1GP1A

The refined structure of the selenoenzyme glutathione peroxidase at 0.2-nm resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
184
structure length
183
Chain Sequence
RTVYAFSARPLAGGEPFNLSSLRGKVLLIENVASLGTTVRDYTQMNDLQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNCLKYVRPGGGFEPNFMLFEKCEVNGEKAHPLFAFLREVLPTPSDDATALMTDPKFITWSPVCRNDVSWNFEKFLVGPDGVPVRRYSRRFLTIDIEPDIETLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE PEROXIDASE
publication title The refined structure of the selenoenzyme glutathione peroxidase at 0.2-nm resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Oxidoreductase(h2o2(a))
total genus 59
structure length 183
sequence length 184
chains with identical sequence B
ec nomenclature ec 1.11.1.9: Glutathione peroxidase.
pdb deposition date 1985-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gp1A00
1DE2A 1JLWA 2DSAA 1F3AA 4MH3A 2E2GA 3IC4A 4XS6A 3TCOA 1XIYA 3FRCA 4E8EA 5DALB 4I97A 3Q6OA 2P5RA 4YQMA 1B8XA 2ES7A 2BJXA 4NWYA 2CQ9A 2NVLA 1G6YA 2AJQB 5IO0A 3RHCA 2DMLA 3LWAA 2LNSA 3ZMKA 2DMMA 5A4VA 5DDLA 3DEXA 22GSA 1A0RP 3TRPA 1O7UA 4YQUA 2CZ2A 4FH8A 4OFMA 2AHEA 4DSQA 2HE3A 5FT3A 4ZL8A 4XRAA 1A23A 2XPEA 3UBKA 4DEJA 4GWRA 4TKYA 2CVKA 6GSVA 2H66A 4G19A 5IPHA 3GV1A 1PGTA 4DVCA 5D9VA 1XWBA 1O8WA 2YWMA 2YV9A 2YZUA 2VUPA 1TXXA 4NAXA 4LMVA 2CX4A 1FO5A 2AV4A 2K8VA 2C3TA 4ZL9A 2YJ7A 2FD3A 2O8VB 2ZNMA 2WJUA 2KUCA 3UBLA 2H8LA 1OKDA 4HJMA 3HJOA 4MA9A 1V40A 1M9AA 4TVEA 1PX6A 2LJKA 4NPBA 3HHVA 3VWVA 3PINA 2MBSA 2HYXA 1BEDA 2VCQA 1JZDA 1SKRB 6GSSA 2PVOC 2GZYA 2A2SA 2LEGA 2L4QA 1VF4A 4TXOA 2J23A 4KAEA 5E4WA 1SYRA 1T1VA 4Q5FA 3QMXA 5IM9A 1EEMA 4MABA 3J7Yk 2L5LA 1TI1A 1W89A 3D5JA 4HOJA 1GSEA 4GQFA 5IMZA 1XBSA 4XS4B 4JE1A 4NMUA 4Z7XA 1EP8A 1EOHA 2LSTA 3VWXA 2LQOA 5AGYA 1TKDB 2VLTA 1K0OA 3QAGA 5E59A 4ISDA 2R6KA 1UN2A 3D4TA 2QC7A 1TU8A 4ZBBA 4I6XA 4POBA 2FWHA 3TUEA 3QD9A 1M9BA 2G0FA 4JR6A 4V2MA 2GLRA 4EL1A 3L9VA 3IPZA 16GSA 2M72A 5KEJA 2R2JA 5GAND 1A2LA 3NOFA 4AGSA 5ABRA 3VFIA 2IN3A 1ST9A 2F8FA 3GN3A 2PUKC 4E8HA 1LJRA 6GSUA 3N9JA 2IMKA 14GSA 3FHKA 1M99A 1WP0A 8GSSA 4KNDA 1EEJA 1K3OA 3BCIA 5G5EA 3BOAA 1WIKA 2XHFA 4K0GA 5H5SA 4NHWA 4JZQA 3DD3A 3RDWA 2IMIA 4IGJA 3LJRA 3IBHA 1I5GA 4O5RA 1DSBA 2EC4A 1GNEA 4MJEA 3VI7A 3GX8A 2RUEA 1FVKA 2PU9C 3WGDA 4Q5QA 2IMEA 4MJAA 4WBJA 3HJMA 3M3MA 4DSSA 3G7YA 3EU3A 3KEBA 3HXSA 4MPFA 3FZ4A 5DJMA 3LQ7A 3TJFA 1YZXA 5LNKe 3RAZA 2YZHA 1TDIA 5IIZA 4K9ZA 2N5BA 3KH7A 3GH6A 1OAZA 3IE3A 4EKZA 3QFBC 1MD3A 4PQHA 3Q19A 1KBNA 3ISOA 5B8BA 4MZWA 1XW9A 1V57A 3F9UA 4MJBA 4PNFA 4X43A 2V2GA 2VO4A 3F6FA 4K7NA 1B4PA 3FEUA 1AC1A 1PL1A 1FOVA 2C0GA 5DCGA 4POLA 3WT2A 3UARA 1I9DA 5HFIA 4ML6A 2CVBA 3ZRDA 3H79A 3TOTA 3FY7A 2WB9A 2VCXA 2YNXA 3CSHA 5INYA 2A2RA 3FZ9A 3APSA 2IL3A 1PRXA 1UC7A 2YN1A 2LRCA 4ACSA 1HYUA 4WR5A 4OWYA 1XXUA 4WXTA 1VRSD 3F3QA 1Y25A 1M2BA 3QDNA 3WGXA 2CT6A 2GGTA 2X64A 2HZFA 2MMZA 5KN0A 2L59A 3P8WA 2VL9A 3UVHA 2C0DA 2LTKA 5ECIB 1U3AA 3KIJA 1YKAA 2H75A 1PQNA 1GSQA 1TRWA 5FWGA 2MMNA 2PVQA 2B1KA 12GSA 2LV3A 1OC9A 2HI7A 3EWLA 3IK9A 4CHSA 3TKPA 2OBKA 4BWSA 5ELGA 1X0RA 4K7IA 1B9XC 4IQ1A 1M2AA 1SYXA 1T4YA 1K3LA 4L5LA 1AQXA 3HVXA 1R4WA 1SL1B 3EURA 1BAYA 1GTIA 5G5FA 5C04A 2OACA 2F3MA 3CTGA 1E2YA 1MEKA 4MMMA 1MDIA 5CNWA 2H6XA 1SENA 2DJJA 5JCWA 4RI7A 1YF1A 2Z9SA 1T00A 3I43A 2TRXA 5JCUA 2XC2A 4F9ZA 1GULA 2FNOA 1GSSA 1SJZA 1F9MA 1PD21 4Q5NA 3LSZA 1PSQA 1ZGNA 1K0MA 2AAWA 3KP8A 4P3YB 1TTZA 5FHIA 1BG5A 2QSIA 3GSTA 1CQGA 1DE1A 5LD0A 3TKSC 2DJ3A 2H72A 1O73A 2BMXA 1FB0A 1WMJA 1LU4A 1V2AA 3LFLA 2GQLA 1RQMA 3L9UA 1AW9A 4AJ8A 5HQPA 3EYTA 1X9SB 4PQIA 1ZMAA 1IYHA 3Q74A 2R4VA 3LYKA 3ZIVA 4TOPA 3GH9A 4FIWA 1ML6A 3IRAA 6GSYA 1C72A 2VD0A 4H86A 1DBYA 4TW5A 2OJLA 3FYGA 1GLQA 2DJKA 2HSYA 2XBQA 4KCAA 1K0DA 2B7JA 4KSMA 1MDJA 4KA0A 2LJRA 3KJYA 1R5PA 5DCHA 3DKSA 4F0CA 3VPTA 2H1AA 1QK8A 4BPYA 2JZTA 7GSSA 1YY7A 3L4NA 3DIEA 1ZYEA 3DGQA 2GZPA 5J5NA 3CXGA 2H1GA 4D73A 2FGXA 4GQCA 4HU9A 1R7HA 2IFQB 2K9FA 1YQ1A 2CAIA 4IJIA 1Z7RA 4F0BA 3EVIA 1EGRA 3CSJA 4POKA 1CQHA 2LNTA 1J0FA 3GURA 2IIYA 5D96A 2H0GA 4IKHA 3HA9A 3RPNA 2JZRA 3SWLA 1X5CA 5IMDA 5EVOA 2HSHA 3C7MA 5DAKA 2VCTA 3APOA 4RUVA 3TJGA 4OO5A 5D8IA 3I6AA 4TR4A 3LXTA 2L5OA 2YWIA 4WF4A 3KTLA 4RQRA 2TIRA 3S9FA 3M9JA 3C73A 3HJPA 1WPIA 3CTFA 1GUMA 5ECOB 1FB6A 1NW2A 3GMFA 2LRTA 2GSSA 1SU9A 4CW9A 3GRXA 1XOAA 4MCUA 5B6MA 3VI5A 4LA1A 2PERA 5IPGA 5CAXA 3FR3A 4GSNA 2YWOA 3QPMA 3HD5A 5F0GA 1JZOA 2I1UA 2NPBA 4GXZA 2FWGA 1K0AA 1GSFA 4AF2A 4FYCA 1XWGA 1FG4A 4XS4A 2HRFA 4HEA2 3J7Yb 2C0EA 2DIYA 4BVXA 3FK8A 3ZYWA 1X5EA 3TKQA 3CBUA 5GAPD 1PL2A 5KN2A 1ERVA 3VURA 2VM1A 1AAZA 1ACVA 1OE7A 3H93A 2O85A 3HZ8A 1H75A 4KH7A 3N5OA 1YF0A 4IJ3A 3ZREA 2H6YA 3R2QA 5G1KA 3Q18A 2G2QA 3IK7A 4YQVA 4NHZA 4EDZA 3GKKA 3CYNA 1Z5YE 5F05A 2NBSA 1ABAA 4CDOA 5DVBA 2I81A 1ZYQB 4HDEA 3TJJA 2GZZA 3JCML 1B48A 3ERWA 2CV4A 3U6VA 4K6XA 1NHOA 4GCIA 2YJHA 1A8YA 3C1SA 2GVPA 2VL2C 2JZSA 5F06A 2AUVA 4F03A 3A2WA 1BYEA 2H73A 2HZEA 4TRXA 3D22A 4K2DA 2HNLA 3F4RA 1V98A 4JEDA 3RHBA 4KSOA 2FLSA 4HUAA 2H74A 1SKWB 2PN8A 1WJKA 4PQ1A 1ON4A 4I2TA 3P7XA 2KHPA 1SK1A 2RM6A 5A4WA 3DVWA 1XWKA 3GL3A 2ALBA 4GSSA 3IA1A 2P31A 1GSDA 1F37A 1TRVA 1XW6A 1BX9A 2H76A 4IS0A 3BCKA 4MZBA 5EL8A 1F6MC 1QQ2A 5B8AA 2H1BA 2VD1A 4GF0A 2JU5A 3TOUA 2H30A 1ZZYA 2CX3A 1O81A 5KN3A 3HDCA 4EF0A 1M7TA 1PN9A 4IHUA 1XFLA 2KP2A 4KX4A 4TR1A 5AIVA 3GFKA 2PGTA 3F3RA 3KMOA 2CVDA 3ERFA 3ZIJA 3CMIA 3CSIA 1M2DA 1QUWA 3MWHA 1YKCA 2PWJA 4N0VA 1QGVA 5B6NA 2MMOA 2DIZA 4PUFC 1FW1A 3BJ5A 4N11A 2X8HA 3M9KA 1GNWA 3W8JA 5J9BA 1N2AA 3KZQA 4ZB6A 5CYYA 3UMAA 2ON7A 2JSZA 4XCSA 3GIXA 5ECRB 3DMLA 3LGCA 3ME8A 5F8BA 2IWTA 1WE0A 2K8SA 2J9HA 3MAKA 1XZOA 1E6BA 2WDUA 3ERGA 1EZKA 2REMA 1O8XA 3M0FA 4ECJA 2N5AA 3P2AA 1VF1A 2PBJA 4EVMA 1EV4A 5GZZB 5HR2A 3ZVJA 2ON5A 1U87A 2B7KA 2VLVA 2X8GA 5IMFA 2EIRA 2NDOA 1ZCPA 3IHQA 2E7PA 1S3AA 4MDCA 2OE0A 3UIWA 1Z6NA 2H19A 1F3BA 1KNGA 5GSSA 4WETA 1PA3A 3EE2A 4V1Ag 3F0IA 3M1GA 3VPQA 2MYGA 2N5FA 3F4SA 2XBIA 2CAQA 13GSA 1U3IA 3ZFBA 18GSA 2WFCA 4LMWA 1XCCA 1EP7A 3FZAA 1PMTA 3OR5A 5H5QA 2I3YA 1OE8A 4GTUA 2H0HA 5L71A 2CA8A 3BBYA 2DJ2A 2WS2A 2B6MA 1U6TA 4TN8A 4MF5A 6GSWA 1GTAA 1XW5A 1LBKA 2IPAA 1R26A 1GH2A 1HNAA 3TB2A 4K0NA 4MH2A 5CRWA 2C80A 3GA4A 3F6DA 3ED3A 4OO4A 5J3RA 2V32A 1URMA 1EGOA 2DJ1A 2R3XA 1SJ6A 2GDRA 1THOA 1VGLA 2FUG2 2I4AA 3I69A 2LKUA 2V6OA 4FYUA 5EPFA 3TDGA 1B9YC 4L8EA 5ENUA 3U5RE 4N30A 1X9MB 5IMVA 5DJLA 4FYBA 2E2MA 2RIIA 1YEXA 4I8BA 2YWNA 3C8EA 4PUAA 5IOXA 2RUFA 4WF5A 5DQYA 3HVVA 5ID2A 3F63A 3PH9A 3LG6A 1AQWA 3F4TA 4V2NA 2JSYA 1G6WA 3FZ5A 1ERTA 2YP6A 1HNBA 2C4JA 3PR8A 2B5YA 4TR3A 1T4ZA 4YAVA 4GLTA 3A5WA 1JZRA 3RBTA 3IXRA 2OA7A 1DUGA 5ECNB 4AJ6A 5DQSA 3D0ZA 3QR6A 2O7KA 2AYTA 3VLNA 1OC9B 2FY6A 4KDUA 1MD4A 2H1DA 3V1WA 2L57A 2AB6A 1K0CA 3A3TA 3QAVA 4X1UA 5GSTA 3H4KA 5ECSA 1GLPA 2MZCA 3ZZXA 2P5QA 1HD2A 1PKZA 1T3BA 2DC5A 2K18A 2GT5A 1QMVA 2FHEA 2VIMA 4G2EA 2E0QA 3UL3A 2YPMA 5ECHB 2GSRA 1AIUA 4L0UA 1M0UA 2I9HA 1ILOA 3ME7A 5HR0A 4IW9A 2H6ZA 2VL3A 1Q98A 4MLYA 3W8SA 19GSA 4XS1A 2OBIA 4GRFA 3ZMLA 3M8NA 2H01A 2IMFA 3GX0A 4HZ4A 4PNGA 2F8AA 5IQYA 4EXJA 3QAWA 3UVTA 17GSA 3EU4A 5LCZA 3O3TA 4KDXA 5JWQB 2EIQA 5DALA 3GTUB 3L0HA 1KEBA 2KP1A 3IOSA 1EOGA 2KLXA 3L78A 3QOUA 4ILFA 2TRCP 2B5XA 2GQMA 4ZILA 1ERUA 1USBA 2HT9A 2LS5A 2H0IA 1YDKA 1N8JA 1V9WA 3O6TA 2YOIA 2HLSA 5D9WA 5ECPB 3I9V2 1K3YA 2OKAA 3DXBA 4KCEA 2JADA 4MF6A 3UOMA 2GT6A 4WEYA 3US3A 4V2LA 2V41A 3L9SA 5G30A 2RLIA 4O7HA 4ZB9A 6GSTA 1FHEA 3EMPA 3LEFA 2VLUA 2YANA 4NXIA 2GQKA 2IMDA 1AQVA 4IQAA 1KTEA 5CRHA 3H8QA 1XWAA 5ECLB 9GSSA 2YV7A 5ECMB 4TXVA 3O76A 5JWOB 3KXOA 4IBPA 5AISA 11GSA 5G2ZA 4D73B 2WGRA 1X5DA 2M80A 1THXA 3ZFLA 1A24A 1PX7A 1SD9A 3KD0A 4KW6A 5HR3A 2X8CA 1ZL9A 1J08A 1EWXA 5HR1A 4JU5A 2ZCTA 1FVJA 4ULXA 2WRTA 1OC8A 4HZ2A 4K8MA 3D6IA 3KP9A 5ELAA 2VM2A 1TOFA 4RQXA 5G1LA 2LUSA 4HQSA 5HFGA 4BL7A 3F8UA 2K6VA 1RK4A 4PXOA 3SBCA 4DSRA 1A2MA 5A5KA 1XWCA 5DAKB 4Q5RA 4EDYA 3GNJA 2GTUA 3TRXA 4ECIA 5J41A 1GUKA 3GL5A 1JHBA 2B5EA 2LJAA 3TKRA 1GSUA 4XRDA 4IN0A 2FCHA 4EUYA 2VOCA 4QL9A 1SJIA 3FKFA 4G9HA 3ZLPA 3TKSE 1SL2B 1UVZA 3CRUA 3MSZA 1PKWA 4GSTA 2L4CA 4V1Ap 1EV9A 4ML1A 2JACA 4WBRD 4ECCA 2HRNA 4F2IA 1GP1A 4AJ7A 1HNCA 2C3QA 5D93A 2FA4A 1GTBA 5COHA 3C1RA 3TRQA 4LL1B 4HS1A 1O85A 4BWQA 1YEPA 4ZBDA 4RI6A 3KH9A 5C00A 1GL8A 1R5AA 5HFKA 3UAPA 5CO3A 3HVSA 3HYPA 4QQ7A 1K0BA 3KMNA 2VL2A 4PGTA 3EC3A 1K0NA 3WYWA 3UJ1A 4WKWA 4K1FA 2R37A 1TU7A 4I2UA 1GTUA 1S3CA 4XIHA 1Z3EA 4TXOB 5A4UA 4MZCA 1X9WB 3W6GA 2VCVA 1GSYA 1OVNA 2B3SA 4I5QA 1Z6MA 3MNGA 3IAS2 4F82A 4O32A 3IV4A 2GS3A 3HKRA 4QL7A 5DBQA 4OFTA 5AIXA 1B4QA 4ZBAA 2HZEB 1XPVA 2MMAA 4EE0A 1JFUA 4YH2A 2GSQA 2L6CA 4EO3A 3ZTLA 1T7PB 3GHAA 1FAAA 3NZNA 4KB3A 3EINA 3NIVA 4HU7A 3A2XA 4ZB8A 1SKSB 1TK8B 3TGZA 3VWWA 2FWEA 5IOWA 4X0XA 5D73A 1T8EB 1WWJA 2RM5A 1NHYA 20GSA 5CP1A 2P0GA 1U88A 3BD2A 4OCFA 1XVWA 3EMXA 3E3EA 2V6KA 1BJXA 2VCZA 3TJBA 3LORA 4JR4A 4OFNA 2QGVA 1NSWA 1G0TA 1O6JA 3KGKA 3HZ4A 3HCZA 1W4VA 3GSSA 4TR1B 1NM3A 4FO5A 3H1NA 1QFNA 4KUNA 1ERWA 3GKXA 3FW2A 2DLXA 4PX1A 3HY2A 4J56E 3FR6A 1UA5A 2VCWA 1A0FA 3MDKA 2O87A 3LXZA 5IO2A 4POMA 3IDVA 4DSSB 1F2EA 1OYJA 2WCIA 1J9BA 1SD8A 4EC0A 2GSTA 3D4MA 1QXHA 3E9JB 3G7JA 4ID0A 2XPDA 2M46A 5G31A 4L5OA 5J4UA 3ZITA 1WOUA 4MP4A 2B1LA 4IVFA 4NV2A 4N0ZA 2WULA 3DYRA 3QCPA 1Y6EA 4IP1A 1MDKA 5D9XA 1TJDA 3FR9A 4K7OA 4MK3A 3E0UA 1GWCA 2PPTA 2F51A 1ZOFA 2C1YA 3P90A 1AUCA 3AY8A 2FWFA 3KTBA 1MTCA 4OCEA 3LYPA 3IR4A 1TP9A 3GUSA 4LL4B 2ZUPA 4G10A 2YCDA 1GRXA 4BA7A 4ZIJA 2NTOA 3QFAC 2LQQA 2QKEA 1G7OA 5IMAA 3K8NA 4IP6A 1XOBA 3ZL5A 1A8LA 3GKNA 2A4VA 1VF2A 3IAM2 1SK2A 5ECKB 6GSXA 2IJYA 2OE1A 4KGIA 1A2JA 4HJ2A 3G7IA 2HXKA 5CRDA 1XVQA 4KDYA 5J9CA 4BVYA 2WZ9A 1HQOA 2FA8A 4NV5A 3D21A 2LRNA 4N10A 1Z7PA 2BTOT 4YAPA 1H4OA 5ECQB 1BQ7A 1JZWA 3GYKA 4PURA 2KOKA 4XTSA 3VK9A 4JRRA 4O92A 4ZXGA 1AXDA 2F9SA 3GTUA 3VWUA 3DRNA 3UEMA 4OD7A 4MF7A 1IYIA 1SK0A 4KE3A 1Q4JA 2H70A 4OMVA 1V58A 1TRSA 2IFQA 2VAFA 3KM6A 1VF3A 3CRTA 2L6DA 3TKSA 2C0FA 1TK5B 5ID2B 5IMCA 3KCMA 1YJ6A 2HFDA 4XHMA 3TJKA 1RW1A 1JLVA 4HI7A 5D9TA 3GKMA 1Z9HA 3RPPA 2O89A 4ZL7A 5B7CA 1OKTA 1GUHA 3WT1A 3ZVJD 2R5GA 5CRGA 10GSA 3C71A 4J57E 2MBTA 2DJ0A 4MJCA 1SL0B 4J2FA 3DVXA 3WD6A 5EY6A 2JL4A 4ECBA 1G7EA 4L0WA 5JWRB 3G9BA 2C3NA 5KN1A 2OE3A 1WRYA 4WR4A 3APQA 1S3DA 2DBCA 2V1MA 4MPGA 5F07A 1TRUA 2EIOA 4JBBA 3WGEA 2H71A 1TK0B 2PMTA 3A2VA 5AN1A 5H5RA 3DWVA 2CZ3A 4HQZA 1TW9A 2C8UA 4TR0A 4IELA 2D2ZA 3PGTA 1TI3A 4LLRA 2OADA 2X99A 1OC3A 5JCGA 5CREA
chains in the Genus database with same CATH superfamily
1DE2A 1JLWA 2DSAA 1F3AA 4MH3A 2E2GA 3IC4A 4XS6A 3TCOA 1XIYA 3FRCA 4E8EA 5DALB 4I97A 2UZ8A 2P5RA 3Q6OA 4YQMA 1B8XA 2ES7A 2BJXA 4NWYA 2CQ9A 2NVLA 1G6YA 2AJQB 5IO0A 3RHCA 2DMLA 3LWAA 2LNSA 3ZMKA 2DMMA 5A4VA 5DDLA 3DEXA 22GSA 1A0RP 3TRPA 1O7UA 4YQUA 2CZ2A 4FH8A 4OFMA 2AHEA 4DSQA 2HE3A 5FT3A 4ZL8A 4XRAA 1A23A 2XPEA 3UBKA 4DEJA 4GWRA 4TKYA 2CVKA 6GSVA 2H66A 4G19A 5IPHA 3GV1A 1PGTA 4DVCA 5D9VA 1XWBA 1O8WA 2YWMA 1M3JA 2YV9A 2YZUA 2VUPA 1TXXA 4NAXA 4LMVA 2CX4A 1FO5A 2AV4A 2K8VA 2C3TA 4ZL9A 2YJ7A 2FD3A 2O8VB 2ZNMA 2WJUA 2KUCA 3UBLA 2H8LA 1OKDA 4HJMA 3HJOA 4MA9A 1V40A 4G0IA 1M9AA 4TVEA 4K5SA 1PFOA 1PX6A 2LJKA 4NPBA 3HHVA 3VWVA 3PINA 2MBSA 2HYXA 1BEDA 2VCQA 1JZDA 1SKRB 6GSSA 2PVOC 2GZYA 2A2SA 2LEGA 2L4QA 1VF4A 4TXOA 2J23A 4KAEA 5E4WA 1SYRA 1T1VA 4Q5FA 3QMXA 5IM9A 1EEMA 4MABA 3J7Yk 2L5LA 1TI1A 1W89A 4FQUA 3D5JA 4HOJA 1GSEA 4GQFA 5IMZA 1XBSA 4XS4B 4BL7B 4JE1A 4NMUA 4Z7XA 4X4JA 1EP8A 1EOHA 2LSTA 3VWXA 3A5IA 2LQOA 5AGYA 1TKDB 2VLTA 1K0OA 3QAGA 5E59A 4ISDA 2R6KA 2A4HA 1UN2A 3D4TA 2QC7A 1TU8A 4ZBBA 3EPTA 4I6XA 4POBA 2FWHA 3TUEA 3QD9A 1M9BA 2G0FA 4JR6A 4V2MA 2GLRA 4EL1A 3L9VA 3IPZA 16GSA 1ZYNA 2M72A 3HVNA 5KEJA 2R2JA 4EIQA 5GAND 1A2LA 3NOFA 4AGSA 5ABRA 3VFIA 2IN3A 1ST9A 2F8FA 3GN3A 2PUKC 4E8HA 1LJRA 6GSUA 3N9JA 2IMKA 14GSA 3FHKA 1M99A 1WP0A 8GSSA 4KNDA 1EEJA 1K3OA 3BCIA 5G5EA 3BOAA 1WIKA 2XHFA 4K0GA 5H5SA 4NHWA 4JZQA 3DD3A 3RDWA 2IMIA 4IGJA 3LJRA 3IBHA 1I5GA 4O5RA 1DSBA 2EC4A 1GNEA 4MJEA 3VI7A 3GX8A 2RUEA 1FVKA 2PU9C 3WGDA 4Q5QA 2IMEA 4MJAA 4WBJA 3HJMA 3M3MA 3IC8A 3G7YA 4DSSA 3EU3A 3KEBA 3HXSA 4MPFA 3FZ4A 5DJMA 3LQ7A 3TJFA 1YZXA 5LNKe 3RAZA 2YZHA 1TDIA 5IIZA 4K9ZA 2N5BA 3KH7A 3GH6A 1OAZA 3IE3A 4EKZA 3QFBC 1MD3A 4PQHA 3Q19A 1KBNA 3ISOA 5B8BA 4MZWA 1XW9A 1V57A 3F9UA 4MJBA 4PNFA 4X43A 2V2GA 2VO4A 3F6FA 4K7NA 1B4PA 3FEUA 1AC1A 1PL1A 1FOVA 2C0GA 5DCGA 4POLA 3WT2A 2A2PA 3UARA 1I9DA 5HFIA 3LW9A 4ML6A 2CVBA 3ZRDA 3H79A 3TOTA 3FY7A 2WB9A 2VCXA 2YNXA 3CSHA 5INYA 2R0PA 2A2RA 3FZ9A 3APSA 2IL3A 1PRXA 1UC7A 2YN1A 2LRCA 4ACSA 1HYUA 4WR5A 4OWYA 1XXUA 4WXTA 1VRSD 3F3QA 5BMUA 1Y25A 1M2BA 3QDNA 3WGXA 2CT6A 2R0CA 2GGTA 2X64A 2HZFA 2MMZA 5KN0A 2L59A 3P8WA 2VL9A 3UVHA 2C0DA 2LTKA 5ECIB 1U3AA 3KIJA 1YKAA 2H75A 1PQNA 1GSQA 1TRWA 5FWGA 2MMNA 2PVQA 2B1KA 12GSA 2LV3A 1OC9A 2HI7A 3EWLA 3IK9A 4CHSA 3TKPA 1FOHA 2OBKA 2DKIA 4BWSA 5ELGA 1X0RA 4K7IA 1B9XC 4IQ1A 1M2AA 1SYXA 1T4YA 1K3LA 4L5LA 1AQXA 3HVXA 1R4WA 1SL1B 3EURA 1BAYA 1GTIA 5G5FA 5C04A 2OACA 2F3MA 3CTGA 1E2YA 1MEKA 4MMMA 1MDIA 5CNWA 2H6XA 2DKHA 1SENA 2DJJA 5JCWA 4RI7A 1YF1A 3MIXA 2Z9SA 1T00A 3I43A 2TRXA 5JCUA 2XC2A 4F9ZA 1GULA 2FNOA 1GSSA 4YKFA 1SJZA 1F9MA 1PD21 4Q5NA 3LSZA 1PSQA 1ZGNA 1K0MA 2AAWA 3KP8A 4P3YB 1TTZA 5FHIA 1BG5A 2QSIA 3GSTA 1CQGA 1DE1A 5LD0A 3TKSC 2DJ3A 2H72A 1O73A 2BMXA 1FB0A 1WMJA 1LU4A 1V2AA 3LFLA 2GQLA 1RQMA 3L9UA 1AW9A 4AJ8A 5HQPA 3EYTA 1X9SB 4PQIA 1ZMAA 1IYHA 3Q74A 2R4VA 3LYKA 3ZIVA 4YKGA 4TOPA 3GH9A 4FIWA 1ML6A 3IRAA 6GSYA 1C72A 2VD0A 4BVYB 4H86A 1DBYA 4TW5A 2OJLA 3FYGA 1GLQA 2DJKA 2HSYA 2XBQA 4KCAA 1K0DA 2B7JA 4KSMA 1MDJA 4KA0A 2LJRA 3KJYA 1R5PA 2HSMA 5DCHA 3DKSA 4F0CA 3VPTA 2H1AA 1QK8A 4BPYA 2JZTA 7GSSA 1YY7A 3L4NA 3DIEA 1ZYEA 3DGQA 2GZPA 5J5NA 3CXGA 2H1GA 4D73A 2FGXA 4GQCA 4HU9A 1R7HA 2IFQB 2K9FA 1YQ1A 2CAIA 4IJIA 1Z7RA 4F0BA 3EVIA 1EGRA 5KOXA 3CSJA 4POKA 1CQHA 2LNTA 1J0FA 3GURA 2IIYA 5D96A 2H0GA 4IKHA 3HA9A 3RPNA 2JZRA 3SWLA 1X5CA 5IMDA 5EVOA 2HSHA 3C7MA 5DAKA 2VCTA 3APOA 4RUVA 3TJGA 4OO5A 5D8IA 3I6AA 4TR4A 3LXTA 2L5OA 2YWIA 4WF4A 3KTLA 4RQRA 2TIRA 3S9FA 3M9JA 3C73A 3HJPA 1WPIA 3CTFA 1GUMA 5ECOB 1FB6A 1NW2A 3GMFA 2LRTA 2GSSA 1SU9A 4CW9A 3GRXA 1XOAA 4MCUA 5B6MA 3VI5A 4LA1A 2PERA 5IPGA 5CAXA 3FR3A 4GSNA 2YWOA 3QPMA 3HD5A 5F0GA 1JZOA 2I1UA 1XG8A 2NPBA 4GXZA 2FWGA 1K0AA 1GSFA 4AF2A 4FYCA 1XWGA 1FG4A 4XS4A 2HRFA 4HEA2 3J7Yb 2C0EA 2DIYA 4BVXA 3FK8A 3ZYWA 1X5EA 3TKQA 3CBUA 5GAPD 1PL2A 5KN2A 1ERVA 3VURA 2VM1A 1AAZA 1ACVA 1OE7A 3H93A 2O85A 3HZ8A 1H75A 4KH7A 3N5OA 1YF0A 4IJ3A 3ZREA 2H6YA 3R2QA 5G1KA 3Q18A 2G2QA 3IK7A 4YQVA 4NHZA 4EDZA 3GKKA 3CYNA 1Z5YE 5F05A 2NBSA 1ABAA 4CDOA 5BRTA 5DVBA 2I81A 1ZYQB 4HDEA 3TJJA 2GZZA 3JCML 1B48A 3ERWA 2CV4A 3U6VA 4K6XA 1NHOA 4GCIA 2YJHA 1A8YA 3C1SA 2GVPA 2VL2C 2JZSA 4PTSA 2AUVA 5F06A 4F03A 3A2WA 1BYEA 2H73A 2HZEA 4TRXA 3D22A 4K2DA 2HNLA 3PPUA 3F4RA 1V98A 4JEDA 3RHBA 4USSA 4KSOA 2FLSA 4HUAA 2H74A 1SKWB 5KOWA 2PN8A 1WJKA 4PQ1A 1ON4A 4I2TA 4HSCX 3P7XA 2KHPA 1SK1A 2RM6A 5A4WA 3DVWA 1XWKA 3GL3A 2ALBA 4GSSA 3IA1A 2P31A 1GSDA 1F37A 1TRVA 1XW6A 1BX9A 2H76A 4IS0A 3BCKA 4MZBA 5EL8A 1F6MC 1QQ2A 5B8AA 2H1BA 2VD1A 4GF0A 2JU5A 3TOUA 2H30A 1ZZYA 2CX3A 1O81A 5KN3A 3HDCA 4EF0A 1M7TA 1PN9A 4IHUA 1XFLA 2KP2A 4KX4A 4TR1A 5AIVA 3GFKA 2PGTA 3F3RA 3KMOA 2CVDA 3ERFA 3ZIJA 3CMIA 3CSIA 1M2DA 4KF9A 1QUWA 3MWHA 1YKCA 4Z2UA 2PWJA 4N0VA 1QGVA 5B6NA 2MMOA 2DIZA 4PUFC 1FW1A 3BJ5A 4N11A 2X8HA 3M9KA 1GNWA 3W8JA 5J9BA 1N2AA 3KZQA 4ZB6A 5CYYA 3UMAA 2ON7A 2JSZA 4XCSA 3GIXA 5ECRB 3DMLA 3LGCA 3ME8A 5F8BA 2IWTA 1WE0A 2K8SA 2J9HA 3MAKA 1XZOA 1E6BA 2WDUA 3ERGA 1EZKA 2REMA 1O8XA 3M0FA 4ECJA 2N5AA 3P2AA 1VF1A 2PBJA 4EVMA 1EV4A 5GZZB 5HR2A 4Z2TA 3ZVJA 2ON5A 3CQFA 1U87A 2B7KA 2VLVA 2X8GA 5IMFA 2EIRA 2NDOA 1ZCPA 3IHQA 2E7PA 1S3AA 4MDCA 2OE0A 3UIWA 1Z6NA 2H19A 1F3BA 1KNGA 5GSSA 4WETA 1PA3A 3EE2A 4V1Ag 3F0IA 3M1GA 3VPQA 2MYGA 2N5FA 3F4SA 4EIPA 2XBIA 2CAQA 13GSA 1U3IA 3ZFBA 18GSA 2WFCA 4LMWA 1XCCA 1EP7A 3FZAA 1PMTA 3OR5A 5H5QA 2I3YA 1OE8A 4GTUA 3MYDA 2H0HA 5L71A 2CA8A 3BBYA 2DJ2A 2WS2A 2B6MA 1U6TA 4TN8A 4MF5A 6GSWA 1GTAA 1XW5A 1LBKA 2IPAA 1R26A 1GH2A 1HNAA 3TB2A 4K0NA 4MH2A 5CRWA 2C80A 3GA4A 3F6DA 3ED3A 4OO4A 5J3RA 2V32A 1URMA 1EGOA 2DJ1A 2R3XA 1SJ6A 2GDRA 1THOA 1VGLA 2FUG2 2I4AA 3I69A 2LKUA 2V6OA 4FYUA 5EPFA 3TDGA 1B9YC 4L8EA 5ENUA 3U5RE 4N30A 1X9MB 5IMVA 5DJLA 4FYBA 2E2MA 2RIIA 1YEXA 4I8BA 2YWNA 3C8EA 4PUAA 5IOXA 2RUFA 4WF5A 5DQYA 3HVVA 5ID2A 3F63A 3PH9A 3LG6A 1AQWA 3F4TA 4V2NA 2JSYA 1G6WA 3FZ5A 1ERTA 2YP6A 1HNBA 2C4JA 2X4AA 3PR8A 2B5YA 4TR3A 1T4ZA 4YAVA 4K5RA 4GLTA 3A5WA 1JZRA 3RBTA 3IXRA 2OA7A 1DUGA 4G0LA 5ECNB 4AJ6A 5DQSA 3D0ZA 3QR6A 2O7KA 2AYTA 3VLNA 1OC9B 2FY6A 4KDUA 3R3EA 1MD4A 2H1DA 3V1WA 2L57A 2AB6A 1K0CA 4Z2RA 3A3TA 3QAVA 4X1UA 5GSTA 3H4KA 5ECSA 4K2XA 1GLPA 2MZCA 3ZZXA 2P5QA 1HD2A 1PKZA 1T3BA 2DC5A 2K18A 2GT5A 1QMVA 2FHEA 2VIMA 4G2EA 2E0QA 3UL3A 1M3IA 2YPMA 5ECHB 2GSRA 1AIUA 4L0UA 1M0UA 2I9HA 1ILOA 3ME7A 5HR0A 4IW9A 2H6ZA 2VL3A 1Q98A 4MLYA 4G0KA 3W8SA 19GSA 4XS1A 2OBIA 4GRFA 3ZMLA 3M8NA 2H01A 2IMFA 3GX0A 4HZ4A 4PNGA 2F8AA 5IQYA 4EXJA 3QAWA 3UVTA 17GSA 3EU4A 5LCZA 2QA2A 3O3TA 4KDXA 5JWQB 2EIQA 5DALA 3GTUB 3L0HA 1KEBA 2KP1A 3IOSA 1EOGA 2KLXA 3L78A 3QOUA 4ILFA 4CY6A 2TRCP 2B5XA 2GQMA 4ZILA 1ERUA 1USBA 2HT9A 2LS5A 2H0IA 1YDKA 1N8JA 1V9WA 3O6TA 2YOIA 2HLSA 5D9WA 5ECPB 3I9V2 1K3YA 2OKAA 3DXBA 4KCEA 2JADA 4MF6A 3UOMA 2GT6A 4WEYA 3US3A 4V2LA 2V41A 3L9SA 5G30A 2RLIA 4O7HA 4ZB9A 6GSTA 1FHEA 3EMPA 3LEFA 2VLUA 2YANA 4NXIA 2GQKA 2IMDA 1AQVA 4IQAA 1KTEA 5CRHA 3H8QA 4CY8A 1XWAA 5ECLB 9GSSA 2YV7A 5ECMB 4TXVA 3O76A 5JWOB 3KXOA 4IBPA 5AISA 11GSA 5G2ZA 4D73B 2WGRA 1X5DA 2M80A 1THXA 3ZFLA 1A24A 1PX7A 1SD9A 3KD0A 4KW6A 5HR3A 2X8CA 1ZL9A 1J08A 1EWXA 5HR1A 4JU5A 2ZCTA 1FVJA 4ULXA 2WRTA 1OC8A 4HZ2A 4K8MA 3D6IA 3KP9A 5ELAA 2VM2A 1TOFA 4RQXA 5G1LA 2LUSA 4HQSA 5HFGA 4BL7A 3F8UA 1PN0A 2K6VA 1RK4A 4PXOA 3SBCA 4DSRA 1A2MA 5A5KA 1XWCA 5DAKB 4Q5RA 4EDYA 3GNJA 2GTUA 3TRXA 4ECIA 5J41A 1GUKA 3GL5A 1JHBA 2B5EA 2LJAA 3TKRA 1GSUA 4XRDA 4IN0A 2FCHA 4EUYA 2VOCA 4QL9A 1SJIA 3FKFA 4G9HA 3ZLPA 3TKSE 1SL2B 1UVZA 3CRUA 3MSZA 4MNNA 1PKWA 4GSTA 2L4CA 4V1Ap 1EV9A 2HRAA 4ML1A 2JACA 4WBRD 4ECCA 2HRNA 4F2IA 1GP1A 4AJ7A 1HNCA 2C3QA 5D93A 2FA4A 1GTBA 5COHA 3C1RA 3TRQA 4LL1B 4HS1A 1O85A 4BWQA 1YEPA 4ZBDA 4RI6A 3KH9A 5C00A 1GL8A 1R5AA 5HFKA 3UAPA 4BVXB 5CO3A 3HVSA 3HYPA 4QQ7A 1K0BA 3KMNA 2VL2A 4PGTA 3EC3A 1K0NA 2R0GA 3WYWA 3UJ1A 4WKWA 4K1FA 2R37A 1TU7A 4I2UA 1GTUA 1S3CA 4XIHA 1Z3EA 4TXOB 5A4UA 4MZCA 1X9WB 3W6GA 2VCVA 1GSYA 1OVNA 4A5PA 2B3SA 4I5QA 1Z6MA 3MNGA 3IAS2 4F82A 4O32A 3IV4A 2GS3A 3HKRA 4QL7A 5DBQA 4OFTA 5AIXA 1B4QA 4ZBAA 2HZEB 1XPVA 2MMAA 4EE0A 1JFUA 4YH2A 2GSQA 2L6CA 4EO3A 3ZTLA 1T7PB 3GHAA 1FAAA 3NZNA 4KB3A 3EINA 3NIVA 4HU7A 3A2XA 4ZB8A 1SKSB 1TK8B 3TGZA 3VWWA 2FWEA 3FMWA 5IOWA 4X0XA 5D73A 1T8EB 1WWJA 2RM5A 1NHYA 20GSA 5CP1A 2P0GA 1U88A 3BD2A 4OCFA 1XVWA 3EMXA 3E3EA 2V6KA 1BJXA 2VCZA 3TJBA 3LORA 4JR4A 4OFNA 2QGVA 1NSWA 1G0TA 1O6JA 3KGKA 3HZ4A 3HCZA 1W4VA 3GSSA 4TR1B 1NM3A 4FO5A 3H1NA 1QFNA 4KUNA 1ERWA 3GKXA 3FW2A 2DLXA 4PX1A 3HY2A 4J56E 3FR6A 1UA5A 2VCWA 1A0FA 3MDKA 2O87A 3LXZA 5IO2A 4POMA 3IDVA 4DSSB 1F2EA 1OYJA 2WCIA 1J9BA 1SD8A 4EC0A 2GSTA 3D4MA 1QXHA 3E9JB 3G7JA 4ID0A 2XPDA 2M46A 5G31A 4L5OA 5J4UA 3ZITA 1WOUA 4MP4A 2B1LA 4IVFA 4NV2A 4N0ZA 2WULA 3DYRA 3QCPA 1Y6EA 4IP1A 1MDKA 5D9XA 1S3RA 1TJDA 3FR9A 1ZYPA 4K7OA 4MK3A 3E0UA 2HRKA 1GWCA 2PPTA 2F51A 1ZOFA 2C1YA 3P90A 1AUCA 3AY8A 2FWFA 3KTBA 1MTCA 4OCEA 3LYPA 3IR4A 1TP9A 3GUSA 4LL4B 2ZUPA 4G10A 2YCDA 1GRXA 4BA7A 4ZIJA 2NTOA 3QFAC 2LQQA 2QKEA 1G7OA 5IMAA 3K8NA 4IP6A 1XOBA 3ZL5A 1A8LA 2X49A 3GKNA 2A4VA 1VF2A 3IAM2 1SK2A 4BIKA 5ECKB 6GSXA 2IJYA 2OE1A 4KGIA 1A2JA 4HJ2A 3G7IA 2HXKA 5CRDA 1XVQA 4KDYA 5J9CA 4BVYA 2WZ9A 1HQOA 2FA8A 4NV5A 3D21A 2LRNA 4N10A 1Z7PA 2BTOT 4YAPA 1H4OA 5ECQB 1BQ7A 1JZWA 3GYKA 4PURA 2KOKA 4XTSA 3VK9A 4JRRA 4O92A 4ZXGA 1AXDA 2F9SA 3GTUA 4O5UA 3VWUA 3DRNA 3UEMA 4OD7A 4ICYA 4MF7A 1IYIA 1SK0A 4KE3A 1Q4JA 2H70A 4OMVA 1V58A 1TRSA 2IFQA 2QA1A 2VAFA 3KM6A 1VF3A 3CRTA 2L6DA 3TKSA 2C0FA 1TK5B 5ID2B 5IMCA 3KCMA 1YJ6A 2HFDA 4XHMA 3TJKA 1RW1A 1JLVA 4HI7A 5D9TA 3GKMA 1Z9HA 3RPPA 2O89A 4ZL7A 5B7CA 1OKTA 1GUHA 3WT1A 3ZVJD 2R5GA 5CRGA 10GSA 3C71A 4J57E 2MBTA 2DJ0A 4MJCA 1SL0B 4J2FA 3DVXA 3WD6A 5EY6A 2JL4A 4ECBA 1G7EA 4L0WA 5JWRB 3G9BA 2C3NA 5KN1A 2OE3A 1WRYA 4WR4A 3APQA 1S3DA 2DBCA 2V1MA 4MPGA 5F07A 1TRUA 2EIOA 4JBBA 3WGEA 2H71A 1TK0B 2PMTA 4O5QA 3A2VA 5AN1A 5H5RA 3DWVA 2CZ3A 4HQZA 1TW9A 2C8UA 4TR0A 4IELA 3IHGA 2D2ZA 3PGTA 1TI3A 4LLRA 2OADA 2X99A 1OC3A 5JCGA 5CREA
chains in the Genus database with same CATH topology
1DE2A 1JLWA 2DSAA 1F3AA 4MH3A 2E2GA 3IC4A 4XS6A 3TCOA 1XIYA 3FRCA 4E8EA 5DALB 4I97A 2UZ8A 2P5RA 3Q6OA 4YQMA 1B8XA 2ES7A 2BJXA 4NWYA 2CQ9A 2NVLA 1G6YA 2AJQB 5IO0A 3RHCA 2DMLA 3LWAA 2LNSA 3ZMKA 2DMMA 5A4VA 5DDLA 3DEXA 22GSA 1A0RP 3TRPA 1O7UA 4YQUA 2CZ2A 4FH8A 4OFMA 2AHEA 4DSQA 2HE3A 5FT3A 4ZL8A 4XRAA 1A23A 2XPEA 3UBKA 4DEJA 4GWRA 4TKYA 2CVKA 6GSVA 2H66A 4G19A 5IPHA 3GV1A 1PGTA 4DVCA 5D9VA 1XWBA 1O8WA 2YWMA 2YV9A 2YZUA 2VUPA 1TXXA 4NAXA 4LMVA 2CX4A 1FO5A 2AV4A 2K8VA 2C3TA 4ZL9A 2YJ7A 2FD3A 2O8VB 2ZNMA 2WJUA 2KUCA 3UBLA 2H8LA 1OKDA 4HJMA 3HJOA 4MA9A 1V40A 4G0IA 1M9AA 4TVEA 4K5SA 1PX6A 2LJKA 4NPBA 3HHVA 3VWVA 3PINA 2MBSA 2HYXA 1BEDA 2VCQA 1JZDA 1SKRB 6GSSA 2PVOC 2GZYA 2A2SA 2LEGA 2L4QA 1VF4A 4TXOA 2J23A 4KAEA 5E4WA 1SYRA 1T1VA 4Q5FA 3QMXA 5IM9A 1EEMA 4MABA 3J7Yk 2L5LA 1TI1A 1W89A 4FQUA 3D5JA 4HOJA 1GSEA 4GQFA 5IMZA 1XBSA 4XS4B 4BL7B 4JE1A 4NMUA 4Z7XA 4X4JA 1EP8A 1EOHA 2LSTA 3VWXA 3A5IA 2LQOA 5AGYA 1TKDB 2VLTA 1K0OA 3QAGA 5E59A 4ISDA 2R6KA 2A4HA 1UN2A 3D4TA 2QC7A 1TU8A 4ZBBA 3EPTA 4I6XA 4POBA 2FWHA 3TUEA 3QD9A 1M9BA 2G0FA 4JR6A 4V2MA 2GLRA 4EL1A 3L9VA 3IPZA 16GSA 1ZYNA 2M72A 5KEJA 2R2JA 4EIQA 5GAND 1A2LA 3NOFA 4AGSA 5ABRA 3VFIA 2IN3A 1ST9A 2F8FA 3GN3A 2PUKC 4E8HA 1LJRA 6GSUA 3N9JA 2IMKA 14GSA 3FHKA 1M99A 1WP0A 8GSSA 4KNDA 1EEJA 1K3OA 3BCIA 5G5EA 3BOAA 1WIKA 2XHFA 4K0GA 5H5SA 4NHWA 4JZQA 3DD3A 3RDWA 2IMIA 4IGJA 3LJRA 3IBHA 1I5GA 4O5RA 1DSBA 2EC4A 1GNEA 4MJEA 3VI7A 3GX8A 2RUEA 1FVKA 2PU9C 3WGDA 4Q5QA 2IMEA 4MJAA 4WBJA 3HJMA 3M3MA 3IC8A 3G7YA 4DSSA 3EU3A 3KEBA 3HXSA 4MPFA 3FZ4A 5DJMA 3LQ7A 3TJFA 1YZXA 5LNKe 3RAZA 2YZHA 1TDIA 5IIZA 4K9ZA 2N5BA 3KH7A 3GH6A 1OAZA 3IE3A 4EKZA 3QFBC 1MD3A 4PQHA 3Q19A 1KBNA 3ISOA 5B8BA 4MZWA 1XW9A 1V57A 3F9UA 4MJBA 4PNFA 4X43A 2V2GA 2VO4A 3F6FA 4K7NA 1B4PA 3FEUA 1AC1A 1PL1A 1FOVA 2C0GA 5DCGA 4POLA 3WT2A 2A2PA 3UARA 1I9DA 5HFIA 3LW9A 4ML6A 2CVBA 3ZRDA 3H79A 3TOTA 3FY7A 2WB9A 2VCXA 2YNXA 3CSHA 5INYA 2R0PA 2A2RA 3FZ9A 3APSA 2IL3A 1PRXA 1UC7A 2YN1A 2LRCA 4ACSA 1HYUA 4WR5A 4OWYA 1XXUA 4WXTA 1VRSD 3F3QA 5BMUA 1Y25A 1M2BA 3QDNA 3WGXA 2CT6A 2R0CA 2GGTA 2X64A 2HZFA 2MMZA 5KN0A 2L59A 3P8WA 2VL9A 3UVHA 2C0DA 2LTKA 5ECIB 1U3AA 3KIJA 1YKAA 2H75A 1PQNA 1GSQA 1TRWA 5FWGA 2MMNA 2PVQA 2B1KA 12GSA 2LV3A 1OC9A 2HI7A 3EWLA 3IK9A 4CHSA 3TKPA 1FOHA 2OBKA 2DKIA 4BWSA 5ELGA 1X0RA 4K7IA 1B9XC 4IQ1A 1M2AA 1SYXA 1T4YA 1K3LA 4L5LA 1AQXA 3HVXA 1R4WA 1SL1B 3EURA 1BAYA 1GTIA 5G5FA 5C04A 2OACA 2F3MA 3CTGA 1E2YA 1MEKA 4MMMA 1MDIA 5CNWA 2H6XA 2DKHA 1SENA 2DJJA 5JCWA 4RI7A 1YF1A 3MIXA 2Z9SA 1T00A 3I43A 2TRXA 5JCUA 2XC2A 4F9ZA 1GULA 2FNOA 1GSSA 4YKFA 1SJZA 1F9MA 1PD21 4Q5NA 3LSZA 1PSQA 1ZGNA 1K0MA 2AAWA 3KP8A 4P3YB 1TTZA 5FHIA 1BG5A 2QSIA 3GSTA 1CQGA 1DE1A 5LD0A 3TKSC 2DJ3A 2H72A 1O73A 2BMXA 1FB0A 1WMJA 1LU4A 1V2AA 3LFLA 2GQLA 1RQMA 3L9UA 1AW9A 4AJ8A 5HQPA 3EYTA 1X9SB 4PQIA 1ZMAA 1IYHA 3Q74A 2R4VA 3LYKA 3ZIVA 4YKGA 4TOPA 3GH9A 4FIWA 1ML6A 3IRAA 6GSYA 1C72A 2VD0A 4BVYB 4H86A 1DBYA 4TW5A 2OJLA 3FYGA 1GLQA 2DJKA 2HSYA 2XBQA 4KCAA 1K0DA 2B7JA 4KSMA 1MDJA 4KA0A 2LJRA 3KJYA 1R5PA 2HSMA 5DCHA 3DKSA 4F0CA 3VPTA 2H1AA 1QK8A 4BPYA 2JZTA 7GSSA 1YY7A 3L4NA 3DIEA 1ZYEA 3DGQA 2GZPA 5J5NA 3CXGA 2H1GA 4D73A 2FGXA 4GQCA 4HU9A 1R7HA 2IFQB 2K9FA 1YQ1A 2CAIA 4IJIA 1Z7RA 4F0BA 3EVIA 1EGRA 5KOXA 3CSJA 4POKA 1CQHA 2LNTA 1J0FA 3GURA 2IIYA 5D96A 2H0GA 4IKHA 3HA9A 3RPNA 2JZRA 3SWLA 1X5CA 5IMDA 5EVOA 2HSHA 3C7MA 5DAKA 2VCTA 3APOA 4RUVA 3TJGA 4OO5A 5D8IA 3I6AA 4TR4A 3LXTA 2L5OA 2YWIA 4WF4A 3KTLA 4RQRA 2TIRA 3S9FA 3M9JA 3C73A 3HJPA 1WPIA 3CTFA 1GUMA 5ECOB 1FB6A 1NW2A 3GMFA 2LRTA 2GSSA 1SU9A 4CW9A 3GRXA 1XOAA 4MCUA 5B6MA 3VI5A 4LA1A 2PERA 5IPGA 5CAXA 3FR3A 4GSNA 2YWOA 3QPMA 3HD5A 5F0GA 1JZOA 2I1UA 2NPBA 4GXZA 2FWGA 1K0AA 1GSFA 4AF2A 4FYCA 1XWGA 1FG4A 4XS4A 2HRFA 4HEA2 3J7Yb 2C0EA 2DIYA 4BVXA 3FK8A 3ZYWA 1X5EA 3TKQA 3CBUA 5GAPD 1PL2A 5KN2A 1ERVA 3VURA 2VM1A 1AAZA 1ACVA 1OE7A 3H93A 2O85A 3HZ8A 1H75A 4KH7A 3N5OA 1YF0A 4IJ3A 3ZREA 2H6YA 3R2QA 5G1KA 3Q18A 2G2QA 3IK7A 4YQVA 4NHZA 4EDZA 3GKKA 3CYNA 1Z5YE 5F05A 2NBSA 1ABAA 4CDOA 5BRTA 5DVBA 2I81A 1ZYQB 4HDEA 3TJJA 2GZZA 3JCML 1B48A 3ERWA 2CV4A 3U6VA 4K6XA 1NHOA 4GCIA 2YJHA 1A8YA 3C1SA 2GVPA 2VL2C 2JZSA 4PTSA 2AUVA 5F06A 4F03A 3A2WA 1BYEA 2H73A 2HZEA 4TRXA 3D22A 4K2DA 2HNLA 3PPUA 3F4RA 1V98A 4JEDA 3RHBA 4USSA 4KSOA 2FLSA 4HUAA 2H74A 1SKWB 5KOWA 2PN8A 1WJKA 4PQ1A 1ON4A 4I2TA 3P7XA 2KHPA 1SK1A 2RM6A 5A4WA 3DVWA 1XWKA 3GL3A 2ALBA 4GSSA 3IA1A 2P31A 1GSDA 1F37A 1TRVA 1XW6A 1BX9A 2H76A 4IS0A 3BCKA 4MZBA 5EL8A 1F6MC 1QQ2A 5B8AA 2H1BA 2VD1A 4GF0A 2JU5A 3TOUA 2H30A 1ZZYA 2CX3A 1O81A 5KN3A 3HDCA 4EF0A 1M7TA 1PN9A 4IHUA 1XFLA 2KP2A 4KX4A 4TR1A 5AIVA 3GFKA 2PGTA 3F3RA 3KMOA 2CVDA 3ERFA 3ZIJA 3CMIA 3CSIA 1M2DA 4KF9A 1QUWA 3MWHA 1YKCA 4Z2UA 2PWJA 4N0VA 1QGVA 5B6NA 2MMOA 2DIZA 4PUFC 1FW1A 3BJ5A 4N11A 2X8HA 3M9KA 1GNWA 3W8JA 5J9BA 1N2AA 3KZQA 4ZB6A 5CYYA 3UMAA 2ON7A 2JSZA 4XCSA 3GIXA 5ECRB 3DMLA 3LGCA 3ME8A 5F8BA 2IWTA 1WE0A 2K8SA 2J9HA 3MAKA 1XZOA 1E6BA 2WDUA 3ERGA 1EZKA 2REMA 1O8XA 3M0FA 4ECJA 2N5AA 3P2AA 1VF1A 2PBJA 4EVMA 1EV4A 5GZZB 5HR2A 4Z2TA 3ZVJA 2ON5A 1U87A 2B7KA 2VLVA 2X8GA 5IMFA 2EIRA 2NDOA 1ZCPA 3IHQA 2E7PA 1S3AA 4MDCA 2OE0A 3UIWA 1Z6NA 2H19A 1F3BA 1KNGA 5GSSA 4WETA 1PA3A 3EE2A 4V1Ag 3F0IA 3M1GA 3VPQA 2MYGA 2N5FA 3F4SA 4EIPA 2XBIA 2CAQA 13GSA 1U3IA 3ZFBA 18GSA 2WFCA 4LMWA 1XCCA 1EP7A 3FZAA 1PMTA 3OR5A 5H5QA 2I3YA 1OE8A 4GTUA 3MYDA 2H0HA 5L71A 2CA8A 3BBYA 2DJ2A 2WS2A 2B6MA 1U6TA 4TN8A 4MF5A 6GSWA 1GTAA 1XW5A 1LBKA 2IPAA 1R26A 1GH2A 1HNAA 3TB2A 4K0NA 4MH2A 5CRWA 2C80A 3GA4A 3F6DA 3ED3A 4OO4A 5J3RA 2V32A 1URMA 1EGOA 2DJ1A 2R3XA 1SJ6A 2GDRA 1THOA 1VGLA 2FUG2 2I4AA 3I69A 2LKUA 2V6OA 4FYUA 5EPFA 3TDGA 1B9YC 4L8EA 5ENUA 3U5RE 4N30A 1X9MB 5IMVA 5DJLA 4FYBA 2E2MA 2RIIA 1YEXA 4I8BA 2YWNA 3C8EA 4PUAA 5IOXA 2RUFA 4WF5A 5DQYA 3HVVA 5ID2A 3F63A 3PH9A 3LG6A 1AQWA 3F4TA 4V2NA 2JSYA 1G6WA 3FZ5A 1ERTA 2YP6A 1HNBA 2C4JA 2X4AA 3PR8A 2B5YA 4TR3A 1T4ZA 4YAVA 4K5RA 4GLTA 3A5WA 1JZRA 3RBTA 3IXRA 2OA7A 1DUGA 4G0LA 5ECNB 4AJ6A 5DQSA 3D0ZA 3QR6A 2O7KA 2AYTA 3VLNA 1OC9B 2FY6A 4KDUA 3R3EA 1MD4A 2H1DA 3V1WA 2L57A 2AB6A 1K0CA 4Z2RA 3A3TA 3QAVA 4X1UA 5GSTA 3H4KA 5ECSA 4K2XA 1GLPA 2MZCA 3ZZXA 2P5QA 1HD2A 1PKZA 1T3BA 2DC5A 2K18A 2GT5A 1QMVA 2FHEA 2VIMA 4G2EA 2E0QA 3UL3A 2YPMA 5ECHB 2GSRA 1AIUA 4L0UA 1M0UA 2I9HA 1ILOA 3ME7A 5HR0A 4IW9A 2H6ZA 2VL3A 1Q98A 4MLYA 4G0KA 3W8SA 19GSA 4XS1A 2OBIA 4GRFA 3ZMLA 3M8NA 2H01A 2IMFA 3GX0A 4HZ4A 4PNGA 2F8AA 5IQYA 4EXJA 3QAWA 3UVTA 17GSA 3EU4A 5LCZA 2QA2A 3O3TA 4KDXA 5JWQB 2EIQA 5DALA 3GTUB 3L0HA 1KEBA 2KP1A 3IOSA 1EOGA 2KLXA 3L78A 3QOUA 4ILFA 4CY6A 2TRCP 2B5XA 2GQMA 4ZILA 1ERUA 1USBA 2HT9A 2LS5A 2H0IA 1YDKA 1N8JA 1V9WA 3O6TA 2YOIA 2HLSA 5D9WA 5ECPB 3I9V2 1K3YA 2OKAA 3DXBA 4KCEA 2JADA 4MF6A 3UOMA 2GT6A 4WEYA 3US3A 4V2LA 2V41A 3L9SA 5G30A 2RLIA 4O7HA 4ZB9A 6GSTA 1FHEA 3EMPA 3LEFA 2VLUA 2YANA 4NXIA 2GQKA 2IMDA 1AQVA 4IQAA 1KTEA 5CRHA 3H8QA 4CY8A 1XWAA 5ECLB 9GSSA 2YV7A 5ECMB 4TXVA 3O76A 5JWOB 3KXOA 4IBPA 5AISA 11GSA 5G2ZA 4D73B 2WGRA 1X5DA 2M80A 1THXA 3ZFLA 1A24A 1PX7A 1SD9A 3KD0A 4KW6A 5HR3A 2X8CA 1ZL9A 1J08A 1EWXA 5HR1A 4JU5A 2ZCTA 1FVJA 4ULXA 2WRTA 1OC8A 4HZ2A 4K8MA 3D6IA 3KP9A 5ELAA 2VM2A 1TOFA 4RQXA 5G1LA 2LUSA 4HQSA 5HFGA 4BL7A 3F8UA 1PN0A 2K6VA 1RK4A 4PXOA 3SBCA 4DSRA 1A2MA 5A5KA 1XWCA 5DAKB 4Q5RA 4EDYA 3GNJA 2GTUA 3TRXA 4ECIA 5J41A 1GUKA 3GL5A 1JHBA 2B5EA 2LJAA 3TKRA 1GSUA 4XRDA 4IN0A 2FCHA 4EUYA 2VOCA 4QL9A 1SJIA 3FKFA 4G9HA 3ZLPA 3TKSE 1SL2B 1UVZA 3CRUA 3MSZA 4MNNA 1PKWA 4GSTA 2L4CA 4V1Ap 1EV9A 2HRAA 4ML1A 2JACA 4WBRD 4ECCA 2HRNA 4F2IA 1GP1A 4AJ7A 1HNCA 2C3QA 5D93A 2FA4A 1GTBA 5COHA 3C1RA 3TRQA 4LL1B 4HS1A 1O85A 4BWQA 1YEPA 4ZBDA 4RI6A 3KH9A 5C00A 1GL8A 1R5AA 5HFKA 3UAPA 4BVXB 5CO3A 3HVSA 3HYPA 4QQ7A 1K0BA 3KMNA 2VL2A 4PGTA 3EC3A 1K0NA 2R0GA 3WYWA 3UJ1A 4WKWA 4K1FA 2R37A 1TU7A 4I2UA 1GTUA 1S3CA 4XIHA 1Z3EA 4TXOB 5A4UA 4MZCA 1X9WB 3W6GA 2VCVA 1GSYA 1OVNA 4A5PA 2B3SA 4I5QA 1Z6MA 3MNGA 3IAS2 4F82A 4O32A 3IV4A 2GS3A 3HKRA 4QL7A 5DBQA 4OFTA 5AIXA 1B4QA 4ZBAA 2HZEB 1XPVA 2MMAA 4EE0A 1JFUA 4YH2A 2GSQA 2L6CA 4EO3A 3ZTLA 1T7PB 3GHAA 1FAAA 3NZNA 4KB3A 3EINA 3NIVA 4HU7A 3A2XA 4ZB8A 1SKSB 1TK8B 3TGZA 3VWWA 2FWEA 3FMWA 5IOWA 4X0XA 5D73A 1T8EB 1WWJA 2RM5A 1NHYA 20GSA 5CP1A 2P0GA 1U88A 3BD2A 4OCFA 1XVWA 3EMXA 3E3EA 2V6KA 1BJXA 2VCZA 3TJBA 3LORA 4JR4A 4OFNA 2QGVA 1NSWA 1G0TA 1O6JA 3KGKA 3HZ4A 3HCZA 1W4VA 3GSSA 4TR1B 1NM3A 4FO5A 3H1NA 1QFNA 4KUNA 1ERWA 3GKXA 3FW2A 2DLXA 4PX1A 3HY2A 4J56E 3FR6A 1UA5A 2VCWA 1A0FA 3MDKA 2O87A 3LXZA 5IO2A 4POMA 3IDVA 4DSSB 1F2EA 1OYJA 2WCIA 1J9BA 1SD8A 4EC0A 2GSTA 3D4MA 1QXHA 3E9JB 3G7JA 4ID0A 2XPDA 2M46A 5G31A 4L5OA 5J4UA 3ZITA 1WOUA 4MP4A 2B1LA 4IVFA 4NV2A 4N0ZA 2WULA 3DYRA 3QCPA 1Y6EA 4IP1A 1MDKA 5D9XA 1TJDA 3FR9A 1ZYPA 4K7OA 4MK3A 3E0UA 2HRKA 1GWCA 2PPTA 2F51A 1ZOFA 2C1YA 3P90A 1AUCA 3AY8A 2FWFA 3KTBA 1MTCA 4OCEA 3LYPA 3IR4A 1TP9A 3GUSA 4LL4B 2ZUPA 4G10A 2YCDA 1GRXA 4BA7A 4ZIJA 2NTOA 3QFAC 2LQQA 2QKEA 1G7OA 5IMAA 3K8NA 4IP6A 1XOBA 3ZL5A 1A8LA 2X49A 3GKNA 2A4VA 1VF2A 3IAM2 1SK2A 5ECKB 6GSXA 2IJYA 2OE1A 4KGIA 1A2JA 4HJ2A 3G7IA 2HXKA 5CRDA 1XVQA 4KDYA 5J9CA 4BVYA 2WZ9A 1HQOA 2FA8A 4NV5A 3D21A 2LRNA 4N10A 1Z7PA 2BTOT 4YAPA 1H4OA 5ECQB 1BQ7A 1JZWA 3GYKA 4PURA 2KOKA 4XTSA 3VK9A 4JRRA 4O92A 4ZXGA 1AXDA 2F9SA 3GTUA 4O5UA 3VWUA 3DRNA 3UEMA 4OD7A 4ICYA 4MF7A 1IYIA 1SK0A 4KE3A 1Q4JA 2H70A 4OMVA 1V58A 1TRSA 2IFQA 2QA1A 2VAFA 3KM6A 1VF3A 3CRTA 2L6DA 3TKSA 2C0FA 1TK5B 5ID2B 5IMCA 3KCMA 1YJ6A 2HFDA 4XHMA 3TJKA 1RW1A 1JLVA 4HI7A 5D9TA 3GKMA 1Z9HA 3RPPA 2O89A 4ZL7A 5B7CA 1OKTA 1GUHA 3WT1A 3ZVJD 2R5GA 5CRGA 10GSA 3C71A 4J57E 2MBTA 2DJ0A 4MJCA 1SL0B 4J2FA 3DVXA 3WD6A 5EY6A 2JL4A 4ECBA 1G7EA 4L0WA 5JWRB 3G9BA 2C3NA 5KN1A 2OE3A 1WRYA 4WR4A 3APQA 1S3DA 2DBCA 2V1MA 4MPGA 5F07A 1TRUA 2EIOA 4JBBA 3WGEA 2H71A 1TK0B 2PMTA 4O5QA 3A2VA 5AN1A 5H5RA 3DWVA 2CZ3A 4HQZA 1TW9A 2C8UA 4TR0A 4IELA 3IHGA 2D2ZA 3PGTA 1TI3A 4LLRA 2OADA 2X99A 1OC3A 5JCGA 5CREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DE2 A;  1JLW A;  2DSA A;  1F3A A;  4MH3 A;  2E2G A;  3IC4 A;  4XS6 A;  3TCO A;  1XIY A;  3FRC A;  4E8E A;  5DAL B;  4I97 A;  3Q6O A;  2P5R A;  4YQM A;  1B8X A;  2ES7 A;  2BJX A;  4NWY A;  2CQ9 A;  2NVL A;  1G6Y A;  2AJQ B;  5IO0 A;  3RHC A;  2DML A;  3LWA A;  2LNS A;  3ZMK A;  2DMM A;  5A4V A;  5DDL A;  3DEX A;  22GS A;  1A0R P;  3TRP A;  1O7U A;  4YQU A;  2CZ2 A;  4FH8 A;  4OFM A;  2AHE A;  4DSQ A;  2HE3 A;  5FT3 A;  4ZL8 A;  4XRA A;  1A23 A;  2XPE A;  3UBK A;  4DEJ A;  4GWR A;  4TKY A;  2CVK A;  6GSV A;  2H66 A;  4G19 A;  5IPH A;  3GV1 A;  1PGT A;  4DVC A;  5D9V A;  1XWB A;  1O8W A;  2YWM A;  2YV9 A;  2YZU A;  2VUP A;  1TXX A;  4NAX A;  4LMV A;  2CX4 A;  1FO5 A;  2AV4 A;  2K8V A;  2C3T A;  4ZL9 A;  2YJ7 A;  2FD3 A;  2O8V B;  2ZNM A;  2WJU A;  2KUC A;  3UBL A;  2H8L A;  1OKD A;  4HJM A;  3HJO A;  4MA9 A;  1V40 A;  1M9A A;  4TVE A;  1PX6 A;  2LJK A;  4NPB A;  3HHV A;  3VWV A;  3PIN A;  2MBS A;  2HYX A;  1BED A;  2VCQ A;  1JZD A;  1SKR B;  6GSS A;  2PVO C;  2GZY A;  2A2S A;  2LEG A;  2L4Q A;  1VF4 A;  4TXO A;  2J23 A;  4KAE A;  5E4W A;  1SYR A;  1T1V A;  4Q5F A;  3QMX A;  5IM9 A;  1EEM A;  4MAB A;  3J7Y k;  2L5L A;  1TI1 A;  1W89 A;  3D5J A;  4HOJ A;  1GSE A;  4GQF A;  5IMZ A;  1XBS A;  4XS4 B;  4JE1 A;  4NMU A;  4Z7X A;  1EP8 A;  1EOH A;  2LST A;  3VWX A;  2LQO A;  5AGY A;  1TKD B;  2VLT A;  1K0O A;  3QAG A;  5E59 A;  4ISD A;  2R6K A;  1UN2 A;  3D4T A;  2QC7 A;  1TU8 A;  4ZBB A;  4I6X A;  4POB A;  2FWH A;  3TUE A;  3QD9 A;  1M9B A;  2G0F A;  4JR6 A;  4V2M A;  2GLR A;  4EL1 A;  3L9V A;  3IPZ A;  16GS A;  2M72 A;  5KEJ A;  2R2J A;  5GAN D;  1A2L A;  3NOF A;  4AGS A;  5ABR A;  3VFI A;  2IN3 A;  1ST9 A;  2F8F A;  3GN3 A;  2PUK C;  4E8H A;  1LJR A;  6GSU A;  3N9J A;  2IMK A;  14GS A;  3FHK A;  1M99 A;  1WP0 A;  8GSS A;  4KND A;  1EEJ A;  1K3O A;  3BCI A;  5G5E A;  3BOA A;  1WIK A;  2XHF A;  4K0G A;  5H5S A;  4NHW A;  4JZQ A;  3DD3 A;  3RDW A;  2IMI A;  4IGJ A;  3LJR A;  3IBH A;  1I5G A;  4O5R A;  1DSB A;  2EC4 A;  1GNE A;  4MJE A;  3VI7 A;  3GX8 A;  2RUE A;  1FVK A;  2PU9 C;  3WGD A;  4Q5Q A;  2IME A;  4MJA A;  4WBJ A;  3HJM A;  3M3M A;  4DSS A;  3G7Y A;  3EU3 A;  3KEB A;  3HXS A;  4MPF A;  3FZ4 A;  5DJM A;  3LQ7 A;  3TJF A;  1YZX A;  5LNK e;  3RAZ A;  2YZH A;  1TDI A;  5IIZ A;  4K9Z A;  2N5B A;  3KH7 A;  3GH6 A;  1OAZ A;  3IE3 A;  4EKZ A;  3QFB C;  1MD3 A;  4PQH A;  3Q19 A;  1KBN A;  3ISO A;  5B8B A;  4MZW A;  1XW9 A;  1V57 A;  3F9U A;  4MJB A;  4PNF A;  4X43 A;  2V2G A;  2VO4 A;  3F6F A;  4K7N A;  1B4P A;  3FEU A;  1AC1 A;  1PL1 A;  1FOV A;  2C0G A;  5DCG A;  4POL A;  3WT2 A;  3UAR A;  1I9D A;  5HFI A;  4ML6 A;  2CVB A;  3ZRD A;  3H79 A;  3TOT A;  3FY7 A;  2WB9 A;  2VCX A;  2YNX A;  3CSH A;  5INY A;  2A2R A;  3FZ9 A;  3APS A;  2IL3 A;  1PRX A;  1UC7 A;  2YN1 A;  2LRC A;  4ACS A;  1HYU A;  4WR5 A;  4OWY A;  1XXU A;  4WXT A;  1VRS D;  3F3Q A;  1Y25 A;  1M2B A;  3QDN A;  3WGX A;  2CT6 A;  2GGT A;  2X64 A;  2HZF A;  2MMZ A;  5KN0 A;  2L59 A;  3P8W A;  2VL9 A;  3UVH A;  2C0D A;  2LTK A;  5ECI B;  1U3A A;  3KIJ A;  1YKA A;  2H75 A;  1PQN A;  1GSQ A;  1TRW A;  5FWG A;  2MMN A;  2PVQ A;  2B1K A;  12GS A;  2LV3 A;  1OC9 A;  2HI7 A;  3EWL A;  3IK9 A;  4CHS A;  3TKP A;  2OBK A;  4BWS A;  5ELG A;  1X0R A;  4K7I A;  1B9X C;  4IQ1 A;  1M2A A;  1SYX A;  1T4Y A;  1K3L A;  4L5L A;  1AQX A;  3HVX A;  1R4W A;  1SL1 B;  3EUR A;  1BAY A;  1GTI A;  5G5F A;  5C04 A;  2OAC A;  2F3M A;  3CTG A;  1E2Y A;  1MEK A;  4MMM A;  1MDI A;  5CNW A;  2H6X A;  1SEN A;  2DJJ A;  5JCW A;  4RI7 A;  1YF1 A;  2Z9S A;  1T00 A;  3I43 A;  2TRX A;  5JCU A;  2XC2 A;  4F9Z A;  1GUL A;  2FNO A;  1GSS A;  1SJZ A;  1F9M A;  1PD2 1;  4Q5N A;  3LSZ A;  1PSQ A;  1ZGN A;  1K0M A;  2AAW A;  3KP8 A;  4P3Y B;  1TTZ A;  5FHI A;  1BG5 A;  2QSI A;  3GST A;  1CQG A;  1DE1 A;  5LD0 A;  3TKS C;  2DJ3 A;  2H72 A;  1O73 A;  2BMX A;  1FB0 A;  1WMJ A;  1LU4 A;  1V2A A;  3LFL A;  2GQL A;  1RQM A;  3L9U A;  1AW9 A;  4AJ8 A;  5HQP A;  3EYT A;  1X9S B;  4PQI A;  1ZMA A;  1IYH A;  3Q74 A;  2R4V A;  3LYK A;  3ZIV A;  4TOP A;  3GH9 A;  4FIW A;  1ML6 A;  3IRA A;  6GSY A;  1C72 A;  2VD0 A;  4H86 A;  1DBY A;  4TW5 A;  2OJL A;  3FYG A;  1GLQ A;  2DJK A;  2HSY A;  2XBQ A;  4KCA A;  1K0D A;  2B7J A;  4KSM A;  1MDJ A;  4KA0 A;  2LJR A;  3KJY A;  1R5P A;  5DCH A;  3DKS A;  4F0C A;  3VPT A;  2H1A A;  1QK8 A;  4BPY A;  2JZT A;  7GSS A;  1YY7 A;  3L4N A;  3DIE A;  1ZYE A;  3DGQ A;  2GZP A;  5J5N A;  3CXG A;  2H1G A;  4D73 A;  2FGX A;  4GQC A;  4HU9 A;  1R7H A;  2IFQ B;  2K9F A;  1YQ1 A;  2CAI A;  4IJI A;  1Z7R A;  4F0B A;  3EVI A;  1EGR A;  3CSJ A;  4POK A;  1CQH A;  2LNT A;  1J0F A;  3GUR A;  2IIY A;  5D96 A;  2H0G A;  4IKH A;  3HA9 A;  3RPN A;  2JZR A;  3SWL A;  1X5C A;  5IMD A;  5EVO A;  2HSH A;  3C7M A;  5DAK A;  2VCT A;  3APO A;  4RUV A;  3TJG A;  4OO5 A;  5D8I A;  3I6A A;  4TR4 A;  3LXT A;  2L5O A;  2YWI A;  4WF4 A;  3KTL A;  4RQR A;  2TIR A;  3S9F A;  3M9J A;  3C73 A;  3HJP A;  1WPI A;  3CTF A;  1GUM A;  5ECO B;  1FB6 A;  1NW2 A;  3GMF A;  2LRT A;  2GSS A;  1SU9 A;  4CW9 A;  3GRX A;  1XOA A;  4MCU A;  5B6M A;  3VI5 A;  4LA1 A;  2PER A;  5IPG A;  5CAX A;  3FR3 A;  4GSN A;  2YWO A;  3QPM A;  3HD5 A;  5F0G A;  1JZO A;  2I1U A;  2NPB A;  4GXZ A;  2FWG A;  1K0A A;  1GSF A;  4AF2 A;  4FYC A;  1XWG A;  1FG4 A;  4XS4 A;  2HRF A;  4HEA 2;  3J7Y b;  2C0E A;  2DIY A;  4BVX A;  3FK8 A;  3ZYW A;  1X5E A;  3TKQ A;  3CBU A;  5GAP D;  1PL2 A;  5KN2 A;  1ERV A;  3VUR A;  2VM1 A;  1AAZ A;  1ACV A;  1OE7 A;  3H93 A;  2O85 A;  3HZ8 A;  1H75 A;  4KH7 A;  3N5O A;  1YF0 A;  4IJ3 A;  3ZRE A;  2H6Y A;  3R2Q A;  5G1K A;  3Q18 A;  2G2Q A;  3IK7 A;  4YQV A;  4NHZ A;  4EDZ A;  3GKK A;  3CYN A;  1Z5Y E;  5F05 A;  2NBS A;  1ABA A;  4CDO A;  5DVB A;  2I81 A;  1ZYQ B;  4HDE A;  3TJJ A;  2GZZ A;  3JCM L;  1B48 A;  3ERW A;  2CV4 A;  3U6V A;  4K6X A;  1NHO A;  4GCI A;  2YJH A;  1A8Y A;  3C1S A;  2GVP A;  2VL2 C;  2JZS A;  5F06 A;  2AUV A;  4F03 A;  3A2W A;  1BYE A;  2H73 A;  2HZE A;  4TRX A;  3D22 A;  4K2D A;  2HNL A;  3F4R A;  1V98 A;  4JED A;  3RHB A;  4KSO A;  2FLS A;  4HUA A;  2H74 A;  1SKW B;  2PN8 A;  1WJK A;  4PQ1 A;  1ON4 A;  4I2T A;  3P7X A;  2KHP A;  1SK1 A;  2RM6 A;  5A4W A;  3DVW A;  1XWK A;  3GL3 A;  2ALB A;  4GSS A;  3IA1 A;  2P31 A;  1GSD A;  1F37 A;  1TRV A;  1XW6 A;  1BX9 A;  2H76 A;  4IS0 A;  3BCK A;  4MZB A;  5EL8 A;  1F6M C;  1QQ2 A;  5B8A A;  2H1B A;  2VD1 A;  4GF0 A;  2JU5 A;  3TOU A;  2H30 A;  1ZZY A;  2CX3 A;  1O81 A;  5KN3 A;  3HDC A;  4EF0 A;  1M7T A;  1PN9 A;  4IHU A;  1XFL A;  2KP2 A;  4KX4 A;  4TR1 A;  5AIV A;  3GFK A;  2PGT A;  3F3R A;  3KMO A;  2CVD A;  3ERF A;  3ZIJ A;  3CMI A;  3CSI A;  1M2D A;  1QUW A;  3MWH A;  1YKC A;  2PWJ A;  4N0V A;  1QGV A;  5B6N A;  2MMO A;  2DIZ A;  4PUF C;  1FW1 A;  3BJ5 A;  4N11 A;  2X8H A;  3M9K A;  1GNW A;  3W8J A;  5J9B A;  1N2A A;  3KZQ A;  4ZB6 A;  5CYY A;  3UMA A;  2ON7 A;  2JSZ A;  4XCS A;  3GIX A;  5ECR B;  3DML A;  3LGC A;  3ME8 A;  5F8B A;  2IWT A;  1WE0 A;  2K8S A;  2J9H A;  3MAK A;  1XZO A;  1E6B A;  2WDU A;  3ERG A;  1EZK A;  2REM A;  1O8X A;  3M0F A;  4ECJ A;  2N5A A;  3P2A A;  1VF1 A;  2PBJ A;  4EVM A;  1EV4 A;  5GZZ B;  5HR2 A;  3ZVJ A;  2ON5 A;  1U87 A;  2B7K A;  2VLV A;  2X8G A;  5IMF A;  2EIR A;  2NDO A;  1ZCP A;  3IHQ A;  2E7P A;  1S3A A;  4MDC A;  2OE0 A;  3UIW A;  1Z6N A;  2H19 A;  1F3B A;  1KNG A;  5GSS A;  4WET A;  1PA3 A;  3EE2 A;  4V1A g;  3F0I A;  3M1G A;  3VPQ A;  2MYG A;  2N5F A;  3F4S A;  2XBI A;  2CAQ A;  13GS A;  1U3I A;  3ZFB A;  18GS A;  2WFC A;  4LMW A;  1XCC A;  1EP7 A;  3FZA A;  1PMT A;  3OR5 A;  5H5Q A;  2I3Y A;  1OE8 A;  4GTU A;  2H0H A;  5L71 A;  2CA8 A;  3BBY A;  2DJ2 A;  2WS2 A;  2B6M A;  1U6T A;  4TN8 A;  4MF5 A;  6GSW A;  1GTA A;  1XW5 A;  1LBK A;  2IPA A;  1R26 A;  1GH2 A;  1HNA A;  3TB2 A;  4K0N A;  4MH2 A;  5CRW A;  2C80 A;  3GA4 A;  3F6D A;  3ED3 A;  4OO4 A;  5J3R A;  2V32 A;  1URM A;  1EGO A;  2DJ1 A;  2R3X A;  1SJ6 A;  2GDR A;  1THO A;  1VGL A;  2FUG 2;  2I4A A;  3I69 A;  2LKU A;  2V6O A;  4FYU A;  5EPF A;  3TDG A;  1B9Y C;  4L8E A;  5ENU A;  3U5R E;  4N30 A;  1X9M B;  5IMV A;  5DJL A;  4FYB A;  2E2M A;  2RII A;  1YEX A;  4I8B A;  2YWN A;  3C8E A;  4PUA A;  5IOX A;  2RUF A;  4WF5 A;  5DQY A;  3HVV A;  5ID2 A;  3F63 A;  3PH9 A;  3LG6 A;  1AQW A;  3F4T A;  4V2N A;  2JSY A;  1G6W A;  3FZ5 A;  1ERT A;  2YP6 A;  1HNB A;  2C4J A;  3PR8 A;  2B5Y A;  4TR3 A;  1T4Z A;  4YAV A;  4GLT A;  3A5W A;  1JZR A;  3RBT A;  3IXR A;  2OA7 A;  1DUG A;  5ECN B;  4AJ6 A;  5DQS A;  3D0Z A;  3QR6 A;  2O7K A;  2AYT A;  3VLN A;  1OC9 B;  2FY6 A;  4KDU A;  1MD4 A;  2H1D A;  3V1W A;  2L57 A;  2AB6 A;  1K0C A;  3A3T A;  3QAV A;  4X1U A;  5GST A;  3H4K A;  5ECS A;  1GLP A;  2MZC A;  3ZZX A;  2P5Q A;  1HD2 A;  1PKZ A;  1T3B A;  2DC5 A;  2K18 A;  2GT5 A;  1QMV A;  2FHE A;  2VIM A;  4G2E A;  2E0Q A;  3UL3 A;  2YPM A;  5ECH B;  2GSR A;  1AIU A;  4L0U A;  1M0U A;  2I9H A;  1ILO A;  3ME7 A;  5HR0 A;  4IW9 A;  2H6Z A;  2VL3 A;  1Q98 A;  4MLY A;  3W8S A;  19GS A;  4XS1 A;  2OBI A;  4GRF A;  3ZML A;  3M8N A;  2H01 A;  2IMF A;  3GX0 A;  4HZ4 A;  4PNG A;  2F8A A;  5IQY A;  4EXJ A;  3QAW A;  3UVT A;  17GS A;  3EU4 A;  5LCZ A;  3O3T A;  4KDX A;  5JWQ B;  2EIQ A;  5DAL A;  3GTU B;  3L0H A;  1KEB A;  2KP1 A;  3IOS A;  1EOG A;  2KLX A;  3L78 A;  3QOU A;  4ILF A;  2TRC P;  2B5X A;  2GQM A;  4ZIL A;  1ERU A;  1USB A;  2HT9 A;  2LS5 A;  2H0I A;  1YDK A;  1N8J A;  1V9W A;  3O6T A;  2YOI A;  2HLS A;  5D9W A;  5ECP B;  3I9V 2;  1K3Y A;  2OKA A;  3DXB A;  4KCE A;  2JAD A;  4MF6 A;  3UOM A;  2GT6 A;  4WEY A;  3US3 A;  4V2L A;  2V41 A;  3L9S A;  5G30 A;  2RLI A;  4O7H A;  4ZB9 A;  6GST A;  1FHE A;  3EMP A;  3LEF A;  2VLU A;  2YAN A;  4NXI A;  2GQK A;  2IMD A;  1AQV A;  4IQA A;  1KTE A;  5CRH A;  3H8Q A;  1XWA A;  5ECL B;  9GSS A;  2YV7 A;  5ECM B;  4TXV A;  3O76 A;  5JWO B;  3KXO A;  4IBP A;  5AIS A;  11GS A;  5G2Z A;  4D73 B;  2WGR A;  1X5D A;  2M80 A;  1THX A;  3ZFL A;  1A24 A;  1PX7 A;  1SD9 A;  3KD0 A;  4KW6 A;  5HR3 A;  2X8C A;  1ZL9 A;  1J08 A;  1EWX A;  5HR1 A;  4JU5 A;  2ZCT A;  1FVJ A;  4ULX A;  2WRT A;  1OC8 A;  4HZ2 A;  4K8M A;  3D6I A;  3KP9 A;  5ELA A;  2VM2 A;  1TOF A;  4RQX A;  5G1L A;  2LUS A;  4HQS A;  5HFG A;  4BL7 A;  3F8U A;  2K6V A;  1RK4 A;  4PXO A;  3SBC A;  4DSR A;  1A2M A;  5A5K A;  1XWC A;  5DAK B;  4Q5R A;  4EDY A;  3GNJ A;  2GTU A;  3TRX A;  4ECI A;  5J41 A;  1GUK A;  3GL5 A;  1JHB A;  2B5E A;  2LJA A;  3TKR A;  1GSU A;  4XRD A;  4IN0 A;  2FCH A;  4EUY A;  2VOC A;  4QL9 A;  1SJI A;  3FKF A;  4G9H A;  3ZLP A;  3TKS E;  1SL2 B;  1UVZ A;  3CRU A;  3MSZ A;  1PKW A;  4GST A;  2L4C A;  4V1A p;  1EV9 A;  4ML1 A;  2JAC A;  4WBR D;  4ECC A;  2HRN A;  4F2I A;  1GP1 A;  4AJ7 A;  1HNC A;  2C3Q A;  5D93 A;  2FA4 A;  1GTB A;  5COH A;  3C1R A;  3TRQ A;  4LL1 B;  4HS1 A;  1O85 A;  4BWQ A;  1YEP A;  4ZBD A;  4RI6 A;  3KH9 A;  5C00 A;  1GL8 A;  1R5A A;  5HFK A;  3UAP A;  5CO3 A;  3HVS A;  3HYP A;  4QQ7 A;  1K0B A;  3KMN A;  2VL2 A;  4PGT A;  3EC3 A;  1K0N A;  3WYW A;  3UJ1 A;  4WKW A;  4K1F A;  2R37 A;  1TU7 A;  4I2U A;  1GTU A;  1S3C A;  4XIH A;  1Z3E A;  4TXO B;  5A4U A;  4MZC A;  1X9W B;  3W6G A;  2VCV A;  1GSY A;  1OVN A;  2B3S A;  4I5Q A;  1Z6M A;  3MNG A;  3IAS 2;  4F82 A;  4O32 A;  3IV4 A;  2GS3 A;  3HKR A;  4QL7 A;  5DBQ A;  4OFT A;  5AIX A;  1B4Q A;  4ZBA A;  2HZE B;  1XPV A;  2MMA A;  4EE0 A;  1JFU A;  4YH2 A;  2GSQ A;  2L6C A;  4EO3 A;  3ZTL A;  1T7P B;  3GHA A;  1FAA A;  3NZN A;  4KB3 A;  3EIN A;  3NIV A;  4HU7 A;  3A2X A;  4ZB8 A;  1SKS B;  1TK8 B;  3TGZ A;  3VWW A;  2FWE A;  5IOW A;  4X0X A;  5D73 A;  1T8E B;  1WWJ A;  2RM5 A;  1NHY A;  20GS A;  5CP1 A;  2P0G A;  1U88 A;  3BD2 A;  4OCF A;  1XVW A;  3EMX A;  3E3E A;  2V6K A;  1BJX A;  2VCZ A;  3TJB A;  3LOR A;  4JR4 A;  4OFN A;  2QGV A;  1NSW A;  1G0T A;  1O6J A;  3KGK A;  3HZ4 A;  3HCZ A;  1W4V A;  3GSS A;  4TR1 B;  1NM3 A;  4FO5 A;  3H1N A;  1QFN A;  4KUN A;  1ERW A;  3GKX A;  3FW2 A;  2DLX A;  4PX1 A;  3HY2 A;  4J56 E;  3FR6 A;  1UA5 A;  2VCW A;  1A0F A;  3MDK A;  2O87 A;  3LXZ A;  5IO2 A;  4POM A;  3IDV A;  4DSS B;  1F2E A;  1OYJ A;  2WCI A;  1J9B A;  1SD8 A;  4EC0 A;  2GST A;  3D4M A;  1QXH A;  3E9J B;  3G7J A;  4ID0 A;  2XPD A;  2M46 A;  5G31 A;  4L5O A;  5J4U A;  3ZIT A;  1WOU A;  4MP4 A;  2B1L A;  4IVF A;  4NV2 A;  4N0Z A;  2WUL A;  3DYR A;  3QCP A;  1Y6E A;  4IP1 A;  1MDK A;  5D9X A;  1TJD A;  3FR9 A;  4K7O A;  4MK3 A;  3E0U A;  1GWC A;  2PPT A;  2F51 A;  1ZOF A;  2C1Y A;  3P90 A;  1AUC A;  3AY8 A;  2FWF A;  3KTB A;  1MTC A;  4OCE A;  3LYP A;  3IR4 A;  1TP9 A;  3GUS A;  4LL4 B;  2ZUP A;  4G10 A;  2YCD A;  1GRX A;  4BA7 A;  4ZIJ A;  2NTO A;  3QFA C;  2LQQ A;  2QKE A;  1G7O A;  5IMA A;  3K8N A;  4IP6 A;  1XOB A;  3ZL5 A;  1A8L A;  3GKN A;  2A4V A;  1VF2 A;  3IAM 2;  1SK2 A;  5ECK B;  6GSX A;  2IJY A;  2OE1 A;  4KGI A;  1A2J A;  4HJ2 A;  3G7I A;  2HXK A;  5CRD A;  1XVQ A;  4KDY A;  5J9C A;  4BVY A;  2WZ9 A;  1HQO A;  2FA8 A;  4NV5 A;  3D21 A;  2LRN A;  4N10 A;  1Z7P A;  2BTO T;  4YAP A;  1H4O A;  5ECQ B;  1BQ7 A;  1JZW A;  3GYK A;  4PUR A;  2KOK A;  4XTS A;  3VK9 A;  4JRR A;  4O92 A;  4ZXG A;  1AXD A;  2F9S A;  3GTU A;  3VWU A;  3DRN A;  3UEM A;  4OD7 A;  4MF7 A;  1IYI A;  1SK0 A;  4KE3 A;  1Q4J A;  2H70 A;  4OMV A;  1V58 A;  1TRS A;  2IFQ A;  2VAF A;  3KM6 A;  1VF3 A;  3CRT A;  2L6D A;  3TKS A;  2C0F A;  1TK5 B;  5ID2 B;  5IMC A;  3KCM A;  1YJ6 A;  2HFD A;  4XHM A;  3TJK A;  1RW1 A;  1JLV A;  4HI7 A;  5D9T A;  3GKM A;  1Z9H A;  3RPP A;  2O89 A;  4ZL7 A;  5B7C A;  1OKT A;  1GUH A;  3WT1 A;  3ZVJ D;  2R5G A;  5CRG A;  10GS A;  3C71 A;  4J57 E;  2MBT A;  2DJ0 A;  4MJC A;  1SL0 B;  4J2F A;  3DVX A;  3WD6 A;  5EY6 A;  2JL4 A;  4ECB A;  1G7E A;  4L0W A;  5JWR B;  3G9B A;  2C3N A;  5KN1 A;  2OE3 A;  1WRY A;  4WR4 A;  3APQ A;  1S3D A;  2DBC A;  2V1M A;  4MPG A;  5F07 A;  1TRU A;  2EIO A;  4JBB A;  3WGE A;  2H71 A;  1TK0 B;  2PMT A;  3A2V A;  5AN1 A;  5H5R A;  3DWV A;  2CZ3 A;  4HQZ A;  1TW9 A;  2C8U A;  4TR0 A;  4IEL A;  2D2Z A;  3PGT A;  1TI3 A;  4LLR A;  2OAD A;  2X99 A;  1OC3 A;  5JCG A;  5CRE A; 
#chains in the Genus database with same CATH topology
 1DE2 A;  1JLW A;  2DSA A;  1F3A A;  4MH3 A;  2E2G A;  3IC4 A;  4XS6 A;  3TCO A;  1XIY A;  3FRC A;  4E8E A;  5DAL B;  4I97 A;  2UZ8 A;  2P5R A;  3Q6O A;  4YQM A;  1B8X A;  2ES7 A;  2BJX A;  4NWY A;  2CQ9 A;  2NVL A;  1G6Y A;  2AJQ B;  5IO0 A;  3RHC A;  2DML A;  3LWA A;  2LNS A;  3ZMK A;  2DMM A;  5A4V A;  5DDL A;  3DEX A;  22GS A;  1A0R P;  3TRP A;  1O7U A;  4YQU A;  2CZ2 A;  4FH8 A;  4OFM A;  2AHE A;  4DSQ A;  2HE3 A;  5FT3 A;  4ZL8 A;  4XRA A;  1A23 A;  2XPE A;  3UBK A;  4DEJ A;  4GWR A;  4TKY A;  2CVK A;  6GSV A;  2H66 A;  4G19 A;  5IPH A;  3GV1 A;  1PGT A;  4DVC A;  5D9V A;  1XWB A;  1O8W A;  2YWM A;  1M3J A;  2YV9 A;  2YZU A;  2VUP A;  1TXX A;  4NAX A;  4LMV A;  2CX4 A;  1FO5 A;  2AV4 A;  2K8V A;  2C3T A;  4ZL9 A;  2YJ7 A;  2FD3 A;  2O8V B;  2ZNM A;  2WJU A;  2KUC A;  3UBL A;  2H8L A;  1OKD A;  4HJM A;  3HJO A;  4MA9 A;  1V40 A;  4G0I A;  1M9A A;  4TVE A;  4K5S A;  1PFO A;  1PX6 A;  2LJK A;  4NPB A;  3HHV A;  3VWV A;  3PIN A;  2MBS A;  2HYX A;  1BED A;  2VCQ A;  1JZD A;  1SKR B;  6GSS A;  2PVO C;  2GZY A;  2A2S A;  2LEG A;  2L4Q A;  1VF4 A;  4TXO A;  2J23 A;  4KAE A;  5E4W A;  1SYR A;  1T1V A;  4Q5F A;  3QMX A;  5IM9 A;  1EEM A;  4MAB A;  3J7Y k;  2L5L A;  1TI1 A;  1W89 A;  4FQU A;  3D5J A;  4HOJ A;  1GSE A;  4GQF A;  5IMZ A;  1XBS A;  4XS4 B;  4BL7 B;  4JE1 A;  4NMU A;  4Z7X A;  4X4J A;  1EP8 A;  1EOH A;  2LST A;  3VWX A;  3A5I A;  2LQO A;  5AGY A;  1TKD B;  2VLT A;  1K0O A;  3QAG A;  5E59 A;  4ISD A;  2R6K A;  2A4H A;  1UN2 A;  3D4T A;  2QC7 A;  1TU8 A;  4ZBB A;  3EPT A;  4I6X A;  4POB A;  2FWH A;  3TUE A;  3QD9 A;  1M9B A;  2G0F A;  4JR6 A;  4V2M A;  2GLR A;  4EL1 A;  3L9V A;  3IPZ A;  16GS A;  1ZYN A;  2M72 A;  3HVN A;  5KEJ A;  2R2J A;  4EIQ A;  5GAN D;  1A2L A;  3NOF A;  4AGS A;  5ABR A;  3VFI A;  2IN3 A;  1ST9 A;  2F8F A;  3GN3 A;  2PUK C;  4E8H A;  1LJR A;  6GSU A;  3N9J A;  2IMK A;  14GS A;  3FHK A;  1M99 A;  1WP0 A;  8GSS A;  4KND A;  1EEJ A;  1K3O A;  3BCI A;  5G5E A;  3BOA A;  1WIK A;  2XHF A;  4K0G A;  5H5S A;  4NHW A;  4JZQ A;  3DD3 A;  3RDW A;  2IMI A;  4IGJ A;  3LJR A;  3IBH A;  1I5G A;  4O5R A;  1DSB A;  2EC4 A;  1GNE A;  4MJE A;  3VI7 A;  3GX8 A;  2RUE A;  1FVK A;  2PU9 C;  3WGD A;  4Q5Q A;  2IME A;  4MJA A;  4WBJ A;  3HJM A;  3M3M A;  3IC8 A;  3G7Y A;  4DSS A;  3EU3 A;  3KEB A;  3HXS A;  4MPF A;  3FZ4 A;  5DJM A;  3LQ7 A;  3TJF A;  1YZX A;  5LNK e;  3RAZ A;  2YZH A;  1TDI A;  5IIZ A;  4K9Z A;  2N5B A;  3KH7 A;  3GH6 A;  1OAZ A;  3IE3 A;  4EKZ A;  3QFB C;  1MD3 A;  4PQH A;  3Q19 A;  1KBN A;  3ISO A;  5B8B A;  4MZW A;  1XW9 A;  1V57 A;  3F9U A;  4MJB A;  4PNF A;  4X43 A;  2V2G A;  2VO4 A;  3F6F A;  4K7N A;  1B4P A;  3FEU A;  1AC1 A;  1PL1 A;  1FOV A;  2C0G A;  5DCG A;  4POL A;  3WT2 A;  2A2P A;  3UAR A;  1I9D A;  5HFI A;  3LW9 A;  4ML6 A;  2CVB A;  3ZRD A;  3H79 A;  3TOT A;  3FY7 A;  2WB9 A;  2VCX A;  2YNX A;  3CSH A;  5INY A;  2R0P A;  2A2R A;  3FZ9 A;  3APS A;  2IL3 A;  1PRX A;  1UC7 A;  2YN1 A;  2LRC A;  4ACS A;  1HYU A;  4WR5 A;  4OWY A;  1XXU A;  4WXT A;  1VRS D;  3F3Q A;  5BMU A;  1Y25 A;  1M2B A;  3QDN A;  3WGX A;  2CT6 A;  2R0C A;  2GGT A;  2X64 A;  2HZF A;  2MMZ A;  5KN0 A;  2L59 A;  3P8W A;  2VL9 A;  3UVH A;  2C0D A;  2LTK A;  5ECI B;  1U3A A;  3KIJ A;  1YKA A;  2H75 A;  1PQN A;  1GSQ A;  1TRW A;  5FWG A;  2MMN A;  2PVQ A;  2B1K A;  12GS A;  2LV3 A;  1OC9 A;  2HI7 A;  3EWL A;  3IK9 A;  4CHS A;  3TKP A;  1FOH A;  2OBK A;  2DKI A;  4BWS A;  5ELG A;  1X0R A;  4K7I A;  1B9X C;  4IQ1 A;  1M2A A;  1SYX A;  1T4Y A;  1K3L A;  4L5L A;  1AQX A;  3HVX A;  1R4W A;  1SL1 B;  3EUR A;  1BAY A;  1GTI A;  5G5F A;  5C04 A;  2OAC A;  2F3M A;  3CTG A;  1E2Y A;  1MEK A;  4MMM A;  1MDI A;  5CNW A;  2H6X A;  2DKH A;  1SEN A;  2DJJ A;  5JCW A;  4RI7 A;  1YF1 A;  3MIX A;  2Z9S A;  1T00 A;  3I43 A;  2TRX A;  5JCU A;  2XC2 A;  4F9Z A;  1GUL A;  2FNO A;  1GSS A;  4YKF A;  1SJZ A;  1F9M A;  1PD2 1;  4Q5N A;  3LSZ A;  1PSQ A;  1ZGN A;  1K0M A;  2AAW A;  3KP8 A;  4P3Y B;  1TTZ A;  5FHI A;  1BG5 A;  2QSI A;  3GST A;  1CQG A;  1DE1 A;  5LD0 A;  3TKS C;  2DJ3 A;  2H72 A;  1O73 A;  2BMX A;  1FB0 A;  1WMJ A;  1LU4 A;  1V2A A;  3LFL A;  2GQL A;  1RQM A;  3L9U A;  1AW9 A;  4AJ8 A;  5HQP A;  3EYT A;  1X9S B;  4PQI A;  1ZMA A;  1IYH A;  3Q74 A;  2R4V A;  3LYK A;  3ZIV A;  4YKG A;  4TOP A;  3GH9 A;  4FIW A;  1ML6 A;  3IRA A;  6GSY A;  1C72 A;  2VD0 A;  4BVY B;  4H86 A;  1DBY A;  4TW5 A;  2OJL A;  3FYG A;  1GLQ A;  2DJK A;  2HSY A;  2XBQ A;  4KCA A;  1K0D A;  2B7J A;  4KSM A;  1MDJ A;  4KA0 A;  2LJR A;  3KJY A;  1R5P A;  2HSM A;  5DCH A;  3DKS A;  4F0C A;  3VPT A;  2H1A A;  1QK8 A;  4BPY A;  2JZT A;  7GSS A;  1YY7 A;  3L4N A;  3DIE A;  1ZYE A;  3DGQ A;  2GZP A;  5J5N A;  3CXG A;  2H1G A;  4D73 A;  2FGX A;  4GQC A;  4HU9 A;  1R7H A;  2IFQ B;  2K9F A;  1YQ1 A;  2CAI A;  4IJI A;  1Z7R A;  4F0B A;  3EVI A;  1EGR A;  5KOX A;  3CSJ A;  4POK A;  1CQH A;  2LNT A;  1J0F A;  3GUR A;  2IIY A;  5D96 A;  2H0G A;  4IKH A;  3HA9 A;  3RPN A;  2JZR A;  3SWL A;  1X5C A;  5IMD A;  5EVO A;  2HSH A;  3C7M A;  5DAK A;  2VCT A;  3APO A;  4RUV A;  3TJG A;  4OO5 A;  5D8I A;  3I6A A;  4TR4 A;  3LXT A;  2L5O A;  2YWI A;  4WF4 A;  3KTL A;  4RQR A;  2TIR A;  3S9F A;  3M9J A;  3C73 A;  3HJP A;  1WPI A;  3CTF A;  1GUM A;  5ECO B;  1FB6 A;  1NW2 A;  3GMF A;  2LRT A;  2GSS A;  1SU9 A;  4CW9 A;  3GRX A;  1XOA A;  4MCU A;  5B6M A;  3VI5 A;  4LA1 A;  2PER A;  5IPG A;  5CAX A;  3FR3 A;  4GSN A;  2YWO A;  3QPM A;  3HD5 A;  5F0G A;  1JZO A;  2I1U A;  1XG8 A;  2NPB A;  4GXZ A;  2FWG A;  1K0A A;  1GSF A;  4AF2 A;  4FYC A;  1XWG A;  1FG4 A;  4XS4 A;  2HRF A;  4HEA 2;  3J7Y b;  2C0E A;  2DIY A;  4BVX A;  3FK8 A;  3ZYW A;  1X5E A;  3TKQ A;  3CBU A;  5GAP D;  1PL2 A;  5KN2 A;  1ERV A;  3VUR A;  2VM1 A;  1AAZ A;  1ACV A;  1OE7 A;  3H93 A;  2O85 A;  3HZ8 A;  1H75 A;  4KH7 A;  3N5O A;  1YF0 A;  4IJ3 A;  3ZRE A;  2H6Y A;  3R2Q A;  5G1K A;  3Q18 A;  2G2Q A;  3IK7 A;  4YQV A;  4NHZ A;  4EDZ A;  3GKK A;  3CYN A;  1Z5Y E;  5F05 A;  2NBS A;  1ABA A;  4CDO A;  5BRT A;  5DVB A;  2I81 A;  1ZYQ B;  4HDE A;  3TJJ A;  2GZZ A;  3JCM L;  1B48 A;  3ERW A;  2CV4 A;  3U6V A;  4K6X A;  1NHO A;  4GCI A;  2YJH A;  1A8Y A;  3C1S A;  2GVP A;  2VL2 C;  2JZS A;  4PTS A;  2AUV A;  5F06 A;  4F03 A;  3A2W A;  1BYE A;  2H73 A;  2HZE A;  4TRX A;  3D22 A;  4K2D A;  2HNL A;  3PPU A;  3F4R A;  1V98 A;  4JED A;  3RHB A;  4USS A;  4KSO A;  2FLS A;  4HUA A;  2H74 A;  1SKW B;  5KOW A;  2PN8 A;  1WJK A;  4PQ1 A;  1ON4 A;  4I2T A;  4HSC X;  3P7X A;  2KHP A;  1SK1 A;  2RM6 A;  5A4W A;  3DVW A;  1XWK A;  3GL3 A;  2ALB A;  4GSS A;  3IA1 A;  2P31 A;  1GSD A;  1F37 A;  1TRV A;  1XW6 A;  1BX9 A;  2H76 A;  4IS0 A;  3BCK A;  4MZB A;  5EL8 A;  1F6M C;  1QQ2 A;  5B8A A;  2H1B A;  2VD1 A;  4GF0 A;  2JU5 A;  3TOU A;  2H30 A;  1ZZY A;  2CX3 A;  1O81 A;  5KN3 A;  3HDC A;  4EF0 A;  1M7T A;  1PN9 A;  4IHU A;  1XFL A;  2KP2 A;  4KX4 A;  4TR1 A;  5AIV A;  3GFK A;  2PGT A;  3F3R A;  3KMO A;  2CVD A;  3ERF A;  3ZIJ A;  3CMI A;  3CSI A;  1M2D A;  4KF9 A;  1QUW A;  3MWH A;  1YKC A;  4Z2U A;  2PWJ A;  4N0V A;  1QGV A;  5B6N A;  2MMO A;  2DIZ A;  4PUF C;  1FW1 A;  3BJ5 A;  4N11 A;  2X8H A;  3M9K A;  1GNW A;  3W8J A;  5J9B A;  1N2A A;  3KZQ A;  4ZB6 A;  5CYY A;  3UMA A;  2ON7 A;  2JSZ A;  4XCS A;  3GIX A;  5ECR B;  3DML A;  3LGC A;  3ME8 A;  5F8B A;  2IWT A;  1WE0 A;  2K8S A;  2J9H A;  3MAK A;  1XZO A;  1E6B A;  2WDU A;  3ERG A;  1EZK A;  2REM A;  1O8X A;  3M0F A;  4ECJ A;  2N5A A;  3P2A A;  1VF1 A;  2PBJ A;  4EVM A;  1EV4 A;  5GZZ B;  5HR2 A;  4Z2T A;  3ZVJ A;  2ON5 A;  3CQF A;  1U87 A;  2B7K A;  2VLV A;  2X8G A;  5IMF A;  2EIR A;  2NDO A;  1ZCP A;  3IHQ A;  2E7P A;  1S3A A;  4MDC A;  2OE0 A;  3UIW A;  1Z6N A;  2H19 A;  1F3B A;  1KNG A;  5GSS A;  4WET A;  1PA3 A;  3EE2 A;  4V1A g;  3F0I A;  3M1G A;  3VPQ A;  2MYG A;  2N5F A;  3F4S A;  4EIP A;  2XBI A;  2CAQ A;  13GS A;  1U3I A;  3ZFB A;  18GS A;  2WFC A;  4LMW A;  1XCC A;  1EP7 A;  3FZA A;  1PMT A;  3OR5 A;  5H5Q A;  2I3Y A;  1OE8 A;  4GTU A;  3MYD A;  2H0H A;  5L71 A;  2CA8 A;  3BBY A;  2DJ2 A;  2WS2 A;  2B6M A;  1U6T A;  4TN8 A;  4MF5 A;  6GSW A;  1GTA A;  1XW5 A;  1LBK A;  2IPA A;  1R26 A;  1GH2 A;  1HNA A;  3TB2 A;  4K0N A;  4MH2 A;  5CRW A;  2C80 A;  3GA4 A;  3F6D A;  3ED3 A;  4OO4 A;  5J3R A;  2V32 A;  1URM A;  1EGO A;  2DJ1 A;  2R3X A;  1SJ6 A;  2GDR A;  1THO A;  1VGL A;  2FUG 2;  2I4A A;  3I69 A;  2LKU A;  2V6O A;  4FYU A;  5EPF A;  3TDG A;  1B9Y C;  4L8E A;  5ENU A;  3U5R E;  4N30 A;  1X9M B;  5IMV A;  5DJL A;  4FYB A;  2E2M A;  2RII A;  1YEX A;  4I8B A;  2YWN A;  3C8E A;  4PUA A;  5IOX A;  2RUF A;  4WF5 A;  5DQY A;  3HVV A;  5ID2 A;  3F63 A;  3PH9 A;  3LG6 A;  1AQW A;  3F4T A;  4V2N A;  2JSY A;  1G6W A;  3FZ5 A;  1ERT A;  2YP6 A;  1HNB A;  2C4J A;  2X4A A;  3PR8 A;  2B5Y A;  4TR3 A;  1T4Z A;  4YAV A;  4K5R A;  4GLT A;  3A5W A;  1JZR A;  3RBT A;  3IXR A;  2OA7 A;  1DUG A;  4G0L A;  5ECN B;  4AJ6 A;  5DQS A;  3D0Z A;  3QR6 A;  2O7K A;  2AYT A;  3VLN A;  1OC9 B;  2FY6 A;  4KDU A;  3R3E A;  1MD4 A;  2H1D A;  3V1W A;  2L57 A;  2AB6 A;  1K0C A;  4Z2R A;  3A3T A;  3QAV A;  4X1U A;  5GST A;  3H4K A;  5ECS A;  4K2X A;  1GLP A;  2MZC A;  3ZZX A;  2P5Q A;  1HD2 A;  1PKZ A;  1T3B A;  2DC5 A;  2K18 A;  2GT5 A;  1QMV A;  2FHE A;  2VIM A;  4G2E A;  2E0Q A;  3UL3 A;  1M3I A;  2YPM A;  5ECH B;  2GSR A;  1AIU A;  4L0U A;  1M0U A;  2I9H A;  1ILO A;  3ME7 A;  5HR0 A;  4IW9 A;  2H6Z A;  2VL3 A;  1Q98 A;  4MLY A;  4G0K A;  3W8S A;  19GS A;  4XS1 A;  2OBI A;  4GRF A;  3ZML A;  3M8N A;  2H01 A;  2IMF A;  3GX0 A;  4HZ4 A;  4PNG A;  2F8A A;  5IQY A;  4EXJ A;  3QAW A;  3UVT A;  17GS A;  3EU4 A;  5LCZ A;  2QA2 A;  3O3T A;  4KDX A;  5JWQ B;  2EIQ A;  5DAL A;  3GTU B;  3L0H A;  1KEB A;  2KP1 A;  3IOS A;  1EOG A;  2KLX A;  3L78 A;  3QOU A;  4ILF A;  4CY6 A;  2TRC P;  2B5X A;  2GQM A;  4ZIL A;  1ERU A;  1USB A;  2HT9 A;  2LS5 A;  2H0I A;  1YDK A;  1N8J A;  1V9W A;  3O6T A;  2YOI A;  2HLS A;  5D9W A;  5ECP B;  3I9V 2;  1K3Y A;  2OKA A;  3DXB A;  4KCE A;  2JAD A;  4MF6 A;  3UOM A;  2GT6 A;  4WEY A;  3US3 A;  4V2L A;  2V41 A;  3L9S A;  5G30 A;  2RLI A;  4O7H A;  4ZB9 A;  6GST A;  1FHE A;  3EMP A;  3LEF A;  2VLU A;  2YAN A;  4NXI A;  2GQK A;  2IMD A;  1AQV A;  4IQA A;  1KTE A;  5CRH A;  3H8Q A;  4CY8 A;  1XWA A;  5ECL B;  9GSS A;  2YV7 A;  5ECM B;  4TXV A;  3O76 A;  5JWO B;  3KXO A;  4IBP A;  5AIS A;  11GS A;  5G2Z A;  4D73 B;  2WGR A;  1X5D A;  2M80 A;  1THX A;  3ZFL A;  1A24 A;  1PX7 A;  1SD9 A;  3KD0 A;  4KW6 A;  5HR3 A;  2X8C A;  1ZL9 A;  1J08 A;  1EWX A;  5HR1 A;  4JU5 A;  2ZCT A;  1FVJ A;  4ULX A;  2WRT A;  1OC8 A;  4HZ2 A;  4K8M A;  3D6I A;  3KP9 A;  5ELA A;  2VM2 A;  1TOF A;  4RQX A;  5G1L A;  2LUS A;  4HQS A;  5HFG A;  4BL7 A;  3F8U A;  1PN0 A;  2K6V A;  1RK4 A;  4PXO A;  3SBC A;  4DSR A;  1A2M A;  5A5K A;  1XWC A;  5DAK B;  4Q5R A;  4EDY A;  3GNJ A;  2GTU A;  3TRX A;  4ECI A;  5J41 A;  1GUK A;  3GL5 A;  1JHB A;  2B5E A;  2LJA A;  3TKR A;  1GSU A;  4XRD A;  4IN0 A;  2FCH A;  4EUY A;  2VOC A;  4QL9 A;  1SJI A;  3FKF A;  4G9H A;  3ZLP A;  3TKS E;  1SL2 B;  1UVZ A;  3CRU A;  3MSZ A;  4MNN A;  1PKW A;  4GST A;  2L4C A;  4V1A p;  1EV9 A;  2HRA A;  4ML1 A;  2JAC A;  4WBR D;  4ECC A;  2HRN A;  4F2I A;  1GP1 A;  4AJ7 A;  1HNC A;  2C3Q A;  5D93 A;  2FA4 A;  1GTB A;  5COH A;  3C1R A;  3TRQ A;  4LL1 B;  4HS1 A;  1O85 A;  4BWQ A;  1YEP A;  4ZBD A;  4RI6 A;  3KH9 A;  5C00 A;  1GL8 A;  1R5A A;  5HFK A;  3UAP A;  4BVX B;  5CO3 A;  3HVS A;  3HYP A;  4QQ7 A;  1K0B A;  3KMN A;  2VL2 A;  4PGT A;  3EC3 A;  1K0N A;  2R0G A;  3WYW A;  3UJ1 A;  4WKW A;  4K1F A;  2R37 A;  1TU7 A;  4I2U A;  1GTU A;  1S3C A;  4XIH A;  1Z3E A;  4TXO B;  5A4U A;  4MZC A;  1X9W B;  3W6G A;  2VCV A;  1GSY A;  1OVN A;  4A5P A;  2B3S A;  4I5Q A;  1Z6M A;  3MNG A;  3IAS 2;  4F82 A;  4O32 A;  3IV4 A;  2GS3 A;  3HKR A;  4QL7 A;  5DBQ A;  4OFT A;  5AIX A;  1B4Q A;  4ZBA A;  2HZE B;  1XPV A;  2MMA A;  4EE0 A;  1JFU A;  4YH2 A;  2GSQ A;  2L6C A;  4EO3 A;  3ZTL A;  1T7P B;  3GHA A;  1FAA A;  3NZN A;  4KB3 A;  3EIN A;  3NIV A;  4HU7 A;  3A2X A;  4ZB8 A;  1SKS B;  1TK8 B;  3TGZ A;  3VWW A;  2FWE A;  3FMW A;  5IOW A;  4X0X A;  5D73 A;  1T8E B;  1WWJ A;  2RM5 A;  1NHY A;  20GS A;  5CP1 A;  2P0G A;  1U88 A;  3BD2 A;  4OCF A;  1XVW A;  3EMX A;  3E3E A;  2V6K A;  1BJX A;  2VCZ A;  3TJB A;  3LOR A;  4JR4 A;  4OFN A;  2QGV A;  1NSW A;  1G0T A;  1O6J A;  3KGK A;  3HZ4 A;  3HCZ A;  1W4V A;  3GSS A;  4TR1 B;  1NM3 A;  4FO5 A;  3H1N A;  1QFN A;  4KUN A;  1ERW A;  3GKX A;  3FW2 A;  2DLX A;  4PX1 A;  3HY2 A;  4J56 E;  3FR6 A;  1UA5 A;  2VCW A;  1A0F A;  3MDK A;  2O87 A;  3LXZ A;  5IO2 A;  4POM A;  3IDV A;  4DSS B;  1F2E A;  1OYJ A;  2WCI A;  1J9B A;  1SD8 A;  4EC0 A;  2GST A;  3D4M A;  1QXH A;  3E9J B;  3G7J A;  4ID0 A;  2XPD A;  2M46 A;  5G31 A;  4L5O A;  5J4U A;  3ZIT A;  1WOU A;  4MP4 A;  2B1L A;  4IVF A;  4NV2 A;  4N0Z A;  2WUL A;  3DYR A;  3QCP A;  1Y6E A;  4IP1 A;  1MDK A;  5D9X A;  1S3R A;  1TJD A;  3FR9 A;  1ZYP A;  4K7O A;  4MK3 A;  3E0U A;  2HRK A;  1GWC A;  2PPT A;  2F51 A;  1ZOF A;  2C1Y A;  3P90 A;  1AUC A;  3AY8 A;  2FWF A;  3KTB A;  1MTC A;  4OCE A;  3LYP A;  3IR4 A;  1TP9 A;  3GUS A;  4LL4 B;  2ZUP A;  4G10 A;  2YCD A;  1GRX A;  4BA7 A;  4ZIJ A;  2NTO A;  3QFA C;  2LQQ A;  2QKE A;  1G7O A;  5IMA A;  3K8N A;  4IP6 A;  1XOB A;  3ZL5 A;  1A8L A;  2X49 A;  3GKN A;  2A4V A;  1VF2 A;  3IAM 2;  1SK2 A;  4BIK A;  5ECK B;  6GSX A;  2IJY A;  2OE1 A;  4KGI A;  1A2J A;  4HJ2 A;  3G7I A;  2HXK A;  5CRD A;  1XVQ A;  4KDY A;  5J9C A;  4BVY A;  2WZ9 A;  1HQO A;  2FA8 A;  4NV5 A;  3D21 A;  2LRN A;  4N10 A;  1Z7P A;  2BTO T;  4YAP A;  1H4O A;  5ECQ B;  1BQ7 A;  1JZW A;  3GYK A;  4PUR A;  2KOK A;  4XTS A;  3VK9 A;  4JRR A;  4O92 A;  4ZXG A;  1AXD A;  2F9S A;  3GTU A;  4O5U A;  3VWU A;  3DRN A;  3UEM A;  4OD7 A;  4ICY A;  4MF7 A;  1IYI A;  1SK0 A;  4KE3 A;  1Q4J A;  2H70 A;  4OMV A;  1V58 A;  1TRS A;  2IFQ A;  2QA1 A;  2VAF A;  3KM6 A;  1VF3 A;  3CRT A;  2L6D A;  3TKS A;  2C0F A;  1TK5 B;  5ID2 B;  5IMC A;  3KCM A;  1YJ6 A;  2HFD A;  4XHM A;  3TJK A;  1RW1 A;  1JLV A;  4HI7 A;  5D9T A;  3GKM A;  1Z9H A;  3RPP A;  2O89 A;  4ZL7 A;  5B7C A;  1OKT A;  1GUH A;  3WT1 A;  3ZVJ D;  2R5G A;  5CRG A;  10GS A;  3C71 A;  4J57 E;  2MBT A;  2DJ0 A;  4MJC A;  1SL0 B;  4J2F A;  3DVX A;  3WD6 A;  5EY6 A;  2JL4 A;  4ECB A;  1G7E A;  4L0W A;  5JWR B;  3G9B A;  2C3N A;  5KN1 A;  2OE3 A;  1WRY A;  4WR4 A;  3APQ A;  1S3D A;  2DBC A;  2V1M A;  4MPG A;  5F07 A;  1TRU A;  2EIO A;  4JBB A;  3WGE A;  2H71 A;  1TK0 B;  2PMT A;  4O5Q A;  3A2V A;  5AN1 A;  5H5R A;  3DWV A;  2CZ3 A;  4HQZ A;  1TW9 A;  2C8U A;  4TR0 A;  4IEL A;  3IHG A;  2D2Z A;  3PGT A;  1TI3 A;  4LLR A;  2OAD A;  2X99 A;  1OC3 A;  5JCG A;  5CRE A; 
#chains in the Genus database with same CATH homology
 1DE2 A;  1JLW A;  2DSA A;  1F3A A;  4MH3 A;  2E2G A;  3IC4 A;  4XS6 A;  3TCO A;  1XIY A;  3FRC A;  4E8E A;  5DAL B;  4I97 A;  2UZ8 A;  2P5R A;  3Q6O A;  4YQM A;  1B8X A;  2ES7 A;  2BJX A;  4NWY A;  2CQ9 A;  2NVL A;  1G6Y A;  2AJQ B;  5IO0 A;  3RHC A;  2DML A;  3LWA A;  2LNS A;  3ZMK A;  2DMM A;  5A4V A;  5DDL A;  3DEX A;  22GS A;  1A0R P;  3TRP A;  1O7U A;  4YQU A;  2CZ2 A;  4FH8 A;  4OFM A;  2AHE A;  4DSQ A;  2HE3 A;  5FT3 A;  4ZL8 A;  4XRA A;  1A23 A;  2XPE A;  3UBK A;  4DEJ A;  4GWR A;  4TKY A;  2CVK A;  6GSV A;  2H66 A;  4G19 A;  5IPH A;  3GV1 A;  1PGT A;  4DVC A;  5D9V A;  1XWB A;  1O8W A;  2YWM A;  2YV9 A;  2YZU A;  2VUP A;  1TXX A;  4NAX A;  4LMV A;  2CX4 A;  1FO5 A;  2AV4 A;  2K8V A;  2C3T A;  4ZL9 A;  2YJ7 A;  2FD3 A;  2O8V B;  2ZNM A;  2WJU A;  2KUC A;  3UBL A;  2H8L A;  1OKD A;  4HJM A;  3HJO A;  4MA9 A;  1V40 A;  4G0I A;  1M9A A;  4TVE A;  4K5S A;  1PX6 A;  2LJK A;  4NPB A;  3HHV A;  3VWV A;  3PIN A;  2MBS A;  2HYX A;  1BED A;  2VCQ A;  1JZD A;  1SKR B;  6GSS A;  2PVO C;  2GZY A;  2A2S A;  2LEG A;  2L4Q A;  1VF4 A;  4TXO A;  2J23 A;  4KAE A;  5E4W A;  1SYR A;  1T1V A;  4Q5F A;  3QMX A;  5IM9 A;  1EEM A;  4MAB A;  3J7Y k;  2L5L A;  1TI1 A;  1W89 A;  4FQU A;  3D5J A;  4HOJ A;  1GSE A;  4GQF A;  5IMZ A;  1XBS A;  4XS4 B;  4BL7 B;  4JE1 A;  4NMU A;  4Z7X A;  4X4J A;  1EP8 A;  1EOH A;  2LST A;  3VWX A;  3A5I A;  2LQO A;  5AGY A;  1TKD B;  2VLT A;  1K0O A;  3QAG A;  5E59 A;  4ISD A;  2R6K A;  2A4H A;  1UN2 A;  3D4T A;  2QC7 A;  1TU8 A;  4ZBB A;  3EPT A;  4I6X A;  4POB A;  2FWH A;  3TUE A;  3QD9 A;  1M9B A;  2G0F A;  4JR6 A;  4V2M A;  2GLR A;  4EL1 A;  3L9V A;  3IPZ A;  16GS A;  1ZYN A;  2M72 A;  5KEJ A;  2R2J A;  4EIQ A;  5GAN D;  1A2L A;  3NOF A;  4AGS A;  5ABR A;  3VFI A;  2IN3 A;  1ST9 A;  2F8F A;  3GN3 A;  2PUK C;  4E8H A;  1LJR A;  6GSU A;  3N9J A;  2IMK A;  14GS A;  3FHK A;  1M99 A;  1WP0 A;  8GSS A;  4KND A;  1EEJ A;  1K3O A;  3BCI A;  5G5E A;  3BOA A;  1WIK A;  2XHF A;  4K0G A;  5H5S A;  4NHW A;  4JZQ A;  3DD3 A;  3RDW A;  2IMI A;  4IGJ A;  3LJR A;  3IBH A;  1I5G A;  4O5R A;  1DSB A;  2EC4 A;  1GNE A;  4MJE A;  3VI7 A;  3GX8 A;  2RUE A;  1FVK A;  2PU9 C;  3WGD A;  4Q5Q A;  2IME A;  4MJA A;  4WBJ A;  3HJM A;  3M3M A;  3IC8 A;  3G7Y A;  4DSS A;  3EU3 A;  3KEB A;  3HXS A;  4MPF A;  3FZ4 A;  5DJM A;  3LQ7 A;  3TJF A;  1YZX A;  5LNK e;  3RAZ A;  2YZH A;  1TDI A;  5IIZ A;  4K9Z A;  2N5B A;  3KH7 A;  3GH6 A;  1OAZ A;  3IE3 A;  4EKZ A;  3QFB C;  1MD3 A;  4PQH A;  3Q19 A;  1KBN A;  3ISO A;  5B8B A;  4MZW A;  1XW9 A;  1V57 A;  3F9U A;  4MJB A;  4PNF A;  4X43 A;  2V2G A;  2VO4 A;  3F6F A;  4K7N A;  1B4P A;  3FEU A;  1AC1 A;  1PL1 A;  1FOV A;  2C0G A;  5DCG A;  4POL A;  3WT2 A;  2A2P A;  3UAR A;  1I9D A;  5HFI A;  3LW9 A;  4ML6 A;  2CVB A;  3ZRD A;  3H79 A;  3TOT A;  3FY7 A;  2WB9 A;  2VCX A;  2YNX A;  3CSH A;  5INY A;  2R0P A;  2A2R A;  3FZ9 A;  3APS A;  2IL3 A;  1PRX A;  1UC7 A;  2YN1 A;  2LRC A;  4ACS A;  1HYU A;  4WR5 A;  4OWY A;  1XXU A;  4WXT A;  1VRS D;  3F3Q A;  5BMU A;  1Y25 A;  1M2B A;  3QDN A;  3WGX A;  2CT6 A;  2R0C A;  2GGT A;  2X64 A;  2HZF A;  2MMZ A;  5KN0 A;  2L59 A;  3P8W A;  2VL9 A;  3UVH A;  2C0D A;  2LTK A;  5ECI B;  1U3A A;  3KIJ A;  1YKA A;  2H75 A;  1PQN A;  1GSQ A;  1TRW A;  5FWG A;  2MMN A;  2PVQ A;  2B1K A;  12GS A;  2LV3 A;  1OC9 A;  2HI7 A;  3EWL A;  3IK9 A;  4CHS A;  3TKP A;  1FOH A;  2OBK A;  2DKI A;  4BWS A;  5ELG A;  1X0R A;  4K7I A;  1B9X C;  4IQ1 A;  1M2A A;  1SYX A;  1T4Y A;  1K3L A;  4L5L A;  1AQX A;  3HVX A;  1R4W A;  1SL1 B;  3EUR A;  1BAY A;  1GTI A;  5G5F A;  5C04 A;  2OAC A;  2F3M A;  3CTG A;  1E2Y A;  1MEK A;  4MMM A;  1MDI A;  5CNW A;  2H6X A;  2DKH A;  1SEN A;  2DJJ A;  5JCW A;  4RI7 A;  1YF1 A;  3MIX A;  2Z9S A;  1T00 A;  3I43 A;  2TRX A;  5JCU A;  2XC2 A;  4F9Z A;  1GUL A;  2FNO A;  1GSS A;  4YKF A;  1SJZ A;  1F9M A;  1PD2 1;  4Q5N A;  3LSZ A;  1PSQ A;  1ZGN A;  1K0M A;  2AAW A;  3KP8 A;  4P3Y B;  1TTZ A;  5FHI A;  1BG5 A;  2QSI A;  3GST A;  1CQG A;  1DE1 A;  5LD0 A;  3TKS C;  2DJ3 A;  2H72 A;  1O73 A;  2BMX A;  1FB0 A;  1WMJ A;  1LU4 A;  1V2A A;  3LFL A;  2GQL A;  1RQM A;  3L9U A;  1AW9 A;  4AJ8 A;  5HQP A;  3EYT A;  1X9S B;  4PQI A;  1ZMA A;  1IYH A;  3Q74 A;  2R4V A;  3LYK A;  3ZIV A;  4YKG A;  4TOP A;  3GH9 A;  4FIW A;  1ML6 A;  3IRA A;  6GSY A;  1C72 A;  2VD0 A;  4BVY B;  4H86 A;  1DBY A;  4TW5 A;  2OJL A;  3FYG A;  1GLQ A;  2DJK A;  2HSY A;  2XBQ A;  4KCA A;  1K0D A;  2B7J A;  4KSM A;  1MDJ A;  4KA0 A;  2LJR A;  3KJY A;  1R5P A;  2HSM A;  5DCH A;  3DKS A;  4F0C A;  3VPT A;  2H1A A;  1QK8 A;  4BPY A;  2JZT A;  7GSS A;  1YY7 A;  3L4N A;  3DIE A;  1ZYE A;  3DGQ A;  2GZP A;  5J5N A;  3CXG A;  2H1G A;  4D73 A;  2FGX A;  4GQC A;  4HU9 A;  1R7H A;  2IFQ B;  2K9F A;  1YQ1 A;  2CAI A;  4IJI A;  1Z7R A;  4F0B A;  3EVI A;  1EGR A;  5KOX A;  3CSJ A;  4POK A;  1CQH A;  2LNT A;  1J0F A;  3GUR A;  2IIY A;  5D96 A;  2H0G A;  4IKH A;  3HA9 A;  3RPN A;  2JZR A;  3SWL A;  1X5C A;  5IMD A;  5EVO A;  2HSH A;  3C7M A;  5DAK A;  2VCT A;  3APO A;  4RUV A;  3TJG A;  4OO5 A;  5D8I A;  3I6A A;  4TR4 A;  3LXT A;  2L5O A;  2YWI A;  4WF4 A;  3KTL A;  4RQR A;  2TIR A;  3S9F A;  3M9J A;  3C73 A;  3HJP A;  1WPI A;  3CTF A;  1GUM A;  5ECO B;  1FB6 A;  1NW2 A;  3GMF A;  2LRT A;  2GSS A;  1SU9 A;  4CW9 A;  3GRX A;  1XOA A;  4MCU A;  5B6M A;  3VI5 A;  4LA1 A;  2PER A;  5IPG A;  5CAX A;  3FR3 A;  4GSN A;  2YWO A;  3QPM A;  3HD5 A;  5F0G A;  1JZO A;  2I1U A;  2NPB A;  4GXZ A;  2FWG A;  1K0A A;  1GSF A;  4AF2 A;  4FYC A;  1XWG A;  1FG4 A;  4XS4 A;  2HRF A;  4HEA 2;  3J7Y b;  2C0E A;  2DIY A;  4BVX A;  3FK8 A;  3ZYW A;  1X5E A;  3TKQ A;  3CBU A;  5GAP D;  1PL2 A;  5KN2 A;  1ERV A;  3VUR A;  2VM1 A;  1AAZ A;  1ACV A;  1OE7 A;  3H93 A;  2O85 A;  3HZ8 A;  1H75 A;  4KH7 A;  3N5O A;  1YF0 A;  4IJ3 A;  3ZRE A;  2H6Y A;  3R2Q A;  5G1K A;  3Q18 A;  2G2Q A;  3IK7 A;  4YQV A;  4NHZ A;  4EDZ A;  3GKK A;  3CYN A;  1Z5Y E;  5F05 A;  2NBS A;  1ABA A;  4CDO A;  5BRT A;  5DVB A;  2I81 A;  1ZYQ B;  4HDE A;  3TJJ A;  2GZZ A;  3JCM L;  1B48 A;  3ERW A;  2CV4 A;  3U6V A;  4K6X A;  1NHO A;  4GCI A;  2YJH A;  1A8Y A;  3C1S A;  2GVP A;  2VL2 C;  2JZS A;  4PTS A;  2AUV A;  5F06 A;  4F03 A;  3A2W A;  1BYE A;  2H73 A;  2HZE A;  4TRX A;  3D22 A;  4K2D A;  2HNL A;  3PPU A;  3F4R A;  1V98 A;  4JED A;  3RHB A;  4USS A;  4KSO A;  2FLS A;  4HUA A;  2H74 A;  1SKW B;  5KOW A;  2PN8 A;  1WJK A;  4PQ1 A;  1ON4 A;  4I2T A;  3P7X A;  2KHP A;  1SK1 A;  2RM6 A;  5A4W A;  3DVW A;  1XWK A;  3GL3 A;  2ALB A;  4GSS A;  3IA1 A;  2P31 A;  1GSD A;  1F37 A;  1TRV A;  1XW6 A;  1BX9 A;  2H76 A;  4IS0 A;  3BCK A;  4MZB A;  5EL8 A;  1F6M C;  1QQ2 A;  5B8A A;  2H1B A;  2VD1 A;  4GF0 A;  2JU5 A;  3TOU A;  2H30 A;  1ZZY A;  2CX3 A;  1O81 A;  5KN3 A;  3HDC A;  4EF0 A;  1M7T A;  1PN9 A;  4IHU A;  1XFL A;  2KP2 A;  4KX4 A;  4TR1 A;  5AIV A;  3GFK A;  2PGT A;  3F3R A;  3KMO A;  2CVD A;  3ERF A;  3ZIJ A;  3CMI A;  3CSI A;  1M2D A;  4KF9 A;  1QUW A;  3MWH A;  1YKC A;  4Z2U A;  2PWJ A;  4N0V A;  1QGV A;  5B6N A;  2MMO A;  2DIZ A;  4PUF C;  1FW1 A;  3BJ5 A;  4N11 A;  2X8H A;  3M9K A;  1GNW A;  3W8J A;  5J9B A;  1N2A A;  3KZQ A;  4ZB6 A;  5CYY A;  3UMA A;  2ON7 A;  2JSZ A;  4XCS A;  3GIX A;  5ECR B;  3DML A;  3LGC A;  3ME8 A;  5F8B A;  2IWT A;  1WE0 A;  2K8S A;  2J9H A;  3MAK A;  1XZO A;  1E6B A;  2WDU A;  3ERG A;  1EZK A;  2REM A;  1O8X A;  3M0F A;  4ECJ A;  2N5A A;  3P2A A;  1VF1 A;  2PBJ A;  4EVM A;  1EV4 A;  5GZZ B;  5HR2 A;  4Z2T A;  3ZVJ A;  2ON5 A;  1U87 A;  2B7K A;  2VLV A;  2X8G A;  5IMF A;  2EIR A;  2NDO A;  1ZCP A;  3IHQ A;  2E7P A;  1S3A A;  4MDC A;  2OE0 A;  3UIW A;  1Z6N A;  2H19 A;  1F3B A;  1KNG A;  5GSS A;  4WET A;  1PA3 A;  3EE2 A;  4V1A g;  3F0I A;  3M1G A;  3VPQ A;  2MYG A;  2N5F A;  3F4S A;  4EIP A;  2XBI A;  2CAQ A;  13GS A;  1U3I A;  3ZFB A;  18GS A;  2WFC A;  4LMW A;  1XCC A;  1EP7 A;  3FZA A;  1PMT A;  3OR5 A;  5H5Q A;  2I3Y A;  1OE8 A;  4GTU A;  3MYD A;  2H0H A;  5L71 A;  2CA8 A;  3BBY A;  2DJ2 A;  2WS2 A;  2B6M A;  1U6T A;  4TN8 A;  4MF5 A;  6GSW A;  1GTA A;  1XW5 A;  1LBK A;  2IPA A;  1R26 A;  1GH2 A;  1HNA A;  3TB2 A;  4K0N A;  4MH2 A;  5CRW A;  2C80 A;  3GA4 A;  3F6D A;  3ED3 A;  4OO4 A;  5J3R A;  2V32 A;  1URM A;  1EGO A;  2DJ1 A;  2R3X A;  1SJ6 A;  2GDR A;  1THO A;  1VGL A;  2FUG 2;  2I4A A;  3I69 A;  2LKU A;  2V6O A;  4FYU A;  5EPF A;  3TDG A;  1B9Y C;  4L8E A;  5ENU A;  3U5R E;  4N30 A;  1X9M B;  5IMV A;  5DJL A;  4FYB A;  2E2M A;  2RII A;  1YEX A;  4I8B A;  2YWN A;  3C8E A;  4PUA A;  5IOX A;  2RUF A;  4WF5 A;  5DQY A;  3HVV A;  5ID2 A;  3F63 A;  3PH9 A;  3LG6 A;  1AQW A;  3F4T A;  4V2N A;  2JSY A;  1G6W A;  3FZ5 A;  1ERT A;  2YP6 A;  1HNB A;  2C4J A;  2X4A A;  3PR8 A;  2B5Y A;  4TR3 A;  1T4Z A;  4YAV A;  4K5R A;  4GLT A;  3A5W A;  1JZR A;  3RBT A;  3IXR A;  2OA7 A;  1DUG A;  4G0L A;  5ECN B;  4AJ6 A;  5DQS A;  3D0Z A;  3QR6 A;  2O7K A;  2AYT A;  3VLN A;  1OC9 B;  2FY6 A;  4KDU A;  3R3E A;  1MD4 A;  2H1D A;  3V1W A;  2L57 A;  2AB6 A;  1K0C A;  4Z2R A;  3A3T A;  3QAV A;  4X1U A;  5GST A;  3H4K A;  5ECS A;  4K2X A;  1GLP A;  2MZC A;  3ZZX A;  2P5Q A;  1HD2 A;  1PKZ A;  1T3B A;  2DC5 A;  2K18 A;  2GT5 A;  1QMV A;  2FHE A;  2VIM A;  4G2E A;  2E0Q A;  3UL3 A;  2YPM A;  5ECH B;  2GSR A;  1AIU A;  4L0U A;  1M0U A;  2I9H A;  1ILO A;  3ME7 A;  5HR0 A;  4IW9 A;  2H6Z A;  2VL3 A;  1Q98 A;  4MLY A;  4G0K A;  3W8S A;  19GS A;  4XS1 A;  2OBI A;  4GRF A;  3ZML A;  3M8N A;  2H01 A;  2IMF A;  3GX0 A;  4HZ4 A;  4PNG A;  2F8A A;  5IQY A;  4EXJ A;  3QAW A;  3UVT A;  17GS A;  3EU4 A;  5LCZ A;  2QA2 A;  3O3T A;  4KDX A;  5JWQ B;  2EIQ A;  5DAL A;  3GTU B;  3L0H A;  1KEB A;  2KP1 A;  3IOS A;  1EOG A;  2KLX A;  3L78 A;  3QOU A;  4ILF A;  4CY6 A;  2TRC P;  2B5X A;  2GQM A;  4ZIL A;  1ERU A;  1USB A;  2HT9 A;  2LS5 A;  2H0I A;  1YDK A;  1N8J A;  1V9W A;  3O6T A;  2YOI A;  2HLS A;  5D9W A;  5ECP B;  3I9V 2;  1K3Y A;  2OKA A;  3DXB A;  4KCE A;  2JAD A;  4MF6 A;  3UOM A;  2GT6 A;  4WEY A;  3US3 A;  4V2L A;  2V41 A;  3L9S A;  5G30 A;  2RLI A;  4O7H A;  4ZB9 A;  6GST A;  1FHE A;  3EMP A;  3LEF A;  2VLU A;  2YAN A;  4NXI A;  2GQK A;  2IMD A;  1AQV A;  4IQA A;  1KTE A;  5CRH A;  3H8Q A;  4CY8 A;  1XWA A;  5ECL B;  9GSS A;  2YV7 A;  5ECM B;  4TXV A;  3O76 A;  5JWO B;  3KXO A;  4IBP A;  5AIS A;  11GS A;  5G2Z A;  4D73 B;  2WGR A;  1X5D A;  2M80 A;  1THX A;  3ZFL A;  1A24 A;  1PX7 A;  1SD9 A;  3KD0 A;  4KW6 A;  5HR3 A;  2X8C A;  1ZL9 A;  1J08 A;  1EWX A;  5HR1 A;  4JU5 A;  2ZCT A;  1FVJ A;  4ULX A;  2WRT A;  1OC8 A;  4HZ2 A;  4K8M A;  3D6I A;  3KP9 A;  5ELA A;  2VM2 A;  1TOF A;  4RQX A;  5G1L A;  2LUS A;  4HQS A;  5HFG A;  4BL7 A;  3F8U A;  1PN0 A;  2K6V A;  1RK4 A;  4PXO A;  3SBC A;  4DSR A;  1A2M A;  5A5K A;  1XWC A;  5DAK B;  4Q5R A;  4EDY A;  3GNJ A;  2GTU A;  3TRX A;  4ECI A;  5J41 A;  1GUK A;  3GL5 A;  1JHB A;  2B5E A;  2LJA A;  3TKR A;  1GSU A;  4XRD A;  4IN0 A;  2FCH A;  4EUY A;  2VOC A;  4QL9 A;  1SJI A;  3FKF A;  4G9H A;  3ZLP A;  3TKS E;  1SL2 B;  1UVZ A;  3CRU A;  3MSZ A;  4MNN A;  1PKW A;  4GST A;  2L4C A;  4V1A p;  1EV9 A;  2HRA A;  4ML1 A;  2JAC A;  4WBR D;  4ECC A;  2HRN A;  4F2I A;  1GP1 A;  4AJ7 A;  1HNC A;  2C3Q A;  5D93 A;  2FA4 A;  1GTB A;  5COH A;  3C1R A;  3TRQ A;  4LL1 B;  4HS1 A;  1O85 A;  4BWQ A;  1YEP A;  4ZBD A;  4RI6 A;  3KH9 A;  5C00 A;  1GL8 A;  1R5A A;  5HFK A;  3UAP A;  4BVX B;  5CO3 A;  3HVS A;  3HYP A;  4QQ7 A;  1K0B A;  3KMN A;  2VL2 A;  4PGT A;  3EC3 A;  1K0N A;  2R0G A;  3WYW A;  3UJ1 A;  4WKW A;  4K1F A;  2R37 A;  1TU7 A;  4I2U A;  1GTU A;  1S3C A;  4XIH A;  1Z3E A;  4TXO B;  5A4U A;  4MZC A;  1X9W B;  3W6G A;  2VCV A;  1GSY A;  1OVN A;  4A5P A;  2B3S A;  4I5Q A;  1Z6M A;  3MNG A;  3IAS 2;  4F82 A;  4O32 A;  3IV4 A;  2GS3 A;  3HKR A;  4QL7 A;  5DBQ A;  4OFT A;  5AIX A;  1B4Q A;  4ZBA A;  2HZE B;  1XPV A;  2MMA A;  4EE0 A;  1JFU A;  4YH2 A;  2GSQ A;  2L6C A;  4EO3 A;  3ZTL A;  1T7P B;  3GHA A;  1FAA A;  3NZN A;  4KB3 A;  3EIN A;  3NIV A;  4HU7 A;  3A2X A;  4ZB8 A;  1SKS B;  1TK8 B;  3TGZ A;  3VWW A;  2FWE A;  3FMW A;  5IOW A;  4X0X A;  5D73 A;  1T8E B;  1WWJ A;  2RM5 A;  1NHY A;  20GS A;  5CP1 A;  2P0G A;  1U88 A;  3BD2 A;  4OCF A;  1XVW A;  3EMX A;  3E3E A;  2V6K A;  1BJX A;  2VCZ A;  3TJB A;  3LOR A;  4JR4 A;  4OFN A;  2QGV A;  1NSW A;  1G0T A;  1O6J A;  3KGK A;  3HZ4 A;  3HCZ A;  1W4V A;  3GSS A;  4TR1 B;  1NM3 A;  4FO5 A;  3H1N A;  1QFN A;  4KUN A;  1ERW A;  3GKX A;  3FW2 A;  2DLX A;  4PX1 A;  3HY2 A;  4J56 E;  3FR6 A;  1UA5 A;  2VCW A;  1A0F A;  3MDK A;  2O87 A;  3LXZ A;  5IO2 A;  4POM A;  3IDV A;  4DSS B;  1F2E A;  1OYJ A;  2WCI A;  1J9B A;  1SD8 A;  4EC0 A;  2GST A;  3D4M A;  1QXH A;  3E9J B;  3G7J A;  4ID0 A;  2XPD A;  2M46 A;  5G31 A;  4L5O A;  5J4U A;  3ZIT A;  1WOU A;  4MP4 A;  2B1L A;  4IVF A;  4NV2 A;  4N0Z A;  2WUL A;  3DYR A;  3QCP A;  1Y6E A;  4IP1 A;  1MDK A;  5D9X A;  1TJD A;  3FR9 A;  1ZYP A;  4K7O A;  4MK3 A;  3E0U A;  2HRK A;  1GWC A;  2PPT A;  2F51 A;  1ZOF A;  2C1Y A;  3P90 A;  1AUC A;  3AY8 A;  2FWF A;  3KTB A;  1MTC A;  4OCE A;  3LYP A;  3IR4 A;  1TP9 A;  3GUS A;  4LL4 B;  2ZUP A;  4G10 A;  2YCD A;  1GRX A;  4BA7 A;  4ZIJ A;  2NTO A;  3QFA C;  2LQQ A;  2QKE A;  1G7O A;  5IMA A;  3K8N A;  4IP6 A;  1XOB A;  3ZL5 A;  1A8L A;  2X49 A;  3GKN A;  2A4V A;  1VF2 A;  3IAM 2;  1SK2 A;  5ECK B;  6GSX A;  2IJY A;  2OE1 A;  4KGI A;  1A2J A;  4HJ2 A;  3G7I A;  2HXK A;  5CRD A;  1XVQ A;  4KDY A;  5J9C A;  4BVY A;  2WZ9 A;  1HQO A;  2FA8 A;  4NV5 A;  3D21 A;  2LRN A;  4N10 A;  1Z7P A;  2BTO T;  4YAP A;  1H4O A;  5ECQ B;  1BQ7 A;  1JZW A;  3GYK A;  4PUR A;  2KOK A;  4XTS A;  3VK9 A;  4JRR A;  4O92 A;  4ZXG A;  1AXD A;  2F9S A;  3GTU A;  4O5U A;  3VWU A;  3DRN A;  3UEM A;  4OD7 A;  4ICY A;  4MF7 A;  1IYI A;  1SK0 A;  4KE3 A;  1Q4J A;  2H70 A;  4OMV A;  1V58 A;  1TRS A;  2IFQ A;  2QA1 A;  2VAF A;  3KM6 A;  1VF3 A;  3CRT A;  2L6D A;  3TKS A;  2C0F A;  1TK5 B;  5ID2 B;  5IMC A;  3KCM A;  1YJ6 A;  2HFD A;  4XHM A;  3TJK A;  1RW1 A;  1JLV A;  4HI7 A;  5D9T A;  3GKM A;  1Z9H A;  3RPP A;  2O89 A;  4ZL7 A;  5B7C A;  1OKT A;  1GUH A;  3WT1 A;  3ZVJ D;  2R5G A;  5CRG A;  10GS A;  3C71 A;  4J57 E;  2MBT A;  2DJ0 A;  4MJC A;  1SL0 B;  4J2F A;  3DVX A;  3WD6 A;  5EY6 A;  2JL4 A;  4ECB A;  1G7E A;  4L0W A;  5JWR B;  3G9B A;  2C3N A;  5KN1 A;  2OE3 A;  1WRY A;  4WR4 A;  3APQ A;  1S3D A;  2DBC A;  2V1M A;  4MPG A;  5F07 A;  1TRU A;  2EIO A;  4JBB A;  3WGE A;  2H71 A;  1TK0 B;  2PMT A;  4O5Q A;  3A2V A;  5AN1 A;  5H5R A;  3DWV A;  2CZ3 A;  4HQZ A;  1TW9 A;  2C8U A;  4TR0 A;  4IEL A;  3IHG A;  2D2Z A;  3PGT A;  1TI3 A;  4LLR A;  2OAD A;  2X99 A;  1OC3 A;  5JCG A;  5CRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...