3IDVA

Crystal structure of the a0a fragment of erp72
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
235
Chain Sequence
DDLEVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGAAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein disulfide-isomerase A4
publication title Structure of the Catalytic a(0)a Fragment of the Protein Disulfide Isomerase ERp72.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 67
structure length 235
sequence length 235
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2009-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3idvA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3idvA01
1OYJA 1ZL9A 1J08A 5CRGA 1NM3A 2H1DA 1SK2A 1SL0B 1G0TA 4JR6A 2VUPA 5EY6A 2DJKA 4IP1A 1TU8A 1PX6A 1S3CA 4L0WA 2EIOA 5ECKB 4HEA2 4MMMA 3WGEA 2HLSA 2KP2A 3WD6A 1M7TA 4HZ2A 3A5WA 3D4MA 3HCZA 2LV3A 2FHEA 5F0GA 2C0FA 4OFNA 1GTIA 1K0OA 2VIMA 5JCUA 1W4VA 2IWTA 2VCXA 4BVXA 2PERA 3FK8A 2PPTA 4DSSB 1ILOA 3VWUA 4WF4A 3F8UA 2YWIA 2R2JA 1QGVA 3ISOA 1JZOA 3TRQA 1YQ1A 2M80A 4WR4A 3QAGA 1A2LA 3ZIJA 2A2SA 2MMAA 4K0GA 5D73A 5KN3A 3GKKA 6GSWA 1GUKA 1VRSD 2H73A 2FLSA 1ON4A 2GT6A 4EF0A 3TJGA 5JWQB 1BQ7A 4DSQA 4LL4B 4KCEA 3DKSA 3GHAA 17GSA 3ME8A 2IMKA 5AIXA 1QXHA 5A4UA 1ML6A 5H5SA 2YV9A 2NBSA 1O85A 2XPEA 1U6TA 5IIZA 4KDXA 2PVOC 12GSA 2CA8A 4ZL9A 3QOUA 3BCKA 2V6OA 1F6MC 2KHPA 3SWLA 5DQYA 2BTOT 4CDOA 6GSTA 4NHZA 3C1RA 1B9YC 2MZCA 2VLTA 3IR4A 2R3XA 4K9ZA 4XIHA 2F51A 2E7PA 3APSA 1SENA 5CREA 4GSSA 5IOWA 2JZSA 3QPMA 4WBRD 3EINA 3VWWA 3EWLA 3LSZA 1QK8A 1YY7A 3GN3A 2WGRA 2G2QA 2KUCA 1TP9A 4TXVA 3U6VA 2JU5A 1SD8A 3CTGA 4MF6A 4KAEA 2C80A 2H74A 7GSSA 5G1KA 1FB0A 2LJRA 4IJIA 5ECIB 3G7IA 2CZ3A 4MJEA 2CT6A 5ELAA 5CRWA 2OACA 4NAXA 3TJKA 4FYUA 2ZCTA 3GL3A 4ACSA 1TRVA 2DIZA 1VF4A 4PQ1A 2WCIA 5DJMA 1H4OA 4EE0A 3V1WA 1U3IA 4QL7A 3LXZA 2WZ9A 4J56E 5B8AA 10GSA 1T8EB 4HQSA 1GSEA 3EE2A 3KGKA 2AV4A 1XWGA 2H30A 3ME7A 4Q5QA 3HKRA 3FEUA 1XZOA 3M9JA 3Q19A 2LUSA 4MDCA 4GSNA 3Q6OA 4LL1B 2VOCA 2L59A 1U87A 3GKNA 4F0CA 3GX0A 2VCZA 1XVWA 3CTFA 1F3AA 1SYRA 3D22A 5G2ZA 3GSTA 5ID2B 2KLXA 2GLRA 3GTUA 2IIYA 3KMNA 2KP1A 4XHMA 5AGYA 1T7PB 1V9WA 2YWNA 2DJJA 4TR1A 5COHA 1TK5B 4JZQA 1HNAA 3QAWA 2GZPA 2A4VA 2LRTA 2HZEB 4JR4A 6GSYA 1XWKA 1EOGA 1QMVA 3BJ5A 2DC5A 1A2JA 3GMFA 4OCFA 4PXOA 2LRCA 2OBKA 4JEDA 3EYTA 1WPIA 4TR3A 3A2VA 3LJRA 3UBKA 2NDOA 4FH8A 2FD3A 1PN9A 1EEMA 4ULXA 4KE3A 2VLUA 2GQLA 4KA0A 3Q18A 4F2IA 4KW6A 2X8GA 1XOAA 3US3A 3H79A 2XC2A 1V98A 2D2ZA 3RHBA 1O81A 3HA9A 5H5RA 3WYWA 2HRFA 4ZBDA 3QFBC 3ZVJD 1VF1A 1GSUA 1O8WA 4O92A 3ZLPA 2PWJA 2AJQB 1FHEA 3RBTA 4Z7XA 5HFIA 4DSRA 3F63A 1R4WA 4MJBA 1XW9A 4HI7A 2VL2C 3G7JA 3HYPA 1O7UA 2GDRA 4P3YB 4PUAA 4TXOA 5ECMB 3HVVA 3BD2A 1NSWA 2IMFA 11GSA 2VCWA 4TR1B 1K3LA 3WT2A 4TOPA 4GQCA 1OKTA 1YEXA 2OE0A 1AC1A 5IPGA 1Z7RA 4MPGA 2HXKA 2REMA 5GSSA 4DVCA 2GZZA 1BX9A 3E0UA 4OO4A 3TKSA 4HZ4A 5F05A 3QDNA 1TRUA 1JFUA 4G9HA 4ZXGA 3L9SA 4BWQA 1XWAA 4POMA 2H1AA 3KP8A 4GRFA 3W8SA 2VD0A 4AJ8A 4KDUA 2LTKA 1PRXA 4RQRA 3C73A 4X43A 5ECLB 1YF0A 3MWHA 5IMDA 6GSUA 5IMZA 5D93A 2NTOA 1K3YA 1Z6MA 4POLA 5L71A 5J9BA 1ST9A 5IQYA 2H0IA 4IN0A 3VI5A 1X9MB 4RI6A 4KGIA 4MABA 1JZDA 4AGSA 3UVTA 1W89A 2R4VA 3O76A 1X0RA 3PR8A 2A2RA 5DVBA 9GSSA 1Z3EA 1GH2A 3JCML 5DAKA 2QC7A 1XWCA 3TDGA 2Z9SA 1GLPA 1GSYA 1A8YA 4RI7A 4WR5A 3TKPA 4N10A 3KTLA 2YZHA 4N30A 3GV1A 1SJIA 1R5AA 5ECPB 2GSTA 3M8NA 1WJKA 5CRHA 3PH9A 4Q5FA 3FKFA 1V58A 2BJXA 1IYHA 3RDWA 1PGTA 2MYGA 2IPAA 4IHUA 1E6BA 2L6DA 1KBNA 2M72A 2O7KA 2LQOA 4BVYA 4YQMA 2JZTA 3WGDA 2VCVA 4K8MA 1SKRB 2WB9A 4TRXA 4IELA 4V2MA 2H6XA 2X8HA 3H8QA 2LRNA 1M0UA 3A2WA 2CZ2A 1M9BA 3KEBA 1M2DA 2WS2A 4ZL8A 3TB2A 4FIWA 1M99A 2CX4A 3TRXA 3VFIA 2PUKC 2QSIA 2H70A 3HDCA 2VD1A 5CP1A 5DAKB 5GAND 2R37A 4PQIA 2FWFA 2HI7A 2JADA 1JZWA 3HJMA 2FCHA 3LWAA 3HD5A 4IQ1A 4ECIA 2FA8A 3KCMA 5DCGA 3HHVA 2GQMA 1TRWA 2JZRA 4PUFC 1AQXA 1SL2B 1TXXA 5HR0A 3GNJA 3OR5A 1O8XA 2V6KA 1EZKA 2V32A 1EWXA 6GSXA 2CX3A 2CAIA 2KOKA 3TJFA 2OJLA 2C3TA 1B9XC 2VM2A 3DXBA 4KSOA 1S3AA 3QCPA 2GTUA 5A4WA 1X9SB 3H4KA 1ZYQB 1GRXA 4V1Ag 2TRXA 3FR6A 2PVQA 1PQNA 3CBUA 2HE3A 2HRNA 3HZ4A 3GIXA 3GFKA 3KH7A 1CQHA 1FB6A 1TI1A 4L8EA 2YP6A 2NPBA 4GCIA 3VLNA 3IRAA 5H5QA 3EMXA 5KN1A 4HS1A 4ML6A 1ZGNA 3KJYA 3MDKA 4WKWA 3I9V2 3FYGA 3G7YA 3ERGA 3TCOA 1DUGA 2I4AA 3CYNA 2VM1A 1U3AA 4IS0A 3DWVA 1NHYA 4PGTA 1BAYA 4IBPA 2OE1A 2HZFA 2LSTA 2XPDA 5DDLA 4AJ7A 4PQHA 4MK3A 1Z9HA 5IMCA 1XIYA 1ZMAA 3A3TA 1XCCA 2DMMA 5EVOA 3GH6A 4GWRA 2HSYA 1ZOFA 3SBCA 4AF2A 1HYUA 4HU9A 1EP7A 4MH2A 1F9MA 1V2AA 4RQXA 2IMDA 1GULA 2LQQA 1Z7PA 2IFQA 4IW9A 2L5LA 3VK9A 1J9BA 3IHQA 5CO3A 1EV4A 2O8VB 2PGTA 4WETA 4HUAA 1F37A 3LFLA 1EP8A 2H6YA 1VF2A 5J5NA 3MAKA 5ID2A 3J7Yk 4L5OA 8GSSA 4K1FA 1ABAA 4ECJA 5CNWA 1T3BA 1EEJA 5FT3A 3ZFLA 3MNGA 2RUEA 2HZEA 2B7KA 1HNBA 1YF1A 4KUNA 2E2MA 2G0FA 3QMXA 1FG4A 4ECBA 1JLVA 3RPPA 2GS3A 1MEKA 5CYYA 4MZBA 3HJOA 1DBYA 3GKXA 3UARA 2EC4A 1TDIA 1I9DA 1M2AA 3P8WA 4F9ZA 2DLXA 4NV2A 4OMVA 4MJAA 1SK1A 3H93A 3DVXA 3UJ1A 1WIKA 5C04A 3UEMA 3S9FA 5D8IA 5IO2A 2LJKA 1PX7A 5ECHB 3BBYA 3BOAA 2IFQB 2O85A 3IOSA 4HJMA 3DVWA 3KTBA 3NIVA 2QGVA 1WMJA 5ELGA 2J23A 3ZITA 1TK0B 2GZYA 3P7XA 2H75A 1RK4A 4ZIJA 5LCZA 2ES7A 1PD21 4IKHA 3TOTA 4KCAA 5KEJA 1XVQA 1PSQA 1T4YA 4HU7A 1BJXA 2R6KA 2GQKA 5F06A 4KDYA 1A2MA 2LNTA 3LGCA 5ECOB 3PGTA 4GLTA 3APQA 2C0EA 1G6YA 3FZAA 2EIQA 3TRPA 1R7HA 1HNCA 4OWYA 3GURA 4BA7A 5JCWA 2E0QA 3NZNA 2FGXA 2L5OA 1BG5A 1QUWA 1GTBA 3GH9A 3QD9A 3IC4A 1ZCPA 2L6CA 5IM9A 2H8LA 3TKSC 2YZUA 3HY2A 3IK7A 4YAPA 4PNFA 1OKDA 2YN1A 1MD3A 2V41A 2AHEA 4IGJA 2FWGA 4TR0A 3Q74A 3IDVA 1GLQA 3KXOA 2FWEA 4G2EA 1XFLA 5G30A 3IPZA 3GX8A 3DEXA 2ON5A 3TUEA 4PNGA 5B6NA 1A0FA 2YPMA 1NHOA 1TK8B 4EKZA 2P31A 4N11A 4ZBBA 3TJJA 4EDYA 1AQWA 1TU7A 3EU3A 1MDKA 2HSHA 2H19A 1UVZA 2CAQA 3KZQA 1KNGA 1S3DA 2IN3A 3QFAC 5DCHA 3HVSA 2ZNMA 1IYIA 2DMLA 4O7HA 5LD0A 1UC7A 3CXGA 2LEGA 4F82A 2C8UA 4NPBA 3KMOA 3TKQA 1RW1A 2AAWA 4OO5A 2F3MA 5J41A 3D21A 5GZZB 3I6AA 1HQOA 1YZXA 3R2QA 2B7JA 2HYXA 3DD3A 1ZYEA 4XCSA 4TR4A 3G9BA 1H75A 1TW9A 2RM5A 3CRTA 3F6FA 1WOUA 3ZREA 2GSQA 6GSSA 1FVJA 4EO3A 3UL3A 1YKAA 4NMUA 1XWBA 3D6IA 4YH2A 2VL2A 2YNXA 2H0HA 2DJ3A 5ENUA 1YDKA 1TOFA 2H6ZA 5HFKA 4FO5A 5IMVA 3DYRA 3EC3A 5D9XA 4ZILA 1V57A 2P5RA 3ZRDA 3M0FA 3TOUA 5GSTA 2B1LA 1XW6A 3VWXA 4HOJA 3FY7A 1UA5A 1A0RP 2GSRA 5ECQB 5JWOB 2YJHA 1TKDB 5DALB 1MTCA 2YOIA 1KEBA 1F3BA 3K8NA 1XXUA 1CQGA 2B5EA 4F03A 4V2LA 3CSJA 4RUVA 2IL3A 2IMIA 2DIYA 3F9UA 3EMPA 4OCEA 1UN2A 14GSA 4N0ZA 4QL9A 1XPVA 3VI7A 2I1UA 2I3YA 3TKRA 5HR3A 2ON7A 3IA1A 3F3QA 3ZMKA 2K18A 4YQVA 1YEPA 5D96A 1G6WA 5ECSA 3VPTA 4ISDA 2F9SA 2O87A 3UVHA 4YAVA 4QQ7A 3M9KA 2ALBA 4J2FA 4Q5NA 5EPFA 2PU9C 1XW5A 1A23A 4CW9A 3CSIA 1DE2A 1OE7A 2RUFA 2IJYA 4KB3A 5F8BA 4F0BA 4IP6A 4MPFA 2E2GA 1F2EA 3LXTA 1JZRA 3I43A 4I6XA 1SL1B 3F4RA 1GSDA 18GSA 4LLRA 4HJ2A 1FVKA 3WGXA 2GSSA 5HR1A 2FUG2 5HQPA 2IMEA 3DRNA 1EGRA 5DJLA 1R5PA 2OKAA 3L9UA 1OC3A 5FWGA 3P90A 2I81A 1PL1A 3UOMA 5D9TA 2DJ0A 3RHCA 4K7NA 2M46A 1GNWA 1USBA 2DBCA 5F07A 3VPQA 4EVMA 2AUVA 4AJ6A 1X9WB 1GTUA 3CMIA 5G5FA 2GGTA 1ERUA 1T1VA 2F8FA 2LS5A 3KH9A 2OBIA 1SJ6A 3GRXA 3ZIVA 5E4WA 4KH7A 4BL7A 3HZ8A 2YCDA 2H01A 2V2GA 3BCIA 5J9CA 1BEDA 5FHIA 3N9JA 2X99A 4ML1A 2VO4A 5AIVA 1G7EA 3FZ4A 3ZTLA 4ZL7A 4EDZA 1XOBA 4O32A 1X5CA 5KN2A 1MD4A 2N5AA 1GSSA 2K8SA 2VAFA 3FHKA 1I5GA 1BYEA 2K8VA 4KSMA 2LKUA 4XS4A 1Y25A 2L4CA 1RQMA 3LORA 2R5GA 5IMAA 4K7IA 2CVDA 4GSTA 2MMNA 3D4TA 3TKSE 4IVFA 3LQ7A 3FZ5A 4E8HA 3GL5A 2WRTA 2H76A 2TIRA 2YWMA 1FW1A 1SKSB 3F4SA 4CHSA 1EGOA 1PL2A 3LG6A 2H1BA 2RM6A 2QKEA 4EC0A 3ERFA 3F4TA 1LU4A 5J4UA 2H72A 2HNLA 1PA3A 2DJ1A 4I97A 3RAZA 1AQVA 1M2BA 4FYBA 3DIEA 2H1GA 3A2XA 3FRCA 1OVNA 5A4VA 3UAPA 3UIWA 2LNSA 3I69A 2DJ2A 22GSA 2FA4A 1GL8A 4GQFA 4BWSA 4MCUA 4XTSA 2B5XA 3UMAA 2CVBA 1GSFA 3GSSA 1YJ6A 3DMLA 1THOA 4XS1A 4OFTA 3N5OA 1SD9A 2YV7A 4K6XA 4JU5A 4LMVA 5KN0A 4NHWA 2VLVA 3PINA 5ECNB 4XS6A 2P5QA 5CRDA 1FOVA 1TTZA 1KTEA 3IV4A 4MZCA 1C72A 4H86A 3U5RE 4XS4B 1T00A 2L57A 1O73A 1SYXA 3ZYWA 19GSA 4XRAA 2WULA 4JRRA 1VF3A 3GA4A 4JBBA 5AN1A 2HFDA 4TN8A 5G1LA 4ZB6A 3W8JA 4MLYA 4ILFA 4ZBAA 4I8BA 3D0ZA 1N8JA 4PX1A 1GSQA 1A8LA 4OD7A 1NW2A 3GKMA 1K3OA 2JSZA 4X0XA 2HT9A 2GT5A 1FAAA 1TRSA 1GP1A 4KX4A 5B6MA 5EL8A 4TW5A 4V2NA 4X1UA 1GUMA 1AIUA 2EIRA 1E2YA 1GTAA 2X64A 1GWCA 3VWVA 3L78A 20GSA 4G19A 4N0VA 4I2TA 5B7CA 5IO0A 3EURA 1K0DA 3E3EA 2B1KA 1TI3A 2L4QA 4GF0A 1FO5A 1WP0A 1X5EA 2AYTA 1Z5YE 3IAM2 1GUHA 2MMOA 3ZMLA 3HXSA 3IXRA 3ZL5A 1PKZA 4BPYA 3ZVJA 2B5YA 1WWJA 1ACVA 1YKCA 2K9FA 5JCGA 1SJZA 2TRCP 3HVXA 2YWOA 3FR9A 3O6TA 4POKA 4YQUA 2C0GA 4MF7A 1OC8A 1ERWA 2BMXA 5D9WA 4WF5A 2J9HA 6GSVA 1OAZA 5IOXA 3VURA 4MP4A 5B8BA 2OE3A 4D73A 2FNOA 2H71A 2NVLA 3F0IA 1SU9A 1R26A 2VCQA 3M3MA 2YANA 2RIIA 1A24A 3IBHA 1G7OA 1JHBA 4K2DA 1J0FA 3WT1A 3ED3A 4K0NA 4ECCA 3D5JA 1EOHA 4HQZA 2B6MA 3UBLA 2RLIA 3E9JB 1K0MA 3IK9A 2FWHA 3L4NA 5IMFA 2C3NA 4WBJA 2X8CA 1XBSA 4XRDA 2LJAA 3DGQA 5E59A 4OFMA 4G10A 1MDJA 5DALA 1K0CA 3GTUB 4JE1A 1X5DA 5LNKe 5JWRB 4MF5A 1SK0A 4I2UA 1AW9A 1O6JA 1Y6EA 4MA9A 1K0BA 1M9AA 1B4PA 2MBSA 3AY8A 2OADA 2N5BA 3C8EA 1QQ2A 4MZWA 1V40A 2C3QA 4ZB8A 3IE3A 2P0GA 3C1SA 1TJDA 1HD2A 1MDIA 2C1YA 4D73B 4WEYA 4IJ3A 4WXTA 1PMTA 1AAZA 1THXA 2MMZA 4EXJA 3LEFA 2WDUA 4NV5A 3IAS2 3GUSA 3KD0A 2PMTA 5HFGA 3KM6A 1T4ZA 1EV9A 1OC9A 4L0UA 3F3RA 1ERVA 1K0NA 3RPNA 4TVEA 2F8AA 2V1MA 4EUYA 1OE8A 5C00A 4KNDA 3C7MA 4Q5RA 4GTUA 3MSZA 2MBTA 2AB6A 4GXZA 1N2AA 2FY6A 1PKWA 5DBQA 2VL9A 1Z6NA 4NWYA 3CRUA 3FR3A 3NOFA 4EL1A 4DEJA 3TGZA 5A5KA 1B8XA 4TXOB 3EU4A 4J57E 5CAXA 3M1GA 3KIJA 2OA7A 1WRYA 1Q4JA 4I5QA 4O5RA 5HR2A 3W6GA 1WE0A 3LYKA 4IQAA 5J3RA 3FZ9A 2CV4A 5ECRB 2JL4A 4K7OA 5D9VA 1AXDA 3F6DA 3GYKA 4TKYA 2JSYA 5GAPD 3J7Yb 2B3SA 3L0HA 3LYPA 2WFCA 3ERWA 5AISA 3O3TA 4POBA 4PURA 2H66A 4LA1A 3EVIA 1ZZYA 1B4QA 5INYA 1VGLA 3C71A 2YJ7A 3ZFBA 2WJUA 4NXIA 1OC9B 3QR6A 13GSA 4ID0A 2XBQA 2O89A 4V1Ap 2CQ9A 4E8EA 4FYCA 3P2AA 1LJRA 2DSAA 3CSHA 5ABRA 4MJCA 2K6VA 4LMWA 2VL3A 2C4JA 4MH3A 1SKWB 3H1NA 2ZUPA 1U88A 5G31A 3HJPA 3TJBA 1K0AA 3ZZXA 2XHFA 1Q98A 4DSSA 2VCTA 3APOA 4L5LA 3QAVA 2XBIA 3KP9A 3L9VA 2GVPA 1B48A 1AUCA 2PBJA 5G5EA 3FW2A 5IPHA 1JLWA 1QFNA 2H0GA 4HDEA 2I9HA 5DQSA 1LBKA 1GNEA 2CVKA 2PN8A 4ZB9A 1DSBA 16GSA 2N5FA 1URMA 2JACA 1ERTA 2C0DA 1DE1A
chains in the Genus database with same CATH superfamily
4CY8A 1OYJA 1ZL9A 1J08A 5CRGA 1NM3A 2H1DA 1SK2A 1SL0B 1G0TA 4JR6A 2VUPA 5EY6A 2DJKA 4IP1A 1TU8A 1PX6A 1S3CA 4L0WA 2EIOA 5ECKB 4HEA2 4MMMA 3WGEA 2HLSA 2KP2A 3WD6A 1M7TA 4HZ2A 3A5WA 3D4MA 3HCZA 2LV3A 2FHEA 5F0GA 2C0FA 4OFNA 1GTIA 1K0OA 2VIMA 5JCUA 1W4VA 2IWTA 2VCXA 4BVXA 2PERA 3FK8A 2PPTA 4DSSB 1ILOA 3VWUA 4WF4A 3F8UA 2YWIA 2R2JA 1QGVA 3ISOA 1JZOA 3TRQA 1YQ1A 2M80A 4WR4A 3QAGA 1A2LA 3ZIJA 2A2SA 2MMAA 4K0GA 5D73A 5KN3A 3GKKA 6GSWA 1GUKA 1VRSD 2H73A 2FLSA 1ON4A 2GT6A 4EF0A 3TJGA 5JWQB 2DKIA 1BQ7A 4DSQA 4LL4B 4KCEA 3DKSA 3GHAA 17GSA 3ME8A 2IMKA 5AIXA 1QXHA 5A4UA 1ML6A 5H5SA 2YV9A 2NBSA 1O85A 2XPEA 1U6TA 5IIZA 4KDXA 2PVOC 12GSA 2CA8A 4ZL9A 3QOUA 3BCKA 2V6OA 1F6MC 2KHPA 3SWLA 5DQYA 2BTOT 2QA1A 4CDOA 6GSTA 4NHZA 3C1RA 1B9YC 2MZCA 2VLTA 3R3EA 3IR4A 2R3XA 4K9ZA 4XIHA 2F51A 2E7PA 3APSA 1SENA 5CREA 4GSSA 5IOWA 2JZSA 3QPMA 4WBRD 3EINA 3VWWA 3EWLA 3LSZA 1QK8A 1YY7A 3GN3A 2WGRA 2G2QA 2KUCA 1TP9A 4TXVA 3U6VA 2JU5A 1SD8A 3CTGA 4MF6A 4KAEA 2C80A 2H74A 7GSSA 5G1KA 1FB0A 2LJRA 4IJIA 5ECIB 3G7IA 2CZ3A 4MJEA 2CT6A 5ELAA 5CRWA 2OACA 4NAXA 3TJKA 4FYUA 2ZCTA 3GL3A 4ACSA 1TRVA 2DIZA 1VF4A 4PQ1A 2WCIA 5DJMA 1H4OA 4EE0A 3V1WA 1U3IA 4QL7A 3LXZA 3MIXA 2WZ9A 4J56E 5B8AA 10GSA 1T8EB 4HQSA 1GSEA 3EE2A 3KGKA 2AV4A 1XWGA 2H30A 3ME7A 4Q5QA 3HKRA 2X49A 3FEUA 1XZOA 3M9JA 3Q19A 2LUSA 4MDCA 4GSNA 3Q6OA 4LL1B 2VOCA 2L59A 1U87A 3GKNA 4F0CA 3GX0A 2VCZA 1XVWA 3CTFA 1F3AA 1SYRA 3D22A 5G2ZA 4G0LA 3GSTA 5ID2B 2KLXA 2GLRA 3GTUA 2IIYA 3KMNA 2KP1A 4XHMA 5AGYA 1T7PB 1V9WA 2YWNA 2DJJA 4TR1A 5COHA 1TK5B 4JZQA 1HNAA 3QAWA 2GZPA 2A4VA 2LRTA 2HZEB 4JR4A 6GSYA 1XWKA 1EOGA 1QMVA 3BJ5A 2A2PA 2DC5A 4O5QA 1A2JA 3GMFA 4OCFA 4PXOA 2LRCA 2OBKA 4JEDA 3EYTA 1WPIA 4TR3A 3A2VA 3LJRA 4X4JA 3UBKA 2NDOA 4FH8A 2FD3A 1PN9A 1EEMA 4ULXA 4KE3A 2VLUA 2GQLA 4KA0A 2R0CA 3Q18A 4F2IA 4KW6A 2X8GA 1XOAA 3US3A 3H79A 2XC2A 1V98A 2D2ZA 3RHBA 1O81A 1M3JA 3HA9A 5H5RA 3WYWA 2HRFA 4ZBDA 3QFBC 3ZVJD 1VF1A 1GSUA 1O8WA 4O92A 3ZLPA 2PWJA 2AJQB 1FHEA 3RBTA 4Z7XA 5HFIA 4DSRA 3F63A 1R4WA 4MJBA 1XW9A 4HI7A 2VL2C 3G7JA 3HYPA 1O7UA 2GDRA 4P3YB 4PUAA 4TXOA 5ECMB 3HVVA 3BD2A 1NSWA 2IMFA 11GSA 2VCWA 4TR1B 1K3LA 3WT2A 4TOPA 4GQCA 1OKTA 1YEXA 3IC8A 2OE0A 1AC1A 5IPGA 1Z7RA 4MPGA 2HXKA 2REMA 5GSSA 4DVCA 2GZZA 1BX9A 3E0UA 4OO4A 3TKSA 4HZ4A 5F05A 3QDNA 1TRUA 4K5SA 1JFUA 4G9HA 4ZXGA 3L9SA 4BWQA 1XWAA 4POMA 2H1AA 3KP8A 4GRFA 4G0IA 3W8SA 2VD0A 4AJ8A 2R0PA 4KDUA 2LTKA 1PRXA 4RQRA 3C73A 4X43A 5ECLB 1YF0A 3MWHA 5IMDA 6GSUA 5IMZA 5D93A 2NTOA 1K3YA 1Z6MA 4POLA 5L71A 5J9BA 1ST9A 5IQYA 2H0IA 4IN0A 3VI5A 1X9MB 4RI6A 4KGIA 4MABA 1JZDA 4AGSA 3UVTA 4KF9A 1W89A 2R4VA 3O76A 1X0RA 3PR8A 2A2RA 5DVBA 9GSSA 1Z3EA 1GH2A 3JCML 5DAKA 2QC7A 1XWCA 3TDGA 2Z9SA 1GLPA 1GSYA 1A8YA 4RI7A 4WR5A 3TKPA 4N10A 3KTLA 2YZHA 4N30A 3GV1A 1SJIA 1R5AA 5ECPB 2GSTA 3M8NA 1WJKA 5CRHA 3PH9A 4Q5FA 3FKFA 1V58A 2BJXA 1IYHA 3RDWA 1PGTA 4FQUA 2MYGA 2IPAA 4IHUA 1E6BA 2L6DA 1KBNA 2M72A 2O7KA 2LQOA 4BVYA 4YQMA 2JZTA 3WGDA 2VCVA 4K8MA 1SKRB 2WB9A 4TRXA 4IELA 4V2MA 2H6XA 2X8HA 3H8QA 4K5RA 2LRNA 1M0UA 3A2WA 2CZ2A 1M9BA 3KEBA 1M2DA 2WS2A 4ZL8A 3TB2A 4FIWA 4YKFA 1M99A 2CX4A 3TRXA 3VFIA 2PUKC 2QSIA 2H70A 3HDCA 2VD1A 5CP1A 5DAKB 5GAND 2R37A 4PQIA 2FWFA 2HI7A 2JADA 1JZWA 3HJMA 2FCHA 3LWAA 3HD5A 4IQ1A 4ECIA 2FA8A 3KCMA 5DCGA 3HHVA 2GQMA 1TRWA 2JZRA 4PUFC 1AQXA 1SL2B 2X4AA 1TXXA 5HR0A 3GNJA 3OR5A 1O8XA 2V6KA 1EZKA 2V32A 1EWXA 6GSXA 2CX3A 2CAIA 2KOKA 1PN0A 3TJFA 2OJLA 2C3TA 1B9XC 4O5UA 2VM2A 4BVYB 3DXBA 4KSOA 1S3AA 3QCPA 2GTUA 5A4WA 1X9SB 3H4KA 1ZYQB 1GRXA 4V1Ag 2TRXA 3FR6A 2PVQA 1PQNA 2A4HA 3CBUA 2HE3A 2HRNA 3HZ4A 4EIPA 3GIXA 3GFKA 3KH7A 1CQHA 1FB6A 1TI1A 4L8EA 2YP6A 2NPBA 4GCIA 3VLNA 3IRAA 5H5QA 3EMXA 5KN1A 4HS1A 4ML6A 1ZGNA 3KJYA 3MDKA 4WKWA 3I9V2 3FYGA 3G7YA 3ERGA 3TCOA 5KOXA 1DUGA 2I4AA 3CYNA 2VM1A 3A5IA 1U3AA 4IS0A 3MYDA 3DWVA 1NHYA 4PGTA 1BAYA 4IBPA 2OE1A 2HZFA 2LSTA 2XPDA 5DDLA 4AJ7A 4PQHA 4MK3A 1Z9HA 5IMCA 1XIYA 1ZMAA 3A3TA 1XCCA 2DMMA 5EVOA 3GH6A 4GWRA 2HSYA 1ZOFA 3SBCA 4AF2A 1HYUA 4HU9A 1EP7A 4MH2A 1F9MA 1V2AA 4RQXA 2IMDA 1GULA 2LQQA 1Z7PA 2IFQA 4IW9A 2L5LA 3VK9A 1J9BA 3IHQA 4HSCX 5CO3A 1EV4A 2O8VB 2PGTA 4WETA 4HUAA 1F37A 3LFLA 1EP8A 2H6YA 1VF2A 5J5NA 3MAKA 5ID2A 3J7Yk 4L5OA 8GSSA 4K1FA 1ABAA 4ECJA 5CNWA 1T3BA 1EEJA 5FT3A 3ZFLA 3MNGA 2RUEA 2HZEA 2B7KA 1HNBA 1YF1A 4KUNA 2E2MA 2G0FA 3QMXA 1FG4A 4ECBA 1JLVA 3RPPA 2GS3A 1MEKA 5CYYA 4MZBA 3HJOA 1DBYA 3GKXA 3UARA 2EC4A 1TDIA 1I9DA 1M2AA 3P8WA 4F9ZA 3PPUA 2DLXA 4NV2A 3LW9A 4OMVA 4MJAA 1SK1A 3H93A 3DVXA 3UJ1A 1WIKA 5C04A 3UEMA 3S9FA 5D8IA 5IO2A 2LJKA 1PX7A 5ECHB 3BBYA 3BOAA 2IFQB 2O85A 3IOSA 4HJMA 3DVWA 3KTBA 3NIVA 2QGVA 1WMJA 5ELGA 2J23A 3ZITA 1TK0B 2GZYA 3P7XA 2H75A 1RK4A 4ZIJA 4G0KA 5LCZA 2ES7A 1PD21 4IKHA 3TOTA 4KCAA 5KEJA 1XVQA 1PSQA 1T4YA 4HU7A 1BJXA 2R6KA 2GQKA 5F06A 4KDYA 1A2MA 2LNTA 3LGCA 5ECOB 3PGTA 4GLTA 3APQA 2C0EA 1G6YA 3FZAA 2EIQA 2R0GA 3TRPA 1R7HA 1HNCA 4OWYA 3GURA 4BA7A 5JCWA 2E0QA 3NZNA 2FGXA 2L5OA 1BG5A 3CQFA 1QUWA 1GTBA 3GH9A 3QD9A 3IC4A 1ZCPA 2L6CA 5IM9A 3HVNA 2H8LA 3TKSC 2YZUA 3HY2A 3IK7A 4YAPA 4PNFA 1OKDA 2YN1A 1MD3A 2V41A 2AHEA 4IGJA 2FWGA 4TR0A 3Q74A 3IDVA 1GLQA 3KXOA 2FWEA 4G2EA 1XFLA 5G30A 3IPZA 3GX8A 3DEXA 2ON5A 3TUEA 4PNGA 5B6NA 1A0FA 2YPMA 4Z2TA 1NHOA 1TK8B 4EKZA 2P31A 4N11A 4ZBBA 3TJJA 4EDYA 1AQWA 1TU7A 3EU3A 1MDKA 2HSHA 2H19A 1UVZA 2CAQA 5KOWA 3KZQA 1KNGA 1S3DA 4USSA 2IN3A 3QFAC 5DCHA 3HVSA 2ZNMA 1IYIA 2DMLA 4O7HA 5LD0A 1UC7A 3CXGA 2LEGA 4F82A 2C8UA 4NPBA 3KMOA 3TKQA 1RW1A 2AAWA 4OO5A 2F3MA 5J41A 3D21A 5GZZB 3I6AA 1HQOA 1YZXA 3R2QA 2B7JA 2HRAA 2HYXA 3DD3A 1ZYEA 4XCSA 4TR4A 3G9BA 1H75A 1TW9A 2RM5A 3CRTA 3F6FA 1WOUA 3ZREA 2GSQA 6GSSA 1FVJA 4EO3A 4Z2RA 3UL3A 1YKAA 4NMUA 1XWBA 3D6IA 4YH2A 2VL2A 2YNXA 2H0HA 2DJ3A 5ENUA 1YDKA 1TOFA 2H6ZA 5HFKA 4FO5A 5IMVA 3DYRA 3EC3A 5D9XA 4ZILA 1V57A 2P5RA 3ZRDA 3M0FA 3TOUA 5GSTA 2B1LA 1XW6A 3VWXA 4BIKA 4HOJA 3FY7A 1UA5A 1A0RP 4CY6A 2GSRA 5ECQB 5JWOB 2YJHA 1TKDB 5DALB 1MTCA 2YOIA 1KEBA 1F3BA 3K8NA 1XXUA 1CQGA 2B5EA 4F03A 4V2LA 3CSJA 4RUVA 2IL3A 2IMIA 2DIYA 3F9UA 1S3RA 3EMPA 4OCEA 1UN2A 14GSA 4N0ZA 4QL9A 1XPVA 3VI7A 2I1UA 2I3YA 3TKRA 5HR3A 2ON7A 3IA1A 3F3QA 3ZMKA 2K18A 4YQVA 1YEPA 5D96A 1G6WA 5ECSA 3VPTA 4ISDA 2F9SA 2O87A 3UVHA 4YAVA 4QQ7A 3M9KA 2ALBA 4J2FA 4Q5NA 5EPFA 2PU9C 1XW5A 1A23A 4CW9A 3CSIA 1DE2A 1OE7A 2RUFA 2IJYA 4KB3A 5F8BA 4F0BA 4IP6A 3FMWA 4MPFA 2E2GA 1F2EA 3LXTA 1JZRA 3I43A 4I6XA 1SL1B 3F4RA 1GSDA 18GSA 4LLRA 4HJ2A 1FVKA 3WGXA 2GSSA 5HR1A 2FUG2 5HQPA 2IMEA 3DRNA 1EGRA 5DJLA 1R5PA 4YKGA 2OKAA 3L9UA 1OC3A 5FWGA 3P90A 2I81A 1PL1A 3UOMA 5D9TA 2DJ0A 3RHCA 4K7NA 2M46A 1GNWA 1USBA 2DBCA 5F07A 3VPQA 4EVMA 2AUVA 4AJ6A 1X9WB 1GTUA 3CMIA 5G5FA 1M3IA 4ICYA 2GGTA 1ERUA 1T1VA 1ZYPA 2F8FA 2LS5A 3KH9A 2OBIA 1SJ6A 3GRXA 4PTSA 3ZIVA 4K2XA 5E4WA 4KH7A 4BL7A 3HZ8A 2YCDA 2H01A 2V2GA 3BCIA 5J9CA 1PFOA 1BEDA 5FHIA 3N9JA 2X99A 4ML1A 2VO4A 5AIVA 1G7EA 3FZ4A 3ZTLA 2HRKA 4ZL7A 4EDZA 1XOBA 4O32A 1X5CA 5KN2A 1MD4A 2N5AA 1GSSA 2K8SA 2VAFA 3FHKA 1I5GA 1BYEA 2K8VA 4KSMA 2LKUA 4XS4A 1Y25A 2L4CA 1RQMA 3LORA 2R5GA 5IMAA 4K7IA 2CVDA 4GSTA 2MMNA 3D4TA 3TKSE 4IVFA 3LQ7A 3FZ5A 4E8HA 3GL5A 2WRTA 2H76A 2TIRA 2YWMA 1FW1A 1SKSB 3F4SA 4CHSA 1EGOA 1PL2A 3LG6A 2H1BA 2RM6A 2QKEA 4EC0A 3ERFA 3F4TA 1LU4A 5J4UA 2H72A 2HNLA 1PA3A 2DJ1A 4I97A 3RAZA 1AQVA 1M2BA 4FYBA 3DIEA 2H1GA 3A2XA 3FRCA 1OVNA 5A4VA 3UAPA 4BL7B 3UIWA 2LNSA 3I69A 2DJ2A 22GSA 2FA4A 1GL8A 4GQFA 4BWSA 4MCUA 4XTSA 2B5XA 3UMAA 2CVBA 1GSFA 3GSSA 1YJ6A 3DMLA 1THOA 4XS1A 4OFTA 3N5OA 1SD9A 2YV7A 4K6XA 4JU5A 4BVXB 4LMVA 5KN0A 4NHWA 2HSMA 2VLVA 3PINA 4XS6A 5ECNB 2P5QA 5CRDA 1FOVA 1TTZA 1KTEA 3IV4A 4MZCA 1C72A 4H86A 3U5RE 4XS4B 1T00A 2L57A 1O73A 1SYXA 3ZYWA 19GSA 4XRAA 2WULA 4JRRA 1VF3A 3GA4A 4JBBA 5AN1A 2HFDA 4TN8A 5G1LA 4ZB6A 3W8JA 4MLYA 4ILFA 4ZBAA 4I8BA 3D0ZA 1N8JA 4PX1A 1GSQA 1A8LA 4EIQA 4OD7A 1NW2A 3GKMA 1K3OA 2JSZA 4X0XA 2HT9A 2GT5A 1FAAA 1TRSA 1GP1A 4KX4A 5B6MA 5EL8A 4TW5A 4V2NA 4X1UA 1GUMA 1AIUA 2EIRA 1E2YA 1GTAA 2X64A 1GWCA 3VWVA 3L78A 20GSA 4G19A 4N0VA 4I2TA 5B7CA 5IO0A 3EURA 1K0DA 3E3EA 2B1KA 1TI3A 2L4QA 4GF0A 1FO5A 1WP0A 1X5EA 2AYTA 1Z5YE 3IAM2 1GUHA 2MMOA 3ZMLA 3HXSA 3IXRA 3ZL5A 5BMUA 1PKZA 4BPYA 3ZVJA 2B5YA 1WWJA 1ACVA 1YKCA 2K9FA 5JCGA 1SJZA 2TRCP 3HVXA 2YWOA 3FR9A 3O6TA 4POKA 4YQUA 2C0GA 4MF7A 1OC8A 1ERWA 2BMXA 5D9WA 4WF5A 2J9HA 6GSVA 1OAZA 5IOXA 3VURA 4MP4A 5B8BA 2OE3A 4D73A 2FNOA 2H71A 2NVLA 3F0IA 1SU9A 1R26A 2VCQA 3M3MA 2YANA 2RIIA 1A24A 3IBHA 1G7OA 1JHBA 4K2DA 5BRTA 1J0FA 3WT1A 3ED3A 4K0NA 4ECCA 3D5JA 1EOHA 4HQZA 2B6MA 3UBLA 2RLIA 3E9JB 1K0MA 3IK9A 2FWHA 3L4NA 5IMFA 2C3NA 4WBJA 2X8CA 1XBSA 4XRDA 2LJAA 3DGQA 5E59A 4OFMA 4G10A 1MDJA 5DALA 1K0CA 3GTUB 4JE1A 1X5DA 1ZYNA 5LNKe 5JWRB 4MF5A 1SK0A 4I2UA 1AW9A 1O6JA 1Y6EA 4MA9A 1K0BA 1M9AA 1B4PA 2MBSA 3AY8A 2OADA 2N5BA 3C8EA 1QQ2A 4MZWA 3IHGA 1V40A 2C3QA 4ZB8A 3IE3A 2P0GA 3C1SA 1TJDA 1HD2A 1MDIA 2C1YA 4D73B 4WEYA 4IJ3A 4WXTA 1PMTA 1AAZA 1FOHA 1THXA 2MMZA 4EXJA 3LEFA 2WDUA 4NV5A 3IAS2 3GUSA 3KD0A 2PMTA 5HFGA 3KM6A 1T4ZA 1EV9A 1OC9A 4L0UA 3F3RA 1ERVA 1K0NA 3RPNA 4TVEA 2F8AA 2V1MA 2QA2A 4EUYA 1OE8A 5C00A 4KNDA 3C7MA 4Q5RA 4GTUA 3MSZA 2MBTA 2AB6A 4GXZA 1N2AA 2FY6A 1PKWA 5DBQA 2VL9A 1Z6NA 4NWYA 3CRUA 3FR3A 3NOFA 4A5PA 4EL1A 4DEJA 3TGZA 5A5KA 1B8XA 4TXOB 3EU4A 4J57E 5CAXA 3M1GA 3KIJA 2OA7A 1WRYA 1Q4JA 4I5QA 4O5RA 5HR2A 3W6GA 1WE0A 3LYKA 3EPTA 4IQAA 5J3RA 3FZ9A 2CV4A 5ECRB 2JL4A 4K7OA 5D9VA 1AXDA 3F6DA 3GYKA 4TKYA 2JSYA 5GAPD 3J7Yb 2B3SA 3L0HA 3LYPA 2WFCA 3ERWA 4Z2UA 5AISA 3O3TA 4POBA 4PURA 2H66A 4LA1A 3EVIA 1ZZYA 1B4QA 5INYA 1VGLA 3C71A 2YJ7A 3ZFBA 2WJUA 4NXIA 1OC9B 3QR6A 13GSA 4ID0A 2XBQA 2O89A 4V1Ap 2CQ9A 4E8EA 4FYCA 3P2AA 1LJRA 2DSAA 4MNNA 3CSHA 5ABRA 4MJCA 2K6VA 4LMWA 2VL3A 2C4JA 4MH3A 1SKWB 3H1NA 2ZUPA 1U88A 5G31A 3HJPA 3TJBA 1K0AA 3ZZXA 2XHFA 1Q98A 4DSSA 2VCTA 3APOA 4L5LA 3QAVA 2XBIA 3KP9A 3L9VA 2GVPA 1B48A 1AUCA 2PBJA 1XG8A 5G5EA 3FW2A 5IPHA 1JLWA 1QFNA 2H0GA 4HDEA 2I9HA 5DQSA 1LBKA 1GNEA 2CVKA 2PN8A 4ZB9A 2UZ8A 1DSBA 16GSA 2N5FA 1URMA 2DKHA 2JACA 1ERTA 2C0DA 1DE1A
chains in the Genus database with same CATH topology
4CY8A 1OYJA 1ZL9A 1J08A 5CRGA 1NM3A 2H1DA 1SK2A 1SL0B 1G0TA 4JR6A 2VUPA 5EY6A 2DJKA 4IP1A 1TU8A 1PX6A 1S3CA 4L0WA 2EIOA 5ECKB 4HEA2 4MMMA 3WGEA 2HLSA 2KP2A 3WD6A 1M7TA 4HZ2A 3A5WA 3D4MA 3HCZA 2LV3A 2FHEA 5F0GA 2C0FA 4OFNA 1GTIA 1K0OA 2VIMA 5JCUA 1W4VA 2IWTA 2VCXA 4BVXA 2PERA 3FK8A 2PPTA 4DSSB 1ILOA 3VWUA 4WF4A 3F8UA 2YWIA 2R2JA 1QGVA 3ISOA 1JZOA 3TRQA 1YQ1A 2M80A 4WR4A 3QAGA 1A2LA 3ZIJA 2A2SA 2MMAA 4K0GA 5D73A 5KN3A 3GKKA 6GSWA 1GUKA 1VRSD 2H73A 2FLSA 1ON4A 2GT6A 4EF0A 3TJGA 5JWQB 2DKIA 1BQ7A 4DSQA 4LL4B 4KCEA 3DKSA 3GHAA 17GSA 3ME8A 2IMKA 5AIXA 1QXHA 5A4UA 1ML6A 5H5SA 2YV9A 2NBSA 1O85A 2XPEA 1U6TA 5IIZA 4KDXA 2PVOC 12GSA 2CA8A 4ZL9A 3QOUA 3BCKA 2V6OA 1F6MC 2KHPA 3SWLA 5DQYA 2BTOT 2QA1A 4CDOA 6GSTA 4NHZA 3C1RA 1B9YC 2MZCA 2VLTA 3R3EA 3IR4A 2R3XA 4K9ZA 4XIHA 2F51A 2E7PA 3APSA 1SENA 5CREA 4GSSA 5IOWA 2JZSA 3QPMA 4WBRD 3EINA 3VWWA 3EWLA 3LSZA 1QK8A 1YY7A 3GN3A 2WGRA 2G2QA 2KUCA 1TP9A 4TXVA 3U6VA 2JU5A 1SD8A 3CTGA 4MF6A 4KAEA 2C80A 2H74A 7GSSA 5G1KA 1FB0A 2LJRA 4IJIA 5ECIB 3G7IA 2CZ3A 4MJEA 2CT6A 5ELAA 5CRWA 2OACA 4NAXA 3TJKA 4FYUA 2ZCTA 3GL3A 4ACSA 1TRVA 2DIZA 1VF4A 4PQ1A 2WCIA 5DJMA 1H4OA 4EE0A 3V1WA 1U3IA 4QL7A 3LXZA 3MIXA 2WZ9A 4J56E 5B8AA 10GSA 1T8EB 4HQSA 1GSEA 3EE2A 3KGKA 2AV4A 1XWGA 2H30A 3ME7A 4Q5QA 3HKRA 2X49A 3FEUA 1XZOA 3M9JA 3Q19A 2LUSA 4MDCA 4GSNA 3Q6OA 4LL1B 2VOCA 2L59A 1U87A 3GKNA 4F0CA 3GX0A 2VCZA 1XVWA 3CTFA 1F3AA 1SYRA 3D22A 5G2ZA 4G0LA 3GSTA 5ID2B 2KLXA 2GLRA 3GTUA 2IIYA 3KMNA 2KP1A 4XHMA 5AGYA 1T7PB 1V9WA 2YWNA 2DJJA 4TR1A 5COHA 1TK5B 4JZQA 1HNAA 3QAWA 2GZPA 2A4VA 2LRTA 2HZEB 4JR4A 6GSYA 1XWKA 1EOGA 1QMVA 3BJ5A 2A2PA 2DC5A 4O5QA 1A2JA 3GMFA 4OCFA 4PXOA 2LRCA 2OBKA 4JEDA 3EYTA 1WPIA 4TR3A 3A2VA 3LJRA 4X4JA 3UBKA 2NDOA 4FH8A 2FD3A 1PN9A 1EEMA 4ULXA 4KE3A 2VLUA 2GQLA 4KA0A 2R0CA 3Q18A 4F2IA 4KW6A 2X8GA 1XOAA 3US3A 3H79A 2XC2A 1V98A 2D2ZA 3RHBA 1O81A 3HA9A 5H5RA 3WYWA 2HRFA 4ZBDA 3QFBC 3ZVJD 1VF1A 1GSUA 1O8WA 4O92A 3ZLPA 2PWJA 2AJQB 1FHEA 3RBTA 4Z7XA 5HFIA 4DSRA 3F63A 1R4WA 4MJBA 1XW9A 4HI7A 2VL2C 3G7JA 3HYPA 1O7UA 2GDRA 4P3YB 4PUAA 4TXOA 5ECMB 3HVVA 3BD2A 1NSWA 2IMFA 11GSA 2VCWA 4TR1B 1K3LA 3WT2A 4TOPA 4GQCA 1OKTA 1YEXA 3IC8A 2OE0A 1AC1A 5IPGA 1Z7RA 4MPGA 2HXKA 2REMA 5GSSA 4DVCA 2GZZA 1BX9A 3E0UA 4OO4A 3TKSA 4HZ4A 5F05A 3QDNA 1TRUA 4K5SA 1JFUA 4G9HA 4ZXGA 3L9SA 4BWQA 1XWAA 4POMA 2H1AA 3KP8A 4GRFA 4G0IA 3W8SA 2VD0A 4AJ8A 2R0PA 4KDUA 2LTKA 1PRXA 4RQRA 3C73A 4X43A 5ECLB 1YF0A 3MWHA 5IMDA 6GSUA 5IMZA 5D93A 2NTOA 1K3YA 1Z6MA 4POLA 5L71A 5J9BA 1ST9A 5IQYA 2H0IA 4IN0A 3VI5A 1X9MB 4RI6A 4KGIA 4MABA 1JZDA 4AGSA 3UVTA 4KF9A 1W89A 2R4VA 3O76A 1X0RA 3PR8A 2A2RA 5DVBA 9GSSA 1Z3EA 1GH2A 3JCML 5DAKA 2QC7A 1XWCA 3TDGA 2Z9SA 1GLPA 1GSYA 1A8YA 4RI7A 4WR5A 3TKPA 4N10A 3KTLA 2YZHA 4N30A 3GV1A 1SJIA 1R5AA 5ECPB 2GSTA 3M8NA 1WJKA 5CRHA 3PH9A 4Q5FA 3FKFA 1V58A 2BJXA 1IYHA 3RDWA 1PGTA 4FQUA 2MYGA 2IPAA 4IHUA 1E6BA 2L6DA 1KBNA 2M72A 2O7KA 2LQOA 4BVYA 4YQMA 2JZTA 3WGDA 2VCVA 4K8MA 1SKRB 2WB9A 4TRXA 4IELA 4V2MA 2H6XA 2X8HA 3H8QA 4K5RA 2LRNA 1M0UA 3A2WA 2CZ2A 1M9BA 3KEBA 1M2DA 2WS2A 4ZL8A 3TB2A 4FIWA 4YKFA 1M99A 2CX4A 3TRXA 3VFIA 2PUKC 2QSIA 2H70A 3HDCA 2VD1A 5CP1A 5DAKB 5GAND 2R37A 4PQIA 2FWFA 2HI7A 2JADA 1JZWA 3HJMA 2FCHA 3LWAA 3HD5A 4IQ1A 4ECIA 2FA8A 3KCMA 5DCGA 3HHVA 2GQMA 1TRWA 2JZRA 4PUFC 1AQXA 1SL2B 2X4AA 1TXXA 5HR0A 3GNJA 3OR5A 1O8XA 2V6KA 1EZKA 2V32A 1EWXA 6GSXA 2CX3A 2CAIA 2KOKA 1PN0A 3TJFA 2OJLA 2C3TA 1B9XC 4O5UA 2VM2A 4BVYB 3DXBA 4KSOA 1S3AA 3QCPA 2GTUA 5A4WA 1X9SB 3H4KA 1ZYQB 1GRXA 4V1Ag 2TRXA 3FR6A 2PVQA 1PQNA 2A4HA 3CBUA 2HE3A 2HRNA 3HZ4A 4EIPA 3GIXA 3GFKA 3KH7A 1CQHA 1FB6A 1TI1A 4L8EA 2YP6A 2NPBA 4GCIA 3VLNA 3IRAA 5H5QA 3EMXA 5KN1A 4HS1A 4ML6A 1ZGNA 3KJYA 3MDKA 4WKWA 3I9V2 3FYGA 3G7YA 3ERGA 3TCOA 5KOXA 1DUGA 2I4AA 3CYNA 2VM1A 3A5IA 1U3AA 4IS0A 3MYDA 3DWVA 1NHYA 4PGTA 1BAYA 4IBPA 2OE1A 2HZFA 2LSTA 2XPDA 5DDLA 4AJ7A 4PQHA 4MK3A 1Z9HA 5IMCA 1XIYA 1ZMAA 3A3TA 1XCCA 2DMMA 5EVOA 3GH6A 4GWRA 2HSYA 1ZOFA 3SBCA 4AF2A 1HYUA 4HU9A 1EP7A 4MH2A 1F9MA 1V2AA 4RQXA 2IMDA 1GULA 2LQQA 1Z7PA 2IFQA 4IW9A 2L5LA 3VK9A 1J9BA 3IHQA 5CO3A 1EV4A 2O8VB 2PGTA 4WETA 4HUAA 1F37A 3LFLA 1EP8A 2H6YA 1VF2A 5J5NA 3MAKA 5ID2A 3J7Yk 4L5OA 8GSSA 4K1FA 1ABAA 4ECJA 5CNWA 1T3BA 1EEJA 5FT3A 3ZFLA 3MNGA 2RUEA 2HZEA 2B7KA 1HNBA 1YF1A 4KUNA 2E2MA 2G0FA 3QMXA 1FG4A 4ECBA 1JLVA 3RPPA 2GS3A 1MEKA 5CYYA 4MZBA 3HJOA 1DBYA 3GKXA 3UARA 2EC4A 1TDIA 1I9DA 1M2AA 3P8WA 4F9ZA 3PPUA 2DLXA 4NV2A 3LW9A 4OMVA 4MJAA 1SK1A 3H93A 3DVXA 3UJ1A 1WIKA 5C04A 3UEMA 3S9FA 5D8IA 5IO2A 2LJKA 1PX7A 5ECHB 3BBYA 3BOAA 2IFQB 2O85A 3IOSA 4HJMA 3DVWA 3KTBA 3NIVA 2QGVA 1WMJA 5ELGA 2J23A 3ZITA 1TK0B 2GZYA 3P7XA 2H75A 1RK4A 4ZIJA 4G0KA 5LCZA 2ES7A 1PD21 4IKHA 3TOTA 4KCAA 5KEJA 1XVQA 1PSQA 1T4YA 4HU7A 1BJXA 2R6KA 2GQKA 5F06A 4KDYA 1A2MA 2LNTA 3LGCA 5ECOB 3PGTA 4GLTA 3APQA 2C0EA 1G6YA 3FZAA 2EIQA 2R0GA 3TRPA 1R7HA 1HNCA 4OWYA 3GURA 4BA7A 5JCWA 2E0QA 3NZNA 2FGXA 2L5OA 1BG5A 1QUWA 1GTBA 3GH9A 3QD9A 3IC4A 1ZCPA 2L6CA 5IM9A 2H8LA 3TKSC 2YZUA 3HY2A 3IK7A 4YAPA 4PNFA 1OKDA 2YN1A 1MD3A 2V41A 2AHEA 4IGJA 2FWGA 4TR0A 3Q74A 3IDVA 1GLQA 3KXOA 2FWEA 4G2EA 1XFLA 5G30A 3IPZA 3GX8A 3DEXA 2ON5A 3TUEA 4PNGA 5B6NA 1A0FA 2YPMA 4Z2TA 1NHOA 1TK8B 4EKZA 2P31A 4N11A 4ZBBA 3TJJA 4EDYA 1AQWA 1TU7A 3EU3A 1MDKA 2HSHA 2H19A 1UVZA 2CAQA 5KOWA 3KZQA 1KNGA 1S3DA 4USSA 2IN3A 3QFAC 5DCHA 3HVSA 2ZNMA 1IYIA 2DMLA 4O7HA 5LD0A 1UC7A 3CXGA 2LEGA 4F82A 2C8UA 4NPBA 3KMOA 3TKQA 1RW1A 2AAWA 4OO5A 2F3MA 5J41A 3D21A 5GZZB 3I6AA 1HQOA 1YZXA 3R2QA 2B7JA 2HRAA 2HYXA 3DD3A 1ZYEA 4XCSA 4TR4A 3G9BA 1H75A 1TW9A 2RM5A 3CRTA 3F6FA 1WOUA 3ZREA 2GSQA 6GSSA 1FVJA 4EO3A 4Z2RA 3UL3A 1YKAA 4NMUA 1XWBA 3D6IA 4YH2A 2VL2A 2YNXA 2H0HA 2DJ3A 5ENUA 1YDKA 1TOFA 2H6ZA 5HFKA 4FO5A 5IMVA 3DYRA 3EC3A 5D9XA 4ZILA 1V57A 2P5RA 3ZRDA 3M0FA 3TOUA 5GSTA 2B1LA 1XW6A 3VWXA 4HOJA 3FY7A 1UA5A 1A0RP 4CY6A 2GSRA 5ECQB 5JWOB 2YJHA 1TKDB 5DALB 1MTCA 2YOIA 1KEBA 1F3BA 3K8NA 1XXUA 1CQGA 2B5EA 4F03A 4V2LA 3CSJA 4RUVA 2IL3A 2IMIA 2DIYA 3F9UA 3EMPA 4OCEA 1UN2A 14GSA 4N0ZA 4QL9A 1XPVA 3VI7A 2I1UA 2I3YA 3TKRA 5HR3A 2ON7A 3IA1A 3F3QA 3ZMKA 2K18A 4YQVA 1YEPA 5D96A 1G6WA 5ECSA 3VPTA 4ISDA 2F9SA 2O87A 3UVHA 4YAVA 4QQ7A 3M9KA 2ALBA 4J2FA 4Q5NA 5EPFA 2PU9C 1XW5A 1A23A 4CW9A 3CSIA 1DE2A 1OE7A 2RUFA 2IJYA 4KB3A 5F8BA 4F0BA 4IP6A 3FMWA 4MPFA 2E2GA 1F2EA 3LXTA 1JZRA 3I43A 4I6XA 1SL1B 3F4RA 1GSDA 18GSA 4LLRA 4HJ2A 1FVKA 3WGXA 2GSSA 5HR1A 2FUG2 5HQPA 2IMEA 3DRNA 1EGRA 5DJLA 1R5PA 4YKGA 2OKAA 3L9UA 1OC3A 5FWGA 3P90A 2I81A 1PL1A 3UOMA 5D9TA 2DJ0A 3RHCA 4K7NA 2M46A 1GNWA 1USBA 2DBCA 5F07A 3VPQA 4EVMA 2AUVA 4AJ6A 1X9WB 1GTUA 3CMIA 5G5FA 4ICYA 2GGTA 1ERUA 1T1VA 1ZYPA 2F8FA 2LS5A 3KH9A 2OBIA 1SJ6A 3GRXA 4PTSA 3ZIVA 4K2XA 5E4WA 4KH7A 4BL7A 3HZ8A 2YCDA 2H01A 2V2GA 3BCIA 5J9CA 1BEDA 5FHIA 3N9JA 2X99A 4ML1A 2VO4A 5AIVA 1G7EA 3FZ4A 3ZTLA 2HRKA 4ZL7A 4EDZA 1XOBA 4O32A 1X5CA 5KN2A 1MD4A 2N5AA 1GSSA 2K8SA 2VAFA 3FHKA 1I5GA 1BYEA 2K8VA 4KSMA 2LKUA 4XS4A 1Y25A 2L4CA 1RQMA 3LORA 2R5GA 5IMAA 4K7IA 2CVDA 4GSTA 2MMNA 3D4TA 3TKSE 4IVFA 3LQ7A 3FZ5A 4E8HA 3GL5A 2WRTA 2H76A 2TIRA 2YWMA 1FW1A 1SKSB 3F4SA 4CHSA 1EGOA 1PL2A 3LG6A 2H1BA 2RM6A 2QKEA 4EC0A 3ERFA 3F4TA 1LU4A 5J4UA 2H72A 2HNLA 1PA3A 2DJ1A 4I97A 3RAZA 1AQVA 1M2BA 4FYBA 3DIEA 2H1GA 3A2XA 3FRCA 1OVNA 5A4VA 3UAPA 4BL7B 3UIWA 2LNSA 3I69A 2DJ2A 22GSA 2FA4A 1GL8A 4GQFA 4BWSA 4MCUA 4XTSA 2B5XA 3UMAA 2CVBA 1GSFA 3GSSA 1YJ6A 3DMLA 1THOA 4XS1A 4OFTA 3N5OA 1SD9A 2YV7A 4K6XA 4JU5A 4BVXB 4LMVA 5KN0A 4NHWA 2HSMA 2VLVA 3PINA 4XS6A 5ECNB 2P5QA 5CRDA 1FOVA 1TTZA 1KTEA 3IV4A 4MZCA 1C72A 4H86A 3U5RE 4XS4B 1T00A 2L57A 1O73A 1SYXA 3ZYWA 19GSA 4XRAA 2WULA 4JRRA 1VF3A 3GA4A 4JBBA 5AN1A 2HFDA 4TN8A 5G1LA 4ZB6A 3W8JA 4MLYA 4ILFA 4ZBAA 4I8BA 3D0ZA 1N8JA 4PX1A 1GSQA 1A8LA 4EIQA 4OD7A 1NW2A 3GKMA 1K3OA 2JSZA 4X0XA 2HT9A 2GT5A 1FAAA 1TRSA 1GP1A 4KX4A 5B6MA 5EL8A 4TW5A 4V2NA 4X1UA 1GUMA 1AIUA 2EIRA 1E2YA 1GTAA 2X64A 1GWCA 3VWVA 3L78A 20GSA 4G19A 4N0VA 4I2TA 5B7CA 5IO0A 3EURA 1K0DA 3E3EA 2B1KA 1TI3A 2L4QA 4GF0A 1FO5A 1WP0A 1X5EA 2AYTA 1Z5YE 3IAM2 1GUHA 2MMOA 3ZMLA 3HXSA 3IXRA 3ZL5A 5BMUA 1PKZA 4BPYA 3ZVJA 2B5YA 1WWJA 1ACVA 1YKCA 2K9FA 5JCGA 1SJZA 2TRCP 3HVXA 2YWOA 3FR9A 3O6TA 4POKA 4YQUA 2C0GA 4MF7A 1OC8A 1ERWA 2BMXA 5D9WA 4WF5A 2J9HA 6GSVA 1OAZA 5IOXA 3VURA 4MP4A 5B8BA 2OE3A 4D73A 2FNOA 2H71A 2NVLA 3F0IA 1SU9A 1R26A 2VCQA 3M3MA 2YANA 2RIIA 1A24A 3IBHA 1G7OA 1JHBA 4K2DA 5BRTA 1J0FA 3WT1A 3ED3A 4K0NA 4ECCA 3D5JA 1EOHA 4HQZA 2B6MA 3UBLA 2RLIA 3E9JB 1K0MA 3IK9A 2FWHA 3L4NA 5IMFA 2C3NA 4WBJA 2X8CA 1XBSA 4XRDA 2LJAA 3DGQA 5E59A 4OFMA 4G10A 1MDJA 5DALA 1K0CA 3GTUB 4JE1A 1X5DA 1ZYNA 5LNKe 5JWRB 4MF5A 1SK0A 4I2UA 1AW9A 1O6JA 1Y6EA 4MA9A 1K0BA 1M9AA 1B4PA 2MBSA 3AY8A 2OADA 2N5BA 3C8EA 1QQ2A 4MZWA 3IHGA 1V40A 2C3QA 4ZB8A 3IE3A 2P0GA 3C1SA 1TJDA 1HD2A 1MDIA 2C1YA 4D73B 4WEYA 4IJ3A 4WXTA 1PMTA 1AAZA 1FOHA 1THXA 2MMZA 4EXJA 3LEFA 2WDUA 4NV5A 3IAS2 3GUSA 3KD0A 2PMTA 5HFGA 3KM6A 1T4ZA 1EV9A 1OC9A 4L0UA 3F3RA 1ERVA 1K0NA 3RPNA 4TVEA 2F8AA 2V1MA 2QA2A 4EUYA 1OE8A 5C00A 4KNDA 3C7MA 4Q5RA 4GTUA 3MSZA 2MBTA 2AB6A 4GXZA 1N2AA 2FY6A 1PKWA 5DBQA 2VL9A 1Z6NA 4NWYA 3CRUA 3FR3A 3NOFA 4A5PA 4EL1A 4DEJA 3TGZA 5A5KA 1B8XA 4TXOB 3EU4A 4J57E 5CAXA 3M1GA 3KIJA 2OA7A 1WRYA 1Q4JA 4I5QA 4O5RA 5HR2A 3W6GA 1WE0A 3LYKA 3EPTA 4IQAA 5J3RA 3FZ9A 2CV4A 5ECRB 2JL4A 4K7OA 5D9VA 1AXDA 3F6DA 3GYKA 4TKYA 2JSYA 5GAPD 3J7Yb 2B3SA 3L0HA 3LYPA 2WFCA 3ERWA 4Z2UA 5AISA 3O3TA 4POBA 4PURA 2H66A 4LA1A 3EVIA 1ZZYA 1B4QA 5INYA 1VGLA 3C71A 2YJ7A 3ZFBA 2WJUA 4NXIA 1OC9B 3QR6A 13GSA 4ID0A 2XBQA 2O89A 4V1Ap 2CQ9A 4E8EA 4FYCA 3P2AA 1LJRA 2DSAA 4MNNA 3CSHA 5ABRA 4MJCA 2K6VA 4LMWA 2VL3A 2C4JA 4MH3A 1SKWB 3H1NA 2ZUPA 1U88A 5G31A 3HJPA 3TJBA 1K0AA 3ZZXA 2XHFA 1Q98A 4DSSA 2VCTA 3APOA 4L5LA 3QAVA 2XBIA 3KP9A 3L9VA 2GVPA 1B48A 1AUCA 2PBJA 5G5EA 3FW2A 5IPHA 1JLWA 1QFNA 2H0GA 4HDEA 2I9HA 5DQSA 1LBKA 1GNEA 2CVKA 2PN8A 4ZB9A 2UZ8A 1DSBA 16GSA 2N5FA 1URMA 2DKHA 2JACA 1ERTA 2C0DA 1DE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OYJ A;  1ZL9 A;  1J08 A;  5CRG A;  1NM3 A;  2H1D A;  1SK2 A;  1SL0 B;  1G0T A;  4JR6 A;  2VUP A;  5EY6 A;  2DJK A;  4IP1 A;  1TU8 A;  1PX6 A;  1S3C A;  4L0W A;  2EIO A;  5ECK B;  4HEA 2;  4MMM A;  3WGE A;  2HLS A;  2KP2 A;  3WD6 A;  1M7T A;  4HZ2 A;  3A5W A;  3D4M A;  3HCZ A;  2LV3 A;  2FHE A;  5F0G A;  2C0F A;  4OFN A;  1GTI A;  1K0O A;  2VIM A;  5JCU A;  1W4V A;  2IWT A;  2VCX A;  4BVX A;  2PER A;  3FK8 A;  2PPT A;  4DSS B;  1ILO A;  3VWU A;  4WF4 A;  3F8U A;  2YWI A;  2R2J A;  1QGV A;  3ISO A;  1JZO A;  3TRQ A;  1YQ1 A;  2M80 A;  4WR4 A;  3QAG A;  1A2L A;  3ZIJ A;  2A2S A;  2MMA A;  4K0G A;  5D73 A;  5KN3 A;  3GKK A;  6GSW A;  1GUK A;  1VRS D;  2H73 A;  2FLS A;  1ON4 A;  2GT6 A;  4EF0 A;  3TJG A;  5JWQ B;  1BQ7 A;  4DSQ A;  4LL4 B;  4KCE A;  3DKS A;  3GHA A;  17GS A;  3ME8 A;  2IMK A;  5AIX A;  1QXH A;  5A4U A;  1ML6 A;  5H5S A;  2YV9 A;  2NBS A;  1O85 A;  2XPE A;  1U6T A;  5IIZ A;  4KDX A;  2PVO C;  12GS A;  2CA8 A;  4ZL9 A;  3QOU A;  3BCK A;  2V6O A;  1F6M C;  2KHP A;  3SWL A;  5DQY A;  2BTO T;  4CDO A;  6GST A;  4NHZ A;  3C1R A;  1B9Y C;  2MZC A;  2VLT A;  3IR4 A;  2R3X A;  4K9Z A;  4XIH A;  2F51 A;  2E7P A;  3APS A;  1SEN A;  5CRE A;  4GSS A;  5IOW A;  2JZS A;  3QPM A;  4WBR D;  3EIN A;  3VWW A;  3EWL A;  3LSZ A;  1QK8 A;  1YY7 A;  3GN3 A;  2WGR A;  2G2Q A;  2KUC A;  1TP9 A;  4TXV A;  3U6V A;  2JU5 A;  1SD8 A;  3CTG A;  4MF6 A;  4KAE A;  2C80 A;  2H74 A;  7GSS A;  5G1K A;  1FB0 A;  2LJR A;  4IJI A;  5ECI B;  3G7I A;  2CZ3 A;  4MJE A;  2CT6 A;  5ELA A;  5CRW A;  2OAC A;  4NAX A;  3TJK A;  4FYU A;  2ZCT A;  3GL3 A;  4ACS A;  1TRV A;  2DIZ A;  1VF4 A;  4PQ1 A;  2WCI A;  5DJM A;  1H4O A;  4EE0 A;  3V1W A;  1U3I A;  4QL7 A;  3LXZ A;  2WZ9 A;  4J56 E;  5B8A A;  10GS A;  1T8E B;  4HQS A;  1GSE A;  3EE2 A;  3KGK A;  2AV4 A;  1XWG A;  2H30 A;  3ME7 A;  4Q5Q A;  3HKR A;  3FEU A;  1XZO A;  3M9J A;  3Q19 A;  2LUS A;  4MDC A;  4GSN A;  3Q6O A;  4LL1 B;  2VOC A;  2L59 A;  1U87 A;  3GKN A;  4F0C A;  3GX0 A;  2VCZ A;  1XVW A;  3CTF A;  1F3A A;  1SYR A;  3D22 A;  5G2Z A;  3GST A;  5ID2 B;  2KLX A;  2GLR A;  3GTU A;  2IIY A;  3KMN A;  2KP1 A;  4XHM A;  5AGY A;  1T7P B;  1V9W A;  2YWN A;  2DJJ A;  4TR1 A;  5COH A;  1TK5 B;  4JZQ A;  1HNA A;  3QAW A;  2GZP A;  2A4V A;  2LRT A;  2HZE B;  4JR4 A;  6GSY A;  1XWK A;  1EOG A;  1QMV A;  3BJ5 A;  2DC5 A;  1A2J A;  3GMF A;  4OCF A;  4PXO A;  2LRC A;  2OBK A;  4JED A;  3EYT A;  1WPI A;  4TR3 A;  3A2V A;  3LJR A;  3UBK A;  2NDO A;  4FH8 A;  2FD3 A;  1PN9 A;  1EEM A;  4ULX A;  4KE3 A;  2VLU A;  2GQL A;  4KA0 A;  3Q18 A;  4F2I A;  4KW6 A;  2X8G A;  1XOA A;  3US3 A;  3H79 A;  2XC2 A;  1V98 A;  2D2Z A;  3RHB A;  1O81 A;  3HA9 A;  5H5R A;  3WYW A;  2HRF A;  4ZBD A;  3QFB C;  3ZVJ D;  1VF1 A;  1GSU A;  1O8W A;  4O92 A;  3ZLP A;  2PWJ A;  2AJQ B;  1FHE A;  3RBT A;  4Z7X A;  5HFI A;  4DSR A;  3F63 A;  1R4W A;  4MJB A;  1XW9 A;  4HI7 A;  2VL2 C;  3G7J A;  3HYP A;  1O7U A;  2GDR A;  4P3Y B;  4PUA A;  4TXO A;  5ECM B;  3HVV A;  3BD2 A;  1NSW A;  2IMF A;  11GS A;  2VCW A;  4TR1 B;  1K3L A;  3WT2 A;  4TOP A;  4GQC A;  1OKT A;  1YEX A;  2OE0 A;  1AC1 A;  5IPG A;  1Z7R A;  4MPG A;  2HXK A;  2REM A;  5GSS A;  4DVC A;  2GZZ A;  1BX9 A;  3E0U A;  4OO4 A;  3TKS A;  4HZ4 A;  5F05 A;  3QDN A;  1TRU A;  1JFU A;  4G9H A;  4ZXG A;  3L9S A;  4BWQ A;  1XWA A;  4POM A;  2H1A A;  3KP8 A;  4GRF A;  3W8S A;  2VD0 A;  4AJ8 A;  4KDU A;  2LTK A;  1PRX A;  4RQR A;  3C73 A;  4X43 A;  5ECL B;  1YF0 A;  3MWH A;  5IMD A;  6GSU A;  5IMZ A;  5D93 A;  2NTO A;  1K3Y A;  1Z6M A;  4POL A;  5L71 A;  5J9B A;  1ST9 A;  5IQY A;  2H0I A;  4IN0 A;  3VI5 A;  1X9M B;  4RI6 A;  4KGI A;  4MAB A;  1JZD A;  4AGS A;  3UVT A;  1W89 A;  2R4V A;  3O76 A;  1X0R A;  3PR8 A;  2A2R A;  5DVB A;  9GSS A;  1Z3E A;  1GH2 A;  3JCM L;  5DAK A;  2QC7 A;  1XWC A;  3TDG A;  2Z9S A;  1GLP A;  1GSY A;  1A8Y A;  4RI7 A;  4WR5 A;  3TKP A;  4N10 A;  3KTL A;  2YZH A;  4N30 A;  3GV1 A;  1SJI A;  1R5A A;  5ECP B;  2GST A;  3M8N A;  1WJK A;  5CRH A;  3PH9 A;  4Q5F A;  3FKF A;  1V58 A;  2BJX A;  1IYH A;  3RDW A;  1PGT A;  2MYG A;  2IPA A;  4IHU A;  1E6B A;  2L6D A;  1KBN A;  2M72 A;  2O7K A;  2LQO A;  4BVY A;  4YQM A;  2JZT A;  3WGD A;  2VCV A;  4K8M A;  1SKR B;  2WB9 A;  4TRX A;  4IEL A;  4V2M A;  2H6X A;  2X8H A;  3H8Q A;  2LRN A;  1M0U A;  3A2W A;  2CZ2 A;  1M9B A;  3KEB A;  1M2D A;  2WS2 A;  4ZL8 A;  3TB2 A;  4FIW A;  1M99 A;  2CX4 A;  3TRX A;  3VFI A;  2PUK C;  2QSI A;  2H70 A;  3HDC A;  2VD1 A;  5CP1 A;  5DAK B;  5GAN D;  2R37 A;  4PQI A;  2FWF A;  2HI7 A;  2JAD A;  1JZW A;  3HJM A;  2FCH A;  3LWA A;  3HD5 A;  4IQ1 A;  4ECI A;  2FA8 A;  3KCM A;  5DCG A;  3HHV A;  2GQM A;  1TRW A;  2JZR A;  4PUF C;  1AQX A;  1SL2 B;  1TXX A;  5HR0 A;  3GNJ A;  3OR5 A;  1O8X A;  2V6K A;  1EZK A;  2V32 A;  1EWX A;  6GSX A;  2CX3 A;  2CAI A;  2KOK A;  3TJF A;  2OJL A;  2C3T A;  1B9X C;  2VM2 A;  3DXB A;  4KSO A;  1S3A A;  3QCP A;  2GTU A;  5A4W A;  1X9S B;  3H4K A;  1ZYQ B;  1GRX A;  4V1A g;  2TRX A;  3FR6 A;  2PVQ A;  1PQN A;  3CBU A;  2HE3 A;  2HRN A;  3HZ4 A;  3GIX A;  3GFK A;  3KH7 A;  1CQH A;  1FB6 A;  1TI1 A;  4L8E A;  2YP6 A;  2NPB A;  4GCI A;  3VLN A;  3IRA A;  5H5Q A;  3EMX A;  5KN1 A;  4HS1 A;  4ML6 A;  1ZGN A;  3KJY A;  3MDK A;  4WKW A;  3I9V 2;  3FYG A;  3G7Y A;  3ERG A;  3TCO A;  1DUG A;  2I4A A;  3CYN A;  2VM1 A;  1U3A A;  4IS0 A;  3DWV A;  1NHY A;  4PGT A;  1BAY A;  4IBP A;  2OE1 A;  2HZF A;  2LST A;  2XPD A;  5DDL A;  4AJ7 A;  4PQH A;  4MK3 A;  1Z9H A;  5IMC A;  1XIY A;  1ZMA A;  3A3T A;  1XCC A;  2DMM A;  5EVO A;  3GH6 A;  4GWR A;  2HSY A;  1ZOF A;  3SBC A;  4AF2 A;  1HYU A;  4HU9 A;  1EP7 A;  4MH2 A;  1F9M A;  1V2A A;  4RQX A;  2IMD A;  1GUL A;  2LQQ A;  1Z7P A;  2IFQ A;  4IW9 A;  2L5L A;  3VK9 A;  1J9B A;  3IHQ A;  5CO3 A;  1EV4 A;  2O8V B;  2PGT A;  4WET A;  4HUA A;  1F37 A;  3LFL A;  1EP8 A;  2H6Y A;  1VF2 A;  5J5N A;  3MAK A;  5ID2 A;  3J7Y k;  4L5O A;  8GSS A;  4K1F A;  1ABA A;  4ECJ A;  5CNW A;  1T3B A;  1EEJ A;  5FT3 A;  3ZFL A;  3MNG A;  2RUE A;  2HZE A;  2B7K A;  1HNB A;  1YF1 A;  4KUN A;  2E2M A;  2G0F A;  3QMX A;  1FG4 A;  4ECB A;  1JLV A;  3RPP A;  2GS3 A;  1MEK A;  5CYY A;  4MZB A;  3HJO A;  1DBY A;  3GKX A;  3UAR A;  2EC4 A;  1TDI A;  1I9D A;  1M2A A;  3P8W A;  4F9Z A;  2DLX A;  4NV2 A;  4OMV A;  4MJA A;  1SK1 A;  3H93 A;  3DVX A;  3UJ1 A;  1WIK A;  5C04 A;  3UEM A;  3S9F A;  5D8I A;  5IO2 A;  2LJK A;  1PX7 A;  5ECH B;  3BBY A;  3BOA A;  2IFQ B;  2O85 A;  3IOS A;  4HJM A;  3DVW A;  3KTB A;  3NIV A;  2QGV A;  1WMJ A;  5ELG A;  2J23 A;  3ZIT A;  1TK0 B;  2GZY A;  3P7X A;  2H75 A;  1RK4 A;  4ZIJ A;  5LCZ A;  2ES7 A;  1PD2 1;  4IKH A;  3TOT A;  4KCA A;  5KEJ A;  1XVQ A;  1PSQ A;  1T4Y A;  4HU7 A;  1BJX A;  2R6K A;  2GQK A;  5F06 A;  4KDY A;  1A2M A;  2LNT A;  3LGC A;  5ECO B;  3PGT A;  4GLT A;  3APQ A;  2C0E A;  1G6Y A;  3FZA A;  2EIQ A;  3TRP A;  1R7H A;  1HNC A;  4OWY A;  3GUR A;  4BA7 A;  5JCW A;  2E0Q A;  3NZN A;  2FGX A;  2L5O A;  1BG5 A;  1QUW A;  1GTB A;  3GH9 A;  3QD9 A;  3IC4 A;  1ZCP A;  2L6C A;  5IM9 A;  2H8L A;  3TKS C;  2YZU A;  3HY2 A;  3IK7 A;  4YAP A;  4PNF A;  1OKD A;  2YN1 A;  1MD3 A;  2V41 A;  2AHE A;  4IGJ A;  2FWG A;  4TR0 A;  3Q74 A;  3IDV A;  1GLQ A;  3KXO A;  2FWE A;  4G2E A;  1XFL A;  5G30 A;  3IPZ A;  3GX8 A;  3DEX A;  2ON5 A;  3TUE A;  4PNG A;  5B6N A;  1A0F A;  2YPM A;  1NHO A;  1TK8 B;  4EKZ A;  2P31 A;  4N11 A;  4ZBB A;  3TJJ A;  4EDY A;  1AQW A;  1TU7 A;  3EU3 A;  1MDK A;  2HSH A;  2H19 A;  1UVZ A;  2CAQ A;  3KZQ A;  1KNG A;  1S3D A;  2IN3 A;  3QFA C;  5DCH A;  3HVS A;  2ZNM A;  1IYI A;  2DML A;  4O7H A;  5LD0 A;  1UC7 A;  3CXG A;  2LEG A;  4F82 A;  2C8U A;  4NPB A;  3KMO A;  3TKQ A;  1RW1 A;  2AAW A;  4OO5 A;  2F3M A;  5J41 A;  3D21 A;  5GZZ B;  3I6A A;  1HQO A;  1YZX A;  3R2Q A;  2B7J A;  2HYX A;  3DD3 A;  1ZYE A;  4XCS A;  4TR4 A;  3G9B A;  1H75 A;  1TW9 A;  2RM5 A;  3CRT A;  3F6F A;  1WOU A;  3ZRE A;  2GSQ A;  6GSS A;  1FVJ A;  4EO3 A;  3UL3 A;  1YKA A;  4NMU A;  1XWB A;  3D6I A;  4YH2 A;  2VL2 A;  2YNX A;  2H0H A;  2DJ3 A;  5ENU A;  1YDK A;  1TOF A;  2H6Z A;  5HFK A;  4FO5 A;  5IMV A;  3DYR A;  3EC3 A;  5D9X A;  4ZIL A;  1V57 A;  2P5R A;  3ZRD A;  3M0F A;  3TOU A;  5GST A;  2B1L A;  1XW6 A;  3VWX A;  4HOJ A;  3FY7 A;  1UA5 A;  1A0R P;  2GSR A;  5ECQ B;  5JWO B;  2YJH A;  1TKD B;  5DAL B;  1MTC A;  2YOI A;  1KEB A;  1F3B A;  3K8N A;  1XXU A;  1CQG A;  2B5E A;  4F03 A;  4V2L A;  3CSJ A;  4RUV A;  2IL3 A;  2IMI A;  2DIY A;  3F9U A;  3EMP A;  4OCE A;  1UN2 A;  14GS A;  4N0Z A;  4QL9 A;  1XPV A;  3VI7 A;  2I1U A;  2I3Y A;  3TKR A;  5HR3 A;  2ON7 A;  3IA1 A;  3F3Q A;  3ZMK A;  2K18 A;  4YQV A;  1YEP A;  5D96 A;  1G6W A;  5ECS A;  3VPT A;  4ISD A;  2F9S A;  2O87 A;  3UVH A;  4YAV A;  4QQ7 A;  3M9K A;  2ALB A;  4J2F A;  4Q5N A;  5EPF A;  2PU9 C;  1XW5 A;  1A23 A;  4CW9 A;  3CSI A;  1DE2 A;  1OE7 A;  2RUF A;  2IJY A;  4KB3 A;  5F8B A;  4F0B A;  4IP6 A;  4MPF A;  2E2G A;  1F2E A;  3LXT A;  1JZR A;  3I43 A;  4I6X A;  1SL1 B;  3F4R A;  1GSD A;  18GS A;  4LLR A;  4HJ2 A;  1FVK A;  3WGX A;  2GSS A;  5HR1 A;  2FUG 2;  5HQP A;  2IME A;  3DRN A;  1EGR A;  5DJL A;  1R5P A;  2OKA A;  3L9U A;  1OC3 A;  5FWG A;  3P90 A;  2I81 A;  1PL1 A;  3UOM A;  5D9T A;  2DJ0 A;  3RHC A;  4K7N A;  2M46 A;  1GNW A;  1USB A;  2DBC A;  5F07 A;  3VPQ A;  4EVM A;  2AUV A;  4AJ6 A;  1X9W B;  1GTU A;  3CMI A;  5G5F A;  2GGT A;  1ERU A;  1T1V A;  2F8F A;  2LS5 A;  3KH9 A;  2OBI A;  1SJ6 A;  3GRX A;  3ZIV A;  5E4W A;  4KH7 A;  4BL7 A;  3HZ8 A;  2YCD A;  2H01 A;  2V2G A;  3BCI A;  5J9C A;  1BED A;  5FHI A;  3N9J A;  2X99 A;  4ML1 A;  2VO4 A;  5AIV A;  1G7E A;  3FZ4 A;  3ZTL A;  4ZL7 A;  4EDZ A;  1XOB A;  4O32 A;  1X5C A;  5KN2 A;  1MD4 A;  2N5A A;  1GSS A;  2K8S A;  2VAF A;  3FHK A;  1I5G A;  1BYE A;  2K8V A;  4KSM A;  2LKU A;  4XS4 A;  1Y25 A;  2L4C A;  1RQM A;  3LOR A;  2R5G A;  5IMA A;  4K7I A;  2CVD A;  4GST A;  2MMN A;  3D4T A;  3TKS E;  4IVF A;  3LQ7 A;  3FZ5 A;  4E8H A;  3GL5 A;  2WRT A;  2H76 A;  2TIR A;  2YWM A;  1FW1 A;  1SKS B;  3F4S A;  4CHS A;  1EGO A;  1PL2 A;  3LG6 A;  2H1B A;  2RM6 A;  2QKE A;  4EC0 A;  3ERF A;  3F4T A;  1LU4 A;  5J4U A;  2H72 A;  2HNL A;  1PA3 A;  2DJ1 A;  4I97 A;  3RAZ A;  1AQV A;  1M2B A;  4FYB A;  3DIE A;  2H1G A;  3A2X A;  3FRC A;  1OVN A;  5A4V A;  3UAP A;  3UIW A;  2LNS A;  3I69 A;  2DJ2 A;  22GS A;  2FA4 A;  1GL8 A;  4GQF A;  4BWS A;  4MCU A;  4XTS A;  2B5X A;  3UMA A;  2CVB A;  1GSF A;  3GSS A;  1YJ6 A;  3DML A;  1THO A;  4XS1 A;  4OFT A;  3N5O A;  1SD9 A;  2YV7 A;  4K6X A;  4JU5 A;  4LMV A;  5KN0 A;  4NHW A;  2VLV A;  3PIN A;  5ECN B;  4XS6 A;  2P5Q A;  5CRD A;  1FOV A;  1TTZ A;  1KTE A;  3IV4 A;  4MZC A;  1C72 A;  4H86 A;  3U5R E;  4XS4 B;  1T00 A;  2L57 A;  1O73 A;  1SYX A;  3ZYW A;  19GS A;  4XRA A;  2WUL A;  4JRR A;  1VF3 A;  3GA4 A;  4JBB A;  5AN1 A;  2HFD A;  4TN8 A;  5G1L A;  4ZB6 A;  3W8J A;  4MLY A;  4ILF A;  4ZBA A;  4I8B A;  3D0Z A;  1N8J A;  4PX1 A;  1GSQ A;  1A8L A;  4OD7 A;  1NW2 A;  3GKM A;  1K3O A;  2JSZ A;  4X0X A;  2HT9 A;  2GT5 A;  1FAA A;  1TRS A;  1GP1 A;  4KX4 A;  5B6M A;  5EL8 A;  4TW5 A;  4V2N A;  4X1U A;  1GUM A;  1AIU A;  2EIR A;  1E2Y A;  1GTA A;  2X64 A;  1GWC A;  3VWV A;  3L78 A;  20GS A;  4G19 A;  4N0V A;  4I2T A;  5B7C A;  5IO0 A;  3EUR A;  1K0D A;  3E3E A;  2B1K A;  1TI3 A;  2L4Q A;  4GF0 A;  1FO5 A;  1WP0 A;  1X5E A;  2AYT A;  1Z5Y E;  3IAM 2;  1GUH A;  2MMO A;  3ZML A;  3HXS A;  3IXR A;  3ZL5 A;  1PKZ A;  4BPY A;  3ZVJ A;  2B5Y A;  1WWJ A;  1ACV A;  1YKC A;  2K9F A;  5JCG A;  1SJZ A;  2TRC P;  3HVX A;  2YWO A;  3FR9 A;  3O6T A;  4POK A;  4YQU A;  2C0G A;  4MF7 A;  1OC8 A;  1ERW A;  2BMX A;  5D9W A;  4WF5 A;  2J9H A;  6GSV A;  1OAZ A;  5IOX A;  3VUR A;  4MP4 A;  5B8B A;  2OE3 A;  4D73 A;  2FNO A;  2H71 A;  2NVL A;  3F0I A;  1SU9 A;  1R26 A;  2VCQ A;  3M3M A;  2YAN A;  2RII A;  1A24 A;  3IBH A;  1G7O A;  1JHB A;  4K2D A;  1J0F A;  3WT1 A;  3ED3 A;  4K0N A;  4ECC A;  3D5J A;  1EOH A;  4HQZ A;  2B6M A;  3UBL A;  2RLI A;  3E9J B;  1K0M A;  3IK9 A;  2FWH A;  3L4N A;  5IMF A;  2C3N A;  4WBJ A;  2X8C A;  1XBS A;  4XRD A;  2LJA A;  3DGQ A;  5E59 A;  4OFM A;  4G10 A;  1MDJ A;  5DAL A;  1K0C A;  3GTU B;  4JE1 A;  1X5D A;  5LNK e;  5JWR B;  4MF5 A;  1SK0 A;  4I2U A;  1AW9 A;  1O6J A;  1Y6E A;  4MA9 A;  1K0B A;  1M9A A;  1B4P A;  2MBS A;  3AY8 A;  2OAD A;  2N5B A;  3C8E A;  1QQ2 A;  4MZW A;  1V40 A;  2C3Q A;  4ZB8 A;  3IE3 A;  2P0G A;  3C1S A;  1TJD A;  1HD2 A;  1MDI A;  2C1Y A;  4D73 B;  4WEY A;  4IJ3 A;  4WXT A;  1PMT A;  1AAZ A;  1THX A;  2MMZ A;  4EXJ A;  3LEF A;  2WDU A;  4NV5 A;  3IAS 2;  3GUS A;  3KD0 A;  2PMT A;  5HFG A;  3KM6 A;  1T4Z A;  1EV9 A;  1OC9 A;  4L0U A;  3F3R A;  1ERV A;  1K0N A;  3RPN A;  4TVE A;  2F8A A;  2V1M A;  4EUY A;  1OE8 A;  5C00 A;  4KND A;  3C7M A;  4Q5R A;  4GTU A;  3MSZ A;  2MBT A;  2AB6 A;  4GXZ A;  1N2A A;  2FY6 A;  1PKW A;  5DBQ A;  2VL9 A;  1Z6N A;  4NWY A;  3CRU A;  3FR3 A;  3NOF A;  4EL1 A;  4DEJ A;  3TGZ A;  5A5K A;  1B8X A;  4TXO B;  3EU4 A;  4J57 E;  5CAX A;  3M1G A;  3KIJ A;  2OA7 A;  1WRY A;  1Q4J A;  4I5Q A;  4O5R A;  5HR2 A;  3W6G A;  1WE0 A;  3LYK A;  4IQA A;  5J3R A;  3FZ9 A;  2CV4 A;  5ECR B;  2JL4 A;  4K7O A;  5D9V A;  1AXD A;  3F6D A;  3GYK A;  4TKY A;  2JSY A;  5GAP D;  3J7Y b;  2B3S A;  3L0H A;  3LYP A;  2WFC A;  3ERW A;  5AIS A;  3O3T A;  4POB A;  4PUR A;  2H66 A;  4LA1 A;  3EVI A;  1ZZY A;  1B4Q A;  5INY A;  1VGL A;  3C71 A;  2YJ7 A;  3ZFB A;  2WJU A;  4NXI A;  1OC9 B;  3QR6 A;  13GS A;  4ID0 A;  2XBQ A;  2O89 A;  4V1A p;  2CQ9 A;  4E8E A;  4FYC A;  3P2A A;  1LJR A;  2DSA A;  3CSH A;  5ABR A;  4MJC A;  2K6V A;  4LMW A;  2VL3 A;  2C4J A;  4MH3 A;  1SKW B;  3H1N A;  2ZUP A;  1U88 A;  5G31 A;  3HJP A;  3TJB A;  1K0A A;  3ZZX A;  2XHF A;  1Q98 A;  4DSS A;  2VCT A;  3APO A;  4L5L A;  3QAV A;  2XBI A;  3KP9 A;  3L9V A;  2GVP A;  1B48 A;  1AUC A;  2PBJ A;  5G5E A;  3FW2 A;  5IPH A;  1JLW A;  1QFN A;  2H0G A;  4HDE A;  2I9H A;  5DQS A;  1LBK A;  1GNE A;  2CVK A;  2PN8 A;  4ZB9 A;  1DSB A;  16GS A;  2N5F A;  1URM A;  2JAC A;  1ERT A;  2C0D A;  1DE1 A; 
#chains in the Genus database with same CATH topology
 4CY8 A;  1OYJ A;  1ZL9 A;  1J08 A;  5CRG A;  1NM3 A;  2H1D A;  1SK2 A;  1SL0 B;  1G0T A;  4JR6 A;  2VUP A;  5EY6 A;  2DJK A;  4IP1 A;  1TU8 A;  1PX6 A;  1S3C A;  4L0W A;  2EIO A;  5ECK B;  4HEA 2;  4MMM A;  3WGE A;  2HLS A;  2KP2 A;  3WD6 A;  1M7T A;  4HZ2 A;  3A5W A;  3D4M A;  3HCZ A;  2LV3 A;  2FHE A;  5F0G A;  2C0F A;  4OFN A;  1GTI A;  1K0O A;  2VIM A;  5JCU A;  1W4V A;  2IWT A;  2VCX A;  4BVX A;  2PER A;  3FK8 A;  2PPT A;  4DSS B;  1ILO A;  3VWU A;  4WF4 A;  3F8U A;  2YWI A;  2R2J A;  1QGV A;  3ISO A;  1JZO A;  3TRQ A;  1YQ1 A;  2M80 A;  4WR4 A;  3QAG A;  1A2L A;  3ZIJ A;  2A2S A;  2MMA A;  4K0G A;  5D73 A;  5KN3 A;  3GKK A;  6GSW A;  1GUK A;  1VRS D;  2H73 A;  2FLS A;  1ON4 A;  2GT6 A;  4EF0 A;  3TJG A;  5JWQ B;  2DKI A;  1BQ7 A;  4DSQ A;  4LL4 B;  4KCE A;  3DKS A;  3GHA A;  17GS A;  3ME8 A;  2IMK A;  5AIX A;  1QXH A;  5A4U A;  1ML6 A;  5H5S A;  2YV9 A;  2NBS A;  1O85 A;  2XPE A;  1U6T A;  5IIZ A;  4KDX A;  2PVO C;  12GS A;  2CA8 A;  4ZL9 A;  3QOU A;  3BCK A;  2V6O A;  1F6M C;  2KHP A;  3SWL A;  5DQY A;  2BTO T;  2QA1 A;  4CDO A;  6GST A;  4NHZ A;  3C1R A;  1B9Y C;  2MZC A;  2VLT A;  3R3E A;  3IR4 A;  2R3X A;  4K9Z A;  4XIH A;  2F51 A;  2E7P A;  3APS A;  1SEN A;  5CRE A;  4GSS A;  5IOW A;  2JZS A;  3QPM A;  4WBR D;  3EIN A;  3VWW A;  3EWL A;  3LSZ A;  1QK8 A;  1YY7 A;  3GN3 A;  2WGR A;  2G2Q A;  2KUC A;  1TP9 A;  4TXV A;  3U6V A;  2JU5 A;  1SD8 A;  3CTG A;  4MF6 A;  4KAE A;  2C80 A;  2H74 A;  7GSS A;  5G1K A;  1FB0 A;  2LJR A;  4IJI A;  5ECI B;  3G7I A;  2CZ3 A;  4MJE A;  2CT6 A;  5ELA A;  5CRW A;  2OAC A;  4NAX A;  3TJK A;  4FYU A;  2ZCT A;  3GL3 A;  4ACS A;  1TRV A;  2DIZ A;  1VF4 A;  4PQ1 A;  2WCI A;  5DJM A;  1H4O A;  4EE0 A;  3V1W A;  1U3I A;  4QL7 A;  3LXZ A;  3MIX A;  2WZ9 A;  4J56 E;  5B8A A;  10GS A;  1T8E B;  4HQS A;  1GSE A;  3EE2 A;  3KGK A;  2AV4 A;  1XWG A;  2H30 A;  3ME7 A;  4Q5Q A;  3HKR A;  2X49 A;  3FEU A;  1XZO A;  3M9J A;  3Q19 A;  2LUS A;  4MDC A;  4GSN A;  3Q6O A;  4LL1 B;  2VOC A;  2L59 A;  1U87 A;  3GKN A;  4F0C A;  3GX0 A;  2VCZ A;  1XVW A;  3CTF A;  1F3A A;  1SYR A;  3D22 A;  5G2Z A;  4G0L A;  3GST A;  5ID2 B;  2KLX A;  2GLR A;  3GTU A;  2IIY A;  3KMN A;  2KP1 A;  4XHM A;  5AGY A;  1T7P B;  1V9W A;  2YWN A;  2DJJ A;  4TR1 A;  5COH A;  1TK5 B;  4JZQ A;  1HNA A;  3QAW A;  2GZP A;  2A4V A;  2LRT A;  2HZE B;  4JR4 A;  6GSY A;  1XWK A;  1EOG A;  1QMV A;  3BJ5 A;  2A2P A;  2DC5 A;  4O5Q A;  1A2J A;  3GMF A;  4OCF A;  4PXO A;  2LRC A;  2OBK A;  4JED A;  3EYT A;  1WPI A;  4TR3 A;  3A2V A;  3LJR A;  4X4J A;  3UBK A;  2NDO A;  4FH8 A;  2FD3 A;  1PN9 A;  1EEM A;  4ULX A;  4KE3 A;  2VLU A;  2GQL A;  4KA0 A;  2R0C A;  3Q18 A;  4F2I A;  4KW6 A;  2X8G A;  1XOA A;  3US3 A;  3H79 A;  2XC2 A;  1V98 A;  2D2Z A;  3RHB A;  1O81 A;  1M3J A;  3HA9 A;  5H5R A;  3WYW A;  2HRF A;  4ZBD A;  3QFB C;  3ZVJ D;  1VF1 A;  1GSU A;  1O8W A;  4O92 A;  3ZLP A;  2PWJ A;  2AJQ B;  1FHE A;  3RBT A;  4Z7X A;  5HFI A;  4DSR A;  3F63 A;  1R4W A;  4MJB A;  1XW9 A;  4HI7 A;  2VL2 C;  3G7J A;  3HYP A;  1O7U A;  2GDR A;  4P3Y B;  4PUA A;  4TXO A;  5ECM B;  3HVV A;  3BD2 A;  1NSW A;  2IMF A;  11GS A;  2VCW A;  4TR1 B;  1K3L A;  3WT2 A;  4TOP A;  4GQC A;  1OKT A;  1YEX A;  3IC8 A;  2OE0 A;  1AC1 A;  5IPG A;  1Z7R A;  4MPG A;  2HXK A;  2REM A;  5GSS A;  4DVC A;  2GZZ A;  1BX9 A;  3E0U A;  4OO4 A;  3TKS A;  4HZ4 A;  5F05 A;  3QDN A;  1TRU A;  4K5S A;  1JFU A;  4G9H A;  4ZXG A;  3L9S A;  4BWQ A;  1XWA A;  4POM A;  2H1A A;  3KP8 A;  4GRF A;  4G0I A;  3W8S A;  2VD0 A;  4AJ8 A;  2R0P A;  4KDU A;  2LTK A;  1PRX A;  4RQR A;  3C73 A;  4X43 A;  5ECL B;  1YF0 A;  3MWH A;  5IMD A;  6GSU A;  5IMZ A;  5D93 A;  2NTO A;  1K3Y A;  1Z6M A;  4POL A;  5L71 A;  5J9B A;  1ST9 A;  5IQY A;  2H0I A;  4IN0 A;  3VI5 A;  1X9M B;  4RI6 A;  4KGI A;  4MAB A;  1JZD A;  4AGS A;  3UVT A;  4KF9 A;  1W89 A;  2R4V A;  3O76 A;  1X0R A;  3PR8 A;  2A2R A;  5DVB A;  9GSS A;  1Z3E A;  1GH2 A;  3JCM L;  5DAK A;  2QC7 A;  1XWC A;  3TDG A;  2Z9S A;  1GLP A;  1GSY A;  1A8Y A;  4RI7 A;  4WR5 A;  3TKP A;  4N10 A;  3KTL A;  2YZH A;  4N30 A;  3GV1 A;  1SJI A;  1R5A A;  5ECP B;  2GST A;  3M8N A;  1WJK A;  5CRH A;  3PH9 A;  4Q5F A;  3FKF A;  1V58 A;  2BJX A;  1IYH A;  3RDW A;  1PGT A;  4FQU A;  2MYG A;  2IPA A;  4IHU A;  1E6B A;  2L6D A;  1KBN A;  2M72 A;  2O7K A;  2LQO A;  4BVY A;  4YQM A;  2JZT A;  3WGD A;  2VCV A;  4K8M A;  1SKR B;  2WB9 A;  4TRX A;  4IEL A;  4V2M A;  2H6X A;  2X8H A;  3H8Q A;  4K5R A;  2LRN A;  1M0U A;  3A2W A;  2CZ2 A;  1M9B A;  3KEB A;  1M2D A;  2WS2 A;  4ZL8 A;  3TB2 A;  4FIW A;  4YKF A;  1M99 A;  2CX4 A;  3TRX A;  3VFI A;  2PUK C;  2QSI A;  2H70 A;  3HDC A;  2VD1 A;  5CP1 A;  5DAK B;  5GAN D;  2R37 A;  4PQI A;  2FWF A;  2HI7 A;  2JAD A;  1JZW A;  3HJM A;  2FCH A;  3LWA A;  3HD5 A;  4IQ1 A;  4ECI A;  2FA8 A;  3KCM A;  5DCG A;  3HHV A;  2GQM A;  1TRW A;  2JZR A;  4PUF C;  1AQX A;  1SL2 B;  2X4A A;  1TXX A;  5HR0 A;  3GNJ A;  3OR5 A;  1O8X A;  2V6K A;  1EZK A;  2V32 A;  1EWX A;  6GSX A;  2CX3 A;  2CAI A;  2KOK A;  1PN0 A;  3TJF A;  2OJL A;  2C3T A;  1B9X C;  4O5U A;  2VM2 A;  4BVY B;  3DXB A;  4KSO A;  1S3A A;  3QCP A;  2GTU A;  5A4W A;  1X9S B;  3H4K A;  1ZYQ B;  1GRX A;  4V1A g;  2TRX A;  3FR6 A;  2PVQ A;  1PQN A;  2A4H A;  3CBU A;  2HE3 A;  2HRN A;  3HZ4 A;  4EIP A;  3GIX A;  3GFK A;  3KH7 A;  1CQH A;  1FB6 A;  1TI1 A;  4L8E A;  2YP6 A;  2NPB A;  4GCI A;  3VLN A;  3IRA A;  5H5Q A;  3EMX A;  5KN1 A;  4HS1 A;  4ML6 A;  1ZGN A;  3KJY A;  3MDK A;  4WKW A;  3I9V 2;  3FYG A;  3G7Y A;  3ERG A;  3TCO A;  5KOX A;  1DUG A;  2I4A A;  3CYN A;  2VM1 A;  3A5I A;  1U3A A;  4IS0 A;  3MYD A;  3DWV A;  1NHY A;  4PGT A;  1BAY A;  4IBP A;  2OE1 A;  2HZF A;  2LST A;  2XPD A;  5DDL A;  4AJ7 A;  4PQH A;  4MK3 A;  1Z9H A;  5IMC A;  1XIY A;  1ZMA A;  3A3T A;  1XCC A;  2DMM A;  5EVO A;  3GH6 A;  4GWR A;  2HSY A;  1ZOF A;  3SBC A;  4AF2 A;  1HYU A;  4HU9 A;  1EP7 A;  4MH2 A;  1F9M A;  1V2A A;  4RQX A;  2IMD A;  1GUL A;  2LQQ A;  1Z7P A;  2IFQ A;  4IW9 A;  2L5L A;  3VK9 A;  1J9B A;  3IHQ A;  4HSC X;  5CO3 A;  1EV4 A;  2O8V B;  2PGT A;  4WET A;  4HUA A;  1F37 A;  3LFL A;  1EP8 A;  2H6Y A;  1VF2 A;  5J5N A;  3MAK A;  5ID2 A;  3J7Y k;  4L5O A;  8GSS A;  4K1F A;  1ABA A;  4ECJ A;  5CNW A;  1T3B A;  1EEJ A;  5FT3 A;  3ZFL A;  3MNG A;  2RUE A;  2HZE A;  2B7K A;  1HNB A;  1YF1 A;  4KUN A;  2E2M A;  2G0F A;  3QMX A;  1FG4 A;  4ECB A;  1JLV A;  3RPP A;  2GS3 A;  1MEK A;  5CYY A;  4MZB A;  3HJO A;  1DBY A;  3GKX A;  3UAR A;  2EC4 A;  1TDI A;  1I9D A;  1M2A A;  3P8W A;  4F9Z A;  3PPU A;  2DLX A;  4NV2 A;  3LW9 A;  4OMV A;  4MJA A;  1SK1 A;  3H93 A;  3DVX A;  3UJ1 A;  1WIK A;  5C04 A;  3UEM A;  3S9F A;  5D8I A;  5IO2 A;  2LJK A;  1PX7 A;  5ECH B;  3BBY A;  3BOA A;  2IFQ B;  2O85 A;  3IOS A;  4HJM A;  3DVW A;  3KTB A;  3NIV A;  2QGV A;  1WMJ A;  5ELG A;  2J23 A;  3ZIT A;  1TK0 B;  2GZY A;  3P7X A;  2H75 A;  1RK4 A;  4ZIJ A;  4G0K A;  5LCZ A;  2ES7 A;  1PD2 1;  4IKH A;  3TOT A;  4KCA A;  5KEJ A;  1XVQ A;  1PSQ A;  1T4Y A;  4HU7 A;  1BJX A;  2R6K A;  2GQK A;  5F06 A;  4KDY A;  1A2M A;  2LNT A;  3LGC A;  5ECO B;  3PGT A;  4GLT A;  3APQ A;  2C0E A;  1G6Y A;  3FZA A;  2EIQ A;  2R0G A;  3TRP A;  1R7H A;  1HNC A;  4OWY A;  3GUR A;  4BA7 A;  5JCW A;  2E0Q A;  3NZN A;  2FGX A;  2L5O A;  1BG5 A;  3CQF A;  1QUW A;  1GTB A;  3GH9 A;  3QD9 A;  3IC4 A;  1ZCP A;  2L6C A;  5IM9 A;  3HVN A;  2H8L A;  3TKS C;  2YZU A;  3HY2 A;  3IK7 A;  4YAP A;  4PNF A;  1OKD A;  2YN1 A;  1MD3 A;  2V41 A;  2AHE A;  4IGJ A;  2FWG A;  4TR0 A;  3Q74 A;  3IDV A;  1GLQ A;  3KXO A;  2FWE A;  4G2E A;  1XFL A;  5G30 A;  3IPZ A;  3GX8 A;  3DEX A;  2ON5 A;  3TUE A;  4PNG A;  5B6N A;  1A0F A;  2YPM A;  4Z2T A;  1NHO A;  1TK8 B;  4EKZ A;  2P31 A;  4N11 A;  4ZBB A;  3TJJ A;  4EDY A;  1AQW A;  1TU7 A;  3EU3 A;  1MDK A;  2HSH A;  2H19 A;  1UVZ A;  2CAQ A;  5KOW A;  3KZQ A;  1KNG A;  1S3D A;  4USS A;  2IN3 A;  3QFA C;  5DCH A;  3HVS A;  2ZNM A;  1IYI A;  2DML A;  4O7H A;  5LD0 A;  1UC7 A;  3CXG A;  2LEG A;  4F82 A;  2C8U A;  4NPB A;  3KMO A;  3TKQ A;  1RW1 A;  2AAW A;  4OO5 A;  2F3M A;  5J41 A;  3D21 A;  5GZZ B;  3I6A A;  1HQO A;  1YZX A;  3R2Q A;  2B7J A;  2HRA A;  2HYX A;  3DD3 A;  1ZYE A;  4XCS A;  4TR4 A;  3G9B A;  1H75 A;  1TW9 A;  2RM5 A;  3CRT A;  3F6F A;  1WOU A;  3ZRE A;  2GSQ A;  6GSS A;  1FVJ A;  4EO3 A;  4Z2R A;  3UL3 A;  1YKA A;  4NMU A;  1XWB A;  3D6I A;  4YH2 A;  2VL2 A;  2YNX A;  2H0H A;  2DJ3 A;  5ENU A;  1YDK A;  1TOF A;  2H6Z A;  5HFK A;  4FO5 A;  5IMV A;  3DYR A;  3EC3 A;  5D9X A;  4ZIL A;  1V57 A;  2P5R A;  3ZRD A;  3M0F A;  3TOU A;  5GST A;  2B1L A;  1XW6 A;  3VWX A;  4BIK A;  4HOJ A;  3FY7 A;  1UA5 A;  1A0R P;  4CY6 A;  2GSR A;  5ECQ B;  5JWO B;  2YJH A;  1TKD B;  5DAL B;  1MTC A;  2YOI A;  1KEB A;  1F3B A;  3K8N A;  1XXU A;  1CQG A;  2B5E A;  4F03 A;  4V2L A;  3CSJ A;  4RUV A;  2IL3 A;  2IMI A;  2DIY A;  3F9U A;  1S3R A;  3EMP A;  4OCE A;  1UN2 A;  14GS A;  4N0Z A;  4QL9 A;  1XPV A;  3VI7 A;  2I1U A;  2I3Y A;  3TKR A;  5HR3 A;  2ON7 A;  3IA1 A;  3F3Q A;  3ZMK A;  2K18 A;  4YQV A;  1YEP A;  5D96 A;  1G6W A;  5ECS A;  3VPT A;  4ISD A;  2F9S A;  2O87 A;  3UVH A;  4YAV A;  4QQ7 A;  3M9K A;  2ALB A;  4J2F A;  4Q5N A;  5EPF A;  2PU9 C;  1XW5 A;  1A23 A;  4CW9 A;  3CSI A;  1DE2 A;  1OE7 A;  2RUF A;  2IJY A;  4KB3 A;  5F8B A;  4F0B A;  4IP6 A;  3FMW A;  4MPF A;  2E2G A;  1F2E A;  3LXT A;  1JZR A;  3I43 A;  4I6X A;  1SL1 B;  3F4R A;  1GSD A;  18GS A;  4LLR A;  4HJ2 A;  1FVK A;  3WGX A;  2GSS A;  5HR1 A;  2FUG 2;  5HQP A;  2IME A;  3DRN A;  1EGR A;  5DJL A;  1R5P A;  4YKG A;  2OKA A;  3L9U A;  1OC3 A;  5FWG A;  3P90 A;  2I81 A;  1PL1 A;  3UOM A;  5D9T A;  2DJ0 A;  3RHC A;  4K7N A;  2M46 A;  1GNW A;  1USB A;  2DBC A;  5F07 A;  3VPQ A;  4EVM A;  2AUV A;  4AJ6 A;  1X9W B;  1GTU A;  3CMI A;  5G5F A;  1M3I A;  4ICY A;  2GGT A;  1ERU A;  1T1V A;  1ZYP A;  2F8F A;  2LS5 A;  3KH9 A;  2OBI A;  1SJ6 A;  3GRX A;  4PTS A;  3ZIV A;  4K2X A;  5E4W A;  4KH7 A;  4BL7 A;  3HZ8 A;  2YCD A;  2H01 A;  2V2G A;  3BCI A;  5J9C A;  1PFO A;  1BED A;  5FHI A;  3N9J A;  2X99 A;  4ML1 A;  2VO4 A;  5AIV A;  1G7E A;  3FZ4 A;  3ZTL A;  2HRK A;  4ZL7 A;  4EDZ A;  1XOB A;  4O32 A;  1X5C A;  5KN2 A;  1MD4 A;  2N5A A;  1GSS A;  2K8S A;  2VAF A;  3FHK A;  1I5G A;  1BYE A;  2K8V A;  4KSM A;  2LKU A;  4XS4 A;  1Y25 A;  2L4C A;  1RQM A;  3LOR A;  2R5G A;  5IMA A;  4K7I A;  2CVD A;  4GST A;  2MMN A;  3D4T A;  3TKS E;  4IVF A;  3LQ7 A;  3FZ5 A;  4E8H A;  3GL5 A;  2WRT A;  2H76 A;  2TIR A;  2YWM A;  1FW1 A;  1SKS B;  3F4S A;  4CHS A;  1EGO A;  1PL2 A;  3LG6 A;  2H1B A;  2RM6 A;  2QKE A;  4EC0 A;  3ERF A;  3F4T A;  1LU4 A;  5J4U A;  2H72 A;  2HNL A;  1PA3 A;  2DJ1 A;  4I97 A;  3RAZ A;  1AQV A;  1M2B A;  4FYB A;  3DIE A;  2H1G A;  3A2X A;  3FRC A;  1OVN A;  5A4V A;  3UAP A;  4BL7 B;  3UIW A;  2LNS A;  3I69 A;  2DJ2 A;  22GS A;  2FA4 A;  1GL8 A;  4GQF A;  4BWS A;  4MCU A;  4XTS A;  2B5X A;  3UMA A;  2CVB A;  1GSF A;  3GSS A;  1YJ6 A;  3DML A;  1THO A;  4XS1 A;  4OFT A;  3N5O A;  1SD9 A;  2YV7 A;  4K6X A;  4JU5 A;  4BVX B;  4LMV A;  5KN0 A;  4NHW A;  2HSM A;  2VLV A;  3PIN A;  4XS6 A;  5ECN B;  2P5Q A;  5CRD A;  1FOV A;  1TTZ A;  1KTE A;  3IV4 A;  4MZC A;  1C72 A;  4H86 A;  3U5R E;  4XS4 B;  1T00 A;  2L57 A;  1O73 A;  1SYX A;  3ZYW A;  19GS A;  4XRA A;  2WUL A;  4JRR A;  1VF3 A;  3GA4 A;  4JBB A;  5AN1 A;  2HFD A;  4TN8 A;  5G1L A;  4ZB6 A;  3W8J A;  4MLY A;  4ILF A;  4ZBA A;  4I8B A;  3D0Z A;  1N8J A;  4PX1 A;  1GSQ A;  1A8L A;  4EIQ A;  4OD7 A;  1NW2 A;  3GKM A;  1K3O A;  2JSZ A;  4X0X A;  2HT9 A;  2GT5 A;  1FAA A;  1TRS A;  1GP1 A;  4KX4 A;  5B6M A;  5EL8 A;  4TW5 A;  4V2N A;  4X1U A;  1GUM A;  1AIU A;  2EIR A;  1E2Y A;  1GTA A;  2X64 A;  1GWC A;  3VWV A;  3L78 A;  20GS A;  4G19 A;  4N0V A;  4I2T A;  5B7C A;  5IO0 A;  3EUR A;  1K0D A;  3E3E A;  2B1K A;  1TI3 A;  2L4Q A;  4GF0 A;  1FO5 A;  1WP0 A;  1X5E A;  2AYT A;  1Z5Y E;  3IAM 2;  1GUH A;  2MMO A;  3ZML A;  3HXS A;  3IXR A;  3ZL5 A;  5BMU A;  1PKZ A;  4BPY A;  3ZVJ A;  2B5Y A;  1WWJ A;  1ACV A;  1YKC A;  2K9F A;  5JCG A;  1SJZ A;  2TRC P;  3HVX A;  2YWO A;  3FR9 A;  3O6T A;  4POK A;  4YQU A;  2C0G A;  4MF7 A;  1OC8 A;  1ERW A;  2BMX A;  5D9W A;  4WF5 A;  2J9H A;  6GSV A;  1OAZ A;  5IOX A;  3VUR A;  4MP4 A;  5B8B A;  2OE3 A;  4D73 A;  2FNO A;  2H71 A;  2NVL A;  3F0I A;  1SU9 A;  1R26 A;  2VCQ A;  3M3M A;  2YAN A;  2RII A;  1A24 A;  3IBH A;  1G7O A;  1JHB A;  4K2D A;  5BRT A;  1J0F A;  3WT1 A;  3ED3 A;  4K0N A;  4ECC A;  3D5J A;  1EOH A;  4HQZ A;  2B6M A;  3UBL A;  2RLI A;  3E9J B;  1K0M A;  3IK9 A;  2FWH A;  3L4N A;  5IMF A;  2C3N A;  4WBJ A;  2X8C A;  1XBS A;  4XRD A;  2LJA A;  3DGQ A;  5E59 A;  4OFM A;  4G10 A;  1MDJ A;  5DAL A;  1K0C A;  3GTU B;  4JE1 A;  1X5D A;  1ZYN A;  5LNK e;  5JWR B;  4MF5 A;  1SK0 A;  4I2U A;  1AW9 A;  1O6J A;  1Y6E A;  4MA9 A;  1K0B A;  1M9A A;  1B4P A;  2MBS A;  3AY8 A;  2OAD A;  2N5B A;  3C8E A;  1QQ2 A;  4MZW A;  3IHG A;  1V40 A;  2C3Q A;  4ZB8 A;  3IE3 A;  2P0G A;  3C1S A;  1TJD A;  1HD2 A;  1MDI A;  2C1Y A;  4D73 B;  4WEY A;  4IJ3 A;  4WXT A;  1PMT A;  1AAZ A;  1FOH A;  1THX A;  2MMZ A;  4EXJ A;  3LEF A;  2WDU A;  4NV5 A;  3IAS 2;  3GUS A;  3KD0 A;  2PMT A;  5HFG A;  3KM6 A;  1T4Z A;  1EV9 A;  1OC9 A;  4L0U A;  3F3R A;  1ERV A;  1K0N A;  3RPN A;  4TVE A;  2F8A A;  2V1M A;  2QA2 A;  4EUY A;  1OE8 A;  5C00 A;  4KND A;  3C7M A;  4Q5R A;  4GTU A;  3MSZ A;  2MBT A;  2AB6 A;  4GXZ A;  1N2A A;  2FY6 A;  1PKW A;  5DBQ A;  2VL9 A;  1Z6N A;  4NWY A;  3CRU A;  3FR3 A;  3NOF A;  4A5P A;  4EL1 A;  4DEJ A;  3TGZ A;  5A5K A;  1B8X A;  4TXO B;  3EU4 A;  4J57 E;  5CAX A;  3M1G A;  3KIJ A;  2OA7 A;  1WRY A;  1Q4J A;  4I5Q A;  4O5R A;  5HR2 A;  3W6G A;  1WE0 A;  3LYK A;  3EPT A;  4IQA A;  5J3R A;  3FZ9 A;  2CV4 A;  5ECR B;  2JL4 A;  4K7O A;  5D9V A;  1AXD A;  3F6D A;  3GYK A;  4TKY A;  2JSY A;  5GAP D;  3J7Y b;  2B3S A;  3L0H A;  3LYP A;  2WFC A;  3ERW A;  4Z2U A;  5AIS A;  3O3T A;  4POB A;  4PUR A;  2H66 A;  4LA1 A;  3EVI A;  1ZZY A;  1B4Q A;  5INY A;  1VGL A;  3C71 A;  2YJ7 A;  3ZFB A;  2WJU A;  4NXI A;  1OC9 B;  3QR6 A;  13GS A;  4ID0 A;  2XBQ A;  2O89 A;  4V1A p;  2CQ9 A;  4E8E A;  4FYC A;  3P2A A;  1LJR A;  2DSA A;  4MNN A;  3CSH A;  5ABR A;  4MJC A;  2K6V A;  4LMW A;  2VL3 A;  2C4J A;  4MH3 A;  1SKW B;  3H1N A;  2ZUP A;  1U88 A;  5G31 A;  3HJP A;  3TJB A;  1K0A A;  3ZZX A;  2XHF A;  1Q98 A;  4DSS A;  2VCT A;  3APO A;  4L5L A;  3QAV A;  2XBI A;  3KP9 A;  3L9V A;  2GVP A;  1B48 A;  1AUC A;  2PBJ A;  1XG8 A;  5G5E A;  3FW2 A;  5IPH A;  1JLW A;  1QFN A;  2H0G A;  4HDE A;  2I9H A;  5DQS A;  1LBK A;  1GNE A;  2CVK A;  2PN8 A;  4ZB9 A;  2UZ8 A;  1DSB A;  16GS A;  2N5F A;  1URM A;  2DKH A;  2JAC A;  1ERT A;  2C0D A;  1DE1 A; 
#chains in the Genus database with same CATH homology
 4CY8 A;  1OYJ A;  1ZL9 A;  1J08 A;  5CRG A;  1NM3 A;  2H1D A;  1SK2 A;  1SL0 B;  1G0T A;  4JR6 A;  2VUP A;  5EY6 A;  2DJK A;  4IP1 A;  1TU8 A;  1PX6 A;  1S3C A;  4L0W A;  2EIO A;  5ECK B;  4HEA 2;  4MMM A;  3WGE A;  2HLS A;  2KP2 A;  3WD6 A;  1M7T A;  4HZ2 A;  3A5W A;  3D4M A;  3HCZ A;  2LV3 A;  2FHE A;  5F0G A;  2C0F A;  4OFN A;  1GTI A;  1K0O A;  2VIM A;  5JCU A;  1W4V A;  2IWT A;  2VCX A;  4BVX A;  2PER A;  3FK8 A;  2PPT A;  4DSS B;  1ILO A;  3VWU A;  4WF4 A;  3F8U A;  2YWI A;  2R2J A;  1QGV A;  3ISO A;  1JZO A;  3TRQ A;  1YQ1 A;  2M80 A;  4WR4 A;  3QAG A;  1A2L A;  3ZIJ A;  2A2S A;  2MMA A;  4K0G A;  5D73 A;  5KN3 A;  3GKK A;  6GSW A;  1GUK A;  1VRS D;  2H73 A;  2FLS A;  1ON4 A;  2GT6 A;  4EF0 A;  3TJG A;  5JWQ B;  2DKI A;  1BQ7 A;  4DSQ A;  4LL4 B;  4KCE A;  3DKS A;  3GHA A;  17GS A;  3ME8 A;  2IMK A;  5AIX A;  1QXH A;  5A4U A;  1ML6 A;  5H5S A;  2YV9 A;  2NBS A;  1O85 A;  2XPE A;  1U6T A;  5IIZ A;  4KDX A;  2PVO C;  12GS A;  2CA8 A;  4ZL9 A;  3QOU A;  3BCK A;  2V6O A;  1F6M C;  2KHP A;  3SWL A;  5DQY A;  2BTO T;  2QA1 A;  4CDO A;  6GST A;  4NHZ A;  3C1R A;  1B9Y C;  2MZC A;  2VLT A;  3R3E A;  3IR4 A;  2R3X A;  4K9Z A;  4XIH A;  2F51 A;  2E7P A;  3APS A;  1SEN A;  5CRE A;  4GSS A;  5IOW A;  2JZS A;  3QPM A;  4WBR D;  3EIN A;  3VWW A;  3EWL A;  3LSZ A;  1QK8 A;  1YY7 A;  3GN3 A;  2WGR A;  2G2Q A;  2KUC A;  1TP9 A;  4TXV A;  3U6V A;  2JU5 A;  1SD8 A;  3CTG A;  4MF6 A;  4KAE A;  2C80 A;  2H74 A;  7GSS A;  5G1K A;  1FB0 A;  2LJR A;  4IJI A;  5ECI B;  3G7I A;  2CZ3 A;  4MJE A;  2CT6 A;  5ELA A;  5CRW A;  2OAC A;  4NAX A;  3TJK A;  4FYU A;  2ZCT A;  3GL3 A;  4ACS A;  1TRV A;  2DIZ A;  1VF4 A;  4PQ1 A;  2WCI A;  5DJM A;  1H4O A;  4EE0 A;  3V1W A;  1U3I A;  4QL7 A;  3LXZ A;  3MIX A;  2WZ9 A;  4J56 E;  5B8A A;  10GS A;  1T8E B;  4HQS A;  1GSE A;  3EE2 A;  3KGK A;  2AV4 A;  1XWG A;  2H30 A;  3ME7 A;  4Q5Q A;  3HKR A;  2X49 A;  3FEU A;  1XZO A;  3M9J A;  3Q19 A;  2LUS A;  4MDC A;  4GSN A;  3Q6O A;  4LL1 B;  2VOC A;  2L59 A;  1U87 A;  3GKN A;  4F0C A;  3GX0 A;  2VCZ A;  1XVW A;  3CTF A;  1F3A A;  1SYR A;  3D22 A;  5G2Z A;  4G0L A;  3GST A;  5ID2 B;  2KLX A;  2GLR A;  3GTU A;  2IIY A;  3KMN A;  2KP1 A;  4XHM A;  5AGY A;  1T7P B;  1V9W A;  2YWN A;  2DJJ A;  4TR1 A;  5COH A;  1TK5 B;  4JZQ A;  1HNA A;  3QAW A;  2GZP A;  2A4V A;  2LRT A;  2HZE B;  4JR4 A;  6GSY A;  1XWK A;  1EOG A;  1QMV A;  3BJ5 A;  2A2P A;  2DC5 A;  4O5Q A;  1A2J A;  3GMF A;  4OCF A;  4PXO A;  2LRC A;  2OBK A;  4JED A;  3EYT A;  1WPI A;  4TR3 A;  3A2V A;  3LJR A;  4X4J A;  3UBK A;  2NDO A;  4FH8 A;  2FD3 A;  1PN9 A;  1EEM A;  4ULX A;  4KE3 A;  2VLU A;  2GQL A;  4KA0 A;  2R0C A;  3Q18 A;  4F2I A;  4KW6 A;  2X8G A;  1XOA A;  3US3 A;  3H79 A;  2XC2 A;  1V98 A;  2D2Z A;  3RHB A;  1O81 A;  3HA9 A;  5H5R A;  3WYW A;  2HRF A;  4ZBD A;  3QFB C;  3ZVJ D;  1VF1 A;  1GSU A;  1O8W A;  4O92 A;  3ZLP A;  2PWJ A;  2AJQ B;  1FHE A;  3RBT A;  4Z7X A;  5HFI A;  4DSR A;  3F63 A;  1R4W A;  4MJB A;  1XW9 A;  4HI7 A;  2VL2 C;  3G7J A;  3HYP A;  1O7U A;  2GDR A;  4P3Y B;  4PUA A;  4TXO A;  5ECM B;  3HVV A;  3BD2 A;  1NSW A;  2IMF A;  11GS A;  2VCW A;  4TR1 B;  1K3L A;  3WT2 A;  4TOP A;  4GQC A;  1OKT A;  1YEX A;  3IC8 A;  2OE0 A;  1AC1 A;  5IPG A;  1Z7R A;  4MPG A;  2HXK A;  2REM A;  5GSS A;  4DVC A;  2GZZ A;  1BX9 A;  3E0U A;  4OO4 A;  3TKS A;  4HZ4 A;  5F05 A;  3QDN A;  1TRU A;  4K5S A;  1JFU A;  4G9H A;  4ZXG A;  3L9S A;  4BWQ A;  1XWA A;  4POM A;  2H1A A;  3KP8 A;  4GRF A;  4G0I A;  3W8S A;  2VD0 A;  4AJ8 A;  2R0P A;  4KDU A;  2LTK A;  1PRX A;  4RQR A;  3C73 A;  4X43 A;  5ECL B;  1YF0 A;  3MWH A;  5IMD A;  6GSU A;  5IMZ A;  5D93 A;  2NTO A;  1K3Y A;  1Z6M A;  4POL A;  5L71 A;  5J9B A;  1ST9 A;  5IQY A;  2H0I A;  4IN0 A;  3VI5 A;  1X9M B;  4RI6 A;  4KGI A;  4MAB A;  1JZD A;  4AGS A;  3UVT A;  4KF9 A;  1W89 A;  2R4V A;  3O76 A;  1X0R A;  3PR8 A;  2A2R A;  5DVB A;  9GSS A;  1Z3E A;  1GH2 A;  3JCM L;  5DAK A;  2QC7 A;  1XWC A;  3TDG A;  2Z9S A;  1GLP A;  1GSY A;  1A8Y A;  4RI7 A;  4WR5 A;  3TKP A;  4N10 A;  3KTL A;  2YZH A;  4N30 A;  3GV1 A;  1SJI A;  1R5A A;  5ECP B;  2GST A;  3M8N A;  1WJK A;  5CRH A;  3PH9 A;  4Q5F A;  3FKF A;  1V58 A;  2BJX A;  1IYH A;  3RDW A;  1PGT A;  4FQU A;  2MYG A;  2IPA A;  4IHU A;  1E6B A;  2L6D A;  1KBN A;  2M72 A;  2O7K A;  2LQO A;  4BVY A;  4YQM A;  2JZT A;  3WGD A;  2VCV A;  4K8M A;  1SKR B;  2WB9 A;  4TRX A;  4IEL A;  4V2M A;  2H6X A;  2X8H A;  3H8Q A;  4K5R A;  2LRN A;  1M0U A;  3A2W A;  2CZ2 A;  1M9B A;  3KEB A;  1M2D A;  2WS2 A;  4ZL8 A;  3TB2 A;  4FIW A;  4YKF A;  1M99 A;  2CX4 A;  3TRX A;  3VFI A;  2PUK C;  2QSI A;  2H70 A;  3HDC A;  2VD1 A;  5CP1 A;  5DAK B;  5GAN D;  2R37 A;  4PQI A;  2FWF A;  2HI7 A;  2JAD A;  1JZW A;  3HJM A;  2FCH A;  3LWA A;  3HD5 A;  4IQ1 A;  4ECI A;  2FA8 A;  3KCM A;  5DCG A;  3HHV A;  2GQM A;  1TRW A;  2JZR A;  4PUF C;  1AQX A;  1SL2 B;  2X4A A;  1TXX A;  5HR0 A;  3GNJ A;  3OR5 A;  1O8X A;  2V6K A;  1EZK A;  2V32 A;  1EWX A;  6GSX A;  2CX3 A;  2CAI A;  2KOK A;  1PN0 A;  3TJF A;  2OJL A;  2C3T A;  1B9X C;  4O5U A;  2VM2 A;  4BVY B;  3DXB A;  4KSO A;  1S3A A;  3QCP A;  2GTU A;  5A4W A;  1X9S B;  3H4K A;  1ZYQ B;  1GRX A;  4V1A g;  2TRX A;  3FR6 A;  2PVQ A;  1PQN A;  2A4H A;  3CBU A;  2HE3 A;  2HRN A;  3HZ4 A;  4EIP A;  3GIX A;  3GFK A;  3KH7 A;  1CQH A;  1FB6 A;  1TI1 A;  4L8E A;  2YP6 A;  2NPB A;  4GCI A;  3VLN A;  3IRA A;  5H5Q A;  3EMX A;  5KN1 A;  4HS1 A;  4ML6 A;  1ZGN A;  3KJY A;  3MDK A;  4WKW A;  3I9V 2;  3FYG A;  3G7Y A;  3ERG A;  3TCO A;  5KOX A;  1DUG A;  2I4A A;  3CYN A;  2VM1 A;  3A5I A;  1U3A A;  4IS0 A;  3MYD A;  3DWV A;  1NHY A;  4PGT A;  1BAY A;  4IBP A;  2OE1 A;  2HZF A;  2LST A;  2XPD A;  5DDL A;  4AJ7 A;  4PQH A;  4MK3 A;  1Z9H A;  5IMC A;  1XIY A;  1ZMA A;  3A3T A;  1XCC A;  2DMM A;  5EVO A;  3GH6 A;  4GWR A;  2HSY A;  1ZOF A;  3SBC A;  4AF2 A;  1HYU A;  4HU9 A;  1EP7 A;  4MH2 A;  1F9M A;  1V2A A;  4RQX A;  2IMD A;  1GUL A;  2LQQ A;  1Z7P A;  2IFQ A;  4IW9 A;  2L5L A;  3VK9 A;  1J9B A;  3IHQ A;  5CO3 A;  1EV4 A;  2O8V B;  2PGT A;  4WET A;  4HUA A;  1F37 A;  3LFL A;  1EP8 A;  2H6Y A;  1VF2 A;  5J5N A;  3MAK A;  5ID2 A;  3J7Y k;  4L5O A;  8GSS A;  4K1F A;  1ABA A;  4ECJ A;  5CNW A;  1T3B A;  1EEJ A;  5FT3 A;  3ZFL A;  3MNG A;  2RUE A;  2HZE A;  2B7K A;  1HNB A;  1YF1 A;  4KUN A;  2E2M A;  2G0F A;  3QMX A;  1FG4 A;  4ECB A;  1JLV A;  3RPP A;  2GS3 A;  1MEK A;  5CYY A;  4MZB A;  3HJO A;  1DBY A;  3GKX A;  3UAR A;  2EC4 A;  1TDI A;  1I9D A;  1M2A A;  3P8W A;  4F9Z A;  3PPU A;  2DLX A;  4NV2 A;  3LW9 A;  4OMV A;  4MJA A;  1SK1 A;  3H93 A;  3DVX A;  3UJ1 A;  1WIK A;  5C04 A;  3UEM A;  3S9F A;  5D8I A;  5IO2 A;  2LJK A;  1PX7 A;  5ECH B;  3BBY A;  3BOA A;  2IFQ B;  2O85 A;  3IOS A;  4HJM A;  3DVW A;  3KTB A;  3NIV A;  2QGV A;  1WMJ A;  5ELG A;  2J23 A;  3ZIT A;  1TK0 B;  2GZY A;  3P7X A;  2H75 A;  1RK4 A;  4ZIJ A;  4G0K A;  5LCZ A;  2ES7 A;  1PD2 1;  4IKH A;  3TOT A;  4KCA A;  5KEJ A;  1XVQ A;  1PSQ A;  1T4Y A;  4HU7 A;  1BJX A;  2R6K A;  2GQK A;  5F06 A;  4KDY A;  1A2M A;  2LNT A;  3LGC A;  5ECO B;  3PGT A;  4GLT A;  3APQ A;  2C0E A;  1G6Y A;  3FZA A;  2EIQ A;  2R0G A;  3TRP A;  1R7H A;  1HNC A;  4OWY A;  3GUR A;  4BA7 A;  5JCW A;  2E0Q A;  3NZN A;  2FGX A;  2L5O A;  1BG5 A;  1QUW A;  1GTB A;  3GH9 A;  3QD9 A;  3IC4 A;  1ZCP A;  2L6C A;  5IM9 A;  2H8L A;  3TKS C;  2YZU A;  3HY2 A;  3IK7 A;  4YAP A;  4PNF A;  1OKD A;  2YN1 A;  1MD3 A;  2V41 A;  2AHE A;  4IGJ A;  2FWG A;  4TR0 A;  3Q74 A;  3IDV A;  1GLQ A;  3KXO A;  2FWE A;  4G2E A;  1XFL A;  5G30 A;  3IPZ A;  3GX8 A;  3DEX A;  2ON5 A;  3TUE A;  4PNG A;  5B6N A;  1A0F A;  2YPM A;  4Z2T A;  1NHO A;  1TK8 B;  4EKZ A;  2P31 A;  4N11 A;  4ZBB A;  3TJJ A;  4EDY A;  1AQW A;  1TU7 A;  3EU3 A;  1MDK A;  2HSH A;  2H19 A;  1UVZ A;  2CAQ A;  5KOW A;  3KZQ A;  1KNG A;  1S3D A;  4USS A;  2IN3 A;  3QFA C;  5DCH A;  3HVS A;  2ZNM A;  1IYI A;  2DML A;  4O7H A;  5LD0 A;  1UC7 A;  3CXG A;  2LEG A;  4F82 A;  2C8U A;  4NPB A;  3KMO A;  3TKQ A;  1RW1 A;  2AAW A;  4OO5 A;  2F3M A;  5J41 A;  3D21 A;  5GZZ B;  3I6A A;  1HQO A;  1YZX A;  3R2Q A;  2B7J A;  2HRA A;  2HYX A;  3DD3 A;  1ZYE A;  4XCS A;  4TR4 A;  3G9B A;  1H75 A;  1TW9 A;  2RM5 A;  3CRT A;  3F6F A;  1WOU A;  3ZRE A;  2GSQ A;  6GSS A;  1FVJ A;  4EO3 A;  4Z2R A;  3UL3 A;  1YKA A;  4NMU A;  1XWB A;  3D6I A;  4YH2 A;  2VL2 A;  2YNX A;  2H0H A;  2DJ3 A;  5ENU A;  1YDK A;  1TOF A;  2H6Z A;  5HFK A;  4FO5 A;  5IMV A;  3DYR A;  3EC3 A;  5D9X A;  4ZIL A;  1V57 A;  2P5R A;  3ZRD A;  3M0F A;  3TOU A;  5GST A;  2B1L A;  1XW6 A;  3VWX A;  4HOJ A;  3FY7 A;  1UA5 A;  1A0R P;  4CY6 A;  2GSR A;  5ECQ B;  5JWO B;  2YJH A;  1TKD B;  5DAL B;  1MTC A;  2YOI A;  1KEB A;  1F3B A;  3K8N A;  1XXU A;  1CQG A;  2B5E A;  4F03 A;  4V2L A;  3CSJ A;  4RUV A;  2IL3 A;  2IMI A;  2DIY A;  3F9U A;  3EMP A;  4OCE A;  1UN2 A;  14GS A;  4N0Z A;  4QL9 A;  1XPV A;  3VI7 A;  2I1U A;  2I3Y A;  3TKR A;  5HR3 A;  2ON7 A;  3IA1 A;  3F3Q A;  3ZMK A;  2K18 A;  4YQV A;  1YEP A;  5D96 A;  1G6W A;  5ECS A;  3VPT A;  4ISD A;  2F9S A;  2O87 A;  3UVH A;  4YAV A;  4QQ7 A;  3M9K A;  2ALB A;  4J2F A;  4Q5N A;  5EPF A;  2PU9 C;  1XW5 A;  1A23 A;  4CW9 A;  3CSI A;  1DE2 A;  1OE7 A;  2RUF A;  2IJY A;  4KB3 A;  5F8B A;  4F0B A;  4IP6 A;  3FMW A;  4MPF A;  2E2G A;  1F2E A;  3LXT A;  1JZR A;  3I43 A;  4I6X A;  1SL1 B;  3F4R A;  1GSD A;  18GS A;  4LLR A;  4HJ2 A;  1FVK A;  3WGX A;  2GSS A;  5HR1 A;  2FUG 2;  5HQP A;  2IME A;  3DRN A;  1EGR A;  5DJL A;  1R5P A;  4YKG A;  2OKA A;  3L9U A;  1OC3 A;  5FWG A;  3P90 A;  2I81 A;  1PL1 A;  3UOM A;  5D9T A;  2DJ0 A;  3RHC A;  4K7N A;  2M46 A;  1GNW A;  1USB A;  2DBC A;  5F07 A;  3VPQ A;  4EVM A;  2AUV A;  4AJ6 A;  1X9W B;  1GTU A;  3CMI A;  5G5F A;  4ICY A;  2GGT A;  1ERU A;  1T1V A;  1ZYP A;  2F8F A;  2LS5 A;  3KH9 A;  2OBI A;  1SJ6 A;  3GRX A;  4PTS A;  3ZIV A;  4K2X A;  5E4W A;  4KH7 A;  4BL7 A;  3HZ8 A;  2YCD A;  2H01 A;  2V2G A;  3BCI A;  5J9C A;  1BED A;  5FHI A;  3N9J A;  2X99 A;  4ML1 A;  2VO4 A;  5AIV A;  1G7E A;  3FZ4 A;  3ZTL A;  2HRK A;  4ZL7 A;  4EDZ A;  1XOB A;  4O32 A;  1X5C A;  5KN2 A;  1MD4 A;  2N5A A;  1GSS A;  2K8S A;  2VAF A;  3FHK A;  1I5G A;  1BYE A;  2K8V A;  4KSM A;  2LKU A;  4XS4 A;  1Y25 A;  2L4C A;  1RQM A;  3LOR A;  2R5G A;  5IMA A;  4K7I A;  2CVD A;  4GST A;  2MMN A;  3D4T A;  3TKS E;  4IVF A;  3LQ7 A;  3FZ5 A;  4E8H A;  3GL5 A;  2WRT A;  2H76 A;  2TIR A;  2YWM A;  1FW1 A;  1SKS B;  3F4S A;  4CHS A;  1EGO A;  1PL2 A;  3LG6 A;  2H1B A;  2RM6 A;  2QKE A;  4EC0 A;  3ERF A;  3F4T A;  1LU4 A;  5J4U A;  2H72 A;  2HNL A;  1PA3 A;  2DJ1 A;  4I97 A;  3RAZ A;  1AQV A;  1M2B A;  4FYB A;  3DIE A;  2H1G A;  3A2X A;  3FRC A;  1OVN A;  5A4V A;  3UAP A;  4BL7 B;  3UIW A;  2LNS A;  3I69 A;  2DJ2 A;  22GS A;  2FA4 A;  1GL8 A;  4GQF A;  4BWS A;  4MCU A;  4XTS A;  2B5X A;  3UMA A;  2CVB A;  1GSF A;  3GSS A;  1YJ6 A;  3DML A;  1THO A;  4XS1 A;  4OFT A;  3N5O A;  1SD9 A;  2YV7 A;  4K6X A;  4JU5 A;  4BVX B;  4LMV A;  5KN0 A;  4NHW A;  2HSM A;  2VLV A;  3PIN A;  4XS6 A;  5ECN B;  2P5Q A;  5CRD A;  1FOV A;  1TTZ A;  1KTE A;  3IV4 A;  4MZC A;  1C72 A;  4H86 A;  3U5R E;  4XS4 B;  1T00 A;  2L57 A;  1O73 A;  1SYX A;  3ZYW A;  19GS A;  4XRA A;  2WUL A;  4JRR A;  1VF3 A;  3GA4 A;  4JBB A;  5AN1 A;  2HFD A;  4TN8 A;  5G1L A;  4ZB6 A;  3W8J A;  4MLY A;  4ILF A;  4ZBA A;  4I8B A;  3D0Z A;  1N8J A;  4PX1 A;  1GSQ A;  1A8L A;  4EIQ A;  4OD7 A;  1NW2 A;  3GKM A;  1K3O A;  2JSZ A;  4X0X A;  2HT9 A;  2GT5 A;  1FAA A;  1TRS A;  1GP1 A;  4KX4 A;  5B6M A;  5EL8 A;  4TW5 A;  4V2N A;  4X1U A;  1GUM A;  1AIU A;  2EIR A;  1E2Y A;  1GTA A;  2X64 A;  1GWC A;  3VWV A;  3L78 A;  20GS A;  4G19 A;  4N0V A;  4I2T A;  5B7C A;  5IO0 A;  3EUR A;  1K0D A;  3E3E A;  2B1K A;  1TI3 A;  2L4Q A;  4GF0 A;  1FO5 A;  1WP0 A;  1X5E A;  2AYT A;  1Z5Y E;  3IAM 2;  1GUH A;  2MMO A;  3ZML A;  3HXS A;  3IXR A;  3ZL5 A;  5BMU A;  1PKZ A;  4BPY A;  3ZVJ A;  2B5Y A;  1WWJ A;  1ACV A;  1YKC A;  2K9F A;  5JCG A;  1SJZ A;  2TRC P;  3HVX A;  2YWO A;  3FR9 A;  3O6T A;  4POK A;  4YQU A;  2C0G A;  4MF7 A;  1OC8 A;  1ERW A;  2BMX A;  5D9W A;  4WF5 A;  2J9H A;  6GSV A;  1OAZ A;  5IOX A;  3VUR A;  4MP4 A;  5B8B A;  2OE3 A;  4D73 A;  2FNO A;  2H71 A;  2NVL A;  3F0I A;  1SU9 A;  1R26 A;  2VCQ A;  3M3M A;  2YAN A;  2RII A;  1A24 A;  3IBH A;  1G7O A;  1JHB A;  4K2D A;  5BRT A;  1J0F A;  3WT1 A;  3ED3 A;  4K0N A;  4ECC A;  3D5J A;  1EOH A;  4HQZ A;  2B6M A;  3UBL A;  2RLI A;  3E9J B;  1K0M A;  3IK9 A;  2FWH A;  3L4N A;  5IMF A;  2C3N A;  4WBJ A;  2X8C A;  1XBS A;  4XRD A;  2LJA A;  3DGQ A;  5E59 A;  4OFM A;  4G10 A;  1MDJ A;  5DAL A;  1K0C A;  3GTU B;  4JE1 A;  1X5D A;  1ZYN A;  5LNK e;  5JWR B;  4MF5 A;  1SK0 A;  4I2U A;  1AW9 A;  1O6J A;  1Y6E A;  4MA9 A;  1K0B A;  1M9A A;  1B4P A;  2MBS A;  3AY8 A;  2OAD A;  2N5B A;  3C8E A;  1QQ2 A;  4MZW A;  3IHG A;  1V40 A;  2C3Q A;  4ZB8 A;  3IE3 A;  2P0G A;  3C1S A;  1TJD A;  1HD2 A;  1MDI A;  2C1Y A;  4D73 B;  4WEY A;  4IJ3 A;  4WXT A;  1PMT A;  1AAZ A;  1FOH A;  1THX A;  2MMZ A;  4EXJ A;  3LEF A;  2WDU A;  4NV5 A;  3IAS 2;  3GUS A;  3KD0 A;  2PMT A;  5HFG A;  3KM6 A;  1T4Z A;  1EV9 A;  1OC9 A;  4L0U A;  3F3R A;  1ERV A;  1K0N A;  3RPN A;  4TVE A;  2F8A A;  2V1M A;  2QA2 A;  4EUY A;  1OE8 A;  5C00 A;  4KND A;  3C7M A;  4Q5R A;  4GTU A;  3MSZ A;  2MBT A;  2AB6 A;  4GXZ A;  1N2A A;  2FY6 A;  1PKW A;  5DBQ A;  2VL9 A;  1Z6N A;  4NWY A;  3CRU A;  3FR3 A;  3NOF A;  4A5P A;  4EL1 A;  4DEJ A;  3TGZ A;  5A5K A;  1B8X A;  4TXO B;  3EU4 A;  4J57 E;  5CAX A;  3M1G A;  3KIJ A;  2OA7 A;  1WRY A;  1Q4J A;  4I5Q A;  4O5R A;  5HR2 A;  3W6G A;  1WE0 A;  3LYK A;  3EPT A;  4IQA A;  5J3R A;  3FZ9 A;  2CV4 A;  5ECR B;  2JL4 A;  4K7O A;  5D9V A;  1AXD A;  3F6D A;  3GYK A;  4TKY A;  2JSY A;  5GAP D;  3J7Y b;  2B3S A;  3L0H A;  3LYP A;  2WFC A;  3ERW A;  4Z2U A;  5AIS A;  3O3T A;  4POB A;  4PUR A;  2H66 A;  4LA1 A;  3EVI A;  1ZZY A;  1B4Q A;  5INY A;  1VGL A;  3C71 A;  2YJ7 A;  3ZFB A;  2WJU A;  4NXI A;  1OC9 B;  3QR6 A;  13GS A;  4ID0 A;  2XBQ A;  2O89 A;  4V1A p;  2CQ9 A;  4E8E A;  4FYC A;  3P2A A;  1LJR A;  2DSA A;  4MNN A;  3CSH A;  5ABR A;  4MJC A;  2K6V A;  4LMW A;  2VL3 A;  2C4J A;  4MH3 A;  1SKW B;  3H1N A;  2ZUP A;  1U88 A;  5G31 A;  3HJP A;  3TJB A;  1K0A A;  3ZZX A;  2XHF A;  1Q98 A;  4DSS A;  2VCT A;  3APO A;  4L5L A;  3QAV A;  2XBI A;  3KP9 A;  3L9V A;  2GVP A;  1B48 A;  1AUC A;  2PBJ A;  5G5E A;  3FW2 A;  5IPH A;  1JLW A;  1QFN A;  2H0G A;  4HDE A;  2I9H A;  5DQS A;  1LBK A;  1GNE A;  2CVK A;  2PN8 A;  4ZB9 A;  2UZ8 A;  1DSB A;  16GS A;  2N5F A;  1URM A;  2DKH A;  2JAC A;  1ERT A;  2C0D A;  1DE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...