3IDVA

Crystal structure of the a0a fragment of erp72
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
235
Chain Sequence
DDLEVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGAAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Protein disulfide-isomerase A4
publication title Structure of the Catalytic a(0)a Fragment of the Protein Disulfide Isomerase ERp72.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 235
sequence length 235
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2009-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3idvA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3idvA01
5J3RA 5H5RA 1V58A 2RUFA 3GURA 1PN9A 4IP1A 4DVCA 3VWVA 1JLWA 1B9YC 3GH6A 2WCIA 16GSA 1A24A 2LJKA 3LQ7A 5D73A 2LTKA 4GRFA 3M9JA 2MMAA 3VI5A 3BCIA 4AJ6A 1OVNA 1Y25A 2V6OA 2H74A 5JCGA 1SYRA 1MD3A 4G9HA 4K6XA 1FOVA 3FR6A 4MLYA 4IP6A 1G6WA 3UVHA 5HFKA 4GTUA 1UVZA 4NV2A 3RAZA 1CQGA 3IE3A 4TVEA 1TRWA 5DALB 2C1YA 1T4ZA 3ED3A 3TDGA 1V98A 4OWYA 1B48A 1SK2A 3DIEA 1EP8A 5D9WA 4XS4B 5E4WA 3L9VA 4YQVA 4EUYA 2B1KA 4IQ1A 1GTIA 1EOGA 4ID0A 1AQXA 1YZXA 4LMWA 2R2JA 2VD1A 3LWAA 3DMLA 2E2MA 1PKZA 4MF5A 3ZRDA 4CHSA 3TKSA 2N5BA 2K8VA 4MZBA 1DE2A 4L5LA 2DSAA 1SU9A 1XCCA 2MMZA 3QPMA 3N9JA 3QD9A 4I6XA 2HT9A 3GH9A 4MP4A 1O8XA 4AF2A 1SKWB 3LFLA 3ISOA 4GSTA 3DRNA 9GSSA 3TJBA 3GRXA 5J5NA 3GA4A 2RM5A 4K0GA 1ON4A 1M9BA 5CRHA 1S3DA 4J56E 4AJ7A 1YF1A 4JZQA 2HNLA 4X0XA 3Q19A 2N5AA 1OKTA 1F9MA 3H93A 2LV3A 1Y6EA 1NSWA 3IK9A 5F8BA 1W4VA 1YJ6A 2BTOT 5EL8A 5GSTA 1XPVA 4EXJA 2M80A 4RI7A 5IIZA 2HSYA 1OC9A 2REMA 1PL2A 2D2ZA 1F37A 1F2EA 5IMVA 4I2TA 3FZAA 4PQIA 1X5DA 2ZNMA 3HVXA 2CQ9A 2OADA 4TR3A 1K0MA 2WULA 1HNAA 4K9ZA 2H6YA 2XBQA 3DYRA 4ISDA 1O6JA 1I9DA 1VF1A 1AIUA 3EYTA 3IV4A 3F63A 11GSA 3KGKA 3U6VA 1RQMA 2DJ2A 3EMXA 3MNGA 3CTGA 6GSTA 1W89A 3HXSA 3UOMA 1GH2A 1WOUA 2LSTA 3LGCA 4NPBA 1PA3A 3C1SA 2ALBA 3FK8A 3EVIA 4RQXA 3TKQA 3FR3A 3APQA 3Q6OA 2H75A 3G7YA 2VM1A 4V1Ag 1A8YA 2V41A 4XHMA 5ECNB 4EF0A 2DJ3A 2CX3A 2YPMA 2GSSA 3FW2A 2B5EA 1EGRA 1M99A 1Z6NA 1QQ2A 2VCVA 3W8SA 1XWBA 5DJMA 1QK8A 1GSQA 2C80A 3P8WA 2PBJA 1BAYA 14GSA 3P90A 3W8JA 3LORA 3VWWA 1A23A 3HZ8A 2KLXA 4HUAA 2OBKA 4TR1A 2WZ9A 4EC0A 2OE0A 4Z7XA 2XC2A 1J9BA 2HRFA 1QUWA 1WJKA 3ERGA 5G31A 4BVXA 1PSQA 3JCML 1YY7A 4FYCA 2JSZA 5ECLB 5LD0A 3ZLPA 3HVSA 1M0UA 1OC9B 1DSBA 2A2RA 1AQWA 5ELAA 3I6AA 3QFBC 5CAXA 3F4RA 2YNXA 4EDYA 1SJ6A 1U3AA 2YWMA 4NV5A 2CZ3A 1EV4A 1TDIA 4YAPA 2O87A 2C0FA 4XRAA 1MEKA 1VGLA 2NVLA 3APSA 4N11A 2FA8A 2K8SA 2JACA 4ZBAA 4HS1A 4ECBA 4PXOA 4MJEA 2WJUA 2H6XA 1SL0B 4F0BA 2JZRA 2G0FA 1PMTA 3LJRA 2VD0A 5LNKe 3DVXA 2B5YA 5IOWA 3C7MA 2VAFA 3ZREA 3KJYA 2RIIA 1OKDA 1GNWA 1ZMAA 3A2XA 3DD3A 1YEPA 5KN0A 4Q5NA 1GULA 4CW9A 3FHKA 4EE0A 2MMOA 4TR1B 4EDZA 3FZ9A 1TK5B 2VCTA 4WF5A 5IQYA 1YEXA 1WWJA 1AXDA 4ZB6A 1H75A 4KAEA 4OO5A 4IELA 5J4UA 2B3SA 4XTSA 2CVKA 1YDKA 5HQPA 1PX6A 5ECPB 3S9FA 4ECIA 4V2NA 3UARA 3VK9A 5ABRA 5B7CA 3HD5A 4I97A 5IMDA 2X8CA 3H1NA 3TKSE 1N8JA 1Z9HA 2GQKA 5ECHB 2H1GA 3I69A 4NHZA 2M72A 1BG5A 4Q5QA 2YV9A 3LXTA 2CVBA 7GSSA 2VCWA 4BWSA 2K6VA 3DKSA 3HJOA 2VOCA 4L5OA 1TU8A 3HYPA 2LUSA 1XVQA 1FHEA 3QAWA 5DJLA 19GSA 3UBKA 4DEJA 1FO5A 2L6DA 5J9BA 1K0DA 4KE3A 5G1LA 3D22A 1AW9A 2NDOA 1T3BA 1G7OA 1ZGNA 1OE7A 3ERWA 1TJDA 5IOXA 2YJ7A 4TXVA 1MDJA 2PVOC 2F8FA 3MDKA 1YQ1A 2H72A 5A4UA 4MJBA 2V2GA 2GS3A 2DIYA 1I5GA 2R4VA 4BVYA 3MSZA 5JWRB 3ZZXA 3C71A 4ZIJA 2I1UA 1Z3EA 2FCHA 3TKSC 2L5OA 1JHBA 1V57A 3KH7A 2YN1A 2J23A 3ZMKA 3IPZA 1M2AA 4K8MA 2C4JA 2GZYA 3CTFA 3IC4A 2E7PA 2X99A 4RUVA 5B8AA 2PUKC 2CA8A 1GUKA 4PX1A 1BYEA 4JU5A 1O8WA 2VUPA 4ECCA 1ERUA 1B4PA 1O7UA 3EC3A 3A5WA 1WP0A 3CYNA 1B4QA 3EWLA 3HDCA 4TR4A 1ILOA 1EP7A 2ES7A 4AGSA 4KGIA 2DJJA 1XWCA 2GQMA 1SL1B 3OR5A 2XPDA 2VCXA 4BL7A 5L71A 1TW9A 1PL1A 1TRVA 2P5RA 2WDUA 3ZL5A 4LLRA 2JSYA 4IS0A 4QL9A 2GSQA 1BJXA 2L4QA 2F9SA 2FWEA 4I5QA 1G7EA 4TXOB 1V9WA 1F6MC 5DQYA 4OFTA 1GUHA 1X9SB 4FO5A 4F2IA 1GTBA 3ME7A 2HRNA 5E59A 1R5PA 3TRQA 2I3YA 1Z6MA 2YJHA 2FWHA 4MDCA 3PINA 3EMPA 4LA1A 1BX9A 4KW6A 3D4MA 1F3BA 3GUSA 2JZSA 2GLRA 4GSNA 3RDWA 1SK1A 4PGTA 2H1BA 1T4YA 3KP8A 1QGVA 4ZBDA 2LRTA 3J7Yb 5DDLA 2AYTA 3PGTA 4L0WA 4YQUA 5CNWA 2WRTA 4TKYA 2QC7A 3FYGA 2FWFA 3VLNA 5HFIA 4WF4A 1SL2B 2FLSA 3IAS2 5ECSA 2I9HA 2WS2A 3R2QA 1U6TA 1XW9A 1TK8B 4XCSA 2H6ZA 2IL3A 3TKRA 1PRXA 1EWXA 3M3MA 2PVQA 2LNSA 1M2DA 3IRAA 1XWAA 4KSMA 10GSA 1QMVA 5F07A 2VL2A 4HQZA 3GX8A 4KUNA 4N30A 2B6MA 4JBBA 4D73A 2O7KA 3RBTA 2B5XA 4V2LA 1GUMA 5COHA 3CBUA 1XWGA 3GTUB 2OKAA 3E0UA 4POLA 2DBCA 3BCKA 5ECQB 1GSFA 3UL3A 4CDOA 3ZITA 2AJQB 5AIXA 2OBIA 1A0FA 3GX0A 4XIHA 2DMMA 2H70A 4WXTA 3I43A 2H8LA 1OC8A 4XRDA 2OE1A 2LNTA 4PURA 1GWCA 2HZEA 3M1GA 5KN2A 3F9UA 5JCUA 3KIJA 4G19A 4ML6A 2LRNA 3PR8A 2GQLA 4F9ZA 2KOKA 3UAPA 4G10A 4X43A 1JZWA 2LQQA 6GSUA 4I2UA 4O32A 3VWXA 4MJCA 2J9HA 3ZMLA 2FWGA 3WGDA 3GYKA 4HOJA 1ZL9A 2WB9A 1A8LA 4NHWA 2YWIA 3MAKA 3DXBA 5A4WA 5IPGA 3EINA 5F05A 3GSTA 4KX4A 2CZ2A 1HNCA 3TUEA 2O85A 1R5AA 1TTZA 2H0GA 5LCZA 3F6FA 2VLTA 4MH2A 4ACSA 1Q4JA 3FZ4A 1GTUA 5D9VA 1HD2A 2NPBA 1NM3A 1ST9A 3KEBA 3IBHA 5IMCA 1X0RA 3F3RA 5JWOB 4D73B 1NW2A 1CQHA 1Q98A 4ZL7A 2XPEA 4V2MA 1JZRA 3LG6A 4K7OA 2OJLA 2Z9SA 1THOA 1R26A 3A2VA 5GSSA 3EU4A 3J7Yk 1IYIA 1Z7RA 1PQNA 5GZZB 1A2MA 1A2LA 4MZWA 1X5CA 4PNGA 3VFIA 1OC3A 4ZILA 1JLVA 2HZEB 3VPTA 2K9FA 4NMUA 5D9XA 1ABAA 4X1UA 4RQRA 4ZB9A 2GSTA 1H4OA 17GSA 4IJ3A 4OD7A 3HJMA 1EOHA 1XXUA 3H79A 2M46A 4H86A 3GN3A 2GZZA 2P0GA 2QSIA 4JE1A 5DAKA 4IHUA 4J57E 4HQSA 2VIMA 1MDKA 22GSA 4MZCA 4IW9A 5J9CA 2YWNA 3GL5A 2TRXA 3F0IA 4ZB8A 2JZTA 4KH7A 3TJFA 5HR0A 2E2GA 2HSHA 4BWQA 5ECIB 3QMXA 5G1KA 3HKRA 2K18A 1GSYA 1R7HA 1AC1A 5A5KA 3GKXA 1BQ7A 1GSDA 4I8BA 4O5RA 5FHIA 3TGZA 4YH2A 2CVDA 1HQOA 4HDEA 4KSOA 4F0CA 3P2AA 3CMIA 2KUCA 2GT5A 2IPAA 3L78A 4E8EA 2AAWA 5GAPD 1O81A 1J08A 1TKDB 2KP1A 2YCDA 4POKA 2H73A 1SJZA 3IA1A 6GSVA 1DE1A 4KB3A 4PQ1A 5J41A 2C3NA 4Q5FA 1G0TA 3C1RA 3LYKA 1VF2A 3SWLA 2DMLA 1PKWA 4ZL8A 1SD8A 3EU3A 1G6YA 4KDUA 3EE2A 3CSHA 1JZOA 2P31A 3LEFA 2B7JA 1E2YA 4EL1A 3APOA 1ZZYA 5IM9A 1PD21 4N10A 1GLQA 2YZHA 3W6GA 5DAKB 3US3A 1XW6A 3TKPA 1TXXA 1XFLA 2HE3A 3PH9A 1TI1A 1EEMA 1V2AA 2DLXA 2X8GA 3TJJA 1SENA 4K2DA 5AGYA 1VF3A 1WIKA 3TB2A 2I81A 2PERA 1XW5A 4FH8A 2VCZA 1DUGA 2IJYA 5IO2A 3D0ZA 3F6DA 1SKSB 2H1DA 5JWQB 1MDIA 1EV9A 2KHPA 2LRCA 1LU4A 4GQCA 2RUEA 5DVBA 3C8EA 1K0NA 2DJ0A 4TXOA 4HI7A 4HZ2A 4HEA2 2GSRA 3HVVA 1U3IA 4JEDA 4DSSA 1JZDA 3H8QA 1HYUA 4MF7A 3VWUA 3WGXA 2GVPA 1AAZA 5G30A 1Z7PA 3WYWA 2RLIA 1UN2A 4IJIA 3GSSA 3QAGA 4MMMA 3CSJA 1JFUA 3DVWA 4OFNA 3ZYWA 3U5RE 1VF4A 2VCQA 4N0ZA 4O7HA 2R5GA 6GSWA 4HJMA 2CAIA 3CSIA 5CRDA 3C73A 5F0GA 4GSSA 3E3EA 6GSSA 1N2AA 3UVTA 5IMAA 1GTAA 1M7TA 3L0HA 2AHEA 2VL2C 1YKCA 1AUCA 1QXHA 2F8AA 2JL4A 1GRXA 2H0IA 4MPFA 3ERFA 2PMTA 1BEDA 1K0AA 4BA7A 3M9KA 4OFMA 3M0FA 5DQSA 3KTBA 3TRXA 2DIZA 4JRRA 4WETA 1RK4A 5B6MA 5HFGA 2ON7A 1K3LA 1XWKA 1X5EA 1K3YA 5D93A 2FY6A 1XOAA 5ECOB 4MABA 2IWTA 5ID2A 5H5QA 4GF0A 3KH9A 5DCGA 2GT6A 2FGXA 4F82A 2MMNA 1OYJA 2HXKA 2LJRA 5HR3A 1YKAA 1ACVA 3KTLA 2FNOA 1ERTA 4DSSB 3G7IA 1SKRB 4ML1A 5KEJA 4ILFA 4TRXA 3GTUA 1GSSA 5CP1A 4WKWA 3A2WA 2MYGA 4K7IA 2TIRA 4XS1A 4YQMA 2NTOA 4MCUA 3QAVA 5ENUA 4PUFC 3ZTLA 1Z5YE 5ECMB 2B7KA 1SJIA 4AJ8A 2IMFA 2FUG2 1SYXA 1QFNA 4NXIA 2GGTA 3NOFA 1ERVA 3HA9A 1E6BA 2TRCP 1NHYA 4XS6A 5FT3A 3D5JA 3BOAA 4IN0A 2GZPA 2NBSA 4MPGA 5JCWA 4N0VA 2CX4A 4JR4A 4ULXA 2AV4A 1OAZA 2JADA 1EGOA 3F4TA 2PWJA 1TK0B 20GSA 3TCOA 2EIOA 18GSA 3HJPA 3IR4A 4EKZA 2HFDA 1WMJA 2IMKA 3KCMA 5CRGA 3D21A 2YOIA 2HZFA 1FB6A 3TRPA 4DSRA 4V1Ap 1TU7A 1KTEA 4ZBBA 3RHBA 3V1WA 1T8EB 4FYBA 2VLVA 3HCZA 5ID2B 4MJAA 1A0RP 3QOUA 3TJKA 1LBKA 2OE3A 1SK0A 3FRCA 3ZIVA 3KMNA 1A2JA 2WFCA 4GQFA 2E0QA 3O3TA 1K3OA 5IMZA 1XOBA 1MTCA 3WT2A 2L6CA 4K7NA 2GDRA 3L9UA 3QDNA 4HJ2A 3ZVJD 3VI7A 2XHFA 4WBJA 2BJXA 1ML6A 4WR4A 3ZIJA 2V32A 6GSYA 2LJAA 3M8NA 2OA7A 3A3TA 1XVWA 4PUAA 3ZFLA 2O8VB 4F03A 5HR2A 3KM6A 3MWHA 4TN8A 2A4VA 1GNEA 2G2QA 3RPPA 1XBSA 1X9WB 2MBSA 1B8XA 2BMXA 2X8HA 5DCHA 2LKUA 5AN1A 2GTUA 2MBTA 1TOFA 4NWYA 3O6TA 3K8NA 1WPIA 3KP9A 3WD6A 2L59A 4KA0A 1LJRA 1URMA 2PN8A 4E8HA 2AUVA 5C04A 4MA9A 2ZUPA 13GSA 1FB0A 1THXA 3KXOA 4O92A 3IDVA 5IMFA 3G7JA 3GKNA 2CAQA 3D6IA 1EEJA 2H76A 1R4WA 2YANA 3UMAA 1C72A 2EIRA 5ELGA 2DC5A 3F8UA 5CYYA 3WGEA 1WE0A 3UBLA 2C0DA 2H66A 2KP2A 3RPNA 2WGRA 2IMDA 4LL4B 5AIVA 1GSEA 3CXGA 4FYUA 1X9MB 1M9AA 3NZNA 1ZYEA 3H4KA 1T00A 1O73A 1PX7A 1TRSA 1AQVA 3E9JB 2ON5A 4JR6A 2HI7A 3TOTA 5F06A 3CRUA 1DBYA 1MD4A 4L0UA 2P5QA 1ZOFA 4RI6A 4YAVA 5FWGA 3BD2A 5D96A 4PNFA 4MF6A 4IKHA 1VRSD 5EY6A 1EZKA 2DJKA 1FG4A 5C00A 1KNGA 2H71A 3QCPA 3GMFA 2LS5A 1J0FA 4TOPA 4KDXA 3I9V2 3KZQA 4KCAA 3VPQA 4ECJA 3GHAA 1KEBA 1WRYA 4MK3A 1GLPA 3UJ1A 3O76A 4ZL9A 1HNBA 5ECKB 3HY2A 3HZ4A 3UEMA 2IMIA 3CRTA 5HR1A 5KN1A 5B8BA 4QQ7A 2DJ1A 3GNJA 3EURA 5GAND 1T7PB 1USBA 3F4SA 2HYXA 2R6KA 3BJ5A 5INYA 4J2FA 4TW5A 2H01A 2LEGA 5EVOA 1U88A 4IVFA 4IGJA 3P7XA 2IFQA 2YWOA 4QL7A 4DSQA 2QGVA 3QR6A 1TRUA 2L57A 3IK7A 2VO4A 5KN3A 1GSUA 3UIWA 4EVMA 3SBCA 2YV7A 2I4AA 4GWRA 4KNDA 1S3CA 4HU7A 2XBIA 4K0NA 1ZYQB 3DEXA 4POMA 1NHOA 2HLSA 2L4CA 1UA5A 2VLUA 4NAXA 1F3AA 2PGTA 3AY8A 5G2ZA 2FA4A 3GV1A 3HHVA 2QKEA 3L9SA 3LXZA 3N5OA 5EPFA 1V40A 3IXRA 1M2BA 2PU9C 4GCIA 4IQAA 1PGTA 2H1AA 4POBA 4TR0A 4ZXGA 3KD0A 3BBYA 4Q5RA 2PPTA 4PQHA 8GSSA 2VL9A 4K1FA 1K0OA 2EIQA 3Q18A 2IIYA 2YP6A 2A2SA 1SD9A 1XZOA 4GLTA 3GKMA 2N5FA 5IO0A 3DWVA 1T1VA 2V1MA 4LL1B 1U87A 1XIYA 2F51A 2VM2A 6GSXA 1UC7A 3DGQA 4KCEA 3TOUA 4WEYA 3ME8A 3GIXA 3VURA 4MH3A 2MZCA 4WBRD 3L4NA 5CREA 5D8IA 3TJGA 2V6KA 3RHCA 3GL3A 2FHEA 2IFQB 5G5EA 4HU9A 4OCFA 1FAAA 1OE8A 2O89A 1IYHA 4KDYA 4HZ4A 1ERWA 4LMVA 5CRWA 1KBNA 2H19A 3FEUA 3LSZA 1ZCPA 1B9XC 4FIWA 3ZVJA 4P3YB 3LYPA 1K0BA 1FVJA 12GSA 1O85A 3ZFBA 3KMOA 2EC4A 2VL3A 2C0GA 2H0HA 3FZ5A 4OMVA 1GL8A 2C3QA 3F3QA 4G2EA 2RM6A 4IBPA 3FY7A 3NIVA 2X64A 3GKKA 2L5LA 3Q74A 3QFAC 3WT1A 2C0EA 5IPHA 2F3MA 4EO3A 1FVKA 2B1LA 3D4TA 2YZUA 5DALA 3IOSA 1GP1A 2C8UA 3FKFA 4WR5A 3IHQA 5AISA 3FR9A 1FW1A 2R3XA 5ECRB 1TP9A 4XS4A 5DBQA 1YF0A 2CT6A 4L8EA 5H5SA 3G9BA 4BPYA 2C3TA 5B6NA 5A4VA 4OCEA 5D9TA 4GXZA 2JU5A 2CV4A 1K0CA 2IN3A 2ZCTA 4OO4A 3GFKA 1TI3A 2LQOA 3IAM2 2AB6A 2R37A 2OACA 2H30A 5G5FA 2FD3A 2IMEA 1RW1A 5CO3A 1S3AA
chains in the Genus database with same CATH superfamily
5J3RA 5H5RA 1V58A 2RUFA 3GURA 1PN9A 4IP1A 4DVCA 3VWVA 1JLWA 1B9YC 1PN0A 3GH6A 2WCIA 16GSA 1A24A 2LJKA 3LQ7A 5D73A 2LTKA 4GRFA 1M3IA 3M9JA 2MMAA 3VI5A 3BCIA 4AJ6A 1OVNA 1Y25A 2V6OA 2H74A 5JCGA 1SYRA 1MD3A 4G9HA 4K6XA 1FOVA 4EIQA 3FR6A 4MLYA 4IP6A 1G6WA 3UVHA 5HFKA 4GTUA 1UVZA 4NV2A 3RAZA 1CQGA 3IE3A 4TVEA 1TRWA 1FOHA 5DALB 2C1YA 1T4ZA 3ED3A 3TDGA 1V98A 4OWYA 1B48A 1SK2A 3DIEA 1EP8A 5D9WA 4XS4B 5E4WA 3L9VA 4YQVA 4EUYA 2B1KA 4IQ1A 1GTIA 1EOGA 4ID0A 1AQXA 1YZXA 4LMWA 2R2JA 2VD1A 3LWAA 3DMLA 2E2MA 1PKZA 4MF5A 3ZRDA 4CHSA 3TKSA 2N5BA 2K8VA 4MZBA 1DE2A 4L5LA 2DSAA 1SU9A 1XCCA 2MMZA 3QPMA 3N9JA 3QD9A 4I6XA 2HT9A 3GH9A 4MP4A 1O8XA 4AF2A 1SKWB 3LFLA 3ISOA 4GSTA 3DRNA 9GSSA 3TJBA 3GRXA 5J5NA 3GA4A 2RM5A 4K0GA 1ON4A 4G0LA 1M9BA 5CRHA 1S3DA 4J56E 4AJ7A 1YF1A 4JZQA 2HNLA 4X0XA 3Q19A 2N5AA 1OKTA 1F9MA 3H93A 2LV3A 1Y6EA 1NSWA 3IK9A 5F8BA 1W4VA 1YJ6A 2BTOT 5EL8A 5GSTA 1XPVA 4EXJA 2M80A 4RI7A 5IIZA 2HSYA 1OC9A 2REMA 1PL2A 2D2ZA 1F37A 1F2EA 5IMVA 4I2TA 3FZAA 4PQIA 1X5DA 2ZNMA 3HVXA 2CQ9A 2OADA 4TR3A 1K0MA 2WULA 1HNAA 4K9ZA 2H6YA 2XBQA 3DYRA 4ISDA 1O6JA 1I9DA 1VF1A 1AIUA 3EYTA 3IV4A 3F63A 11GSA 3KGKA 3U6VA 1RQMA 2DJ2A 3EMXA 3MNGA 3CTGA 6GSTA 1W89A 3HXSA 3UOMA 1GH2A 1WOUA 2LSTA 3LGCA 4NPBA 1PA3A 3C1SA 2ALBA 3FK8A 3EVIA 4RQXA 3TKQA 3FR3A 3APQA 3Q6OA 2H75A 3G7YA 2VM1A 4V1Ag 1A8YA 2V41A 4XHMA 5ECNB 4EF0A 2DJ3A 2CX3A 2YPMA 2GSSA 3FW2A 2B5EA 1EGRA 1M99A 1Z6NA 1QQ2A 2VCVA 3W8SA 1XWBA 5DJMA 1QK8A 1GSQA 2C80A 3P8WA 2PBJA 1BAYA 14GSA 3P90A 3W8JA 3LORA 3VWWA 1A23A 3HZ8A 2KLXA 4HUAA 2OBKA 4TR1A 4YKGA 2WZ9A 4EC0A 2OE0A 4Z7XA 2XC2A 1J9BA 2HRFA 1QUWA 1WJKA 3ERGA 5G31A 4BVXA 1PSQA 3JCML 1YY7A 4FYCA 2JSZA 5ECLB 5LD0A 3ZLPA 3HVSA 1M0UA 1OC9B 1DSBA 2A2RA 1AQWA 3LW9A 5ELAA 4CY8A 3I6AA 3QFBC 5CAXA 3F4RA 2YNXA 4EDYA 1SJ6A 1U3AA 2YWMA 4NV5A 2CZ3A 1EV4A 1TDIA 4YAPA 2O87A 2C0FA 4XRAA 1MEKA 1VGLA 2NVLA 3APSA 4N11A 2FA8A 2K8SA 2JACA 4ZBAA 4HS1A 4K5RA 1S3RA 4ECBA 4PXOA 4MJEA 4G0IA 2WJUA 2DKHA 2H6XA 1SL0B 4F0BA 2JZRA 2G0FA 1PMTA 3LJRA 2VD0A 5LNKe 1XG8A 3DVXA 2B5YA 3MYDA 5IOWA 3C7MA 2VAFA 2R0PA 3ZREA 3KJYA 2RIIA 1OKDA 1GNWA 1ZMAA 3A2XA 2HRAA 3DD3A 1YEPA 1ZYPA 5KN0A 4Q5NA 1GULA 4CW9A 3FHKA 4EE0A 2MMOA 4TR1B 4EDZA 3FZ9A 1TK5B 2VCTA 4WF5A 5IQYA 1YEXA 1WWJA 1AXDA 4BVXB 4ZB6A 1H75A 4KAEA 4OO5A 4IELA 5J4UA 2B3SA 4XTSA 2CVKA 1YDKA 5HQPA 1PX6A 5ECPB 3S9FA 4ECIA 4V2NA 3UARA 3VK9A 5ABRA 5B7CA 3HD5A 4I97A 5IMDA 2X8CA 3H1NA 3TKSE 1N8JA 1Z9HA 2GQKA 5ECHB 2H1GA 3I69A 4NHZA 2M72A 1BG5A 4Q5QA 2YV9A 3LXTA 2CVBA 7GSSA 2VCWA 4BWSA 2K6VA 3DKSA 3HJOA 3CQFA 2VOCA 4L5OA 1TU8A 3HYPA 2LUSA 1XVQA 1FHEA 3QAWA 5DJLA 19GSA 3UBKA 4DEJA 1FO5A 2L6DA 5J9BA 1K0DA 4KE3A 5G1LA 3D22A 1AW9A 2NDOA 1T3BA 1G7OA 1ZGNA 1OE7A 3ERWA 1TJDA 5IOXA 2YJ7A 4TXVA 1MDJA 2PVOC 2F8FA 3MDKA 1YQ1A 2H72A 5A4UA 4MJBA 2V2GA 2GS3A 2DIYA 1I5GA 2R4VA 4BVYA 3MSZA 5JWRB 3ZZXA 3C71A 1ZYNA 4ZIJA 2I1UA 1Z3EA 2FCHA 3TKSC 2L5OA 1JHBA 1V57A 3KH7A 2YN1A 2J23A 3ZMKA 3IPZA 1M2AA 4K8MA 2C4JA 2GZYA 3CTFA 3IC4A 2E7PA 2X99A 4RUVA 5B8AA 2PUKC 2CA8A 1GUKA 4PX1A 1BYEA 4JU5A 1O8WA 2VUPA 4ECCA 1ERUA 2QA2A 1B4PA 1O7UA 3EC3A 3A5WA 1WP0A 3CYNA 1B4QA 3EWLA 3HDCA 4TR4A 1ILOA 1EP7A 2ES7A 4AGSA 4KGIA 2DJJA 1XWCA 2GQMA 1SL1B 3OR5A 2XPDA 2VCXA 4BL7A 5L71A 1TW9A 1PL1A 1TRVA 2P5RA 2WDUA 3ZL5A 4LLRA 2JSYA 4IS0A 4QL9A 2GSQA 1BJXA 2L4QA 2F9SA 3A5IA 2FWEA 4I5QA 1G7EA 4TXOB 1V9WA 1F6MC 5DQYA 4OFTA 1GUHA 1X9SB 4FO5A 4F2IA 1GTBA 3ME7A 2HRNA 5E59A 1R5PA 3TRQA 2I3YA 4BVYB 1Z6MA 2YJHA 2FWHA 4CY6A 4MDCA 3PINA 3EMPA 4LA1A 1BX9A 4KW6A 3D4MA 1F3BA 3GUSA 4BIKA 2JZSA 2GLRA 4GSNA 3RDWA 1SK1A 4PGTA 2H1BA 1T4YA 3KP8A 1QGVA 4ZBDA 2LRTA 3J7Yb 5DDLA 4G0KA 3R3EA 2AYTA 3PGTA 4L0WA 4YQUA 5CNWA 2WRTA 4TKYA 2QC7A 3FYGA 2FWFA 3VLNA 4YKFA 5HFIA 4WF4A 1SL2B 2FLSA 3IAS2 5ECSA 2I9HA 2WS2A 3R2QA 1U6TA 1XW9A 1TK8B 4BL7B 4XCSA 2H6ZA 2IL3A 4KF9A 3TKRA 1PRXA 1EWXA 3M3MA 2PVQA 2LNSA 1M2DA 3IRAA 1XWAA 4ICYA 4KSMA 10GSA 1QMVA 5F07A 2VL2A 4HQZA 3GX8A 4KUNA 4N30A 2B6MA 4JBBA 4D73A 2O7KA 3RBTA 2B5XA 4V2LA 1GUMA 5COHA 3CBUA 1XWGA 3GTUB 2OKAA 3E0UA 4POLA 2DBCA 3BCKA 5ECQB 1GSFA 3UL3A 4CDOA 3ZITA 2AJQB 5AIXA 2OBIA 1A0FA 3GX0A 4XIHA 2DMMA 2H70A 4WXTA 3I43A 1M3JA 1OC8A 2H8LA 4XRDA 2OE1A 4Z2UA 2LNTA 4PURA 1GWCA 2HZEA 3M1GA 5KN2A 3F9UA 5JCUA 3KIJA 4G19A 4ML6A 2LRNA 3PR8A 2GQLA 4F9ZA 2KOKA 3UAPA 4G10A 4X43A 1JZWA 2LQQA 2X4AA 6GSUA 4I2UA 4O32A 3VWXA 4Z2RA 4MJCA 2J9HA 3ZMLA 2FWGA 3WGDA 3GYKA 4HOJA 1ZL9A 2WB9A 4USSA 1A8LA 4NHWA 2R0CA 2YWIA 3MAKA 3DXBA 5A4WA 5IPGA 3EINA 5F05A 3GSTA 4KX4A 2CZ2A 1HNCA 3TUEA 2O85A 1R5AA 1TTZA 2H0GA 5LCZA 3F6FA 2VLTA 2HRKA 4MH2A 4ACSA 1Q4JA 3FZ4A 1GTUA 5D9VA 4HSCX 1HD2A 2NPBA 1NM3A 1ST9A 3KEBA 3IBHA 5IMCA 1X0RA 3F3RA 5JWOB 4D73B 1NW2A 1CQHA 1Q98A 4ZL7A 2XPEA 4V2MA 1JZRA 3LG6A 4K7OA 2OJLA 2Z9SA 1THOA 1R26A 3A2VA 5GSSA 3EU4A 3J7Yk 1IYIA 1Z7RA 1PQNA 5GZZB 1A2MA 1A2LA 4MZWA 1X5CA 4PNGA 3VFIA 1OC3A 4ZILA 1JLVA 2HZEB 3VPTA 2K9FA 4NMUA 5D9XA 1ABAA 4X1UA 4RQRA 4ZB9A 2GSTA 1H4OA 17GSA 4IJ3A 4OD7A 3HJMA 1EOHA 1XXUA 3H79A 2M46A 4H86A 3GN3A 2GZZA 2P0GA 2QSIA 4JE1A 5DAKA 4IHUA 4J57E 4HQSA 2VIMA 1MDKA 22GSA 4MZCA 4IW9A 5J9CA 2YWNA 3GL5A 2TRXA 3F0IA 4ZB8A 2JZTA 4KH7A 3TJFA 5HR0A 2E2GA 2HSHA 4BWQA 5ECIB 3QMXA 5G1KA 3HKRA 2K18A 1GSYA 1R7HA 1AC1A 5A5KA 2UZ8A 3GKXA 1BQ7A 1GSDA 4I8BA 4O5RA 5FHIA 3TGZA 4YH2A 4MNNA 2CVDA 1HQOA 3IC8A 4HDEA 4KSOA 4F0CA 3P2AA 3CMIA 2KUCA 2GT5A 2A4HA 2IPAA 3L78A 4E8EA 2AAWA 5GAPD 4O5UA 1O81A 1J08A 1TKDB 2KP1A 2YCDA 4POKA 2H73A 1SJZA 3IA1A 6GSVA 1DE1A 4KB3A 4PQ1A 5J41A 2C3NA 4Q5FA 1G0TA 3C1RA 3LYKA 1VF2A 4PTSA 3SWLA 2DMLA 1PKWA 4ZL8A 3FMWA 1SD8A 3EU3A 1G6YA 4KDUA 3EE2A 3CSHA 1JZOA 2P31A 3LEFA 2B7JA 1E2YA 4EL1A 3APOA 1ZZYA 5IM9A 1PD21 4N10A 1GLQA 2YZHA 3W6GA 5DAKB 5BMUA 3US3A 1XW6A 3TKPA 1TXXA 1XFLA 2HE3A 3PH9A 1TI1A 1EEMA 1V2AA 2DLXA 2X8GA 3TJJA 1SENA 4K2DA 3HVNA 2R0GA 5AGYA 1VF3A 1WIKA 3TB2A 1PFOA 2I81A 2PERA 1XW5A 4FH8A 2VCZA 1DUGA 2IJYA 5IO2A 4O5QA 3D0ZA 3F6DA 1SKSB 2H1DA 5JWQB 1MDIA 1EV9A 2KHPA 2LRCA 1LU4A 4GQCA 2RUEA 5DVBA 3C8EA 1K0NA 2DJ0A 4TXOA 4HI7A 4HZ2A 4HEA2 2GSRA 3HVVA 1U3IA 4JEDA 4DSSA 1JZDA 3H8QA 1HYUA 4MF7A 3VWUA 3WGXA 2GVPA 1AAZA 5G30A 1Z7PA 3WYWA 2HSMA 2RLIA 1UN2A 4IJIA 3GSSA 3QAGA 4MMMA 3CSJA 1JFUA 3DVWA 4OFNA 3ZYWA 4FQUA 3U5RE 1VF4A 2VCQA 4N0ZA 3IHGA 4O7HA 2R5GA 6GSWA 4HJMA 2CAIA 3CSIA 5CRDA 3C73A 5F0GA 4GSSA 3MIXA 3E3EA 6GSSA 1N2AA 3UVTA 5IMAA 1GTAA 1M7TA 3L0HA 2AHEA 2VL2C 1YKCA 1AUCA 1QXHA 2F8AA 2JL4A 1GRXA 2H0IA 4MPFA 3ERFA 2PMTA 1BEDA 1K0AA 3PPUA 4BA7A 3M9KA 4OFMA 3M0FA 5DQSA 3KTBA 3TRXA 2DIZA 4JRRA 4WETA 1RK4A 5B6MA 5HFGA 2ON7A 1K3LA 2DKIA 1XWKA 1X5EA 1K3YA 5D93A 2FY6A 1XOAA 5ECOB 4MABA 2IWTA 5ID2A 5H5QA 4GF0A 3KH9A 5DCGA 2GT6A 2FGXA 4F82A 2MMNA 1OYJA 2HXKA 2LJRA 5HR3A 1YKAA 1ACVA 3KTLA 2FNOA 1ERTA 4DSSB 3G7IA 1SKRB 4ML1A 5KEJA 4X4JA 4ILFA 4K2XA 4TRXA 3GTUA 1GSSA 5CP1A 4WKWA 3A2WA 2MYGA 4K7IA 2TIRA 3EPTA 4XS1A 4YQMA 2NTOA 4MCUA 3QAVA 5ENUA 4PUFC 3ZTLA 1Z5YE 5ECMB 2B7KA 1SJIA 4AJ8A 2IMFA 2FUG2 1SYXA 1QFNA 4NXIA 2GGTA 3NOFA 1ERVA 3HA9A 1E6BA 2TRCP 1NHYA 4XS6A 5FT3A 3D5JA 3BOAA 4IN0A 2GZPA 2NBSA 4MPGA 5JCWA 4N0VA 2CX4A 2X49A 4JR4A 4ULXA 2AV4A 1OAZA 2JADA 1EGOA 3F4TA 2PWJA 1TK0B 20GSA 3TCOA 2EIOA 18GSA 3HJPA 3IR4A 4EKZA 2HFDA 1WMJA 2IMKA 3KCMA 5CRGA 4A5PA 3D21A 2YOIA 2HZFA 1FB6A 3TRPA 4DSRA 4V1Ap 1TU7A 1KTEA 4ZBBA 3RHBA 3V1WA 1T8EB 4FYBA 2VLVA 3HCZA 5ID2B 4MJAA 1A0RP 3QOUA 3TJKA 1LBKA 2OE3A 1SK0A 3FRCA 3ZIVA 3KMNA 1A2JA 2WFCA 4GQFA 2E0QA 3O3TA 1K3OA 5IMZA 1XOBA 1MTCA 3WT2A 2L6CA 4K7NA 2GDRA 3L9UA 3QDNA 4HJ2A 3ZVJD 3VI7A 2XHFA 4WBJA 2BJXA 1ML6A 4WR4A 3ZIJA 2V32A 6GSYA 2LJAA 3M8NA 2OA7A 3A3TA 1XVWA 4PUAA 3ZFLA 2O8VB 4F03A 5HR2A 3KM6A 3MWHA 4TN8A 2A4VA 1GNEA 2G2QA 3RPPA 1XBSA 1X9WB 2MBSA 1B8XA 2BMXA 2X8HA 5DCHA 2LKUA 5AN1A 2GTUA 2MBTA 1TOFA 4NWYA 3O6TA 3K8NA 1WPIA 3KP9A 3WD6A 2L59A 4KA0A 1LJRA 1URMA 2PN8A 4E8HA 4K5SA 2AUVA 5C04A 4MA9A 2ZUPA 13GSA 1FB0A 1THXA 3KXOA 4O92A 3IDVA 5IMFA 3G7JA 3GKNA 2CAQA 3D6IA 1EEJA 2H76A 1R4WA 2YANA 3UMAA 1C72A 2EIRA 5ELGA 2DC5A 3F8UA 5CYYA 3WGEA 1WE0A 5BRTA 3UBLA 2C0DA 2H66A 2KP2A 3RPNA 2WGRA 5KOXA 2IMDA 4LL4B 5AIVA 1GSEA 3CXGA 4FYUA 1X9MB 4Z2TA 1M9AA 3NZNA 1ZYEA 3H4KA 1T00A 1O73A 1PX7A 1TRSA 1AQVA 3E9JB 2ON5A 4JR6A 2HI7A 2A2PA 3TOTA 5F06A 3CRUA 5KOWA 1DBYA 1MD4A 4L0UA 2P5QA 1ZOFA 4RI6A 4YAVA 5FWGA 3BD2A 5D96A 4PNFA 4MF6A 4IKHA 1VRSD 5EY6A 1EZKA 2DJKA 1FG4A 5C00A 1KNGA 2H71A 3QCPA 3GMFA 2LS5A 1J0FA 2QA1A 4TOPA 4KDXA 3I9V2 3KZQA 4KCAA 3VPQA 4ECJA 3GHAA 1KEBA 1WRYA 4MK3A 1GLPA 3UJ1A 3O76A 4ZL9A 1HNBA 5ECKB 3HY2A 3HZ4A 3UEMA 2IMIA 3CRTA 5HR1A 5KN1A 5B8BA 4QQ7A 2DJ1A 3GNJA 3EURA 5GAND 1T7PB 1USBA 3F4SA 2HYXA 2R6KA 3BJ5A 5INYA 4J2FA 4TW5A 2H01A 2LEGA 5EVOA 1U88A 4IVFA 4IGJA 3P7XA 2IFQA 2YWOA 4QL7A 4DSQA 2QGVA 3QR6A 1TRUA 2L57A 3IK7A 2VO4A 5KN3A 1GSUA 3UIWA 4EVMA 3SBCA 2YV7A 2I4AA 4GWRA 4KNDA 1S3CA 4HU7A 2XBIA 4K0NA 1ZYQB 3DEXA 4POMA 4EIPA 1NHOA 2HLSA 2L4CA 1UA5A 2VLUA 4NAXA 1F3AA 2PGTA 3AY8A 5G2ZA 2FA4A 3GV1A 3HHVA 2QKEA 3L9SA 3LXZA 3N5OA 5EPFA 1V40A 3IXRA 1M2BA 2PU9C 4GCIA 4IQAA 1PGTA 2H1AA 4POBA 4TR0A 4ZXGA 3KD0A 3BBYA 4Q5RA 2PPTA 4PQHA 8GSSA 2VL9A 4K1FA 1K0OA 2EIQA 3Q18A 2IIYA 2YP6A 2A2SA 1SD9A 1XZOA 4GLTA 3GKMA 2N5FA 5IO0A 3DWVA 1T1VA 2V1MA 4LL1B 1U87A 1XIYA 2F51A 2VM2A 6GSXA 1UC7A 3DGQA 4KCEA 3TOUA 4WEYA 3ME8A 3GIXA 3VURA 4MH3A 2MZCA 4WBRD 3L4NA 5CREA 5D8IA 3TJGA 2V6KA 3RHCA 3GL3A 2FHEA 2IFQB 5G5EA 4HU9A 4OCFA 1FAAA 1OE8A 2O89A 1IYHA 4KDYA 4HZ4A 1ERWA 4LMVA 5CRWA 1KBNA 2H19A 3FEUA 3LSZA 1ZCPA 1B9XC 4FIWA 3ZVJA 4P3YB 3LYPA 1K0BA 1FVJA 12GSA 1O85A 3ZFBA 3KMOA 2EC4A 2VL3A 2C0GA 2H0HA 3FZ5A 4OMVA 1GL8A 2C3QA 3F3QA 4G2EA 2RM6A 4IBPA 3FY7A 3NIVA 2X64A 3GKKA 2L5LA 3Q74A 3QFAC 3WT1A 2C0EA 5IPHA 2F3MA 4EO3A 1FVKA 2B1LA 3D4TA 2YZUA 5DALA 3IOSA 1GP1A 2C8UA 3FKFA 4WR5A 3IHQA 5AISA 3FR9A 1FW1A 2R3XA 5ECRB 1TP9A 4XS4A 5DBQA 1YF0A 2CT6A 4L8EA 5H5SA 3G9BA 4BPYA 2C3TA 5B6NA 5A4VA 4OCEA 5D9TA 4GXZA 2JU5A 2CV4A 1K0CA 2IN3A 2ZCTA 4OO4A 3GFKA 1TI3A 2LQOA 3IAM2 2AB6A 2R37A 2OACA 2H30A 5G5FA 2FD3A 2IMEA 1RW1A 5CO3A 1S3AA
chains in the Genus database with same CATH topology
5J3RA 5H5RA 1V58A 2RUFA 3GURA 1PN9A 4IP1A 4DVCA 3VWVA 1JLWA 1B9YC 1PN0A 3GH6A 2WCIA 16GSA 1A24A 2LJKA 3LQ7A 5D73A 2LTKA 4GRFA 3M9JA 2MMAA 3VI5A 3BCIA 4AJ6A 1OVNA 1Y25A 2V6OA 2H74A 5JCGA 1SYRA 1MD3A 4G9HA 4K6XA 1FOVA 4EIQA 3FR6A 4MLYA 4IP6A 1G6WA 3UVHA 5HFKA 4GTUA 1UVZA 4NV2A 3RAZA 1CQGA 3IE3A 4TVEA 1TRWA 1FOHA 5DALB 2C1YA 1T4ZA 3ED3A 3TDGA 1V98A 4OWYA 1B48A 1SK2A 3DIEA 1EP8A 5D9WA 4XS4B 5E4WA 3L9VA 4YQVA 4EUYA 2B1KA 4IQ1A 1GTIA 1EOGA 4ID0A 1AQXA 1YZXA 4LMWA 2R2JA 2VD1A 3LWAA 3DMLA 2E2MA 1PKZA 4MF5A 3ZRDA 4CHSA 3TKSA 2N5BA 2K8VA 4MZBA 1DE2A 4L5LA 2DSAA 1SU9A 1XCCA 2MMZA 3QPMA 3N9JA 3QD9A 4I6XA 2HT9A 3GH9A 4MP4A 1O8XA 4AF2A 1SKWB 3LFLA 3ISOA 4GSTA 3DRNA 9GSSA 3TJBA 3GRXA 5J5NA 3GA4A 2RM5A 4K0GA 1ON4A 4G0LA 1M9BA 5CRHA 1S3DA 4J56E 4AJ7A 1YF1A 4JZQA 2HNLA 4X0XA 3Q19A 2N5AA 1OKTA 1F9MA 3H93A 2LV3A 1Y6EA 1NSWA 3IK9A 5F8BA 1W4VA 1YJ6A 2BTOT 5EL8A 5GSTA 1XPVA 4EXJA 2M80A 4RI7A 5IIZA 2HSYA 1OC9A 2REMA 1PL2A 2D2ZA 1F37A 1F2EA 5IMVA 4I2TA 3FZAA 4PQIA 1X5DA 2ZNMA 3HVXA 2CQ9A 2OADA 4TR3A 1K0MA 2WULA 1HNAA 4K9ZA 2H6YA 2XBQA 3DYRA 4ISDA 1O6JA 1I9DA 1VF1A 1AIUA 3EYTA 3IV4A 3F63A 11GSA 3KGKA 3U6VA 1RQMA 2DJ2A 3EMXA 3MNGA 3CTGA 6GSTA 1W89A 3HXSA 3UOMA 1GH2A 1WOUA 2LSTA 3LGCA 4NPBA 1PA3A 3C1SA 2ALBA 3FK8A 3EVIA 4RQXA 3TKQA 3FR3A 3APQA 3Q6OA 2H75A 3G7YA 2VM1A 4V1Ag 1A8YA 2V41A 4XHMA 5ECNB 4EF0A 2DJ3A 2CX3A 2YPMA 2GSSA 3FW2A 2B5EA 1EGRA 1M99A 1Z6NA 1QQ2A 2VCVA 3W8SA 1XWBA 5DJMA 1QK8A 1GSQA 2C80A 3P8WA 2PBJA 1BAYA 14GSA 3P90A 3W8JA 3LORA 3VWWA 1A23A 3HZ8A 2KLXA 4HUAA 2OBKA 4TR1A 4YKGA 2WZ9A 4EC0A 2OE0A 4Z7XA 2XC2A 1J9BA 2HRFA 1QUWA 1WJKA 3ERGA 5G31A 4BVXA 1PSQA 3JCML 1YY7A 4FYCA 2JSZA 5ECLB 5LD0A 3ZLPA 3HVSA 1M0UA 1OC9B 1DSBA 2A2RA 1AQWA 3LW9A 5ELAA 4CY8A 3I6AA 3QFBC 5CAXA 3F4RA 2YNXA 4EDYA 1SJ6A 1U3AA 2YWMA 4NV5A 2CZ3A 1EV4A 1TDIA 4YAPA 2O87A 2C0FA 4XRAA 1MEKA 1VGLA 2NVLA 3APSA 4N11A 2FA8A 2K8SA 2JACA 4ZBAA 4HS1A 4K5RA 4ECBA 4PXOA 4MJEA 4G0IA 2WJUA 2DKHA 2H6XA 1SL0B 4F0BA 2JZRA 2G0FA 1PMTA 3LJRA 2VD0A 5LNKe 3DVXA 2B5YA 3MYDA 5IOWA 3C7MA 2VAFA 2R0PA 3ZREA 3KJYA 2RIIA 1OKDA 1GNWA 1ZMAA 3A2XA 2HRAA 3DD3A 1YEPA 1ZYPA 5KN0A 4Q5NA 1GULA 4CW9A 3FHKA 4EE0A 2MMOA 4TR1B 4EDZA 3FZ9A 1TK5B 2VCTA 4WF5A 5IQYA 1YEXA 1WWJA 1AXDA 4BVXB 4ZB6A 1H75A 4KAEA 4OO5A 4IELA 5J4UA 2B3SA 4XTSA 2CVKA 1YDKA 5HQPA 1PX6A 5ECPB 3S9FA 4ECIA 4V2NA 3UARA 3VK9A 5ABRA 5B7CA 3HD5A 4I97A 5IMDA 2X8CA 3H1NA 3TKSE 1N8JA 1Z9HA 2GQKA 5ECHB 2H1GA 3I69A 4NHZA 2M72A 1BG5A 4Q5QA 2YV9A 3LXTA 2CVBA 7GSSA 2VCWA 4BWSA 2K6VA 3DKSA 3HJOA 2VOCA 4L5OA 1TU8A 3HYPA 2LUSA 1XVQA 1FHEA 3QAWA 5DJLA 19GSA 3UBKA 4DEJA 1FO5A 2L6DA 5J9BA 1K0DA 4KE3A 5G1LA 3D22A 1AW9A 2NDOA 1T3BA 1G7OA 1ZGNA 1OE7A 3ERWA 1TJDA 5IOXA 2YJ7A 4TXVA 1MDJA 2PVOC 2F8FA 3MDKA 1YQ1A 2H72A 5A4UA 4MJBA 2V2GA 2GS3A 2DIYA 1I5GA 2R4VA 4BVYA 3MSZA 5JWRB 3ZZXA 3C71A 1ZYNA 4ZIJA 2I1UA 1Z3EA 2FCHA 3TKSC 2L5OA 1JHBA 1V57A 3KH7A 2YN1A 2J23A 3ZMKA 3IPZA 1M2AA 4K8MA 2C4JA 2GZYA 3CTFA 3IC4A 2E7PA 2X99A 4RUVA 5B8AA 2PUKC 2CA8A 1GUKA 4PX1A 1BYEA 4JU5A 1O8WA 2VUPA 4ECCA 1ERUA 2QA2A 1B4PA 1O7UA 3EC3A 3A5WA 1WP0A 3CYNA 1B4QA 3EWLA 3HDCA 4TR4A 1ILOA 1EP7A 2ES7A 4AGSA 4KGIA 2DJJA 1XWCA 2GQMA 1SL1B 3OR5A 2XPDA 2VCXA 4BL7A 5L71A 1TW9A 1PL1A 1TRVA 2P5RA 2WDUA 3ZL5A 4LLRA 2JSYA 4IS0A 4QL9A 2GSQA 1BJXA 2L4QA 2F9SA 3A5IA 2FWEA 4I5QA 1G7EA 4TXOB 1V9WA 1F6MC 5DQYA 4OFTA 1GUHA 1X9SB 4FO5A 4F2IA 1GTBA 3ME7A 2HRNA 5E59A 1R5PA 3TRQA 2I3YA 4BVYB 1Z6MA 2YJHA 2FWHA 4CY6A 4MDCA 3PINA 3EMPA 4LA1A 1BX9A 4KW6A 3D4MA 1F3BA 3GUSA 2JZSA 2GLRA 4GSNA 3RDWA 1SK1A 4PGTA 2H1BA 1T4YA 3KP8A 1QGVA 4ZBDA 2LRTA 3J7Yb 5DDLA 4G0KA 3R3EA 2AYTA 3PGTA 4L0WA 4YQUA 5CNWA 2WRTA 4TKYA 2QC7A 3FYGA 2FWFA 3VLNA 4YKFA 5HFIA 4WF4A 1SL2B 2FLSA 3IAS2 5ECSA 2I9HA 2WS2A 3R2QA 1U6TA 1XW9A 1TK8B 4BL7B 4XCSA 2H6ZA 2IL3A 4KF9A 3TKRA 1PRXA 1EWXA 3M3MA 2PVQA 2LNSA 1M2DA 3IRAA 1XWAA 4ICYA 4KSMA 10GSA 1QMVA 5F07A 2VL2A 4HQZA 3GX8A 4KUNA 4N30A 2B6MA 4JBBA 4D73A 2O7KA 3RBTA 2B5XA 4V2LA 1GUMA 5COHA 3CBUA 1XWGA 3GTUB 2OKAA 3E0UA 4POLA 2DBCA 3BCKA 5ECQB 1GSFA 3UL3A 4CDOA 3ZITA 2AJQB 5AIXA 2OBIA 1A0FA 3GX0A 4XIHA 2DMMA 2H70A 4WXTA 3I43A 2H8LA 1OC8A 4XRDA 2OE1A 4Z2UA 2LNTA 4PURA 1GWCA 2HZEA 3M1GA 5KN2A 3F9UA 5JCUA 3KIJA 4G19A 4ML6A 2LRNA 3PR8A 2GQLA 4F9ZA 2KOKA 3UAPA 4G10A 4X43A 1JZWA 2LQQA 2X4AA 6GSUA 4I2UA 4O32A 3VWXA 4Z2RA 4MJCA 2J9HA 3ZMLA 2FWGA 3WGDA 3GYKA 4HOJA 1ZL9A 2WB9A 4USSA 1A8LA 4NHWA 2R0CA 2YWIA 3MAKA 3DXBA 5A4WA 5IPGA 3EINA 5F05A 3GSTA 4KX4A 2CZ2A 1HNCA 3TUEA 2O85A 1R5AA 1TTZA 2H0GA 5LCZA 3F6FA 2VLTA 2HRKA 4MH2A 4ACSA 1Q4JA 3FZ4A 1GTUA 5D9VA 1HD2A 2NPBA 1NM3A 1ST9A 3KEBA 3IBHA 5IMCA 1X0RA 3F3RA 5JWOB 4D73B 1NW2A 1CQHA 1Q98A 4ZL7A 2XPEA 4V2MA 1JZRA 3LG6A 4K7OA 2OJLA 2Z9SA 1THOA 1R26A 3A2VA 5GSSA 3EU4A 3J7Yk 1IYIA 1Z7RA 1PQNA 5GZZB 1A2MA 1A2LA 4MZWA 1X5CA 4PNGA 3VFIA 1OC3A 4ZILA 1JLVA 2HZEB 3VPTA 2K9FA 4NMUA 5D9XA 1ABAA 4X1UA 4RQRA 4ZB9A 2GSTA 1H4OA 17GSA 4IJ3A 4OD7A 3HJMA 1EOHA 1XXUA 3H79A 2M46A 4H86A 3GN3A 2GZZA 2P0GA 2QSIA 4JE1A 5DAKA 4IHUA 4J57E 4HQSA 2VIMA 1MDKA 22GSA 4MZCA 4IW9A 5J9CA 2YWNA 3GL5A 2TRXA 3F0IA 4ZB8A 2JZTA 4KH7A 3TJFA 5HR0A 2E2GA 2HSHA 4BWQA 5ECIB 3QMXA 5G1KA 3HKRA 2K18A 1GSYA 1R7HA 1AC1A 5A5KA 2UZ8A 3GKXA 1BQ7A 1GSDA 4I8BA 4O5RA 5FHIA 3TGZA 4YH2A 4MNNA 2CVDA 1HQOA 3IC8A 4HDEA 4KSOA 4F0CA 3P2AA 3CMIA 2KUCA 2GT5A 2A4HA 2IPAA 3L78A 4E8EA 2AAWA 5GAPD 4O5UA 1O81A 1J08A 1TKDB 2KP1A 2YCDA 4POKA 2H73A 1SJZA 3IA1A 6GSVA 1DE1A 4KB3A 4PQ1A 5J41A 2C3NA 4Q5FA 1G0TA 3C1RA 3LYKA 1VF2A 4PTSA 3SWLA 2DMLA 1PKWA 4ZL8A 3FMWA 1SD8A 3EU3A 1G6YA 4KDUA 3EE2A 3CSHA 1JZOA 2P31A 3LEFA 2B7JA 1E2YA 4EL1A 3APOA 1ZZYA 5IM9A 1PD21 4N10A 1GLQA 2YZHA 3W6GA 5DAKB 5BMUA 3US3A 1XW6A 3TKPA 1TXXA 1XFLA 2HE3A 3PH9A 1TI1A 1EEMA 1V2AA 2DLXA 2X8GA 3TJJA 1SENA 4K2DA 2R0GA 5AGYA 1VF3A 1WIKA 3TB2A 2I81A 2PERA 1XW5A 4FH8A 2VCZA 1DUGA 2IJYA 5IO2A 4O5QA 3D0ZA 3F6DA 1SKSB 2H1DA 5JWQB 1MDIA 1EV9A 2KHPA 2LRCA 1LU4A 4GQCA 2RUEA 5DVBA 3C8EA 1K0NA 2DJ0A 4TXOA 4HI7A 4HZ2A 4HEA2 2GSRA 3HVVA 1U3IA 4JEDA 4DSSA 1JZDA 3H8QA 1HYUA 4MF7A 3VWUA 3WGXA 2GVPA 1AAZA 5G30A 1Z7PA 3WYWA 2HSMA 2RLIA 1UN2A 4IJIA 3GSSA 3QAGA 4MMMA 3CSJA 1JFUA 3DVWA 4OFNA 3ZYWA 4FQUA 3U5RE 1VF4A 2VCQA 4N0ZA 3IHGA 4O7HA 2R5GA 6GSWA 4HJMA 2CAIA 3CSIA 5CRDA 3C73A 5F0GA 4GSSA 3MIXA 3E3EA 6GSSA 1N2AA 3UVTA 5IMAA 1GTAA 1M7TA 3L0HA 2AHEA 2VL2C 1YKCA 1AUCA 1QXHA 2F8AA 2JL4A 1GRXA 2H0IA 4MPFA 3ERFA 2PMTA 1BEDA 1K0AA 3PPUA 4BA7A 3M9KA 4OFMA 3M0FA 5DQSA 3KTBA 3TRXA 2DIZA 4JRRA 4WETA 1RK4A 5B6MA 5HFGA 2ON7A 1K3LA 2DKIA 1XWKA 1X5EA 1K3YA 5D93A 2FY6A 1XOAA 5ECOB 4MABA 2IWTA 5ID2A 5H5QA 4GF0A 3KH9A 5DCGA 2GT6A 2FGXA 4F82A 2MMNA 1OYJA 2HXKA 2LJRA 5HR3A 1YKAA 1ACVA 3KTLA 2FNOA 1ERTA 4DSSB 3G7IA 1SKRB 4ML1A 5KEJA 4X4JA 4ILFA 4K2XA 4TRXA 3GTUA 1GSSA 5CP1A 4WKWA 3A2WA 2MYGA 4K7IA 2TIRA 3EPTA 4XS1A 4YQMA 2NTOA 4MCUA 3QAVA 5ENUA 4PUFC 3ZTLA 1Z5YE 5ECMB 2B7KA 1SJIA 4AJ8A 2IMFA 2FUG2 1SYXA 1QFNA 4NXIA 2GGTA 3NOFA 1ERVA 3HA9A 1E6BA 2TRCP 1NHYA 4XS6A 5FT3A 3D5JA 3BOAA 4IN0A 2GZPA 2NBSA 4MPGA 5JCWA 4N0VA 2CX4A 2X49A 4JR4A 4ULXA 2AV4A 1OAZA 2JADA 1EGOA 3F4TA 2PWJA 1TK0B 20GSA 3TCOA 2EIOA 18GSA 3HJPA 3IR4A 4EKZA 2HFDA 1WMJA 2IMKA 3KCMA 5CRGA 4A5PA 3D21A 2YOIA 2HZFA 1FB6A 3TRPA 4DSRA 4V1Ap 1TU7A 1KTEA 4ZBBA 3RHBA 3V1WA 1T8EB 4FYBA 2VLVA 3HCZA 5ID2B 4MJAA 1A0RP 3QOUA 3TJKA 1LBKA 2OE3A 1SK0A 3FRCA 3ZIVA 3KMNA 1A2JA 2WFCA 4GQFA 2E0QA 3O3TA 1K3OA 5IMZA 1XOBA 1MTCA 3WT2A 2L6CA 4K7NA 2GDRA 3L9UA 3QDNA 4HJ2A 3ZVJD 3VI7A 2XHFA 4WBJA 2BJXA 1ML6A 4WR4A 3ZIJA 2V32A 6GSYA 2LJAA 3M8NA 2OA7A 3A3TA 1XVWA 4PUAA 3ZFLA 2O8VB 4F03A 5HR2A 3KM6A 3MWHA 4TN8A 2A4VA 1GNEA 2G2QA 3RPPA 1XBSA 1X9WB 2MBSA 1B8XA 2BMXA 2X8HA 5DCHA 2LKUA 5AN1A 2GTUA 2MBTA 1TOFA 4NWYA 3O6TA 3K8NA 1WPIA 3KP9A 3WD6A 2L59A 4KA0A 1LJRA 1URMA 2PN8A 4E8HA 4K5SA 2AUVA 5C04A 4MA9A 2ZUPA 13GSA 1FB0A 1THXA 3KXOA 4O92A 3IDVA 5IMFA 3G7JA 3GKNA 2CAQA 3D6IA 1EEJA 2H76A 1R4WA 2YANA 3UMAA 1C72A 2EIRA 5ELGA 2DC5A 3F8UA 5CYYA 3WGEA 1WE0A 5BRTA 3UBLA 2C0DA 2H66A 2KP2A 3RPNA 2WGRA 5KOXA 2IMDA 4LL4B 5AIVA 1GSEA 3CXGA 4FYUA 1X9MB 4Z2TA 1M9AA 3NZNA 1ZYEA 3H4KA 1T00A 1O73A 1PX7A 1TRSA 1AQVA 3E9JB 2ON5A 4JR6A 2HI7A 2A2PA 3TOTA 5F06A 3CRUA 5KOWA 1DBYA 1MD4A 4L0UA 2P5QA 1ZOFA 4RI6A 4YAVA 5FWGA 3BD2A 5D96A 4PNFA 4MF6A 4IKHA 1VRSD 5EY6A 1EZKA 2DJKA 1FG4A 5C00A 1KNGA 2H71A 3QCPA 3GMFA 2LS5A 1J0FA 2QA1A 4TOPA 4KDXA 3I9V2 3KZQA 4KCAA 3VPQA 4ECJA 3GHAA 1KEBA 1WRYA 4MK3A 1GLPA 3UJ1A 3O76A 4ZL9A 1HNBA 5ECKB 3HY2A 3HZ4A 3UEMA 2IMIA 3CRTA 5HR1A 5KN1A 5B8BA 4QQ7A 2DJ1A 3GNJA 3EURA 5GAND 1T7PB 1USBA 3F4SA 2HYXA 2R6KA 3BJ5A 5INYA 4J2FA 4TW5A 2H01A 2LEGA 5EVOA 1U88A 4IVFA 4IGJA 3P7XA 2IFQA 2YWOA 4QL7A 4DSQA 2QGVA 3QR6A 1TRUA 2L57A 3IK7A 2VO4A 5KN3A 1GSUA 3UIWA 4EVMA 3SBCA 2YV7A 2I4AA 4GWRA 4KNDA 1S3CA 4HU7A 2XBIA 4K0NA 1ZYQB 3DEXA 4POMA 4EIPA 1NHOA 2HLSA 2L4CA 1UA5A 2VLUA 4NAXA 1F3AA 2PGTA 3AY8A 5G2ZA 2FA4A 3GV1A 3HHVA 2QKEA 3L9SA 3LXZA 3N5OA 5EPFA 1V40A 3IXRA 1M2BA 2PU9C 4GCIA 4IQAA 1PGTA 2H1AA 4POBA 4TR0A 4ZXGA 3KD0A 3BBYA 4Q5RA 2PPTA 4PQHA 8GSSA 2VL9A 4K1FA 1K0OA 2EIQA 3Q18A 2IIYA 2YP6A 2A2SA 1SD9A 1XZOA 4GLTA 3GKMA 2N5FA 5IO0A 3DWVA 1T1VA 2V1MA 4LL1B 1U87A 1XIYA 2F51A 2VM2A 6GSXA 1UC7A 3DGQA 4KCEA 3TOUA 4WEYA 3ME8A 3GIXA 3VURA 4MH3A 2MZCA 4WBRD 3L4NA 5CREA 5D8IA 3TJGA 2V6KA 3RHCA 3GL3A 2FHEA 2IFQB 5G5EA 4HU9A 4OCFA 1FAAA 1OE8A 2O89A 1IYHA 4KDYA 4HZ4A 1ERWA 4LMVA 5CRWA 1KBNA 2H19A 3FEUA 3LSZA 1ZCPA 1B9XC 4FIWA 3ZVJA 4P3YB 3LYPA 1K0BA 1FVJA 12GSA 1O85A 3ZFBA 3KMOA 2EC4A 2VL3A 2C0GA 2H0HA 3FZ5A 4OMVA 1GL8A 2C3QA 3F3QA 4G2EA 2RM6A 4IBPA 3FY7A 3NIVA 2X64A 3GKKA 2L5LA 3Q74A 3QFAC 3WT1A 2C0EA 5IPHA 2F3MA 4EO3A 1FVKA 2B1LA 3D4TA 2YZUA 5DALA 3IOSA 1GP1A 2C8UA 3FKFA 4WR5A 3IHQA 5AISA 3FR9A 1FW1A 2R3XA 5ECRB 1TP9A 4XS4A 5DBQA 1YF0A 2CT6A 4L8EA 5H5SA 3G9BA 4BPYA 2C3TA 5B6NA 5A4VA 4OCEA 5D9TA 4GXZA 2JU5A 2CV4A 1K0CA 2IN3A 2ZCTA 4OO4A 3GFKA 1TI3A 2LQOA 3IAM2 2AB6A 2R37A 2OACA 2H30A 5G5FA 2FD3A 2IMEA 1RW1A 5CO3A 1S3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3R A;  5H5R A;  1V58 A;  2RUF A;  3GUR A;  1PN9 A;  4IP1 A;  4DVC A;  3VWV A;  1JLW A;  1B9Y C;  3GH6 A;  2WCI A;  16GS A;  1A24 A;  2LJK A;  3LQ7 A;  5D73 A;  2LTK A;  4GRF A;  3M9J A;  2MMA A;  3VI5 A;  3BCI A;  4AJ6 A;  1OVN A;  1Y25 A;  2V6O A;  2H74 A;  5JCG A;  1SYR A;  1MD3 A;  4G9H A;  4K6X A;  1FOV A;  3FR6 A;  4MLY A;  4IP6 A;  1G6W A;  3UVH A;  5HFK A;  4GTU A;  1UVZ A;  4NV2 A;  3RAZ A;  1CQG A;  3IE3 A;  4TVE A;  1TRW A;  5DAL B;  2C1Y A;  1T4Z A;  3ED3 A;  3TDG A;  1V98 A;  4OWY A;  1B48 A;  1SK2 A;  3DIE A;  1EP8 A;  5D9W A;  4XS4 B;  5E4W A;  3L9V A;  4YQV A;  4EUY A;  2B1K A;  4IQ1 A;  1GTI A;  1EOG A;  4ID0 A;  1AQX A;  1YZX A;  4LMW A;  2R2J A;  2VD1 A;  3LWA A;  3DML A;  2E2M A;  1PKZ A;  4MF5 A;  3ZRD A;  4CHS A;  3TKS A;  2N5B A;  2K8V A;  4MZB A;  1DE2 A;  4L5L A;  2DSA A;  1SU9 A;  1XCC A;  2MMZ A;  3QPM A;  3N9J A;  3QD9 A;  4I6X A;  2HT9 A;  3GH9 A;  4MP4 A;  1O8X A;  4AF2 A;  1SKW B;  3LFL A;  3ISO A;  4GST A;  3DRN A;  9GSS A;  3TJB A;  3GRX A;  5J5N A;  3GA4 A;  2RM5 A;  4K0G A;  1ON4 A;  1M9B A;  5CRH A;  1S3D A;  4J56 E;  4AJ7 A;  1YF1 A;  4JZQ A;  2HNL A;  4X0X A;  3Q19 A;  2N5A A;  1OKT A;  1F9M A;  3H93 A;  2LV3 A;  1Y6E A;  1NSW A;  3IK9 A;  5F8B A;  1W4V A;  1YJ6 A;  2BTO T;  5EL8 A;  5GST A;  1XPV A;  4EXJ A;  2M80 A;  4RI7 A;  5IIZ A;  2HSY A;  1OC9 A;  2REM A;  1PL2 A;  2D2Z A;  1F37 A;  1F2E A;  5IMV A;  4I2T A;  3FZA A;  4PQI A;  1X5D A;  2ZNM A;  3HVX A;  2CQ9 A;  2OAD A;  4TR3 A;  1K0M A;  2WUL A;  1HNA A;  4K9Z A;  2H6Y A;  2XBQ A;  3DYR A;  4ISD A;  1O6J A;  1I9D A;  1VF1 A;  1AIU A;  3EYT A;  3IV4 A;  3F63 A;  11GS A;  3KGK A;  3U6V A;  1RQM A;  2DJ2 A;  3EMX A;  3MNG A;  3CTG A;  6GST A;  1W89 A;  3HXS A;  3UOM A;  1GH2 A;  1WOU A;  2LST A;  3LGC A;  4NPB A;  1PA3 A;  3C1S A;  2ALB A;  3FK8 A;  3EVI A;  4RQX A;  3TKQ A;  3FR3 A;  3APQ A;  3Q6O A;  2H75 A;  3G7Y A;  2VM1 A;  4V1A g;  1A8Y A;  2V41 A;  4XHM A;  5ECN B;  4EF0 A;  2DJ3 A;  2CX3 A;  2YPM A;  2GSS A;  3FW2 A;  2B5E A;  1EGR A;  1M99 A;  1Z6N A;  1QQ2 A;  2VCV A;  3W8S A;  1XWB A;  5DJM A;  1QK8 A;  1GSQ A;  2C80 A;  3P8W A;  2PBJ A;  1BAY A;  14GS A;  3P90 A;  3W8J A;  3LOR A;  3VWW A;  1A23 A;  3HZ8 A;  2KLX A;  4HUA A;  2OBK A;  4TR1 A;  2WZ9 A;  4EC0 A;  2OE0 A;  4Z7X A;  2XC2 A;  1J9B A;  2HRF A;  1QUW A;  1WJK A;  3ERG A;  5G31 A;  4BVX A;  1PSQ A;  3JCM L;  1YY7 A;  4FYC A;  2JSZ A;  5ECL B;  5LD0 A;  3ZLP A;  3HVS A;  1M0U A;  1OC9 B;  1DSB A;  2A2R A;  1AQW A;  5ELA A;  3I6A A;  3QFB C;  5CAX A;  3F4R A;  2YNX A;  4EDY A;  1SJ6 A;  1U3A A;  2YWM A;  4NV5 A;  2CZ3 A;  1EV4 A;  1TDI A;  4YAP A;  2O87 A;  2C0F A;  4XRA A;  1MEK A;  1VGL A;  2NVL A;  3APS A;  4N11 A;  2FA8 A;  2K8S A;  2JAC A;  4ZBA A;  4HS1 A;  4ECB A;  4PXO A;  4MJE A;  2WJU A;  2H6X A;  1SL0 B;  4F0B A;  2JZR A;  2G0F A;  1PMT A;  3LJR A;  2VD0 A;  5LNK e;  3DVX A;  2B5Y A;  5IOW A;  3C7M A;  2VAF A;  3ZRE A;  3KJY A;  2RII A;  1OKD A;  1GNW A;  1ZMA A;  3A2X A;  3DD3 A;  1YEP A;  5KN0 A;  4Q5N A;  1GUL A;  4CW9 A;  3FHK A;  4EE0 A;  2MMO A;  4TR1 B;  4EDZ A;  3FZ9 A;  1TK5 B;  2VCT A;  4WF5 A;  5IQY A;  1YEX A;  1WWJ A;  1AXD A;  4ZB6 A;  1H75 A;  4KAE A;  4OO5 A;  4IEL A;  5J4U A;  2B3S A;  4XTS A;  2CVK A;  1YDK A;  5HQP A;  1PX6 A;  5ECP B;  3S9F A;  4ECI A;  4V2N A;  3UAR A;  3VK9 A;  5ABR A;  5B7C A;  3HD5 A;  4I97 A;  5IMD A;  2X8C A;  3H1N A;  3TKS E;  1N8J A;  1Z9H A;  2GQK A;  5ECH B;  2H1G A;  3I69 A;  4NHZ A;  2M72 A;  1BG5 A;  4Q5Q A;  2YV9 A;  3LXT A;  2CVB A;  7GSS A;  2VCW A;  4BWS A;  2K6V A;  3DKS A;  3HJO A;  2VOC A;  4L5O A;  1TU8 A;  3HYP A;  2LUS A;  1XVQ A;  1FHE A;  3QAW A;  5DJL A;  19GS A;  3UBK A;  4DEJ A;  1FO5 A;  2L6D A;  5J9B A;  1K0D A;  4KE3 A;  5G1L A;  3D22 A;  1AW9 A;  2NDO A;  1T3B A;  1G7O A;  1ZGN A;  1OE7 A;  3ERW A;  1TJD A;  5IOX A;  2YJ7 A;  4TXV A;  1MDJ A;  2PVO C;  2F8F A;  3MDK A;  1YQ1 A;  2H72 A;  5A4U A;  4MJB A;  2V2G A;  2GS3 A;  2DIY A;  1I5G A;  2R4V A;  4BVY A;  3MSZ A;  5JWR B;  3ZZX A;  3C71 A;  4ZIJ A;  2I1U A;  1Z3E A;  2FCH A;  3TKS C;  2L5O A;  1JHB A;  1V57 A;  3KH7 A;  2YN1 A;  2J23 A;  3ZMK A;  3IPZ A;  1M2A A;  4K8M A;  2C4J A;  2GZY A;  3CTF A;  3IC4 A;  2E7P A;  2X99 A;  4RUV A;  5B8A A;  2PUK C;  2CA8 A;  1GUK A;  4PX1 A;  1BYE A;  4JU5 A;  1O8W A;  2VUP A;  4ECC A;  1ERU A;  1B4P A;  1O7U A;  3EC3 A;  3A5W A;  1WP0 A;  3CYN A;  1B4Q A;  3EWL A;  3HDC A;  4TR4 A;  1ILO A;  1EP7 A;  2ES7 A;  4AGS A;  4KGI A;  2DJJ A;  1XWC A;  2GQM A;  1SL1 B;  3OR5 A;  2XPD A;  2VCX A;  4BL7 A;  5L71 A;  1TW9 A;  1PL1 A;  1TRV A;  2P5R A;  2WDU A;  3ZL5 A;  4LLR A;  2JSY A;  4IS0 A;  4QL9 A;  2GSQ A;  1BJX A;  2L4Q A;  2F9S A;  2FWE A;  4I5Q A;  1G7E A;  4TXO B;  1V9W A;  1F6M C;  5DQY A;  4OFT A;  1GUH A;  1X9S B;  4FO5 A;  4F2I A;  1GTB A;  3ME7 A;  2HRN A;  5E59 A;  1R5P A;  3TRQ A;  2I3Y A;  1Z6M A;  2YJH A;  2FWH A;  4MDC A;  3PIN A;  3EMP A;  4LA1 A;  1BX9 A;  4KW6 A;  3D4M A;  1F3B A;  3GUS A;  2JZS A;  2GLR A;  4GSN A;  3RDW A;  1SK1 A;  4PGT A;  2H1B A;  1T4Y A;  3KP8 A;  1QGV A;  4ZBD A;  2LRT A;  3J7Y b;  5DDL A;  2AYT A;  3PGT A;  4L0W A;  4YQU A;  5CNW A;  2WRT A;  4TKY A;  2QC7 A;  3FYG A;  2FWF A;  3VLN A;  5HFI A;  4WF4 A;  1SL2 B;  2FLS A;  3IAS 2;  5ECS A;  2I9H A;  2WS2 A;  3R2Q A;  1U6T A;  1XW9 A;  1TK8 B;  4XCS A;  2H6Z A;  2IL3 A;  3TKR A;  1PRX A;  1EWX A;  3M3M A;  2PVQ A;  2LNS A;  1M2D A;  3IRA A;  1XWA A;  4KSM A;  10GS A;  1QMV A;  5F07 A;  2VL2 A;  4HQZ A;  3GX8 A;  4KUN A;  4N30 A;  2B6M A;  4JBB A;  4D73 A;  2O7K A;  3RBT A;  2B5X A;  4V2L A;  1GUM A;  5COH A;  3CBU A;  1XWG A;  3GTU B;  2OKA A;  3E0U A;  4POL A;  2DBC A;  3BCK A;  5ECQ B;  1GSF A;  3UL3 A;  4CDO A;  3ZIT A;  2AJQ B;  5AIX A;  2OBI A;  1A0F A;  3GX0 A;  4XIH A;  2DMM A;  2H70 A;  4WXT A;  3I43 A;  2H8L A;  1OC8 A;  4XRD A;  2OE1 A;  2LNT A;  4PUR A;  1GWC A;  2HZE A;  3M1G A;  5KN2 A;  3F9U A;  5JCU A;  3KIJ A;  4G19 A;  4ML6 A;  2LRN A;  3PR8 A;  2GQL A;  4F9Z A;  2KOK A;  3UAP A;  4G10 A;  4X43 A;  1JZW A;  2LQQ A;  6GSU A;  4I2U A;  4O32 A;  3VWX A;  4MJC A;  2J9H A;  3ZML A;  2FWG A;  3WGD A;  3GYK A;  4HOJ A;  1ZL9 A;  2WB9 A;  1A8L A;  4NHW A;  2YWI A;  3MAK A;  3DXB A;  5A4W A;  5IPG A;  3EIN A;  5F05 A;  3GST A;  4KX4 A;  2CZ2 A;  1HNC A;  3TUE A;  2O85 A;  1R5A A;  1TTZ A;  2H0G A;  5LCZ A;  3F6F A;  2VLT A;  4MH2 A;  4ACS A;  1Q4J A;  3FZ4 A;  1GTU A;  5D9V A;  1HD2 A;  2NPB A;  1NM3 A;  1ST9 A;  3KEB A;  3IBH A;  5IMC A;  1X0R A;  3F3R A;  5JWO B;  4D73 B;  1NW2 A;  1CQH A;  1Q98 A;  4ZL7 A;  2XPE A;  4V2M A;  1JZR A;  3LG6 A;  4K7O A;  2OJL A;  2Z9S A;  1THO A;  1R26 A;  3A2V A;  5GSS A;  3EU4 A;  3J7Y k;  1IYI A;  1Z7R A;  1PQN A;  5GZZ B;  1A2M A;  1A2L A;  4MZW A;  1X5C A;  4PNG A;  3VFI A;  1OC3 A;  4ZIL A;  1JLV A;  2HZE B;  3VPT A;  2K9F A;  4NMU A;  5D9X A;  1ABA A;  4X1U A;  4RQR A;  4ZB9 A;  2GST A;  1H4O A;  17GS A;  4IJ3 A;  4OD7 A;  3HJM A;  1EOH A;  1XXU A;  3H79 A;  2M46 A;  4H86 A;  3GN3 A;  2GZZ A;  2P0G A;  2QSI A;  4JE1 A;  5DAK A;  4IHU A;  4J57 E;  4HQS A;  2VIM A;  1MDK A;  22GS A;  4MZC A;  4IW9 A;  5J9C A;  2YWN A;  3GL5 A;  2TRX A;  3F0I A;  4ZB8 A;  2JZT A;  4KH7 A;  3TJF A;  5HR0 A;  2E2G A;  2HSH A;  4BWQ A;  5ECI B;  3QMX A;  5G1K A;  3HKR A;  2K18 A;  1GSY A;  1R7H A;  1AC1 A;  5A5K A;  3GKX A;  1BQ7 A;  1GSD A;  4I8B A;  4O5R A;  5FHI A;  3TGZ A;  4YH2 A;  2CVD A;  1HQO A;  4HDE A;  4KSO A;  4F0C A;  3P2A A;  3CMI A;  2KUC A;  2GT5 A;  2IPA A;  3L78 A;  4E8E A;  2AAW A;  5GAP D;  1O81 A;  1J08 A;  1TKD B;  2KP1 A;  2YCD A;  4POK A;  2H73 A;  1SJZ A;  3IA1 A;  6GSV A;  1DE1 A;  4KB3 A;  4PQ1 A;  5J41 A;  2C3N A;  4Q5F A;  1G0T A;  3C1R A;  3LYK A;  1VF2 A;  3SWL A;  2DML A;  1PKW A;  4ZL8 A;  1SD8 A;  3EU3 A;  1G6Y A;  4KDU A;  3EE2 A;  3CSH A;  1JZO A;  2P31 A;  3LEF A;  2B7J A;  1E2Y A;  4EL1 A;  3APO A;  1ZZY A;  5IM9 A;  1PD2 1;  4N10 A;  1GLQ A;  2YZH A;  3W6G A;  5DAK B;  3US3 A;  1XW6 A;  3TKP A;  1TXX A;  1XFL A;  2HE3 A;  3PH9 A;  1TI1 A;  1EEM A;  1V2A A;  2DLX A;  2X8G A;  3TJJ A;  1SEN A;  4K2D A;  5AGY A;  1VF3 A;  1WIK A;  3TB2 A;  2I81 A;  2PER A;  1XW5 A;  4FH8 A;  2VCZ A;  1DUG A;  2IJY A;  5IO2 A;  3D0Z A;  3F6D A;  1SKS B;  2H1D A;  5JWQ B;  1MDI A;  1EV9 A;  2KHP A;  2LRC A;  1LU4 A;  4GQC A;  2RUE A;  5DVB A;  3C8E A;  1K0N A;  2DJ0 A;  4TXO A;  4HI7 A;  4HZ2 A;  4HEA 2;  2GSR A;  3HVV A;  1U3I A;  4JED A;  4DSS A;  1JZD A;  3H8Q A;  1HYU A;  4MF7 A;  3VWU A;  3WGX A;  2GVP A;  1AAZ A;  5G30 A;  1Z7P A;  3WYW A;  2RLI A;  1UN2 A;  4IJI A;  3GSS A;  3QAG A;  4MMM A;  3CSJ A;  1JFU A;  3DVW A;  4OFN A;  3ZYW A;  3U5R E;  1VF4 A;  2VCQ A;  4N0Z A;  4O7H A;  2R5G A;  6GSW A;  4HJM A;  2CAI A;  3CSI A;  5CRD A;  3C73 A;  5F0G A;  4GSS A;  3E3E A;  6GSS A;  1N2A A;  3UVT A;  5IMA A;  1GTA A;  1M7T A;  3L0H A;  2AHE A;  2VL2 C;  1YKC A;  1AUC A;  1QXH A;  2F8A A;  2JL4 A;  1GRX A;  2H0I A;  4MPF A;  3ERF A;  2PMT A;  1BED A;  1K0A A;  4BA7 A;  3M9K A;  4OFM A;  3M0F A;  5DQS A;  3KTB A;  3TRX A;  2DIZ A;  4JRR A;  4WET A;  1RK4 A;  5B6M A;  5HFG A;  2ON7 A;  1K3L A;  1XWK A;  1X5E A;  1K3Y A;  5D93 A;  2FY6 A;  1XOA A;  5ECO B;  4MAB A;  2IWT A;  5ID2 A;  5H5Q A;  4GF0 A;  3KH9 A;  5DCG A;  2GT6 A;  2FGX A;  4F82 A;  2MMN A;  1OYJ A;  2HXK A;  2LJR A;  5HR3 A;  1YKA A;  1ACV A;  3KTL A;  2FNO A;  1ERT A;  4DSS B;  3G7I A;  1SKR B;  4ML1 A;  5KEJ A;  4ILF A;  4TRX A;  3GTU A;  1GSS A;  5CP1 A;  4WKW A;  3A2W A;  2MYG A;  4K7I A;  2TIR A;  4XS1 A;  4YQM A;  2NTO A;  4MCU A;  3QAV A;  5ENU A;  4PUF C;  3ZTL A;  1Z5Y E;  5ECM B;  2B7K A;  1SJI A;  4AJ8 A;  2IMF A;  2FUG 2;  1SYX A;  1QFN A;  4NXI A;  2GGT A;  3NOF A;  1ERV A;  3HA9 A;  1E6B A;  2TRC P;  1NHY A;  4XS6 A;  5FT3 A;  3D5J A;  3BOA A;  4IN0 A;  2GZP A;  2NBS A;  4MPG A;  5JCW A;  4N0V A;  2CX4 A;  4JR4 A;  4ULX A;  2AV4 A;  1OAZ A;  2JAD A;  1EGO A;  3F4T A;  2PWJ A;  1TK0 B;  20GS A;  3TCO A;  2EIO A;  18GS A;  3HJP A;  3IR4 A;  4EKZ A;  2HFD A;  1WMJ A;  2IMK A;  3KCM A;  5CRG A;  3D21 A;  2YOI A;  2HZF A;  1FB6 A;  3TRP A;  4DSR A;  4V1A p;  1TU7 A;  1KTE A;  4ZBB A;  3RHB A;  3V1W A;  1T8E B;  4FYB A;  2VLV A;  3HCZ A;  5ID2 B;  4MJA A;  1A0R P;  3QOU A;  3TJK A;  1LBK A;  2OE3 A;  1SK0 A;  3FRC A;  3ZIV A;  3KMN A;  1A2J A;  2WFC A;  4GQF A;  2E0Q A;  3O3T A;  1K3O A;  5IMZ A;  1XOB A;  1MTC A;  3WT2 A;  2L6C A;  4K7N A;  2GDR A;  3L9U A;  3QDN A;  4HJ2 A;  3ZVJ D;  3VI7 A;  2XHF A;  4WBJ A;  2BJX A;  1ML6 A;  4WR4 A;  3ZIJ A;  2V32 A;  6GSY A;  2LJA A;  3M8N A;  2OA7 A;  3A3T A;  1XVW A;  4PUA A;  3ZFL A;  2O8V B;  4F03 A;  5HR2 A;  3KM6 A;  3MWH A;  4TN8 A;  2A4V A;  1GNE A;  2G2Q A;  3RPP A;  1XBS A;  1X9W B;  2MBS A;  1B8X A;  2BMX A;  2X8H A;  5DCH A;  2LKU A;  5AN1 A;  2GTU A;  2MBT A;  1TOF A;  4NWY A;  3O6T A;  3K8N A;  1WPI A;  3KP9 A;  3WD6 A;  2L59 A;  4KA0 A;  1LJR A;  1URM A;  2PN8 A;  4E8H A;  2AUV A;  5C04 A;  4MA9 A;  2ZUP A;  13GS A;  1FB0 A;  1THX A;  3KXO A;  4O92 A;  3IDV A;  5IMF A;  3G7J A;  3GKN A;  2CAQ A;  3D6I A;  1EEJ A;  2H76 A;  1R4W A;  2YAN A;  3UMA A;  1C72 A;  2EIR A;  5ELG A;  2DC5 A;  3F8U A;  5CYY A;  3WGE A;  1WE0 A;  3UBL A;  2C0D A;  2H66 A;  2KP2 A;  3RPN A;  2WGR A;  2IMD A;  4LL4 B;  5AIV A;  1GSE A;  3CXG A;  4FYU A;  1X9M B;  1M9A A;  3NZN A;  1ZYE A;  3H4K A;  1T00 A;  1O73 A;  1PX7 A;  1TRS A;  1AQV A;  3E9J B;  2ON5 A;  4JR6 A;  2HI7 A;  3TOT A;  5F06 A;  3CRU A;  1DBY A;  1MD4 A;  4L0U A;  2P5Q A;  1ZOF A;  4RI6 A;  4YAV A;  5FWG A;  3BD2 A;  5D96 A;  4PNF A;  4MF6 A;  4IKH A;  1VRS D;  5EY6 A;  1EZK A;  2DJK A;  1FG4 A;  5C00 A;  1KNG A;  2H71 A;  3QCP A;  3GMF A;  2LS5 A;  1J0F A;  4TOP A;  4KDX A;  3I9V 2;  3KZQ A;  4KCA A;  3VPQ A;  4ECJ A;  3GHA A;  1KEB A;  1WRY A;  4MK3 A;  1GLP A;  3UJ1 A;  3O76 A;  4ZL9 A;  1HNB A;  5ECK B;  3HY2 A;  3HZ4 A;  3UEM A;  2IMI A;  3CRT A;  5HR1 A;  5KN1 A;  5B8B A;  4QQ7 A;  2DJ1 A;  3GNJ A;  3EUR A;  5GAN D;  1T7P B;  1USB A;  3F4S A;  2HYX A;  2R6K A;  3BJ5 A;  5INY A;  4J2F A;  4TW5 A;  2H01 A;  2LEG A;  5EVO A;  1U88 A;  4IVF A;  4IGJ A;  3P7X A;  2IFQ A;  2YWO A;  4QL7 A;  4DSQ A;  2QGV A;  3QR6 A;  1TRU A;  2L57 A;  3IK7 A;  2VO4 A;  5KN3 A;  1GSU A;  3UIW A;  4EVM A;  3SBC A;  2YV7 A;  2I4A A;  4GWR A;  4KND A;  1S3C A;  4HU7 A;  2XBI A;  4K0N A;  1ZYQ B;  3DEX A;  4POM A;  1NHO A;  2HLS A;  2L4C A;  1UA5 A;  2VLU A;  4NAX A;  1F3A A;  2PGT A;  3AY8 A;  5G2Z A;  2FA4 A;  3GV1 A;  3HHV A;  2QKE A;  3L9S A;  3LXZ A;  3N5O A;  5EPF A;  1V40 A;  3IXR A;  1M2B A;  2PU9 C;  4GCI A;  4IQA A;  1PGT A;  2H1A A;  4POB A;  4TR0 A;  4ZXG A;  3KD0 A;  3BBY A;  4Q5R A;  2PPT A;  4PQH A;  8GSS A;  2VL9 A;  4K1F A;  1K0O A;  2EIQ A;  3Q18 A;  2IIY A;  2YP6 A;  2A2S A;  1SD9 A;  1XZO A;  4GLT A;  3GKM A;  2N5F A;  5IO0 A;  3DWV A;  1T1V A;  2V1M A;  4LL1 B;  1U87 A;  1XIY A;  2F51 A;  2VM2 A;  6GSX A;  1UC7 A;  3DGQ A;  4KCE A;  3TOU A;  4WEY A;  3ME8 A;  3GIX A;  3VUR A;  4MH3 A;  2MZC A;  4WBR D;  3L4N A;  5CRE A;  5D8I A;  3TJG A;  2V6K A;  3RHC A;  3GL3 A;  2FHE A;  2IFQ B;  5G5E A;  4HU9 A;  4OCF A;  1FAA A;  1OE8 A;  2O89 A;  1IYH A;  4KDY A;  4HZ4 A;  1ERW A;  4LMV A;  5CRW A;  1KBN A;  2H19 A;  3FEU A;  3LSZ A;  1ZCP A;  1B9X C;  4FIW A;  3ZVJ A;  4P3Y B;  3LYP A;  1K0B A;  1FVJ A;  12GS A;  1O85 A;  3ZFB A;  3KMO A;  2EC4 A;  2VL3 A;  2C0G A;  2H0H A;  3FZ5 A;  4OMV A;  1GL8 A;  2C3Q A;  3F3Q A;  4G2E A;  2RM6 A;  4IBP A;  3FY7 A;  3NIV A;  2X64 A;  3GKK A;  2L5L A;  3Q74 A;  3QFA C;  3WT1 A;  2C0E A;  5IPH A;  2F3M A;  4EO3 A;  1FVK A;  2B1L A;  3D4T A;  2YZU A;  5DAL A;  3IOS A;  1GP1 A;  2C8U A;  3FKF A;  4WR5 A;  3IHQ A;  5AIS A;  3FR9 A;  1FW1 A;  2R3X A;  5ECR B;  1TP9 A;  4XS4 A;  5DBQ A;  1YF0 A;  2CT6 A;  4L8E A;  5H5S A;  3G9B A;  4BPY A;  2C3T A;  5B6N A;  5A4V A;  4OCE A;  5D9T A;  4GXZ A;  2JU5 A;  2CV4 A;  1K0C A;  2IN3 A;  2ZCT A;  4OO4 A;  3GFK A;  1TI3 A;  2LQO A;  3IAM 2;  2AB6 A;  2R37 A;  2OAC A;  2H30 A;  5G5F A;  2FD3 A;  2IME A;  1RW1 A;  5CO3 A;  1S3A A; 
#chains in the Genus database with same CATH topology
 5J3R A;  5H5R A;  1V58 A;  2RUF A;  3GUR A;  1PN9 A;  4IP1 A;  4DVC A;  3VWV A;  1JLW A;  1B9Y C;  1PN0 A;  3GH6 A;  2WCI A;  16GS A;  1A24 A;  2LJK A;  3LQ7 A;  5D73 A;  2LTK A;  4GRF A;  1M3I A;  3M9J A;  2MMA A;  3VI5 A;  3BCI A;  4AJ6 A;  1OVN A;  1Y25 A;  2V6O A;  2H74 A;  5JCG A;  1SYR A;  1MD3 A;  4G9H A;  4K6X A;  1FOV A;  4EIQ A;  3FR6 A;  4MLY A;  4IP6 A;  1G6W A;  3UVH A;  5HFK A;  4GTU A;  1UVZ A;  4NV2 A;  3RAZ A;  1CQG A;  3IE3 A;  4TVE A;  1TRW A;  1FOH A;  5DAL B;  2C1Y A;  1T4Z A;  3ED3 A;  3TDG A;  1V98 A;  4OWY A;  1B48 A;  1SK2 A;  3DIE A;  1EP8 A;  5D9W A;  4XS4 B;  5E4W A;  3L9V A;  4YQV A;  4EUY A;  2B1K A;  4IQ1 A;  1GTI A;  1EOG A;  4ID0 A;  1AQX A;  1YZX A;  4LMW A;  2R2J A;  2VD1 A;  3LWA A;  3DML A;  2E2M A;  1PKZ A;  4MF5 A;  3ZRD A;  4CHS A;  3TKS A;  2N5B A;  2K8V A;  4MZB A;  1DE2 A;  4L5L A;  2DSA A;  1SU9 A;  1XCC A;  2MMZ A;  3QPM A;  3N9J A;  3QD9 A;  4I6X A;  2HT9 A;  3GH9 A;  4MP4 A;  1O8X A;  4AF2 A;  1SKW B;  3LFL A;  3ISO A;  4GST A;  3DRN A;  9GSS A;  3TJB A;  3GRX A;  5J5N A;  3GA4 A;  2RM5 A;  4K0G A;  1ON4 A;  4G0L A;  1M9B A;  5CRH A;  1S3D A;  4J56 E;  4AJ7 A;  1YF1 A;  4JZQ A;  2HNL A;  4X0X A;  3Q19 A;  2N5A A;  1OKT A;  1F9M A;  3H93 A;  2LV3 A;  1Y6E A;  1NSW A;  3IK9 A;  5F8B A;  1W4V A;  1YJ6 A;  2BTO T;  5EL8 A;  5GST A;  1XPV A;  4EXJ A;  2M80 A;  4RI7 A;  5IIZ A;  2HSY A;  1OC9 A;  2REM A;  1PL2 A;  2D2Z A;  1F37 A;  1F2E A;  5IMV A;  4I2T A;  3FZA A;  4PQI A;  1X5D A;  2ZNM A;  3HVX A;  2CQ9 A;  2OAD A;  4TR3 A;  1K0M A;  2WUL A;  1HNA A;  4K9Z A;  2H6Y A;  2XBQ A;  3DYR A;  4ISD A;  1O6J A;  1I9D A;  1VF1 A;  1AIU A;  3EYT A;  3IV4 A;  3F63 A;  11GS A;  3KGK A;  3U6V A;  1RQM A;  2DJ2 A;  3EMX A;  3MNG A;  3CTG A;  6GST A;  1W89 A;  3HXS A;  3UOM A;  1GH2 A;  1WOU A;  2LST A;  3LGC A;  4NPB A;  1PA3 A;  3C1S A;  2ALB A;  3FK8 A;  3EVI A;  4RQX A;  3TKQ A;  3FR3 A;  3APQ A;  3Q6O A;  2H75 A;  3G7Y A;  2VM1 A;  4V1A g;  1A8Y A;  2V41 A;  4XHM A;  5ECN B;  4EF0 A;  2DJ3 A;  2CX3 A;  2YPM A;  2GSS A;  3FW2 A;  2B5E A;  1EGR A;  1M99 A;  1Z6N A;  1QQ2 A;  2VCV A;  3W8S A;  1XWB A;  5DJM A;  1QK8 A;  1GSQ A;  2C80 A;  3P8W A;  2PBJ A;  1BAY A;  14GS A;  3P90 A;  3W8J A;  3LOR A;  3VWW A;  1A23 A;  3HZ8 A;  2KLX A;  4HUA A;  2OBK A;  4TR1 A;  4YKG A;  2WZ9 A;  4EC0 A;  2OE0 A;  4Z7X A;  2XC2 A;  1J9B A;  2HRF A;  1QUW A;  1WJK A;  3ERG A;  5G31 A;  4BVX A;  1PSQ A;  3JCM L;  1YY7 A;  4FYC A;  2JSZ A;  5ECL B;  5LD0 A;  3ZLP A;  3HVS A;  1M0U A;  1OC9 B;  1DSB A;  2A2R A;  1AQW A;  3LW9 A;  5ELA A;  4CY8 A;  3I6A A;  3QFB C;  5CAX A;  3F4R A;  2YNX A;  4EDY A;  1SJ6 A;  1U3A A;  2YWM A;  4NV5 A;  2CZ3 A;  1EV4 A;  1TDI A;  4YAP A;  2O87 A;  2C0F A;  4XRA A;  1MEK A;  1VGL A;  2NVL A;  3APS A;  4N11 A;  2FA8 A;  2K8S A;  2JAC A;  4ZBA A;  4HS1 A;  4K5R A;  1S3R A;  4ECB A;  4PXO A;  4MJE A;  4G0I A;  2WJU A;  2DKH A;  2H6X A;  1SL0 B;  4F0B A;  2JZR A;  2G0F A;  1PMT A;  3LJR A;  2VD0 A;  5LNK e;  1XG8 A;  3DVX A;  2B5Y A;  3MYD A;  5IOW A;  3C7M A;  2VAF A;  2R0P A;  3ZRE A;  3KJY A;  2RII A;  1OKD A;  1GNW A;  1ZMA A;  3A2X A;  2HRA A;  3DD3 A;  1YEP A;  1ZYP A;  5KN0 A;  4Q5N A;  1GUL A;  4CW9 A;  3FHK A;  4EE0 A;  2MMO A;  4TR1 B;  4EDZ A;  3FZ9 A;  1TK5 B;  2VCT A;  4WF5 A;  5IQY A;  1YEX A;  1WWJ A;  1AXD A;  4BVX B;  4ZB6 A;  1H75 A;  4KAE A;  4OO5 A;  4IEL A;  5J4U A;  2B3S A;  4XTS A;  2CVK A;  1YDK A;  5HQP A;  1PX6 A;  5ECP B;  3S9F A;  4ECI A;  4V2N A;  3UAR A;  3VK9 A;  5ABR A;  5B7C A;  3HD5 A;  4I97 A;  5IMD A;  2X8C A;  3H1N A;  3TKS E;  1N8J A;  1Z9H A;  2GQK A;  5ECH B;  2H1G A;  3I69 A;  4NHZ A;  2M72 A;  1BG5 A;  4Q5Q A;  2YV9 A;  3LXT A;  2CVB A;  7GSS A;  2VCW A;  4BWS A;  2K6V A;  3DKS A;  3HJO A;  3CQF A;  2VOC A;  4L5O A;  1TU8 A;  3HYP A;  2LUS A;  1XVQ A;  1FHE A;  3QAW A;  5DJL A;  19GS A;  3UBK A;  4DEJ A;  1FO5 A;  2L6D A;  5J9B A;  1K0D A;  4KE3 A;  5G1L A;  3D22 A;  1AW9 A;  2NDO A;  1T3B A;  1G7O A;  1ZGN A;  1OE7 A;  3ERW A;  1TJD A;  5IOX A;  2YJ7 A;  4TXV A;  1MDJ A;  2PVO C;  2F8F A;  3MDK A;  1YQ1 A;  2H72 A;  5A4U A;  4MJB A;  2V2G A;  2GS3 A;  2DIY A;  1I5G A;  2R4V A;  4BVY A;  3MSZ A;  5JWR B;  3ZZX A;  3C71 A;  1ZYN A;  4ZIJ A;  2I1U A;  1Z3E A;  2FCH A;  3TKS C;  2L5O A;  1JHB A;  1V57 A;  3KH7 A;  2YN1 A;  2J23 A;  3ZMK A;  3IPZ A;  1M2A A;  4K8M A;  2C4J A;  2GZY A;  3CTF A;  3IC4 A;  2E7P A;  2X99 A;  4RUV A;  5B8A A;  2PUK C;  2CA8 A;  1GUK A;  4PX1 A;  1BYE A;  4JU5 A;  1O8W A;  2VUP A;  4ECC A;  1ERU A;  2QA2 A;  1B4P A;  1O7U A;  3EC3 A;  3A5W A;  1WP0 A;  3CYN A;  1B4Q A;  3EWL A;  3HDC A;  4TR4 A;  1ILO A;  1EP7 A;  2ES7 A;  4AGS A;  4KGI A;  2DJJ A;  1XWC A;  2GQM A;  1SL1 B;  3OR5 A;  2XPD A;  2VCX A;  4BL7 A;  5L71 A;  1TW9 A;  1PL1 A;  1TRV A;  2P5R A;  2WDU A;  3ZL5 A;  4LLR A;  2JSY A;  4IS0 A;  4QL9 A;  2GSQ A;  1BJX A;  2L4Q A;  2F9S A;  3A5I A;  2FWE A;  4I5Q A;  1G7E A;  4TXO B;  1V9W A;  1F6M C;  5DQY A;  4OFT A;  1GUH A;  1X9S B;  4FO5 A;  4F2I A;  1GTB A;  3ME7 A;  2HRN A;  5E59 A;  1R5P A;  3TRQ A;  2I3Y A;  4BVY B;  1Z6M A;  2YJH A;  2FWH A;  4CY6 A;  4MDC A;  3PIN A;  3EMP A;  4LA1 A;  1BX9 A;  4KW6 A;  3D4M A;  1F3B A;  3GUS A;  4BIK A;  2JZS A;  2GLR A;  4GSN A;  3RDW A;  1SK1 A;  4PGT A;  2H1B A;  1T4Y A;  3KP8 A;  1QGV A;  4ZBD A;  2LRT A;  3J7Y b;  5DDL A;  4G0K A;  3R3E A;  2AYT A;  3PGT A;  4L0W A;  4YQU A;  5CNW A;  2WRT A;  4TKY A;  2QC7 A;  3FYG A;  2FWF A;  3VLN A;  4YKF A;  5HFI A;  4WF4 A;  1SL2 B;  2FLS A;  3IAS 2;  5ECS A;  2I9H A;  2WS2 A;  3R2Q A;  1U6T A;  1XW9 A;  1TK8 B;  4BL7 B;  4XCS A;  2H6Z A;  2IL3 A;  4KF9 A;  3TKR A;  1PRX A;  1EWX A;  3M3M A;  2PVQ A;  2LNS A;  1M2D A;  3IRA A;  1XWA A;  4ICY A;  4KSM A;  10GS A;  1QMV A;  5F07 A;  2VL2 A;  4HQZ A;  3GX8 A;  4KUN A;  4N30 A;  2B6M A;  4JBB A;  4D73 A;  2O7K A;  3RBT A;  2B5X A;  4V2L A;  1GUM A;  5COH A;  3CBU A;  1XWG A;  3GTU B;  2OKA A;  3E0U A;  4POL A;  2DBC A;  3BCK A;  5ECQ B;  1GSF A;  3UL3 A;  4CDO A;  3ZIT A;  2AJQ B;  5AIX A;  2OBI A;  1A0F A;  3GX0 A;  4XIH A;  2DMM A;  2H70 A;  4WXT A;  3I43 A;  1M3J A;  1OC8 A;  2H8L A;  4XRD A;  2OE1 A;  4Z2U A;  2LNT A;  4PUR A;  1GWC A;  2HZE A;  3M1G A;  5KN2 A;  3F9U A;  5JCU A;  3KIJ A;  4G19 A;  4ML6 A;  2LRN A;  3PR8 A;  2GQL A;  4F9Z A;  2KOK A;  3UAP A;  4G10 A;  4X43 A;  1JZW A;  2LQQ A;  2X4A A;  6GSU A;  4I2U A;  4O32 A;  3VWX A;  4Z2R A;  4MJC A;  2J9H A;  3ZML A;  2FWG A;  3WGD A;  3GYK A;  4HOJ A;  1ZL9 A;  2WB9 A;  4USS A;  1A8L A;  4NHW A;  2R0C A;  2YWI A;  3MAK A;  3DXB A;  5A4W A;  5IPG A;  3EIN A;  5F05 A;  3GST A;  4KX4 A;  2CZ2 A;  1HNC A;  3TUE A;  2O85 A;  1R5A A;  1TTZ A;  2H0G A;  5LCZ A;  3F6F A;  2VLT A;  2HRK A;  4MH2 A;  4ACS A;  1Q4J A;  3FZ4 A;  1GTU A;  5D9V A;  4HSC X;  1HD2 A;  2NPB A;  1NM3 A;  1ST9 A;  3KEB A;  3IBH A;  5IMC A;  1X0R A;  3F3R A;  5JWO B;  4D73 B;  1NW2 A;  1CQH A;  1Q98 A;  4ZL7 A;  2XPE A;  4V2M A;  1JZR A;  3LG6 A;  4K7O A;  2OJL A;  2Z9S A;  1THO A;  1R26 A;  3A2V A;  5GSS A;  3EU4 A;  3J7Y k;  1IYI A;  1Z7R A;  1PQN A;  5GZZ B;  1A2M A;  1A2L A;  4MZW A;  1X5C A;  4PNG A;  3VFI A;  1OC3 A;  4ZIL A;  1JLV A;  2HZE B;  3VPT A;  2K9F A;  4NMU A;  5D9X A;  1ABA A;  4X1U A;  4RQR A;  4ZB9 A;  2GST A;  1H4O A;  17GS A;  4IJ3 A;  4OD7 A;  3HJM A;  1EOH A;  1XXU A;  3H79 A;  2M46 A;  4H86 A;  3GN3 A;  2GZZ A;  2P0G A;  2QSI A;  4JE1 A;  5DAK A;  4IHU A;  4J57 E;  4HQS A;  2VIM A;  1MDK A;  22GS A;  4MZC A;  4IW9 A;  5J9C A;  2YWN A;  3GL5 A;  2TRX A;  3F0I A;  4ZB8 A;  2JZT A;  4KH7 A;  3TJF A;  5HR0 A;  2E2G A;  2HSH A;  4BWQ A;  5ECI B;  3QMX A;  5G1K A;  3HKR A;  2K18 A;  1GSY A;  1R7H A;  1AC1 A;  5A5K A;  2UZ8 A;  3GKX A;  1BQ7 A;  1GSD A;  4I8B A;  4O5R A;  5FHI A;  3TGZ A;  4YH2 A;  4MNN A;  2CVD A;  1HQO A;  3IC8 A;  4HDE A;  4KSO A;  4F0C A;  3P2A A;  3CMI A;  2KUC A;  2GT5 A;  2A4H A;  2IPA A;  3L78 A;  4E8E A;  2AAW A;  5GAP D;  4O5U A;  1O81 A;  1J08 A;  1TKD B;  2KP1 A;  2YCD A;  4POK A;  2H73 A;  1SJZ A;  3IA1 A;  6GSV A;  1DE1 A;  4KB3 A;  4PQ1 A;  5J41 A;  2C3N A;  4Q5F A;  1G0T A;  3C1R A;  3LYK A;  1VF2 A;  4PTS A;  3SWL A;  2DML A;  1PKW A;  4ZL8 A;  3FMW A;  1SD8 A;  3EU3 A;  1G6Y A;  4KDU A;  3EE2 A;  3CSH A;  1JZO A;  2P31 A;  3LEF A;  2B7J A;  1E2Y A;  4EL1 A;  3APO A;  1ZZY A;  5IM9 A;  1PD2 1;  4N10 A;  1GLQ A;  2YZH A;  3W6G A;  5DAK B;  5BMU A;  3US3 A;  1XW6 A;  3TKP A;  1TXX A;  1XFL A;  2HE3 A;  3PH9 A;  1TI1 A;  1EEM A;  1V2A A;  2DLX A;  2X8G A;  3TJJ A;  1SEN A;  4K2D A;  3HVN A;  2R0G A;  5AGY A;  1VF3 A;  1WIK A;  3TB2 A;  1PFO A;  2I81 A;  2PER A;  1XW5 A;  4FH8 A;  2VCZ A;  1DUG A;  2IJY A;  5IO2 A;  4O5Q A;  3D0Z A;  3F6D A;  1SKS B;  2H1D A;  5JWQ B;  1MDI A;  1EV9 A;  2KHP A;  2LRC A;  1LU4 A;  4GQC A;  2RUE A;  5DVB A;  3C8E A;  1K0N A;  2DJ0 A;  4TXO A;  4HI7 A;  4HZ2 A;  4HEA 2;  2GSR A;  3HVV A;  1U3I A;  4JED A;  4DSS A;  1JZD A;  3H8Q A;  1HYU A;  4MF7 A;  3VWU A;  3WGX A;  2GVP A;  1AAZ A;  5G30 A;  1Z7P A;  3WYW A;  2HSM A;  2RLI A;  1UN2 A;  4IJI A;  3GSS A;  3QAG A;  4MMM A;  3CSJ A;  1JFU A;  3DVW A;  4OFN A;  3ZYW A;  4FQU A;  3U5R E;  1VF4 A;  2VCQ A;  4N0Z A;  3IHG A;  4O7H A;  2R5G A;  6GSW A;  4HJM A;  2CAI A;  3CSI A;  5CRD A;  3C73 A;  5F0G A;  4GSS A;  3MIX A;  3E3E A;  6GSS A;  1N2A A;  3UVT A;  5IMA A;  1GTA A;  1M7T A;  3L0H A;  2AHE A;  2VL2 C;  1YKC A;  1AUC A;  1QXH A;  2F8A A;  2JL4 A;  1GRX A;  2H0I A;  4MPF A;  3ERF A;  2PMT A;  1BED A;  1K0A A;  3PPU A;  4BA7 A;  3M9K A;  4OFM A;  3M0F A;  5DQS A;  3KTB A;  3TRX A;  2DIZ A;  4JRR A;  4WET A;  1RK4 A;  5B6M A;  5HFG A;  2ON7 A;  1K3L A;  2DKI A;  1XWK A;  1X5E A;  1K3Y A;  5D93 A;  2FY6 A;  1XOA A;  5ECO B;  4MAB A;  2IWT A;  5ID2 A;  5H5Q A;  4GF0 A;  3KH9 A;  5DCG A;  2GT6 A;  2FGX A;  4F82 A;  2MMN A;  1OYJ A;  2HXK A;  2LJR A;  5HR3 A;  1YKA A;  1ACV A;  3KTL A;  2FNO A;  1ERT A;  4DSS B;  3G7I A;  1SKR B;  4ML1 A;  5KEJ A;  4X4J A;  4ILF A;  4K2X A;  4TRX A;  3GTU A;  1GSS A;  5CP1 A;  4WKW A;  3A2W A;  2MYG A;  4K7I A;  2TIR A;  3EPT A;  4XS1 A;  4YQM A;  2NTO A;  4MCU A;  3QAV A;  5ENU A;  4PUF C;  3ZTL A;  1Z5Y E;  5ECM B;  2B7K A;  1SJI A;  4AJ8 A;  2IMF A;  2FUG 2;  1SYX A;  1QFN A;  4NXI A;  2GGT A;  3NOF A;  1ERV A;  3HA9 A;  1E6B A;  2TRC P;  1NHY A;  4XS6 A;  5FT3 A;  3D5J A;  3BOA A;  4IN0 A;  2GZP A;  2NBS A;  4MPG A;  5JCW A;  4N0V A;  2CX4 A;  2X49 A;  4JR4 A;  4ULX A;  2AV4 A;  1OAZ A;  2JAD A;  1EGO A;  3F4T A;  2PWJ A;  1TK0 B;  20GS A;  3TCO A;  2EIO A;  18GS A;  3HJP A;  3IR4 A;  4EKZ A;  2HFD A;  1WMJ A;  2IMK A;  3KCM A;  5CRG A;  4A5P A;  3D21 A;  2YOI A;  2HZF A;  1FB6 A;  3TRP A;  4DSR A;  4V1A p;  1TU7 A;  1KTE A;  4ZBB A;  3RHB A;  3V1W A;  1T8E B;  4FYB A;  2VLV A;  3HCZ A;  5ID2 B;  4MJA A;  1A0R P;  3QOU A;  3TJK A;  1LBK A;  2OE3 A;  1SK0 A;  3FRC A;  3ZIV A;  3KMN A;  1A2J A;  2WFC A;  4GQF A;  2E0Q A;  3O3T A;  1K3O A;  5IMZ A;  1XOB A;  1MTC A;  3WT2 A;  2L6C A;  4K7N A;  2GDR A;  3L9U A;  3QDN A;  4HJ2 A;  3ZVJ D;  3VI7 A;  2XHF A;  4WBJ A;  2BJX A;  1ML6 A;  4WR4 A;  3ZIJ A;  2V32 A;  6GSY A;  2LJA A;  3M8N A;  2OA7 A;  3A3T A;  1XVW A;  4PUA A;  3ZFL A;  2O8V B;  4F03 A;  5HR2 A;  3KM6 A;  3MWH A;  4TN8 A;  2A4V A;  1GNE A;  2G2Q A;  3RPP A;  1XBS A;  1X9W B;  2MBS A;  1B8X A;  2BMX A;  2X8H A;  5DCH A;  2LKU A;  5AN1 A;  2GTU A;  2MBT A;  1TOF A;  4NWY A;  3O6T A;  3K8N A;  1WPI A;  3KP9 A;  3WD6 A;  2L59 A;  4KA0 A;  1LJR A;  1URM A;  2PN8 A;  4E8H A;  4K5S A;  2AUV A;  5C04 A;  4MA9 A;  2ZUP A;  13GS A;  1FB0 A;  1THX A;  3KXO A;  4O92 A;  3IDV A;  5IMF A;  3G7J A;  3GKN A;  2CAQ A;  3D6I A;  1EEJ A;  2H76 A;  1R4W A;  2YAN A;  3UMA A;  1C72 A;  2EIR A;  5ELG A;  2DC5 A;  3F8U A;  5CYY A;  3WGE A;  1WE0 A;  5BRT A;  3UBL A;  2C0D A;  2H66 A;  2KP2 A;  3RPN A;  2WGR A;  5KOX A;  2IMD A;  4LL4 B;  5AIV A;  1GSE A;  3CXG A;  4FYU A;  1X9M B;  4Z2T A;  1M9A A;  3NZN A;  1ZYE A;  3H4K A;  1T00 A;  1O73 A;  1PX7 A;  1TRS A;  1AQV A;  3E9J B;  2ON5 A;  4JR6 A;  2HI7 A;  2A2P A;  3TOT A;  5F06 A;  3CRU A;  5KOW A;  1DBY A;  1MD4 A;  4L0U A;  2P5Q A;  1ZOF A;  4RI6 A;  4YAV A;  5FWG A;  3BD2 A;  5D96 A;  4PNF A;  4MF6 A;  4IKH A;  1VRS D;  5EY6 A;  1EZK A;  2DJK A;  1FG4 A;  5C00 A;  1KNG A;  2H71 A;  3QCP A;  3GMF A;  2LS5 A;  1J0F A;  2QA1 A;  4TOP A;  4KDX A;  3I9V 2;  3KZQ A;  4KCA A;  3VPQ A;  4ECJ A;  3GHA A;  1KEB A;  1WRY A;  4MK3 A;  1GLP A;  3UJ1 A;  3O76 A;  4ZL9 A;  1HNB A;  5ECK B;  3HY2 A;  3HZ4 A;  3UEM A;  2IMI A;  3CRT A;  5HR1 A;  5KN1 A;  5B8B A;  4QQ7 A;  2DJ1 A;  3GNJ A;  3EUR A;  5GAN D;  1T7P B;  1USB A;  3F4S A;  2HYX A;  2R6K A;  3BJ5 A;  5INY A;  4J2F A;  4TW5 A;  2H01 A;  2LEG A;  5EVO A;  1U88 A;  4IVF A;  4IGJ A;  3P7X A;  2IFQ A;  2YWO A;  4QL7 A;  4DSQ A;  2QGV A;  3QR6 A;  1TRU A;  2L57 A;  3IK7 A;  2VO4 A;  5KN3 A;  1GSU A;  3UIW A;  4EVM A;  3SBC A;  2YV7 A;  2I4A A;  4GWR A;  4KND A;  1S3C A;  4HU7 A;  2XBI A;  4K0N A;  1ZYQ B;  3DEX A;  4POM A;  4EIP A;  1NHO A;  2HLS A;  2L4C A;  1UA5 A;  2VLU A;  4NAX A;  1F3A A;  2PGT A;  3AY8 A;  5G2Z A;  2FA4 A;  3GV1 A;  3HHV A;  2QKE A;  3L9S A;  3LXZ A;  3N5O A;  5EPF A;  1V40 A;  3IXR A;  1M2B A;  2PU9 C;  4GCI A;  4IQA A;  1PGT A;  2H1A A;  4POB A;  4TR0 A;  4ZXG A;  3KD0 A;  3BBY A;  4Q5R A;  2PPT A;  4PQH A;  8GSS A;  2VL9 A;  4K1F A;  1K0O A;  2EIQ A;  3Q18 A;  2IIY A;  2YP6 A;  2A2S A;  1SD9 A;  1XZO A;  4GLT A;  3GKM A;  2N5F A;  5IO0 A;  3DWV A;  1T1V A;  2V1M A;  4LL1 B;  1U87 A;  1XIY A;  2F51 A;  2VM2 A;  6GSX A;  1UC7 A;  3DGQ A;  4KCE A;  3TOU A;  4WEY A;  3ME8 A;  3GIX A;  3VUR A;  4MH3 A;  2MZC A;  4WBR D;  3L4N A;  5CRE A;  5D8I A;  3TJG A;  2V6K A;  3RHC A;  3GL3 A;  2FHE A;  2IFQ B;  5G5E A;  4HU9 A;  4OCF A;  1FAA A;  1OE8 A;  2O89 A;  1IYH A;  4KDY A;  4HZ4 A;  1ERW A;  4LMV A;  5CRW A;  1KBN A;  2H19 A;  3FEU A;  3LSZ A;  1ZCP A;  1B9X C;  4FIW A;  3ZVJ A;  4P3Y B;  3LYP A;  1K0B A;  1FVJ A;  12GS A;  1O85 A;  3ZFB A;  3KMO A;  2EC4 A;  2VL3 A;  2C0G A;  2H0H A;  3FZ5 A;  4OMV A;  1GL8 A;  2C3Q A;  3F3Q A;  4G2E A;  2RM6 A;  4IBP A;  3FY7 A;  3NIV A;  2X64 A;  3GKK A;  2L5L A;  3Q74 A;  3QFA C;  3WT1 A;  2C0E A;  5IPH A;  2F3M A;  4EO3 A;  1FVK A;  2B1L A;  3D4T A;  2YZU A;  5DAL A;  3IOS A;  1GP1 A;  2C8U A;  3FKF A;  4WR5 A;  3IHQ A;  5AIS A;  3FR9 A;  1FW1 A;  2R3X A;  5ECR B;  1TP9 A;  4XS4 A;  5DBQ A;  1YF0 A;  2CT6 A;  4L8E A;  5H5S A;  3G9B A;  4BPY A;  2C3T A;  5B6N A;  5A4V A;  4OCE A;  5D9T A;  4GXZ A;  2JU5 A;  2CV4 A;  1K0C A;  2IN3 A;  2ZCT A;  4OO4 A;  3GFK A;  1TI3 A;  2LQO A;  3IAM 2;  2AB6 A;  2R37 A;  2OAC A;  2H30 A;  5G5F A;  2FD3 A;  2IME A;  1RW1 A;  5CO3 A;  1S3A A; 
#chains in the Genus database with same CATH homology
 5J3R A;  5H5R A;  1V58 A;  2RUF A;  3GUR A;  1PN9 A;  4IP1 A;  4DVC A;  3VWV A;  1JLW A;  1B9Y C;  1PN0 A;  3GH6 A;  2WCI A;  16GS A;  1A24 A;  2LJK A;  3LQ7 A;  5D73 A;  2LTK A;  4GRF A;  3M9J A;  2MMA A;  3VI5 A;  3BCI A;  4AJ6 A;  1OVN A;  1Y25 A;  2V6O A;  2H74 A;  5JCG A;  1SYR A;  1MD3 A;  4G9H A;  4K6X A;  1FOV A;  4EIQ A;  3FR6 A;  4MLY A;  4IP6 A;  1G6W A;  3UVH A;  5HFK A;  4GTU A;  1UVZ A;  4NV2 A;  3RAZ A;  1CQG A;  3IE3 A;  4TVE A;  1TRW A;  1FOH A;  5DAL B;  2C1Y A;  1T4Z A;  3ED3 A;  3TDG A;  1V98 A;  4OWY A;  1B48 A;  1SK2 A;  3DIE A;  1EP8 A;  5D9W A;  4XS4 B;  5E4W A;  3L9V A;  4YQV A;  4EUY A;  2B1K A;  4IQ1 A;  1GTI A;  1EOG A;  4ID0 A;  1AQX A;  1YZX A;  4LMW A;  2R2J A;  2VD1 A;  3LWA A;  3DML A;  2E2M A;  1PKZ A;  4MF5 A;  3ZRD A;  4CHS A;  3TKS A;  2N5B A;  2K8V A;  4MZB A;  1DE2 A;  4L5L A;  2DSA A;  1SU9 A;  1XCC A;  2MMZ A;  3QPM A;  3N9J A;  3QD9 A;  4I6X A;  2HT9 A;  3GH9 A;  4MP4 A;  1O8X A;  4AF2 A;  1SKW B;  3LFL A;  3ISO A;  4GST A;  3DRN A;  9GSS A;  3TJB A;  3GRX A;  5J5N A;  3GA4 A;  2RM5 A;  4K0G A;  1ON4 A;  4G0L A;  1M9B A;  5CRH A;  1S3D A;  4J56 E;  4AJ7 A;  1YF1 A;  4JZQ A;  2HNL A;  4X0X A;  3Q19 A;  2N5A A;  1OKT A;  1F9M A;  3H93 A;  2LV3 A;  1Y6E A;  1NSW A;  3IK9 A;  5F8B A;  1W4V A;  1YJ6 A;  2BTO T;  5EL8 A;  5GST A;  1XPV A;  4EXJ A;  2M80 A;  4RI7 A;  5IIZ A;  2HSY A;  1OC9 A;  2REM A;  1PL2 A;  2D2Z A;  1F37 A;  1F2E A;  5IMV A;  4I2T A;  3FZA A;  4PQI A;  1X5D A;  2ZNM A;  3HVX A;  2CQ9 A;  2OAD A;  4TR3 A;  1K0M A;  2WUL A;  1HNA A;  4K9Z A;  2H6Y A;  2XBQ A;  3DYR A;  4ISD A;  1O6J A;  1I9D A;  1VF1 A;  1AIU A;  3EYT A;  3IV4 A;  3F63 A;  11GS A;  3KGK A;  3U6V A;  1RQM A;  2DJ2 A;  3EMX A;  3MNG A;  3CTG A;  6GST A;  1W89 A;  3HXS A;  3UOM A;  1GH2 A;  1WOU A;  2LST A;  3LGC A;  4NPB A;  1PA3 A;  3C1S A;  2ALB A;  3FK8 A;  3EVI A;  4RQX A;  3TKQ A;  3FR3 A;  3APQ A;  3Q6O A;  2H75 A;  3G7Y A;  2VM1 A;  4V1A g;  1A8Y A;  2V41 A;  4XHM A;  5ECN B;  4EF0 A;  2DJ3 A;  2CX3 A;  2YPM A;  2GSS A;  3FW2 A;  2B5E A;  1EGR A;  1M99 A;  1Z6N A;  1QQ2 A;  2VCV A;  3W8S A;  1XWB A;  5DJM A;  1QK8 A;  1GSQ A;  2C80 A;  3P8W A;  2PBJ A;  1BAY A;  14GS A;  3P90 A;  3W8J A;  3LOR A;  3VWW A;  1A23 A;  3HZ8 A;  2KLX A;  4HUA A;  2OBK A;  4TR1 A;  4YKG A;  2WZ9 A;  4EC0 A;  2OE0 A;  4Z7X A;  2XC2 A;  1J9B A;  2HRF A;  1QUW A;  1WJK A;  3ERG A;  5G31 A;  4BVX A;  1PSQ A;  3JCM L;  1YY7 A;  4FYC A;  2JSZ A;  5ECL B;  5LD0 A;  3ZLP A;  3HVS A;  1M0U A;  1OC9 B;  1DSB A;  2A2R A;  1AQW A;  3LW9 A;  5ELA A;  4CY8 A;  3I6A A;  3QFB C;  5CAX A;  3F4R A;  2YNX A;  4EDY A;  1SJ6 A;  1U3A A;  2YWM A;  4NV5 A;  2CZ3 A;  1EV4 A;  1TDI A;  4YAP A;  2O87 A;  2C0F A;  4XRA A;  1MEK A;  1VGL A;  2NVL A;  3APS A;  4N11 A;  2FA8 A;  2K8S A;  2JAC A;  4ZBA A;  4HS1 A;  4K5R A;  4ECB A;  4PXO A;  4MJE A;  4G0I A;  2WJU A;  2DKH A;  2H6X A;  1SL0 B;  4F0B A;  2JZR A;  2G0F A;  1PMT A;  3LJR A;  2VD0 A;  5LNK e;  3DVX A;  2B5Y A;  3MYD A;  5IOW A;  3C7M A;  2VAF A;  2R0P A;  3ZRE A;  3KJY A;  2RII A;  1OKD A;  1GNW A;  1ZMA A;  3A2X A;  2HRA A;  3DD3 A;  1YEP A;  1ZYP A;  5KN0 A;  4Q5N A;  1GUL A;  4CW9 A;  3FHK A;  4EE0 A;  2MMO A;  4TR1 B;  4EDZ A;  3FZ9 A;  1TK5 B;  2VCT A;  4WF5 A;  5IQY A;  1YEX A;  1WWJ A;  1AXD A;  4BVX B;  4ZB6 A;  1H75 A;  4KAE A;  4OO5 A;  4IEL A;  5J4U A;  2B3S A;  4XTS A;  2CVK A;  1YDK A;  5HQP A;  1PX6 A;  5ECP B;  3S9F A;  4ECI A;  4V2N A;  3UAR A;  3VK9 A;  5ABR A;  5B7C A;  3HD5 A;  4I97 A;  5IMD A;  2X8C A;  3H1N A;  3TKS E;  1N8J A;  1Z9H A;  2GQK A;  5ECH B;  2H1G A;  3I69 A;  4NHZ A;  2M72 A;  1BG5 A;  4Q5Q A;  2YV9 A;  3LXT A;  2CVB A;  7GSS A;  2VCW A;  4BWS A;  2K6V A;  3DKS A;  3HJO A;  2VOC A;  4L5O A;  1TU8 A;  3HYP A;  2LUS A;  1XVQ A;  1FHE A;  3QAW A;  5DJL A;  19GS A;  3UBK A;  4DEJ A;  1FO5 A;  2L6D A;  5J9B A;  1K0D A;  4KE3 A;  5G1L A;  3D22 A;  1AW9 A;  2NDO A;  1T3B A;  1G7O A;  1ZGN A;  1OE7 A;  3ERW A;  1TJD A;  5IOX A;  2YJ7 A;  4TXV A;  1MDJ A;  2PVO C;  2F8F A;  3MDK A;  1YQ1 A;  2H72 A;  5A4U A;  4MJB A;  2V2G A;  2GS3 A;  2DIY A;  1I5G A;  2R4V A;  4BVY A;  3MSZ A;  5JWR B;  3ZZX A;  3C71 A;  1ZYN A;  4ZIJ A;  2I1U A;  1Z3E A;  2FCH A;  3TKS C;  2L5O A;  1JHB A;  1V57 A;  3KH7 A;  2YN1 A;  2J23 A;  3ZMK A;  3IPZ A;  1M2A A;  4K8M A;  2C4J A;  2GZY A;  3CTF A;  3IC4 A;  2E7P A;  2X99 A;  4RUV A;  5B8A A;  2PUK C;  2CA8 A;  1GUK A;  4PX1 A;  1BYE A;  4JU5 A;  1O8W A;  2VUP A;  4ECC A;  1ERU A;  2QA2 A;  1B4P A;  1O7U A;  3EC3 A;  3A5W A;  1WP0 A;  3CYN A;  1B4Q A;  3EWL A;  3HDC A;  4TR4 A;  1ILO A;  1EP7 A;  2ES7 A;  4AGS A;  4KGI A;  2DJJ A;  1XWC A;  2GQM A;  1SL1 B;  3OR5 A;  2XPD A;  2VCX A;  4BL7 A;  5L71 A;  1TW9 A;  1PL1 A;  1TRV A;  2P5R A;  2WDU A;  3ZL5 A;  4LLR A;  2JSY A;  4IS0 A;  4QL9 A;  2GSQ A;  1BJX A;  2L4Q A;  2F9S A;  3A5I A;  2FWE A;  4I5Q A;  1G7E A;  4TXO B;  1V9W A;  1F6M C;  5DQY A;  4OFT A;  1GUH A;  1X9S B;  4FO5 A;  4F2I A;  1GTB A;  3ME7 A;  2HRN A;  5E59 A;  1R5P A;  3TRQ A;  2I3Y A;  4BVY B;  1Z6M A;  2YJH A;  2FWH A;  4CY6 A;  4MDC A;  3PIN A;  3EMP A;  4LA1 A;  1BX9 A;  4KW6 A;  3D4M A;  1F3B A;  3GUS A;  2JZS A;  2GLR A;  4GSN A;  3RDW A;  1SK1 A;  4PGT A;  2H1B A;  1T4Y A;  3KP8 A;  1QGV A;  4ZBD A;  2LRT A;  3J7Y b;  5DDL A;  4G0K A;  3R3E A;  2AYT A;  3PGT A;  4L0W A;  4YQU A;  5CNW A;  2WRT A;  4TKY A;  2QC7 A;  3FYG A;  2FWF A;  3VLN A;  4YKF A;  5HFI A;  4WF4 A;  1SL2 B;  2FLS A;  3IAS 2;  5ECS A;  2I9H A;  2WS2 A;  3R2Q A;  1U6T A;  1XW9 A;  1TK8 B;  4BL7 B;  4XCS A;  2H6Z A;  2IL3 A;  4KF9 A;  3TKR A;  1PRX A;  1EWX A;  3M3M A;  2PVQ A;  2LNS A;  1M2D A;  3IRA A;  1XWA A;  4ICY A;  4KSM A;  10GS A;  1QMV A;  5F07 A;  2VL2 A;  4HQZ A;  3GX8 A;  4KUN A;  4N30 A;  2B6M A;  4JBB A;  4D73 A;  2O7K A;  3RBT A;  2B5X A;  4V2L A;  1GUM A;  5COH A;  3CBU A;  1XWG A;  3GTU B;  2OKA A;  3E0U A;  4POL A;  2DBC A;  3BCK A;  5ECQ B;  1GSF A;  3UL3 A;  4CDO A;  3ZIT A;  2AJQ B;  5AIX A;  2OBI A;  1A0F A;  3GX0 A;  4XIH A;  2DMM A;  2H70 A;  4WXT A;  3I43 A;  2H8L A;  1OC8 A;  4XRD A;  2OE1 A;  4Z2U A;  2LNT A;  4PUR A;  1GWC A;  2HZE A;  3M1G A;  5KN2 A;  3F9U A;  5JCU A;  3KIJ A;  4G19 A;  4ML6 A;  2LRN A;  3PR8 A;  2GQL A;  4F9Z A;  2KOK A;  3UAP A;  4G10 A;  4X43 A;  1JZW A;  2LQQ A;  2X4A A;  6GSU A;  4I2U A;  4O32 A;  3VWX A;  4Z2R A;  4MJC A;  2J9H A;  3ZML A;  2FWG A;  3WGD A;  3GYK A;  4HOJ A;  1ZL9 A;  2WB9 A;  4USS A;  1A8L A;  4NHW A;  2R0C A;  2YWI A;  3MAK A;  3DXB A;  5A4W A;  5IPG A;  3EIN A;  5F05 A;  3GST A;  4KX4 A;  2CZ2 A;  1HNC A;  3TUE A;  2O85 A;  1R5A A;  1TTZ A;  2H0G A;  5LCZ A;  3F6F A;  2VLT A;  2HRK A;  4MH2 A;  4ACS A;  1Q4J A;  3FZ4 A;  1GTU A;  5D9V A;  1HD2 A;  2NPB A;  1NM3 A;  1ST9 A;  3KEB A;  3IBH A;  5IMC A;  1X0R A;  3F3R A;  5JWO B;  4D73 B;  1NW2 A;  1CQH A;  1Q98 A;  4ZL7 A;  2XPE A;  4V2M A;  1JZR A;  3LG6 A;  4K7O A;  2OJL A;  2Z9S A;  1THO A;  1R26 A;  3A2V A;  5GSS A;  3EU4 A;  3J7Y k;  1IYI A;  1Z7R A;  1PQN A;  5GZZ B;  1A2M A;  1A2L A;  4MZW A;  1X5C A;  4PNG A;  3VFI A;  1OC3 A;  4ZIL A;  1JLV A;  2HZE B;  3VPT A;  2K9F A;  4NMU A;  5D9X A;  1ABA A;  4X1U A;  4RQR A;  4ZB9 A;  2GST A;  1H4O A;  17GS A;  4IJ3 A;  4OD7 A;  3HJM A;  1EOH A;  1XXU A;  3H79 A;  2M46 A;  4H86 A;  3GN3 A;  2GZZ A;  2P0G A;  2QSI A;  4JE1 A;  5DAK A;  4IHU A;  4J57 E;  4HQS A;  2VIM A;  1MDK A;  22GS A;  4MZC A;  4IW9 A;  5J9C A;  2YWN A;  3GL5 A;  2TRX A;  3F0I A;  4ZB8 A;  2JZT A;  4KH7 A;  3TJF A;  5HR0 A;  2E2G A;  2HSH A;  4BWQ A;  5ECI B;  3QMX A;  5G1K A;  3HKR A;  2K18 A;  1GSY A;  1R7H A;  1AC1 A;  5A5K A;  2UZ8 A;  3GKX A;  1BQ7 A;  1GSD A;  4I8B A;  4O5R A;  5FHI A;  3TGZ A;  4YH2 A;  4MNN A;  2CVD A;  1HQO A;  3IC8 A;  4HDE A;  4KSO A;  4F0C A;  3P2A A;  3CMI A;  2KUC A;  2GT5 A;  2A4H A;  2IPA A;  3L78 A;  4E8E A;  2AAW A;  5GAP D;  4O5U A;  1O81 A;  1J08 A;  1TKD B;  2KP1 A;  2YCD A;  4POK A;  2H73 A;  1SJZ A;  3IA1 A;  6GSV A;  1DE1 A;  4KB3 A;  4PQ1 A;  5J41 A;  2C3N A;  4Q5F A;  1G0T A;  3C1R A;  3LYK A;  1VF2 A;  4PTS A;  3SWL A;  2DML A;  1PKW A;  4ZL8 A;  3FMW A;  1SD8 A;  3EU3 A;  1G6Y A;  4KDU A;  3EE2 A;  3CSH A;  1JZO A;  2P31 A;  3LEF A;  2B7J A;  1E2Y A;  4EL1 A;  3APO A;  1ZZY A;  5IM9 A;  1PD2 1;  4N10 A;  1GLQ A;  2YZH A;  3W6G A;  5DAK B;  5BMU A;  3US3 A;  1XW6 A;  3TKP A;  1TXX A;  1XFL A;  2HE3 A;  3PH9 A;  1TI1 A;  1EEM A;  1V2A A;  2DLX A;  2X8G A;  3TJJ A;  1SEN A;  4K2D A;  2R0G A;  5AGY A;  1VF3 A;  1WIK A;  3TB2 A;  2I81 A;  2PER A;  1XW5 A;  4FH8 A;  2VCZ A;  1DUG A;  2IJY A;  5IO2 A;  4O5Q A;  3D0Z A;  3F6D A;  1SKS B;  2H1D A;  5JWQ B;  1MDI A;  1EV9 A;  2KHP A;  2LRC A;  1LU4 A;  4GQC A;  2RUE A;  5DVB A;  3C8E A;  1K0N A;  2DJ0 A;  4TXO A;  4HI7 A;  4HZ2 A;  4HEA 2;  2GSR A;  3HVV A;  1U3I A;  4JED A;  4DSS A;  1JZD A;  3H8Q A;  1HYU A;  4MF7 A;  3VWU A;  3WGX A;  2GVP A;  1AAZ A;  5G30 A;  1Z7P A;  3WYW A;  2HSM A;  2RLI A;  1UN2 A;  4IJI A;  3GSS A;  3QAG A;  4MMM A;  3CSJ A;  1JFU A;  3DVW A;  4OFN A;  3ZYW A;  4FQU A;  3U5R E;  1VF4 A;  2VCQ A;  4N0Z A;  3IHG A;  4O7H A;  2R5G A;  6GSW A;  4HJM A;  2CAI A;  3CSI A;  5CRD A;  3C73 A;  5F0G A;  4GSS A;  3MIX A;  3E3E A;  6GSS A;  1N2A A;  3UVT A;  5IMA A;  1GTA A;  1M7T A;  3L0H A;  2AHE A;  2VL2 C;  1YKC A;  1AUC A;  1QXH A;  2F8A A;  2JL4 A;  1GRX A;  2H0I A;  4MPF A;  3ERF A;  2PMT A;  1BED A;  1K0A A;  3PPU A;  4BA7 A;  3M9K A;  4OFM A;  3M0F A;  5DQS A;  3KTB A;  3TRX A;  2DIZ A;  4JRR A;  4WET A;  1RK4 A;  5B6M A;  5HFG A;  2ON7 A;  1K3L A;  2DKI A;  1XWK A;  1X5E A;  1K3Y A;  5D93 A;  2FY6 A;  1XOA A;  5ECO B;  4MAB A;  2IWT A;  5ID2 A;  5H5Q A;  4GF0 A;  3KH9 A;  5DCG A;  2GT6 A;  2FGX A;  4F82 A;  2MMN A;  1OYJ A;  2HXK A;  2LJR A;  5HR3 A;  1YKA A;  1ACV A;  3KTL A;  2FNO A;  1ERT A;  4DSS B;  3G7I A;  1SKR B;  4ML1 A;  5KEJ A;  4X4J A;  4ILF A;  4K2X A;  4TRX A;  3GTU A;  1GSS A;  5CP1 A;  4WKW A;  3A2W A;  2MYG A;  4K7I A;  2TIR A;  3EPT A;  4XS1 A;  4YQM A;  2NTO A;  4MCU A;  3QAV A;  5ENU A;  4PUF C;  3ZTL A;  1Z5Y E;  5ECM B;  2B7K A;  1SJI A;  4AJ8 A;  2IMF A;  2FUG 2;  1SYX A;  1QFN A;  4NXI A;  2GGT A;  3NOF A;  1ERV A;  3HA9 A;  1E6B A;  2TRC P;  1NHY A;  4XS6 A;  5FT3 A;  3D5J A;  3BOA A;  4IN0 A;  2GZP A;  2NBS A;  4MPG A;  5JCW A;  4N0V A;  2CX4 A;  2X49 A;  4JR4 A;  4ULX A;  2AV4 A;  1OAZ A;  2JAD A;  1EGO A;  3F4T A;  2PWJ A;  1TK0 B;  20GS A;  3TCO A;  2EIO A;  18GS A;  3HJP A;  3IR4 A;  4EKZ A;  2HFD A;  1WMJ A;  2IMK A;  3KCM A;  5CRG A;  4A5P A;  3D21 A;  2YOI A;  2HZF A;  1FB6 A;  3TRP A;  4DSR A;  4V1A p;  1TU7 A;  1KTE A;  4ZBB A;  3RHB A;  3V1W A;  1T8E B;  4FYB A;  2VLV A;  3HCZ A;  5ID2 B;  4MJA A;  1A0R P;  3QOU A;  3TJK A;  1LBK A;  2OE3 A;  1SK0 A;  3FRC A;  3ZIV A;  3KMN A;  1A2J A;  2WFC A;  4GQF A;  2E0Q A;  3O3T A;  1K3O A;  5IMZ A;  1XOB A;  1MTC A;  3WT2 A;  2L6C A;  4K7N A;  2GDR A;  3L9U A;  3QDN A;  4HJ2 A;  3ZVJ D;  3VI7 A;  2XHF A;  4WBJ A;  2BJX A;  1ML6 A;  4WR4 A;  3ZIJ A;  2V32 A;  6GSY A;  2LJA A;  3M8N A;  2OA7 A;  3A3T A;  1XVW A;  4PUA A;  3ZFL A;  2O8V B;  4F03 A;  5HR2 A;  3KM6 A;  3MWH A;  4TN8 A;  2A4V A;  1GNE A;  2G2Q A;  3RPP A;  1XBS A;  1X9W B;  2MBS A;  1B8X A;  2BMX A;  2X8H A;  5DCH A;  2LKU A;  5AN1 A;  2GTU A;  2MBT A;  1TOF A;  4NWY A;  3O6T A;  3K8N A;  1WPI A;  3KP9 A;  3WD6 A;  2L59 A;  4KA0 A;  1LJR A;  1URM A;  2PN8 A;  4E8H A;  4K5S A;  2AUV A;  5C04 A;  4MA9 A;  2ZUP A;  13GS A;  1FB0 A;  1THX A;  3KXO A;  4O92 A;  3IDV A;  5IMF A;  3G7J A;  3GKN A;  2CAQ A;  3D6I A;  1EEJ A;  2H76 A;  1R4W A;  2YAN A;  3UMA A;  1C72 A;  2EIR A;  5ELG A;  2DC5 A;  3F8U A;  5CYY A;  3WGE A;  1WE0 A;  5BRT A;  3UBL A;  2C0D A;  2H66 A;  2KP2 A;  3RPN A;  2WGR A;  5KOX A;  2IMD A;  4LL4 B;  5AIV A;  1GSE A;  3CXG A;  4FYU A;  1X9M B;  4Z2T A;  1M9A A;  3NZN A;  1ZYE A;  3H4K A;  1T00 A;  1O73 A;  1PX7 A;  1TRS A;  1AQV A;  3E9J B;  2ON5 A;  4JR6 A;  2HI7 A;  2A2P A;  3TOT A;  5F06 A;  3CRU A;  5KOW A;  1DBY A;  1MD4 A;  4L0U A;  2P5Q A;  1ZOF A;  4RI6 A;  4YAV A;  5FWG A;  3BD2 A;  5D96 A;  4PNF A;  4MF6 A;  4IKH A;  1VRS D;  5EY6 A;  1EZK A;  2DJK A;  1FG4 A;  5C00 A;  1KNG A;  2H71 A;  3QCP A;  3GMF A;  2LS5 A;  1J0F A;  2QA1 A;  4TOP A;  4KDX A;  3I9V 2;  3KZQ A;  4KCA A;  3VPQ A;  4ECJ A;  3GHA A;  1KEB A;  1WRY A;  4MK3 A;  1GLP A;  3UJ1 A;  3O76 A;  4ZL9 A;  1HNB A;  5ECK B;  3HY2 A;  3HZ4 A;  3UEM A;  2IMI A;  3CRT A;  5HR1 A;  5KN1 A;  5B8B A;  4QQ7 A;  2DJ1 A;  3GNJ A;  3EUR A;  5GAN D;  1T7P B;  1USB A;  3F4S A;  2HYX A;  2R6K A;  3BJ5 A;  5INY A;  4J2F A;  4TW5 A;  2H01 A;  2LEG A;  5EVO A;  1U88 A;  4IVF A;  4IGJ A;  3P7X A;  2IFQ A;  2YWO A;  4QL7 A;  4DSQ A;  2QGV A;  3QR6 A;  1TRU A;  2L57 A;  3IK7 A;  2VO4 A;  5KN3 A;  1GSU A;  3UIW A;  4EVM A;  3SBC A;  2YV7 A;  2I4A A;  4GWR A;  4KND A;  1S3C A;  4HU7 A;  2XBI A;  4K0N A;  1ZYQ B;  3DEX A;  4POM A;  4EIP A;  1NHO A;  2HLS A;  2L4C A;  1UA5 A;  2VLU A;  4NAX A;  1F3A A;  2PGT A;  3AY8 A;  5G2Z A;  2FA4 A;  3GV1 A;  3HHV A;  2QKE A;  3L9S A;  3LXZ A;  3N5O A;  5EPF A;  1V40 A;  3IXR A;  1M2B A;  2PU9 C;  4GCI A;  4IQA A;  1PGT A;  2H1A A;  4POB A;  4TR0 A;  4ZXG A;  3KD0 A;  3BBY A;  4Q5R A;  2PPT A;  4PQH A;  8GSS A;  2VL9 A;  4K1F A;  1K0O A;  2EIQ A;  3Q18 A;  2IIY A;  2YP6 A;  2A2S A;  1SD9 A;  1XZO A;  4GLT A;  3GKM A;  2N5F A;  5IO0 A;  3DWV A;  1T1V A;  2V1M A;  4LL1 B;  1U87 A;  1XIY A;  2F51 A;  2VM2 A;  6GSX A;  1UC7 A;  3DGQ A;  4KCE A;  3TOU A;  4WEY A;  3ME8 A;  3GIX A;  3VUR A;  4MH3 A;  2MZC A;  4WBR D;  3L4N A;  5CRE A;  5D8I A;  3TJG A;  2V6K A;  3RHC A;  3GL3 A;  2FHE A;  2IFQ B;  5G5E A;  4HU9 A;  4OCF A;  1FAA A;  1OE8 A;  2O89 A;  1IYH A;  4KDY A;  4HZ4 A;  1ERW A;  4LMV A;  5CRW A;  1KBN A;  2H19 A;  3FEU A;  3LSZ A;  1ZCP A;  1B9X C;  4FIW A;  3ZVJ A;  4P3Y B;  3LYP A;  1K0B A;  1FVJ A;  12GS A;  1O85 A;  3ZFB A;  3KMO A;  2EC4 A;  2VL3 A;  2C0G A;  2H0H A;  3FZ5 A;  4OMV A;  1GL8 A;  2C3Q A;  3F3Q A;  4G2E A;  2RM6 A;  4IBP A;  3FY7 A;  3NIV A;  2X64 A;  3GKK A;  2L5L A;  3Q74 A;  3QFA C;  3WT1 A;  2C0E A;  5IPH A;  2F3M A;  4EO3 A;  1FVK A;  2B1L A;  3D4T A;  2YZU A;  5DAL A;  3IOS A;  1GP1 A;  2C8U A;  3FKF A;  4WR5 A;  3IHQ A;  5AIS A;  3FR9 A;  1FW1 A;  2R3X A;  5ECR B;  1TP9 A;  4XS4 A;  5DBQ A;  1YF0 A;  2CT6 A;  4L8E A;  5H5S A;  3G9B A;  4BPY A;  2C3T A;  5B6N A;  5A4V A;  4OCE A;  5D9T A;  4GXZ A;  2JU5 A;  2CV4 A;  1K0C A;  2IN3 A;  2ZCT A;  4OO4 A;  3GFK A;  1TI3 A;  2LQO A;  3IAM 2;  2AB6 A;  2R37 A;  2OAC A;  2H30 A;  5G5F A;  2FD3 A;  2IME A;  1RW1 A;  5CO3 A;  1S3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...