7 A;  2B7J A;  2I4A A;  1VF4 A;  3UVT A;  4HJ2 A;  1R4W A;  1KNG A;  3A2V A;  3CRU A;  1CQH A;  2O87 A;  4KND A;  1AIU A;  4X0X A;  3EYT A;  4OFM A;  2FWE A;  4GCI A;  1X9M B;  1XW9 A;  2VCV A;  3F6F A;  3GKX A;  1E6B A;  1AAZ A;  2FA4 A;  1V2A A;  3G7J A;  3F9U A;  3KJY A;  1BJX A;  4EXJ A;  2H76 A;  3GNJ A;  1TDI A;  1GLP A;  1Y6E A;  2EIO A;  1ILO A;  3ME7 A;  2IFQ A;  1GLQ A;  2IME A;  1OKD A;  3KP9 A;  3QFA C;  2M72 A;  1G6Y A;  4QQ7 A;  1YZX A;  5IPG A;  3FZA A;  3I6A A;  5KEJ A;  2FLS A;  3DRN A;  2CZ3 A;  4JR6 A;  3KMO A;  2R3X A;  1XW5 A;  2I1U A;  5CRG A;  1YDK A;  4GLT A;  2FWH A;  5D8I A;  1OVN A;  4CHS A;  3D0Z A;  3D21 A;  1JHB A;  4EC0 A;  2H1G A;  2C0E A;  2C0D A;  2DJ0 A;  4AJ8 A;  4BVX A;  1TI1 A;  3GUS A;  4ML6 A;  3DVX A;  2B7K A;  3RPN A;  3GRX A;  5ECP B;  4FYB A;  1AC1 A;  2V6O A;  1OE7 A;  4PQ1 A;  2OA7 A;  1X0R A;  4I2U A;  13GS A;  5AIS A;  4POK A;  2PN8 A;  2TRX A;  1SYR A;  3KXO A;  2LUS A;  3HHV A;  5ENU A;  3QMX A;  6GST A;  2L5O A;  3LXZ A;  5HR1 A;  5A4V A;  2HSY A;  3LXT A;  3ZL5 A;  2CX4 A;  4PX1 A;  3QDN A;  5ECI B;  4N0V A;  4RI6 A;  1TW9 A;  3F6D A;  3ZTL A;  1VF3 A;  4EDZ A;  4XIH A;  5IQY A;  3KD0 A;  1X9W B;  1FO5 A;  1GSD A;  3WGX A;  5IO2 A;  4TW5 A;  3AY8 A;  3F8U A;  4IQA A;  3N5O A;  4OWY A;  1URM A;  5G31 A;  3GFK A;  5CRD A;  2I9H A;  1DE1 A;  1UN2 A;  4OCF A;  1B48 A;  1K0N A;  2DMM A;  2B1K A;  4DSS A;  1EEJ A;  5FWG A;  3KP8 A;  2MMZ A;  2MBT A;  4FIW A;  4GRF A;  2H0H A;  2WRT A;  1Z5Y E;  1M2B A;  1MD4 A;  4MMM A;  1T4Z A;  2FWF A;  3G7Y A;  3US3 A;  1KBN A;  2LRN A;  2L4Q A;  4YAV A;  4PGT A;  4WET A;  3O6T A;  1AUC A;  4KAE A;  3QD9 A;  3EIN A;  1YY7 A;  5IIZ A;  4Q5R A;  4MF5 A;  2LQQ A;  5KN0 A;  1GUL A;  1EOH A;  4I2T A;  3UMA A;  4ZB8 A;  1SYX A;  2GST A;  3C1R A;  5ECK B;  2VLU A;  4K7I A;  4QL9 A;  2YN1 A;  3EU3 A;  2R5G A;  2VOC A;  2JSY A;  3F3R A;  1YKC A;  5IMZ A;  5JCG A;  9GSS A;  1A2L A;  3S9F A;  5D9V A;  1NHY A;  2V32 A;  4BL7 A;  3L9U A;  4PQI A;  2LQO A;  4AF2 A;  4HQS A;  1IYH A;  2YOI A;  1GTI A;  2RII A;  4KW6 A;  3J7Y b;  19GS A;  2TRC P;  3HVV A;  5F07 A;  3MAK A;  4D73 B;  4X43 A;  5B7C A;  4ZBD A;  3BJ5 A;  4KH7 A;  4K6X A;  4IQ1 A;  2RUF A;  4LL1 B;  3VK9 A;  1SD9 A;  1XW6 A;  3LFL A;  1OE8 A;  1K3O A;  3CXG A;  4J57 E;  1OC8 A;  2CT6 A;  2GQL A;  4V1A p;  2P5R A;  2CA8 A;  3IOS A;  5DDL A;  2WFC A;  2H8L A;  5DJM A;  3TKS A;  4ZB6 A;  1PKZ A;  4XRD A;  3BCI A;  2DJ1 A;  1RW1 A;  5JWR B;  4DSR A;  1V57 A;  4JR4 A;  3HCZ A;  4O7H A;  3HJP A;  1PN9 A;  2GTU A;  3H4K A;  5A4W A;  3KM6 A;  3ZVJ A;  4CW9 A;  1QXH A;  4XRA A;  3E0U A;  1HNB A;  1GSY A;  5J5N A;  1C72 A;  2H71 A;  3NIV A;  2HE3 A;  3TJJ A;  1FVK A;  4FH8 A;  2TIR A;  2JAD A;  2JL4 A;  1Z6M A;  2IIY A;  3BBY A;  5DQS A;  4K2D A;  2DIZ A;  4ILF A;  4POM A;  3HKR A;  4LLR A;  2MMA A;  2V41 A;  2LJR A;  2V2G A;  3C71 A;  3ZZX A;  1ERU A;  1O81 A;  1ZYE A;  4TOP A;  1SL0 B;  1EV4 A;  1FW1 A;  16GS A;  1SK2 A;  4ZL7 A;  1X5C A;  1G0T A;  2J23 A;  1WIK A;  4KX4 A;  1V40 A;  3UEM A;  3WGD A;  3ERF A;  2VAF A;  1ABA A;  1TU7 A;  4K7N A;  3MNG A;  5INY A;  1XPV A;  2ZCT A;  1PGT A;  4YH2 A;  5DAK B;  2KP1 A;  2KLX A;  1NW2 A;  5A5K A;  2FWG A;  1NSW A;  3GH6 A;  5HFK A;  2XC2 A;  2WGR A;  4MJC A;  1ZCP A;  1WRY A;  3Q19 A;  1BED A;  2IMF A;  1THX A;  3HD5 A;  3IV4 A;  2IJY A;  2HRF A;  4WXT A;  4POB A;  3H8Q A;  1JZO A;  1JZR A;  2MYG A;  4V1A g;  1S3A A;  2X8C A;  4MH2 A;  1SK0 A;  5ECR B;  2NPB A;  2WUL A;  5D9T A;  4TKY A;  3D4T A;  3W8J A;  4MJA A;  1YKA A;  4P3Y B;  1FB6 A;  1U6T A;  4HU7 A;  4G2E A;  22GS A;  1YF0 A;  4ULX A;  4HQZ A;  3TOT A;  4IVF A;  1WE0 A;  4PUF C;  5F8B A;  2MMN A;  3TJF A;  3UAP A;  4JRR A;  4MF6 A;  4V2N A;  3UL3 A;  2Z9S A;  2PPT A;  3PR8 A;  2GT6 A;  4GF0 A;  4O92 A;  1O6J A;  5ECH B;  3U5R E;  6GSU A;  5EPF A;  2GS3 A;  1QFN A;  4KE3 A;  2JZT A;  4F0B A;  4NPB A;  4K7O A;  5ECN B;  1GSF A;  4MCU A;  4MLY A;  1ERV A;  5ECS A;  2CV4 A;  1GSQ A;  3UVH A;  3I69 A;  1HNA A;  1JZW A;  5G30 A;  2GLR A;  4L0U A;  4AJ6 A;  3HJO A;  4I6X A;  3CYN A;  4NV5 A;  2IN3 A;  4EE0 A;  2A2R A;  2XBQ A;  1F3B A;  2OE0 A;  5DJL A;  4E8H A;  5D9X A;  4ZIL A;  2AYT A;  1NM3 A;  4JZQ A;  5H5S A;  3QAW A;  1TXX A;  1PRX A;  2H75 A;  2E7P A;  1OAZ A;  2F9S A;  4MPF A;  5JCU A;  2RUE A;  2GT5 A;  2LNT A;  3ZRD A;  2L6D A;  5HFI A;  4F03 A;  2ZNM A;  3I9V 2;  2HYX A;  4BPY A;  4D73 A;  4HUA A;  4MJE A;  5B6M A;  2VL2 C;  4I5Q A;  4HZ2 A;  3CRT A;  1RQM A;  2F8F A;  4MPG A;  3FRC A;  3UOM A;  2B6M A;  1M0U A;  1R7H A;  3LQ7 A;  1OC9 B;  1IYI A;  1TJD A;  3M1G A;  2OE3 A;  3FR3 A;  2JZR A;  17GS A;  1PKW A;  4K9Z A;  3E9J B;  4ML1 A;  4TR1 B;  3GX0 A;  5CYY A; 
#chains in the Genus database with same CATH topology
 2YAN A;  4CY8 A;  4TN8 A;  3D5J A;  2IPA A;  5JWQ B;  1PX6 A;  3M9K A;  2YV7 A;  4ISD A;  2CVB A;  5IM9 A;  3ISO A;  1SEN A;  5FHI A;  1BQ7 A;  3U6V A;  1XVW A;  2CAQ A;  3M0F A;  3GL3 A;  3TRX A;  3GUR A;  3SWL A;  4MZB A;  5CO3 A;  1O7U A;  1N2A A;  3EU4 A;  4G0L A;  2H1D A;  4NMU A;  1USB A;  3UBK A;  1AQV A;  5IOX A;  1B8X A;  3UAR A;  3IHQ A;  3UJ1 A;  1T7P B;  3W6G A;  4XS1 A;  2FNO A;  20GS A;  2VCQ A;  2H1A A;  1MDI A;  4BWQ A;  4RQX A;  3TRQ A;  5L71 A;  4HOJ A;  2FD3 A;  4I8B A;  2VL3 A;  3GYK A;  1SKR B;  2IMD A;  1FB0 A;  1HNC A;  2WS2 A;  4MA9 A;  5AIV A;  4BIK A;  2PWJ A;  4YQM A;  1T1V A;  4XTS A;  3QAV A;  1K0A A;  1XWG A;  1A23 A;  2H0G A;  2FUG 2;  1Z7P A;  1H75 A;  5CRH A;  5DAK A;  4TR4 A;  5G1K A;  1DSB A;  2N5A A;  3TUE A;  3ERW A;  4FO5 A;  3FZ5 A;  2GZY A;  4USS A;  5AGY A;  4HSC X;  4KDY A;  2RM6 A;  3PPU A;  5LCZ A;  1TK5 B;  3CSI A;  3KZQ A;  5DCH A;  3RHB A;  3KGK A;  2WDU A;  3LOR A;  2A2P A;  3PGT A;  3GTU B;  4FYC A;  3VWU A;  3LYP A;  2X99 A;  1TK8 B;  2OE1 A;  2R4V A;  5C04 A;  3DIE A;  5CAX A;  4TRX A;  4IP6 A;  3ZIT A;  1SL2 B;  3ZIJ A;  3GST A;  1A2J A;  1T8E B;  5F0G A;  2M46 A;  3IRA A;  4GST A;  2X8H A;  4TR0 A;  2GSR A;  3LEF A;  2H6X A;  1FAA A;  2YP6 A;  1O8X A;  1OC3 A;  2ZUP A;  2H1B A;  4N11 A;  4ID0 A;  4GTU A;  3H93 A;  4F9Z A;  3KEB A;  3F0I A;  2F3M A;  1WWJ A;  2LRT A;  1GUM A;  1T00 A;  3R2Q A;  2DJ2 A;  2E2M A;  2H30 A;  5HR0 A;  1FVJ A;  3TB2 A;  1WP0 A;  4MJB A;  2BJX A;  2LJA A;  2C3T A;  3G9B A;  3P90 A;  2NVL A;  3L78 A;  5IOW A;  1MDK A;  2R6K A;  4FYU A;  4HS1 A;  3ZFL A;  5LD0 A;  5EVO A;  1LJR A;  2C0F A;  2L59 A;  2H74 A;  4LMW A;  2G2Q A;  4TR3 A;  6GSV A;  3O76 A;  4EIQ A;  5HR3 A;  3F63 A;  2AHE A;  1QGV A;  2P5Q A;  2XHF A;  1ACV A;  4K1F A;  4N0Z A;  4ECJ A;  2LKU A;  3CTF A;  5J3R A;  5ECO B;  4F2I A;  1G7O A;  2OAC A;  3P2A A;  1ZMA A;  3A2X A;  5C00 A;  4ECI A;  3IK7 A;  4H86 A;  4ZBA A;  2YWM A;  5ID2 B;  1M3I A;  4PXO A;  1MD3 A;  1S3D A;  1GUK A;  1CQG A;  2HRK A;  3EC3 A;  3HVS A;  4G0I A;  2YCD A;  5EY6 A;  2WB9 A;  1XZO A;  3VUR A;  2VLV A;  1J0F A;  1B9X C;  1MEK A;  2IMK A;  1K3Y A;  1SJZ A;  4ZBB A;  4ZXG A;  1OKT A;  3CSH A;  2JZS A;  2F51 A;  3IAM 2;  1W4V A;  3FEU A;  5G5E A;  1F37 A;  3IXR A;  1XG8 A;  1DBY A;  1OC9 A;  5LNK e;  1G7E A;  2DJ3 A;  2H19 A;  4QL7 A;  2L57 A;  1E2Y A;  5ECQ B;  1J08 A;  4TR1 A;  4PUR A;  2O89 A;  3CSJ A;  5GSS A;  1ZYQ B;  2DLX A;  1DE2 A;  3H79 A;  5CRE A;  3HVX A;  4XS4 A;  1M9A A;  2HI7 A;  3RAZ A;  4OO5 A;  2GQM A;  5J4U A;  1A2M A;  3GSS A;  2OBI A;  1Z9H A;  4EF0 A;  3UBL A;  3JCM L;  2V6K A;  2DML A;  5HQP A;  4IJI A;  5A4U A;  1THO A;  1KTE A;  1GP1 A;  3HVN A;  2H72 A;  3O3T A;  1ST9 A;  2VD0 A;  2C80 A;  2C0G A;  5IMC A;  1SKS B;  4YQU A;  1H4O A;  3DEX A;  1VF1 A;  2K6V A;  4KSO A;  2GZP A;  2XPE A;  5G2Z A;  1SK1 A;  5DVB A;  5B8A A;  1T3B A;  4WR4 A;  1R26 A;  4MH3 A;  2H0I A;  3TCO A;  2CVK A;  2L4C A;  2P31 A;  4Z2R A;  3L9V A;  4IGJ A;  2ON7 A;  5ECM B;  2HLS A;  4Q5N A;  2L5L A;  1N8J A;  4KB3 A;  1TP9 A;  3GX8 A;  4TXV A;  3LYK A;  6GSY A;  1SD8 A;  2VLT A;  4K5R A;  11GS A;  4X4J A;  1R5P A;  3DML A;  4AGS A;  2YNX A;  4GQC A;  2HRN A;  1PD2 1;  3ZFB A;  1GRX A;  3C7M A;  5H5R A;  2VCX A;  3GTU A;  3KMN A;  3VWV A;  3IC4 A;  3Q6O A;  3ZYW A;  2N5B A;  4K5S A;  4KUN A;  1S3C A;  4JED A;  2B5E A;  1F2E A;  3LSZ A;  4PNG A;  3EMP A;  1EGO A;  4OMV A;  1XWC A;  2LTK A;  3ED3 A;  2NTO A;  2QGV A;  3I43 A;  2VCT A;  3TJK A;  1PQN A;  3ZIV A;  2QC7 A;  4Z7X A;  1EWX A;  5D93 A;  3ME8 A;  2VUP A;  1X5D A;  2VIM A;  10GS A;  4ACS A;  1GSS A;  1J9B A;  1GSE A;  1V9W A;  3QOU A;  3A5W A;  4NAX A;  1O85 A;  3KCM A;  2CZ2 A;  4WKW A;  1O8W A;  3ERG A;  2HRA A;  3FYG A;  4HZ4 A;  3PH9 A;  3IAS 2;  1FHE A;  3PIN A;  3HA9 A;  4OD7 A;  3IE3 A;  2LNS A;  4DEJ A;  1Y25 A;  1JLW A;  4BVY B;  1MTC A;  1K0B A;  1ZGN A;  4TXO B;  5IMD A;  1ML6 A;  5GAP D;  1FOV A;  4RI7 A;  3TKR A;  3E3E A;  5D96 A;  2P0G A;  2X49 A;  3QAG A;  4PNF A;  1XXU A;  4NXI A;  1BYE A;  1GH2 A;  3VI7 A;  2X64 A;  1LBK A;  2CAI A;  1GSU A;  1QQ2 A;  2IWT A;  3QPM A;  1EOG A;  3NOF A;  3HY2 A;  4G10 A;  3KIJ A;  5DBQ A;  4E8E A;  1I9D A;  2HSM A;  4IS0 A;  5KN1 A;  2CQ9 A;  3WT2 A;  5ID2 A;  2MMO A;  4MZW A;  1XOB A;  1XCC A;  4NWY A;  3EMX A;  2HXK A;  2YWI A;  3TGZ A;  2AB6 A;  2FGX A;  2ALB A;  1YF1 A;  1F6M C;  3TOU A;  5GAN D;  2VO4 A;  3P8W A;  2D2Z A;  4GSS A;  2XPD A;  4WBJ A;  2N5F A;  3MSZ A;  3TKQ A;  2L6C A;  3IC8 A;  2PVO C;  4WF4 A;  4O5R A;  4HJM A;  2HZF A;  1K0M A;  3DD3 A;  2IMI A;  2O8V B;  4IN0 A;  1PX7 A;  4XS4 B;  3WYW A;  5E59 A;  4KA0 A;  4RUV A;  5COH A;  2JSZ A;  1PSQ A;  3MDK A;  4IKH A;  3ZMK A;  1ZOF A;  1PN0 A;  5D9W A;  5J9C A;  1X9S B;  6GSW A;  4KSM A;  4J56 E;  1WMJ A;  4IP1 A;  2GZZ A;  4YKG A;  1PL1 A;  5J41 A;  2ON5 A;  5AN1 A;  3ZRE A;  12GS A;  3DYR A;  4XCS A;  1BX9 A;  4HU9 A;  5JWO B;  2YWN A;  1WOU A;  3DVW A;  1MDJ A;  1T4Y A;  2WZ9 A;  3EPT A;  4L5O A;  1XWB A;  2DKI A;  4N30 A;  2C8U A;  5E4W A;  4K0G A;  2KP2 A;  3APS A;  1XWA A;  5HFG A;  5GST A;  3GHA A;  2WJU A;  1X5E A;  2AAW A;  2QKE A;  3IA1 A;  4LL4 B;  2PU9 C;  4L5L A;  1YQ1 A;  3DKS A;  2E2G A;  3BOA A;  2J9H A;  1F3A A;  4JBB A;  2GSQ A;  3GA4 A;  5CP1 A;  1BAY A;  2NDO A;  4MZC A;  1YJ6 A;  3M9J A;  2B5Y A;  1M99 A;  1QMV A;  4K2X A;  5DAL B;  4XS6 A;  4K8M A;  2VM1 A;  3TKS C;  4GSN A;  4MP4 A;  1A8L A;  2YJH A;  1DUG A;  2YZH A;  2PUK C;  3IR4 A;  2GDR A;  5JCW A;  4TVE A;  3VLN A;  2HZE B;  3L0H A;  2CVD A;  1M3J A;  4DSQ A;  1F9M A;  1Z3E A;  4L0W A;  3EWL A;  1Q4J A;  2EIR A;  3IBH A;  4WF5 A;  2VL2 A;  1XIY A;  1FG4 A;  2VM2 A;  2K8V A;  2DIY A;  1XFL A;  2PMT A;  5F06 A;  3VWW A;  2X8G A;  3FKF A;  3MIX A;  1ERT A;  4KDX A;  3RBT A;  2OKA A;  2FY6 A;  1ERW A;  3HZ4 A;  3TKS E;  5KOX A;  1VF2 A;  2GGT A;  1TRU A;  1EZK A;  3HYP A;  4MF7 A;  1TOF A;  5BRT A;  1GTU A;  4F82 A;  2OBK A;  4WR5 A;  2PER A;  4GWR A;  4K0N A;  2LRC A;  3DXB A;  1TKD B;  1EV9 A;  3QR6 A;  1SKW B;  1K3L A;  3V1W A;  1VRS D;  1XOA A;  3KH9 A;  2G0F A;  5ECL B;  2H73 A;  1UVZ A;  1S3R A;  4N10 A;  1TU8 A;  2C3Q A;  1SJ6 A;  3CTG A;  3TJB A;  4KGI A;  4BVY A;  1ON4 A;  3HZ8 A;  3NZN A;  2H01 A;  3GH9 A;  4TXO A;  2LST A;  3N9J A;  3C73 A;  8GSS A;  3CBU A;  2K9F A;  3LW9 A;  1YEP A;  5GZZ B;  2AJQ B;  1V98 A;  3KTB A;  1TRS A;  3GKN A;  1K0O A;  2R2J A;  3EE2 A;  2YZU A;  4GQF A;  1V58 A;  3GN3 A;  3VFI A;  1TI3 A;  3G7I A;  2R37 A;  1K0C A;  3IK9 A;  5HR2 A;  1GTB A;  1HD2 A;  4NHZ A;  3L4N A;  1U88 A;  3IDV A;  3Q18 A;  5D73 A;  3WD6 A;  2HSH A;  3SBC A;  4OFN A;  2I3Y A;  4ZB9 A;  4Q5F A;  4IEL A;  2B3S A;  3TDG A;  4IJ3 A;  6GSS A;  3VPQ A;  1O73 A;  1U3A A;  4O5U A;  1TK0 B;  4NV2 A;  3P7X A;  2C1Y A;  4L8E A;  4YQV A;  1UA5 A;  1JFU A;  4EUY A;  4MK3 A;  1TRV A;  2LS5 A;  5H5Q A;  2FHE A;  2JU5 A;  3UIW A;  3RHC A;  3TRP A;  4G9H A;  2REM A;  1B4P A;  1I5G A;  1KEB A;  2DJJ A;  3BCK A;  4MAB A;  2GSS A;  1Z6N A;  5CRW A;  2VL9 A;  4ZIJ A;  4NHW A;  3QFB C;  4KCE A;  3W8S A;  3LGC A;  5IMV A;  3VWX A;  1AQW A;  5B6N A;  2C4J A;  2K8S A;  14GS A;  1QUW A;  1NHO A;  3APQ A;  5KN2 A;  3VI5 A;  2BTO T;  2H6Y A;  3R3E A;  2AUV A;  1XWK A;  4HI7 A;  1PL2 A;  2F8A A;  1SU9 A;  1ZZY A;  3HJM A;  4V2L A;  3TJG A;  1GUH A;  2DSA A;  3QCP A;  3VPT A;  4EVM A;  1K0D A;  3RPP A;  1EP8 A;  1YEX A;  2JAC A;  3GMF A;  4LA1 A;  1XBS A;  1ZL9 A;  2A2S A;  5DCG A;  3IHG A;  4G19 A;  4KF9 A;  4ZL8 A;  1PMT A;  3OR5 A;  2IFQ B;  3D4M A;  1M7T A;  3BD2 A;  3RDW A;  3D6I A;  4WBR D;  1QK8 A;  1JLV A;  3Q74 A;  2IL3 A;  4JU5 A;  5IMF A;  4F0C A;  3LWA A;  3D22 A;  3TKP A;  3IPZ A;  2RM5 A;  18GS A;  6GSX A;  1BG5 A;  1HYU A;  4IW9 A;  1A0F A;  1WPI A;  3ZLP A;  4IBP A;  2I81 A;  5KN3 A;  2YPM A;  3ZVJ D;  4OO4 A;  3DGQ A;  2GQK A;  3F3Q A;  2B1L A;  4BVX B;  5F05 A;  3FHK A;  4PUA A;  5FT3 A;  3KTL A;  4JE1 A;  1M2D A;  1W89 A;  3FK8 A;  3FZ4 A;  1TRW A;  3F4T A;  2M80 A;  2HFD A;  2FCH A;  4OFT A;  4HDE A;  5DAL A;  1AQX A;  2H70 A;  4EO3 A;  2AV4 A;  4MDC A;  1TTZ A;  4LMV A;  3M8N A;  4YAP A;  1PFO A;  5IO0 A;  2OAD A;  3WT1 A;  2OJL A;  4BA7 A;  2YJ7 A;  2VCW A;  2MZC A;  5IPH A;  2KUC A;  2HZE A;  3GV1 A;  1XVQ A;  1GWC A;  1LU4 A;  1GL8 A;  1VGL A;  4V2M A;  4POL A;  2YWO A;  3LJR A;  5CNW A;  1GTA A;  5ABR A;  3A2W A;  4EKZ A;  2B5X A;  2FA8 A;  2PBJ A;  2ES7 A;  3C1S A;  4DSS B;  3K8N A;  2O7K A;  4WEY A;  2HNL A;  1A8Y A;  4EL1 A;  4CDO A;  1RK4 A;  1A24 A;  3F4S A;  3KH7 A;  5IMA A;  4ECB A;  2LV3 A;  3C8E A;  4DVC A;  2WCI A;  1U3I A;  3A3T A;  3M3M A;  4A5P A;  2H66 A;  5G5F A;  1SL1 B;  3WGE A;  3FW2 A;  2HT9 A;  4IHU A;  1AW9 A;  5B8B A;  3FY7 A;  5G1L A;  4PQH A;  2LEG A;  2CX3 A;  2C3N A;  2PVQ A;  2DC5 A;  1U87 A;  2KOK A;  4I97 A;  2BMX A;  4AJ7 A;  2V1M A;  3H1N A;  2DBC A;  5ELG A;  3CMI A;  2EIQ A;  2R0C A;  4HEA 2;  2GVP A;  1JZD A;  1Z7R A;  1R5A A;  2VD1 A;  2RLI A;  1WJK A;  1UC7 A;  1AXD A;  3MWH A;  1GNW A;  3LG6 A;  3EUR A;  4ECC A;  4X1U A;  2E0Q A;  2XBI A;  5DQY A;  3FZ9 A;  2LJK A;  3L9S A;  4BL7 B;  2EC4 A;  5ELA A;  3EVI A;  2A4V A;  5KOW A;  2YV9 A;  2H6Z A;  3DWV A;  1M9B A;  1B9Y C;  1EGR A;  2MBS A;  3GKM A;  5AIX A;  4RQR A;  1A0R P;  2DJK A;  2NBS A;  1SJI A;  3HDC A;  2K18 A;  1ZYN A;  2VCZ A;  2O85 A;  4ZL9 A;  2KHP A;  3GKK A;  1Q98 A;  2QSI A;  1EEM A;  1PA3 A;  4OCE A;  1HQO A;  1M2A A;  3GL5 A;  3HXS A;  5J9B A;  4Q5Q A;  2PGT A;  4O32 A;  4BWS A;  3J7Y k;  4J2F A;  1GNE A;  3FR6 A;  4EDY A;  3GIX A;  1OYJ A;  3ZML A;  3APO A;  1G6W A;  4GXZ A;  1B4Q A;  7GSS A;  5EL8 A;  4XHM A;  4KCA A;  3F4R A;  4KDU A;  2R0G A;  3FR9 A;  1EP7 A;  2B7J A;  2I4A A;  1VF4 A;  3UVT A;  4HJ2 A;  1R4W A;  1KNG A;  2QA1 A;  3A2V A;  3CRU A;  1CQH A;  2O87 A;  4KND A;  1AIU A;  4X0X A;  3EYT A;  4OFM A;  2FWE A;  4GCI A;  1X9M B;  1XW9 A;  2VCV A;  3F6F A;  3GKX A;  1E6B A;  1AAZ A;  2FA4 A;  1V2A A;  3G7J A;  3F9U A;  3KJY A;  1BJX A;  4EXJ A;  2H76 A;  3GNJ A;  1TDI A;  1GLP A;  1Y6E A;  2EIO A;  1ILO A;  3ME7 A;  2IFQ A;  1GLQ A;  2IME A;  1OKD A;  3KP9 A;  3QFA C;  2M72 A;  1G6Y A;  4QQ7 A;  1YZX A;  5IPG A;  3FZA A;  3I6A A;  5KEJ A;  2FLS A;  3DRN A;  2CZ3 A;  4JR6 A;  3KMO A;  2R3X A;  1XW5 A;  2I1U A;  5CRG A;  1YDK A;  4GLT A;  2FWH A;  5D8I A;  1OVN A;  4CHS A;  3D0Z A;  3D21 A;  1JHB A;  4EC0 A;  2H1G A;  2C0E A;  2C0D A;  2DJ0 A;  4AJ8 A;  4BVX A;  1TI1 A;  3GUS A;  4ML6 A;  3DVX A;  2B7K A;  2X4A A;  3RPN A;  3GRX A;  5ECP B;  4FYB A;  1AC1 A;  2V6O A;  1OE7 A;  4PQ1 A;  2UZ8 A;  2OA7 A;  1X0R A;  4I2U A;  13GS A;  5AIS A;  4POK A;  2PN8 A;  2TRX A;  1SYR A;  3KXO A;  2LUS A;  3HHV A;  5ENU A;  3QMX A;  6GST A;  2L5O A;  3LXZ A;  5HR1 A;  5A4V A;  2HSY A;  3LXT A;  3ZL5 A;  2CX4 A;  4PX1 A;  3QDN A;  5ECI B;  4N0V A;  4RI6 A;  1TW9 A;  3F6D A;  3ZTL A;  1VF3 A;  4EDZ A;  4XIH A;  5IQY A;  3KD0 A;  1X9W B;  1FO5 A;  1GSD A;  3WGX A;  5IO2 A;  4TW5 A;  3AY8 A;  3F8U A;  4IQA A;  3N5O A;  4OWY A;  1URM A;  5G31 A;  3GFK A;  5CRD A;  2I9H A;  1DE1 A;  1UN2 A;  4OCF A;  1B48 A;  1K0N A;  2DMM A;  2B1K A;  4DSS A;  1EEJ A;  5FWG A;  3KP8 A;  4CY6 A;  2MMZ A;  2MBT A;  4FIW A;  4GRF A;  2H0H A;  2WRT A;  1Z5Y E;  1M2B A;  1MD4 A;  4MMM A;  1T4Z A;  2FWF A;  3G7Y A;  3US3 A;  1KBN A;  2LRN A;  2L4Q A;  4YAV A;  4PGT A;  4WET A;  3O6T A;  1AUC A;  4KAE A;  3QD9 A;  3EIN A;  1YY7 A;  5IIZ A;  4Q5R A;  4MF5 A;  2LQQ A;  4Z2T A;  5KN0 A;  1GUL A;  1EOH A;  4I2T A;  3UMA A;  4ZB8 A;  1SYX A;  2GST A;  3C1R A;  5ECK B;  2VLU A;  4K7I A;  4QL9 A;  2YN1 A;  3EU3 A;  2R5G A;  2VOC A;  2JSY A;  3F3R A;  1YKC A;  5IMZ A;  5JCG A;  9GSS A;  1A2L A;  3S9F A;  4ICY A;  5D9V A;  1NHY A;  2V32 A;  4BL7 A;  3L9U A;  4PQI A;  2LQO A;  4AF2 A;  4HQS A;  1IYH A;  2YOI A;  1GTI A;  2RII A;  4KW6 A;  3J7Y b;  19GS A;  4Z2U A;  2TRC P;  3HVV A;  5F07 A;  3MAK A;  4D73 B;  3A5I A;  4X43 A;  5B7C A;  4ZBD A;  3BJ5 A;  4KH7 A;  1FOH A;  4K6X A;  4IQ1 A;  2RUF A;  4LL1 B;  3VK9 A;  1SD9 A;  1XW6 A;  3LFL A;  1OE8 A;  1K3O A;  3CXG A;  4J57 E;  1OC8 A;  2CT6 A;  2GQL A;  4V1A p;  2P5R A;  2CA8 A;  3IOS A;  5DDL A;  2WFC A;  4EIP A;  2H8L A;  5DJM A;  3TKS A;  4ZB6 A;  1PKZ A;  4XRD A;  3BCI A;  2DJ1 A;  1RW1 A;  5JWR B;  4DSR A;  1V57 A;  4FQU A;  4JR4 A;  3HCZ A;  4O7H A;  3HJP A;  1PN9 A;  2GTU A;  3CQF A;  3H4K A;  5A4W A;  4YKF A;  3KM6 A;  3ZVJ A;  4CW9 A;  1QXH A;  4XRA A;  3E0U A;  4G0K A;  1HNB A;  1GSY A;  5J5N A;  1C72 A;  2H71 A;  3NIV A;  2HE3 A;  3TJJ A;  1FVK A;  4FH8 A;  2TIR A;  2JAD A;  2JL4 A;  1Z6M A;  2IIY A;  3BBY A;  5DQS A;  4K2D A;  2DIZ A;  4ILF A;  4POM A;  3HKR A;  4LLR A;  2MMA A;  2V41 A;  2LJR A;  2V2G A;  3C71 A;  3ZZX A;  1ERU A;  1O81 A;  1ZYE A;  4O5Q A;  4TOP A;  1SL0 B;  1EV4 A;  1FW1 A;  16GS A;  1SK2 A;  4ZL7 A;  1X5C A;  1G0T A;  2J23 A;  1WIK A;  4KX4 A;  1V40 A;  3UEM A;  3WGD A;  3ERF A;  2VAF A;  1ABA A;  1TU7 A;  4K7N A;  3MNG A;  5INY A;  1XPV A;  2ZCT A;  1PGT A;  4YH2 A;  5DAK B;  2KP1 A;  2KLX A;  1NW2 A;  5A5K A;  2FWG A;  1NSW A;  3GH6 A;  5HFK A;  2XC2 A;  2WGR A;  4MJC A;  1ZCP A;  1WRY A;  3Q19 A;  1BED A;  2DKH A;  2IMF A;  1THX A;  3HD5 A;  3IV4 A;  2IJY A;  2HRF A;  4WXT A;  4POB A;  3H8Q A;  1JZO A;  1JZR A;  2A4H A;  2MYG A;  4V1A g;  1S3A A;  2X8C A;  4MH2 A;  1SK0 A;  5ECR B;  2NPB A;  2WUL A;  5D9T A;  4TKY A;  3D4T A;  3W8J A;  4MJA A;  1YKA A;  4P3Y B;  1FB6 A;  1U6T A;  4HU7 A;  4G2E A;  22GS A;  1YF0 A;  4ULX A;  4HQZ A;  3TOT A;  4IVF A;  4PTS A;  1WE0 A;  2R0P A;  4PUF C;  5F8B A;  2MMN A;  3TJF A;  3UAP A;  4JRR A;  4MF6 A;  4V2N A;  3UL3 A;  2Z9S A;  2PPT A;  3PR8 A;  2GT6 A;  4GF0 A;  4O92 A;  1O6J A;  5ECH B;  3U5R E;  6GSU A;  5EPF A;  2GS3 A;  1QFN A;  4KE3 A;  2JZT A;  4F0B A;  3MYD A;  4NPB A;  4K7O A;  5ECN B;  1GSF A;  4MCU A;  4MLY A;  1ERV A;  5ECS A;  2CV4 A;  1GSQ A;  3UVH A;  3I69 A;  1HNA A;  1JZW A;  5G30 A;  2GLR A;  4L0U A;  4AJ6 A;  3HJO A;  4I6X A;  3CYN A;  4NV5 A;  2IN3 A;  4EE0 A;  2A2R A;  2XBQ A;  1F3B A;  2OE0 A;  5DJL A;  4E8H A;  5D9X A;  4ZIL A;  4MNN A;  2AYT A;  1NM3 A;  2QA2 A;  4JZQ A;  5H5S A;  3QAW A;  1TXX A;  1PRX A;  2H75 A;  2E7P A;  1OAZ A;  2F9S A;  4MPF A;  5JCU A;  2RUE A;  2GT5 A;  2LNT A;  3ZRD A;  2L6D A;  5HFI A;  4F03 A;  2ZNM A;  3I9V 2;  2HYX A;  4BPY A;  4D73 A;  4HUA A;  4MJE A;  5B6M A;  2VL2 C;  4I5Q A;  4HZ2 A;  5BMU A;  3CRT A;  1RQM A;  2F8F A;  4MPG A;  3FRC A;  3UOM A;  2B6M A;  1ZYP A;  1M0U A;  1R7H A;  3LQ7 A;  1OC9 B;  1IYI A;  1TJD A;  3M1G A;  2OE3 A;  3FR3 A;  2JZR A;  3FMW A;  17GS A;  1PKW A;  4K9Z A;  3E9J B;  4ML1 A;  4TR1 B;  3GX0 A;  5CYY A; 
#chains in the Genus database with same CATH homology
 2YAN A;  4CY8 A;  4TN8 A;  3D5J A;  2IPA A;  5JWQ B;  1PX6 A;  3M9K A;  2YV7 A;  4ISD A;  2CVB A;  5IM9 A;  3ISO A;  1SEN A;  5FHI A;  1BQ7 A;  3U6V A;  1XVW A;  2CAQ A;  3M0F A;  3GL3 A;  3TRX A;  3GUR A;  3SWL A;  4MZB A;  5CO3 A;  1O7U A;  1N2A A;  3EU4 A;  4G0L A;  2H1D A;  4NMU A;  1USB A;  3UBK A;  1AQV A;  5IOX A;  1B8X A;  3UAR A;  3IHQ A;  3UJ1 A;  1T7P B;  3W6G A;  4XS1 A;  2FNO A;  20GS A;  2VCQ A;  2H1A A;  1MDI A;  4BWQ A;  4RQX A;  3TRQ A;  5L71 A;  4HOJ A;  2FD3 A;  4I8B A;  2VL3 A;  3GYK A;  1SKR B;  2IMD A;  1FB0 A;  1HNC A;  2WS2 A;  4MA9 A;  5AIV A;  2PWJ A;  4YQM A;  1T1V A;  4XTS A;  3QAV A;  1K0A A;  1XWG A;  1A23 A;  2H0G A;  2FUG 2;  1Z7P A;  1H75 A;  5CRH A;  5DAK A;  4TR4 A;  5G1K A;  1DSB A;  2N5A A;  3TUE A;  3ERW A;  4FO5 A;  3FZ5 A;  2GZY A;  4USS A;  5AGY A;  4KDY A;  2RM6 A;  3PPU A;  5LCZ A;  1TK5 B;  3CSI A;  3KZQ A;  5DCH A;  3RHB A;  3KGK A;  2WDU A;  3LOR A;  2A2P A;  3PGT A;  3GTU B;  4FYC A;  3VWU A;  3LYP A;  2X99 A;  1TK8 B;  2OE1 A;  2R4V A;  5C04 A;  3DIE A;  5CAX A;  4TRX A;  4IP6 A;  3ZIT A;  1SL2 B;  3ZIJ A;  3GST A;  1A2J A;  1T8E B;  5F0G A;  2M46 A;  3IRA A;  4GST A;  2X8H A;  4TR0 A;  2GSR A;  3LEF A;  2H6X A;  1FAA A;  2YP6 A;  1O8X A;  1OC3 A;  2ZUP A;  2H1B A;  4N11 A;  4ID0 A;  4GTU A;  3H93 A;  4F9Z A;  3KEB A;  3F0I A;  2F3M A;  1WWJ A;  2LRT A;  1GUM A;  1T00 A;  3R2Q A;  2DJ2 A;  2E2M A;  2H30 A;  5HR0 A;  1FVJ A;  3TB2 A;  1WP0 A;  4MJB A;  2BJX A;  2LJA A;  2C3T A;  3G9B A;  3P90 A;  2NVL A;  3L78 A;  5IOW A;  1MDK A;  2R6K A;  4FYU A;  4HS1 A;  3ZFL A;  5LD0 A;  5EVO A;  1LJR A;  2C0F A;  2L59 A;  2H74 A;  4LMW A;  2G2Q A;  4TR3 A;  6GSV A;  3O76 A;  4EIQ A;  5HR3 A;  3F63 A;  2AHE A;  1QGV A;  2P5Q A;  2XHF A;  1ACV A;  4K1F A;  4N0Z A;  4ECJ A;  2LKU A;  3CTF A;  5J3R A;  5ECO B;  4F2I A;  1G7O A;  2OAC A;  3P2A A;  1ZMA A;  3A2X A;  5C00 A;  4ECI A;  3IK7 A;  4H86 A;  4ZBA A;  2YWM A;  5ID2 B;  4PXO A;  1MD3 A;  1S3D A;  1GUK A;  1CQG A;  2HRK A;  3EC3 A;  3HVS A;  4G0I A;  2YCD A;  5EY6 A;  2WB9 A;  1XZO A;  3VUR A;  2VLV A;  1J0F A;  1B9X C;  1MEK A;  2IMK A;  1K3Y A;  1SJZ A;  4ZBB A;  4ZXG A;  1OKT A;  3CSH A;  2JZS A;  2F51 A;  3IAM 2;  1W4V A;  3FEU A;  5G5E A;  1F37 A;  3IXR A;  1DBY A;  1OC9 A;  5LNK e;  1G7E A;  2DJ3 A;  2H19 A;  4QL7 A;  2L57 A;  1E2Y A;  5ECQ B;  1J08 A;  4TR1 A;  4PUR A;  2O89 A;  3CSJ A;  5GSS A;  1ZYQ B;  2DLX A;  1DE2 A;  3H79 A;  5CRE A;  3HVX A;  4XS4 A;  1M9A A;  2HI7 A;  3RAZ A;  4OO5 A;  2GQM A;  5J4U A;  1A2M A;  3GSS A;  2OBI A;  1Z9H A;  4EF0 A;  3UBL A;  3JCM L;  2V6K A;  2DML A;  5HQP A;  4IJI A;  5A4U A;  1THO A;  1KTE A;  1GP1 A;  2H72 A;  3O3T A;  1ST9 A;  2VD0 A;  2C80 A;  2C0G A;  5IMC A;  1SKS B;  4YQU A;  1H4O A;  3DEX A;  1VF1 A;  2K6V A;  4KSO A;  2GZP A;  2XPE A;  5G2Z A;  1SK1 A;  5DVB A;  5B8A A;  1T3B A;  4WR4 A;  1R26 A;  4MH3 A;  2H0I A;  3TCO A;  2CVK A;  2L4C A;  2P31 A;  4Z2R A;  3L9V A;  4IGJ A;  2ON7 A;  5ECM B;  2HLS A;  4Q5N A;  2L5L A;  1N8J A;  4KB3 A;  1TP9 A;  3GX8 A;  4TXV A;  3LYK A;  6GSY A;  1SD8 A;  2VLT A;  4K5R A;  11GS A;  4X4J A;  1R5P A;  3DML A;  4AGS A;  2YNX A;  4GQC A;  2HRN A;  1PD2 1;  3ZFB A;  1GRX A;  3C7M A;  5H5R A;  2VCX A;  3GTU A;  3KMN A;  3VWV A;  3IC4 A;  3Q6O A;  3ZYW A;  2N5B A;  4K5S A;  4KUN A;  1S3C A;  4JED A;  2B5E A;  1F2E A;  3LSZ A;  4PNG A;  3EMP A;  1EGO A;  4OMV A;  1XWC A;  2LTK A;  3ED3 A;  2NTO A;  2QGV A;  3I43 A;  2VCT A;  3TJK A;  1PQN A;  3ZIV A;  2QC7 A;  4Z7X A;  1EWX A;  5D93 A;  3ME8 A;  2VUP A;  1X5D A;  2VIM A;  10GS A;  4ACS A;  1GSS A;  1J9B A;  1GSE A;  1V9W A;  3QOU A;  3A5W A;  4NAX A;  1O85 A;  3KCM A;  2CZ2 A;  4WKW A;  1O8W A;  3ERG A;  2HRA A;  3FYG A;  4HZ4 A;  3PH9 A;  3IAS 2;  1FHE A;  3PIN A;  3HA9 A;  4OD7 A;  3IE3 A;  2LNS A;  4DEJ A;  1Y25 A;  1JLW A;  4BVY B;  1MTC A;  1K0B A;  1ZGN A;  4TXO B;  5IMD A;  1ML6 A;  5GAP D;  1FOV A;  4RI7 A;  3TKR A;  3E3E A;  5D96 A;  2P0G A;  2X49 A;  3QAG A;  4PNF A;  1XXU A;  4NXI A;  1BYE A;  1GH2 A;  3VI7 A;  2X64 A;  1LBK A;  2CAI A;  1GSU A;  1QQ2 A;  2IWT A;  3QPM A;  1EOG A;  3NOF A;  3HY2 A;  4G10 A;  3KIJ A;  5DBQ A;  4E8E A;  1I9D A;  2HSM A;  4IS0 A;  5KN1 A;  2CQ9 A;  3WT2 A;  5ID2 A;  2MMO A;  4MZW A;  1XOB A;  1XCC A;  4NWY A;  3EMX A;  2HXK A;  2YWI A;  3TGZ A;  2AB6 A;  2FGX A;  2ALB A;  1YF1 A;  1F6M C;  3TOU A;  5GAN D;  2VO4 A;  3P8W A;  2D2Z A;  4GSS A;  2XPD A;  4WBJ A;  2N5F A;  3MSZ A;  3TKQ A;  2L6C A;  3IC8 A;  2PVO C;  4WF4 A;  4O5R A;  4HJM A;  2HZF A;  1K0M A;  3DD3 A;  2IMI A;  2O8V B;  4IN0 A;  1PX7 A;  4XS4 B;  3WYW A;  5E59 A;  4KA0 A;  4RUV A;  5COH A;  2JSZ A;  1PSQ A;  3MDK A;  4IKH A;  3ZMK A;  1ZOF A;  1PN0 A;  5D9W A;  5J9C A;  1X9S B;  6GSW A;  4KSM A;  4J56 E;  1WMJ A;  4IP1 A;  2GZZ A;  4YKG A;  1PL1 A;  5J41 A;  2ON5 A;  5AN1 A;  3ZRE A;  12GS A;  3DYR A;  4XCS A;  1BX9 A;  4HU9 A;  5JWO B;  2YWN A;  1WOU A;  3DVW A;  1MDJ A;  1T4Y A;  2WZ9 A;  3EPT A;  4L5O A;  1XWB A;  2DKI A;  4N30 A;  2C8U A;  5E4W A;  4K0G A;  2KP2 A;  3APS A;  1XWA A;  5HFG A;  5GST A;  3GHA A;  2WJU A;  1X5E A;  2AAW A;  2QKE A;  3IA1 A;  4LL4 B;  2PU9 C;  4L5L A;  1YQ1 A;  3DKS A;  2E2G A;  3BOA A;  2J9H A;  1F3A A;  4JBB A;  2GSQ A;  3GA4 A;  5CP1 A;  1BAY A;  2NDO A;  4MZC A;  1YJ6 A;  3M9J A;  2B5Y A;  1M99 A;  1QMV A;  4K2X A;  5DAL B;  4XS6 A;  4K8M A;  2VM1 A;  3TKS C;  4GSN A;  4MP4 A;  1A8L A;  2YJH A;  1DUG A;  2YZH A;  2PUK C;  3IR4 A;  2GDR A;  5JCW A;  4TVE A;  3VLN A;  2HZE B;  3L0H A;  2CVD A;  4DSQ A;  1F9M A;  1Z3E A;  4L0W A;  3EWL A;  1Q4J A;  2EIR A;  3IBH A;  4WF5 A;  2VL2 A;  1XIY A;  1FG4 A;  2VM2 A;  2K8V A;  2DIY A;  1XFL A;  2PMT A;  5F06 A;  3VWW A;  2X8G A;  3FKF A;  3MIX A;  1ERT A;  4KDX A;  3RBT A;  2OKA A;  2FY6 A;  1ERW A;  3HZ4 A;  3TKS E;  5KOX A;  1VF2 A;  2GGT A;  1TRU A;  1EZK A;  3HYP A;  4MF7 A;  1TOF A;  5BRT A;  1GTU A;  4F82 A;  2OBK A;  4WR5 A;  2PER A;  4GWR A;  4K0N A;  2LRC A;  3DXB A;  1TKD B;  1EV9 A;  3QR6 A;  1SKW B;  1K3L A;  3V1W A;  1VRS D;  1XOA A;  3KH9 A;  2G0F A;  5ECL B;  2H73 A;  1UVZ A;  4N10 A;  1TU8 A;  2C3Q A;  1SJ6 A;  3CTG A;  3TJB A;  4KGI A;  4BVY A;  1ON4 A;  3HZ8 A;  3NZN A;  2H01 A;  3GH9 A;  4TXO A;  2LST A;  3N9J A;  3C73 A;  8GSS A;  3CBU A;  2K9F A;  3LW9 A;  1YEP A;  5GZZ B;  2AJQ B;  1V98 A;  3KTB A;  1TRS A;  3GKN A;  1K0O A;  2R2J A;  3EE2 A;  2YZU A;  4GQF A;  1V58 A;  3GN3 A;  3VFI A;  1TI3 A;  3G7I A;  2R37 A;  1K0C A;  3IK9 A;  5HR2 A;  1GTB A;  1HD2 A;  4NHZ A;  3L4N A;  1U88 A;  3IDV A;  3Q18 A;  5D73 A;  3WD6 A;  2HSH A;  3SBC A;  4OFN A;  2I3Y A;  4ZB9 A;  4Q5F A;  4IEL A;  2B3S A;  3TDG A;  4IJ3 A;  6GSS A;  3VPQ A;  1O73 A;  1U3A A;  4O5U A;  1TK0 B;  4NV2 A;  3P7X A;  2C1Y A;  4L8E A;  4YQV A;  1UA5 A;  1JFU A;  4EUY A;  4MK3 A;  1TRV A;  2LS5 A;  5H5Q A;  2FHE A;  2JU5 A;  3UIW A;  3RHC A;  3TRP A;  4G9H A;  2REM A;  1B4P A;  1I5G A;  1KEB A;  2DJJ A;  3BCK A;  4MAB A;  2GSS A;  1Z6N A;  5CRW A;  2VL9 A;  4ZIJ A;  4NHW A;  3QFB C;  4KCE A;  3W8S A;  3LGC A;  5IMV A;  3VWX A;  1AQW A;  5B6N A;  2C4J A;  2K8S A;  14GS A;  1QUW A;  1NHO A;  3APQ A;  5KN2 A;  3VI5 A;  2BTO T;  2H6Y A;  3R3E A;  2AUV A;  1XWK A;  4HI7 A;  1PL2 A;  2F8A A;  1SU9 A;  1ZZY A;  3HJM A;  4V2L A;  3TJG A;  1GUH A;  2DSA A;  3QCP A;  3VPT A;  4EVM A;  1K0D A;  3RPP A;  1EP8 A;  1YEX A;  2JAC A;  3GMF A;  4LA1 A;  1XBS A;  1ZL9 A;  2A2S A;  5DCG A;  3IHG A;  4G19 A;  4KF9 A;  4ZL8 A;  1PMT A;  3OR5 A;  2IFQ B;  3D4M A;  1M7T A;  3BD2 A;  3RDW A;  3D6I A;  4WBR D;  1QK8 A;  1JLV A;  3Q74 A;  2IL3 A;  4JU5 A;  5IMF A;  4F0C A;  3LWA A;  3D22 A;  3TKP A;  3IPZ A;  2RM5 A;  18GS A;  6GSX A;  1BG5 A;  1HYU A;  4IW9 A;  1A0F A;  1WPI A;  3ZLP A;  4IBP A;  2I81 A;  5KN3 A;  2YPM A;  3ZVJ D;  4OO4 A;  3DGQ A;  2GQK A;  3F3Q A;  2B1L A;  4BVX B;  5F05 A;  3FHK A;  4PUA A;  5FT3 A;  3KTL A;  4JE1 A;  1M2D A;  1W89 A;  3FK8 A;  3FZ4 A;  1TRW A;  3F4T A;  2M80 A;  2HFD A;  2FCH A;  4OFT A;  4HDE A;  5DAL A;  1AQX A;  2H70 A;  4EO3 A;  2AV4 A;  4MDC A;  1TTZ A;  4LMV A;  3M8N A;  4YAP A;  5IO0 A;  2OAD A;  3WT1 A;  2OJL A;  4BA7 A;  2YJ7 A;  2VCW A;  2MZC A;  5IPH A;  2KUC A;  2HZE A;  3GV1 A;  1XVQ A;  1GWC A;  1LU4 A;  1GL8 A;  1VGL A;  4V2M A;  4POL A;  2YWO A;  3LJR A;  5CNW A;  1GTA A;  5ABR A;  3A2W A;  4EKZ A;  2B5X A;  2FA8 A;  2PBJ A;  2ES7 A;  3C1S A;  4DSS B;  3K8N A;  2O7K A;  4WEY A;  2HNL A;  1A8Y A;  4EL1 A;  4CDO A;  1RK4 A;  1A24 A;  3F4S A;  3KH7 A;  5IMA A;  4ECB A;  2LV3 A;  3C8E A;  4DVC A;  2WCI A;  1U3I A;  3A3T A;  3M3M A;  4A5P A;  2H66 A;  5G5F A;  1SL1 B;  3WGE A;  3FW2 A;  2HT9 A;  4IHU A;  1AW9 A;  5B8B A;  3FY7 A;  5G1L A;  4PQH A;  2LEG A;  2CX3 A;  2C3N A;  2PVQ A;  2DC5 A;  1U87 A;  2KOK A;  4I97 A;  2BMX A;  4AJ7 A;  2V1M A;  3H1N A;  2DBC A;  5ELG A;  3CMI A;  2EIQ A;  2R0C A;  4HEA 2;  2GVP A;  1JZD A;  1Z7R A;  1R5A A;  2VD1 A;  2RLI A;  1WJK A;  1UC7 A;  1AXD A;  3MWH A;  1GNW A;  3LG6 A;  3EUR A;  4ECC A;  4X1U A;  2E0Q A;  2XBI A;  5DQY A;  3FZ9 A;  2LJK A;  3L9S A;  4BL7 B;  2EC4 A;  5ELA A;  3EVI A;  2A4V A;  5KOW A;  2YV9 A;  2H6Z A;  3DWV A;  1M9B A;  1B9Y C;  1EGR A;  2MBS A;  3GKM A;  5AIX A;  4RQR A;  1A0R P;  2DJK A;  2NBS A;  1SJI A;  3HDC A;  2K18 A;  1ZYN A;  2VCZ A;  2O85 A;  4ZL9 A;  2KHP A;  3GKK A;  1Q98 A;  2QSI A;  1EEM A;  1PA3 A;  4OCE A;  1HQO A;  1M2A A;  3GL5 A;  3HXS A;  5J9B A;  4Q5Q A;  2PGT A;  4O32 A;  4BWS A;  3J7Y k;  4J2F A;  1GNE A;  3FR6 A;  4EDY A;  3GIX A;  1OYJ A;  3ZML A;  3APO A;  1G6W A;  4GXZ A;  1B4Q A;  7GSS A;  5EL8 A;  4XHM A;  4KCA A;  3F4R A;  4KDU A;  2R0G A;  3FR9 A;  1EP7 A;  2B7J A;  2I4A A;  1VF4 A;  3UVT A;  4HJ2 A;  1R4W A;  1KNG A;  2QA1 A;  3A2V A;  3CRU A;  1CQH A;  2O87 A;  4KND A;  1AIU A;  4X0X A;  3EYT A;  4OFM A;  2FWE A;  4GCI A;  1X9M B;  1XW9 A;  2VCV A;  3F6F A;  3GKX A;  1E6B A;  1AAZ A;  2FA4 A;  1V2A A;  3G7J A;  3F9U A;  3KJY A;  1BJX A;  4EXJ A;  2H76 A;  3GNJ A;  1TDI A;  1GLP A;  1Y6E A;  2EIO A;  1ILO A;  3ME7 A;  2IFQ A;  1GLQ A;  2IME A;  1OKD A;  3KP9 A;  3QFA C;  2M72 A;  1G6Y A;  4QQ7 A;  1YZX A;  5IPG A;  3FZA A;  3I6A A;  5KEJ A;  2FLS A;  3DRN A;  2CZ3 A;  4JR6 A;  3KMO A;  2R3X A;  1XW5 A;  2I1U A;  5CRG A;  1YDK A;  4GLT A;  2FWH A;  5D8I A;  1OVN A;  4CHS A;  3D0Z A;  3D21 A;  1JHB A;  4EC0 A;  2H1G A;  2C0E A;  2C0D A;  2DJ0 A;  4AJ8 A;  4BVX A;  1TI1 A;  3GUS A;  4ML6 A;  3DVX A;  2B7K A;  2X4A A;  3RPN A;  3GRX A;  5ECP B;  4FYB A;  1AC1 A;  2V6O A;  1OE7 A;  4PQ1 A;  2UZ8 A;  2OA7 A;  1X0R A;  4I2U A;  13GS A;  5AIS A;  4POK A;  2PN8 A;  2TRX A;  1SYR A;  3KXO A;  2LUS A;  3HHV A;  5ENU A;  3QMX A;  6GST A;  2L5O A;  3LXZ A;  5HR1 A;  5A4V A;  2HSY A;  3LXT A;  3ZL5 A;  2CX4 A;  4PX1 A;  3QDN A;  5ECI B;  4N0V A;  4RI6 A;  1TW9 A;  3F6D A;  3ZTL A;  1VF3 A;  4EDZ A;  4XIH A;  5IQY A;  3KD0 A;  1X9W B;  1FO5 A;  1GSD A;  3WGX A;  5IO2 A;  4TW5 A;  3AY8 A;  3F8U A;  4IQA A;  3N5O A;  4OWY A;  1URM A;  5G31 A;  3GFK A;  5CRD A;  2I9H A;  1DE1 A;  1UN2 A;  4OCF A;  1B48 A;  1K0N A;  2DMM A;  2B1K A;  4DSS A;  1EEJ A;  5FWG A;  3KP8 A;  4CY6 A;  2MMZ A;  2MBT A;  4FIW A;  4GRF A;  2H0H A;  2WRT A;  1Z5Y E;  1M2B A;  1MD4 A;  4MMM A;  1T4Z A;  2FWF A;  3G7Y A;  3US3 A;  1KBN A;  2LRN A;  2L4Q A;  4YAV A;  4PGT A;  4WET A;  3O6T A;  1AUC A;  4KAE A;  3QD9 A;  3EIN A;  1YY7 A;  5IIZ A;  4Q5R A;  4MF5 A;  2LQQ A;  4Z2T A;  5KN0 A;  1GUL A;  1EOH A;  4I2T A;  3UMA A;  4ZB8 A;  1SYX A;  2GST A;  3C1R A;  5ECK B;  2VLU A;  4K7I A;  4QL9 A;  2YN1 A;  3EU3 A;  2R5G A;  2VOC A;  2JSY A;  3F3R A;  1YKC A;  5IMZ A;  5JCG A;  9GSS A;  1A2L A;  3S9F A;  4ICY A;  5D9V A;  1NHY A;  2V32 A;  4BL7 A;  3L9U A;  4PQI A;  2LQO A;  4AF2 A;  4HQS A;  1IYH A;  2YOI A;  1GTI A;  2RII A;  4KW6 A;  3J7Y b;  19GS A;  4Z2U A;  2TRC P;  3HVV A;  5F07 A;  3MAK A;  4D73 B;  3A5I A;  4X43 A;  5B7C A;  4ZBD A;  3BJ5 A;  4KH7 A;  1FOH A;  4K6X A;  4IQ1 A;  2RUF A;  4LL1 B;  3VK9 A;  1SD9 A;  1XW6 A;  3LFL A;  1OE8 A;  1K3O A;  3CXG A;  4J57 E;  1OC8 A;  2CT6 A;  2GQL A;  4V1A p;  2P5R A;  2CA8 A;  3IOS A;  5DDL A;  2WFC A;  4EIP A;  2H8L A;  5DJM A;  3TKS A;  4ZB6 A;  1PKZ A;  4XRD A;  3BCI A;  2DJ1 A;  1RW1 A;  5JWR B;  4DSR A;  1V57 A;  4FQU A;  4JR4 A;  3HCZ A;  4O7H A;  3HJP A;  1PN9 A;  2GTU A;  3H4K A;  5A4W A;  4YKF A;  3KM6 A;  3ZVJ A;  4CW9 A;  1QXH A;  4XRA A;  3E0U A;  4G0K A;  1HNB A;  1GSY A;  5J5N A;  1C72 A;  2H71 A;  3NIV A;  2HE3 A;  3TJJ A;  1FVK A;  4FH8 A;  2TIR A;  2JAD A;  2JL4 A;  1Z6M A;  2IIY A;  3BBY A;  5DQS A;  4K2D A;  2DIZ A;  4ILF A;  4POM A;  3HKR A;  4LLR A;  2MMA A;  2V41 A;  2LJR A;  2V2G A;  3C71 A;  3ZZX A;  1ERU A;  1O81 A;  1ZYE A;  4O5Q A;  4TOP A;  1SL0 B;  1EV4 A;  1FW1 A;  16GS A;  1SK2 A;  4ZL7 A;  1X5C A;  1G0T A;  2J23 A;  1WIK A;  4KX4 A;  1V40 A;  3UEM A;  3WGD A;  3ERF A;  2VAF A;  1ABA A;  1TU7 A;  4K7N A;  3MNG A;  5INY A;  1XPV A;  2ZCT A;  1PGT A;  4YH2 A;  5DAK B;  2KP1 A;  2KLX A;  1NW2 A;  5A5K A;  2FWG A;  1NSW A;  3GH6 A;  5HFK A;  2XC2 A;  2WGR A;  4MJC A;  1ZCP A;  1WRY A;  3Q19 A;  1BED A;  2DKH A;  2IMF A;  1THX A;  3HD5 A;  3IV4 A;  2IJY A;  2HRF A;  4WXT A;  4POB A;  3H8Q A;  1JZO A;  1JZR A;  2A4H A;  2MYG A;  4V1A g;  1S3A A;  2X8C A;  4MH2 A;  1SK0 A;  5ECR B;  2NPB A;  2WUL A;  5D9T A;  4TKY A;  3D4T A;  3W8J A;  4MJA A;  1YKA A;  4P3Y B;  1FB6 A;  1U6T A;  4HU7 A;  4G2E A;  22GS A;  1YF0 A;  4ULX A;  4HQZ A;  3TOT A;  4IVF A;  4PTS A;  1WE0 A;  2R0P A;  4PUF C;  5F8B A;  2MMN A;  3TJF A;  3UAP A;  4JRR A;  4MF6 A;  4V2N A;  3UL3 A;  2Z9S A;  2PPT A;  3PR8 A;  2GT6 A;  4GF0 A;  4O92 A;  1O6J A;  5ECH B;  3U5R E;  6GSU A;  5EPF A;  2GS3 A;  1QFN A;  4KE3 A;  2JZT A;  4F0B A;  3MYD A;  4NPB A;  4K7O A;  5ECN B;  1GSF A;  4MCU A;  4MLY A;  1ERV A;  5ECS A;  2CV4 A;  1GSQ A;  3UVH A;  3I69 A;  1HNA A;  1JZW A;  5G30 A;  2GLR A;  4L0U A;  4AJ6 A;  3HJO A;  4I6X A;  3CYN A;  4NV5 A;  2IN3 A;  4EE0 A;  2A2R A;  2XBQ A;  1F3B A;  2OE0 A;  5DJL A;  4E8H A;  5D9X A;  4ZIL A;  4MNN A;  2AYT A;  1NM3 A;  2QA2 A;  4JZQ A;  5H5S A;  3QAW A;  1TXX A;  1PRX A;  2H75 A;  2E7P A;  1OAZ A;  2F9S A;  4MPF A;  5JCU A;  2RUE A;  2GT5 A;  2LNT A;  3ZRD A;  2L6D A;  5HFI A;  4F03 A;  2ZNM A;  3I9V 2;  2HYX A;  4BPY A;  4D73 A;  4HUA A;  4MJE A;  5B6M A;  2VL2 C;  4I5Q A;  4HZ2 A;  5BMU A;  3CRT A;  1RQM A;  2F8F A;  4MPG A;  3FRC A;  3UOM A;  2B6M A;  1ZYP A;  1M0U A;  1R7H A;  3LQ7 A;  1OC9 B;  1IYI A;  1TJD A;  3M1G A;  2OE3 A;  3FR3 A;  2JZR A;  3FMW A;  17GS A;  1PKW A;  4K9Z A;  3E9J B;  4ML1 A;  4TR1 B;  3GX0 A;  5CYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...