2IIYA

Crystal structure of s-nitroso thioredoxin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
105
structure length
103
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDQDVASEEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Buried s-nitrosocysteine revealed in crystal structures of human thioredoxin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 34
structure length 103
sequence length 105
ec nomenclature
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2iiyA00
4ZB8A 4MZWA 1XW6A 2FWGA 1F6MC 5F8BA 3DMLA 4LA1A 1TDIA 5IOXA 1YKAA 1SK0A 1H4OA 2GVPA 1ZGNA 2DJKA 5CP1A 2N5AA 4G2EA 4K1FA 2JSYA 4PQ1A 1K0OA 4ECCA 1Y25A 4JR4A 4NV5A 1XWAA 3EU3A 3FYGA 3GKMA 2DIYA 1A2LA 4AJ7A 3LORA 3LXTA 4I8BA 1B9YC 1M9AA 4NAXA 5FT3A 1MDJA 5G5FA 3ZRDA 1GH2A 3Q6OA 3BBYA 1VF3A 3FZAA 4KX4A 4I97A 1GLPA 3TJGA 4MJBA 2CQ9A 4EF0A 5ECOB 2CX4A 1AXDA 4BWQA 2XPEA 3KTLA 3EINA 4I5QA 2V1MA 1DE2A 2ES7A 3W8JA 4OO5A 1V40A 5ENUA 3CSIA 3GL3A 1XWGA 5HFGA 5B6MA 3HVSA 3VPTA 2VCXA 2QSIA 4HDEA 5AGYA 1A23A 1UC7A 5A4UA 1PD21 1YDKA 3KMNA 4PUFC 1MD3A 5GSTA 5G30A 1G6YA 3APSA 2MYGA 3GURA 4XS4A 3F3RA 2QGVA 3WT2A 1GSDA 2HLSA 2NPBA 2R6KA 4AGSA 3FZ5A 4WR4A 2TRCP 4ZILA 5LCZA 5ELGA 1OE8A 1X9SB 3EC3A 3S9FA 1G7EA 4JE1A 1PA3A 2VCQA 3TKSE 1LBKA 4KSOA 2XHFA 1CQHA 2HFDA 4HOJA 5AIVA 4EC0A 2DLXA 9GSSA 2I3YA 1U3AA 4F03A 3GSTA 1I5GA 3J7Yb 4KDYA 1AIUA 3GH6A 1Q4JA 4XCSA 1XBSA 2OKAA 1Z7PA 1XIYA 2KLXA 3DGQA 1A2JA 4MZCA 1LU4A 1SU9A 2R37A 4Q5RA 2R3XA 3CTGA 1M9BA 2KP2A 3IRAA 3G7JA 4GCIA 4ECBA 3CRTA 4IJIA 1EEMA 4IQ1A 3F4RA 4ZB9A 1G7OA 2O85A 1BJXA 1OAZA 2C3TA 3NOFA 4CDOA 4BL7A 3CMIA 1RW1A 1E6BA 4N0ZA 3EE2A 3WGDA 2C1YA 4PXOA 2VCZA 2HZEA 1QUWA 3H1NA 5DJMA 1ZCPA 4K8MA 3A2XA 1WIKA 1OVNA 3HYPA 2PGTA 4ZBBA 4HQSA 4Q5NA 3MDKA 4EXJA 2LQQA 3HJPA 4IKHA 1T00A 1TI1A 2VUPA 4NXIA 2R4VA 5E59A 2CV4A 2XBQA 1KBNA 2XBIA 4E8HA 2NBSA 3UJ1A 2AJQB 3FEUA 4EDYA 2L57A 4GXZA 1FVJA 5DJLA 2YZHA 2FNOA 1IYHA 5ECHB 3AY8A 3ED3A 3F3QA 4GSTA 5IOWA 3UBLA 2I81A 17GSA 1USBA 1Z7RA 4IBPA 3QR6A 3QMXA 1X5EA 1WP0A 4F0CA 4XIHA 1ML6A 2H71A 4KSMA 2GSQA 2L4CA 3Q74A 3QD9A 1AAZA 1PX6A 4L8EA 1TU7A 1ZMAA 2P5RA 3BD2A 3L0HA 1GSQA 5D9WA 5GZZB 2FHEA 4FO5A 2BTOT 2YWNA 4EUYA 2CA8A 3ZFBA 2FLSA 2KUCA 1O73A 2OBKA 5JWRB 4ZL9A 3F8UA 4L0UA 2VL2A 3KTBA 4AF2A 3L9SA 4ZL7A 4HQZA 3IAM2 5AIXA 5KN3A 2FY6A 2BMXA 3LXZA 4IVFA 1THXA 1Q98A 4ILFA 3LFLA 3H93A 1GSSA 3GTUB 2VIMA 2YWOA 1F37A 4MJAA 1B48A 1O6JA 3LGCA 3TJFA 4MF6A 1SKSB 2JU5A 3WGXA 1TXXA 2F8AA 2X64A 3GX0A 4N11A 5HR2A 1YF0A 2M80A 2C80A 1RK4A 2YWMA 3Q19A 2GZZA 3QAVA 4TR4A 3VWXA 3F63A 3F4TA 3TDGA 1O81A 2C4JA 2P31A 3RPPA 1NM3A 5IIZA 3KJYA 4WETA 3PH9A 4NWYA 1ON4A 3KEBA 4EDZA 1SKWB 4BWSA 3LSZA 1TRVA 4F9ZA 1YF1A 4JBBA 2ON7A 4IN0A 4JRRA 2H75A 2L5LA 2IMIA 3FRCA 4I6XA 4XRDA 3WT1A 4FIWA 1M2DA 3IE3A 5F05A 4N30A 4EVMA 3F4SA 3DXBA 4QL9A 1XVQA 1YY7A 1SK1A 2R5GA 4RI7A 1PRXA 3GNJA 2IL3A 4O92A 1J08A 4PQIA 5DQYA 3F6FA 5ECQB 3UMAA 4MJCA 3D22A 4J56E 3EWLA 2VCWA 2JADA 3GHAA 3QCPA 1VF4A 3E9JB 1FVKA 4MZBA 3RPNA 4BVXA 4TR0A 1CQGA 5ELAA 1U87A 5DCHA 1MDIA 3P90A 4XS1A 3DKSA 2AV4A 1UVZA 3KM6A 4PGTA 3WD6A 2AAWA 1K0CA 1U3IA 1JZDA 1T1VA 2NDOA 2X99A 16GSA 12GSA 3C1SA 1F2EA 4Q5QA 4WBRD 4F2IA 3DRNA 2IMKA 3A3TA 2VOCA 3EMXA 2VM1A 1AW9A 1GUKA 4OMVA 2MMZA 3ZLPA 2F3MA 3EURA 2WZ9A 2J9HA 3ZL5A 3QPMA 6GSTA 2DJ3A 1UA5A 2ZUPA 2YN1A 5JWQB 1FW1A 2MMNA 4AJ6A 3O6TA 2TRXA 2EIOA 2P5QA 2IWTA 2CVDA 1H75A 2IPAA 4XS6A 4XRAA 4L0WA 5AN1A 3DIEA 3ERFA 2FCHA 1JHBA 3FZ9A 2IIYA 4X43A 1O8XA 3L4NA 1K3YA 1TW9A 5L71A 5ECRB 3I6AA 1XOAA 2V41A 2FUG2 4KCAA 3TKSC 4OD7A 1GTAA 3ISOA 2H66A 1U6TA 2N5FA 3SWLA 5HQPA 3OR5A 5D93A 3K8NA 4OCEA 3G9BA 3NIVA 4HI7A 4YQUA 1TU8A 4HJ2A 1K0MA 4WF4A 5DBQA 3RAZA 3TUEA 4KA0A 3V1WA 2N5BA 3EYTA 2BJXA 3TKQA 4TW5A 5IPGA 4HZ2A 1RQMA 1WRYA 1VF2A 4IS0A 5LNKe 2OE1A 4GQFA 4ZL8A 4GRFA 4LL4B 2K6VA 2H6YA 1JLVA 1A8YA 2YV7A 4NV2A 3IDVA 4HS1A 1ERVA 5F0GA 3KP8A 1B4PA 2E7PA 4POLA 4WF5A 2C0GA 5KN0A 1M0UA 2REMA 4RQXA 2A4VA 5IMFA 4GQCA 5CRWA 3M3MA 5CNWA 1U88A 2ON5A 4CHSA 4KDUA 2V6OA 1GNWA 3GKXA 2HZFA 3HZ4A 3L9VA 2MMAA 3LJRA 2K9FA 1AQXA 1T4YA 5CAXA 4HU7A 1SL1B 1A24A 1OKTA 5J41A 4KAEA 2OA7A 1EZKA 1ST9A 3VLNA 1F9MA 1GTBA 1I9DA 2RM5A 2E0QA 4F82A 2GGTA 4ML6A 2DMMA 1KEBA 2H73A 3MSZA 4MJEA 1SJIA 4TRXA 1OE7A 3EU4A 2AB6A 3QAGA 5KN2A 3VI7A 4OFNA 1B8XA 2F51A 4JEDA 5B8BA 2O7KA 11GSA 2RIIA 5EPFA 3ZYWA 4ACSA 1A0RP 1TRUA 1XWKA 2KP1A 3KH9A 3M9KA 4TXOB 2I1UA 1S3AA 2K18A 1EWXA 1AQVA 4POKA 5COHA 5D9XA 2C0EA 2LJAA 2LQOA 3BJ5A 2PERA 5DCGA 3TB2A 20GSA 5DVBA 5ECIB 2GQLA 1GL8A 2LV3A 4ML1A 3MAKA 3TRXA 1Y6EA 3GTUA 1FB0A 5EVOA 2H30A 2WRTA 4V2NA 6GSXA 4WXTA 1AC1A 3I43A 5F06A 2IJYA 3HCZA 3APOA 4HUAA 3DD3A 3GFKA 3JCML 3TOUA 1KTEA 3TJKA 5INYA 3N9JA 5AISA 5D96A 2OADA 2DJJA 3LG6A 1PQNA 2L6DA 3ZMKA 2H0HA 3D0ZA 4L5LA 4O7HA 3ERGA 2B7KA 2GZPA 1O8WA 1PMTA 2OACA 2DJ0A 2FA8A 2HE3A 2D2ZA 1XCCA 3UIWA 2PN8A 3GYKA 1QGVA 1VGLA 3QOUA 2LRCA 5HFKA 4D73B 4HJMA 1EEJA 4ECJA 2H76A 1ACVA 1A0FA 4ID0A 1K0BA 2FWEA 3TJJA 3GX8A 2X8GA 4HU9A 1TTZA 1VRSD 1XW5A 5HR0A 1GSUA 5J9BA 5H5RA 4ZIJA 2GQKA 3LWAA 4V2MA 3FZ4A 5J3RA 1SJZA 3LEFA 3LQ7A 3CBUA 5IMZA 1DE1A 3MWHA 3QFAC 2GSRA 3HXSA 3D4MA 4WBJA 4K2DA 4KGIA 3KGKA 4X0XA 3GSSA 1TP9A 3O3TA 1YJ6A 3GN3A 3M1GA 2GTUA 2CVBA 1O7UA 4OO4A 1YQ1A 2HYXA 4POMA 3Q18A 3FR6A 4LLRA 2GSSA 2TIRA 1XZOA 1GLQA 4TOPA 2GDRA 3KH7A 1PL1A 4TKYA 2YWIA 5CRGA 2PWJA 1GUMA 1XOBA 3P7XA 3GL5A 1XWCA 8GSSA 4MA9A 4N10A 3BCIA 3KMOA 1NW2A 2OE0A 2YPMA 3L9UA 3VFIA 13GSA 3IC4A 3FKFA 5D73A 5ECPB 1IYIA 1ERWA 2PVOC 3GUSA 4L5OA 4FYCA 3UBKA 5CYYA 3M0FA 1TK8B 4E8EA 5IMAA 4OFTA 1MDKA 1QK8A 4KE3A 2LKUA 2AYTA 1SL2B 3D5JA 7GSSA 4Z7XA 4IHUA 3CTFA 1UN2A 2FWHA 3TGZA 2HRFA 5DDLA 1WOUA 4PNFA 3FHKA 3HA9A 4GWRA 2H72A 4AJ8A 5JCGA 1AQWA 1OYJA 5G1LA 1WJKA 4POBA 3ZITA 2DMLA 1XW9A 4JR6A 2ZCTA 3RDWA 3RBTA 4K0NA 4I2TA 2RM6A 3FK8A 1HNCA 22GSA 4PNGA 4DSSB 4MK3A 1JFUA 2H1BA 3MNGA 3UEMA 1X9MB 1J0FA 1FOVA 4MH2A 3FW2A 3P2AA 3CRUA 3LYKA 3ERWA 2H74A 4DSRA 2IMDA 1DUGA 3C71A 1PSQA 1EGRA 3RHCA 3VPQA 4FYBA 3VI5A 3H79A 4K0GA 4ZBDA 2YOIA 3UVHA 2K8SA 5CRDA 2JL4A 5ABRA 1V2AA 2E2MA 3C1RA 4KUNA 1YZXA 1M99A 2R2JA 2B7JA 2FA4A 3VK9A 4CW9A 6GSWA 1BQ7A 3VWUA 2K8VA 3ZIVA 1F3AA 5JCWA 4PX1A 3KD0A 4EO3A 5GAND 3VWWA 3ME7A 4RUVA 2LRTA 3WGEA 2CVKA 3DWVA 5C04A 2V32A 4NMUA 4YQMA 1ILOA 2I9HA 1O85A 4IP6A 1PL2A 3LYPA 2VCTA 1GTUA 2WGRA 1X5DA 2C8UA 4WKWA 5HFIA 3HY2A 5A4VA 4RQRA 2NVLA 2CX3A 2HSYA 4YAVA 1QMVA 2L6CA 4LMWA 5DALB 1K0NA 4RI6A 1XVWA 2FGXA 2H0GA 3F6DA 1YKCA 5G31A 2C0DA 1WMJA 1V58A 1W4VA 5JCUA 4ECIA 2H19A 6GSUA 1N8JA 3TOTA 2G0FA 4DVCA 4LL1B 3IK7A 3M8NA 3TKSA 2B1LA 4FYUA 2FWFA 5H5SA 3GIXA 1S3DA 2C0FA 2YJHA 2WJUA 1S3CA 2YV9A 1SYXA 2L4QA 3IOSA 5LD0A 4TXOA 1SK2A 5IPHA 2C3QA 3UOMA 1SL0B 1Z9HA 4YQVA 1T7PB 3D6IA 2WFCA 4WR5A 1GNEA 4G19A 3F9UA 2YCDA 4MLYA 2B5YA 3H8QA 1KNGA 1JLWA 2JZSA 2IFQB 2YNXA 4IP1A 1OC9B 4EL1A 2OJLA 5H5QA 3QFBC 4IGJA 2KHPA 2VD0A 2I4AA 3HJMA 1AUCA 2DC5A 2WS2A 2EC4A 1J9BA 3UVTA 5B6NA 2RUEA 3TRQA 5IMCA 3TKPA 2XC2A 3L78A 1QXHA 1GUHA 14GSA 2VL3A 4IQAA 2P0GA 1HYUA 2F8FA 3TCOA 2LEGA 4PURA 5B8AA 2VLVA 3DEXA 2YJ7A 2GQMA 2JZTA 2LJRA 4HEA2 2NTOA 4K7IA 2F9SA 4TR1B 2IMFA 4OCFA 1HNBA 2WCIA 1BYEA 2X8HA 3HZ8A 2HT9A 4D73A 2YZUA 3KCMA 1DSBA 5J5NA 4P3YB 4ZBAA 2HNLA 4V1Ag 4FH8A 2H6ZA 4QL7A 4K6XA 3F0IA 1GSFA 1R5PA 2H6XA 2G2QA 2C3NA 3HVXA 3HVVA 2E2GA 1K3LA 1THOA 4TXVA 5G5EA 3GA4A 5GAPD 4ZXGA 2GT6A 3KP9A 5J4UA 2PVQA 4MPFA 2H1AA 4GLTA 1MEKA 2O87A 2ZNMA 5DAKB 4NHWA 1M7TA 1GRXA 4DSQA 4PQHA 1EOGA 3ZVJD 2EIQA 2LNTA 3CSJA 4YAPA 3US3A 1ZYQB 1SENA 1Z5YE 4BPYA 2VAFA 1BX9A 3ZREA 4NPBA 1FAAA 3HJOA 2VCVA 6GSVA 1X9WB 2QC7A 3ZTLA 3VWVA 3ZZXA 5F07A 3E0UA 1T3BA 4PUAA 5ECMB 1BAYA 2DBCA 2Z9SA 2GZYA 5IM9A 5ID2B 3C7MA 3G7IA 1YEXA 3VURA 4Q5FA 3UARA 1E2YA 1TRWA 2PMTA 4NHZA 3P8WA 2ALBA 4MCUA 3KIJA 5IMVA 1R7HA 4OWYA 3PGTA 1G0TA 2B5EA 5J9CA 1B9XC 2LUSA 1XPVA 2B1KA 3U5RE 2YP6A 2H0IA 3I69A 2OBIA 5DQSA 4MF7A 3GMFA 1XFLA 2JACA 2M72A 1TI3A 4K9ZA 4MH3A 2H01A 2CZ3A 2M46A 4ISDA 1EOHA 4DSSA 3GKNA 2LSTA 2VL9A 3IK9A 3A5WA 3EMPA 1EP8A 1N2AA 3CYNA 1X0RA 1XWBA 4IW9A 6GSSA 3UAPA 4ULXA 2CAIA 1K0DA 5CREA 5CO3A 5A5KA 4EKZA 3IXRA 2DIZA 1M2AA 6GSYA 1X5CA 2WB9A 1TRSA 4MP4A 2JZRA 2PUKC 5FHIA 1MD4A 2MBTA 3TKRA 4IELA 1XXUA 1Z6NA 1FHEA 2RLIA 2L59A 2PBJA 3C8EA 5ECNB 3FR9A 2CZ2A 1WPIA 2B3SA 1ERUA 5JWOB 2VLUA 2LNSA 1PKZA 2H1DA 3NZNA 1BEDA 1FB6A 1HNAA 4XTSA 5FWGA 4MDCA 2A2RA 1GULA 1ZYEA 4HZ4A 5D9TA 1W89A 2WULA 4O5RA 1NHOA 2EIRA 3ME8A 4KNDA 4G9HA 3ZFLA 3CSHA 5CRHA 1OKDA 3QDNA 1TK0B 4XS4B 2AUVA 1TJDA 2B6MA 1WE0A 4ZB6A 2O8VB 1V9WA 2CAQA 1GSEA 10GSA 2RUFA 2LJKA 5IQYA 4MF5A 1ZL9A 3H4KA 5ECKB 3DVXA 3IR4A 4V2LA 2GSTA 2IMEA 3IHQA 4MPGA 3DYRA 2MMOA 4GSSA 5IO2A 2VO4A 3CXGA 5ECLB 1ABAA 4JZQA 2VM2A 3PR8A 5EL8A 3FR3A 4V1Ap 4K7OA 5DALA 1EV4A 1FG4A 1T8EB 2LRNA 1GTIA 4GSNA 2HXKA 5G2ZA 4KDXA 3BCKA 3APQA 2VL2C 1R26A 5HR1A 3ZMLA 1OC8A 2DSAA 5KN1A 2FD3A 2O89A 2OE3A 4IJ3A 3I9V2 4DEJA 4GTUA 2DJ2A 19GSA 1YEPA 1GWCA 3RHBA 1ERTA 3A2VA 1SYRA 2HZEB 4KB3A 3D21A 3HKRA 2YANA 3N5OA 5B7CA 2KOKA 4J2FA 4YH2A 5IO0A 1MTCA 4OFMA 3W8SA 2XPDA 1OC3A 2VD1A 2QKEA 5D9VA 3G7YA 3BOAA 2PU9C 2JSZA 3ZIJA 1GP1A 2IFQA 2L5OA 1JZWA 2MZCA 4EE0A 4LMVA 5E4WA 1OC9A 1R4WA 1PN9A 1B4QA 2HSHA 3E3EA 1NHYA 1LJRA 1V57A 2AHEA 2H1GA 2GLRA 1ZOFA 4K7NA 4WEYA 4X1UA 3QAWA 3U6VA 3TRPA 3IBHA 4J57E 2CT6A 2A2SA 2J23A 2VLTA 3UL3A 1QQ2A 2IN3A 2MBSA 3GKKA 4I2UA 1A8LA 4GF0A 1JZRA 4MABA 5C00A 4TN8A 3GRXA 1R5AA 3IAS2 3PINA 18GSA 2DJ1A 1BG5A 4JU5A 4N0VA 3EVIA 4TR1A 3IA1A 3D4TA 1PX7A 1EV9A 2GS3A 5KEJA 1A2MA 4MMMA 3HHVA 1SJ6A 1VF1A 1FO5A 3GH9A 4TVEA 4F0BA 4XHMA 3WYWA 4KH7A 2PPTA 2X8CA 3HDCA 4BVYA 4TR3A 5IMDA 5G1KA 3KXOA 3IV4A 1QFNA 2HRNA 4O32A 3IPZA 1V98A 1HD2A 1WWJA 1EGOA 1NSWA 3GV1A 4H86A 3A2WA 3O76A 3SBCA 3W6GA 2B5XA 2HI7A 5EY6A 2V6KA 5DAKA 4G10A 1T4ZA 1TK5B 3M9JA 2WDUA 3KZQA 4BA7A 1F3BA 1SD8A 2H8LA 1K3OA 3FY7A 1K0AA 3J7Yk 1EP7A 2LTKA 2H70A 5GSSA 1C72A 1TKDB 1SKRB 1DBYA 5D8IA 1PKWA 1Z6MA 2GT5A 5ECSA 4KCEA 5HR3A 1JZOA 3TJBA 1SD9A 1G6WA 1M2BA 5A4WA 1ZZYA 3R2QA 3DVWA 4KW6A 4QQ7A 1URMA 1Z3EA 3HD5A 3C73A 5ID2A 2V2GA 1PGTA 3ZVJA 1TOFA 1GSYA 2LS5A 1HQOA
chains in the Genus database with same CATH superfamily
4ZB8A 4MZWA 1XW6A 1ZYNA 1ZYPA 2FWGA 1F6MC 5F8BA 3DMLA 4LA1A 1TDIA 5IOXA 1YKAA 1SK0A 1H4OA 2GVPA 1ZGNA 2DJKA 5CP1A 2N5AA 4G2EA 4K1FA 2JSYA 4PQ1A 1K0OA 4ECCA 1PN0A 1Y25A 4JR4A 4NV5A 4EIQA 1XWAA 3EU3A 3FYGA 2R0GA 3GKMA 2DIYA 1A2LA 4AJ7A 1FOHA 3LORA 3LXTA 4I8BA 1B9YC 1M9AA 4NAXA 5FT3A 1MDJA 5G5FA 3ZRDA 1GH2A 3Q6OA 3BBYA 1VF3A 3FZAA 4KX4A 4I97A 1GLPA 4BVXB 3TJGA 4MJBA 2CQ9A 4EF0A 5ECOB 2CX4A 1AXDA 4BWQA 2XPEA 3KTLA 3EINA 4I5QA 4CY6A 2V1MA 1DE2A 1S3RA 2ES7A 3W8JA 4OO5A 1V40A 5ENUA 3CSIA 3GL3A 1XWGA 5HFGA 5B6MA 3HVSA 3VPTA 2VCXA 2QSIA 4HDEA 5AGYA 1A23A 1UC7A 5A4UA 1PD21 1YDKA 3KMNA 4PUFC 1MD3A 5GSTA 5G30A 1G6YA 3APSA 2MYGA 3GURA 4XS4A 3F3RA 2X49A 2QGVA 3WT2A 1GSDA 2HLSA 2NPBA 2R6KA 4AGSA 3FZ5A 4WR4A 2TRCP 4ZILA 5LCZA 5ELGA 1OE8A 1X9SB 3EC3A 3S9FA 1G7EA 4JE1A 1PA3A 2VCQA 3TKSE 1LBKA 4KSOA 2XHFA 1CQHA 2HFDA 4HOJA 5AIVA 4EC0A 2DLXA 9GSSA 2I3YA 1U3AA 4F03A 3GSTA 1I5GA 3J7Yb 4KDYA 1AIUA 3GH6A 1Q4JA 4XCSA 1XBSA 2OKAA 1Z7PA 1XIYA 2KLXA 3DGQA 1A2JA 4MZCA 1LU4A 1SU9A 2R37A 4Q5RA 2R3XA 3CTGA 1M9BA 2KP2A 3IRAA 3G7JA 4GCIA 4ECBA 3CRTA 4IJIA 4K5SA 1EEMA 4IQ1A 3F4RA 4ZB9A 1G7OA 2O85A 1BJXA 1OAZA 2C3TA 3NOFA 4CDOA 4BL7A 3CMIA 1RW1A 1E6BA 4N0ZA 3EE2A 3WGDA 2C1YA 4PXOA 2VCZA 2HZEA 1QUWA 3H1NA 5DJMA 1ZCPA 4K8MA 3A2XA 1WIKA 1OVNA 3HYPA 2PGTA 4ZBBA 4HQSA 4Q5NA 3MDKA 4EXJA 2LQQA 3HJPA 4IKHA 1T00A 1TI1A 2VUPA 4NXIA 2QA2A 2R4VA 5E59A 2CV4A 2XBQA 1KBNA 2XBIA 4E8HA 2NBSA 3UJ1A 2AJQB 3FEUA 4EDYA 2L57A 4GXZA 1FVJA 5DJLA 2YZHA 2FNOA 1IYHA 5ECHB 3AY8A 3ED3A 3F3QA 4GSTA 5IOWA 3UBLA 2I81A 17GSA 1USBA 1Z7RA 4IBPA 3QR6A 3QMXA 1X5EA 4O5UA 1WP0A 4F0CA 4XIHA 1ML6A 2H71A 4KSMA 2GSQA 2L4CA 3Q74A 3QD9A 1AAZA 1PX6A 4L8EA 1TU7A 1ZMAA 2P5RA 3BD2A 3L0HA 1GSQA 5D9WA 5GZZB 2FHEA 4FO5A 2BTOT 2YWNA 4EUYA 2CA8A 3ZFBA 3HVNA 2FLSA 2KUCA 1O73A 2OBKA 3R3EA 5JWRB 4ZL9A 3F8UA 4L0UA 2VL2A 4CY8A 3KTBA 4AF2A 3L9SA 4ZL7A 4HQZA 3IAM2 5AIXA 5KN3A 2FY6A 2BMXA 3LXZA 4IVFA 1THXA 1Q98A 4ILFA 3LFLA 3H93A 1GSSA 4Z2TA 3GTUB 2VIMA 2YWOA 1F37A 4MJAA 1B48A 1O6JA 3LGCA 3TJFA 4MF6A 1SKSB 2JU5A 3WGXA 1TXXA 2F8AA 4PTSA 2X64A 3GX0A 4N11A 3PPUA 5HR2A 4G0KA 1YF0A 2M80A 2C80A 1RK4A 2YWMA 3Q19A 2GZZA 3QAVA 4TR4A 3VWXA 3F63A 2HRKA 3F4TA 3TDGA 1O81A 2C4JA 2P31A 3RPPA 1NM3A 5IIZA 3KJYA 4WETA 3PH9A 4NWYA 1ON4A 3KEBA 4EDZA 1SKWB 4BWSA 3LSZA 1TRVA 4F9ZA 1YF1A 4JBBA 2ON7A 4IN0A 4JRRA 2H75A 2L5LA 2IMIA 3FRCA 4I6XA 4XRDA 3WT1A 4FIWA 1M2DA 3IE3A 5F05A 4N30A 4EVMA 3F4SA 3DXBA 4QL9A 1XVQA 1YY7A 1SK1A 2R5GA 5BRTA 4RI7A 1PFOA 1PRXA 3GNJA 2IL3A 4O92A 1J08A 4PQIA 5DQYA 3F6FA 5KOXA 5ECQB 3UMAA 4MJCA 3D22A 4J56E 3EWLA 2VCWA 2JADA 3GHAA 3QCPA 1VF4A 3E9JB 1FVKA 4MZBA 3RPNA 4BVXA 4TR0A 1CQGA 5ELAA 1U87A 5DCHA 1MDIA 3P90A 4XS1A 3DKSA 2AV4A 1UVZA 3KM6A 4PGTA 3WD6A 2AAWA 1K0CA 1U3IA 1JZDA 1T1VA 2NDOA 2X99A 16GSA 12GSA 3C1SA 1F2EA 4Q5QA 4WBRD 4F2IA 3DRNA 2IMKA 3A3TA 2VOCA 3EMXA 2VM1A 1AW9A 1GUKA 4OMVA 2MMZA 3ZLPA 3IC8A 2F3MA 3EURA 4MNNA 2WZ9A 2J9HA 3ZL5A 3QPMA 6GSTA 2DJ3A 1UA5A 2ZUPA 2YN1A 5JWQB 1FW1A 2MMNA 4AJ6A 3O6TA 2TRXA 2EIOA 2P5QA 2IWTA 2CVDA 1H75A 2IPAA 4XS6A 4XRAA 4L0WA 5AN1A 3DIEA 3ERFA 2FCHA 1JHBA 3FZ9A 2IIYA 4X43A 1O8XA 3L4NA 1K3YA 1TW9A 5L71A 2R0CA 5ECRB 3I6AA 1XOAA 2V41A 2FUG2 4KCAA 1M3IA 4OD7A 1GTAA 3ISOA 3TKSC 2H66A 1U6TA 2N5FA 3SWLA 5HQPA 1XG8A 3OR5A 5D93A 3K8NA 4OCEA 3G9BA 3NIVA 4HI7A 4YQUA 1TU8A 4HJ2A 1K0MA 4WF4A 5DBQA 4FQUA 3RAZA 3TUEA 4KA0A 3V1WA 2N5BA 3EYTA 2BJXA 3TKQA 4TW5A 5IPGA 4HZ2A 1RQMA 1WRYA 1VF2A 4IS0A 5LNKe 2OE1A 4GQFA 4ZL8A 4GRFA 4LL4B 2K6VA 2H6YA 2HSMA 1JLVA 1A8YA 2YV7A 4NV2A 3IDVA 4HS1A 1ERVA 5F0GA 3KP8A 1B4PA 2E7PA 4POLA 4WF5A 2C0GA 5KN0A 1M0UA 2REMA 4RQXA 2A4VA 5IMFA 4GQCA 5CRWA 3M3MA 5CNWA 1U88A 2ON5A 4CHSA 4KDUA 2V6OA 3EPTA 1GNWA 3GKXA 2HZFA 3HZ4A 3L9VA 2MMAA 3LJRA 2K9FA 1AQXA 1T4YA 5CAXA 4HU7A 1SL1B 1A24A 1OKTA 5J41A 4KAEA 2OA7A 1EZKA 1ST9A 3VLNA 1F9MA 1GTBA 1I9DA 2RM5A 2E0QA 4F82A 2GGTA 4ML6A 2DMMA 1KEBA 2H73A 3MSZA 4MJEA 1SJIA 4TRXA 4G0LA 1OE7A 3EU4A 4K5RA 2AB6A 3QAGA 5KN2A 3VI7A 4OFNA 1B8XA 2F51A 4JEDA 5B8BA 2O7KA 11GSA 2RIIA 5EPFA 3ZYWA 4ACSA 1A0RP 1TRUA 1XWKA 2KP1A 3KH9A 3M9KA 4TXOB 2I1UA 1S3AA 2K18A 1EWXA 1AQVA 4POKA 5COHA 5D9XA 2C0EA 2LJAA 2LQOA 3BJ5A 2PERA 5DCGA 3TB2A 20GSA 5DVBA 5ECIB 2GQLA 1GL8A 2LV3A 4ML1A 3MAKA 3TRXA 1Y6EA 3GTUA 1FB0A 5EVOA 2H30A 2WRTA 4V2NA 6GSXA 4WXTA 1AC1A 3I43A 5F06A 2IJYA 3HCZA 3APOA 4HUAA 3DD3A 3GFKA 3JCML 3TOUA 1KTEA 3TJKA 5INYA 3N9JA 5AISA 5D96A 2OADA 2DJJA 3LG6A 1PQNA 2L6DA 3ZMKA 2H0HA 3D0ZA 4L5LA 4O7HA 3ERGA 2B7KA 2GZPA 1O8WA 1PMTA 2UZ8A 2OACA 2DJ0A 2FA8A 1M3JA 2D2ZA 2HE3A 1XCCA 3UIWA 2PN8A 3GYKA 4Z2UA 1QGVA 1VGLA 3QOUA 2LRCA 5HFKA 4D73B 4HJMA 1EEJA 3MIXA 4ECJA 2H76A 1ACVA 1A0FA 4ID0A 1K0BA 2FWEA 3TJJA 3GX8A 2X8GA 4HU9A 1TTZA 1VRSD 1XW5A 5HR0A 1GSUA 5J9BA 5H5RA 4ZIJA 2GQKA 3LWAA 4V2MA 3FZ4A 5J3RA 1SJZA 3LEFA 3LQ7A 3CBUA 5IMZA 1DE1A 3MWHA 3QFAC 2GSRA 3HXSA 3IHGA 3D4MA 4WBJA 4K2DA 4KGIA 3KGKA 4X0XA 3GSSA 1TP9A 3O3TA 1YJ6A 3GN3A 3M1GA 2GTUA 2CVBA 1O7UA 4OO4A 1YQ1A 2HYXA 4POMA 3Q18A 3FR6A 4LLRA 2GSSA 2TIRA 1XZOA 1GLQA 4TOPA 2GDRA 3KH7A 1PL1A 4TKYA 2YWIA 5CRGA 2PWJA 1GUMA 1XOBA 3P7XA 3GL5A 1XWCA 8GSSA 4MA9A 4N10A 3BCIA 3KMOA 1NW2A 2OE0A 2YPMA 3L9UA 3VFIA 4USSA 13GSA 3IC4A 3FKFA 5D73A 5ECPB 1IYIA 1ERWA 2PVOC 3GUSA 4L5OA 4FYCA 3UBKA 5CYYA 3M0FA 1TK8B 4E8EA 5IMAA 4OFTA 1MDKA 1QK8A 4KE3A 2LKUA 2AYTA 1SL2B 3D5JA 7GSSA 4Z7XA 4IHUA 3CTFA 1UN2A 2FWHA 3TGZA 2HRFA 5DDLA 1WOUA 4PNFA 3FHKA 3HA9A 4GWRA 2H72A 4AJ8A 5JCGA 1AQWA 1OYJA 5G1LA 1WJKA 4POBA 3ZITA 2A2PA 2DMLA 1XW9A 4JR6A 2ZCTA 3RDWA 3RBTA 4K0NA 2DKHA 4I2TA 2RM6A 3FK8A 1HNCA 22GSA 2HRAA 4PNGA 4DSSB 4MK3A 1JFUA 2H1BA 3MNGA 3UEMA 1X9MB 1J0FA 1FOVA 4MH2A 3FW2A 3P2AA 3CRUA 3LYKA 3ERWA 2H74A 4DSRA 2IMDA 4YKGA 1DUGA 4KF9A 3C71A 1PSQA 1EGRA 3RHCA 3VPQA 4FYBA 3VI5A 3H79A 4K0GA 4ZBDA 2YOIA 3UVHA 2K8SA 5CRDA 2JL4A 5KOWA 5ABRA 1V2AA 2E2MA 3C1RA 4KUNA 1YZXA 2A4HA 1M99A 3FMWA 2R2JA 2B7JA 2FA4A 3VK9A 4CW9A 6GSWA 1BQ7A 3VWUA 2K8VA 3ZIVA 1F3AA 3MYDA 5JCWA 4PX1A 5BMUA 3KD0A 4EO3A 5GAND 3VWWA 3ME7A 4RUVA 2LRTA 3WGEA 2CVKA 3DWVA 5C04A 2V32A 4NMUA 4YQMA 1ILOA 2I9HA 1O85A 4IP6A 1PL2A 3LYPA 2VCTA 1GTUA 2WGRA 1X5DA 2C8UA 4WKWA 5HFIA 3HY2A 5A4VA 4RQRA 2NVLA 2CX3A 2HSYA 4YAVA 1QMVA 2L6CA 4LMWA 5DALB 1K0NA 4RI6A 1XVWA 2FGXA 2H0GA 3F6DA 1YKCA 5G31A 2C0DA 1WMJA 1V58A 1W4VA 5JCUA 4ECIA 2H19A 6GSUA 1N8JA 3TOTA 2G0FA 4DVCA 4LL1B 3IK7A 3M8NA 3TKSA 2B1LA 4FYUA 2FWFA 5H5SA 3GIXA 1S3DA 2C0FA 2YJHA 2WJUA 1S3CA 2YV9A 1SYXA 2L4QA 3IOSA 5LD0A 4TXOA 1SK2A 5IPHA 2C3QA 3UOMA 1SL0B 1Z9HA 4YQVA 1T7PB 3D6IA 2WFCA 4WR5A 1GNEA 4G19A 3F9UA 2YCDA 4MLYA 2B5YA 3H8QA 1KNGA 1JLWA 2JZSA 2IFQB 2YNXA 4IP1A 1OC9B 4EL1A 2OJLA 5H5QA 3QFBC 4IGJA 2KHPA 2VD0A 2I4AA 3HJMA 1AUCA 2DC5A 2WS2A 2EC4A 2QA1A 1J9BA 3UVTA 5B6NA 2RUEA 3TRQA 5IMCA 3TKPA 2XC2A 3L78A 1QXHA 1GUHA 14GSA 2VL3A 4IQAA 2P0GA 1HYUA 2F8FA 3TCOA 2LEGA 4PURA 5B8AA 2VLVA 3DEXA 2YJ7A 2GQMA 2JZTA 4X4JA 2LJRA 4HEA2 2NTOA 4K7IA 2F9SA 4TR1B 2IMFA 4OCFA 1HNBA 2WCIA 1BYEA 2X8HA 3HZ8A 2HT9A 4D73A 2YZUA 3KCMA 1DSBA 5J5NA 4P3YB 4ZBAA 2HNLA 4V1Ag 4FH8A 2H6ZA 4QL7A 4K6XA 3F0IA 1GSFA 1R5PA 2H6XA 2G2QA 2C3NA 4BVYB 3HVXA 3HVVA 2E2GA 1K3LA 1THOA 4TXVA 5G5EA 3GA4A 5GAPD 4ZXGA 2GT6A 3KP9A 5J4UA 2PVQA 4MPFA 2H1AA 4GLTA 1MEKA 4A5PA 2O87A 2ZNMA 5DAKB 4NHWA 1M7TA 1GRXA 4DSQA 4PQHA 1EOGA 3ZVJD 2EIQA 2LNTA 4G0IA 3CSJA 4YAPA 3US3A 1ZYQB 1SENA 1Z5YE 4BPYA 2VAFA 1BX9A 3ZREA 4NPBA 1FAAA 3HJOA 2VCVA 6GSVA 1X9WB 2QC7A 3ZTLA 3VWVA 3ZZXA 5F07A 3E0UA 1T3BA 4PUAA 5ECMB 1BAYA 2DKIA 2DBCA 2Z9SA 2GZYA 5IM9A 5ID2B 3C7MA 3G7IA 1YEXA 3VURA 4Q5FA 3UARA 1E2YA 1TRWA 2PMTA 4NHZA 3P8WA 2ALBA 4MCUA 3KIJA 5IMVA 1R7HA 4OWYA 3PGTA 1G0TA 2B5EA 5J9CA 1B9XC 2LUSA 1XPVA 2B1KA 3U5RE 2YP6A 2H0IA 3I69A 2OBIA 5DQSA 4MF7A 3GMFA 1XFLA 2JACA 2M72A 4K2XA 1TI3A 4K9ZA 4MH3A 2H01A 3CQFA 2CZ3A 2M46A 4ISDA 1EOHA 4DSSA 3GKNA 2LSTA 2VL9A 3IK9A 3A5WA 3EMPA 1EP8A 1N2AA 3CYNA 1X0RA 1XWBA 4IW9A 6GSSA 3UAPA 4ULXA 2CAIA 4EIPA 1K0DA 5CREA 5CO3A 5A5KA 4EKZA 3IXRA 2DIZA 1M2AA 6GSYA 1X5CA 2WB9A 1TRSA 4MP4A 4Z2RA 4O5QA 2JZRA 2PUKC 5FHIA 1MD4A 2MBTA 3TKRA 2R0PA 4IELA 1XXUA 1Z6NA 1FHEA 2RLIA 2L59A 2PBJA 3C8EA 5ECNB 3FR9A 2CZ2A 1WPIA 2B3SA 4ICYA 1ERUA 5JWOB 2VLUA 2LNSA 1PKZA 2H1DA 3NZNA 1BEDA 1FB6A 1HNAA 4XTSA 5FWGA 4MDCA 2A2RA 1GULA 1ZYEA 4HZ4A 5D9TA 1W89A 2WULA 4O5RA 1NHOA 2EIRA 3ME8A 4KNDA 4G9HA 3ZFLA 3CSHA 5CRHA 1OKDA 3QDNA 1TK0B 4XS4B 2AUVA 1TJDA 3A5IA 2B6MA 1WE0A 4ZB6A 2O8VB 1V9WA 2CAQA 1GSEA 10GSA 4YKFA 2RUFA 2LJKA 5IQYA 4MF5A 1ZL9A 3H4KA 5ECKB 3DVXA 3IR4A 4V2LA 2GSTA 2IMEA 3IHQA 4MPGA 3DYRA 2MMOA 4GSSA 5IO2A 2VO4A 3CXGA 5ECLB 1ABAA 4JZQA 2VM2A 3PR8A 5EL8A 3FR3A 4V1Ap 4K7OA 5DALA 1EV4A 1FG4A 1T8EB 2LRNA 1GTIA 4GSNA 2HXKA 5G2ZA 4KDXA 3BCKA 3APQA 2VL2C 1R26A 5HR1A 3ZMLA 1OC8A 4BIKA 2DSAA 5KN1A 2FD3A 2O89A 2OE3A 4IJ3A 3I9V2 4DEJA 4GTUA 2DJ2A 19GSA 1YEPA 1GWCA 3RHBA 1ERTA 2X4AA 3A2VA 4BL7B 1SYRA 4HSCX 2HZEB 4KB3A 3D21A 3HKRA 2YANA 3N5OA 5B7CA 2KOKA 4J2FA 4YH2A 5IO0A 1MTCA 4OFMA 3LW9A 3W8SA 2XPDA 1OC3A 2VD1A 2QKEA 5D9VA 3G7YA 3BOAA 2PU9C 2JSZA 3ZIJA 1GP1A 2IFQA 2L5OA 1JZWA 2MZCA 4EE0A 4LMVA 5E4WA 1OC9A 1R4WA 1PN9A 1B4QA 2HSHA 3E3EA 1NHYA 1LJRA 1V57A 2AHEA 2H1GA 2GLRA 1ZOFA 4K7NA 4WEYA 4X1UA 3QAWA 3U6VA 3TRPA 3IBHA 4J57E 2CT6A 2A2SA 2J23A 2VLTA 3UL3A 1QQ2A 2IN3A 2MBSA 3GKKA 4I2UA 1A8LA 4GF0A 1JZRA 4MABA 5C00A 4TN8A 3GRXA 1R5AA 3IAS2 3PINA 18GSA 2DJ1A 1BG5A 4JU5A 4N0VA 3EVIA 4TR1A 3IA1A 3D4TA 1PX7A 1EV9A 2GS3A 5KEJA 1A2MA 4MMMA 3HHVA 1SJ6A 1VF1A 1FO5A 3GH9A 4TVEA 4F0BA 4XHMA 3WYWA 4KH7A 2PPTA 2X8CA 3HDCA 4BVYA 4TR3A 5IMDA 5G1KA 3KXOA 3IV4A 1QFNA 2HRNA 4O32A 3IPZA 1V98A 1HD2A 1WWJA 1EGOA 1NSWA 3GV1A 4H86A 3A2WA 3O76A 3SBCA 3W6GA 2B5XA 2HI7A 5EY6A 2V6KA 5DAKA 4G10A 1T4ZA 1TK5B 3M9JA 2WDUA 3KZQA 4BA7A 1F3BA 1SD8A 2H8LA 1K3OA 3FY7A 1K0AA 3J7Yk 1EP7A 2LTKA 2H70A 5GSSA 1C72A 1TKDB 1SKRB 1DBYA 5D8IA 1PKWA 1Z6MA 2GT5A 5ECSA 4KCEA 5HR3A 1JZOA 3TJBA 1SD9A 1G6WA 1M2BA 5A4WA 1ZZYA 3R2QA 3DVWA 4KW6A 4QQ7A 1URMA 1Z3EA 3HD5A 3C73A 5ID2A 2V2GA 1PGTA 3ZVJA 1TOFA 1GSYA 2LS5A 1HQOA
chains in the Genus database with same CATH topology
4ZB8A 4MZWA 1XW6A 1ZYNA 1ZYPA 2FWGA 1F6MC 5F8BA 3DMLA 4LA1A 1TDIA 5IOXA 1YKAA 1SK0A 1H4OA 2GVPA 1ZGNA 2DJKA 5CP1A 2N5AA 4G2EA 4K1FA 2JSYA 4PQ1A 1K0OA 4ECCA 1PN0A 1Y25A 4JR4A 4NV5A 4EIQA 1XWAA 3EU3A 3FYGA 2R0GA 3GKMA 2DIYA 1A2LA 4AJ7A 1FOHA 3LORA 3LXTA 4I8BA 1B9YC 1M9AA 4NAXA 5FT3A 1MDJA 5G5FA 3ZRDA 1GH2A 3Q6OA 3BBYA 1VF3A 3FZAA 4KX4A 4I97A 1GLPA 4BVXB 3TJGA 4MJBA 2CQ9A 4EF0A 5ECOB 2CX4A 1AXDA 4BWQA 2XPEA 3KTLA 3EINA 4I5QA 4CY6A 2V1MA 1DE2A 2ES7A 3W8JA 4OO5A 1V40A 5ENUA 3CSIA 3GL3A 1XWGA 5HFGA 5B6MA 3HVSA 3VPTA 2VCXA 2QSIA 4HDEA 5AGYA 1A23A 1UC7A 5A4UA 1PD21 1YDKA 3KMNA 4PUFC 1MD3A 5GSTA 5G30A 1G6YA 3APSA 2MYGA 3GURA 4XS4A 3F3RA 2X49A 2QGVA 3WT2A 1GSDA 2HLSA 2NPBA 2R6KA 4AGSA 3FZ5A 4WR4A 2TRCP 4ZILA 5LCZA 5ELGA 1OE8A 1X9SB 3EC3A 3S9FA 1G7EA 4JE1A 1PA3A 2VCQA 3TKSE 1LBKA 4KSOA 2XHFA 1CQHA 2HFDA 4HOJA 5AIVA 4EC0A 2DLXA 9GSSA 2I3YA 1U3AA 4F03A 3GSTA 1I5GA 3J7Yb 4KDYA 1AIUA 3GH6A 1Q4JA 4XCSA 1XBSA 2OKAA 1Z7PA 1XIYA 2KLXA 3DGQA 1A2JA 4MZCA 1LU4A 1SU9A 2R37A 4Q5RA 2R3XA 3CTGA 1M9BA 2KP2A 3IRAA 3G7JA 4GCIA 4ECBA 3CRTA 4IJIA 4K5SA 1EEMA 4IQ1A 3F4RA 4ZB9A 1G7OA 2O85A 1BJXA 1OAZA 2C3TA 3NOFA 4CDOA 4BL7A 3CMIA 1RW1A 1E6BA 4N0ZA 3EE2A 3WGDA 2C1YA 4PXOA 2VCZA 2HZEA 1QUWA 3H1NA 5DJMA 1ZCPA 4K8MA 3A2XA 1WIKA 1OVNA 3HYPA 2PGTA 4ZBBA 4HQSA 4Q5NA 3MDKA 4EXJA 2LQQA 3HJPA 4IKHA 1T00A 1TI1A 2VUPA 4NXIA 2QA2A 2R4VA 5E59A 2CV4A 2XBQA 1KBNA 2XBIA 4E8HA 2NBSA 3UJ1A 2AJQB 3FEUA 4EDYA 2L57A 4GXZA 1FVJA 5DJLA 2YZHA 2FNOA 1IYHA 5ECHB 3AY8A 3ED3A 3F3QA 4GSTA 5IOWA 3UBLA 2I81A 17GSA 1USBA 1Z7RA 4IBPA 3QR6A 3QMXA 1X5EA 4O5UA 1WP0A 4F0CA 4XIHA 1ML6A 2H71A 4KSMA 2GSQA 2L4CA 3Q74A 3QD9A 1AAZA 1PX6A 4L8EA 1TU7A 1ZMAA 2P5RA 3BD2A 3L0HA 1GSQA 5D9WA 5GZZB 2FHEA 4FO5A 2BTOT 2YWNA 4EUYA 2CA8A 3ZFBA 2FLSA 2KUCA 1O73A 2OBKA 3R3EA 5JWRB 4ZL9A 3F8UA 4L0UA 2VL2A 4CY8A 3KTBA 4AF2A 3L9SA 4ZL7A 4HQZA 3IAM2 5AIXA 5KN3A 2FY6A 2BMXA 3LXZA 4IVFA 1THXA 1Q98A 4ILFA 3LFLA 3H93A 1GSSA 4Z2TA 3GTUB 2VIMA 2YWOA 1F37A 4MJAA 1B48A 1O6JA 3LGCA 3TJFA 4MF6A 1SKSB 2JU5A 3WGXA 1TXXA 2F8AA 4PTSA 2X64A 3GX0A 4N11A 3PPUA 5HR2A 4G0KA 1YF0A 2M80A 2C80A 1RK4A 2YWMA 3Q19A 2GZZA 3QAVA 4TR4A 3VWXA 3F63A 2HRKA 3F4TA 3TDGA 1O81A 2C4JA 2P31A 3RPPA 1NM3A 5IIZA 3KJYA 4WETA 3PH9A 4NWYA 1ON4A 3KEBA 4EDZA 1SKWB 4BWSA 3LSZA 1TRVA 4F9ZA 1YF1A 4JBBA 2ON7A 4IN0A 4JRRA 2H75A 2L5LA 2IMIA 3FRCA 4I6XA 4XRDA 3WT1A 4FIWA 1M2DA 3IE3A 5F05A 4N30A 4EVMA 3F4SA 3DXBA 4QL9A 1XVQA 1YY7A 1SK1A 2R5GA 5BRTA 4RI7A 1PRXA 3GNJA 2IL3A 4O92A 1J08A 4PQIA 5DQYA 3F6FA 5KOXA 5ECQB 3UMAA 4MJCA 3D22A 4J56E 3EWLA 2VCWA 2JADA 3GHAA 3QCPA 1VF4A 3E9JB 1FVKA 4MZBA 3RPNA 4BVXA 4TR0A 1CQGA 5ELAA 1U87A 5DCHA 1MDIA 3P90A 4XS1A 3DKSA 2AV4A 1UVZA 3KM6A 4PGTA 3WD6A 2AAWA 1K0CA 1U3IA 1JZDA 1T1VA 2NDOA 2X99A 16GSA 12GSA 3C1SA 1F2EA 4Q5QA 4WBRD 4F2IA 3DRNA 2IMKA 3A3TA 2VOCA 3EMXA 2VM1A 1AW9A 1GUKA 4OMVA 2MMZA 3ZLPA 3IC8A 2F3MA 3EURA 4MNNA 2WZ9A 2J9HA 3ZL5A 3QPMA 6GSTA 2DJ3A 1UA5A 2ZUPA 2YN1A 5JWQB 1FW1A 2MMNA 4AJ6A 3O6TA 2TRXA 2EIOA 2P5QA 2IWTA 2CVDA 1H75A 2IPAA 4XS6A 4XRAA 4L0WA 5AN1A 3DIEA 3ERFA 2FCHA 1JHBA 3FZ9A 2IIYA 4X43A 1O8XA 3L4NA 1K3YA 1TW9A 5L71A 2R0CA 5ECRB 3I6AA 1XOAA 2V41A 2FUG2 4KCAA 3TKSC 4OD7A 1GTAA 3ISOA 2H66A 1U6TA 2N5FA 3SWLA 5HQPA 3OR5A 5D93A 3K8NA 4OCEA 3G9BA 3NIVA 4HI7A 4YQUA 1TU8A 4HJ2A 1K0MA 4WF4A 5DBQA 4FQUA 3RAZA 3TUEA 4KA0A 3V1WA 2N5BA 3EYTA 2BJXA 3TKQA 4TW5A 5IPGA 4HZ2A 1RQMA 1WRYA 1VF2A 4IS0A 5LNKe 2OE1A 4GQFA 4ZL8A 4GRFA 4LL4B 2K6VA 2H6YA 2HSMA 1JLVA 1A8YA 2YV7A 4NV2A 3IDVA 4HS1A 1ERVA 5F0GA 3KP8A 1B4PA 2E7PA 4POLA 4WF5A 2C0GA 5KN0A 1M0UA 2REMA 4RQXA 2A4VA 5IMFA 4GQCA 5CRWA 3M3MA 5CNWA 1U88A 2ON5A 4CHSA 4KDUA 2V6OA 3EPTA 1GNWA 3GKXA 2HZFA 3HZ4A 3L9VA 2MMAA 3LJRA 2K9FA 1AQXA 1T4YA 5CAXA 4HU7A 1SL1B 1A24A 1OKTA 5J41A 4KAEA 2OA7A 1EZKA 1ST9A 3VLNA 1F9MA 1GTBA 1I9DA 2RM5A 2E0QA 4F82A 2GGTA 4ML6A 2DMMA 1KEBA 2H73A 3MSZA 4MJEA 1SJIA 4TRXA 4G0LA 1OE7A 3EU4A 4K5RA 2AB6A 3QAGA 5KN2A 3VI7A 4OFNA 1B8XA 2F51A 4JEDA 5B8BA 2O7KA 11GSA 2RIIA 5EPFA 3ZYWA 4ACSA 1A0RP 1TRUA 1XWKA 2KP1A 3KH9A 3M9KA 4TXOB 2I1UA 1S3AA 2K18A 1EWXA 1AQVA 4POKA 5COHA 5D9XA 2C0EA 2LJAA 2LQOA 3BJ5A 2PERA 5DCGA 3TB2A 20GSA 5DVBA 5ECIB 2GQLA 1GL8A 2LV3A 4ML1A 3MAKA 3TRXA 1Y6EA 3GTUA 1FB0A 5EVOA 2H30A 2WRTA 4V2NA 6GSXA 4WXTA 1AC1A 3I43A 5F06A 2IJYA 3HCZA 3APOA 4HUAA 3DD3A 3GFKA 3JCML 3TOUA 1KTEA 3TJKA 5INYA 3N9JA 5AISA 5D96A 2OADA 2DJJA 3LG6A 1PQNA 2L6DA 3ZMKA 2H0HA 3D0ZA 4L5LA 4O7HA 3ERGA 2B7KA 2GZPA 1O8WA 1PMTA 2UZ8A 2OACA 2DJ0A 2FA8A 2HE3A 2D2ZA 1XCCA 3UIWA 2PN8A 3GYKA 4Z2UA 1QGVA 1VGLA 3QOUA 2LRCA 5HFKA 4D73B 4HJMA 1EEJA 3MIXA 4ECJA 2H76A 1ACVA 1A0FA 4ID0A 1K0BA 2FWEA 3TJJA 3GX8A 2X8GA 4HU9A 1TTZA 1VRSD 1XW5A 5HR0A 1GSUA 5J9BA 5H5RA 4ZIJA 2GQKA 3LWAA 4V2MA 3FZ4A 5J3RA 1SJZA 3LEFA 3LQ7A 3CBUA 5IMZA 1DE1A 3MWHA 3QFAC 2GSRA 3HXSA 3IHGA 3D4MA 4WBJA 4K2DA 4KGIA 3KGKA 4X0XA 3GSSA 1TP9A 3O3TA 1YJ6A 3GN3A 3M1GA 2GTUA 2CVBA 1O7UA 4OO4A 1YQ1A 2HYXA 4POMA 3Q18A 3FR6A 4LLRA 2GSSA 2TIRA 1XZOA 1GLQA 4TOPA 2GDRA 3KH7A 1PL1A 4TKYA 2YWIA 5CRGA 2PWJA 1GUMA 1XOBA 3P7XA 3GL5A 1XWCA 8GSSA 4MA9A 4N10A 3BCIA 3KMOA 1NW2A 2OE0A 2YPMA 3L9UA 3VFIA 4USSA 13GSA 3IC4A 3FKFA 5D73A 5ECPB 1IYIA 1ERWA 2PVOC 3GUSA 4L5OA 4FYCA 3UBKA 5CYYA 3M0FA 1TK8B 4E8EA 5IMAA 4OFTA 1MDKA 1QK8A 4KE3A 2LKUA 2AYTA 1SL2B 3D5JA 7GSSA 4Z7XA 4IHUA 3CTFA 1UN2A 2FWHA 3TGZA 2HRFA 5DDLA 1WOUA 4PNFA 3FHKA 3HA9A 4GWRA 2H72A 4AJ8A 5JCGA 1AQWA 1OYJA 5G1LA 1WJKA 4POBA 3ZITA 2A2PA 2DMLA 1XW9A 4JR6A 2ZCTA 3RDWA 3RBTA 4K0NA 2DKHA 4I2TA 2RM6A 3FK8A 1HNCA 22GSA 2HRAA 4PNGA 4DSSB 4MK3A 1JFUA 2H1BA 3MNGA 3UEMA 1X9MB 1J0FA 1FOVA 4MH2A 3FW2A 3P2AA 3CRUA 3LYKA 3ERWA 2H74A 4DSRA 2IMDA 4YKGA 1DUGA 4KF9A 3C71A 1PSQA 1EGRA 3RHCA 3VPQA 4FYBA 3VI5A 3H79A 4K0GA 4ZBDA 2YOIA 3UVHA 2K8SA 5CRDA 2JL4A 5KOWA 5ABRA 1V2AA 2E2MA 3C1RA 4KUNA 1YZXA 2A4HA 1M99A 3FMWA 2R2JA 2B7JA 2FA4A 3VK9A 4CW9A 6GSWA 1BQ7A 3VWUA 2K8VA 3ZIVA 1F3AA 3MYDA 5JCWA 4PX1A 5BMUA 3KD0A 4EO3A 5GAND 3VWWA 3ME7A 4RUVA 2LRTA 3WGEA 2CVKA 3DWVA 5C04A 2V32A 4NMUA 4YQMA 1ILOA 2I9HA 1O85A 4IP6A 1PL2A 3LYPA 2VCTA 1GTUA 2WGRA 1X5DA 2C8UA 4WKWA 5HFIA 3HY2A 5A4VA 4RQRA 2NVLA 2CX3A 2HSYA 4YAVA 1QMVA 2L6CA 4LMWA 5DALB 1K0NA 4RI6A 1XVWA 2FGXA 2H0GA 3F6DA 1YKCA 5G31A 2C0DA 1WMJA 1V58A 1W4VA 5JCUA 4ECIA 2H19A 6GSUA 1N8JA 3TOTA 2G0FA 4DVCA 4LL1B 3IK7A 3M8NA 3TKSA 2B1LA 4FYUA 2FWFA 5H5SA 3GIXA 1S3DA 2C0FA 2YJHA 2WJUA 1S3CA 2YV9A 1SYXA 2L4QA 3IOSA 5LD0A 4TXOA 1SK2A 5IPHA 2C3QA 3UOMA 1SL0B 1Z9HA 4YQVA 1T7PB 3D6IA 2WFCA 4WR5A 1GNEA 4G19A 3F9UA 2YCDA 4MLYA 2B5YA 3H8QA 1KNGA 1JLWA 2JZSA 2IFQB 2YNXA 4IP1A 1OC9B 4EL1A 2OJLA 5H5QA 3QFBC 4IGJA 2KHPA 2VD0A 2I4AA 3HJMA 1AUCA 2DC5A 2WS2A 2EC4A 2QA1A 1J9BA 3UVTA 5B6NA 2RUEA 3TRQA 5IMCA 3TKPA 2XC2A 3L78A 1QXHA 1GUHA 14GSA 2VL3A 4IQAA 2P0GA 1HYUA 2F8FA 3TCOA 2LEGA 4PURA 5B8AA 2VLVA 3DEXA 2YJ7A 2GQMA 2JZTA 4X4JA 2LJRA 4HEA2 2NTOA 4K7IA 2F9SA 4TR1B 2IMFA 4OCFA 1HNBA 2WCIA 1BYEA 2X8HA 3HZ8A 2HT9A 4D73A 2YZUA 3KCMA 1DSBA 5J5NA 4P3YB 4ZBAA 2HNLA 4V1Ag 4FH8A 2H6ZA 4QL7A 4K6XA 3F0IA 1GSFA 1R5PA 2H6XA 2G2QA 2C3NA 4BVYB 3HVXA 3HVVA 2E2GA 1K3LA 1THOA 4TXVA 5G5EA 3GA4A 5GAPD 4ZXGA 2GT6A 3KP9A 5J4UA 2PVQA 4MPFA 2H1AA 4GLTA 1MEKA 4A5PA 2O87A 2ZNMA 5DAKB 4NHWA 1M7TA 1GRXA 4DSQA 4PQHA 1EOGA 3ZVJD 2EIQA 2LNTA 4G0IA 3CSJA 4YAPA 3US3A 1ZYQB 1SENA 1Z5YE 4BPYA 2VAFA 1BX9A 3ZREA 4NPBA 1FAAA 3HJOA 2VCVA 6GSVA 1X9WB 2QC7A 3ZTLA 3VWVA 3ZZXA 5F07A 3E0UA 1T3BA 4PUAA 5ECMB 1BAYA 2DKIA 2DBCA 2Z9SA 2GZYA 5IM9A 5ID2B 3C7MA 3G7IA 1YEXA 3VURA 4Q5FA 3UARA 1E2YA 1TRWA 2PMTA 4NHZA 3P8WA 2ALBA 4MCUA 3KIJA 5IMVA 1R7HA 4OWYA 3PGTA 1G0TA 2B5EA 5J9CA 1B9XC 2LUSA 1XPVA 2B1KA 3U5RE 2YP6A 2H0IA 3I69A 2OBIA 5DQSA 4MF7A 3GMFA 1XFLA 2JACA 2M72A 4K2XA 1TI3A 4K9ZA 4MH3A 2H01A 2CZ3A 2M46A 4ISDA 1EOHA 4DSSA 3GKNA 2LSTA 2VL9A 3IK9A 3A5WA 3EMPA 1EP8A 1N2AA 3CYNA 1X0RA 1XWBA 4IW9A 6GSSA 3UAPA 4ULXA 2CAIA 4EIPA 1K0DA 5CREA 5CO3A 5A5KA 4EKZA 3IXRA 2DIZA 1M2AA 6GSYA 1X5CA 2WB9A 1TRSA 4MP4A 4Z2RA 4O5QA 2JZRA 2PUKC 5FHIA 1MD4A 2MBTA 3TKRA 2R0PA 4IELA 1XXUA 1Z6NA 1FHEA 2RLIA 2L59A 2PBJA 3C8EA 5ECNB 3FR9A 2CZ2A 1WPIA 2B3SA 4ICYA 1ERUA 5JWOB 2VLUA 2LNSA 1PKZA 2H1DA 3NZNA 1BEDA 1FB6A 1HNAA 4XTSA 5FWGA 4MDCA 2A2RA 1GULA 1ZYEA 4HZ4A 5D9TA 1W89A 2WULA 4O5RA 1NHOA 2EIRA 3ME8A 4KNDA 4G9HA 3ZFLA 3CSHA 5CRHA 1OKDA 3QDNA 1TK0B 4XS4B 2AUVA 1TJDA 3A5IA 2B6MA 1WE0A 4ZB6A 2O8VB 1V9WA 2CAQA 1GSEA 10GSA 4YKFA 2RUFA 2LJKA 5IQYA 4MF5A 1ZL9A 3H4KA 5ECKB 3DVXA 3IR4A 4V2LA 2GSTA 2IMEA 3IHQA 4MPGA 3DYRA 2MMOA 4GSSA 5IO2A 2VO4A 3CXGA 5ECLB 1ABAA 4JZQA 2VM2A 3PR8A 5EL8A 3FR3A 4V1Ap 4K7OA 5DALA 1EV4A 1FG4A 1T8EB 2LRNA 1GTIA 4GSNA 2HXKA 5G2ZA 4KDXA 3BCKA 3APQA 2VL2C 1R26A 5HR1A 3ZMLA 1OC8A 2DSAA 5KN1A 2FD3A 2O89A 2OE3A 4IJ3A 3I9V2 4DEJA 4GTUA 2DJ2A 19GSA 1YEPA 1GWCA 3RHBA 1ERTA 2X4AA 3A2VA 4BL7B 1SYRA 2HZEB 4KB3A 3D21A 3HKRA 2YANA 3N5OA 5B7CA 2KOKA 4J2FA 4YH2A 5IO0A 1MTCA 4OFMA 3LW9A 3W8SA 2XPDA 1OC3A 2VD1A 2QKEA 5D9VA 3G7YA 3BOAA 2PU9C 2JSZA 3ZIJA 1GP1A 2IFQA 2L5OA 1JZWA 2MZCA 4EE0A 4LMVA 5E4WA 1OC9A 1R4WA 1PN9A 1B4QA 2HSHA 3E3EA 1NHYA 1LJRA 1V57A 2AHEA 2H1GA 2GLRA 1ZOFA 4K7NA 4WEYA 4X1UA 3QAWA 3U6VA 3TRPA 3IBHA 4J57E 2CT6A 2A2SA 2J23A 2VLTA 3UL3A 1QQ2A 2IN3A 2MBSA 3GKKA 4I2UA 1A8LA 4GF0A 1JZRA 4MABA 5C00A 4TN8A 3GRXA 1R5AA 3IAS2 3PINA 18GSA 2DJ1A 1BG5A 4JU5A 4N0VA 3EVIA 4TR1A 3IA1A 3D4TA 1PX7A 1EV9A 2GS3A 5KEJA 1A2MA 4MMMA 3HHVA 1SJ6A 1VF1A 1FO5A 3GH9A 4TVEA 4F0BA 4XHMA 3WYWA 4KH7A 2PPTA 2X8CA 3HDCA 4BVYA 4TR3A 5IMDA 5G1KA 3KXOA 3IV4A 1QFNA 2HRNA 4O32A 3IPZA 1V98A 1HD2A 1WWJA 1EGOA 1NSWA 3GV1A 4H86A 3A2WA 3O76A 3SBCA 3W6GA 2B5XA 2HI7A 5EY6A 2V6KA 5DAKA 4G10A 1T4ZA 1TK5B 3M9JA 2WDUA 3KZQA 4BA7A 1F3BA 1SD8A 2H8LA 1K3OA 3FY7A 1K0AA 3J7Yk 1EP7A 2LTKA 2H70A 5GSSA 1C72A 1TKDB 1SKRB 1DBYA 5D8IA 1PKWA 1Z6MA 2GT5A 5ECSA 4KCEA 5HR3A 1JZOA 3TJBA 1SD9A 1G6WA 1M2BA 5A4WA 1ZZYA 3R2QA 3DVWA 4KW6A 4QQ7A 1URMA 1Z3EA 3HD5A 3C73A 5ID2A 2V2GA 1PGTA 3ZVJA 1TOFA 1GSYA 2LS5A 1HQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZB8 A;  4MZW A;  1XW6 A;  2FWG A;  1F6M C;  5F8B A;  3DML A;  4LA1 A;  1TDI A;  5IOX A;  1YKA A;  1SK0 A;  1H4O A;  2GVP A;  1ZGN A;  2DJK A;  5CP1 A;  2N5A A;  4G2E A;  4K1F A;  2JSY A;  4PQ1 A;  1K0O A;  4ECC A;  1Y25 A;  4JR4 A;  4NV5 A;  1XWA A;  3EU3 A;  3FYG A;  3GKM A;  2DIY A;  1A2L A;  4AJ7 A;  3LOR A;  3LXT A;  4I8B A;  1B9Y C;  1M9A A;  4NAX A;  5FT3 A;  1MDJ A;  5G5F A;  3ZRD A;  1GH2 A;  3Q6O A;  3BBY A;  1VF3 A;  3FZA A;  4KX4 A;  4I97 A;  1GLP A;  3TJG A;  4MJB A;  2CQ9 A;  4EF0 A;  5ECO B;  2CX4 A;  1AXD A;  4BWQ A;  2XPE A;  3KTL A;  3EIN A;  4I5Q A;  2V1M A;  1DE2 A;  2ES7 A;  3W8J A;  4OO5 A;  1V40 A;  5ENU A;  3CSI A;  3GL3 A;  1XWG A;  5HFG A;  5B6M A;  3HVS A;  3VPT A;  2VCX A;  2QSI A;  4HDE A;  5AGY A;  1A23 A;  1UC7 A;  5A4U A;  1PD2 1;  1YDK A;  3KMN A;  4PUF C;  1MD3 A;  5GST A;  5G30 A;  1G6Y A;  3APS A;  2MYG A;  3GUR A;  4XS4 A;  3F3R A;  2QGV A;  3WT2 A;  1GSD A;  2HLS A;  2NPB A;  2R6K A;  4AGS A;  3FZ5 A;  4WR4 A;  2TRC P;  4ZIL A;  5LCZ A;  5ELG A;  1OE8 A;  1X9S B;  3EC3 A;  3S9F A;  1G7E A;  4JE1 A;  1PA3 A;  2VCQ A;  3TKS E;  1LBK A;  4KSO A;  2XHF A;  1CQH A;  2HFD A;  4HOJ A;  5AIV A;  4EC0 A;  2DLX A;  9GSS A;  2I3Y A;  1U3A A;  4F03 A;  3GST A;  1I5G A;  3J7Y b;  4KDY A;  1AIU A;  3GH6 A;  1Q4J A;  4XCS A;  1XBS A;  2OKA A;  1Z7P A;  1XIY A;  2KLX A;  3DGQ A;  1A2J A;  4MZC A;  1LU4 A;  1SU9 A;  2R37 A;  4Q5R A;  2R3X A;  3CTG A;  1M9B A;  2KP2 A;  3IRA A;  3G7J A;  4GCI A;  4ECB A;  3CRT A;  4IJI A;  1EEM A;  4IQ1 A;  3F4R A;  4ZB9 A;  1G7O A;  2O85 A;  1BJX A;  1OAZ A;  2C3T A;  3NOF A;  4CDO A;  4BL7 A;  3CMI A;  1RW1 A;  1E6B A;  4N0Z A;  3EE2 A;  3WGD A;  2C1Y A;  4PXO A;  2VCZ A;  2HZE A;  1QUW A;  3H1N A;  5DJM A;  1ZCP A;  4K8M A;  3A2X A;  1WIK A;  1OVN A;  3HYP A;  2PGT A;  4ZBB A;  4HQS A;  4Q5N A;  3MDK A;  4EXJ A;  2LQQ A;  3HJP A;  4IKH A;  1T00 A;  1TI1 A;  2VUP A;  4NXI A;  2R4V A;  5E59 A;  2CV4 A;  2XBQ A;  1KBN A;  2XBI A;  4E8H A;  2NBS A;  3UJ1 A;  2AJQ B;  3FEU A;  4EDY A;  2L57 A;  4GXZ A;  1FVJ A;  5DJL A;  2YZH A;  2FNO A;  1IYH A;  5ECH B;  3AY8 A;  3ED3 A;  3F3Q A;  4GST A;  5IOW A;  3UBL A;  2I81 A;  17GS A;  1USB A;  1Z7R A;  4IBP A;  3QR6 A;  3QMX A;  1X5E A;  1WP0 A;  4F0C A;  4XIH A;  1ML6 A;  2H71 A;  4KSM A;  2GSQ A;  2L4C A;  3Q74 A;  3QD9 A;  1AAZ A;  1PX6 A;  4L8E A;  1TU7 A;  1ZMA A;  2P5R A;  3BD2 A;  3L0H A;  1GSQ A;  5D9W A;  5GZZ B;  2FHE A;  4FO5 A;  2BTO T;  2YWN A;  4EUY A;  2CA8 A;  3ZFB A;  2FLS A;  2KUC A;  1O73 A;  2OBK A;  5JWR B;  4ZL9 A;  3F8U A;  4L0U A;  2VL2 A;  3KTB A;  4AF2 A;  3L9S A;  4ZL7 A;  4HQZ A;  3IAM 2;  5AIX A;  5KN3 A;  2FY6 A;  2BMX A;  3LXZ A;  4IVF A;  1THX A;  1Q98 A;  4ILF A;  3LFL A;  3H93 A;  1GSS A;  3GTU B;  2VIM A;  2YWO A;  1F37 A;  4MJA A;  1B48 A;  1O6J A;  3LGC A;  3TJF A;  4MF6 A;  1SKS B;  2JU5 A;  3WGX A;  1TXX A;  2F8A A;  2X64 A;  3GX0 A;  4N11 A;  5HR2 A;  1YF0 A;  2M80 A;  2C80 A;  1RK4 A;  2YWM A;  3Q19 A;  2GZZ A;  3QAV A;  4TR4 A;  3VWX A;  3F63 A;  3F4T A;  3TDG A;  1O81 A;  2C4J A;  2P31 A;  3RPP A;  1NM3 A;  5IIZ A;  3KJY A;  4WET A;  3PH9 A;  4NWY A;  1ON4 A;  3KEB A;  4EDZ A;  1SKW B;  4BWS A;  3LSZ A;  1TRV A;  4F9Z A;  1YF1 A;  4JBB A;  2ON7 A;  4IN0 A;  4JRR A;  2H75 A;  2L5L A;  2IMI A;  3FRC A;  4I6X A;  4XRD A;  3WT1 A;  4FIW A;  1M2D A;  3IE3 A;  5F05 A;  4N30 A;  4EVM A;  3F4S A;  3DXB A;  4QL9 A;  1XVQ A;  1YY7 A;  1SK1 A;  2R5G A;  4RI7 A;  1PRX A;  3GNJ A;  2IL3 A;  4O92 A;  1J08 A;  4PQI A;  5DQY A;  3F6F A;  5ECQ B;  3UMA A;  4MJC A;  3D22 A;  4J56 E;  3EWL A;  2VCW A;  2JAD A;  3GHA A;  3QCP A;  1VF4 A;  3E9J B;  1FVK A;  4MZB A;  3RPN A;  4BVX A;  4TR0 A;  1CQG A;  5ELA A;  1U87 A;  5DCH A;  1MDI A;  3P90 A;  4XS1 A;  3DKS A;  2AV4 A;  1UVZ A;  3KM6 A;  4PGT A;  3WD6 A;  2AAW A;  1K0C A;  1U3I A;  1JZD A;  1T1V A;  2NDO A;  2X99 A;  16GS A;  12GS A;  3C1S A;  1F2E A;  4Q5Q A;  4WBR D;  4F2I A;  3DRN A;  2IMK A;  3A3T A;  2VOC A;  3EMX A;  2VM1 A;  1AW9 A;  1GUK A;  4OMV A;  2MMZ A;  3ZLP A;  2F3M A;  3EUR A;  2WZ9 A;  2J9H A;  3ZL5 A;  3QPM A;  6GST A;  2DJ3 A;  1UA5 A;  2ZUP A;  2YN1 A;  5JWQ B;  1FW1 A;  2MMN A;  4AJ6 A;  3O6T A;  2TRX A;  2EIO A;  2P5Q A;  2IWT A;  2CVD A;  1H75 A;  2IPA A;  4XS6 A;  4XRA A;  4L0W A;  5AN1 A;  3DIE A;  3ERF A;  2FCH A;  1JHB A;  3FZ9 A;  2IIY A;  4X43 A;  1O8X A;  3L4N A;  1K3Y A;  1TW9 A;  5L71 A;  5ECR B;  3I6A A;  1XOA A;  2V41 A;  2FUG 2;  4KCA A;  3TKS C;  4OD7 A;  1GTA A;  3ISO A;  2H66 A;  1U6T A;  2N5F A;  3SWL A;  5HQP A;  3OR5 A;  5D93 A;  3K8N A;  4OCE A;  3G9B A;  3NIV A;  4HI7 A;  4YQU A;  1TU8 A;  4HJ2 A;  1K0M A;  4WF4 A;  5DBQ A;  3RAZ A;  3TUE A;  4KA0 A;  3V1W A;  2N5B A;  3EYT A;  2BJX A;  3TKQ A;  4TW5 A;  5IPG A;  4HZ2 A;  1RQM A;  1WRY A;  1VF2 A;  4IS0 A;  5LNK e;  2OE1 A;  4GQF A;  4ZL8 A;  4GRF A;  4LL4 B;  2K6V A;  2H6Y A;  1JLV A;  1A8Y A;  2YV7 A;  4NV2 A;  3IDV A;  4HS1 A;  1ERV A;  5F0G A;  3KP8 A;  1B4P A;  2E7P A;  4POL A;  4WF5 A;  2C0G A;  5KN0 A;  1M0U A;  2REM A;  4RQX A;  2A4V A;  5IMF A;  4GQC A;  5CRW A;  3M3M A;  5CNW A;  1U88 A;  2ON5 A;  4CHS A;  4KDU A;  2V6O A;  1GNW A;  3GKX A;  2HZF A;  3HZ4 A;  3L9V A;  2MMA A;  3LJR A;  2K9F A;  1AQX A;  1T4Y A;  5CAX A;  4HU7 A;  1SL1 B;  1A24 A;  1OKT A;  5J41 A;  4KAE A;  2OA7 A;  1EZK A;  1ST9 A;  3VLN A;  1F9M A;  1GTB A;  1I9D A;  2RM5 A;  2E0Q A;  4F82 A;  2GGT A;  4ML6 A;  2DMM A;  1KEB A;  2H73 A;  3MSZ A;  4MJE A;  1SJI A;  4TRX A;  1OE7 A;  3EU4 A;  2AB6 A;  3QAG A;  5KN2 A;  3VI7 A;  4OFN A;  1B8X A;  2F51 A;  4JED A;  5B8B A;  2O7K A;  11GS A;  2RII A;  5EPF A;  3ZYW A;  4ACS A;  1A0R P;  1TRU A;  1XWK A;  2KP1 A;  3KH9 A;  3M9K A;  4TXO B;  2I1U A;  1S3A A;  2K18 A;  1EWX A;  1AQV A;  4POK A;  5COH A;  5D9X A;  2C0E A;  2LJA A;  2LQO A;  3BJ5 A;  2PER A;  5DCG A;  3TB2 A;  20GS A;  5DVB A;  5ECI B;  2GQL A;  1GL8 A;  2LV3 A;  4ML1 A;  3MAK A;  3TRX A;  1Y6E A;  3GTU A;  1FB0 A;  5EVO A;  2H30 A;  2WRT A;  4V2N A;  6GSX A;  4WXT A;  1AC1 A;  3I43 A;  5F06 A;  2IJY A;  3HCZ A;  3APO A;  4HUA A;  3DD3 A;  3GFK A;  3JCM L;  3TOU A;  1KTE A;  3TJK A;  5INY A;  3N9J A;  5AIS A;  5D96 A;  2OAD A;  2DJJ A;  3LG6 A;  1PQN A;  2L6D A;  3ZMK A;  2H0H A;  3D0Z A;  4L5L A;  4O7H A;  3ERG A;  2B7K A;  2GZP A;  1O8W A;  1PMT A;  2OAC A;  2DJ0 A;  2FA8 A;  2HE3 A;  2D2Z A;  1XCC A;  3UIW A;  2PN8 A;  3GYK A;  1QGV A;  1VGL A;  3QOU A;  2LRC A;  5HFK A;  4D73 B;  4HJM A;  1EEJ A;  4ECJ A;  2H76 A;  1ACV A;  1A0F A;  4ID0 A;  1K0B A;  2FWE A;  3TJJ A;  3GX8 A;  2X8G A;  4HU9 A;  1TTZ A;  1VRS D;  1XW5 A;  5HR0 A;  1GSU A;  5J9B A;  5H5R A;  4ZIJ A;  2GQK A;  3LWA A;  4V2M A;  3FZ4 A;  5J3R A;  1SJZ A;  3LEF A;  3LQ7 A;  3CBU A;  5IMZ A;  1DE1 A;  3MWH A;  3QFA C;  2GSR A;  3HXS A;  3D4M A;  4WBJ A;  4K2D A;  4KGI A;  3KGK A;  4X0X A;  3GSS A;  1TP9 A;  3O3T A;  1YJ6 A;  3GN3 A;  3M1G A;  2GTU A;  2CVB A;  1O7U A;  4OO4 A;  1YQ1 A;  2HYX A;  4POM A;  3Q18 A;  3FR6 A;  4LLR A;  2GSS A;  2TIR A;  1XZO A;  1GLQ A;  4TOP A;  2GDR A;  3KH7 A;  1PL1 A;  4TKY A;  2YWI A;  5CRG A;  2PWJ A;  1GUM A;  1XOB A;  3P7X A;  3GL5 A;  1XWC A;  8GSS A;  4MA9 A;  4N10 A;  3BCI A;  3KMO A;  1NW2 A;  2OE0 A;  2YPM A;  3L9U A;  3VFI A;  13GS A;  3IC4 A;  3FKF A;  5D73 A;  5ECP B;  1IYI A;  1ERW A;  2PVO C;  3GUS A;  4L5O A;  4FYC A;  3UBK A;  5CYY A;  3M0F A;  1TK8 B;  4E8E A;  5IMA A;  4OFT A;  1MDK A;  1QK8 A;  4KE3 A;  2LKU A;  2AYT A;  1SL2 B;  3D5J A;  7GSS A;  4Z7X A;  4IHU A;  3CTF A;  1UN2 A;  2FWH A;  3TGZ A;  2HRF A;  5DDL A;  1WOU A;  4PNF A;  3FHK A;  3HA9 A;  4GWR A;  2H72 A;  4AJ8 A;  5JCG A;  1AQW A;  1OYJ A;  5G1L A;  1WJK A;  4POB A;  3ZIT A;  2DML A;  1XW9 A;  4JR6 A;  2ZCT A;  3RDW A;  3RBT A;  4K0N A;  4I2T A;  2RM6 A;  3FK8 A;  1HNC A;  22GS A;  4PNG A;  4DSS B;  4MK3 A;  1JFU A;  2H1B A;  3MNG A;  3UEM A;  1X9M B;  1J0F A;  1FOV A;  4MH2 A;  3FW2 A;  3P2A A;  3CRU A;  3LYK A;  3ERW A;  2H74 A;  4DSR A;  2IMD A;  1DUG A;  3C71 A;  1PSQ A;  1EGR A;  3RHC A;  3VPQ A;  4FYB A;  3VI5 A;  3H79 A;  4K0G A;  4ZBD A;  2YOI A;  3UVH A;  2K8S A;  5CRD A;  2JL4 A;  5ABR A;  1V2A A;  2E2M A;  3C1R A;  4KUN A;  1YZX A;  1M99 A;  2R2J A;  2B7J A;  2FA4 A;  3VK9 A;  4CW9 A;  6GSW A;  1BQ7 A;  3VWU A;  2K8V A;  3ZIV A;  1F3A A;  5JCW A;  4PX1 A;  3KD0 A;  4EO3 A;  5GAN D;  3VWW A;  3ME7 A;  4RUV A;  2LRT A;  3WGE A;  2CVK A;  3DWV A;  5C04 A;  2V32 A;  4NMU A;  4YQM A;  1ILO A;  2I9H A;  1O85 A;  4IP6 A;  1PL2 A;  3LYP A;  2VCT A;  1GTU A;  2WGR A;  1X5D A;  2C8U A;  4WKW A;  5HFI A;  3HY2 A;  5A4V A;  4RQR A;  2NVL A;  2CX3 A;  2HSY A;  4YAV A;  1QMV A;  2L6C A;  4LMW A;  5DAL B;  1K0N A;  4RI6 A;  1XVW A;  2FGX A;  2H0G A;  3F6D A;  1YKC A;  5G31 A;  2C0D A;  1WMJ A;  1V58 A;  1W4V A;  5JCU A;  4ECI A;  2H19 A;  6GSU A;  1N8J A;  3TOT A;  2G0F A;  4DVC A;  4LL1 B;  3IK7 A;  3M8N A;  3TKS A;  2B1L A;  4FYU A;  2FWF A;  5H5S A;  3GIX A;  1S3D A;  2C0F A;  2YJH A;  2WJU A;  1S3C A;  2YV9 A;  1SYX A;  2L4Q A;  3IOS A;  5LD0 A;  4TXO A;  1SK2 A;  5IPH A;  2C3Q A;  3UOM A;  1SL0 B;  1Z9H A;  4YQV A;  1T7P B;  3D6I A;  2WFC A;  4WR5 A;  1GNE A;  4G19 A;  3F9U A;  2YCD A;  4MLY A;  2B5Y A;  3H8Q A;  1KNG A;  1JLW A;  2JZS A;  2IFQ B;  2YNX A;  4IP1 A;  1OC9 B;  4EL1 A;  2OJL A;  5H5Q A;  3QFB C;  4IGJ A;  2KHP A;  2VD0 A;  2I4A A;  3HJM A;  1AUC A;  2DC5 A;  2WS2 A;  2EC4 A;  1J9B A;  3UVT A;  5B6N A;  2RUE A;  3TRQ A;  5IMC A;  3TKP A;  2XC2 A;  3L78 A;  1QXH A;  1GUH A;  14GS A;  2VL3 A;  4IQA A;  2P0G A;  1HYU A;  2F8F A;  3TCO A;  2LEG A;  4PUR A;  5B8A A;  2VLV A;  3DEX A;  2YJ7 A;  2GQM A;  2JZT A;  2LJR A;  4HEA 2;  2NTO A;  4K7I A;  2F9S A;  4TR1 B;  2IMF A;  4OCF A;  1HNB A;  2WCI A;  1BYE A;  2X8H A;  3HZ8 A;  2HT9 A;  4D73 A;  2YZU A;  3KCM A;  1DSB A;  5J5N A;  4P3Y B;  4ZBA A;  2HNL A;  4V1A g;  4FH8 A;  2H6Z A;  4QL7 A;  4K6X A;  3F0I A;  1GSF A;  1R5P A;  2H6X A;  2G2Q A;  2C3N A;  3HVX A;  3HVV A;  2E2G A;  1K3L A;  1THO A;  4TXV A;  5G5E A;  3GA4 A;  5GAP D;  4ZXG A;  2GT6 A;  3KP9 A;  5J4U A;  2PVQ A;  4MPF A;  2H1A A;  4GLT A;  1MEK A;  2O87 A;  2ZNM A;  5DAK B;  4NHW A;  1M7T A;  1GRX A;  4DSQ A;  4PQH A;  1EOG A;  3ZVJ D;  2EIQ A;  2LNT A;  3CSJ A;  4YAP A;  3US3 A;  1ZYQ B;  1SEN A;  1Z5Y E;  4BPY A;  2VAF A;  1BX9 A;  3ZRE A;  4NPB A;  1FAA A;  3HJO A;  2VCV A;  6GSV A;  1X9W B;  2QC7 A;  3ZTL A;  3VWV A;  3ZZX A;  5F07 A;  3E0U A;  1T3B A;  4PUA A;  5ECM B;  1BAY A;  2DBC A;  2Z9S A;  2GZY A;  5IM9 A;  5ID2 B;  3C7M A;  3G7I A;  1YEX A;  3VUR A;  4Q5F A;  3UAR A;  1E2Y A;  1TRW A;  2PMT A;  4NHZ A;  3P8W A;  2ALB A;  4MCU A;  3KIJ A;  5IMV A;  1R7H A;  4OWY A;  3PGT A;  1G0T A;  2B5E A;  5J9C A;  1B9X C;  2LUS A;  1XPV A;  2B1K A;  3U5R E;  2YP6 A;  2H0I A;  3I69 A;  2OBI A;  5DQS A;  4MF7 A;  3GMF A;  1XFL A;  2JAC A;  2M72 A;  1TI3 A;  4K9Z A;  4MH3 A;  2H01 A;  2CZ3 A;  2M46 A;  4ISD A;  1EOH A;  4DSS A;  3GKN A;  2LST A;  2VL9 A;  3IK9 A;  3A5W A;  3EMP A;  1EP8 A;  1N2A A;  3CYN A;  1X0R A;  1XWB A;  4IW9 A;  6GSS A;  3UAP A;  4ULX A;  2CAI A;  1K0D A;  5CRE A;  5CO3 A;  5A5K A;  4EKZ A;  3IXR A;  2DIZ A;  1M2A A;  6GSY A;  1X5C A;  2WB9 A;  1TRS A;  4MP4 A;  2JZR A;  2PUK C;  5FHI A;  1MD4 A;  2MBT A;  3TKR A;  4IEL A;  1XXU A;  1Z6N A;  1FHE A;  2RLI A;  2L59 A;  2PBJ A;  3C8E A;  5ECN B;  3FR9 A;  2CZ2 A;  1WPI A;  2B3S A;  1ERU A;  5JWO B;  2VLU A;  2LNS A;  1PKZ A;  2H1D A;  3NZN A;  1BED A;  1FB6 A;  1HNA A;  4XTS A;  5FWG A;  4MDC A;  2A2R A;  1GUL A;  1ZYE A;  4HZ4 A;  5D9T A;  1W89 A;  2WUL A;  4O5R A;  1NHO A;  2EIR A;  3ME8 A;  4KND A;  4G9H A;  3ZFL A;  3CSH A;  5CRH A;  1OKD A;  3QDN A;  1TK0 B;  4XS4 B;  2AUV A;  1TJD A;  2B6M A;  1WE0 A;  4ZB6 A;  2O8V B;  1V9W A;  2CAQ A;  1GSE A;  10GS A;  2RUF A;  2LJK A;  5IQY A;  4MF5 A;  1ZL9 A;  3H4K A;  5ECK B;  3DVX A;  3IR4 A;  4V2L A;  2GST A;  2IME A;  3IHQ A;  4MPG A;  3DYR A;  2MMO A;  4GSS A;  5IO2 A;  2VO4 A;  3CXG A;  5ECL B;  1ABA A;  4JZQ A;  2VM2 A;  3PR8 A;  5EL8 A;  3FR3 A;  4V1A p;  4K7O A;  5DAL A;  1EV4 A;  1FG4 A;  1T8E B;  2LRN A;  1GTI A;  4GSN A;  2HXK A;  5G2Z A;  4KDX A;  3BCK A;  3APQ A;  2VL2 C;  1R26 A;  5HR1 A;  3ZML A;  1OC8 A;  2DSA A;  5KN1 A;  2FD3 A;  2O89 A;  2OE3 A;  4IJ3 A;  3I9V 2;  4DEJ A;  4GTU A;  2DJ2 A;  19GS A;  1YEP A;  1GWC A;  3RHB A;  1ERT A;  3A2V A;  1SYR A;  2HZE B;  4KB3 A;  3D21 A;  3HKR A;  2YAN A;  3N5O A;  5B7C A;  2KOK A;  4J2F A;  4YH2 A;  5IO0 A;  1MTC A;  4OFM A;  3W8S A;  2XPD A;  1OC3 A;  2VD1 A;  2QKE A;  5D9V A;  3G7Y A;  3BOA A;  2PU9 C;  2JSZ A;  3ZIJ A;  1GP1 A;  2IFQ A;  2L5O A;  1JZW A;  2MZC A;  4EE0 A;  4LMV A;  5E4W A;  1OC9 A;  1R4W A;  1PN9 A;  1B4Q A;  2HSH A;  3E3E A;  1NHY A;  1LJR A;  1V57 A;  2AHE A;  2H1G A;  2GLR A;  1ZOF A;  4K7N A;  4WEY A;  4X1U A;  3QAW A;  3U6V A;  3TRP A;  3IBH A;  4J57 E;  2CT6 A;  2A2S A;  2J23 A;  2VLT A;  3UL3 A;  1QQ2 A;  2IN3 A;  2MBS A;  3GKK A;  4I2U A;  1A8L A;  4GF0 A;  1JZR A;  4MAB A;  5C00 A;  4TN8 A;  3GRX A;  1R5A A;  3IAS 2;  3PIN A;  18GS A;  2DJ1 A;  1BG5 A;  4JU5 A;  4N0V A;  3EVI A;  4TR1 A;  3IA1 A;  3D4T A;  1PX7 A;  1EV9 A;  2GS3 A;  5KEJ A;  1A2M A;  4MMM A;  3HHV A;  1SJ6 A;  1VF1 A;  1FO5 A;  3GH9 A;  4TVE A;  4F0B A;  4XHM A;  3WYW A;  4KH7 A;  2PPT A;  2X8C A;  3HDC A;  4BVY A;  4TR3 A;  5IMD A;  5G1K A;  3KXO A;  3IV4 A;  1QFN A;  2HRN A;  4O32 A;  3IPZ A;  1V98 A;  1HD2 A;  1WWJ A;  1EGO A;  1NSW A;  3GV1 A;  4H86 A;  3A2W A;  3O76 A;  3SBC A;  3W6G A;  2B5X A;  2HI7 A;  5EY6 A;  2V6K A;  5DAK A;  4G10 A;  1T4Z A;  1TK5 B;  3M9J A;  2WDU A;  3KZQ A;  4BA7 A;  1F3B A;  1SD8 A;  2H8L A;  1K3O A;  3FY7 A;  1K0A A;  3J7Y k;  1EP7 A;  2LTK A;  2H70 A;  5GSS A;  1C72 A;  1TKD B;  1SKR B;  1DBY A;  5D8I A;  1PKW A;  1Z6M A;  2GT5 A;  5ECS A;  4KCE A;  5HR3 A;  1JZO A;  3TJB A;  1SD9 A;  1G6W A;  1M2B A;  5A4W A;  1ZZY A;  3R2Q A;  3DVW A;  4KW6 A;  4QQ7 A;  1URM A;  1Z3E A;  3HD5 A;  3C73 A;  5ID2 A;  2V2G A;  1PGT A;  3ZVJ A;  1TOF A;  1GSY A;  2LS5 A;  1HQO A; 
#chains in the Genus database with same CATH topology
 4ZB8 A;  4MZW A;  1XW6 A;  1ZYN A;  1ZYP A;  2FWG A;  1F6M C;  5F8B A;  3DML A;  4LA1 A;  1TDI A;  5IOX A;  1YKA A;  1SK0 A;  1H4O A;  2GVP A;  1ZGN A;  2DJK A;  5CP1 A;  2N5A A;  4G2E A;  4K1F A;  2JSY A;  4PQ1 A;  1K0O A;  4ECC A;  1PN0 A;  1Y25 A;  4JR4 A;  4NV5 A;  4EIQ A;  1XWA A;  3EU3 A;  3FYG A;  2R0G A;  3GKM A;  2DIY A;  1A2L A;  4AJ7 A;  1FOH A;  3LOR A;  3LXT A;  4I8B A;  1B9Y C;  1M9A A;  4NAX A;  5FT3 A;  1MDJ A;  5G5F A;  3ZRD A;  1GH2 A;  3Q6O A;  3BBY A;  1VF3 A;  3FZA A;  4KX4 A;  4I97 A;  1GLP A;  4BVX B;  3TJG A;  4MJB A;  2CQ9 A;  4EF0 A;  5ECO B;  2CX4 A;  1AXD A;  4BWQ A;  2XPE A;  3KTL A;  3EIN A;  4I5Q A;  4CY6 A;  2V1M A;  1DE2 A;  1S3R A;  2ES7 A;  3W8J A;  4OO5 A;  1V40 A;  5ENU A;  3CSI A;  3GL3 A;  1XWG A;  5HFG A;  5B6M A;  3HVS A;  3VPT A;  2VCX A;  2QSI A;  4HDE A;  5AGY A;  1A23 A;  1UC7 A;  5A4U A;  1PD2 1;  1YDK A;  3KMN A;  4PUF C;  1MD3 A;  5GST A;  5G30 A;  1G6Y A;  3APS A;  2MYG A;  3GUR A;  4XS4 A;  3F3R A;  2X49 A;  2QGV A;  3WT2 A;  1GSD A;  2HLS A;  2NPB A;  2R6K A;  4AGS A;  3FZ5 A;  4WR4 A;  2TRC P;  4ZIL A;  5LCZ A;  5ELG A;  1OE8 A;  1X9S B;  3EC3 A;  3S9F A;  1G7E A;  4JE1 A;  1PA3 A;  2VCQ A;  3TKS E;  1LBK A;  4KSO A;  2XHF A;  1CQH A;  2HFD A;  4HOJ A;  5AIV A;  4EC0 A;  2DLX A;  9GSS A;  2I3Y A;  1U3A A;  4F03 A;  3GST A;  1I5G A;  3J7Y b;  4KDY A;  1AIU A;  3GH6 A;  1Q4J A;  4XCS A;  1XBS A;  2OKA A;  1Z7P A;  1XIY A;  2KLX A;  3DGQ A;  1A2J A;  4MZC A;  1LU4 A;  1SU9 A;  2R37 A;  4Q5R A;  2R3X A;  3CTG A;  1M9B A;  2KP2 A;  3IRA A;  3G7J A;  4GCI A;  4ECB A;  3CRT A;  4IJI A;  4K5S A;  1EEM A;  4IQ1 A;  3F4R A;  4ZB9 A;  1G7O A;  2O85 A;  1BJX A;  1OAZ A;  2C3T A;  3NOF A;  4CDO A;  4BL7 A;  3CMI A;  1RW1 A;  1E6B A;  4N0Z A;  3EE2 A;  3WGD A;  2C1Y A;  4PXO A;  2VCZ A;  2HZE A;  1QUW A;  3H1N A;  5DJM A;  1ZCP A;  4K8M A;  3A2X A;  1WIK A;  1OVN A;  3HYP A;  2PGT A;  4ZBB A;  4HQS A;  4Q5N A;  3MDK A;  4EXJ A;  2LQQ A;  3HJP A;  4IKH A;  1T00 A;  1TI1 A;  2VUP A;  4NXI A;  2QA2 A;  2R4V A;  5E59 A;  2CV4 A;  2XBQ A;  1KBN A;  2XBI A;  4E8H A;  2NBS A;  3UJ1 A;  2AJQ B;  3FEU A;  4EDY A;  2L57 A;  4GXZ A;  1FVJ A;  5DJL A;  2YZH A;  2FNO A;  1IYH A;  5ECH B;  3AY8 A;  3ED3 A;  3F3Q A;  4GST A;  5IOW A;  3UBL A;  2I81 A;  17GS A;  1USB A;  1Z7R A;  4IBP A;  3QR6 A;  3QMX A;  1X5E A;  4O5U A;  1WP0 A;  4F0C A;  4XIH A;  1ML6 A;  2H71 A;  4KSM A;  2GSQ A;  2L4C A;  3Q74 A;  3QD9 A;  1AAZ A;  1PX6 A;  4L8E A;  1TU7 A;  1ZMA A;  2P5R A;  3BD2 A;  3L0H A;  1GSQ A;  5D9W A;  5GZZ B;  2FHE A;  4FO5 A;  2BTO T;  2YWN A;  4EUY A;  2CA8 A;  3ZFB A;  3HVN A;  2FLS A;  2KUC A;  1O73 A;  2OBK A;  3R3E A;  5JWR B;  4ZL9 A;  3F8U A;  4L0U A;  2VL2 A;  4CY8 A;  3KTB A;  4AF2 A;  3L9S A;  4ZL7 A;  4HQZ A;  3IAM 2;  5AIX A;  5KN3 A;  2FY6 A;  2BMX A;  3LXZ A;  4IVF A;  1THX A;  1Q98 A;  4ILF A;  3LFL A;  3H93 A;  1GSS A;  4Z2T A;  3GTU B;  2VIM A;  2YWO A;  1F37 A;  4MJA A;  1B48 A;  1O6J A;  3LGC A;  3TJF A;  4MF6 A;  1SKS B;  2JU5 A;  3WGX A;  1TXX A;  2F8A A;  4PTS A;  2X64 A;  3GX0 A;  4N11 A;  3PPU A;  5HR2 A;  4G0K A;  1YF0 A;  2M80 A;  2C80 A;  1RK4 A;  2YWM A;  3Q19 A;  2GZZ A;  3QAV A;  4TR4 A;  3VWX A;  3F63 A;  2HRK A;  3F4T A;  3TDG A;  1O81 A;  2C4J A;  2P31 A;  3RPP A;  1NM3 A;  5IIZ A;  3KJY A;  4WET A;  3PH9 A;  4NWY A;  1ON4 A;  3KEB A;  4EDZ A;  1SKW B;  4BWS A;  3LSZ A;  1TRV A;  4F9Z A;  1YF1 A;  4JBB A;  2ON7 A;  4IN0 A;  4JRR A;  2H75 A;  2L5L A;  2IMI A;  3FRC A;  4I6X A;  4XRD A;  3WT1 A;  4FIW A;  1M2D A;  3IE3 A;  5F05 A;  4N30 A;  4EVM A;  3F4S A;  3DXB A;  4QL9 A;  1XVQ A;  1YY7 A;  1SK1 A;  2R5G A;  5BRT A;  4RI7 A;  1PFO A;  1PRX A;  3GNJ A;  2IL3 A;  4O92 A;  1J08 A;  4PQI A;  5DQY A;  3F6F A;  5KOX A;  5ECQ B;  3UMA A;  4MJC A;  3D22 A;  4J56 E;  3EWL A;  2VCW A;  2JAD A;  3GHA A;  3QCP A;  1VF4 A;  3E9J B;  1FVK A;  4MZB A;  3RPN A;  4BVX A;  4TR0 A;  1CQG A;  5ELA A;  1U87 A;  5DCH A;  1MDI A;  3P90 A;  4XS1 A;  3DKS A;  2AV4 A;  1UVZ A;  3KM6 A;  4PGT A;  3WD6 A;  2AAW A;  1K0C A;  1U3I A;  1JZD A;  1T1V A;  2NDO A;  2X99 A;  16GS A;  12GS A;  3C1S A;  1F2E A;  4Q5Q A;  4WBR D;  4F2I A;  3DRN A;  2IMK A;  3A3T A;  2VOC A;  3EMX A;  2VM1 A;  1AW9 A;  1GUK A;  4OMV A;  2MMZ A;  3ZLP A;  3IC8 A;  2F3M A;  3EUR A;  4MNN A;  2WZ9 A;  2J9H A;  3ZL5 A;  3QPM A;  6GST A;  2DJ3 A;  1UA5 A;  2ZUP A;  2YN1 A;  5JWQ B;  1FW1 A;  2MMN A;  4AJ6 A;  3O6T A;  2TRX A;  2EIO A;  2P5Q A;  2IWT A;  2CVD A;  1H75 A;  2IPA A;  4XS6 A;  4XRA A;  4L0W A;  5AN1 A;  3DIE A;  3ERF A;  2FCH A;  1JHB A;  3FZ9 A;  2IIY A;  4X43 A;  1O8X A;  3L4N A;  1K3Y A;  1TW9 A;  5L71 A;  2R0C A;  5ECR B;  3I6A A;  1XOA A;  2V41 A;  2FUG 2;  4KCA A;  1M3I A;  4OD7 A;  1GTA A;  3ISO A;  3TKS C;  2H66 A;  1U6T A;  2N5F A;  3SWL A;  5HQP A;  1XG8 A;  3OR5 A;  5D93 A;  3K8N A;  4OCE A;  3G9B A;  3NIV A;  4HI7 A;  4YQU A;  1TU8 A;  4HJ2 A;  1K0M A;  4WF4 A;  5DBQ A;  4FQU A;  3RAZ A;  3TUE A;  4KA0 A;  3V1W A;  2N5B A;  3EYT A;  2BJX A;  3TKQ A;  4TW5 A;  5IPG A;  4HZ2 A;  1RQM A;  1WRY A;  1VF2 A;  4IS0 A;  5LNK e;  2OE1 A;  4GQF A;  4ZL8 A;  4GRF A;  4LL4 B;  2K6V A;  2H6Y A;  2HSM A;  1JLV A;  1A8Y A;  2YV7 A;  4NV2 A;  3IDV A;  4HS1 A;  1ERV A;  5F0G A;  3KP8 A;  1B4P A;  2E7P A;  4POL A;  4WF5 A;  2C0G A;  5KN0 A;  1M0U A;  2REM A;  4RQX A;  2A4V A;  5IMF A;  4GQC A;  5CRW A;  3M3M A;  5CNW A;  1U88 A;  2ON5 A;  4CHS A;  4KDU A;  2V6O A;  3EPT A;  1GNW A;  3GKX A;  2HZF A;  3HZ4 A;  3L9V A;  2MMA A;  3LJR A;  2K9F A;  1AQX A;  1T4Y A;  5CAX A;  4HU7 A;  1SL1 B;  1A24 A;  1OKT A;  5J41 A;  4KAE A;  2OA7 A;  1EZK A;  1ST9 A;  3VLN A;  1F9M A;  1GTB A;  1I9D A;  2RM5 A;  2E0Q A;  4F82 A;  2GGT A;  4ML6 A;  2DMM A;  1KEB A;  2H73 A;  3MSZ A;  4MJE A;  1SJI A;  4TRX A;  4G0L A;  1OE7 A;  3EU4 A;  4K5R A;  2AB6 A;  3QAG A;  5KN2 A;  3VI7 A;  4OFN A;  1B8X A;  2F51 A;  4JED A;  5B8B A;  2O7K A;  11GS A;  2RII A;  5EPF A;  3ZYW A;  4ACS A;  1A0R P;  1TRU A;  1XWK A;  2KP1 A;  3KH9 A;  3M9K A;  4TXO B;  2I1U A;  1S3A A;  2K18 A;  1EWX A;  1AQV A;  4POK A;  5COH A;  5D9X A;  2C0E A;  2LJA A;  2LQO A;  3BJ5 A;  2PER A;  5DCG A;  3TB2 A;  20GS A;  5DVB A;  5ECI B;  2GQL A;  1GL8 A;  2LV3 A;  4ML1 A;  3MAK A;  3TRX A;  1Y6E A;  3GTU A;  1FB0 A;  5EVO A;  2H30 A;  2WRT A;  4V2N A;  6GSX A;  4WXT A;  1AC1 A;  3I43 A;  5F06 A;  2IJY A;  3HCZ A;  3APO A;  4HUA A;  3DD3 A;  3GFK A;  3JCM L;  3TOU A;  1KTE A;  3TJK A;  5INY A;  3N9J A;  5AIS A;  5D96 A;  2OAD A;  2DJJ A;  3LG6 A;  1PQN A;  2L6D A;  3ZMK A;  2H0H A;  3D0Z A;  4L5L A;  4O7H A;  3ERG A;  2B7K A;  2GZP A;  1O8W A;  1PMT A;  2UZ8 A;  2OAC A;  2DJ0 A;  2FA8 A;  1M3J A;  2D2Z A;  2HE3 A;  1XCC A;  3UIW A;  2PN8 A;  3GYK A;  4Z2U A;  1QGV A;  1VGL A;  3QOU A;  2LRC A;  5HFK A;  4D73 B;  4HJM A;  1EEJ A;  3MIX A;  4ECJ A;  2H76 A;  1ACV A;  1A0F A;  4ID0 A;  1K0B A;  2FWE A;  3TJJ A;  3GX8 A;  2X8G A;  4HU9 A;  1TTZ A;  1VRS D;  1XW5 A;  5HR0 A;  1GSU A;  5J9B A;  5H5R A;  4ZIJ A;  2GQK A;  3LWA A;  4V2M A;  3FZ4 A;  5J3R A;  1SJZ A;  3LEF A;  3LQ7 A;  3CBU A;  5IMZ A;  1DE1 A;  3MWH A;  3QFA C;  2GSR A;  3HXS A;  3IHG A;  3D4M A;  4WBJ A;  4K2D A;  4KGI A;  3KGK A;  4X0X A;  3GSS A;  1TP9 A;  3O3T A;  1YJ6 A;  3GN3 A;  3M1G A;  2GTU A;  2CVB A;  1O7U A;  4OO4 A;  1YQ1 A;  2HYX A;  4POM A;  3Q18 A;  3FR6 A;  4LLR A;  2GSS A;  2TIR A;  1XZO A;  1GLQ A;  4TOP A;  2GDR A;  3KH7 A;  1PL1 A;  4TKY A;  2YWI A;  5CRG A;  2PWJ A;  1GUM A;  1XOB A;  3P7X A;  3GL5 A;  1XWC A;  8GSS A;  4MA9 A;  4N10 A;  3BCI A;  3KMO A;  1NW2 A;  2OE0 A;  2YPM A;  3L9U A;  3VFI A;  4USS A;  13GS A;  3IC4 A;  3FKF A;  5D73 A;  5ECP B;  1IYI A;  1ERW A;  2PVO C;  3GUS A;  4L5O A;  4FYC A;  3UBK A;  5CYY A;  3M0F A;  1TK8 B;  4E8E A;  5IMA A;  4OFT A;  1MDK A;  1QK8 A;  4KE3 A;  2LKU A;  2AYT A;  1SL2 B;  3D5J A;  7GSS A;  4Z7X A;  4IHU A;  3CTF A;  1UN2 A;  2FWH A;  3TGZ A;  2HRF A;  5DDL A;  1WOU A;  4PNF A;  3FHK A;  3HA9 A;  4GWR A;  2H72 A;  4AJ8 A;  5JCG A;  1AQW A;  1OYJ A;  5G1L A;  1WJK A;  4POB A;  3ZIT A;  2A2P A;  2DML A;  1XW9 A;  4JR6 A;  2ZCT A;  3RDW A;  3RBT A;  4K0N A;  2DKH A;  4I2T A;  2RM6 A;  3FK8 A;  1HNC A;  22GS A;  2HRA A;  4PNG A;  4DSS B;  4MK3 A;  1JFU A;  2H1B A;  3MNG A;  3UEM A;  1X9M B;  1J0F A;  1FOV A;  4MH2 A;  3FW2 A;  3P2A A;  3CRU A;  3LYK A;  3ERW A;  2H74 A;  4DSR A;  2IMD A;  4YKG A;  1DUG A;  4KF9 A;  3C71 A;  1PSQ A;  1EGR A;  3RHC A;  3VPQ A;  4FYB A;  3VI5 A;  3H79 A;  4K0G A;  4ZBD A;  2YOI A;  3UVH A;  2K8S A;  5CRD A;  2JL4 A;  5KOW A;  5ABR A;  1V2A A;  2E2M A;  3C1R A;  4KUN A;  1YZX A;  2A4H A;  1M99 A;  3FMW A;  2R2J A;  2B7J A;  2FA4 A;  3VK9 A;  4CW9 A;  6GSW A;  1BQ7 A;  3VWU A;  2K8V A;  3ZIV A;  1F3A A;  3MYD A;  5JCW A;  4PX1 A;  5BMU A;  3KD0 A;  4EO3 A;  5GAN D;  3VWW A;  3ME7 A;  4RUV A;  2LRT A;  3WGE A;  2CVK A;  3DWV A;  5C04 A;  2V32 A;  4NMU A;  4YQM A;  1ILO A;  2I9H A;  1O85 A;  4IP6 A;  1PL2 A;  3LYP A;  2VCT A;  1GTU A;  2WGR A;  1X5D A;  2C8U A;  4WKW A;  5HFI A;  3HY2 A;  5A4V A;  4RQR A;  2NVL A;  2CX3 A;  2HSY A;  4YAV A;  1QMV A;  2L6C A;  4LMW A;  5DAL B;  1K0N A;  4RI6 A;  1XVW A;  2FGX A;  2H0G A;  3F6D A;  1YKC A;  5G31 A;  2C0D A;  1WMJ A;  1V58 A;  1W4V A;  5JCU A;  4ECI A;  2H19 A;  6GSU A;  1N8J A;  3TOT A;  2G0F A;  4DVC A;  4LL1 B;  3IK7 A;  3M8N A;  3TKS A;  2B1L A;  4FYU A;  2FWF A;  5H5S A;  3GIX A;  1S3D A;  2C0F A;  2YJH A;  2WJU A;  1S3C A;  2YV9 A;  1SYX A;  2L4Q A;  3IOS A;  5LD0 A;  4TXO A;  1SK2 A;  5IPH A;  2C3Q A;  3UOM A;  1SL0 B;  1Z9H A;  4YQV A;  1T7P B;  3D6I A;  2WFC A;  4WR5 A;  1GNE A;  4G19 A;  3F9U A;  2YCD A;  4MLY A;  2B5Y A;  3H8Q A;  1KNG A;  1JLW A;  2JZS A;  2IFQ B;  2YNX A;  4IP1 A;  1OC9 B;  4EL1 A;  2OJL A;  5H5Q A;  3QFB C;  4IGJ A;  2KHP A;  2VD0 A;  2I4A A;  3HJM A;  1AUC A;  2DC5 A;  2WS2 A;  2EC4 A;  2QA1 A;  1J9B A;  3UVT A;  5B6N A;  2RUE A;  3TRQ A;  5IMC A;  3TKP A;  2XC2 A;  3L78 A;  1QXH A;  1GUH A;  14GS A;  2VL3 A;  4IQA A;  2P0G A;  1HYU A;  2F8F A;  3TCO A;  2LEG A;  4PUR A;  5B8A A;  2VLV A;  3DEX A;  2YJ7 A;  2GQM A;  2JZT A;  4X4J A;  2LJR A;  4HEA 2;  2NTO A;  4K7I A;  2F9S A;  4TR1 B;  2IMF A;  4OCF A;  1HNB A;  2WCI A;  1BYE A;  2X8H A;  3HZ8 A;  2HT9 A;  4D73 A;  2YZU A;  3KCM A;  1DSB A;  5J5N A;  4P3Y B;  4ZBA A;  2HNL A;  4V1A g;  4FH8 A;  2H6Z A;  4QL7 A;  4K6X A;  3F0I A;  1GSF A;  1R5P A;  2H6X A;  2G2Q A;  2C3N A;  4BVY B;  3HVX A;  3HVV A;  2E2G A;  1K3L A;  1THO A;  4TXV A;  5G5E A;  3GA4 A;  5GAP D;  4ZXG A;  2GT6 A;  3KP9 A;  5J4U A;  2PVQ A;  4MPF A;  2H1A A;  4GLT A;  1MEK A;  4A5P A;  2O87 A;  2ZNM A;  5DAK B;  4NHW A;  1M7T A;  1GRX A;  4DSQ A;  4PQH A;  1EOG A;  3ZVJ D;  2EIQ A;  2LNT A;  4G0I A;  3CSJ A;  4YAP A;  3US3 A;  1ZYQ B;  1SEN A;  1Z5Y E;  4BPY A;  2VAF A;  1BX9 A;  3ZRE A;  4NPB A;  1FAA A;  3HJO A;  2VCV A;  6GSV A;  1X9W B;  2QC7 A;  3ZTL A;  3VWV A;  3ZZX A;  5F07 A;  3E0U A;  1T3B A;  4PUA A;  5ECM B;  1BAY A;  2DKI A;  2DBC A;  2Z9S A;  2GZY A;  5IM9 A;  5ID2 B;  3C7M A;  3G7I A;  1YEX A;  3VUR A;  4Q5F A;  3UAR A;  1E2Y A;  1TRW A;  2PMT A;  4NHZ A;  3P8W A;  2ALB A;  4MCU A;  3KIJ A;  5IMV A;  1R7H A;  4OWY A;  3PGT A;  1G0T A;  2B5E A;  5J9C A;  1B9X C;  2LUS A;  1XPV A;  2B1K A;  3U5R E;  2YP6 A;  2H0I A;  3I69 A;  2OBI A;  5DQS A;  4MF7 A;  3GMF A;  1XFL A;  2JAC A;  2M72 A;  4K2X A;  1TI3 A;  4K9Z A;  4MH3 A;  2H01 A;  3CQF A;  2CZ3 A;  2M46 A;  4ISD A;  1EOH A;  4DSS A;  3GKN A;  2LST A;  2VL9 A;  3IK9 A;  3A5W A;  3EMP A;  1EP8 A;  1N2A A;  3CYN A;  1X0R A;  1XWB A;  4IW9 A;  6GSS A;  3UAP A;  4ULX A;  2CAI A;  4EIP A;  1K0D A;  5CRE A;  5CO3 A;  5A5K A;  4EKZ A;  3IXR A;  2DIZ A;  1M2A A;  6GSY A;  1X5C A;  2WB9 A;  1TRS A;  4MP4 A;  4Z2R A;  4O5Q A;  2JZR A;  2PUK C;  5FHI A;  1MD4 A;  2MBT A;  3TKR A;  2R0P A;  4IEL A;  1XXU A;  1Z6N A;  1FHE A;  2RLI A;  2L59 A;  2PBJ A;  3C8E A;  5ECN B;  3FR9 A;  2CZ2 A;  1WPI A;  2B3S A;  4ICY A;  1ERU A;  5JWO B;  2VLU A;  2LNS A;  1PKZ A;  2H1D A;  3NZN A;  1BED A;  1FB6 A;  1HNA A;  4XTS A;  5FWG A;  4MDC A;  2A2R A;  1GUL A;  1ZYE A;  4HZ4 A;  5D9T A;  1W89 A;  2WUL A;  4O5R A;  1NHO A;  2EIR A;  3ME8 A;  4KND A;  4G9H A;  3ZFL A;  3CSH A;  5CRH A;  1OKD A;  3QDN A;  1TK0 B;  4XS4 B;  2AUV A;  1TJD A;  3A5I A;  2B6M A;  1WE0 A;  4ZB6 A;  2O8V B;  1V9W A;  2CAQ A;  1GSE A;  10GS A;  4YKF A;  2RUF A;  2LJK A;  5IQY A;  4MF5 A;  1ZL9 A;  3H4K A;  5ECK B;  3DVX A;  3IR4 A;  4V2L A;  2GST A;  2IME A;  3IHQ A;  4MPG A;  3DYR A;  2MMO A;  4GSS A;  5IO2 A;  2VO4 A;  3CXG A;  5ECL B;  1ABA A;  4JZQ A;  2VM2 A;  3PR8 A;  5EL8 A;  3FR3 A;  4V1A p;  4K7O A;  5DAL A;  1EV4 A;  1FG4 A;  1T8E B;  2LRN A;  1GTI A;  4GSN A;  2HXK A;  5G2Z A;  4KDX A;  3BCK A;  3APQ A;  2VL2 C;  1R26 A;  5HR1 A;  3ZML A;  1OC8 A;  4BIK A;  2DSA A;  5KN1 A;  2FD3 A;  2O89 A;  2OE3 A;  4IJ3 A;  3I9V 2;  4DEJ A;  4GTU A;  2DJ2 A;  19GS A;  1YEP A;  1GWC A;  3RHB A;  1ERT A;  2X4A A;  3A2V A;  4BL7 B;  1SYR A;  4HSC X;  2HZE B;  4KB3 A;  3D21 A;  3HKR A;  2YAN A;  3N5O A;  5B7C A;  2KOK A;  4J2F A;  4YH2 A;  5IO0 A;  1MTC A;  4OFM A;  3LW9 A;  3W8S A;  2XPD A;  1OC3 A;  2VD1 A;  2QKE A;  5D9V A;  3G7Y A;  3BOA A;  2PU9 C;  2JSZ A;  3ZIJ A;  1GP1 A;  2IFQ A;  2L5O A;  1JZW A;  2MZC A;  4EE0 A;  4LMV A;  5E4W A;  1OC9 A;  1R4W A;  1PN9 A;  1B4Q A;  2HSH A;  3E3E A;  1NHY A;  1LJR A;  1V57 A;  2AHE A;  2H1G A;  2GLR A;  1ZOF A;  4K7N A;  4WEY A;  4X1U A;  3QAW A;  3U6V A;  3TRP A;  3IBH A;  4J57 E;  2CT6 A;  2A2S A;  2J23 A;  2VLT A;  3UL3 A;  1QQ2 A;  2IN3 A;  2MBS A;  3GKK A;  4I2U A;  1A8L A;  4GF0 A;  1JZR A;  4MAB A;  5C00 A;  4TN8 A;  3GRX A;  1R5A A;  3IAS 2;  3PIN A;  18GS A;  2DJ1 A;  1BG5 A;  4JU5 A;  4N0V A;  3EVI A;  4TR1 A;  3IA1 A;  3D4T A;  1PX7 A;  1EV9 A;  2GS3 A;  5KEJ A;  1A2M A;  4MMM A;  3HHV A;  1SJ6 A;  1VF1 A;  1FO5 A;  3GH9 A;  4TVE A;  4F0B A;  4XHM A;  3WYW A;  4KH7 A;  2PPT A;  2X8C A;  3HDC A;  4BVY A;  4TR3 A;  5IMD A;  5G1K A;  3KXO A;  3IV4 A;  1QFN A;  2HRN A;  4O32 A;  3IPZ A;  1V98 A;  1HD2 A;  1WWJ A;  1EGO A;  1NSW A;  3GV1 A;  4H86 A;  3A2W A;  3O76 A;  3SBC A;  3W6G A;  2B5X A;  2HI7 A;  5EY6 A;  2V6K A;  5DAK A;  4G10 A;  1T4Z A;  1TK5 B;  3M9J A;  2WDU A;  3KZQ A;  4BA7 A;  1F3B A;  1SD8 A;  2H8L A;  1K3O A;  3FY7 A;  1K0A A;  3J7Y k;  1EP7 A;  2LTK A;  2H70 A;  5GSS A;  1C72 A;  1TKD B;  1SKR B;  1DBY A;  5D8I A;  1PKW A;  1Z6M A;  2GT5 A;  5ECS A;  4KCE A;  5HR3 A;  1JZO A;  3TJB A;  1SD9 A;  1G6W A;  1M2B A;  5A4W A;  1ZZY A;  3R2Q A;  3DVW A;  4KW6 A;  4QQ7 A;  1URM A;  1Z3E A;  3HD5 A;  3C73 A;  5ID2 A;  2V2G A;  1PGT A;  3ZVJ A;  1TOF A;  1GSY A;  2LS5 A;  1HQO A; 
#chains in the Genus database with same CATH homology
 4ZB8 A;  4MZW A;  1XW6 A;  1ZYN A;  1ZYP A;  2FWG A;  1F6M C;  5F8B A;  3DML A;  4LA1 A;  1TDI A;  5IOX A;  1YKA A;  1SK0 A;  1H4O A;  2GVP A;  1ZGN A;  2DJK A;  5CP1 A;  2N5A A;  4G2E A;  4K1F A;  2JSY A;  4PQ1 A;  1K0O A;  4ECC A;  1PN0 A;  1Y25 A;  4JR4 A;  4NV5 A;  4EIQ A;  1XWA A;  3EU3 A;  3FYG A;  2R0G A;  3GKM A;  2DIY A;  1A2L A;  4AJ7 A;  1FOH A;  3LOR A;  3LXT A;  4I8B A;  1B9Y C;  1M9A A;  4NAX A;  5FT3 A;  1MDJ A;  5G5F A;  3ZRD A;  1GH2 A;  3Q6O A;  3BBY A;  1VF3 A;  3FZA A;  4KX4 A;  4I97 A;  1GLP A;  4BVX B;  3TJG A;  4MJB A;  2CQ9 A;  4EF0 A;  5ECO B;  2CX4 A;  1AXD A;  4BWQ A;  2XPE A;  3KTL A;  3EIN A;  4I5Q A;  4CY6 A;  2V1M A;  1DE2 A;  2ES7 A;  3W8J A;  4OO5 A;  1V40 A;  5ENU A;  3CSI A;  3GL3 A;  1XWG A;  5HFG A;  5B6M A;  3HVS A;  3VPT A;  2VCX A;  2QSI A;  4HDE A;  5AGY A;  1A23 A;  1UC7 A;  5A4U A;  1PD2 1;  1YDK A;  3KMN A;  4PUF C;  1MD3 A;  5GST A;  5G30 A;  1G6Y A;  3APS A;  2MYG A;  3GUR A;  4XS4 A;  3F3R A;  2X49 A;  2QGV A;  3WT2 A;  1GSD A;  2HLS A;  2NPB A;  2R6K A;  4AGS A;  3FZ5 A;  4WR4 A;  2TRC P;  4ZIL A;  5LCZ A;  5ELG A;  1OE8 A;  1X9S B;  3EC3 A;  3S9F A;  1G7E A;  4JE1 A;  1PA3 A;  2VCQ A;  3TKS E;  1LBK A;  4KSO A;  2XHF A;  1CQH A;  2HFD A;  4HOJ A;  5AIV A;  4EC0 A;  2DLX A;  9GSS A;  2I3Y A;  1U3A A;  4F03 A;  3GST A;  1I5G A;  3J7Y b;  4KDY A;  1AIU A;  3GH6 A;  1Q4J A;  4XCS A;  1XBS A;  2OKA A;  1Z7P A;  1XIY A;  2KLX A;  3DGQ A;  1A2J A;  4MZC A;  1LU4 A;  1SU9 A;  2R37 A;  4Q5R A;  2R3X A;  3CTG A;  1M9B A;  2KP2 A;  3IRA A;  3G7J A;  4GCI A;  4ECB A;  3CRT A;  4IJI A;  4K5S A;  1EEM A;  4IQ1 A;  3F4R A;  4ZB9 A;  1G7O A;  2O85 A;  1BJX A;  1OAZ A;  2C3T A;  3NOF A;  4CDO A;  4BL7 A;  3CMI A;  1RW1 A;  1E6B A;  4N0Z A;  3EE2 A;  3WGD A;  2C1Y A;  4PXO A;  2VCZ A;  2HZE A;  1QUW A;  3H1N A;  5DJM A;  1ZCP A;  4K8M A;  3A2X A;  1WIK A;  1OVN A;  3HYP A;  2PGT A;  4ZBB A;  4HQS A;  4Q5N A;  3MDK A;  4EXJ A;  2LQQ A;  3HJP A;  4IKH A;  1T00 A;  1TI1 A;  2VUP A;  4NXI A;  2QA2 A;  2R4V A;  5E59 A;  2CV4 A;  2XBQ A;  1KBN A;  2XBI A;  4E8H A;  2NBS A;  3UJ1 A;  2AJQ B;  3FEU A;  4EDY A;  2L57 A;  4GXZ A;  1FVJ A;  5DJL A;  2YZH A;  2FNO A;  1IYH A;  5ECH B;  3AY8 A;  3ED3 A;  3F3Q A;  4GST A;  5IOW A;  3UBL A;  2I81 A;  17GS A;  1USB A;  1Z7R A;  4IBP A;  3QR6 A;  3QMX A;  1X5E A;  4O5U A;  1WP0 A;  4F0C A;  4XIH A;  1ML6 A;  2H71 A;  4KSM A;  2GSQ A;  2L4C A;  3Q74 A;  3QD9 A;  1AAZ A;  1PX6 A;  4L8E A;  1TU7 A;  1ZMA A;  2P5R A;  3BD2 A;  3L0H A;  1GSQ A;  5D9W A;  5GZZ B;  2FHE A;  4FO5 A;  2BTO T;  2YWN A;  4EUY A;  2CA8 A;  3ZFB A;  2FLS A;  2KUC A;  1O73 A;  2OBK A;  3R3E A;  5JWR B;  4ZL9 A;  3F8U A;  4L0U A;  2VL2 A;  4CY8 A;  3KTB A;  4AF2 A;  3L9S A;  4ZL7 A;  4HQZ A;  3IAM 2;  5AIX A;  5KN3 A;  2FY6 A;  2BMX A;  3LXZ A;  4IVF A;  1THX A;  1Q98 A;  4ILF A;  3LFL A;  3H93 A;  1GSS A;  4Z2T A;  3GTU B;  2VIM A;  2YWO A;  1F37 A;  4MJA A;  1B48 A;  1O6J A;  3LGC A;  3TJF A;  4MF6 A;  1SKS B;  2JU5 A;  3WGX A;  1TXX A;  2F8A A;  4PTS A;  2X64 A;  3GX0 A;  4N11 A;  3PPU A;  5HR2 A;  4G0K A;  1YF0 A;  2M80 A;  2C80 A;  1RK4 A;  2YWM A;  3Q19 A;  2GZZ A;  3QAV A;  4TR4 A;  3VWX A;  3F63 A;  2HRK A;  3F4T A;  3TDG A;  1O81 A;  2C4J A;  2P31 A;  3RPP A;  1NM3 A;  5IIZ A;  3KJY A;  4WET A;  3PH9 A;  4NWY A;  1ON4 A;  3KEB A;  4EDZ A;  1SKW B;  4BWS A;  3LSZ A;  1TRV A;  4F9Z A;  1YF1 A;  4JBB A;  2ON7 A;  4IN0 A;  4JRR A;  2H75 A;  2L5L A;  2IMI A;  3FRC A;  4I6X A;  4XRD A;  3WT1 A;  4FIW A;  1M2D A;  3IE3 A;  5F05 A;  4N30 A;  4EVM A;  3F4S A;  3DXB A;  4QL9 A;  1XVQ A;  1YY7 A;  1SK1 A;  2R5G A;  5BRT A;  4RI7 A;  1PRX A;  3GNJ A;  2IL3 A;  4O92 A;  1J08 A;  4PQI A;  5DQY A;  3F6F A;  5KOX A;  5ECQ B;  3UMA A;  4MJC A;  3D22 A;  4J56 E;  3EWL A;  2VCW A;  2JAD A;  3GHA A;  3QCP A;  1VF4 A;  3E9J B;  1FVK A;  4MZB A;  3RPN A;  4BVX A;  4TR0 A;  1CQG A;  5ELA A;  1U87 A;  5DCH A;  1MDI A;  3P90 A;  4XS1 A;  3DKS A;  2AV4 A;  1UVZ A;  3KM6 A;  4PGT A;  3WD6 A;  2AAW A;  1K0C A;  1U3I A;  1JZD A;  1T1V A;  2NDO A;  2X99 A;  16GS A;  12GS A;  3C1S A;  1F2E A;  4Q5Q A;  4WBR D;  4F2I A;  3DRN A;  2IMK A;  3A3T A;  2VOC A;  3EMX A;  2VM1 A;  1AW9 A;  1GUK A;  4OMV A;  2MMZ A;  3ZLP A;  3IC8 A;  2F3M A;  3EUR A;  4MNN A;  2WZ9 A;  2J9H A;  3ZL5 A;  3QPM A;  6GST A;  2DJ3 A;  1UA5 A;  2ZUP A;  2YN1 A;  5JWQ B;  1FW1 A;  2MMN A;  4AJ6 A;  3O6T A;  2TRX A;  2EIO A;  2P5Q A;  2IWT A;  2CVD A;  1H75 A;  2IPA A;  4XS6 A;  4XRA A;  4L0W A;  5AN1 A;  3DIE A;  3ERF A;  2FCH A;  1JHB A;  3FZ9 A;  2IIY A;  4X43 A;  1O8X A;  3L4N A;  1K3Y A;  1TW9 A;  5L71 A;  2R0C A;  5ECR B;  3I6A A;  1XOA A;  2V41 A;  2FUG 2;  4KCA A;  3TKS C;  4OD7 A;  1GTA A;  3ISO A;  2H66 A;  1U6T A;  2N5F A;  3SWL A;  5HQP A;  3OR5 A;  5D93 A;  3K8N A;  4OCE A;  3G9B A;  3NIV A;  4HI7 A;  4YQU A;  1TU8 A;  4HJ2 A;  1K0M A;  4WF4 A;  5DBQ A;  4FQU A;  3RAZ A;  3TUE A;  4KA0 A;  3V1W A;  2N5B A;  3EYT A;  2BJX A;  3TKQ A;  4TW5 A;  5IPG A;  4HZ2 A;  1RQM A;  1WRY A;  1VF2 A;  4IS0 A;  5LNK e;  2OE1 A;  4GQF A;  4ZL8 A;  4GRF A;  4LL4 B;  2K6V A;  2H6Y A;  2HSM A;  1JLV A;  1A8Y A;  2YV7 A;  4NV2 A;  3IDV A;  4HS1 A;  1ERV A;  5F0G A;  3KP8 A;  1B4P A;  2E7P A;  4POL A;  4WF5 A;  2C0G A;  5KN0 A;  1M0U A;  2REM A;  4RQX A;  2A4V A;  5IMF A;  4GQC A;  5CRW A;  3M3M A;  5CNW A;  1U88 A;  2ON5 A;  4CHS A;  4KDU A;  2V6O A;  3EPT A;  1GNW A;  3GKX A;  2HZF A;  3HZ4 A;  3L9V A;  2MMA A;  3LJR A;  2K9F A;  1AQX A;  1T4Y A;  5CAX A;  4HU7 A;  1SL1 B;  1A24 A;  1OKT A;  5J41 A;  4KAE A;  2OA7 A;  1EZK A;  1ST9 A;  3VLN A;  1F9M A;  1GTB A;  1I9D A;  2RM5 A;  2E0Q A;  4F82 A;  2GGT A;  4ML6 A;  2DMM A;  1KEB A;  2H73 A;  3MSZ A;  4MJE A;  1SJI A;  4TRX A;  4G0L A;  1OE7 A;  3EU4 A;  4K5R A;  2AB6 A;  3QAG A;  5KN2 A;  3VI7 A;  4OFN A;  1B8X A;  2F51 A;  4JED A;  5B8B A;  2O7K A;  11GS A;  2RII A;  5EPF A;  3ZYW A;  4ACS A;  1A0R P;  1TRU A;  1XWK A;  2KP1 A;  3KH9 A;  3M9K A;  4TXO B;  2I1U A;  1S3A A;  2K18 A;  1EWX A;  1AQV A;  4POK A;  5COH A;  5D9X A;  2C0E A;  2LJA A;  2LQO A;  3BJ5 A;  2PER A;  5DCG A;  3TB2 A;  20GS A;  5DVB A;  5ECI B;  2GQL A;  1GL8 A;  2LV3 A;  4ML1 A;  3MAK A;  3TRX A;  1Y6E A;  3GTU A;  1FB0 A;  5EVO A;  2H30 A;  2WRT A;  4V2N A;  6GSX A;  4WXT A;  1AC1 A;  3I43 A;  5F06 A;  2IJY A;  3HCZ A;  3APO A;  4HUA A;  3DD3 A;  3GFK A;  3JCM L;  3TOU A;  1KTE A;  3TJK A;  5INY A;  3N9J A;  5AIS A;  5D96 A;  2OAD A;  2DJJ A;  3LG6 A;  1PQN A;  2L6D A;  3ZMK A;  2H0H A;  3D0Z A;  4L5L A;  4O7H A;  3ERG A;  2B7K A;  2GZP A;  1O8W A;  1PMT A;  2UZ8 A;  2OAC A;  2DJ0 A;  2FA8 A;  2HE3 A;  2D2Z A;  1XCC A;  3UIW A;  2PN8 A;  3GYK A;  4Z2U A;  1QGV A;  1VGL A;  3QOU A;  2LRC A;  5HFK A;  4D73 B;  4HJM A;  1EEJ A;  3MIX A;  4ECJ A;  2H76 A;  1ACV A;  1A0F A;  4ID0 A;  1K0B A;  2FWE A;  3TJJ A;  3GX8 A;  2X8G A;  4HU9 A;  1TTZ A;  1VRS D;  1XW5 A;  5HR0 A;  1GSU A;  5J9B A;  5H5R A;  4ZIJ A;  2GQK A;  3LWA A;  4V2M A;  3FZ4 A;  5J3R A;  1SJZ A;  3LEF A;  3LQ7 A;  3CBU A;  5IMZ A;  1DE1 A;  3MWH A;  3QFA C;  2GSR A;  3HXS A;  3IHG A;  3D4M A;  4WBJ A;  4K2D A;  4KGI A;  3KGK A;  4X0X A;  3GSS A;  1TP9 A;  3O3T A;  1YJ6 A;  3GN3 A;  3M1G A;  2GTU A;  2CVB A;  1O7U A;  4OO4 A;  1YQ1 A;  2HYX A;  4POM A;  3Q18 A;  3FR6 A;  4LLR A;  2GSS A;  2TIR A;  1XZO A;  1GLQ A;  4TOP A;  2GDR A;  3KH7 A;  1PL1 A;  4TKY A;  2YWI A;  5CRG A;  2PWJ A;  1GUM A;  1XOB A;  3P7X A;  3GL5 A;  1XWC A;  8GSS A;  4MA9 A;  4N10 A;  3BCI A;  3KMO A;  1NW2 A;  2OE0 A;  2YPM A;  3L9U A;  3VFI A;  4USS A;  13GS A;  3IC4 A;  3FKF A;  5D73 A;  5ECP B;  1IYI A;  1ERW A;  2PVO C;  3GUS A;  4L5O A;  4FYC A;  3UBK A;  5CYY A;  3M0F A;  1TK8 B;  4E8E A;  5IMA A;  4OFT A;  1MDK A;  1QK8 A;  4KE3 A;  2LKU A;  2AYT A;  1SL2 B;  3D5J A;  7GSS A;  4Z7X A;  4IHU A;  3CTF A;  1UN2 A;  2FWH A;  3TGZ A;  2HRF A;  5DDL A;  1WOU A;  4PNF A;  3FHK A;  3HA9 A;  4GWR A;  2H72 A;  4AJ8 A;  5JCG A;  1AQW A;  1OYJ A;  5G1L A;  1WJK A;  4POB A;  3ZIT A;  2A2P A;  2DML A;  1XW9 A;  4JR6 A;  2ZCT A;  3RDW A;  3RBT A;  4K0N A;  2DKH A;  4I2T A;  2RM6 A;  3FK8 A;  1HNC A;  22GS A;  2HRA A;  4PNG A;  4DSS B;  4MK3 A;  1JFU A;  2H1B A;  3MNG A;  3UEM A;  1X9M B;  1J0F A;  1FOV A;  4MH2 A;  3FW2 A;  3P2A A;  3CRU A;  3LYK A;  3ERW A;  2H74 A;  4DSR A;  2IMD A;  4YKG A;  1DUG A;  4KF9 A;  3C71 A;  1PSQ A;  1EGR A;  3RHC A;  3VPQ A;  4FYB A;  3VI5 A;  3H79 A;  4K0G A;  4ZBD A;  2YOI A;  3UVH A;  2K8S A;  5CRD A;  2JL4 A;  5KOW A;  5ABR A;  1V2A A;  2E2M A;  3C1R A;  4KUN A;  1YZX A;  2A4H A;  1M99 A;  3FMW A;  2R2J A;  2B7J A;  2FA4 A;  3VK9 A;  4CW9 A;  6GSW A;  1BQ7 A;  3VWU A;  2K8V A;  3ZIV A;  1F3A A;  3MYD A;  5JCW A;  4PX1 A;  5BMU A;  3KD0 A;  4EO3 A;  5GAN D;  3VWW A;  3ME7 A;  4RUV A;  2LRT A;  3WGE A;  2CVK A;  3DWV A;  5C04 A;  2V32 A;  4NMU A;  4YQM A;  1ILO A;  2I9H A;  1O85 A;  4IP6 A;  1PL2 A;  3LYP A;  2VCT A;  1GTU A;  2WGR A;  1X5D A;  2C8U A;  4WKW A;  5HFI A;  3HY2 A;  5A4V A;  4RQR A;  2NVL A;  2CX3 A;  2HSY A;  4YAV A;  1QMV A;  2L6C A;  4LMW A;  5DAL B;  1K0N A;  4RI6 A;  1XVW A;  2FGX A;  2H0G A;  3F6D A;  1YKC A;  5G31 A;  2C0D A;  1WMJ A;  1V58 A;  1W4V A;  5JCU A;  4ECI A;  2H19 A;  6GSU A;  1N8J A;  3TOT A;  2G0F A;  4DVC A;  4LL1 B;  3IK7 A;  3M8N A;  3TKS A;  2B1L A;  4FYU A;  2FWF A;  5H5S A;  3GIX A;  1S3D A;  2C0F A;  2YJH A;  2WJU A;  1S3C A;  2YV9 A;  1SYX A;  2L4Q A;  3IOS A;  5LD0 A;  4TXO A;  1SK2 A;  5IPH A;  2C3Q A;  3UOM A;  1SL0 B;  1Z9H A;  4YQV A;  1T7P B;  3D6I A;  2WFC A;  4WR5 A;  1GNE A;  4G19 A;  3F9U A;  2YCD A;  4MLY A;  2B5Y A;  3H8Q A;  1KNG A;  1JLW A;  2JZS A;  2IFQ B;  2YNX A;  4IP1 A;  1OC9 B;  4EL1 A;  2OJL A;  5H5Q A;  3QFB C;  4IGJ A;  2KHP A;  2VD0 A;  2I4A A;  3HJM A;  1AUC A;  2DC5 A;  2WS2 A;  2EC4 A;  2QA1 A;  1J9B A;  3UVT A;  5B6N A;  2RUE A;  3TRQ A;  5IMC A;  3TKP A;  2XC2 A;  3L78 A;  1QXH A;  1GUH A;  14GS A;  2VL3 A;  4IQA A;  2P0G A;  1HYU A;  2F8F A;  3TCO A;  2LEG A;  4PUR A;  5B8A A;  2VLV A;  3DEX A;  2YJ7 A;  2GQM A;  2JZT A;  4X4J A;  2LJR A;  4HEA 2;  2NTO A;  4K7I A;  2F9S A;  4TR1 B;  2IMF A;  4OCF A;  1HNB A;  2WCI A;  1BYE A;  2X8H A;  3HZ8 A;  2HT9 A;  4D73 A;  2YZU A;  3KCM A;  1DSB A;  5J5N A;  4P3Y B;  4ZBA A;  2HNL A;  4V1A g;  4FH8 A;  2H6Z A;  4QL7 A;  4K6X A;  3F0I A;  1GSF A;  1R5P A;  2H6X A;  2G2Q A;  2C3N A;  4BVY B;  3HVX A;  3HVV A;  2E2G A;  1K3L A;  1THO A;  4TXV A;  5G5E A;  3GA4 A;  5GAP D;  4ZXG A;  2GT6 A;  3KP9 A;  5J4U A;  2PVQ A;  4MPF A;  2H1A A;  4GLT A;  1MEK A;  4A5P A;  2O87 A;  2ZNM A;  5DAK B;  4NHW A;  1M7T A;  1GRX A;  4DSQ A;  4PQH A;  1EOG A;  3ZVJ D;  2EIQ A;  2LNT A;  4G0I A;  3CSJ A;  4YAP A;  3US3 A;  1ZYQ B;  1SEN A;  1Z5Y E;  4BPY A;  2VAF A;  1BX9 A;  3ZRE A;  4NPB A;  1FAA A;  3HJO A;  2VCV A;  6GSV A;  1X9W B;  2QC7 A;  3ZTL A;  3VWV A;  3ZZX A;  5F07 A;  3E0U A;  1T3B A;  4PUA A;  5ECM B;  1BAY A;  2DKI A;  2DBC A;  2Z9S A;  2GZY A;  5IM9 A;  5ID2 B;  3C7M A;  3G7I A;  1YEX A;  3VUR A;  4Q5F A;  3UAR A;  1E2Y A;  1TRW A;  2PMT A;  4NHZ A;  3P8W A;  2ALB A;  4MCU A;  3KIJ A;  5IMV A;  1R7H A;  4OWY A;  3PGT A;  1G0T A;  2B5E A;  5J9C A;  1B9X C;  2LUS A;  1XPV A;  2B1K A;  3U5R E;  2YP6 A;  2H0I A;  3I69 A;  2OBI A;  5DQS A;  4MF7 A;  3GMF A;  1XFL A;  2JAC A;  2M72 A;  4K2X A;  1TI3 A;  4K9Z A;  4MH3 A;  2H01 A;  2CZ3 A;  2M46 A;  4ISD A;  1EOH A;  4DSS A;  3GKN A;  2LST A;  2VL9 A;  3IK9 A;  3A5W A;  3EMP A;  1EP8 A;  1N2A A;  3CYN A;  1X0R A;  1XWB A;  4IW9 A;  6GSS A;  3UAP A;  4ULX A;  2CAI A;  4EIP A;  1K0D A;  5CRE A;  5CO3 A;  5A5K A;  4EKZ A;  3IXR A;  2DIZ A;  1M2A A;  6GSY A;  1X5C A;  2WB9 A;  1TRS A;  4MP4 A;  4Z2R A;  4O5Q A;  2JZR A;  2PUK C;  5FHI A;  1MD4 A;  2MBT A;  3TKR A;  2R0P A;  4IEL A;  1XXU A;  1Z6N A;  1FHE A;  2RLI A;  2L59 A;  2PBJ A;  3C8E A;  5ECN B;  3FR9 A;  2CZ2 A;  1WPI A;  2B3S A;  4ICY A;  1ERU A;  5JWO B;  2VLU A;  2LNS A;  1PKZ A;  2H1D A;  3NZN A;  1BED A;  1FB6 A;  1HNA A;  4XTS A;  5FWG A;  4MDC A;  2A2R A;  1GUL A;  1ZYE A;  4HZ4 A;  5D9T A;  1W89 A;  2WUL A;  4O5R A;  1NHO A;  2EIR A;  3ME8 A;  4KND A;  4G9H A;  3ZFL A;  3CSH A;  5CRH A;  1OKD A;  3QDN A;  1TK0 B;  4XS4 B;  2AUV A;  1TJD A;  3A5I A;  2B6M A;  1WE0 A;  4ZB6 A;  2O8V B;  1V9W A;  2CAQ A;  1GSE A;  10GS A;  4YKF A;  2RUF A;  2LJK A;  5IQY A;  4MF5 A;  1ZL9 A;  3H4K A;  5ECK B;  3DVX A;  3IR4 A;  4V2L A;  2GST A;  2IME A;  3IHQ A;  4MPG A;  3DYR A;  2MMO A;  4GSS A;  5IO2 A;  2VO4 A;  3CXG A;  5ECL B;  1ABA A;  4JZQ A;  2VM2 A;  3PR8 A;  5EL8 A;  3FR3 A;  4V1A p;  4K7O A;  5DAL A;  1EV4 A;  1FG4 A;  1T8E B;  2LRN A;  1GTI A;  4GSN A;  2HXK A;  5G2Z A;  4KDX A;  3BCK A;  3APQ A;  2VL2 C;  1R26 A;  5HR1 A;  3ZML A;  1OC8 A;  2DSA A;  5KN1 A;  2FD3 A;  2O89 A;  2OE3 A;  4IJ3 A;  3I9V 2;  4DEJ A;  4GTU A;  2DJ2 A;  19GS A;  1YEP A;  1GWC A;  3RHB A;  1ERT A;  2X4A A;  3A2V A;  4BL7 B;  1SYR A;  2HZE B;  4KB3 A;  3D21 A;  3HKR A;  2YAN A;  3N5O A;  5B7C A;  2KOK A;  4J2F A;  4YH2 A;  5IO0 A;  1MTC A;  4OFM A;  3LW9 A;  3W8S A;  2XPD A;  1OC3 A;  2VD1 A;  2QKE A;  5D9V A;  3G7Y A;  3BOA A;  2PU9 C;  2JSZ A;  3ZIJ A;  1GP1 A;  2IFQ A;  2L5O A;  1JZW A;  2MZC A;  4EE0 A;  4LMV A;  5E4W A;  1OC9 A;  1R4W A;  1PN9 A;  1B4Q A;  2HSH A;  3E3E A;  1NHY A;  1LJR A;  1V57 A;  2AHE A;  2H1G A;  2GLR A;  1ZOF A;  4K7N A;  4WEY A;  4X1U A;  3QAW A;  3U6V A;  3TRP A;  3IBH A;  4J57 E;  2CT6 A;  2A2S A;  2J23 A;  2VLT A;  3UL3 A;  1QQ2 A;  2IN3 A;  2MBS A;  3GKK A;  4I2U A;  1A8L A;  4GF0 A;  1JZR A;  4MAB A;  5C00 A;  4TN8 A;  3GRX A;  1R5A A;  3IAS 2;  3PIN A;  18GS A;  2DJ1 A;  1BG5 A;  4JU5 A;  4N0V A;  3EVI A;  4TR1 A;  3IA1 A;  3D4T A;  1PX7 A;  1EV9 A;  2GS3 A;  5KEJ A;  1A2M A;  4MMM A;  3HHV A;  1SJ6 A;  1VF1 A;  1FO5 A;  3GH9 A;  4TVE A;  4F0B A;  4XHM A;  3WYW A;  4KH7 A;  2PPT A;  2X8C A;  3HDC A;  4BVY A;  4TR3 A;  5IMD A;  5G1K A;  3KXO A;  3IV4 A;  1QFN A;  2HRN A;  4O32 A;  3IPZ A;  1V98 A;  1HD2 A;  1WWJ A;  1EGO A;  1NSW A;  3GV1 A;  4H86 A;  3A2W A;  3O76 A;  3SBC A;  3W6G A;  2B5X A;  2HI7 A;  5EY6 A;  2V6K A;  5DAK A;  4G10 A;  1T4Z A;  1TK5 B;  3M9J A;  2WDU A;  3KZQ A;  4BA7 A;  1F3B A;  1SD8 A;  2H8L A;  1K3O A;  3FY7 A;  1K0A A;  3J7Y k;  1EP7 A;  2LTK A;  2H70 A;  5GSS A;  1C72 A;  1TKD B;  1SKR B;  1DBY A;  5D8I A;  1PKW A;  1Z6M A;  2GT5 A;  5ECS A;  4KCE A;  5HR3 A;  1JZO A;  3TJB A;  1SD9 A;  1G6W A;  1M2B A;  5A4W A;  1ZZY A;  3R2Q A;  3DVW A;  4KW6 A;  4QQ7 A;  1URM A;  1Z3E A;  3HD5 A;  3C73 A;  5ID2 A;  2V2G A;  1PGT A;  3ZVJ A;  1TOF A;  1GSY A;  2LS5 A;  1HQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...