2IIYA

Crystal structure of s-nitroso thioredoxin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
105
structure length
103
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDQDVASEEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin
publication title Buried s-nitrosocysteine revealed in crystal structures of human thioredoxin.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 103
sequence length 105
ec nomenclature
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2iiyA00
5IMVA 4WEYA 4CHSA 1VRSD 5D8IA 4KB3A 2X8HA 3CXGA 3VWUA 5J41A 3VWVA 3Q74A 1GTUA 4GSNA 5DQYA 4X0XA 2H8LA 2PU9C 5GSSA 3D4TA 2L4QA 1A0FA 1BX9A 4N10A 3KD0A 2DJ3A 2GZYA 1YKCA 1NSWA 4ZB9A 3GRXA 1ZMAA 3RBTA 2O7KA 5DJLA 2K8VA 4KE3A 1GSUA 2BTOT 4K7OA 5ECMB 3RDWA 3TKSA 5HR0A 2O87A 4ZL9A 4FYCA 4PNFA 2YWMA 3CBUA 4PGTA 3IDVA 2H1AA 4IP6A 2LEGA 1BYEA 1U3AA 2MMNA 1AW9A 1QXHA 5IM9A 4MJCA 3HXSA 2LJRA 4NXIA 2E7PA 4DSQA 1VF4A 3LORA 4IVFA 1IYHA 2C0EA 5AGYA 1W4VA 4XTSA 3G9BA 2NBSA 4Z7XA 4IQ1A 2YCDA 2YWIA 1EV9A 2FGXA 1X5EA 2VM1A 3E0UA 2AAWA 4I5QA 1XXUA 1TDIA 2VCXA 2DBCA 4L5LA 1U87A 2MBSA 2H73A 1X0RA 1GP1A 1UVZA 4PURA 3HHVA 3DMLA 1Q4JA 1Z7RA 5IMZA 1BJXA 2YANA 5ECLB 4MH3A 2PN8A 5D93A 4MDCA 4FH8A 4XCSA 3UMAA 4AJ6A 1B4PA 2H70A 2DIZA 3C71A 4WETA 3LYPA 3TKQA 1XW6A 1PL2A 1VGLA 3DGQA 2C8UA 1U88A 3F3RA 5G5EA 3PGTA 2C0GA 4XHMA 3P90A 3EWLA 3TJKA 3G7YA 1XWAA 4YQUA 5F05A 1Y6EA 1GNEA 3EMPA 1R7HA 4YH2A 1S3AA 3IC4A 1TK5B 1SKWB 2FA4A 14GSA 2M72A 3TRXA 2L5LA 3FRCA 5CNWA 2H71A 3FW2A 3IE3A 4MP4A 1XW5A 4F0BA 4AF2A 5JCGA 5G31A 3H93A 5D9VA 1MDJA 1TI3A 1E2YA 2CVKA 5GAND 1JLWA 2X99A 1FOVA 3H1NA 5HFGA 3N9JA 2R5GA 5DBQA 4QL9A 1O8XA 4TXVA 2F8AA 4I6XA 2REMA 1XPVA 4PNGA 1OAZA 2GSRA 1HNAA 4KDYA 1TU8A 4MA9A 2LQOA 4Q5RA 1SKSB 2JZSA 4POBA 3GMFA 4X43A 2K9FA 4WBJA 1PX7A 5FWGA 2VL2A 4ZB8A 1ZOFA 3D0ZA 1VF3A 1U3IA 4L8EA 4PX1A 2G0FA 2DMMA 1GSEA 2VL3A 2ON5A 3Q6OA 4EDZA 2F9SA 2H0HA 2ZNMA 4YQMA 5IO0A 1NHOA 1OKTA 3ERGA 4K9ZA 2I9HA 3CTGA 1GTAA 1ABAA 2CA8A 4TVEA 4LMWA 2WCIA 1B9XC 3NIVA 4GLTA 1R26A 3IV4A 1URMA 1ZYQB 5J9CA 1K3LA 2H19A 4V2LA 1HNCA 5HFKA 5JCWA 2VCVA 1HYUA 2XBIA 3P2AA 4O7HA 2L4CA 3TDGA 4KCAA 1NM3A 4V2NA 3GYKA 1TKDB 1EWXA 4ECBA 4HOJA 3BD2A 2LRCA 4MZBA 4I97A 5B6NA 4JRRA 1FW1A 3Q19A 5A4WA 1GLPA 1N2AA 3VLNA 4N30A 3FZ4A 4HU9A 3L9SA 1XIYA 3LWAA 2V6KA 3TCOA 3IOSA 4CDOA 1TU7A 4PQHA 1PKZA 1H4OA 4XS6A 4ZILA 3TUEA 3QCPA 4E8EA 4Q5FA 3A5WA 4PQ1A 5JWOB 2VD0A 4Q5NA 3IK7A 2KHPA 3MNGA 1TRUA 1TOFA 1MEKA 2DC5A 1Z6MA 2GQLA 3RPPA 2B5EA 4TW5A 2H72A 1GSDA 4MF5A 3HKRA 2MBTA 1DE1A 3J7Yb 1K3YA 2PMTA 5B8AA 3UAPA 3WYWA 2IMFA 2XPEA 1OE7A 2L6CA 4PUFC 4OFTA 3QD9A 1GH2A 1OC9B 2GTUA 1ERTA 3HA9A 5DQSA 1AIUA 2RIIA 1NW2A 3UL3A 5IIZA 1TK0B 4OFNA 2H75A 4PQIA 3C1RA 2GGTA 1PN9A 3WGDA 2I1UA 4GWRA 1AQXA 4ZB6A 4NV2A 4NV5A 5B6MA 2QGVA 4RI6A 4J2FA 3LSZA 3ZZXA 2HFDA 5ECRB 4NPBA 2H66A 4RUVA 4ID0A 1E6BA 3DKSA 2VOCA 2LRTA 4YAVA 4K7NA 5DDLA 3CSHA 2WRTA 3GX0A 3M9KA 2A2RA 3KH7A 3GIXA 4JBBA 5J4UA 3EE2A 3O3TA 1GUHA 3KIJA 5IPHA 4EDYA 4MH2A 2FCHA 3ZVJD 4WBRD 1S3CA 4LA1A 3HJPA 3GH9A 2YOIA 4ML1A 4ISDA 5AIXA 2DIYA 3U5RE 2WZ9A 2H76A 4POLA 1EGOA 3IAM2 1IYIA 22GSA 2CVDA 2FWFA 2LTKA 5HR2A 1RQMA 2OBIA 1XW9A 3FY7A 4EVMA 1YDKA 4MK3A 1XFLA 5A5KA 4WR5A 4N0ZA 2MYGA 2Z9SA 3CMIA 2DJ2A 3BBYA 1X5DA 5D9WA 2GT5A 4K0GA 2CQ9A 5ENUA 3GHAA 2IPAA 1FO5A 1OC9A 3DD3A 5J9BA 1XCCA 4EF0A 1F9MA 3TJJA 1PRXA 2IN3A 5F06A 2H01A 4GRFA 1GSFA 1Y25A 1M7TA 4OMVA 4GQCA 3HJMA 1PMTA 2OADA 1ZL9A 3GURA 5G2ZA 2RM5A 3ZTLA 1PX6A 1OVNA 3DIEA 1SL2B 4KNDA 3L9VA 3TOUA 5KN3A 1EP7A 4KDXA 1THOA 2K8SA 4QL7A 4L0WA 3F4RA 2H1BA 2MMZA 1B9YC 3C1SA 1X9SB 3VURA 1N8JA 4KAEA 3SBCA 2DJ0A 2C4JA 1ERWA 2N5BA 4HI7A 1OC8A 5IOXA 3VFIA 4EO3A 3P7XA 2K18A 3U6VA 3DVXA 3MDKA 4ULXA 4DEJA 3EURA 1I5GA 1PKWA 2C80A 1MDIA 2XC2A 2JSYA 1FB6A 1R5PA 2C3TA 1G6WA 5E4WA 4CW9A 1G7EA 2NVLA 3RHCA 1XWCA 1HNBA 2P31A 17GSA 4BVYA 4DVCA 5DCGA 4K6XA 4MJBA 4MMMA 4LMVA 19GSA 1AC1A 1V40A 2VM2A 3KCMA 2AB6A 1K3OA 2HYXA 2FWHA 2V6OA 1BQ7A 1QK8A 5J3RA 4EC0A 1SJ6A 3I69A 1YEXA 3FYGA 2HE3A 2VCWA 5H5QA 12GSA 2OE3A 4WXTA 2B5XA 1SJZA 1K0DA 4N11A 3EYTA 3LXZA 1EOGA 1TRSA 4TR4A 16GSA 3A2VA 1WIKA 2DSAA 4NMUA 5DJMA 4F2IA 3LGCA 3ZL5A 3Q18A 1J08A 2R6KA 3UOMA 3HYPA 4IW9A 4POKA 4KH7A 2CZ2A 2KP2A 5JWQB 2A2SA 1O7UA 3R2QA 3A2WA 5CRGA 3TRQA 5A4VA 2O89A 2YJ7A 1ZGNA 2YNXA 3TKSC 4IP1A 18GSA 5D9XA 1M2DA 1XOAA 4KGIA 3APQA 3EVIA 3IXRA 3UBLA 1F3AA 1JZWA 4XS1A 2JZTA 4Q5QA 1W89A 2GDRA 4ECIA 2CAQA 2ZCTA 2H0IA 5CYYA 1SD9A 1O73A 1TTZA 5G30A 1PL1A 1FG4A 1M2AA 4KW6A 4EE0A 2DJJA 3F6FA 5H5SA 2FNOA 4FIWA 1YZXA 1O8WA 6GSXA 13GSA 1FB0A 2DMLA 3IA1A 2JL4A 4MJAA 4GXZA 1AQVA 4KX4A 4MF6A 3BOAA 3CSJA 1B8XA 3H4KA 4KDUA 1SYRA 1V98A 3ZMLA 2WDUA 2LKUA 1YEPA 1OC3A 2YPMA 3FEUA 5IMFA 3W8JA 2I3YA 3HZ4A 1JZDA 3C73A 3QDNA 2XPDA 3HJOA 2YV9A 5ABRA 2C1YA 3WT1A 3EU4A 2YZUA 2WB9A 3KGKA 2C3NA 2H6XA 3KMNA 1GWCA 3ZFLA 2RUEA 2PVOC 2XHFA 4HJ2A 3FR3A 3ISOA 2D2ZA 5J5NA 3FKFA 4OCFA 3N5OA 2IMEA 2O8VB 3KTLA 3C8EA 3M0FA 3IAS2 2GZPA 4OFMA 3VK9A 2VAFA 1G0TA 4LL1B 2JACA 4YAPA 5B8BA 3KZQA 1TI1A 3DWVA 4XS4B 3GH6A 2AHEA 1SD8A 2V41A 1GTBA 1GSQA 3ERFA 1UA5A 4AGSA 3WT2A 4I2TA 4FYBA 5CRWA 3LG6A 1YY7A 4IKHA 2OJLA 2CT6A 4MZWA 1F2EA 2E2GA 1DSBA 5ELAA 6GSTA 1XWBA 2J23A 1MTCA 2GSTA 4ZBAA 1XWKA 2H6YA 2X64A 1USBA 4RQXA 2CZ3A 1CQGA 3MSZA 1X9WB 2LV3A 3BCIA 3TJGA 2H30A 5G5FA 3TRPA 3FZ5A 1X5CA 5KN0A 2ZUPA 4MABA 1CQHA 4ACSA 1KEBA 5CREA 3L4NA 4TR3A 1AAZA 2VL2C 6GSYA 2KP1A 3D6IA 2N5AA 4MZCA 2L59A 3A3TA 1HD2A 6GSUA 1DBYA 2CAIA 1YKAA 5AN1A 5ECKB 4RI7A 2EIOA 2A4VA 4HQSA 1WWJA 4I2UA 4K2DA 1T1VA 3D22A 4GCIA 3ZVJA 3C7MA 3H8QA 1XVWA 4ILFA 5INYA 1HQOA 2VUPA 5C00A 1A24A 2X8CA 4AJ8A 2YJHA 4OCEA 2HZEA 4PUAA 3PR8A 4DSSA 3OR5A 1VF1A 2LJAA 2B7KA 1KTEA 1G6YA 4MPFA 4XS4A 6GSVA 2R2JA 1ACVA 4L5OA 1GTIA 1FAAA 2TRXA 2HRNA 2IWTA 4IQAA 1MD4A 1B4QA 20GSA 5F8BA 2J9HA 4J57E 1QQ2A 3CRUA 3GTUB 1J9BA 3O76A 2H0GA 5CO3A 3GV1A 5F0GA 1EGRA 4NAXA 2FUG2 3UVHA 3GKNA 3KM6A 2K6VA 3KXOA 2F8FA 3FZAA 3HDCA 3TKRA 1LJRA 3QAGA 2FY6A 1TXXA 3VPTA 2HSHA 5IO2A 1Z7PA 1GULA 4F9ZA 5F07A 4MPGA 2YWNA 5IPGA 4FYUA 2GQMA 3A2XA 3TKSE 3KH9A 4XRDA 1PQNA 2PUKC 2B6MA 2C0FA 5FT3A 3K8NA 3F3QA 1GUMA 4MF7A 4WR4A 2ON7A 5CAXA 2DLXA 1O85A 4JEDA 3I43A 3HD5A 3WD6A 3NOFA 4LLRA 1KNGA 2WGRA 1XBSA 2V1MA 1RW1A 2IL3A 1Z9HA 3TJBA 5ID2B 2ALBA 1WMJA 1ILOA 4ZL8A 4IGJA 1GNWA 5CRHA 3QPMA 1EOHA 4HS1A 4EL1A 4BA7A 1K0MA 2YV7A 3TJFA 2ES7A 3AY8A 3LQ7A 4D73B 5EY6A 4BWSA 3F8UA 1YF1A 5AISA 3I6AA 4AJ7A 1JFUA 4TN8A 2B1LA 5IMCA 4OO4A 1A23A 2OKAA 3CSIA 4MLYA 3GTUA 3D5JA 2H6ZA 1EEMA 2HNLA 3UARA 5JWRB 2C3QA 2B1KA 1ERVA 2GQKA 4JE1A 5D73A 3IBHA 2E2MA 5DCHA 5GZZB 1FHEA 2WFCA 3G7JA 2F3MA 2PPTA 3FZ9A 3ZYWA 5CRDA 3KJYA 2VD1A 3DVWA 4OD7A 2BMXA 2FHEA 4ZBDA 4ZIJA 2AYTA 3E3EA 1YF0A 2VL9A 5FHIA 3S9FA 5D96A 4HU7A 2HLSA 1SK1A 1T7PB 4MJEA 5GAPD 1VF2A 8GSSA 5ECSA 1A8YA 2N5FA 1M9BA 1TRVA 3PINA 5DVBA 2I81A 1DE2A 3TGZA 2V2GA 4HJMA 2LUSA 3ED3A 5ID2A 1H75A 3GFKA 4DSRA 3HCZA 2R4VA 3GA4A 2PBJA 1Z6NA 1PD21 2MZCA 4GF0A 2C0DA 1TJDA 5ECPB 4RQRA 1JHBA 2LS5A 2GSQA 4TXOB 3GSSA 1J0FA 2PWJA 4IBPA 3I9V2 1T4YA 5A4UA 1S3DA 1ERUA 3KEBA 4D73A 4G2EA 3J7Yk 3TKPA 3F63A 5LD0A 4HQZA 1GSYA 2NDOA 5JCUA 5COHA 3QAVA 1I9DA 1R4WA 2OBKA 5ECQB 2QSIA 4KSMA 2P5RA 1XWGA 4J56E 2RM6A 4H86A 2R3XA 3FK8A 3HY2A 3LXTA 4F0CA 7GSSA 2EIRA 2DJ1A 3ERWA 2KLXA 2HZFA 4WF4A 3SWLA 1A2MA 3APOA 5HR1A 3M3MA 5GSTA 3GX8A 1BG5A 3CYNA 4IS0A 3ZFBA 2HXKA 3DYRA 2KOKA 5KEJA 1FVJA 5H5RA 5E59A 1G7OA 1PGTA 2PVQA 3ME8A 4GTUA 5EL8A 4O32A 1U6TA 5IMAA 3IHQA 3ZLPA 1XOBA 5KN2A 1A2LA 1GUKA 2FWGA 2OE1A 3ZIVA 2MMOA 2JU5A 4HZ2A 3UJ1A 3DEXA 2WJUA 2IMKA 4WF5A 1A0RP 3O6TA 5AIVA 4ZBBA 1WPIA 3GKMA 3ZMKA 4ZXGA 2P0GA 5IQYA 1YQ1A 2RLIA 3GL3A 3ZREA 3QFBC 5HQPA 1M2BA 1T4ZA 1BEDA 2EC4A 5G1LA 2AUVA 1ON4A 3LJRA 3RAZA 3D21A 6GSSA 3F9UA 2TRCP 3W6GA 4FO5A 4L0UA 4BVXA 4TXOA 3M9JA 3CRTA 2VLVA 3KMOA 6GSWA 1WOUA 1F6MC 2WULA 4KCEA 2VIMA 2V32A 2LJKA 1K0NA 1ZZYA 3CTFA 2B7JA 4EUYA 5EPFA 2XBQA 2H1GA 5ECHB 1F37A 1SK0A 1TP9A 2NPBA 2WS2A 1XZOA 5HR3A 1O81A 3EC3A 3US3A 1ZYEA 3GSTA 1OKDA 4HEA2 4V1Ap 4TKYA 2L5OA 1SJIA 2GLRA 4IHUA 3MWHA 3KP9A 5C04A 3RPNA 4JU5A 1T3BA 1KBNA 1M0UA 1A2JA 1GSSA 1SL0B 4OO5A 2HZEB 3APSA 4V2MA 4G9HA 4DSSB 3UEMA 3MAKA 4KUNA 2AJQB 1AUCA 5LNKe 4JR6A 1TW9A 2VLTA 3W8SA 2LNSA 3KP8A 3F0IA 3BCKA 4WKWA 4YQVA 1WP0A 4NHZA 3HZ8A 10GSA 2LRNA 5EVOA 2GVPA 4IELA 1O6JA 1Q98A 2OACA 2IMDA 1UC7A 4IN0A 2IFQB 1K0CA 5ECIB 2GS3A 2H74A 2IMIA 4IJIA 4F03A 4GSSA 11GSA 4LL4B 4P3YB 1GLQA 2M80A 2VLUA 1X9MB 1ST9A 2FWEA 2OE0A 2TIRA 1RK4A 1M9AA 2AV4A 2JSZA 4X1UA 2L6DA 4HDEA 3QFAC 1PA3A 3GKXA 3LYKA 2YZHA 3QOUA 5CP1A 2GSSA 3EMXA 1V9WA 2HT9A 3GNJA 3KTBA 3IRAA 1XVQA 1A8LA 2CX4A 3JCML 1K0OA 1F3BA 1YJ6A 3ZRDA 1EEJA 4XRAA 4ECCA 1SK2A 3ZITA 3E9JB 2CVBA 2E0QA 4K1FA 1EZKA 4NHWA 1JLVA 2BJXA 2HSYA 2JADA 3GKKA 3QAWA 2RUFA 3TB2A 2B5YA 3VPQA 4KA0A 2LQQA 1K0BA 1K0AA 3FR9A 4N0VA 3L0HA 3DRNA 3QR6A 1ML6A 4G19A 3P8WA 2VCQA 1GL8A 1QMVA 4MCUA 3HVXA 1EV4A 1SL1B 1MD3A 4I8BA 4F82A 2QC7A 1QGVA 1B48A 1V57A 4HZ4A 1WRYA 2VO4A 4EXJA 3WGXA 2IJYA 2IFQA 1EP8A 3ME7A 1AXDA 3QMXA 5DALB 3VI7A 4OWYA 5ECNB 2X8GA 3BJ5A 1UN2A 2GZZA 3L78A 3F4TA 3UVTA 1V58A 3RHBA 4ML6A 3LFLA 4K7IA 1V2AA 3FR6A 4POMA 4TOPA 3WGEA 4EKZA 2MMAA 4ECJA 1ZCPA 2CX3A 4E8HA 1GRXA 2HI7A 2NTOA 1LU4A 4KSOA 3M1GA 4K0NA 1LBKA 2P5QA 3L9UA 3HVSA 1QUWA 3VWWA 3F4SA 1OE8A 4ZL7A 1R5AA 2QKEA 5IOWA 2G2QA 2VCZA 3LEFA 4TR1B 5DAKB 2DJKA 2LNTA 1JZRA 1M99A 3EU3A 2O85A 5B7CA 3V1WA 1BAYA 4BWQA 4BPYA 1MDKA 2IIYA 4G10A 3VWXA 1AQWA 1QFNA 1THXA 3UBKA 1SENA 2H1DA 2YN1A 2KUCA 5LCZA 2R37A 4PXOA 5G1KA 1Z5YE 3GN3A 1JZOA 3D4MA 5IMDA 4IJ3A 4XIHA 4TR0A 2FA8A 3PH9A 4NWYA 3HVVA 3VI5A 9GSSA 1SU9A 4O5RA 3EINA 5L71A 4K8MA 2FD3A 1TRWA 2OA7A 4JR4A 1DUGA 3GUSA 1FVKA 1Z3EA 3UIWA 2GT6A 2L57A 3ZIJA 2PGTA 3IR4A 5D9TA 2YP6A 3IK9A 4O92A 2JZRA 1C72A 2PERA 2FLSA 3M8NA 2I4AA 5DALA 3DXBA 4BL7A 1SYXA 3G7IA 4TRXA 1OYJA 3GL5A 1NHYA 2F51A 3FHKA 3IPZA 2EIQA 4QQ7A 4JZQA 1T8EB 2LSTA 2VCTA 1T00A 5HFIA 4GQFA 5ECOB 3TOTA 2CV4A 4V1Ag 1WJKA 1WE0A 5KN1A 2HRFA 3H79A 3F6DA 1TK8B 4HUAA 1SKRB 1PSQA 5ELGA 3NZNA 2M46A 2B3SA 4TR1A 4GSTA 5DAKA 2YWOA
chains in the Genus database with same CATH superfamily
5IMVA 4WEYA 4CHSA 1VRSD 5D8IA 4KB3A 2X8HA 3CXGA 3VWUA 5J41A 3VWVA 3Q74A 1GTUA 4GSNA 4FQUA 5DQYA 4X0XA 2H8LA 2PU9C 5GSSA 3D4TA 2L4QA 1A0FA 1BX9A 4N10A 3KD0A 2DJ3A 2GZYA 1YKCA 1NSWA 4ZB9A 3GRXA 1ZMAA 3RBTA 2O7KA 5DJLA 2K8VA 4KE3A 1GSUA 2BTOT 4K7OA 5ECMB 3RDWA 3TKSA 5HR0A 3R3EA 2O87A 4ZL9A 4FYCA 4PNFA 2YWMA 3CBUA 4PGTA 3IDVA 2H1AA 4IP6A 2LEGA 1BYEA 1U3AA 2MMNA 1AW9A 1QXHA 5IM9A 4MJCA 3HXSA 2LJRA 4NXIA 2E7PA 4DSQA 1VF4A 4O5UA 3LORA 4IVFA 1IYHA 2C0EA 5AGYA 1W4VA 4XTSA 3G9BA 2NBSA 4Z7XA 4IQ1A 2YCDA 2YWIA 1EV9A 2FGXA 1X5EA 2VM1A 3IC8A 3E0UA 2AAWA 4I5QA 1XXUA 1TDIA 2VCXA 2DBCA 4L5LA 1U87A 2MBSA 2H73A 1X0RA 1GP1A 1UVZA 4PURA 3HHVA 3DMLA 1Q4JA 1Z7RA 5IMZA 1BJXA 2YANA 5ECLB 4MH3A 2PN8A 5D93A 4MDCA 4FH8A 2DKIA 4XCSA 3UMAA 4AJ6A 1B4PA 3IHGA 2H70A 2DIZA 3C71A 4WETA 3LYPA 3TKQA 1XW6A 1PL2A 1VGLA 3DGQA 2C8UA 1U88A 3F3RA 5G5EA 3PGTA 2C0GA 4XHMA 3P90A 3EWLA 3TJKA 3G7YA 1XWAA 4YQUA 5F05A 1Y6EA 1GNEA 3EMPA 1R7HA 4YH2A 1S3AA 3IC4A 1TK5B 1SKWB 2FA4A 14GSA 2M72A 3TRXA 2L5LA 3FRCA 5CNWA 2H71A 3FW2A 3IE3A 4MP4A 1XW5A 4F0BA 4AF2A 5JCGA 5G31A 3H93A 5D9VA 1MDJA 1TI3A 1E2YA 2CVKA 5GAND 1JLWA 2X99A 1FOVA 3H1NA 5HFGA 3N9JA 4HSCX 2R5GA 5DBQA 4QL9A 1O8XA 4TXVA 2F8AA 4I6XA 2REMA 1XPVA 4PNGA 1OAZA 2GSRA 1HNAA 4KDYA 1TU8A 4MA9A 2LQOA 4Q5RA 1SKSB 2JZSA 4POBA 3GMFA 4X43A 2K9FA 4WBJA 1PX7A 5FWGA 2VL2A 4ZB8A 1ZOFA 3D0ZA 1VF3A 1U3IA 4L8EA 4PX1A 2G0FA 1M3JA 1GSEA 2DMMA 2VL3A 2ON5A 3Q6OA 4EDZA 2F9SA 2H0HA 2ZNMA 4YQMA 5IO0A 1NHOA 1OKTA 3ERGA 5KOXA 4K9ZA 2I9HA 3CTGA 1GTAA 1ABAA 2CA8A 4TVEA 4LMWA 2WCIA 1B9XC 3NIVA 4GLTA 1R26A 3IV4A 1URMA 1ZYQB 5J9CA 1K3LA 2H19A 4V2LA 4EIPA 1HNCA 5HFKA 5JCWA 2VCVA 1HYUA 2XBIA 2A2PA 3P2AA 4O7HA 1PFOA 2L4CA 3TDGA 4KCAA 1NM3A 4V2NA 3GYKA 5BRTA 1TKDB 1EWXA 4ECBA 4HOJA 3BD2A 2LRCA 4MZBA 4I97A 5B6NA 4JRRA 1FW1A 3Q19A 5A4WA 1GLPA 1N2AA 3VLNA 4N30A 3FZ4A 4HU9A 4USSA 3L9SA 1XIYA 3LWAA 2V6KA 3TCOA 3IOSA 4CDOA 4YKFA 1TU7A 4PQHA 1PKZA 1H4OA 4XS6A 4ZILA 3TUEA 3QCPA 4E8EA 3HVNA 4Q5FA 3A5WA 4PQ1A 5JWOB 2VD0A 4Q5NA 3IK7A 2KHPA 3MNGA 1TRUA 1TOFA 1MEKA 2DC5A 1Z6MA 2GQLA 3RPPA 2B5EA 4BIKA 4TW5A 2H72A 1GSDA 4MF5A 3HKRA 2MBTA 2DKHA 1DE1A 3J7Yb 1K3YA 2PMTA 5B8AA 3UAPA 3WYWA 2IMFA 2XPEA 1OE7A 2L6CA 4PUFC 4OFTA 3QD9A 1GH2A 1OC9B 2GTUA 1ERTA 3HA9A 5DQSA 1AIUA 3PPUA 2RIIA 1NW2A 3UL3A 5IIZA 1TK0B 4OFNA 2H75A 4PQIA 3C1RA 2GGTA 2R0CA 1PN9A 3WGDA 2I1UA 4GWRA 1AQXA 4ZB6A 4NV2A 4NV5A 5B6MA 2QGVA 4RI6A 4J2FA 3LSZA 3ZZXA 2HFDA 5ECRB 4NPBA 2H66A 4RUVA 4ID0A 1E6BA 3DKSA 2VOCA 2LRTA 4YAVA 4K7NA 5DDLA 3CSHA 2WRTA 3GX0A 3M9KA 2A2RA 3KH7A 3GIXA 4JBBA 5J4UA 3EE2A 3O3TA 1GUHA 3KIJA 5IPHA 4EDYA 4MH2A 2FCHA 3ZVJD 4WBRD 1S3CA 4LA1A 3HJPA 3GH9A 2YOIA 4ML1A 4ISDA 5AIXA 2DIYA 3U5RE 2WZ9A 2H76A 4POLA 1EGOA 3IAM2 1IYIA 22GSA 2CVDA 4BVYB 2FWFA 2LTKA 5HR2A 1RQMA 2OBIA 1XW9A 3FY7A 4Z2UA 3CQFA 4EVMA 4KF9A 2QA2A 1YDKA 4MK3A 1XFLA 5A5KA 4WR5A 4N0ZA 2MYGA 2Z9SA 3CMIA 2DJ2A 3BBYA 1X5DA 5D9WA 2GT5A 4K0GA 2CQ9A 5ENUA 3GHAA 2IPAA 1FO5A 1OC9A 3DD3A 5J9BA 1XCCA 4EF0A 1F9MA 3TJJA 1PRXA 2IN3A 5F06A 2H01A 4GRFA 1GSFA 1Y25A 1M7TA 4OMVA 4GQCA 3HJMA 1PMTA 2OADA 1ZL9A 3GURA 5G2ZA 2RM5A 3ZTLA 1PX6A 1OVNA 3DIEA 1SL2B 4KNDA 3L9VA 3TOUA 5KN3A 1EP7A 4KDXA 1THOA 2K8SA 4QL7A 4L0WA 3F4RA 2H1BA 2MMZA 1B9YC 3C1SA 1X9SB 3VURA 1N8JA 4KAEA 3SBCA 2DJ0A 2C4JA 1ERWA 2N5BA 4HI7A 1OC8A 5IOXA 3VFIA 4EO3A 3P7XA 2K18A 3U6VA 3DVXA 3MDKA 4ULXA 4DEJA 3EURA 4G0KA 1I5GA 1PKWA 2C80A 1MDIA 2XC2A 2JSYA 1FB6A 1R5PA 2C3TA 1G6WA 5E4WA 4CW9A 4EIQA 1G7EA 2NVLA 3RHCA 1XWCA 1HNBA 2P31A 17GSA 4BVYA 4DVCA 4YKGA 5DCGA 4K6XA 4MJBA 4MMMA 4LMVA 19GSA 1AC1A 1V40A 2VM2A 3KCMA 2AB6A 2UZ8A 1K3OA 2HYXA 2FWHA 2V6OA 1BQ7A 1QK8A 5J3RA 4EC0A 1SJ6A 3I69A 1YEXA 3FYGA 2HE3A 2VCWA 5H5QA 12GSA 2OE3A 4WXTA 2B5XA 1SJZA 1K0DA 4N11A 3EYTA 3LXZA 1EOGA 1TRSA 4TR4A 16GSA 3A2VA 1WIKA 2DSAA 4NMUA 5DJMA 4F2IA 1PN0A 3LGCA 3ZL5A 3Q18A 1J08A 2R6KA 3UOMA 3HYPA 4IW9A 4POKA 4KH7A 2CZ2A 2KP2A 5JWQB 2A2SA 1O7UA 3R2QA 3A2WA 5CRGA 3TRQA 5A4VA 2O89A 2YJ7A 1ZGNA 2YNXA 3TKSC 4PTSA 4IP1A 18GSA 5D9XA 1M2DA 1XOAA 4KGIA 3APQA 3EVIA 4K5SA 3IXRA 3UBLA 1F3AA 1JZWA 4XS1A 2JZTA 4Q5QA 1W89A 2GDRA 4ECIA 2CAQA 2ZCTA 2H0IA 5CYYA 1SD9A 1O73A 1TTZA 5G30A 1PL1A 4K5RA 1FG4A 1M2AA 4KW6A 4EE0A 2DJJA 3F6FA 5H5SA 2FNOA 4FIWA 1YZXA 1O8WA 2X49A 6GSXA 13GSA 1FB0A 2DMLA 3IA1A 1FOHA 2JL4A 4MJAA 4GXZA 1AQVA 4KX4A 4MF6A 3BOAA 3CSJA 1B8XA 3H4KA 4KDUA 1SYRA 1V98A 3ZMLA 2WDUA 2LKUA 1YEPA 1OC3A 2YPMA 3FEUA 5IMFA 3W8JA 2I3YA 3HZ4A 1JZDA 3C73A 3QDNA 2XPDA 3HJOA 2YV9A 5ABRA 2HRKA 2C1YA 3WT1A 3EU4A 2YZUA 2WB9A 3KGKA 2C3NA 2H6XA 3KMNA 1GWCA 3ZFLA 2RUEA 2PVOC 2XHFA 4HJ2A 3FR3A 3ISOA 2D2ZA 5J5NA 3FKFA 1S3RA 4OCFA 3N5OA 2IMEA 2O8VB 3KTLA 3C8EA 3M0FA 3IAS2 2GZPA 4OFMA 3VK9A 2VAFA 1G0TA 4LL1B 2JACA 4YAPA 5B8BA 3KZQA 1TI1A 3DWVA 4XS4B 3GH6A 2AHEA 1SD8A 2V41A 1GTBA 1GSQA 3ERFA 1UA5A 4AGSA 3WT2A 4I2TA 4FYBA 5CRWA 3LG6A 1YY7A 4IKHA 2OJLA 2CT6A 4MZWA 1F2EA 2E2GA 1DSBA 5ELAA 6GSTA 1XWBA 2J23A 1MTCA 2GSTA 4ZBAA 1XWKA 2H6YA 2X64A 1USBA 4RQXA 2CZ3A 4X4JA 1CQGA 3MSZA 1X9WB 2LV3A 3BCIA 3TJGA 2H30A 5G5FA 3TRPA 3FZ5A 1X5CA 5KN0A 2ZUPA 4MABA 1CQHA 4ACSA 1KEBA 5CREA 3L4NA 4TR3A 1AAZA 2VL2C 6GSYA 2KP1A 3D6IA 2N5AA 4MZCA 2L59A 3A3TA 1HD2A 6GSUA 1DBYA 2CAIA 1YKAA 5AN1A 5ECKB 4RI7A 2EIOA 2A4VA 4HQSA 1WWJA 4I2UA 4K2DA 1T1VA 3D22A 4GCIA 3ZVJA 3C7MA 3H8QA 1XVWA 4ILFA 5INYA 1HQOA 2VUPA 5C00A 1A24A 2X8CA 4AJ8A 2YJHA 4OCEA 2HZEA 4PUAA 3PR8A 4DSSA 3OR5A 1VF1A 2LJAA 1M3IA 2B7KA 1KTEA 1G6YA 4MPFA 4XS4A 6GSVA 1ZYNA 2R2JA 1ACVA 4L5OA 5KOWA 1GTIA 1FAAA 2TRXA 2HRNA 2IWTA 4IQAA 1MD4A 4A5PA 1B4QA 2HRAA 20GSA 5F8BA 2J9HA 4J57E 1QQ2A 3CRUA 3GTUB 1J9BA 3O76A 3FMWA 2H0GA 5CO3A 3GV1A 5F0GA 1EGRA 4NAXA 2FUG2 3UVHA 3GKNA 3KM6A 2K6VA 3KXOA 2F8FA 3FZAA 1ZYPA 3HDCA 3TKRA 1LJRA 3QAGA 2FY6A 4ICYA 1TXXA 3VPTA 2HSHA 5IO2A 1Z7PA 1GULA 4F9ZA 5F07A 4MPGA 2YWNA 5IPGA 4FYUA 2GQMA 3A2XA 3TKSE 3KH9A 4XRDA 1PQNA 2PUKC 2B6MA 2C0FA 5FT3A 3K8NA 3F3QA 1GUMA 4O5QA 4MF7A 4WR4A 2ON7A 5CAXA 2DLXA 1O85A 4JEDA 3I43A 3HD5A 3WD6A 3NOFA 4LLRA 1KNGA 2WGRA 1XG8A 1XBSA 2V1MA 1RW1A 2IL3A 1Z9HA 3TJBA 5ID2B 2ALBA 1WMJA 1ILOA 4ZL8A 4IGJA 1GNWA 5CRHA 3QPMA 4G0IA 1EOHA 4HS1A 4EL1A 4BA7A 1K0MA 2YV7A 3TJFA 2ES7A 3AY8A 3LQ7A 4D73B 5EY6A 4BWSA 3F8UA 1YF1A 5AISA 3I6AA 4AJ7A 1JFUA 4TN8A 2B1LA 5IMCA 4OO4A 1A23A 2OKAA 3CSIA 4MLYA 3GTUA 3D5JA 2H6ZA 1EEMA 2HNLA 2A4HA 3UARA 5JWRB 2C3QA 2B1KA 1ERVA 2GQKA 4JE1A 5D73A 3IBHA 2E2MA 5DCHA 5GZZB 1FHEA 2WFCA 3G7JA 2F3MA 2PPTA 3FZ9A 3ZYWA 5CRDA 3KJYA 2VD1A 3DVWA 4OD7A 2BMXA 2FHEA 4ZBDA 4ZIJA 2AYTA 3E3EA 1YF0A 2VL9A 5FHIA 3S9FA 5D96A 4HU7A 2HLSA 1SK1A 1T7PB 4MJEA 5GAPD 1VF2A 8GSSA 5ECSA 1A8YA 2N5FA 1M9BA 1TRVA 3PINA 5DVBA 2I81A 1DE2A 3TGZA 2V2GA 4HJMA 2LUSA 3ED3A 5ID2A 1H75A 3GFKA 4DSRA 3HCZA 2R4VA 3GA4A 2PBJA 1Z6NA 1PD21 3EPTA 2MZCA 4GF0A 2C0DA 1TJDA 5ECPB 4RQRA 1JHBA 2LS5A 2GSQA 4K2XA 4BVXB 4TXOB 3GSSA 1J0FA 2PWJA 4IBPA 3I9V2 1T4YA 5A4UA 1S3DA 1ERUA 3KEBA 4D73A 4G2EA 3J7Yk 3TKPA 3F63A 5LD0A 4HQZA 1GSYA 2NDOA 5JCUA 5COHA 3QAVA 1I9DA 1R4WA 2OBKA 5ECQB 2QSIA 4KSMA 2P5RA 1XWGA 3MYDA 4J56E 2RM6A 4H86A 2R3XA 3FK8A 3HY2A 3LXTA 4F0CA 7GSSA 2EIRA 2DJ1A 3ERWA 2KLXA 4CY8A 2HZFA 3A5IA 4WF4A 3SWLA 1A2MA 3APOA 5HR1A 3M3MA 5GSTA 3GX8A 1BG5A 3CYNA 4IS0A 3ZFBA 2HXKA 3DYRA 2KOKA 5KEJA 1FVJA 5H5RA 5E59A 1G7OA 3LW9A 1PGTA 2PVQA 3ME8A 4GTUA 5EL8A 2X4AA 4O32A 1U6TA 5IMAA 3IHQA 3ZLPA 1XOBA 5KN2A 1A2LA 1GUKA 2FWGA 2OE1A 3ZIVA 2MMOA 2JU5A 4HZ2A 3UJ1A 3DEXA 2WJUA 2IMKA 4WF5A 1A0RP 3O6TA 5AIVA 4ZBBA 1WPIA 3GKMA 3ZMKA 4ZXGA 2P0GA 5IQYA 1YQ1A 2RLIA 3GL3A 3ZREA 3QFBC 5HQPA 1M2BA 1T4ZA 1BEDA 2EC4A 5G1LA 2AUVA 1ON4A 3LJRA 3RAZA 3D21A 6GSSA 3F9UA 2TRCP 3W6GA 4FO5A 4L0UA 4BVXA 4TXOA 3M9JA 3CRTA 2VLVA 3KMOA 6GSWA 1WOUA 1F6MC 2WULA 4KCEA 2VIMA 2V32A 2LJKA 1K0NA 1ZZYA 3CTFA 2B7JA 4EUYA 5EPFA 2XBQA 2H1GA 5ECHB 1F37A 1SK0A 1TP9A 2NPBA 2WS2A 1XZOA 5HR3A 1O81A 3EC3A 3US3A 1ZYEA 3GSTA 1OKDA 4HEA2 4V1Ap 4TKYA 2L5OA 1SJIA 2GLRA 4IHUA 3MWHA 3KP9A 5C04A 3RPNA 4JU5A 1T3BA 1KBNA 1M0UA 1A2JA 1GSSA 1SL0B 4OO5A 2HZEB 3APSA 4V2MA 4G9HA 4DSSB 3UEMA 3MAKA 4KUNA 2AJQB 1AUCA 5LNKe 4JR6A 1TW9A 2VLTA 3W8SA 2LNSA 4Z2TA 3KP8A 3F0IA 3BCKA 4WKWA 4YQVA 1WP0A 4NHZA 3HZ8A 10GSA 2LRNA 2R0GA 5EVOA 2GVPA 4IELA 1O6JA 1Q98A 2OACA 2IMDA 1UC7A 4IN0A 2IFQB 1K0CA 5ECIB 2GS3A 2H74A 2IMIA 4IJIA 4F03A 4GSSA 11GSA 4LL4B 4P3YB 1GLQA 2M80A 2VLUA 1X9MB 1ST9A 2FWEA 2OE0A 2TIRA 1RK4A 1M9AA 2AV4A 2JSZA 4X1UA 2L6DA 4HDEA 3QFAC 1PA3A 3GKXA 3LYKA 2YZHA 3QOUA 5CP1A 2GSSA 3EMXA 1V9WA 2HT9A 3GNJA 3KTBA 3IRAA 1XVQA 1A8LA 2CX4A 3JCML 1K0OA 1F3BA 1YJ6A 3ZRDA 1EEJA 4XRAA 4ECCA 1SK2A 3ZITA 3E9JB 2CVBA 2E0QA 4K1FA 1EZKA 4NHWA 1JLVA 2BJXA 2HSYA 2JADA 3GKKA 3QAWA 2RUFA 3TB2A 2B5YA 3VPQA 4KA0A 2LQQA 1K0BA 1K0AA 3FR9A 4N0VA 3L0HA 4CY6A 3DRNA 3QR6A 1ML6A 4G19A 3P8WA 2VCQA 1GL8A 1QMVA 4MCUA 3HVXA 1EV4A 1SL1B 1MD3A 4I8BA 4F82A 2QC7A 1QGVA 1B48A 1V57A 4HZ4A 1WRYA 2VO4A 4EXJA 3WGXA 2IJYA 2IFQA 1EP8A 3ME7A 1AXDA 3QMXA 5DALB 3VI7A 4BL7B 4OWYA 5ECNB 2X8GA 3BJ5A 1UN2A 2GZZA 3L78A 3F4TA 3UVTA 1V58A 3RHBA 4ML6A 3LFLA 4K7IA 1V2AA 3FR6A 4POMA 4TOPA 3WGEA 4EKZA 2MMAA 4ECJA 1ZCPA 2CX3A 4E8HA 1GRXA 2HI7A 2NTOA 1LU4A 2R0PA 4KSOA 3M1GA 4K0NA 1LBKA 2P5QA 3L9UA 3HVSA 1QUWA 3VWWA 3F4SA 1OE8A 4ZL7A 1R5AA 2QKEA 5IOWA 2G2QA 2VCZA 3LEFA 4TR1B 5DAKB 2DJKA 2LNTA 1JZRA 1M99A 3EU3A 2O85A 5B7CA 3V1WA 1BAYA 4BWQA 4BPYA 1MDKA 2IIYA 4G10A 3VWXA 1AQWA 1QFNA 1THXA 3UBKA 1SENA 2H1DA 2YN1A 2KUCA 4G0LA 5LCZA 2R37A 4PXOA 5G1KA 1Z5YE 3GN3A 1JZOA 3D4MA 5IMDA 4IJ3A 4XIHA 4TR0A 2FA8A 3PH9A 4NWYA 3HVVA 3VI5A 2HSMA 9GSSA 1SU9A 4O5RA 3EINA 5L71A 4K8MA 2FD3A 1TRWA 2OA7A 4JR4A 1DUGA 3GUSA 1FVKA 1Z3EA 3UIWA 2GT6A 2L57A 3ZIJA 2PGTA 3IR4A 5D9TA 2YP6A 3IK9A 5BMUA 4O92A 2JZRA 1C72A 2PERA 2FLSA 3M8NA 2I4AA 5DALA 3DXBA 4BL7A 4MNNA 1SYXA 3G7IA 4TRXA 1OYJA 3MIXA 3GL5A 1NHYA 2F51A 3FHKA 3IPZA 2EIQA 4QQ7A 4JZQA 1T8EB 2LSTA 2VCTA 1T00A 5HFIA 4GQFA 5ECOB 3TOTA 2CV4A 4V1Ag 1WJKA 1WE0A 5KN1A 2HRFA 3H79A 3F6DA 4Z2RA 1TK8B 4HUAA 1SKRB 1PSQA 5ELGA 2QA1A 3NZNA 2M46A 2B3SA 4TR1A 4GSTA 5DAKA 2YWOA
chains in the Genus database with same CATH topology
5IMVA 4WEYA 4CHSA 1VRSD 5D8IA 4KB3A 2X8HA 3CXGA 3VWUA 5J41A 3VWVA 3Q74A 1GTUA 4GSNA 4FQUA 5DQYA 4X0XA 2H8LA 2PU9C 5GSSA 3D4TA 2L4QA 1A0FA 1BX9A 4N10A 3KD0A 2DJ3A 2GZYA 1YKCA 1NSWA 4ZB9A 3GRXA 1ZMAA 3RBTA 2O7KA 5DJLA 2K8VA 4KE3A 1GSUA 2BTOT 4K7OA 5ECMB 3RDWA 3TKSA 5HR0A 3R3EA 2O87A 4ZL9A 4FYCA 4PNFA 2YWMA 3CBUA 4PGTA 3IDVA 2H1AA 4IP6A 2LEGA 1BYEA 1U3AA 2MMNA 1AW9A 1QXHA 5IM9A 4MJCA 3HXSA 2LJRA 4NXIA 2E7PA 4DSQA 1VF4A 4O5UA 3LORA 4IVFA 1IYHA 2C0EA 5AGYA 1W4VA 4XTSA 3G9BA 2NBSA 4Z7XA 4IQ1A 2YCDA 2YWIA 1EV9A 2FGXA 1X5EA 2VM1A 3IC8A 3E0UA 2AAWA 4I5QA 1XXUA 1TDIA 2VCXA 2DBCA 4L5LA 1U87A 2MBSA 2H73A 1X0RA 1GP1A 1UVZA 4PURA 3HHVA 3DMLA 1Q4JA 1Z7RA 5IMZA 1BJXA 2YANA 5ECLB 4MH3A 2PN8A 5D93A 4MDCA 4FH8A 2DKIA 4XCSA 3UMAA 4AJ6A 1B4PA 3IHGA 2H70A 2DIZA 3C71A 4WETA 3LYPA 3TKQA 1XW6A 1PL2A 1VGLA 3DGQA 2C8UA 1U88A 3F3RA 5G5EA 3PGTA 2C0GA 4XHMA 3P90A 3EWLA 3TJKA 3G7YA 1XWAA 4YQUA 5F05A 1Y6EA 1GNEA 3EMPA 1R7HA 4YH2A 1S3AA 3IC4A 1TK5B 1SKWB 2FA4A 14GSA 2M72A 3TRXA 2L5LA 3FRCA 5CNWA 2H71A 3FW2A 3IE3A 4MP4A 1XW5A 4F0BA 4AF2A 5JCGA 5G31A 3H93A 5D9VA 1MDJA 1TI3A 1E2YA 2CVKA 5GAND 1JLWA 2X99A 1FOVA 3H1NA 5HFGA 3N9JA 2R5GA 5DBQA 4QL9A 1O8XA 4TXVA 2F8AA 4I6XA 2REMA 1XPVA 4PNGA 1OAZA 2GSRA 1HNAA 4KDYA 1TU8A 4MA9A 2LQOA 4Q5RA 1SKSB 2JZSA 4POBA 3GMFA 4X43A 2K9FA 4WBJA 1PX7A 5FWGA 2VL2A 4ZB8A 1ZOFA 3D0ZA 1VF3A 1U3IA 4L8EA 4PX1A 2G0FA 2DMMA 1GSEA 2VL3A 2ON5A 3Q6OA 4EDZA 2F9SA 2H0HA 2ZNMA 4YQMA 5IO0A 1NHOA 1OKTA 3ERGA 5KOXA 4K9ZA 2I9HA 3CTGA 1GTAA 1ABAA 2CA8A 4TVEA 4LMWA 2WCIA 1B9XC 3NIVA 4GLTA 1R26A 3IV4A 1URMA 1ZYQB 5J9CA 1K3LA 2H19A 4V2LA 4EIPA 1HNCA 5HFKA 5JCWA 2VCVA 1HYUA 2XBIA 2A2PA 3P2AA 4O7HA 2L4CA 3TDGA 4KCAA 1NM3A 4V2NA 3GYKA 5BRTA 1TKDB 1EWXA 4ECBA 4HOJA 3BD2A 2LRCA 4MZBA 4I97A 5B6NA 4JRRA 1FW1A 3Q19A 5A4WA 1GLPA 1N2AA 3VLNA 4N30A 3FZ4A 4HU9A 4USSA 3L9SA 1XIYA 3LWAA 2V6KA 3TCOA 3IOSA 4CDOA 4YKFA 1TU7A 4PQHA 1PKZA 1H4OA 4XS6A 4ZILA 3TUEA 3QCPA 4E8EA 4Q5FA 3A5WA 4PQ1A 5JWOB 2VD0A 4Q5NA 3IK7A 2KHPA 3MNGA 1TRUA 1TOFA 1MEKA 2DC5A 1Z6MA 2GQLA 3RPPA 2B5EA 4TW5A 2H72A 1GSDA 4MF5A 3HKRA 2MBTA 2DKHA 1DE1A 3J7Yb 1K3YA 2PMTA 5B8AA 3UAPA 3WYWA 2IMFA 2XPEA 1OE7A 2L6CA 4PUFC 4OFTA 3QD9A 1GH2A 1OC9B 2GTUA 1ERTA 3HA9A 5DQSA 1AIUA 3PPUA 2RIIA 1NW2A 3UL3A 5IIZA 1TK0B 4OFNA 2H75A 4PQIA 3C1RA 2GGTA 2R0CA 1PN9A 3WGDA 2I1UA 4GWRA 1AQXA 4ZB6A 4NV2A 4NV5A 5B6MA 2QGVA 4RI6A 4J2FA 3LSZA 3ZZXA 2HFDA 5ECRB 4NPBA 2H66A 4RUVA 4ID0A 1E6BA 3DKSA 2VOCA 2LRTA 4YAVA 4K7NA 5DDLA 3CSHA 2WRTA 3GX0A 3M9KA 2A2RA 3KH7A 3GIXA 4JBBA 5J4UA 3EE2A 3O3TA 1GUHA 3KIJA 5IPHA 4EDYA 4MH2A 2FCHA 3ZVJD 4WBRD 1S3CA 4LA1A 3HJPA 3GH9A 2YOIA 4ML1A 4ISDA 5AIXA 2DIYA 3U5RE 2WZ9A 2H76A 4POLA 1EGOA 3IAM2 1IYIA 22GSA 2CVDA 4BVYB 2FWFA 2LTKA 5HR2A 1RQMA 2OBIA 1XW9A 3FY7A 4Z2UA 4EVMA 4KF9A 2QA2A 1YDKA 4MK3A 1XFLA 5A5KA 4WR5A 4N0ZA 2MYGA 2Z9SA 3CMIA 2DJ2A 3BBYA 1X5DA 5D9WA 2GT5A 4K0GA 2CQ9A 5ENUA 3GHAA 2IPAA 1FO5A 1OC9A 3DD3A 5J9BA 1XCCA 4EF0A 1F9MA 3TJJA 1PRXA 2IN3A 5F06A 2H01A 4GRFA 1GSFA 1Y25A 1M7TA 4OMVA 4GQCA 3HJMA 1PMTA 2OADA 1ZL9A 3GURA 5G2ZA 2RM5A 3ZTLA 1PX6A 1OVNA 3DIEA 1SL2B 4KNDA 3L9VA 3TOUA 5KN3A 1EP7A 4KDXA 1THOA 2K8SA 4QL7A 4L0WA 3F4RA 2H1BA 2MMZA 1B9YC 3C1SA 1X9SB 3VURA 1N8JA 4KAEA 3SBCA 2DJ0A 2C4JA 1ERWA 2N5BA 4HI7A 1OC8A 5IOXA 3VFIA 4EO3A 3P7XA 2K18A 3U6VA 3DVXA 3MDKA 4ULXA 4DEJA 3EURA 4G0KA 1I5GA 1PKWA 2C80A 1MDIA 2XC2A 2JSYA 1FB6A 1R5PA 2C3TA 1G6WA 5E4WA 4CW9A 4EIQA 1G7EA 2NVLA 3RHCA 1XWCA 1HNBA 2P31A 17GSA 4BVYA 4DVCA 4YKGA 5DCGA 4K6XA 4MJBA 4MMMA 4LMVA 19GSA 1AC1A 1V40A 2VM2A 3KCMA 2AB6A 2UZ8A 1K3OA 2HYXA 2FWHA 2V6OA 1BQ7A 1QK8A 5J3RA 4EC0A 1SJ6A 3I69A 1YEXA 3FYGA 2HE3A 2VCWA 5H5QA 12GSA 2OE3A 4WXTA 2B5XA 1SJZA 1K0DA 4N11A 3EYTA 3LXZA 1EOGA 1TRSA 4TR4A 16GSA 3A2VA 1WIKA 2DSAA 4NMUA 5DJMA 4F2IA 1PN0A 3LGCA 3ZL5A 3Q18A 1J08A 2R6KA 3UOMA 3HYPA 4IW9A 4POKA 4KH7A 2CZ2A 2KP2A 5JWQB 2A2SA 1O7UA 3R2QA 3A2WA 5CRGA 3TRQA 5A4VA 2O89A 2YJ7A 1ZGNA 2YNXA 3TKSC 4PTSA 4IP1A 18GSA 5D9XA 1M2DA 1XOAA 4KGIA 3APQA 3EVIA 4K5SA 3IXRA 3UBLA 1F3AA 1JZWA 4XS1A 2JZTA 4Q5QA 1W89A 2GDRA 4ECIA 2CAQA 2ZCTA 2H0IA 5CYYA 1SD9A 1O73A 1TTZA 5G30A 1PL1A 4K5RA 1FG4A 1M2AA 4KW6A 4EE0A 2DJJA 3F6FA 5H5SA 2FNOA 4FIWA 1YZXA 1O8WA 2X49A 6GSXA 13GSA 1FB0A 2DMLA 3IA1A 1FOHA 2JL4A 4MJAA 4GXZA 1AQVA 4KX4A 4MF6A 3BOAA 3CSJA 1B8XA 3H4KA 4KDUA 1SYRA 1V98A 3ZMLA 2WDUA 2LKUA 1YEPA 1OC3A 2YPMA 3FEUA 5IMFA 3W8JA 2I3YA 3HZ4A 1JZDA 3C73A 3QDNA 2XPDA 3HJOA 2YV9A 5ABRA 2HRKA 2C1YA 3WT1A 3EU4A 2YZUA 2WB9A 3KGKA 2C3NA 2H6XA 3KMNA 1GWCA 3ZFLA 2RUEA 2PVOC 2XHFA 4HJ2A 3FR3A 3ISOA 2D2ZA 5J5NA 3FKFA 4OCFA 3N5OA 2IMEA 2O8VB 3KTLA 3C8EA 3M0FA 3IAS2 2GZPA 4OFMA 3VK9A 2VAFA 1G0TA 4LL1B 2JACA 4YAPA 5B8BA 3KZQA 1TI1A 3DWVA 4XS4B 3GH6A 2AHEA 1SD8A 2V41A 1GTBA 1GSQA 3ERFA 1UA5A 4AGSA 3WT2A 4I2TA 4FYBA 5CRWA 3LG6A 1YY7A 4IKHA 2OJLA 2CT6A 4MZWA 1F2EA 2E2GA 1DSBA 5ELAA 6GSTA 1XWBA 2J23A 1MTCA 2GSTA 4ZBAA 1XWKA 2H6YA 2X64A 1USBA 4RQXA 2CZ3A 4X4JA 1CQGA 3MSZA 1X9WB 2LV3A 3BCIA 3TJGA 2H30A 5G5FA 3TRPA 3FZ5A 1X5CA 5KN0A 2ZUPA 4MABA 1CQHA 4ACSA 1KEBA 5CREA 3L4NA 4TR3A 1AAZA 2VL2C 6GSYA 2KP1A 3D6IA 2N5AA 4MZCA 2L59A 3A3TA 1HD2A 6GSUA 1DBYA 2CAIA 1YKAA 5AN1A 5ECKB 4RI7A 2EIOA 2A4VA 4HQSA 1WWJA 4I2UA 4K2DA 1T1VA 3D22A 4GCIA 3ZVJA 3C7MA 3H8QA 1XVWA 4ILFA 5INYA 1HQOA 2VUPA 5C00A 1A24A 2X8CA 4AJ8A 2YJHA 4OCEA 2HZEA 4PUAA 3PR8A 4DSSA 3OR5A 1VF1A 2LJAA 2B7KA 1KTEA 1G6YA 4MPFA 4XS4A 6GSVA 1ZYNA 2R2JA 1ACVA 4L5OA 5KOWA 1GTIA 1FAAA 2TRXA 2HRNA 2IWTA 4IQAA 1MD4A 4A5PA 1B4QA 2HRAA 20GSA 5F8BA 2J9HA 4J57E 1QQ2A 3CRUA 3GTUB 1J9BA 3O76A 3FMWA 2H0GA 5CO3A 3GV1A 5F0GA 1EGRA 4NAXA 2FUG2 3UVHA 3GKNA 3KM6A 2K6VA 3KXOA 2F8FA 3FZAA 1ZYPA 3HDCA 3TKRA 1LJRA 3QAGA 2FY6A 4ICYA 1TXXA 3VPTA 2HSHA 5IO2A 1Z7PA 1GULA 4F9ZA 5F07A 4MPGA 2YWNA 5IPGA 4FYUA 2GQMA 3A2XA 3TKSE 3KH9A 4XRDA 1PQNA 2PUKC 2B6MA 2C0FA 5FT3A 3K8NA 3F3QA 1GUMA 4O5QA 4MF7A 4WR4A 2ON7A 5CAXA 2DLXA 1O85A 4JEDA 3I43A 3HD5A 3WD6A 3NOFA 4LLRA 1KNGA 2WGRA 1XBSA 2V1MA 1RW1A 2IL3A 1Z9HA 3TJBA 5ID2B 2ALBA 1WMJA 1ILOA 4ZL8A 4IGJA 1GNWA 5CRHA 3QPMA 4G0IA 1EOHA 4HS1A 4EL1A 4BA7A 1K0MA 2YV7A 3TJFA 2ES7A 3AY8A 3LQ7A 4D73B 5EY6A 4BWSA 3F8UA 1YF1A 5AISA 3I6AA 4AJ7A 1JFUA 4TN8A 2B1LA 5IMCA 4OO4A 1A23A 2OKAA 3CSIA 4MLYA 3GTUA 3D5JA 2H6ZA 1EEMA 2HNLA 2A4HA 3UARA 5JWRB 2C3QA 2B1KA 1ERVA 2GQKA 4JE1A 5D73A 3IBHA 2E2MA 5DCHA 5GZZB 1FHEA 2WFCA 3G7JA 2F3MA 2PPTA 3FZ9A 3ZYWA 5CRDA 3KJYA 2VD1A 3DVWA 4OD7A 2BMXA 2FHEA 4ZBDA 4ZIJA 2AYTA 3E3EA 1YF0A 2VL9A 5FHIA 3S9FA 5D96A 4HU7A 2HLSA 1SK1A 1T7PB 4MJEA 5GAPD 1VF2A 8GSSA 5ECSA 1A8YA 2N5FA 1M9BA 1TRVA 3PINA 5DVBA 2I81A 1DE2A 3TGZA 2V2GA 4HJMA 2LUSA 3ED3A 5ID2A 1H75A 3GFKA 4DSRA 3HCZA 2R4VA 3GA4A 2PBJA 1Z6NA 1PD21 3EPTA 2MZCA 4GF0A 2C0DA 1TJDA 5ECPB 4RQRA 1JHBA 2LS5A 2GSQA 4K2XA 4BVXB 4TXOB 3GSSA 1J0FA 2PWJA 4IBPA 3I9V2 1T4YA 5A4UA 1S3DA 1ERUA 3KEBA 4D73A 4G2EA 3J7Yk 3TKPA 3F63A 5LD0A 4HQZA 1GSYA 2NDOA 5JCUA 5COHA 3QAVA 1I9DA 1R4WA 2OBKA 5ECQB 2QSIA 4KSMA 2P5RA 1XWGA 3MYDA 4J56E 2RM6A 4H86A 2R3XA 3FK8A 3HY2A 3LXTA 4F0CA 7GSSA 2EIRA 2DJ1A 3ERWA 2KLXA 4CY8A 2HZFA 3A5IA 4WF4A 3SWLA 1A2MA 3APOA 5HR1A 3M3MA 5GSTA 3GX8A 1BG5A 3CYNA 4IS0A 3ZFBA 2HXKA 3DYRA 2KOKA 5KEJA 1FVJA 5H5RA 5E59A 1G7OA 3LW9A 1PGTA 2PVQA 3ME8A 4GTUA 5EL8A 2X4AA 4O32A 1U6TA 5IMAA 3IHQA 3ZLPA 1XOBA 5KN2A 1A2LA 1GUKA 2FWGA 2OE1A 3ZIVA 2MMOA 2JU5A 4HZ2A 3UJ1A 3DEXA 2WJUA 2IMKA 4WF5A 1A0RP 3O6TA 5AIVA 4ZBBA 1WPIA 3GKMA 3ZMKA 4ZXGA 2P0GA 5IQYA 1YQ1A 2RLIA 3GL3A 3ZREA 3QFBC 5HQPA 1M2BA 1T4ZA 1BEDA 2EC4A 5G1LA 2AUVA 1ON4A 3LJRA 3RAZA 3D21A 6GSSA 3F9UA 2TRCP 3W6GA 4FO5A 4L0UA 4BVXA 4TXOA 3M9JA 3CRTA 2VLVA 3KMOA 6GSWA 1WOUA 1F6MC 2WULA 4KCEA 2VIMA 2V32A 2LJKA 1K0NA 1ZZYA 3CTFA 2B7JA 4EUYA 5EPFA 2XBQA 2H1GA 5ECHB 1F37A 1SK0A 1TP9A 2NPBA 2WS2A 1XZOA 5HR3A 1O81A 3EC3A 3US3A 1ZYEA 3GSTA 1OKDA 4HEA2 4V1Ap 4TKYA 2L5OA 1SJIA 2GLRA 4IHUA 3MWHA 3KP9A 5C04A 3RPNA 4JU5A 1T3BA 1KBNA 1M0UA 1A2JA 1GSSA 1SL0B 4OO5A 2HZEB 3APSA 4V2MA 4G9HA 4DSSB 3UEMA 3MAKA 4KUNA 2AJQB 1AUCA 5LNKe 4JR6A 1TW9A 2VLTA 3W8SA 2LNSA 4Z2TA 3KP8A 3F0IA 3BCKA 4WKWA 4YQVA 1WP0A 4NHZA 3HZ8A 10GSA 2LRNA 2R0GA 5EVOA 2GVPA 4IELA 1O6JA 1Q98A 2OACA 2IMDA 1UC7A 4IN0A 2IFQB 1K0CA 5ECIB 2GS3A 2H74A 2IMIA 4IJIA 4F03A 4GSSA 11GSA 4LL4B 4P3YB 1GLQA 2M80A 2VLUA 1X9MB 1ST9A 2FWEA 2OE0A 2TIRA 1RK4A 1M9AA 2AV4A 2JSZA 4X1UA 2L6DA 4HDEA 3QFAC 1PA3A 3GKXA 3LYKA 2YZHA 3QOUA 5CP1A 2GSSA 3EMXA 1V9WA 2HT9A 3GNJA 3KTBA 3IRAA 1XVQA 1A8LA 2CX4A 3JCML 1K0OA 1F3BA 1YJ6A 3ZRDA 1EEJA 4XRAA 4ECCA 1SK2A 3ZITA 3E9JB 2CVBA 2E0QA 4K1FA 1EZKA 4NHWA 1JLVA 2BJXA 2HSYA 2JADA 3GKKA 3QAWA 2RUFA 3TB2A 2B5YA 3VPQA 4KA0A 2LQQA 1K0BA 1K0AA 3FR9A 4N0VA 3L0HA 4CY6A 3DRNA 3QR6A 1ML6A 4G19A 3P8WA 2VCQA 1GL8A 1QMVA 4MCUA 3HVXA 1EV4A 1SL1B 1MD3A 4I8BA 4F82A 2QC7A 1QGVA 1B48A 1V57A 4HZ4A 1WRYA 2VO4A 4EXJA 3WGXA 2IJYA 2IFQA 1EP8A 3ME7A 1AXDA 3QMXA 5DALB 3VI7A 4BL7B 4OWYA 5ECNB 2X8GA 3BJ5A 1UN2A 2GZZA 3L78A 3F4TA 3UVTA 1V58A 3RHBA 4ML6A 3LFLA 4K7IA 1V2AA 3FR6A 4POMA 4TOPA 3WGEA 4EKZA 2MMAA 4ECJA 1ZCPA 2CX3A 4E8HA 1GRXA 2HI7A 2NTOA 1LU4A 2R0PA 4KSOA 3M1GA 4K0NA 1LBKA 2P5QA 3L9UA 3HVSA 1QUWA 3VWWA 3F4SA 1OE8A 4ZL7A 1R5AA 2QKEA 5IOWA 2G2QA 2VCZA 3LEFA 4TR1B 5DAKB 2DJKA 2LNTA 1JZRA 1M99A 3EU3A 2O85A 5B7CA 3V1WA 1BAYA 4BWQA 4BPYA 1MDKA 2IIYA 4G10A 3VWXA 1AQWA 1QFNA 1THXA 3UBKA 1SENA 2H1DA 2YN1A 2KUCA 4G0LA 5LCZA 2R37A 4PXOA 5G1KA 1Z5YE 3GN3A 1JZOA 3D4MA 5IMDA 4IJ3A 4XIHA 4TR0A 2FA8A 3PH9A 4NWYA 3HVVA 3VI5A 2HSMA 9GSSA 1SU9A 4O5RA 3EINA 5L71A 4K8MA 2FD3A 1TRWA 2OA7A 4JR4A 1DUGA 3GUSA 1FVKA 1Z3EA 3UIWA 2GT6A 2L57A 3ZIJA 2PGTA 3IR4A 5D9TA 2YP6A 3IK9A 5BMUA 4O92A 2JZRA 1C72A 2PERA 2FLSA 3M8NA 2I4AA 5DALA 3DXBA 4BL7A 4MNNA 1SYXA 3G7IA 4TRXA 1OYJA 3MIXA 3GL5A 1NHYA 2F51A 3FHKA 3IPZA 2EIQA 4QQ7A 4JZQA 1T8EB 2LSTA 2VCTA 1T00A 5HFIA 4GQFA 5ECOB 3TOTA 2CV4A 4V1Ag 1WJKA 1WE0A 5KN1A 2HRFA 3H79A 3F6DA 4Z2RA 1TK8B 4HUAA 1SKRB 1PSQA 5ELGA 2QA1A 3NZNA 2M46A 2B3SA 4TR1A 4GSTA 5DAKA 2YWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IMV A;  4WEY A;  4CHS A;  1VRS D;  5D8I A;  4KB3 A;  2X8H A;  3CXG A;  3VWU A;  5J41 A;  3VWV A;  3Q74 A;  1GTU A;  4GSN A;  5DQY A;  4X0X A;  2H8L A;  2PU9 C;  5GSS A;  3D4T A;  2L4Q A;  1A0F A;  1BX9 A;  4N10 A;  3KD0 A;  2DJ3 A;  2GZY A;  1YKC A;  1NSW A;  4ZB9 A;  3GRX A;  1ZMA A;  3RBT A;  2O7K A;  5DJL A;  2K8V A;  4KE3 A;  1GSU A;  2BTO T;  4K7O A;  5ECM B;  3RDW A;  3TKS A;  5HR0 A;  2O87 A;  4ZL9 A;  4FYC A;  4PNF A;  2YWM A;  3CBU A;  4PGT A;  3IDV A;  2H1A A;  4IP6 A;  2LEG A;  1BYE A;  1U3A A;  2MMN A;  1AW9 A;  1QXH A;  5IM9 A;  4MJC A;  3HXS A;  2LJR A;  4NXI A;  2E7P A;  4DSQ A;  1VF4 A;  3LOR A;  4IVF A;  1IYH A;  2C0E A;  5AGY A;  1W4V A;  4XTS A;  3G9B A;  2NBS A;  4Z7X A;  4IQ1 A;  2YCD A;  2YWI A;  1EV9 A;  2FGX A;  1X5E A;  2VM1 A;  3E0U A;  2AAW A;  4I5Q A;  1XXU A;  1TDI A;  2VCX A;  2DBC A;  4L5L A;  1U87 A;  2MBS A;  2H73 A;  1X0R A;  1GP1 A;  1UVZ A;  4PUR A;  3HHV A;  3DML A;  1Q4J A;  1Z7R A;  5IMZ A;  1BJX A;  2YAN A;  5ECL B;  4MH3 A;  2PN8 A;  5D93 A;  4MDC A;  4FH8 A;  4XCS A;  3UMA A;  4AJ6 A;  1B4P A;  2H70 A;  2DIZ A;  3C71 A;  4WET A;  3LYP A;  3TKQ A;  1XW6 A;  1PL2 A;  1VGL A;  3DGQ A;  2C8U A;  1U88 A;  3F3R A;  5G5E A;  3PGT A;  2C0G A;  4XHM A;  3P90 A;  3EWL A;  3TJK A;  3G7Y A;  1XWA A;  4YQU A;  5F05 A;  1Y6E A;  1GNE A;  3EMP A;  1R7H A;  4YH2 A;  1S3A A;  3IC4 A;  1TK5 B;  1SKW B;  2FA4 A;  14GS A;  2M72 A;  3TRX A;  2L5L A;  3FRC A;  5CNW A;  2H71 A;  3FW2 A;  3IE3 A;  4MP4 A;  1XW5 A;  4F0B A;  4AF2 A;  5JCG A;  5G31 A;  3H93 A;  5D9V A;  1MDJ A;  1TI3 A;  1E2Y A;  2CVK A;  5GAN D;  1JLW A;  2X99 A;  1FOV A;  3H1N A;  5HFG A;  3N9J A;  2R5G A;  5DBQ A;  4QL9 A;  1O8X A;  4TXV A;  2F8A A;  4I6X A;  2REM A;  1XPV A;  4PNG A;  1OAZ A;  2GSR A;  1HNA A;  4KDY A;  1TU8 A;  4MA9 A;  2LQO A;  4Q5R A;  1SKS B;  2JZS A;  4POB A;  3GMF A;  4X43 A;  2K9F A;  4WBJ A;  1PX7 A;  5FWG A;  2VL2 A;  4ZB8 A;  1ZOF A;  3D0Z A;  1VF3 A;  1U3I A;  4L8E A;  4PX1 A;  2G0F A;  2DMM A;  1GSE A;  2VL3 A;  2ON5 A;  3Q6O A;  4EDZ A;  2F9S A;  2H0H A;  2ZNM A;  4YQM A;  5IO0 A;  1NHO A;  1OKT A;  3ERG A;  4K9Z A;  2I9H A;  3CTG A;  1GTA A;  1ABA A;  2CA8 A;  4TVE A;  4LMW A;  2WCI A;  1B9X C;  3NIV A;  4GLT A;  1R26 A;  3IV4 A;  1URM A;  1ZYQ B;  5J9C A;  1K3L A;  2H19 A;  4V2L A;  1HNC A;  5HFK A;  5JCW A;  2VCV A;  1HYU A;  2XBI A;  3P2A A;  4O7H A;  2L4C A;  3TDG A;  4KCA A;  1NM3 A;  4V2N A;  3GYK A;  1TKD B;  1EWX A;  4ECB A;  4HOJ A;  3BD2 A;  2LRC A;  4MZB A;  4I97 A;  5B6N A;  4JRR A;  1FW1 A;  3Q19 A;  5A4W A;  1GLP A;  1N2A A;  3VLN A;  4N30 A;  3FZ4 A;  4HU9 A;  3L9S A;  1XIY A;  3LWA A;  2V6K A;  3TCO A;  3IOS A;  4CDO A;  1TU7 A;  4PQH A;  1PKZ A;  1H4O A;  4XS6 A;  4ZIL A;  3TUE A;  3QCP A;  4E8E A;  4Q5F A;  3A5W A;  4PQ1 A;  5JWO B;  2VD0 A;  4Q5N A;  3IK7 A;  2KHP A;  3MNG A;  1TRU A;  1TOF A;  1MEK A;  2DC5 A;  1Z6M A;  2GQL A;  3RPP A;  2B5E A;  4TW5 A;  2H72 A;  1GSD A;  4MF5 A;  3HKR A;  2MBT A;  1DE1 A;  3J7Y b;  1K3Y A;  2PMT A;  5B8A A;  3UAP A;  3WYW A;  2IMF A;  2XPE A;  1OE7 A;  2L6C A;  4PUF C;  4OFT A;  3QD9 A;  1GH2 A;  1OC9 B;  2GTU A;  1ERT A;  3HA9 A;  5DQS A;  1AIU A;  2RII A;  1NW2 A;  3UL3 A;  5IIZ A;  1TK0 B;  4OFN A;  2H75 A;  4PQI A;  3C1R A;  2GGT A;  1PN9 A;  3WGD A;  2I1U A;  4GWR A;  1AQX A;  4ZB6 A;  4NV2 A;  4NV5 A;  5B6M A;  2QGV A;  4RI6 A;  4J2F A;  3LSZ A;  3ZZX A;  2HFD A;  5ECR B;  4NPB A;  2H66 A;  4RUV A;  4ID0 A;  1E6B A;  3DKS A;  2VOC A;  2LRT A;  4YAV A;  4K7N A;  5DDL A;  3CSH A;  2WRT A;  3GX0 A;  3M9K A;  2A2R A;  3KH7 A;  3GIX A;  4JBB A;  5J4U A;  3EE2 A;  3O3T A;  1GUH A;  3KIJ A;  5IPH A;  4EDY A;  4MH2 A;  2FCH A;  3ZVJ D;  4WBR D;  1S3C A;  4LA1 A;  3HJP A;  3GH9 A;  2YOI A;  4ML1 A;  4ISD A;  5AIX A;  2DIY A;  3U5R E;  2WZ9 A;  2H76 A;  4POL A;  1EGO A;  3IAM 2;  1IYI A;  22GS A;  2CVD A;  2FWF A;  2LTK A;  5HR2 A;  1RQM A;  2OBI A;  1XW9 A;  3FY7 A;  4EVM A;  1YDK A;  4MK3 A;  1XFL A;  5A5K A;  4WR5 A;  4N0Z A;  2MYG A;  2Z9S A;  3CMI A;  2DJ2 A;  3BBY A;  1X5D A;  5D9W A;  2GT5 A;  4K0G A;  2CQ9 A;  5ENU A;  3GHA A;  2IPA A;  1FO5 A;  1OC9 A;  3DD3 A;  5J9B A;  1XCC A;  4EF0 A;  1F9M A;  3TJJ A;  1PRX A;  2IN3 A;  5F06 A;  2H01 A;  4GRF A;  1GSF A;  1Y25 A;  1M7T A;  4OMV A;  4GQC A;  3HJM A;  1PMT A;  2OAD A;  1ZL9 A;  3GUR A;  5G2Z A;  2RM5 A;  3ZTL A;  1PX6 A;  1OVN A;  3DIE A;  1SL2 B;  4KND A;  3L9V A;  3TOU A;  5KN3 A;  1EP7 A;  4KDX A;  1THO A;  2K8S A;  4QL7 A;  4L0W A;  3F4R A;  2H1B A;  2MMZ A;  1B9Y C;  3C1S A;  1X9S B;  3VUR A;  1N8J A;  4KAE A;  3SBC A;  2DJ0 A;  2C4J A;  1ERW A;  2N5B A;  4HI7 A;  1OC8 A;  5IOX A;  3VFI A;  4EO3 A;  3P7X A;  2K18 A;  3U6V A;  3DVX A;  3MDK A;  4ULX A;  4DEJ A;  3EUR A;  1I5G A;  1PKW A;  2C80 A;  1MDI A;  2XC2 A;  2JSY A;  1FB6 A;  1R5P A;  2C3T A;  1G6W A;  5E4W A;  4CW9 A;  1G7E A;  2NVL A;  3RHC A;  1XWC A;  1HNB A;  2P31 A;  17GS A;  4BVY A;  4DVC A;  5DCG A;  4K6X A;  4MJB A;  4MMM A;  4LMV A;  19GS A;  1AC1 A;  1V40 A;  2VM2 A;  3KCM A;  2AB6 A;  1K3O A;  2HYX A;  2FWH A;  2V6O A;  1BQ7 A;  1QK8 A;  5J3R A;  4EC0 A;  1SJ6 A;  3I69 A;  1YEX A;  3FYG A;  2HE3 A;  2VCW A;  5H5Q A;  12GS A;  2OE3 A;  4WXT A;  2B5X A;  1SJZ A;  1K0D A;  4N11 A;  3EYT A;  3LXZ A;  1EOG A;  1TRS A;  4TR4 A;  16GS A;  3A2V A;  1WIK A;  2DSA A;  4NMU A;  5DJM A;  4F2I A;  3LGC A;  3ZL5 A;  3Q18 A;  1J08 A;  2R6K A;  3UOM A;  3HYP A;  4IW9 A;  4POK A;  4KH7 A;  2CZ2 A;  2KP2 A;  5JWQ B;  2A2S A;  1O7U A;  3R2Q A;  3A2W A;  5CRG A;  3TRQ A;  5A4V A;  2O89 A;  2YJ7 A;  1ZGN A;  2YNX A;  3TKS C;  4IP1 A;  18GS A;  5D9X A;  1M2D A;  1XOA A;  4KGI A;  3APQ A;  3EVI A;  3IXR A;  3UBL A;  1F3A A;  1JZW A;  4XS1 A;  2JZT A;  4Q5Q A;  1W89 A;  2GDR A;  4ECI A;  2CAQ A;  2ZCT A;  2H0I A;  5CYY A;  1SD9 A;  1O73 A;  1TTZ A;  5G30 A;  1PL1 A;  1FG4 A;  1M2A A;  4KW6 A;  4EE0 A;  2DJJ A;  3F6F A;  5H5S A;  2FNO A;  4FIW A;  1YZX A;  1O8W A;  6GSX A;  13GS A;  1FB0 A;  2DML A;  3IA1 A;  2JL4 A;  4MJA A;  4GXZ A;  1AQV A;  4KX4 A;  4MF6 A;  3BOA A;  3CSJ A;  1B8X A;  3H4K A;  4KDU A;  1SYR A;  1V98 A;  3ZML A;  2WDU A;  2LKU A;  1YEP A;  1OC3 A;  2YPM A;  3FEU A;  5IMF A;  3W8J A;  2I3Y A;  3HZ4 A;  1JZD A;  3C73 A;  3QDN A;  2XPD A;  3HJO A;  2YV9 A;  5ABR A;  2C1Y A;  3WT1 A;  3EU4 A;  2YZU A;  2WB9 A;  3KGK A;  2C3N A;  2H6X A;  3KMN A;  1GWC A;  3ZFL A;  2RUE A;  2PVO C;  2XHF A;  4HJ2 A;  3FR3 A;  3ISO A;  2D2Z A;  5J5N A;  3FKF A;  4OCF A;  3N5O A;  2IME A;  2O8V B;  3KTL A;  3C8E A;  3M0F A;  3IAS 2;  2GZP A;  4OFM A;  3VK9 A;  2VAF A;  1G0T A;  4LL1 B;  2JAC A;  4YAP A;  5B8B A;  3KZQ A;  1TI1 A;  3DWV A;  4XS4 B;  3GH6 A;  2AHE A;  1SD8 A;  2V41 A;  1GTB A;  1GSQ A;  3ERF A;  1UA5 A;  4AGS A;  3WT2 A;  4I2T A;  4FYB A;  5CRW A;  3LG6 A;  1YY7 A;  4IKH A;  2OJL A;  2CT6 A;  4MZW A;  1F2E A;  2E2G A;  1DSB A;  5ELA A;  6GST A;  1XWB A;  2J23 A;  1MTC A;  2GST A;  4ZBA A;  1XWK A;  2H6Y A;  2X64 A;  1USB A;  4RQX A;  2CZ3 A;  1CQG A;  3MSZ A;  1X9W B;  2LV3 A;  3BCI A;  3TJG A;  2H30 A;  5G5F A;  3TRP A;  3FZ5 A;  1X5C A;  5KN0 A;  2ZUP A;  4MAB A;  1CQH A;  4ACS A;  1KEB A;  5CRE A;  3L4N A;  4TR3 A;  1AAZ A;  2VL2 C;  6GSY A;  2KP1 A;  3D6I A;  2N5A A;  4MZC A;  2L59 A;  3A3T A;  1HD2 A;  6GSU A;  1DBY A;  2CAI A;  1YKA A;  5AN1 A;  5ECK B;  4RI7 A;  2EIO A;  2A4V A;  4HQS A;  1WWJ A;  4I2U A;  4K2D A;  1T1V A;  3D22 A;  4GCI A;  3ZVJ A;  3C7M A;  3H8Q A;  1XVW A;  4ILF A;  5INY A;  1HQO A;  2VUP A;  5C00 A;  1A24 A;  2X8C A;  4AJ8 A;  2YJH A;  4OCE A;  2HZE A;  4PUA A;  3PR8 A;  4DSS A;  3OR5 A;  1VF1 A;  2LJA A;  2B7K A;  1KTE A;  1G6Y A;  4MPF A;  4XS4 A;  6GSV A;  2R2J A;  1ACV A;  4L5O A;  1GTI A;  1FAA A;  2TRX A;  2HRN A;  2IWT A;  4IQA A;  1MD4 A;  1B4Q A;  20GS A;  5F8B A;  2J9H A;  4J57 E;  1QQ2 A;  3CRU A;  3GTU B;  1J9B A;  3O76 A;  2H0G A;  5CO3 A;  3GV1 A;  5F0G A;  1EGR A;  4NAX A;  2FUG 2;  3UVH A;  3GKN A;  3KM6 A;  2K6V A;  3KXO A;  2F8F A;  3FZA A;  3HDC A;  3TKR A;  1LJR A;  3QAG A;  2FY6 A;  1TXX A;  3VPT A;  2HSH A;  5IO2 A;  1Z7P A;  1GUL A;  4F9Z A;  5F07 A;  4MPG A;  2YWN A;  5IPG A;  4FYU A;  2GQM A;  3A2X A;  3TKS E;  3KH9 A;  4XRD A;  1PQN A;  2PUK C;  2B6M A;  2C0F A;  5FT3 A;  3K8N A;  3F3Q A;  1GUM A;  4MF7 A;  4WR4 A;  2ON7 A;  5CAX A;  2DLX A;  1O85 A;  4JED A;  3I43 A;  3HD5 A;  3WD6 A;  3NOF A;  4LLR A;  1KNG A;  2WGR A;  1XBS A;  2V1M A;  1RW1 A;  2IL3 A;  1Z9H A;  3TJB A;  5ID2 B;  2ALB A;  1WMJ A;  1ILO A;  4ZL8 A;  4IGJ A;  1GNW A;  5CRH A;  3QPM A;  1EOH A;  4HS1 A;  4EL1 A;  4BA7 A;  1K0M A;  2YV7 A;  3TJF A;  2ES7 A;  3AY8 A;  3LQ7 A;  4D73 B;  5EY6 A;  4BWS A;  3F8U A;  1YF1 A;  5AIS A;  3I6A A;  4AJ7 A;  1JFU A;  4TN8 A;  2B1L A;  5IMC A;  4OO4 A;  1A23 A;  2OKA A;  3CSI A;  4MLY A;  3GTU A;  3D5J A;  2H6Z A;  1EEM A;  2HNL A;  3UAR A;  5JWR B;  2C3Q A;  2B1K A;  1ERV A;  2GQK A;  4JE1 A;  5D73 A;  3IBH A;  2E2M A;  5DCH A;  5GZZ B;  1FHE A;  2WFC A;  3G7J A;  2F3M A;  2PPT A;  3FZ9 A;  3ZYW A;  5CRD A;  3KJY A;  2VD1 A;  3DVW A;  4OD7 A;  2BMX A;  2FHE A;  4ZBD A;  4ZIJ A;  2AYT A;  3E3E A;  1YF0 A;  2VL9 A;  5FHI A;  3S9F A;  5D96 A;  4HU7 A;  2HLS A;  1SK1 A;  1T7P B;  4MJE A;  5GAP D;  1VF2 A;  8GSS A;  5ECS A;  1A8Y A;  2N5F A;  1M9B A;  1TRV A;  3PIN A;  5DVB A;  2I81 A;  1DE2 A;  3TGZ A;  2V2G A;  4HJM A;  2LUS A;  3ED3 A;  5ID2 A;  1H75 A;  3GFK A;  4DSR A;  3HCZ A;  2R4V A;  3GA4 A;  2PBJ A;  1Z6N A;  1PD2 1;  2MZC A;  4GF0 A;  2C0D A;  1TJD A;  5ECP B;  4RQR A;  1JHB A;  2LS5 A;  2GSQ A;  4TXO B;  3GSS A;  1J0F A;  2PWJ A;  4IBP A;  3I9V 2;  1T4Y A;  5A4U A;  1S3D A;  1ERU A;  3KEB A;  4D73 A;  4G2E A;  3J7Y k;  3TKP A;  3F63 A;  5LD0 A;  4HQZ A;  1GSY A;  2NDO A;  5JCU A;  5COH A;  3QAV A;  1I9D A;  1R4W A;  2OBK A;  5ECQ B;  2QSI A;  4KSM A;  2P5R A;  1XWG A;  4J56 E;  2RM6 A;  4H86 A;  2R3X A;  3FK8 A;  3HY2 A;  3LXT A;  4F0C A;  7GSS A;  2EIR A;  2DJ1 A;  3ERW A;  2KLX A;  2HZF A;  4WF4 A;  3SWL A;  1A2M A;  3APO A;  5HR1 A;  3M3M A;  5GST A;  3GX8 A;  1BG5 A;  3CYN A;  4IS0 A;  3ZFB A;  2HXK A;  3DYR A;  2KOK A;  5KEJ A;  1FVJ A;  5H5R A;  5E59 A;  1G7O A;  1PGT A;  2PVQ A;  3ME8 A;  4GTU A;  5EL8 A;  4O32 A;  1U6T A;  5IMA A;  3IHQ A;  3ZLP A;  1XOB A;  5KN2 A;  1A2L A;  1GUK A;  2FWG A;  2OE1 A;  3ZIV A;  2MMO A;  2JU5 A;  4HZ2 A;  3UJ1 A;  3DEX A;  2WJU A;  2IMK A;  4WF5 A;  1A0R P;  3O6T A;  5AIV A;  4ZBB A;  1WPI A;  3GKM A;  3ZMK A;  4ZXG A;  2P0G A;  5IQY A;  1YQ1 A;  2RLI A;  3GL3 A;  3ZRE A;  3QFB C;  5HQP A;  1M2B A;  1T4Z A;  1BED A;  2EC4 A;  5G1L A;  2AUV A;  1ON4 A;  3LJR A;  3RAZ A;  3D21 A;  6GSS A;  3F9U A;  2TRC P;  3W6G A;  4FO5 A;  4L0U A;  4BVX A;  4TXO A;  3M9J A;  3CRT A;  2VLV A;  3KMO A;  6GSW A;  1WOU A;  1F6M C;  2WUL A;  4KCE A;  2VIM A;  2V32 A;  2LJK A;  1K0N A;  1ZZY A;  3CTF A;  2B7J A;  4EUY A;  5EPF A;  2XBQ A;  2H1G A;  5ECH B;  1F37 A;  1SK0 A;  1TP9 A;  2NPB A;  2WS2 A;  1XZO A;  5HR3 A;  1O81 A;  3EC3 A;  3US3 A;  1ZYE A;  3GST A;  1OKD A;  4HEA 2;  4V1A p;  4TKY A;  2L5O A;  1SJI A;  2GLR A;  4IHU A;  3MWH A;  3KP9 A;  5C04 A;  3RPN A;  4JU5 A;  1T3B A;  1KBN A;  1M0U A;  1A2J A;  1GSS A;  1SL0 B;  4OO5 A;  2HZE B;  3APS A;  4V2M A;  4G9H A;  4DSS B;  3UEM A;  3MAK A;  4KUN A;  2AJQ B;  1AUC A;  5LNK e;  4JR6 A;  1TW9 A;  2VLT A;  3W8S A;  2LNS A;  3KP8 A;  3F0I A;  3BCK A;  4WKW A;  4YQV A;  1WP0 A;  4NHZ A;  3HZ8 A;  10GS A;  2LRN A;  5EVO A;  2GVP A;  4IEL A;  1O6J A;  1Q98 A;  2OAC A;  2IMD A;  1UC7 A;  4IN0 A;  2IFQ B;  1K0C A;  5ECI B;  2GS3 A;  2H74 A;  2IMI A;  4IJI A;  4F03 A;  4GSS A;  11GS A;  4LL4 B;  4P3Y B;  1GLQ A;  2M80 A;  2VLU A;  1X9M B;  1ST9 A;  2FWE A;  2OE0 A;  2TIR A;  1RK4 A;  1M9A A;  2AV4 A;  2JSZ A;  4X1U A;  2L6D A;  4HDE A;  3QFA C;  1PA3 A;  3GKX A;  3LYK A;  2YZH A;  3QOU A;  5CP1 A;  2GSS A;  3EMX A;  1V9W A;  2HT9 A;  3GNJ A;  3KTB A;  3IRA A;  1XVQ A;  1A8L A;  2CX4 A;  3JCM L;  1K0O A;  1F3B A;  1YJ6 A;  3ZRD A;  1EEJ A;  4XRA A;  4ECC A;  1SK2 A;  3ZIT A;  3E9J B;  2CVB A;  2E0Q A;  4K1F A;  1EZK A;  4NHW A;  1JLV A;  2BJX A;  2HSY A;  2JAD A;  3GKK A;  3QAW A;  2RUF A;  3TB2 A;  2B5Y A;  3VPQ A;  4KA0 A;  2LQQ A;  1K0B A;  1K0A A;  3FR9 A;  4N0V A;  3L0H A;  3DRN A;  3QR6 A;  1ML6 A;  4G19 A;  3P8W A;  2VCQ A;  1GL8 A;  1QMV A;  4MCU A;  3HVX A;  1EV4 A;  1SL1 B;  1MD3 A;  4I8B A;  4F82 A;  2QC7 A;  1QGV A;  1B48 A;  1V57 A;  4HZ4 A;  1WRY A;  2VO4 A;  4EXJ A;  3WGX A;  2IJY A;  2IFQ A;  1EP8 A;  3ME7 A;  1AXD A;  3QMX A;  5DAL B;  3VI7 A;  4OWY A;  5ECN B;  2X8G A;  3BJ5 A;  1UN2 A;  2GZZ A;  3L78 A;  3F4T A;  3UVT A;  1V58 A;  3RHB A;  4ML6 A;  3LFL A;  4K7I A;  1V2A A;  3FR6 A;  4POM A;  4TOP A;  3WGE A;  4EKZ A;  2MMA A;  4ECJ A;  1ZCP A;  2CX3 A;  4E8H A;  1GRX A;  2HI7 A;  2NTO A;  1LU4 A;  4KSO A;  3M1G A;  4K0N A;  1LBK A;  2P5Q A;  3L9U A;  3HVS A;  1QUW A;  3VWW A;  3F4S A;  1OE8 A;  4ZL7 A;  1R5A A;  2QKE A;  5IOW A;  2G2Q A;  2VCZ A;  3LEF A;  4TR1 B;  5DAK B;  2DJK A;  2LNT A;  1JZR A;  1M99 A;  3EU3 A;  2O85 A;  5B7C A;  3V1W A;  1BAY A;  4BWQ A;  4BPY A;  1MDK A;  2IIY A;  4G10 A;  3VWX A;  1AQW A;  1QFN A;  1THX A;  3UBK A;  1SEN A;  2H1D A;  2YN1 A;  2KUC A;  5LCZ A;  2R37 A;  4PXO A;  5G1K A;  1Z5Y E;  3GN3 A;  1JZO A;  3D4M A;  5IMD A;  4IJ3 A;  4XIH A;  4TR0 A;  2FA8 A;  3PH9 A;  4NWY A;  3HVV A;  3VI5 A;  9GSS A;  1SU9 A;  4O5R A;  3EIN A;  5L71 A;  4K8M A;  2FD3 A;  1TRW A;  2OA7 A;  4JR4 A;  1DUG A;  3GUS A;  1FVK A;  1Z3E A;  3UIW A;  2GT6 A;  2L57 A;  3ZIJ A;  2PGT A;  3IR4 A;  5D9T A;  2YP6 A;  3IK9 A;  4O92 A;  2JZR A;  1C72 A;  2PER A;  2FLS A;  3M8N A;  2I4A A;  5DAL A;  3DXB A;  4BL7 A;  1SYX A;  3G7I A;  4TRX A;  1OYJ A;  3GL5 A;  1NHY A;  2F51 A;  3FHK A;  3IPZ A;  2EIQ A;  4QQ7 A;  4JZQ A;  1T8E B;  2LST A;  2VCT A;  1T00 A;  5HFI A;  4GQF A;  5ECO B;  3TOT A;  2CV4 A;  4V1A g;  1WJK A;  1WE0 A;  5KN1 A;  2HRF A;  3H79 A;  3F6D A;  1TK8 B;  4HUA A;  1SKR B;  1PSQ A;  5ELG A;  3NZN A;  2M46 A;  2B3S A;  4TR1 A;  4GST A;  5DAK A;  2YWO A; 
#chains in the Genus database with same CATH topology
 5IMV A;  4WEY A;  4CHS A;  1VRS D;  5D8I A;  4KB3 A;  2X8H A;  3CXG A;  3VWU A;  5J41 A;  3VWV A;  3Q74 A;  1GTU A;  4GSN A;  4FQU A;  5DQY A;  4X0X A;  2H8L A;  2PU9 C;  5GSS A;  3D4T A;  2L4Q A;  1A0F A;  1BX9 A;  4N10 A;  3KD0 A;  2DJ3 A;  2GZY A;  1YKC A;  1NSW A;  4ZB9 A;  3GRX A;  1ZMA A;  3RBT A;  2O7K A;  5DJL A;  2K8V A;  4KE3 A;  1GSU A;  2BTO T;  4K7O A;  5ECM B;  3RDW A;  3TKS A;  5HR0 A;  3R3E A;  2O87 A;  4ZL9 A;  4FYC A;  4PNF A;  2YWM A;  3CBU A;  4PGT A;  3IDV A;  2H1A A;  4IP6 A;  2LEG A;  1BYE A;  1U3A A;  2MMN A;  1AW9 A;  1QXH A;  5IM9 A;  4MJC A;  3HXS A;  2LJR A;  4NXI A;  2E7P A;  4DSQ A;  1VF4 A;  4O5U A;  3LOR A;  4IVF A;  1IYH A;  2C0E A;  5AGY A;  1W4V A;  4XTS A;  3G9B A;  2NBS A;  4Z7X A;  4IQ1 A;  2YCD A;  2YWI A;  1EV9 A;  2FGX A;  1X5E A;  2VM1 A;  3IC8 A;  3E0U A;  2AAW A;  4I5Q A;  1XXU A;  1TDI A;  2VCX A;  2DBC A;  4L5L A;  1U87 A;  2MBS A;  2H73 A;  1X0R A;  1GP1 A;  1UVZ A;  4PUR A;  3HHV A;  3DML A;  1Q4J A;  1Z7R A;  5IMZ A;  1BJX A;  2YAN A;  5ECL B;  4MH3 A;  2PN8 A;  5D93 A;  4MDC A;  4FH8 A;  2DKI A;  4XCS A;  3UMA A;  4AJ6 A;  1B4P A;  3IHG A;  2H70 A;  2DIZ A;  3C71 A;  4WET A;  3LYP A;  3TKQ A;  1XW6 A;  1PL2 A;  1VGL A;  3DGQ A;  2C8U A;  1U88 A;  3F3R A;  5G5E A;  3PGT A;  2C0G A;  4XHM A;  3P90 A;  3EWL A;  3TJK A;  3G7Y A;  1XWA A;  4YQU A;  5F05 A;  1Y6E A;  1GNE A;  3EMP A;  1R7H A;  4YH2 A;  1S3A A;  3IC4 A;  1TK5 B;  1SKW B;  2FA4 A;  14GS A;  2M72 A;  3TRX A;  2L5L A;  3FRC A;  5CNW A;  2H71 A;  3FW2 A;  3IE3 A;  4MP4 A;  1XW5 A;  4F0B A;  4AF2 A;  5JCG A;  5G31 A;  3H93 A;  5D9V A;  1MDJ A;  1TI3 A;  1E2Y A;  2CVK A;  5GAN D;  1JLW A;  2X99 A;  1FOV A;  3H1N A;  5HFG A;  3N9J A;  4HSC X;  2R5G A;  5DBQ A;  4QL9 A;  1O8X A;  4TXV A;  2F8A A;  4I6X A;  2REM A;  1XPV A;  4PNG A;  1OAZ A;  2GSR A;  1HNA A;  4KDY A;  1TU8 A;  4MA9 A;  2LQO A;  4Q5R A;  1SKS B;  2JZS A;  4POB A;  3GMF A;  4X43 A;  2K9F A;  4WBJ A;  1PX7 A;  5FWG A;  2VL2 A;  4ZB8 A;  1ZOF A;  3D0Z A;  1VF3 A;  1U3I A;  4L8E A;  4PX1 A;  2G0F A;  1M3J A;  1GSE A;  2DMM A;  2VL3 A;  2ON5 A;  3Q6O A;  4EDZ A;  2F9S A;  2H0H A;  2ZNM A;  4YQM A;  5IO0 A;  1NHO A;  1OKT A;  3ERG A;  5KOX A;  4K9Z A;  2I9H A;  3CTG A;  1GTA A;  1ABA A;  2CA8 A;  4TVE A;  4LMW A;  2WCI A;  1B9X C;  3NIV A;  4GLT A;  1R26 A;  3IV4 A;  1URM A;  1ZYQ B;  5J9C A;  1K3L A;  2H19 A;  4V2L A;  4EIP A;  1HNC A;  5HFK A;  5JCW A;  2VCV A;  1HYU A;  2XBI A;  2A2P A;  3P2A A;  4O7H A;  1PFO A;  2L4C A;  3TDG A;  4KCA A;  1NM3 A;  4V2N A;  3GYK A;  5BRT A;  1TKD B;  1EWX A;  4ECB A;  4HOJ A;  3BD2 A;  2LRC A;  4MZB A;  4I97 A;  5B6N A;  4JRR A;  1FW1 A;  3Q19 A;  5A4W A;  1GLP A;  1N2A A;  3VLN A;  4N30 A;  3FZ4 A;  4HU9 A;  4USS A;  3L9S A;  1XIY A;  3LWA A;  2V6K A;  3TCO A;  3IOS A;  4CDO A;  4YKF A;  1TU7 A;  4PQH A;  1PKZ A;  1H4O A;  4XS6 A;  4ZIL A;  3TUE A;  3QCP A;  4E8E A;  3HVN A;  4Q5F A;  3A5W A;  4PQ1 A;  5JWO B;  2VD0 A;  4Q5N A;  3IK7 A;  2KHP A;  3MNG A;  1TRU A;  1TOF A;  1MEK A;  2DC5 A;  1Z6M A;  2GQL A;  3RPP A;  2B5E A;  4BIK A;  4TW5 A;  2H72 A;  1GSD A;  4MF5 A;  3HKR A;  2MBT A;  2DKH A;  1DE1 A;  3J7Y b;  1K3Y A;  2PMT A;  5B8A A;  3UAP A;  3WYW A;  2IMF A;  2XPE A;  1OE7 A;  2L6C A;  4PUF C;  4OFT A;  3QD9 A;  1GH2 A;  1OC9 B;  2GTU A;  1ERT A;  3HA9 A;  5DQS A;  1AIU A;  3PPU A;  2RII A;  1NW2 A;  3UL3 A;  5IIZ A;  1TK0 B;  4OFN A;  2H75 A;  4PQI A;  3C1R A;  2GGT A;  2R0C A;  1PN9 A;  3WGD A;  2I1U A;  4GWR A;  1AQX A;  4ZB6 A;  4NV2 A;  4NV5 A;  5B6M A;  2QGV A;  4RI6 A;  4J2F A;  3LSZ A;  3ZZX A;  2HFD A;  5ECR B;  4NPB A;  2H66 A;  4RUV A;  4ID0 A;  1E6B A;  3DKS A;  2VOC A;  2LRT A;  4YAV A;  4K7N A;  5DDL A;  3CSH A;  2WRT A;  3GX0 A;  3M9K A;  2A2R A;  3KH7 A;  3GIX A;  4JBB A;  5J4U A;  3EE2 A;  3O3T A;  1GUH A;  3KIJ A;  5IPH A;  4EDY A;  4MH2 A;  2FCH A;  3ZVJ D;  4WBR D;  1S3C A;  4LA1 A;  3HJP A;  3GH9 A;  2YOI A;  4ML1 A;  4ISD A;  5AIX A;  2DIY A;  3U5R E;  2WZ9 A;  2H76 A;  4POL A;  1EGO A;  3IAM 2;  1IYI A;  22GS A;  2CVD A;  4BVY B;  2FWF A;  2LTK A;  5HR2 A;  1RQM A;  2OBI A;  1XW9 A;  3FY7 A;  4Z2U A;  3CQF A;  4EVM A;  4KF9 A;  2QA2 A;  1YDK A;  4MK3 A;  1XFL A;  5A5K A;  4WR5 A;  4N0Z A;  2MYG A;  2Z9S A;  3CMI A;  2DJ2 A;  3BBY A;  1X5D A;  5D9W A;  2GT5 A;  4K0G A;  2CQ9 A;  5ENU A;  3GHA A;  2IPA A;  1FO5 A;  1OC9 A;  3DD3 A;  5J9B A;  1XCC A;  4EF0 A;  1F9M A;  3TJJ A;  1PRX A;  2IN3 A;  5F06 A;  2H01 A;  4GRF A;  1GSF A;  1Y25 A;  1M7T A;  4OMV A;  4GQC A;  3HJM A;  1PMT A;  2OAD A;  1ZL9 A;  3GUR A;  5G2Z A;  2RM5 A;  3ZTL A;  1PX6 A;  1OVN A;  3DIE A;  1SL2 B;  4KND A;  3L9V A;  3TOU A;  5KN3 A;  1EP7 A;  4KDX A;  1THO A;  2K8S A;  4QL7 A;  4L0W A;  3F4R A;  2H1B A;  2MMZ A;  1B9Y C;  3C1S A;  1X9S B;  3VUR A;  1N8J A;  4KAE A;  3SBC A;  2DJ0 A;  2C4J A;  1ERW A;  2N5B A;  4HI7 A;  1OC8 A;  5IOX A;  3VFI A;  4EO3 A;  3P7X A;  2K18 A;  3U6V A;  3DVX A;  3MDK A;  4ULX A;  4DEJ A;  3EUR A;  4G0K A;  1I5G A;  1PKW A;  2C80 A;  1MDI A;  2XC2 A;  2JSY A;  1FB6 A;  1R5P A;  2C3T A;  1G6W A;  5E4W A;  4CW9 A;  4EIQ A;  1G7E A;  2NVL A;  3RHC A;  1XWC A;  1HNB A;  2P31 A;  17GS A;  4BVY A;  4DVC A;  4YKG A;  5DCG A;  4K6X A;  4MJB A;  4MMM A;  4LMV A;  19GS A;  1AC1 A;  1V40 A;  2VM2 A;  3KCM A;  2AB6 A;  2UZ8 A;  1K3O A;  2HYX A;  2FWH A;  2V6O A;  1BQ7 A;  1QK8 A;  5J3R A;  4EC0 A;  1SJ6 A;  3I69 A;  1YEX A;  3FYG A;  2HE3 A;  2VCW A;  5H5Q A;  12GS A;  2OE3 A;  4WXT A;  2B5X A;  1SJZ A;  1K0D A;  4N11 A;  3EYT A;  3LXZ A;  1EOG A;  1TRS A;  4TR4 A;  16GS A;  3A2V A;  1WIK A;  2DSA A;  4NMU A;  5DJM A;  4F2I A;  1PN0 A;  3LGC A;  3ZL5 A;  3Q18 A;  1J08 A;  2R6K A;  3UOM A;  3HYP A;  4IW9 A;  4POK A;  4KH7 A;  2CZ2 A;  2KP2 A;  5JWQ B;  2A2S A;  1O7U A;  3R2Q A;  3A2W A;  5CRG A;  3TRQ A;  5A4V A;  2O89 A;  2YJ7 A;  1ZGN A;  2YNX A;  3TKS C;  4PTS A;  4IP1 A;  18GS A;  5D9X A;  1M2D A;  1XOA A;  4KGI A;  3APQ A;  3EVI A;  4K5S A;  3IXR A;  3UBL A;  1F3A A;  1JZW A;  4XS1 A;  2JZT A;  4Q5Q A;  1W89 A;  2GDR A;  4ECI A;  2CAQ A;  2ZCT A;  2H0I A;  5CYY A;  1SD9 A;  1O73 A;  1TTZ A;  5G30 A;  1PL1 A;  4K5R A;  1FG4 A;  1M2A A;  4KW6 A;  4EE0 A;  2DJJ A;  3F6F A;  5H5S A;  2FNO A;  4FIW A;  1YZX A;  1O8W A;  2X49 A;  6GSX A;  13GS A;  1FB0 A;  2DML A;  3IA1 A;  1FOH A;  2JL4 A;  4MJA A;  4GXZ A;  1AQV A;  4KX4 A;  4MF6 A;  3BOA A;  3CSJ A;  1B8X A;  3H4K A;  4KDU A;  1SYR A;  1V98 A;  3ZML A;  2WDU A;  2LKU A;  1YEP A;  1OC3 A;  2YPM A;  3FEU A;  5IMF A;  3W8J A;  2I3Y A;  3HZ4 A;  1JZD A;  3C73 A;  3QDN A;  2XPD A;  3HJO A;  2YV9 A;  5ABR A;  2HRK A;  2C1Y A;  3WT1 A;  3EU4 A;  2YZU A;  2WB9 A;  3KGK A;  2C3N A;  2H6X A;  3KMN A;  1GWC A;  3ZFL A;  2RUE A;  2PVO C;  2XHF A;  4HJ2 A;  3FR3 A;  3ISO A;  2D2Z A;  5J5N A;  3FKF A;  1S3R A;  4OCF A;  3N5O A;  2IME A;  2O8V B;  3KTL A;  3C8E A;  3M0F A;  3IAS 2;  2GZP A;  4OFM A;  3VK9 A;  2VAF A;  1G0T A;  4LL1 B;  2JAC A;  4YAP A;  5B8B A;  3KZQ A;  1TI1 A;  3DWV A;  4XS4 B;  3GH6 A;  2AHE A;  1SD8 A;  2V41 A;  1GTB A;  1GSQ A;  3ERF A;  1UA5 A;  4AGS A;  3WT2 A;  4I2T A;  4FYB A;  5CRW A;  3LG6 A;  1YY7 A;  4IKH A;  2OJL A;  2CT6 A;  4MZW A;  1F2E A;  2E2G A;  1DSB A;  5ELA A;  6GST A;  1XWB A;  2J23 A;  1MTC A;  2GST A;  4ZBA A;  1XWK A;  2H6Y A;  2X64 A;  1USB A;  4RQX A;  2CZ3 A;  4X4J A;  1CQG A;  3MSZ A;  1X9W B;  2LV3 A;  3BCI A;  3TJG A;  2H30 A;  5G5F A;  3TRP A;  3FZ5 A;  1X5C A;  5KN0 A;  2ZUP A;  4MAB A;  1CQH A;  4ACS A;  1KEB A;  5CRE A;  3L4N A;  4TR3 A;  1AAZ A;  2VL2 C;  6GSY A;  2KP1 A;  3D6I A;  2N5A A;  4MZC A;  2L59 A;  3A3T A;  1HD2 A;  6GSU A;  1DBY A;  2CAI A;  1YKA A;  5AN1 A;  5ECK B;  4RI7 A;  2EIO A;  2A4V A;  4HQS A;  1WWJ A;  4I2U A;  4K2D A;  1T1V A;  3D22 A;  4GCI A;  3ZVJ A;  3C7M A;  3H8Q A;  1XVW A;  4ILF A;  5INY A;  1HQO A;  2VUP A;  5C00 A;  1A24 A;  2X8C A;  4AJ8 A;  2YJH A;  4OCE A;  2HZE A;  4PUA A;  3PR8 A;  4DSS A;  3OR5 A;  1VF1 A;  2LJA A;  1M3I A;  2B7K A;  1KTE A;  1G6Y A;  4MPF A;  4XS4 A;  6GSV A;  1ZYN A;  2R2J A;  1ACV A;  4L5O A;  5KOW A;  1GTI A;  1FAA A;  2TRX A;  2HRN A;  2IWT A;  4IQA A;  1MD4 A;  4A5P A;  1B4Q A;  2HRA A;  20GS A;  5F8B A;  2J9H A;  4J57 E;  1QQ2 A;  3CRU A;  3GTU B;  1J9B A;  3O76 A;  3FMW A;  2H0G A;  5CO3 A;  3GV1 A;  5F0G A;  1EGR A;  4NAX A;  2FUG 2;  3UVH A;  3GKN A;  3KM6 A;  2K6V A;  3KXO A;  2F8F A;  3FZA A;  1ZYP A;  3HDC A;  3TKR A;  1LJR A;  3QAG A;  2FY6 A;  4ICY A;  1TXX A;  3VPT A;  2HSH A;  5IO2 A;  1Z7P A;  1GUL A;  4F9Z A;  5F07 A;  4MPG A;  2YWN A;  5IPG A;  4FYU A;  2GQM A;  3A2X A;  3TKS E;  3KH9 A;  4XRD A;  1PQN A;  2PUK C;  2B6M A;  2C0F A;  5FT3 A;  3K8N A;  3F3Q A;  1GUM A;  4O5Q A;  4MF7 A;  4WR4 A;  2ON7 A;  5CAX A;  2DLX A;  1O85 A;  4JED A;  3I43 A;  3HD5 A;  3WD6 A;  3NOF A;  4LLR A;  1KNG A;  2WGR A;  1XG8 A;  1XBS A;  2V1M A;  1RW1 A;  2IL3 A;  1Z9H A;  3TJB A;  5ID2 B;  2ALB A;  1WMJ A;  1ILO A;  4ZL8 A;  4IGJ A;  1GNW A;  5CRH A;  3QPM A;  4G0I A;  1EOH A;  4HS1 A;  4EL1 A;  4BA7 A;  1K0M A;  2YV7 A;  3TJF A;  2ES7 A;  3AY8 A;  3LQ7 A;  4D73 B;  5EY6 A;  4BWS A;  3F8U A;  1YF1 A;  5AIS A;  3I6A A;  4AJ7 A;  1JFU A;  4TN8 A;  2B1L A;  5IMC A;  4OO4 A;  1A23 A;  2OKA A;  3CSI A;  4MLY A;  3GTU A;  3D5J A;  2H6Z A;  1EEM A;  2HNL A;  2A4H A;  3UAR A;  5JWR B;  2C3Q A;  2B1K A;  1ERV A;  2GQK A;  4JE1 A;  5D73 A;  3IBH A;  2E2M A;  5DCH A;  5GZZ B;  1FHE A;  2WFC A;  3G7J A;  2F3M A;  2PPT A;  3FZ9 A;  3ZYW A;  5CRD A;  3KJY A;  2VD1 A;  3DVW A;  4OD7 A;  2BMX A;  2FHE A;  4ZBD A;  4ZIJ A;  2AYT A;  3E3E A;  1YF0 A;  2VL9 A;  5FHI A;  3S9F A;  5D96 A;  4HU7 A;  2HLS A;  1SK1 A;  1T7P B;  4MJE A;  5GAP D;  1VF2 A;  8GSS A;  5ECS A;  1A8Y A;  2N5F A;  1M9B A;  1TRV A;  3PIN A;  5DVB A;  2I81 A;  1DE2 A;  3TGZ A;  2V2G A;  4HJM A;  2LUS A;  3ED3 A;  5ID2 A;  1H75 A;  3GFK A;  4DSR A;  3HCZ A;  2R4V A;  3GA4 A;  2PBJ A;  1Z6N A;  1PD2 1;  3EPT A;  2MZC A;  4GF0 A;  2C0D A;  1TJD A;  5ECP B;  4RQR A;  1JHB A;  2LS5 A;  2GSQ A;  4K2X A;  4BVX B;  4TXO B;  3GSS A;  1J0F A;  2PWJ A;  4IBP A;  3I9V 2;  1T4Y A;  5A4U A;  1S3D A;  1ERU A;  3KEB A;  4D73 A;  4G2E A;  3J7Y k;  3TKP A;  3F63 A;  5LD0 A;  4HQZ A;  1GSY A;  2NDO A;  5JCU A;  5COH A;  3QAV A;  1I9D A;  1R4W A;  2OBK A;  5ECQ B;  2QSI A;  4KSM A;  2P5R A;  1XWG A;  3MYD A;  4J56 E;  2RM6 A;  4H86 A;  2R3X A;  3FK8 A;  3HY2 A;  3LXT A;  4F0C A;  7GSS A;  2EIR A;  2DJ1 A;  3ERW A;  2KLX A;  4CY8 A;  2HZF A;  3A5I A;  4WF4 A;  3SWL A;  1A2M A;  3APO A;  5HR1 A;  3M3M A;  5GST A;  3GX8 A;  1BG5 A;  3CYN A;  4IS0 A;  3ZFB A;  2HXK A;  3DYR A;  2KOK A;  5KEJ A;  1FVJ A;  5H5R A;  5E59 A;  1G7O A;  3LW9 A;  1PGT A;  2PVQ A;  3ME8 A;  4GTU A;  5EL8 A;  2X4A A;  4O32 A;  1U6T A;  5IMA A;  3IHQ A;  3ZLP A;  1XOB A;  5KN2 A;  1A2L A;  1GUK A;  2FWG A;  2OE1 A;  3ZIV A;  2MMO A;  2JU5 A;  4HZ2 A;  3UJ1 A;  3DEX A;  2WJU A;  2IMK A;  4WF5 A;  1A0R P;  3O6T A;  5AIV A;  4ZBB A;  1WPI A;  3GKM A;  3ZMK A;  4ZXG A;  2P0G A;  5IQY A;  1YQ1 A;  2RLI A;  3GL3 A;  3ZRE A;  3QFB C;  5HQP A;  1M2B A;  1T4Z A;  1BED A;  2EC4 A;  5G1L A;  2AUV A;  1ON4 A;  3LJR A;  3RAZ A;  3D21 A;  6GSS A;  3F9U A;  2TRC P;  3W6G A;  4FO5 A;  4L0U A;  4BVX A;  4TXO A;  3M9J A;  3CRT A;  2VLV A;  3KMO A;  6GSW A;  1WOU A;  1F6M C;  2WUL A;  4KCE A;  2VIM A;  2V32 A;  2LJK A;  1K0N A;  1ZZY A;  3CTF A;  2B7J A;  4EUY A;  5EPF A;  2XBQ A;  2H1G A;  5ECH B;  1F37 A;  1SK0 A;  1TP9 A;  2NPB A;  2WS2 A;  1XZO A;  5HR3 A;  1O81 A;  3EC3 A;  3US3 A;  1ZYE A;  3GST A;  1OKD A;  4HEA 2;  4V1A p;  4TKY A;  2L5O A;  1SJI A;  2GLR A;  4IHU A;  3MWH A;  3KP9 A;  5C04 A;  3RPN A;  4JU5 A;  1T3B A;  1KBN A;  1M0U A;  1A2J A;  1GSS A;  1SL0 B;  4OO5 A;  2HZE B;  3APS A;  4V2M A;  4G9H A;  4DSS B;  3UEM A;  3MAK A;  4KUN A;  2AJQ B;  1AUC A;  5LNK e;  4JR6 A;  1TW9 A;  2VLT A;  3W8S A;  2LNS A;  4Z2T A;  3KP8 A;  3F0I A;  3BCK A;  4WKW A;  4YQV A;  1WP0 A;  4NHZ A;  3HZ8 A;  10GS A;  2LRN A;  2R0G A;  5EVO A;  2GVP A;  4IEL A;  1O6J A;  1Q98 A;  2OAC A;  2IMD A;  1UC7 A;  4IN0 A;  2IFQ B;  1K0C A;  5ECI B;  2GS3 A;  2H74 A;  2IMI A;  4IJI A;  4F03 A;  4GSS A;  11GS A;  4LL4 B;  4P3Y B;  1GLQ A;  2M80 A;  2VLU A;  1X9M B;  1ST9 A;  2FWE A;  2OE0 A;  2TIR A;  1RK4 A;  1M9A A;  2AV4 A;  2JSZ A;  4X1U A;  2L6D A;  4HDE A;  3QFA C;  1PA3 A;  3GKX A;  3LYK A;  2YZH A;  3QOU A;  5CP1 A;  2GSS A;  3EMX A;  1V9W A;  2HT9 A;  3GNJ A;  3KTB A;  3IRA A;  1XVQ A;  1A8L A;  2CX4 A;  3JCM L;  1K0O A;  1F3B A;  1YJ6 A;  3ZRD A;  1EEJ A;  4XRA A;  4ECC A;  1SK2 A;  3ZIT A;  3E9J B;  2CVB A;  2E0Q A;  4K1F A;  1EZK A;  4NHW A;  1JLV A;  2BJX A;  2HSY A;  2JAD A;  3GKK A;  3QAW A;  2RUF A;  3TB2 A;  2B5Y A;  3VPQ A;  4KA0 A;  2LQQ A;  1K0B A;  1K0A A;  3FR9 A;  4N0V A;  3L0H A;  4CY6 A;  3DRN A;  3QR6 A;  1ML6 A;  4G19 A;  3P8W A;  2VCQ A;  1GL8 A;  1QMV A;  4MCU A;  3HVX A;  1EV4 A;  1SL1 B;  1MD3 A;  4I8B A;  4F82 A;  2QC7 A;  1QGV A;  1B48 A;  1V57 A;  4HZ4 A;  1WRY A;  2VO4 A;  4EXJ A;  3WGX A;  2IJY A;  2IFQ A;  1EP8 A;  3ME7 A;  1AXD A;  3QMX A;  5DAL B;  3VI7 A;  4BL7 B;  4OWY A;  5ECN B;  2X8G A;  3BJ5 A;  1UN2 A;  2GZZ A;  3L78 A;  3F4T A;  3UVT A;  1V58 A;  3RHB A;  4ML6 A;  3LFL A;  4K7I A;  1V2A A;  3FR6 A;  4POM A;  4TOP A;  3WGE A;  4EKZ A;  2MMA A;  4ECJ A;  1ZCP A;  2CX3 A;  4E8H A;  1GRX A;  2HI7 A;  2NTO A;  1LU4 A;  2R0P A;  4KSO A;  3M1G A;  4K0N A;  1LBK A;  2P5Q A;  3L9U A;  3HVS A;  1QUW A;  3VWW A;  3F4S A;  1OE8 A;  4ZL7 A;  1R5A A;  2QKE A;  5IOW A;  2G2Q A;  2VCZ A;  3LEF A;  4TR1 B;  5DAK B;  2DJK A;  2LNT A;  1JZR A;  1M99 A;  3EU3 A;  2O85 A;  5B7C A;  3V1W A;  1BAY A;  4BWQ A;  4BPY A;  1MDK A;  2IIY A;  4G10 A;  3VWX A;  1AQW A;  1QFN A;  1THX A;  3UBK A;  1SEN A;  2H1D A;  2YN1 A;  2KUC A;  4G0L A;  5LCZ A;  2R37 A;  4PXO A;  5G1K A;  1Z5Y E;  3GN3 A;  1JZO A;  3D4M A;  5IMD A;  4IJ3 A;  4XIH A;  4TR0 A;  2FA8 A;  3PH9 A;  4NWY A;  3HVV A;  3VI5 A;  2HSM A;  9GSS A;  1SU9 A;  4O5R A;  3EIN A;  5L71 A;  4K8M A;  2FD3 A;  1TRW A;  2OA7 A;  4JR4 A;  1DUG A;  3GUS A;  1FVK A;  1Z3E A;  3UIW A;  2GT6 A;  2L57 A;  3ZIJ A;  2PGT A;  3IR4 A;  5D9T A;  2YP6 A;  3IK9 A;  5BMU A;  4O92 A;  2JZR A;  1C72 A;  2PER A;  2FLS A;  3M8N A;  2I4A A;  5DAL A;  3DXB A;  4BL7 A;  4MNN A;  1SYX A;  3G7I A;  4TRX A;  1OYJ A;  3MIX A;  3GL5 A;  1NHY A;  2F51 A;  3FHK A;  3IPZ A;  2EIQ A;  4QQ7 A;  4JZQ A;  1T8E B;  2LST A;  2VCT A;  1T00 A;  5HFI A;  4GQF A;  5ECO B;  3TOT A;  2CV4 A;  4V1A g;  1WJK A;  1WE0 A;  5KN1 A;  2HRF A;  3H79 A;  3F6D A;  4Z2R A;  1TK8 B;  4HUA A;  1SKR B;  1PSQ A;  5ELG A;  2QA1 A;  3NZN A;  2M46 A;  2B3S A;  4TR1 A;  4GST A;  5DAK A;  2YWO A; 
#chains in the Genus database with same CATH homology
 5IMV A;  4WEY A;  4CHS A;  1VRS D;  5D8I A;  4KB3 A;  2X8H A;  3CXG A;  3VWU A;  5J41 A;  3VWV A;  3Q74 A;  1GTU A;  4GSN A;  4FQU A;  5DQY A;  4X0X A;  2H8L A;  2PU9 C;  5GSS A;  3D4T A;  2L4Q A;  1A0F A;  1BX9 A;  4N10 A;  3KD0 A;  2DJ3 A;  2GZY A;  1YKC A;  1NSW A;  4ZB9 A;  3GRX A;  1ZMA A;  3RBT A;  2O7K A;  5DJL A;  2K8V A;  4KE3 A;  1GSU A;  2BTO T;  4K7O A;  5ECM B;  3RDW A;  3TKS A;  5HR0 A;  3R3E A;  2O87 A;  4ZL9 A;  4FYC A;  4PNF A;  2YWM A;  3CBU A;  4PGT A;  3IDV A;  2H1A A;  4IP6 A;  2LEG A;  1BYE A;  1U3A A;  2MMN A;  1AW9 A;  1QXH A;  5IM9 A;  4MJC A;  3HXS A;  2LJR A;  4NXI A;  2E7P A;  4DSQ A;  1VF4 A;  4O5U A;  3LOR A;  4IVF A;  1IYH A;  2C0E A;  5AGY A;  1W4V A;  4XTS A;  3G9B A;  2NBS A;  4Z7X A;  4IQ1 A;  2YCD A;  2YWI A;  1EV9 A;  2FGX A;  1X5E A;  2VM1 A;  3IC8 A;  3E0U A;  2AAW A;  4I5Q A;  1XXU A;  1TDI A;  2VCX A;  2DBC A;  4L5L A;  1U87 A;  2MBS A;  2H73 A;  1X0R A;  1GP1 A;  1UVZ A;  4PUR A;  3HHV A;  3DML A;  1Q4J A;  1Z7R A;  5IMZ A;  1BJX A;  2YAN A;  5ECL B;  4MH3 A;  2PN8 A;  5D93 A;  4MDC A;  4FH8 A;  2DKI A;  4XCS A;  3UMA A;  4AJ6 A;  1B4P A;  3IHG A;  2H70 A;  2DIZ A;  3C71 A;  4WET A;  3LYP A;  3TKQ A;  1XW6 A;  1PL2 A;  1VGL A;  3DGQ A;  2C8U A;  1U88 A;  3F3R A;  5G5E A;  3PGT A;  2C0G A;  4XHM A;  3P90 A;  3EWL A;  3TJK A;  3G7Y A;  1XWA A;  4YQU A;  5F05 A;  1Y6E A;  1GNE A;  3EMP A;  1R7H A;  4YH2 A;  1S3A A;  3IC4 A;  1TK5 B;  1SKW B;  2FA4 A;  14GS A;  2M72 A;  3TRX A;  2L5L A;  3FRC A;  5CNW A;  2H71 A;  3FW2 A;  3IE3 A;  4MP4 A;  1XW5 A;  4F0B A;  4AF2 A;  5JCG A;  5G31 A;  3H93 A;  5D9V A;  1MDJ A;  1TI3 A;  1E2Y A;  2CVK A;  5GAN D;  1JLW A;  2X99 A;  1FOV A;  3H1N A;  5HFG A;  3N9J A;  2R5G A;  5DBQ A;  4QL9 A;  1O8X A;  4TXV A;  2F8A A;  4I6X A;  2REM A;  1XPV A;  4PNG A;  1OAZ A;  2GSR A;  1HNA A;  4KDY A;  1TU8 A;  4MA9 A;  2LQO A;  4Q5R A;  1SKS B;  2JZS A;  4POB A;  3GMF A;  4X43 A;  2K9F A;  4WBJ A;  1PX7 A;  5FWG A;  2VL2 A;  4ZB8 A;  1ZOF A;  3D0Z A;  1VF3 A;  1U3I A;  4L8E A;  4PX1 A;  2G0F A;  2DMM A;  1GSE A;  2VL3 A;  2ON5 A;  3Q6O A;  4EDZ A;  2F9S A;  2H0H A;  2ZNM A;  4YQM A;  5IO0 A;  1NHO A;  1OKT A;  3ERG A;  5KOX A;  4K9Z A;  2I9H A;  3CTG A;  1GTA A;  1ABA A;  2CA8 A;  4TVE A;  4LMW A;  2WCI A;  1B9X C;  3NIV A;  4GLT A;  1R26 A;  3IV4 A;  1URM A;  1ZYQ B;  5J9C A;  1K3L A;  2H19 A;  4V2L A;  4EIP A;  1HNC A;  5HFK A;  5JCW A;  2VCV A;  1HYU A;  2XBI A;  2A2P A;  3P2A A;  4O7H A;  2L4C A;  3TDG A;  4KCA A;  1NM3 A;  4V2N A;  3GYK A;  5BRT A;  1TKD B;  1EWX A;  4ECB A;  4HOJ A;  3BD2 A;  2LRC A;  4MZB A;  4I97 A;  5B6N A;  4JRR A;  1FW1 A;  3Q19 A;  5A4W A;  1GLP A;  1N2A A;  3VLN A;  4N30 A;  3FZ4 A;  4HU9 A;  4USS A;  3L9S A;  1XIY A;  3LWA A;  2V6K A;  3TCO A;  3IOS A;  4CDO A;  4YKF A;  1TU7 A;  4PQH A;  1PKZ A;  1H4O A;  4XS6 A;  4ZIL A;  3TUE A;  3QCP A;  4E8E A;  4Q5F A;  3A5W A;  4PQ1 A;  5JWO B;  2VD0 A;  4Q5N A;  3IK7 A;  2KHP A;  3MNG A;  1TRU A;  1TOF A;  1MEK A;  2DC5 A;  1Z6M A;  2GQL A;  3RPP A;  2B5E A;  4TW5 A;  2H72 A;  1GSD A;  4MF5 A;  3HKR A;  2MBT A;  2DKH A;  1DE1 A;  3J7Y b;  1K3Y A;  2PMT A;  5B8A A;  3UAP A;  3WYW A;  2IMF A;  2XPE A;  1OE7 A;  2L6C A;  4PUF C;  4OFT A;  3QD9 A;  1GH2 A;  1OC9 B;  2GTU A;  1ERT A;  3HA9 A;  5DQS A;  1AIU A;  3PPU A;  2RII A;  1NW2 A;  3UL3 A;  5IIZ A;  1TK0 B;  4OFN A;  2H75 A;  4PQI A;  3C1R A;  2GGT A;  2R0C A;  1PN9 A;  3WGD A;  2I1U A;  4GWR A;  1AQX A;  4ZB6 A;  4NV2 A;  4NV5 A;  5B6M A;  2QGV A;  4RI6 A;  4J2F A;  3LSZ A;  3ZZX A;  2HFD A;  5ECR B;  4NPB A;  2H66 A;  4RUV A;  4ID0 A;  1E6B A;  3DKS A;  2VOC A;  2LRT A;  4YAV A;  4K7N A;  5DDL A;  3CSH A;  2WRT A;  3GX0 A;  3M9K A;  2A2R A;  3KH7 A;  3GIX A;  4JBB A;  5J4U A;  3EE2 A;  3O3T A;  1GUH A;  3KIJ A;  5IPH A;  4EDY A;  4MH2 A;  2FCH A;  3ZVJ D;  4WBR D;  1S3C A;  4LA1 A;  3HJP A;  3GH9 A;  2YOI A;  4ML1 A;  4ISD A;  5AIX A;  2DIY A;  3U5R E;  2WZ9 A;  2H76 A;  4POL A;  1EGO A;  3IAM 2;  1IYI A;  22GS A;  2CVD A;  4BVY B;  2FWF A;  2LTK A;  5HR2 A;  1RQM A;  2OBI A;  1XW9 A;  3FY7 A;  4Z2U A;  4EVM A;  4KF9 A;  2QA2 A;  1YDK A;  4MK3 A;  1XFL A;  5A5K A;  4WR5 A;  4N0Z A;  2MYG A;  2Z9S A;  3CMI A;  2DJ2 A;  3BBY A;  1X5D A;  5D9W A;  2GT5 A;  4K0G A;  2CQ9 A;  5ENU A;  3GHA A;  2IPA A;  1FO5 A;  1OC9 A;  3DD3 A;  5J9B A;  1XCC A;  4EF0 A;  1F9M A;  3TJJ A;  1PRX A;  2IN3 A;  5F06 A;  2H01 A;  4GRF A;  1GSF A;  1Y25 A;  1M7T A;  4OMV A;  4GQC A;  3HJM A;  1PMT A;  2OAD A;  1ZL9 A;  3GUR A;  5G2Z A;  2RM5 A;  3ZTL A;  1PX6 A;  1OVN A;  3DIE A;  1SL2 B;  4KND A;  3L9V A;  3TOU A;  5KN3 A;  1EP7 A;  4KDX A;  1THO A;  2K8S A;  4QL7 A;  4L0W A;  3F4R A;  2H1B A;  2MMZ A;  1B9Y C;  3C1S A;  1X9S B;  3VUR A;  1N8J A;  4KAE A;  3SBC A;  2DJ0 A;  2C4J A;  1ERW A;  2N5B A;  4HI7 A;  1OC8 A;  5IOX A;  3VFI A;  4EO3 A;  3P7X A;  2K18 A;  3U6V A;  3DVX A;  3MDK A;  4ULX A;  4DEJ A;  3EUR A;  4G0K A;  1I5G A;  1PKW A;  2C80 A;  1MDI A;  2XC2 A;  2JSY A;  1FB6 A;  1R5P A;  2C3T A;  1G6W A;  5E4W A;  4CW9 A;  4EIQ A;  1G7E A;  2NVL A;  3RHC A;  1XWC A;  1HNB A;  2P31 A;  17GS A;  4BVY A;  4DVC A;  4YKG A;  5DCG A;  4K6X A;  4MJB A;  4MMM A;  4LMV A;  19GS A;  1AC1 A;  1V40 A;  2VM2 A;  3KCM A;  2AB6 A;  2UZ8 A;  1K3O A;  2HYX A;  2FWH A;  2V6O A;  1BQ7 A;  1QK8 A;  5J3R A;  4EC0 A;  1SJ6 A;  3I69 A;  1YEX A;  3FYG A;  2HE3 A;  2VCW A;  5H5Q A;  12GS A;  2OE3 A;  4WXT A;  2B5X A;  1SJZ A;  1K0D A;  4N11 A;  3EYT A;  3LXZ A;  1EOG A;  1TRS A;  4TR4 A;  16GS A;  3A2V A;  1WIK A;  2DSA A;  4NMU A;  5DJM A;  4F2I A;  1PN0 A;  3LGC A;  3ZL5 A;  3Q18 A;  1J08 A;  2R6K A;  3UOM A;  3HYP A;  4IW9 A;  4POK A;  4KH7 A;  2CZ2 A;  2KP2 A;  5JWQ B;  2A2S A;  1O7U A;  3R2Q A;  3A2W A;  5CRG A;  3TRQ A;  5A4V A;  2O89 A;  2YJ7 A;  1ZGN A;  2YNX A;  3TKS C;  4PTS A;  4IP1 A;  18GS A;  5D9X A;  1M2D A;  1XOA A;  4KGI A;  3APQ A;  3EVI A;  4K5S A;  3IXR A;  3UBL A;  1F3A A;  1JZW A;  4XS1 A;  2JZT A;  4Q5Q A;  1W89 A;  2GDR A;  4ECI A;  2CAQ A;  2ZCT A;  2H0I A;  5CYY A;  1SD9 A;  1O73 A;  1TTZ A;  5G30 A;  1PL1 A;  4K5R A;  1FG4 A;  1M2A A;  4KW6 A;  4EE0 A;  2DJJ A;  3F6F A;  5H5S A;  2FNO A;  4FIW A;  1YZX A;  1O8W A;  2X49 A;  6GSX A;  13GS A;  1FB0 A;  2DML A;  3IA1 A;  1FOH A;  2JL4 A;  4MJA A;  4GXZ A;  1AQV A;  4KX4 A;  4MF6 A;  3BOA A;  3CSJ A;  1B8X A;  3H4K A;  4KDU A;  1SYR A;  1V98 A;  3ZML A;  2WDU A;  2LKU A;  1YEP A;  1OC3 A;  2YPM A;  3FEU A;  5IMF A;  3W8J A;  2I3Y A;  3HZ4 A;  1JZD A;  3C73 A;  3QDN A;  2XPD A;  3HJO A;  2YV9 A;  5ABR A;  2HRK A;  2C1Y A;  3WT1 A;  3EU4 A;  2YZU A;  2WB9 A;  3KGK A;  2C3N A;  2H6X A;  3KMN A;  1GWC A;  3ZFL A;  2RUE A;  2PVO C;  2XHF A;  4HJ2 A;  3FR3 A;  3ISO A;  2D2Z A;  5J5N A;  3FKF A;  4OCF A;  3N5O A;  2IME A;  2O8V B;  3KTL A;  3C8E A;  3M0F A;  3IAS 2;  2GZP A;  4OFM A;  3VK9 A;  2VAF A;  1G0T A;  4LL1 B;  2JAC A;  4YAP A;  5B8B A;  3KZQ A;  1TI1 A;  3DWV A;  4XS4 B;  3GH6 A;  2AHE A;  1SD8 A;  2V41 A;  1GTB A;  1GSQ A;  3ERF A;  1UA5 A;  4AGS A;  3WT2 A;  4I2T A;  4FYB A;  5CRW A;  3LG6 A;  1YY7 A;  4IKH A;  2OJL A;  2CT6 A;  4MZW A;  1F2E A;  2E2G A;  1DSB A;  5ELA A;  6GST A;  1XWB A;  2J23 A;  1MTC A;  2GST A;  4ZBA A;  1XWK A;  2H6Y A;  2X64 A;  1USB A;  4RQX A;  2CZ3 A;  4X4J A;  1CQG A;  3MSZ A;  1X9W B;  2LV3 A;  3BCI A;  3TJG A;  2H30 A;  5G5F A;  3TRP A;  3FZ5 A;  1X5C A;  5KN0 A;  2ZUP A;  4MAB A;  1CQH A;  4ACS A;  1KEB A;  5CRE A;  3L4N A;  4TR3 A;  1AAZ A;  2VL2 C;  6GSY A;  2KP1 A;  3D6I A;  2N5A A;  4MZC A;  2L59 A;  3A3T A;  1HD2 A;  6GSU A;  1DBY A;  2CAI A;  1YKA A;  5AN1 A;  5ECK B;  4RI7 A;  2EIO A;  2A4V A;  4HQS A;  1WWJ A;  4I2U A;  4K2D A;  1T1V A;  3D22 A;  4GCI A;  3ZVJ A;  3C7M A;  3H8Q A;  1XVW A;  4ILF A;  5INY A;  1HQO A;  2VUP A;  5C00 A;  1A24 A;  2X8C A;  4AJ8 A;  2YJH A;  4OCE A;  2HZE A;  4PUA A;  3PR8 A;  4DSS A;  3OR5 A;  1VF1 A;  2LJA A;  2B7K A;  1KTE A;  1G6Y A;  4MPF A;  4XS4 A;  6GSV A;  1ZYN A;  2R2J A;  1ACV A;  4L5O A;  5KOW A;  1GTI A;  1FAA A;  2TRX A;  2HRN A;  2IWT A;  4IQA A;  1MD4 A;  4A5P A;  1B4Q A;  2HRA A;  20GS A;  5F8B A;  2J9H A;  4J57 E;  1QQ2 A;  3CRU A;  3GTU B;  1J9B A;  3O76 A;  3FMW A;  2H0G A;  5CO3 A;  3GV1 A;  5F0G A;  1EGR A;  4NAX A;  2FUG 2;  3UVH A;  3GKN A;  3KM6 A;  2K6V A;  3KXO A;  2F8F A;  3FZA A;  1ZYP A;  3HDC A;  3TKR A;  1LJR A;  3QAG A;  2FY6 A;  4ICY A;  1TXX A;  3VPT A;  2HSH A;  5IO2 A;  1Z7P A;  1GUL A;  4F9Z A;  5F07 A;  4MPG A;  2YWN A;  5IPG A;  4FYU A;  2GQM A;  3A2X A;  3TKS E;  3KH9 A;  4XRD A;  1PQN A;  2PUK C;  2B6M A;  2C0F A;  5FT3 A;  3K8N A;  3F3Q A;  1GUM A;  4O5Q A;  4MF7 A;  4WR4 A;  2ON7 A;  5CAX A;  2DLX A;  1O85 A;  4JED A;  3I43 A;  3HD5 A;  3WD6 A;  3NOF A;  4LLR A;  1KNG A;  2WGR A;  1XBS A;  2V1M A;  1RW1 A;  2IL3 A;  1Z9H A;  3TJB A;  5ID2 B;  2ALB A;  1WMJ A;  1ILO A;  4ZL8 A;  4IGJ A;  1GNW A;  5CRH A;  3QPM A;  4G0I A;  1EOH A;  4HS1 A;  4EL1 A;  4BA7 A;  1K0M A;  2YV7 A;  3TJF A;  2ES7 A;  3AY8 A;  3LQ7 A;  4D73 B;  5EY6 A;  4BWS A;  3F8U A;  1YF1 A;  5AIS A;  3I6A A;  4AJ7 A;  1JFU A;  4TN8 A;  2B1L A;  5IMC A;  4OO4 A;  1A23 A;  2OKA A;  3CSI A;  4MLY A;  3GTU A;  3D5J A;  2H6Z A;  1EEM A;  2HNL A;  2A4H A;  3UAR A;  5JWR B;  2C3Q A;  2B1K A;  1ERV A;  2GQK A;  4JE1 A;  5D73 A;  3IBH A;  2E2M A;  5DCH A;  5GZZ B;  1FHE A;  2WFC A;  3G7J A;  2F3M A;  2PPT A;  3FZ9 A;  3ZYW A;  5CRD A;  3KJY A;  2VD1 A;  3DVW A;  4OD7 A;  2BMX A;  2FHE A;  4ZBD A;  4ZIJ A;  2AYT A;  3E3E A;  1YF0 A;  2VL9 A;  5FHI A;  3S9F A;  5D96 A;  4HU7 A;  2HLS A;  1SK1 A;  1T7P B;  4MJE A;  5GAP D;  1VF2 A;  8GSS A;  5ECS A;  1A8Y A;  2N5F A;  1M9B A;  1TRV A;  3PIN A;  5DVB A;  2I81 A;  1DE2 A;  3TGZ A;  2V2G A;  4HJM A;  2LUS A;  3ED3 A;  5ID2 A;  1H75 A;  3GFK A;  4DSR A;  3HCZ A;  2R4V A;  3GA4 A;  2PBJ A;  1Z6N A;  1PD2 1;  3EPT A;  2MZC A;  4GF0 A;  2C0D A;  1TJD A;  5ECP B;  4RQR A;  1JHB A;  2LS5 A;  2GSQ A;  4K2X A;  4BVX B;  4TXO B;  3GSS A;  1J0F A;  2PWJ A;  4IBP A;  3I9V 2;  1T4Y A;  5A4U A;  1S3D A;  1ERU A;  3KEB A;  4D73 A;  4G2E A;  3J7Y k;  3TKP A;  3F63 A;  5LD0 A;  4HQZ A;  1GSY A;  2NDO A;  5JCU A;  5COH A;  3QAV A;  1I9D A;  1R4W A;  2OBK A;  5ECQ B;  2QSI A;  4KSM A;  2P5R A;  1XWG A;  3MYD A;  4J56 E;  2RM6 A;  4H86 A;  2R3X A;  3FK8 A;  3HY2 A;  3LXT A;  4F0C A;  7GSS A;  2EIR A;  2DJ1 A;  3ERW A;  2KLX A;  4CY8 A;  2HZF A;  3A5I A;  4WF4 A;  3SWL A;  1A2M A;  3APO A;  5HR1 A;  3M3M A;  5GST A;  3GX8 A;  1BG5 A;  3CYN A;  4IS0 A;  3ZFB A;  2HXK A;  3DYR A;  2KOK A;  5KEJ A;  1FVJ A;  5H5R A;  5E59 A;  1G7O A;  3LW9 A;  1PGT A;  2PVQ A;  3ME8 A;  4GTU A;  5EL8 A;  2X4A A;  4O32 A;  1U6T A;  5IMA A;  3IHQ A;  3ZLP A;  1XOB A;  5KN2 A;  1A2L A;  1GUK A;  2FWG A;  2OE1 A;  3ZIV A;  2MMO A;  2JU5 A;  4HZ2 A;  3UJ1 A;  3DEX A;  2WJU A;  2IMK A;  4WF5 A;  1A0R P;  3O6T A;  5AIV A;  4ZBB A;  1WPI A;  3GKM A;  3ZMK A;  4ZXG A;  2P0G A;  5IQY A;  1YQ1 A;  2RLI A;  3GL3 A;  3ZRE A;  3QFB C;  5HQP A;  1M2B A;  1T4Z A;  1BED A;  2EC4 A;  5G1L A;  2AUV A;  1ON4 A;  3LJR A;  3RAZ A;  3D21 A;  6GSS A;  3F9U A;  2TRC P;  3W6G A;  4FO5 A;  4L0U A;  4BVX A;  4TXO A;  3M9J A;  3CRT A;  2VLV A;  3KMO A;  6GSW A;  1WOU A;  1F6M C;  2WUL A;  4KCE A;  2VIM A;  2V32 A;  2LJK A;  1K0N A;  1ZZY A;  3CTF A;  2B7J A;  4EUY A;  5EPF A;  2XBQ A;  2H1G A;  5ECH B;  1F37 A;  1SK0 A;  1TP9 A;  2NPB A;  2WS2 A;  1XZO A;  5HR3 A;  1O81 A;  3EC3 A;  3US3 A;  1ZYE A;  3GST A;  1OKD A;  4HEA 2;  4V1A p;  4TKY A;  2L5O A;  1SJI A;  2GLR A;  4IHU A;  3MWH A;  3KP9 A;  5C04 A;  3RPN A;  4JU5 A;  1T3B A;  1KBN A;  1M0U A;  1A2J A;  1GSS A;  1SL0 B;  4OO5 A;  2HZE B;  3APS A;  4V2M A;  4G9H A;  4DSS B;  3UEM A;  3MAK A;  4KUN A;  2AJQ B;  1AUC A;  5LNK e;  4JR6 A;  1TW9 A;  2VLT A;  3W8S A;  2LNS A;  4Z2T A;  3KP8 A;  3F0I A;  3BCK A;  4WKW A;  4YQV A;  1WP0 A;  4NHZ A;  3HZ8 A;  10GS A;  2LRN A;  2R0G A;  5EVO A;  2GVP A;  4IEL A;  1O6J A;  1Q98 A;  2OAC A;  2IMD A;  1UC7 A;  4IN0 A;  2IFQ B;  1K0C A;  5ECI B;  2GS3 A;  2H74 A;  2IMI A;  4IJI A;  4F03 A;  4GSS A;  11GS A;  4LL4 B;  4P3Y B;  1GLQ A;  2M80 A;  2VLU A;  1X9M B;  1ST9 A;  2FWE A;  2OE0 A;  2TIR A;  1RK4 A;  1M9A A;  2AV4 A;  2JSZ A;  4X1U A;  2L6D A;  4HDE A;  3QFA C;  1PA3 A;  3GKX A;  3LYK A;  2YZH A;  3QOU A;  5CP1 A;  2GSS A;  3EMX A;  1V9W A;  2HT9 A;  3GNJ A;  3KTB A;  3IRA A;  1XVQ A;  1A8L A;  2CX4 A;  3JCM L;  1K0O A;  1F3B A;  1YJ6 A;  3ZRD A;  1EEJ A;  4XRA A;  4ECC A;  1SK2 A;  3ZIT A;  3E9J B;  2CVB A;  2E0Q A;  4K1F A;  1EZK A;  4NHW A;  1JLV A;  2BJX A;  2HSY A;  2JAD A;  3GKK A;  3QAW A;  2RUF A;  3TB2 A;  2B5Y A;  3VPQ A;  4KA0 A;  2LQQ A;  1K0B A;  1K0A A;  3FR9 A;  4N0V A;  3L0H A;  4CY6 A;  3DRN A;  3QR6 A;  1ML6 A;  4G19 A;  3P8W A;  2VCQ A;  1GL8 A;  1QMV A;  4MCU A;  3HVX A;  1EV4 A;  1SL1 B;  1MD3 A;  4I8B A;  4F82 A;  2QC7 A;  1QGV A;  1B48 A;  1V57 A;  4HZ4 A;  1WRY A;  2VO4 A;  4EXJ A;  3WGX A;  2IJY A;  2IFQ A;  1EP8 A;  3ME7 A;  1AXD A;  3QMX A;  5DAL B;  3VI7 A;  4BL7 B;  4OWY A;  5ECN B;  2X8G A;  3BJ5 A;  1UN2 A;  2GZZ A;  3L78 A;  3F4T A;  3UVT A;  1V58 A;  3RHB A;  4ML6 A;  3LFL A;  4K7I A;  1V2A A;  3FR6 A;  4POM A;  4TOP A;  3WGE A;  4EKZ A;  2MMA A;  4ECJ A;  1ZCP A;  2CX3 A;  4E8H A;  1GRX A;  2HI7 A;  2NTO A;  1LU4 A;  2R0P A;  4KSO A;  3M1G A;  4K0N A;  1LBK A;  2P5Q A;  3L9U A;  3HVS A;  1QUW A;  3VWW A;  3F4S A;  1OE8 A;  4ZL7 A;  1R5A A;  2QKE A;  5IOW A;  2G2Q A;  2VCZ A;  3LEF A;  4TR1 B;  5DAK B;  2DJK A;  2LNT A;  1JZR A;  1M99 A;  3EU3 A;  2O85 A;  5B7C A;  3V1W A;  1BAY A;  4BWQ A;  4BPY A;  1MDK A;  2IIY A;  4G10 A;  3VWX A;  1AQW A;  1QFN A;  1THX A;  3UBK A;  1SEN A;  2H1D A;  2YN1 A;  2KUC A;  4G0L A;  5LCZ A;  2R37 A;  4PXO A;  5G1K A;  1Z5Y E;  3GN3 A;  1JZO A;  3D4M A;  5IMD A;  4IJ3 A;  4XIH A;  4TR0 A;  2FA8 A;  3PH9 A;  4NWY A;  3HVV A;  3VI5 A;  2HSM A;  9GSS A;  1SU9 A;  4O5R A;  3EIN A;  5L71 A;  4K8M A;  2FD3 A;  1TRW A;  2OA7 A;  4JR4 A;  1DUG A;  3GUS A;  1FVK A;  1Z3E A;  3UIW A;  2GT6 A;  2L57 A;  3ZIJ A;  2PGT A;  3IR4 A;  5D9T A;  2YP6 A;  3IK9 A;  5BMU A;  4O92 A;  2JZR A;  1C72 A;  2PER A;  2FLS A;  3M8N A;  2I4A A;  5DAL A;  3DXB A;  4BL7 A;  4MNN A;  1SYX A;  3G7I A;  4TRX A;  1OYJ A;  3MIX A;  3GL5 A;  1NHY A;  2F51 A;  3FHK A;  3IPZ A;  2EIQ A;  4QQ7 A;  4JZQ A;  1T8E B;  2LST A;  2VCT A;  1T00 A;  5HFI A;  4GQF A;  5ECO B;  3TOT A;  2CV4 A;  4V1A g;  1WJK A;  1WE0 A;  5KN1 A;  2HRF A;  3H79 A;  3F6D A;  4Z2R A;  1TK8 B;  4HUA A;  1SKR B;  1PSQ A;  5ELG A;  2QA1 A;  3NZN A;  2M46 A;  2B3S A;  4TR1 A;  4GST A;  5DAK A;  2YWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...