1GP1A

The refined structure of the selenoenzyme glutathione peroxidase at 0.2-nm resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
184
structure length
183
Chain Sequence
RTVYAFSARPLAGGEPFNLSSLRGKVLLIENVASLGTTVRDYTQMNDLQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNCLKYVRPGGGFEPNFMLFEKCEVNGEKAHPLFAFLREVLPTPSDDATALMTDPKFITWSPVCRNDVSWNFEKFLVGPDGVPVRRYSRRFLTIDIEPDIETLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase(h2o2(a))
molecule keywords GLUTATHIONE PEROXIDASE
publication title The refined structure of the selenoenzyme glutathione peroxidase at 0.2-nm resolution.
pubmed doi rcsb
source organism Bos taurus
total genus 59
structure length 183
sequence length 184
chains with identical sequence B
ec nomenclature ec 1.11.1.9: Glutathione peroxidase.
pdb deposition date 1985-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gp1A00
1M7TA 3HKRA 1SK1A 2NDOA 1T4ZA 1F3AA 3HYPA 1G0TA 4OD7A 2HFDA 4ZB8A 1TW9A 2JADA 3E0UA 3UL3A 1SKWB 1SK2A 4XS6A 4TXVA 4POLA 2HLSA 4MK3A 2H6XA 4KGIA 4POMA 5CREA 1GLQA 2K9FA 2DJ3A 1JFUA 6GSTA 1AC1A 2O85A 1HNAA 4WKWA 2KOKA 2YJHA 3TKSC 5EPFA 3WGDA 19GSA 3GSTA 5GSSA 1TDIA 3ZMKA 2FWGA 3HXSA 4WF4A 4BPYA 4DEJA 2JZRA 3C73A 5F06A 4MH3A 3ERGA 2B1LA 3V1WA 3QCPA 1K0DA 5HQPA 2M72A 3QFAC 4JZQA 1WP0A 2GZPA 5IMAA 5LD0A 3IRAA 3M3MA 3TKSA 4HQSA 5D93A 3IXRA 5DAKB 2MZCA 3EMPA 2FWEA 1ZCPA 2N5BA 3GFKA 5ECIB 1AUCA 2HZEA 3KP8A 5DVBA 2V6KA 1QUWA 1XW6A 4ZBDA 4TN8A 6GSYA 1S3DA 1IYHA 1XWGA 1YQ1A 2L6CA 1TXXA 3FZ4A 4G9HA 4Q5QA 1X9SB 3ZL5A 2V2GA 3M9KA 2C0DA 1TKDB 2R5GA 4HOJA 1THXA 2QSIA 3BJ5A 2E2MA 3IC4A 5D96A 1TU7A 1V40A 3LJRA 2DLXA 3ERWA 3F0IA 4V2NA 2VLTA 2VUPA 2O7KA 3GNJA 2MYGA 2PWJA 3TUEA 1A2JA 4IJIA 4WXTA 3SWLA 2FY6A 4TVEA 4YAVA 3IAS2 2VLVA 3K8NA 1GL8A 2BTOT 4YAPA 4ZILA 3DIEA 3TRXA 2G0FA 4Q5RA 3EC3A 3FRCA 5D9WA 5AIVA 3HVXA 2WJUA 1TRWA 4IELA 1A2MA 5KN3A 3CRTA 4H86A 1U88A 2CX3A 4F2IA 2I3YA 4BVXA 2FGXA 4MMMA 3G7JA 2YP6A 4GQFA 5IQYA 3QDNA 2GSSA 4CHSA 6GSSA 4K2DA 4K8MA 1FOVA 1EV4A 5ID2B 3IA1A 4WEYA 3TKQA 3D5JA 2OE3A 4NMUA 2R3XA 3QMXA 3TJFA 1A2LA 1TI1A 1SK0A 5ECLB 1OC9B 1THOA 1BX9A 5HFGA 2WRTA 2YWNA 1EEJA 4MPGA 4CDOA 2E0QA 1F2EA 2PBJA 2F8FA 3TKSE 1I5GA 5CYYA 1FB0A 5IPHA 3J7Yk 1ABAA 4PQHA 2WGRA 1V2AA 2V41A 3BD2A 4Z7XA 3DMLA 1SL1B 5F0GA 4IS0A 2DSAA 3ISOA 1N8JA 1B4PA 2QGVA 4ML1A 3ZIVA 2GZZA 4IP6A 2DIYA 2H8LA 2VIMA 3DD3A 3LG6A 2LRNA 2YZHA 3NIVA 3LQ7A 3CMIA 2DC5A 1VF3A 5DCHA 1WPIA 3KH9A 4KSMA 2H6YA 2IL3A 3EU4A 1SJ6A 3W8SA 2LS5A 1GSYA 1WWJA 2WFCA 1TOFA 4JRRA 3F4SA 2A4VA 3SBCA 1GNEA 5INYA 2DJ0A 1EP8A 4ZB6A 3UBLA 3S9FA 3CXGA 3CRUA 4PUAA 3DWVA 4TR1B 2PVOC 4D73A 3KTLA 1GUHA 3TCOA 2A2SA 3US3A 2LNTA 2VCZA 1O8WA 3H79A 1OKTA 1WE0A 1PL1A 4GWRA 2LQOA 3G9BA 5ELGA 1JLWA 4ZL8A 3Q19A 3IDVA 1LU4A 5EY6A 4LL4B 3HZ4A 4TR0A 3VWWA 2H76A 4EUYA 3GMFA 2L4CA 1V9WA 1YEPA 4LLRA 5CNWA 1B48A 2O8VB 5E59A 2LJAA 4ULXA 4EKZA 2AYTA 3FZ5A 2EIOA 2ALBA 2WULA 3G7YA 1A8YA 2JL4A 1XWCA 4KCAA 4ZBBA 1T7PB 2R6KA 2VAFA 1R5PA 1FB6A 4QQ7A 4JBBA 3ZTLA 4WETA 3M1GA 3TJKA 4DSSB 3L0HA 5DCGA 1WMJA 3LGCA 1GSDA 2C3QA 2P0GA 2KUCA 3MWHA 2OKAA 2GGTA 3KD0A 1MTCA 3VPTA 3BBYA 4X0XA 3ZZXA 3WD6A 1T1VA 5D9XA 4O32A 1SYXA 2GSQA 1UN2A 3RDWA 2OA7A 2M46A 2M80A 1XPVA 3TOUA 2H71A 1Q98A 4AGSA 3KEBA 3C8EA 2AB6A 3FZAA 1X5DA 2VO4A 4FYCA 4MJAA 5IOWA 4MZWA 4BL7A 2YCDA 5CP1A 9GSSA 2O87A 2JSYA 3TJGA 1C72A 4I8BA 5HR2A 3GYKA 1N2AA 4YH2A 2L6DA 1SL0B 3LYKA 4XS4B 5DALB 4AF2A 2C0FA 1F3BA 5IM9A 2CAQA 3IBHA 1R4WA 3VWXA 3UOMA 2AV4A 2YV7A 4TXOB 3UVHA 1DE1A 2VCXA 4IP1A 3CTGA 2VM1A 4HU7A 5IIZA 4FO5A 5J5NA 4DSQA 4WF5A 4MJEA 4OCEA 1XVQA 3ZMLA 2K18A 4TR3A 4GRFA 2L57A 4L5OA 3A2XA 1K0MA 5DDLA 4NV2A 3GA4A 4JR6A 1Z9HA 4KE3A 2GTUA 1S3AA 4XRAA 2DMLA 1A23A 4TKYA 3LFLA 2YPMA 1PX7A 2NBSA 2H1GA 1T3BA 1ON4A 3ZYWA 1PX6A 2ZUPA 1YEXA 1O8XA 2LRCA 2I9HA 1S3CA 1I9DA 2IFQB 5IMCA 4PUFC 20GSA 2BJXA 2GT6A 3GSSA 2Z9SA 5KN2A 3NZNA 3A3TA 1VGLA 3F6DA 5D73A 4NPBA 1GP1A 2HSHA 4O5RA 4IKHA 3FHKA 5ECQB 1VF4A 1TK8B 3F4RA 4I6XA 1BEDA 3D0ZA 1SKSB 5H5RA 4GSTA 3HVVA 4GXZA 2DJ1A 2HSYA 2IMEA 2GDRA 4G10A 2LEGA 1NSWA 4K6XA 2VCTA 3QFBC 1OVNA 4IW9A 1TK5B 5D9TA 5JWRB 2C3NA 4BWQA 2C1YA 2H30A 5IMDA 1GNWA 2MMOA 1EV9A 3VWUA 1F37A 1ZZYA 3E3EA 3HA9A 2HRFA 2J9HA 5FT3A 1DBYA 1GRXA 5B7CA 2XC2A 2H74A 2ON5A 3M0FA 4X43A 1XOBA 4EO3A 4MF5A 5CRWA 1MDKA 4NV5A 2JZSA 2H19A 2HI7A 1ERTA 3LWAA 5ECSA 2YWMA 4TXOA 2X8HA 1NW2A 3ED3A 1TTZA 1VF1A 2PN8A 4BA7A 1O6JA 5ECNB 2LRTA 4HEA2 3U5RE 5J9BA 3MDKA 2YNXA 2H1AA 1TRVA 1QMVA 4ECBA 4MJCA 4NAXA 3CTFA 1GTUA 1TRUA 2PMTA 1EOHA 5GAPD 1R26A 2I4AA 4L0UA 2C0EA 2K6VA 1BAYA 3CYNA 4KSOA 2EC4A 3O76A 3UIWA 4EF0A 1BJXA 1M99A 4P3YB 5HR0A 1M2AA 3GTUB 4F03A 5GSTA 4MLYA 3DEXA 4F0CA 1RW1A 3IHQA 1FG4A 1V98A 4TW5A 2X8CA 4PX1A 1Y25A 4IHUA 2R4VA 3IR4A 3UARA 2A2RA 4MCUA 4N11A 3L9SA 3BCKA 1R7HA 4DSRA 1K3OA 3CSHA 1M9BA 1PSQA 2KP2A 4IQAA 4O7HA 2FCHA 1QGVA 3D22A 2C4JA 4MF6A 3KCMA 3CSJA 1EOGA 2KP1A 1PQNA 4JE1A 3GKXA 2H75A 4ML6A 2H6ZA 2REMA 4OO5A 1Z7RA 4PXOA 1AQWA 3PINA 2CZ2A 3N9JA 4L8EA 4POBA 4LMWA 3ZVJA 1HNBA 3L4NA 2PVQA 1J9BA 3VFIA 2CVBA 3KTBA 2IIYA 2BMXA 2KHPA 4HJ2A 5G5FA 5HFKA 1OC3A 3H93A 2IMKA 2MMNA 4ZB9A 1ST9A 3E9JB 2VCVA 4WBJA 5KEJA 1WJKA 5AGYA 3DGQA 5FWGA 2GZYA 4E8HA 4KDUA 5DAKA 1QXHA 3LSZA 1CQGA 1Z3EA 1SU9A 1XXUA 2PPTA 1PD21 1J08A 1Z6NA 4IJ3A 4NHZA 1KBNA 4NWYA 3J7Yb 4GLTA 1KEBA 4L5LA 3G7IA 3HDCA 3IK7A 3KMOA 5J9CA 4HS1A 2N5AA 2RUEA 4ECJA 4JR4A 3DXBA 3GKKA 4RUVA 3ZRDA 4YQMA 4TR4A 5DJMA 1X9MB 1FO5A 1QFNA 2R37A 4MF7A 3P2AA 2DBCA 4XS1A 3TRPA 5J3RA 3PGTA 5CRDA 1JZDA 1AIUA 4ZL7A 1XOAA 2FA4A 2OADA 1JZRA 4NHWA 4POKA 1HQOA 2TRXA 1W89A 4PNFA 1NM3A 3ZITA 2MBSA 2X99A 4JU5A 1PGTA 1U3AA 3W6GA 4DVCA 2PGTA 2H0HA 1SKRB 2XHFA 1EEMA 2GS3A 2IMIA 3L78A 1WOUA 1GTIA 6GSVA 5F07A 1V57A 3IPZA 3C7MA 3QPMA 4KAEA 4PQ1A 1XW9A 4OCFA 4KX4A 2B6MA 1ML6A 2ZNMA 3MAKA 5J41A 1SD9A 3APOA 17GSA 3ZREA 2FA8A 2WDUA 1MEKA 1B9XC 5ID2A 1FVKA 1EGRA 2OBIA 4K7OA 2YN1A 1IYIA 4I2TA 3A2VA 1JLVA 5F05A 4AJ8A 1OC9A 3N5OA 2VL2C 4G2EA 4LA1A 4AJ7A 5IPGA 2F3MA 2OE1A 3ZLPA 1XW5A 3TJJA 2RUFA 2LKUA 2HRNA 3I6AA 2H70A 1RQMA 4RI7A 1GSEA 3JCML 4F0BA 1GSUA 4ZXGA 3WYWA 3HJPA 5ECMB 3GHAA 1X0RA 1VRSD 2E2GA 1EP7A 1BG5A 3ZFBA 5EL8A 5IO0A 2VL2A 4ZBAA 1EWXA 2H66A 1ERWA 3DYRA 16GSA 3R2QA 2YWOA 2RLIA 3EYTA 3FR9A 1GUMA 1ZMAA 2VOCA 1BQ7A 1M2BA 1ZYQB 2NTOA 4GTUA 3GURA 4IVFA 4WR4A 2C3TA 1Z7PA 3KH7A 3GV1A 1YY7A 3LXTA 3ZIJA 3HHVA 4GF0A 5HR1A 5LCZA 2V6OA 3FYGA 1OAZA 1M9AA 1U6TA 3HJOA 4OMVA 4KNDA 3UBKA 1GTAA 1OYJA 3KMNA 3BOAA 2WCIA 2EIRA 2LJRA 5B6NA 5EVOA 4TR1A 4ECIA 4F82A 3Q74A 4N30A 2H0GA 3QAWA 2IN3A 4N0ZA 4OO4A 2VCWA 2L5LA 3DRNA 1YF1A 2B7JA 5CO3A 3IAM2 3GH6A 2YWIA 2JSZA 3EINA 1PMTA 5ELAA 1A0RP 1CQHA 1XVWA 5G31A 6GSUA 1K3YA 5AN1A 2IWTA 2MBTA 2CA8A 3ERFA 3TJBA 3FKFA 1FHEA 3A5WA 3F3QA 2HZEB 4J56E 3VPQA 4IBPA 3IV4A 2E7PA 1PN9A 3O6TA 1GWCA 3Q18A 2I1UA 2OBKA 2VD0A 5ENUA 2VCQA 4OFNA 4MZCA 3UEMA 3F8UA 1U87A 1B9YC 3WT2A 5B8AA 18GSA 5A4UA 1AW9A 4KCEA 1HYUA 2D2ZA 2J23A 3AY8A 1HNCA 4KDYA 2OACA 5C04A 4X1UA 3CSIA 8GSSA 4DSSA 3FEUA 2FLSA 3DVXA 3ZVJD 4GSSA 4XRDA 1GULA 1PRXA 2B3SA 14GSA 3M9JA 1SYRA 3MSZA 5CRGA 2MMZA 2HXKA 3F9UA 1R5AA 2TIRA 1VF2A 4V1Ap 2X8GA 1QQ2A 2YV9A 2P5QA 3U6VA 2RM5A 3I43A 2HNLA 1OE8A 5A4WA 3UAPA 2CVDA 1G6YA 4EVMA 3P90A 4HDEA 1TP9A 1TK0B 3OR5A 1YDKA 1O73A 2LV3A 1K0NA 1X9WB 4QL7A 1M0UA 3TB2A 4V1Ag 3IE3A 4MP4A 4XTSA 3RHCA 1SJIA 1X5CA 4O92A 1HD2A 3C1RA 1TI3A 3MNGA 1Y6EA 5H5SA 2CX4A 5JCWA 2LSTA 4EE0A 4TOPA 13GSA 2AJQB 3KJYA 2DJ2A 2CT6A 2P5RA 4XS4A 5B6MA 5DALA 3EU3A 3PR8A 2H1BA 1OE7A 1YKAA 2B1KA 2HZFA 4YQVA 1B8XA 2YZUA 4F9ZA 5JWQB 5H5QA 2JACA 3H8QA 4WR5A 3RPPA 2YJ7A 3GX0A 3QR6A 1BYEA 2GQLA 1XBSA 1ERVA 4KA0A 3HVSA 3LYPA 5JWOB 2HT9A 2FHEA 4AJ6A 1G7OA 1ACVA 2FWFA 4IN0A 2CZ3A 3TKRA 4QL9A 3DKSA 1XWKA 3HJMA 5IO2A 2CQ9A 2CAIA 3O3TA 2C8UA 4EDZA 4MDCA 2K8VA 1GH2A 1K0AA 4G19A 4WBRD 5B8BA 1GSQA 1DSBA 2V1MA 1ERUA 3LEFA 4BVYA 4N10A 1PKZA 1SD8A 10GSA 2L59A 5ECHB 2GQKA 2IFQA 4NXIA 2LUSA 5DBQA 2FNOA 2DMMA 3QAVA 4ACSA 1XIYA 3VLNA 2OE0A 1ILOA 3FK8A 6GSWA 3EVIA 1E2YA 3VURA 3EE2A 4XCSA 3VI5A 1NHOA 5E4WA 4XHMA 2VL3A 2QKEA 3P7XA 1K3LA 2DJJA 1WIKA 1AQVA 4IQ1A 1WRYA 2OJLA 3GX8A 1DUGA 2G2QA 3KP9A 1XWAA 5JCGA 4HJMA 3RPNA 4Q5FA 2FWHA 3VI7A 4D73B 2KLXA 2RIIA 1ZGNA 5LNKe 2GSTA 3HZ8A 5AISA 2VLUA 3KZQA 1AAZA 1PKWA 1G7EA 4EXJA 2HYXA 11GSA 3KGKA 3P8WA 1O85A 3FR3A 7GSSA 4HUAA 2XBQA 3HD5A 2B7KA 4MA9A 2B5EA 5J4UA 1XCCA 3D4TA 3H1NA 2C0GA 4MZBA 2H1DA 4OFMA 3EMXA 2MMAA 5G2ZA 1UVZA 1A8LA 4HQZA 3FY7A 1M2DA 1YKCA 4ZL9A 2H0IA 2R2JA 4GCIA 3FW2A 1J0FA 4FYUA 4ID0A 5GZZB 1X5EA 2CV4A 2F9SA 5CAXA 2JZTA 2WZ9A 3UVTA 4GQCA 3F63A 2IPAA 3F3RA 3WGEA 1GTBA 2XBIA 3GKMA 5A5KA 4MABA 2B5XA 5ECRB 3GKNA 4EDYA 4I5QA 5COHA 4IGJA 2LTKA 4KH7A 3GL3A 2GQMA 5G1KA 1PL2A 1URMA 1LBKA 4L0WA 3TGZA 2AUVA 3IOSA 1ZL9A 1QK8A 2F8AA 2ON7A 2FD3A 2V32A 3QOUA 2YOIA 5DQSA 2IMDA 1K0OA 4HZ2A 4K0GA 3D4MA 5AIXA 1A24A 4JEDA 3RHBA 3DVWA 3GTUA 1LJRA 3LORA 2L4QA 1V58A 2B5YA 4FYBA 1K0BA 4PURA 2H73A 4KDXA 2FUG2 3ZFLA 3D21A 3PH9A 2HE3A 4RI6A 2EIQA 1H75A 3H4KA 2NPBA 1A0FA 4HU9A 3APQA 2AAWA 2VL9A 12GSA 1YF0A 5CRHA 1G6WA 4I2UA 5D9VA 4LL1B 3C71A 5DQYA 1H4OA 3QAGA 4OWYA 1MDJA 4ILFA 1MDIA 4K9ZA 1MD4A 1FVJA 3WGXA 1JHBA 5JCUA 4OFTA 1TRSA 2X64A 3GN3A 3M8NA 2IJYA 4GSNA 1SENA 1UA5A 2TRCP 4ECCA 22GSA 2WB9A 3FR6A 1TJDA 1SJZA 3ME8A 2GT5A 3RBTA 4EL1A 2ZCTA 5IMFA 2GSRA 4E8EA 3VK9A 5IMVA 4K0NA 1SL2B 2WS2A 6GSXA 4PGTA 1T8EB 2DIZA 5GAND 3F6FA 2PERA 5HFIA 5FHIA 3RAZA 5KN0A 1GUKA 1F6MC 4ISDA 1NHYA 2AHEA 3W8JA 2GVPA 1O7UA 5A4VA 3WT1A 1T4YA 2XPEA 4I97A 1U3IA 3GIXA 3GUSA 4HZ4A 5ABRA 1OKDA 4RQXA 2XPDA 2ES7A 1O81A 5C00A 1XZOA 2CVKA 3QD9A 3D6IA 5G1LA 2H01A 2GLRA 4KB3A 5ECPB 1AXDA 3I9V2 2VD1A 3TRQA 3F4TA 1PA3A 4LMVA 2PUKC 1JZOA 5L71A 2L5OA 5ECOB 1USBA 3GL5A 1E6BA 4V2LA 2C80A 4BWSA 3HY2A 4PQIA 3TKPA 1F9MA 4HI7A 1B4QA 5HR3A 1KNGA 1W4VA 3LXZA 4MJBA 1RK4A 3NOFA 3C1SA 3L9VA 1DE2A 5G30A 3APSA 5IMZA 3VWVA 5KN1A 1GSSA 1Z5YE 2VM2A 3UMAA 5ECKB 1MD3A 2YANA 1EGOA 2I81A 4RQRA 4KUNA 4Q5NA 2DJKA 5F8BA 1KTEA 5IOXA 2N5FA 2K8SA 3GRXA 3IK9A 3KM6A 4K7IA 1ZYEA 3BCIA 1EZKA 4CW9A 3CBUA 3KXOA 4K1FA 3TDGA 1XWBA 4KW6A 1K0CA 1YZXA 4XIHA 2PU9C 5D8IA 1YJ6A 1FW1A 2JU5A 4J57E 2LQQA 1XFLA 1UC7A 1FAAA 2H72A 3FZ9A 3GH9A 4FIWA 1GSFA 1JZWA 4K7NA 1ZOFA 2NVLA 4MH2A 1Z6MA 4TRXA 4N0VA 3KIJA 4PNGA 1GLPA 3I69A 2P31A 3A2WA 4J2FA 1OC8A 3TOTA 4MPFA 3Q6OA 3ME7A 1AQXA 2QC7A 3UJ1A 2RM6A 3HCZA 2LNSA 4ZIJA 2LJKA 1T00A 4FH8A 2F51A 5G5EA 4EC0A 4V2MA 2IMFA 1TU8A 3EURA 3EWLA 4YQUA 2O89A 1Q4JA 3L9UA 5DJLA
chains in the Genus database with same CATH superfamily
1M7TA 3HKRA 1SK1A 2NDOA 1T4ZA 1F3AA 3HYPA 1G0TA 4OD7A 5KOWA 2HFDA 4ZB8A 1TW9A 2HRAA 2JADA 3E0UA 3UL3A 1SKWB 1SK2A 4O5QA 4XS6A 4TXVA 4POLA 2HLSA 4MK3A 2H6XA 4KGIA 4POMA 5CREA 1GLQA 2K9FA 2DJ3A 1JFUA 6GSTA 1AC1A 2O85A 1HNAA 4WKWA 2KOKA 2YJHA 3TKSC 5EPFA 3WGDA 2DKHA 19GSA 3GSTA 5GSSA 1TDIA 3IHGA 3ZMKA 2FWGA 3HXSA 4EIQA 4WF4A 4BPYA 4DEJA 2JZRA 3C73A 2R0CA 5F06A 4MH3A 3ERGA 2B1LA 3V1WA 3QCPA 1K0DA 5HQPA 2M72A 3QFAC 4JZQA 1WP0A 2GZPA 5IMAA 5LD0A 3IRAA 3M3MA 3TKSA 4HQSA 5D93A 3IXRA 5DAKB 2MZCA 3EMPA 4PTSA 2FWEA 1ZCPA 2N5BA 3GFKA 5ECIB 1AUCA 2HZEA 3KP8A 5DVBA 2V6KA 1QUWA 1XW6A 4ZBDA 4TN8A 6GSYA 4KF9A 1S3DA 1IYHA 1XWGA 1YQ1A 2L6CA 1TXXA 3FZ4A 4G9HA 4Q5QA 1X9SB 3ZL5A 2V2GA 3M9KA 2C0DA 1TKDB 2R5GA 4HOJA 1THXA 5BRTA 2QSIA 3BJ5A 2E2MA 3IC4A 5D96A 1TU7A 1V40A 3LJRA 2DLXA 3ERWA 3F0IA 4V2NA 2VLTA 2VUPA 2O7KA 3GNJA 2MYGA 2PWJA 3TUEA 1A2JA 4IJIA 4WXTA 3SWLA 2FY6A 4TVEA 4YAVA 3IAS2 4Z2TA 2VLVA 3K8NA 1GL8A 2BTOT 2A4HA 4YAPA 4ZILA 3DIEA 3TRXA 2G0FA 4Q5RA 3EC3A 3FRCA 5D9WA 5AIVA 3HVXA 2WJUA 1TRWA 4IELA 1A2MA 5KN3A 3CRTA 4H86A 1U88A 2CX3A 4F2IA 2I3YA 4BVXA 2FGXA 4MMMA 3G7JA 2YP6A 4GQFA 5IQYA 3QDNA 2GSSA 4CHSA 6GSSA 4K2DA 4K8MA 1FOVA 1S3RA 1EV4A 5ID2B 3IA1A 4WEYA 3A5IA 3TKQA 3D5JA 2OE3A 4NMUA 2R3XA 3QMXA 3PPUA 3TJFA 1A2LA 1TI1A 1SK0A 5ECLB 1OC9B 1THOA 1BX9A 5HFGA 2WRTA 2YWNA 1EEJA 4MPGA 4CDOA 2E0QA 1F2EA 2PBJA 2F8FA 3TKSE 1I5GA 5CYYA 1PN0A 1FB0A 5IPHA 3J7Yk 1ABAA 4PQHA 2WGRA 1V2AA 2V41A 3BD2A 4Z7XA 3DMLA 1SL1B 1XG8A 5F0GA 4IS0A 2DSAA 3ISOA 1N8JA 5DJLA 1B4PA 2QGVA 4ML1A 3ZIVA 2GZZA 4IP6A 2DIYA 2H8LA 2VIMA 3DD3A 3LG6A 4USSA 2LRNA 2YZHA 3NIVA 3LQ7A 3CMIA 2DC5A 1VF3A 5DCHA 1WPIA 3KH9A 4KSMA 2H6YA 2IL3A 3EU4A 1SJ6A 3W8SA 2LS5A 1GSYA 4Z2UA 1WWJA 2WFCA 1TOFA 4JRRA 3F4SA 2A4VA 3SBCA 1GNEA 5INYA 2DJ0A 1EP8A 4ZB6A 3UBLA 3S9FA 5KOXA 3CXGA 2A2PA 3CRUA 4PUAA 3DWVA 4TR1B 2PVOC 4D73A 3KTLA 1GUHA 4MNNA 3TCOA 2A2SA 3US3A 2LNTA 2VCZA 1O8WA 3H79A 1OKTA 1WE0A 1PL1A 4GWRA 2LQOA 3G9BA 5ELGA 1JLWA 4ZL8A 3Q19A 3IDVA 1LU4A 5EY6A 4LL4B 3HZ4A 4TR0A 3VWWA 2H76A 4EUYA 3GMFA 2L4CA 4HSCX 1V9WA 1YEPA 4LLRA 5CNWA 1B48A 2O8VB 5E59A 2LJAA 4ULXA 4EKZA 2AYTA 3FZ5A 2EIOA 2ALBA 2WULA 3G7YA 1A8YA 2JL4A 1XWCA 4KCAA 4ZBBA 1T7PB 2R6KA 2VAFA 1R5PA 1FB6A 4QQ7A 4JBBA 3ZTLA 4WETA 3M1GA 2HRKA 3TJKA 4DSSB 3L0HA 5DCGA 1WMJA 3LGCA 1GSDA 2C3QA 2P0GA 2KUCA 3MWHA 2OKAA 2GGTA 3KD0A 1MTCA 3VPTA 3BBYA 4X0XA 3ZZXA 3WD6A 1T1VA 5D9XA 4O32A 1SYXA 2GSQA 1UN2A 3RDWA 2OA7A 2M46A 2M80A 1XPVA 3TOUA 2H71A 1Q98A 4AGSA 3KEBA 3C8EA 2AB6A 3FZAA 1X5DA 2VO4A 4FYCA 4MJAA 5IOWA 1M3JA 4MZWA 4BL7A 2YCDA 5CP1A 9GSSA 2O87A 2JSYA 3TJGA 1C72A 4I8BA 5HR2A 3GYKA 1N2AA 4YH2A 2L6DA 1SL0B 3LYKA 4XS4B 5DALB 4AF2A 2C0FA 1F3BA 5IM9A 2CAQA 3IBHA 1R4WA 3VWXA 3UOMA 2AV4A 2YV7A 4TXOB 3UVHA 1DE1A 2VCXA 4IP1A 3CTGA 2VM1A 4HU7A 5IIZA 4FO5A 5J5NA 4DSQA 4WF5A 4MJEA 4OCEA 1XVQA 3ZMLA 2K18A 4TR3A 4GRFA 2L57A 4L5OA 3A2XA 1K0MA 5DDLA 4NV2A 3GA4A 4JR6A 1Z9HA 4KE3A 2GTUA 1S3AA 4XRAA 2DMLA 1A23A 4TKYA 3LFLA 2YPMA 1PX7A 2NBSA 2H1GA 1T3BA 4BVYB 1ON4A 3ZYWA 1PX6A 2ZUPA 1YEXA 1O8XA 2LRCA 2I9HA 1S3CA 1I9DA 2IFQB 5IMCA 4PUFC 20GSA 2BJXA 2GT6A 3GSSA 2Z9SA 5KN2A 3NZNA 3A3TA 1VGLA 3F6DA 5D73A 4NPBA 1GP1A 1PFOA 2HSHA 4O5RA 4IKHA 3FHKA 5ECQB 1VF4A 1TK8B 3F4RA 4I6XA 1BEDA 3D0ZA 1SKSB 5H5RA 4GSTA 3HVVA 4GXZA 2DJ1A 2HSYA 2IMEA 2GDRA 4G10A 2LEGA 1NSWA 4K6XA 4Z2RA 2VCTA 3QFBC 1OVNA 4IW9A 1TK5B 5D9TA 5JWRB 2C3NA 4BWQA 2C1YA 2H30A 5IMDA 1GNWA 2MMOA 1EV9A 3VWUA 1F37A 1ZZYA 3E3EA 3HA9A 2HRFA 2J9HA 5FT3A 1DBYA 1GRXA 5B7CA 2XC2A 2H74A 2ON5A 3M0FA 4X43A 1XOBA 4EO3A 4MF5A 5CRWA 1MDKA 2X49A 4NV5A 2JZSA 2H19A 2HI7A 1ERTA 3LWAA 5ECSA 2YWMA 4EIPA 4TXOA 2X8HA 1NW2A 3ED3A 1TTZA 1VF1A 2PN8A 4BA7A 1O6JA 5ECNB 2LRTA 4HEA2 3U5RE 5J9BA 3MDKA 2YNXA 2H1AA 1TRVA 1QMVA 4ECBA 4MJCA 4NAXA 3CTFA 1GTUA 1TRUA 2PMTA 1EOHA 5GAPD 1R26A 2I4AA 4L0UA 2C0EA 2K6VA 1BAYA 3CYNA 4KSOA 2EC4A 3O76A 3UIWA 4EF0A 1BJXA 1M99A 4P3YB 5HR0A 1M2AA 3GTUB 4F03A 5GSTA 4MLYA 3DEXA 4F0CA 1RW1A 3IHQA 1FG4A 1V98A 4TW5A 2X8CA 4PX1A 1Y25A 4IHUA 2R4VA 3IR4A 3UARA 2A2RA 4MCUA 4N11A 3L9SA 3BCKA 1R7HA 4DSRA 1K3OA 3CSHA 1M9BA 1PSQA 2KP2A 4K5RA 4IQAA 4O7HA 2FCHA 1QGVA 3D22A 2C4JA 4MF6A 3KCMA 3CSJA 1EOGA 2KP1A 1PQNA 4JE1A 3GKXA 2H75A 4ML6A 2H6ZA 2REMA 4OO5A 1Z7RA 4PXOA 1AQWA 3PINA 2CZ2A 3N9JA 4L8EA 4POBA 4LMWA 3ZVJA 1HNBA 3L4NA 2PVQA 1J9BA 4YKGA 3VFIA 2CVBA 3KTBA 2IIYA 2BMXA 2KHPA 4HJ2A 5G5FA 5HFKA 1OC3A 3H93A 2IMKA 2MMNA 4ZB9A 1ST9A 3E9JB 2VCVA 4WBJA 5KEJA 1WJKA 5AGYA 3DGQA 5FWGA 2GZYA 4E8HA 4KDUA 5DAKA 1QXHA 3LSZA 1CQGA 1Z3EA 1SU9A 1XXUA 2PPTA 1PD21 1J08A 1Z6NA 4IJ3A 4NHZA 1KBNA 4NWYA 3J7Yb 4GLTA 4G0LA 1KEBA 4L5LA 3G7IA 3HDCA 3IK7A 3KMOA 5J9CA 4HS1A 2N5AA 2RUEA 4ECJA 4JR4A 3DXBA 3GKKA 4RUVA 4ICYA 3ZRDA 4YQMA 4TR4A 5DJMA 1X9MB 1FO5A 1QFNA 2R37A 4MF7A 3LW9A 3P2AA 2DBCA 4XS1A 3TRPA 5J3RA 3PGTA 5CRDA 1JZDA 1AIUA 4ZL7A 1XOAA 2FA4A 2OADA 1JZRA 4NHWA 4POKA 1HQOA 3MYDA 2TRXA 3IC8A 1W89A 4PNFA 1NM3A 3ZITA 2MBSA 2X99A 4JU5A 1PGTA 1U3AA 3W6GA 4DVCA 2PGTA 2H0HA 1SKRB 2XHFA 1EEMA 2GS3A 2IMIA 3L78A 1WOUA 1GTIA 6GSVA 5F07A 4CY6A 1V57A 3IPZA 3C7MA 3QPMA 4KAEA 4PQ1A 1XW9A 3MIXA 4OCFA 4KX4A 2B6MA 1ML6A 2ZNMA 3MAKA 5J41A 1SD9A 3APOA 17GSA 3ZREA 2FA8A 2WDUA 1MEKA 1B9XC 5ID2A 1FVKA 1EGRA 2OBIA 4K7OA 2YN1A 1IYIA 4I2TA 3A2VA 1JLVA 5F05A 4AJ8A 1OC9A 3N5OA 2VL2C 4G2EA 4LA1A 4AJ7A 5IPGA 2F3MA 2OE1A 3ZLPA 1XW5A 3R3EA 3TJJA 2RUFA 2LKUA 2HRNA 3I6AA 2H70A 1RQMA 4RI7A 1GSEA 3JCML 4F0BA 1GSUA 4ZXGA 3WYWA 3HJPA 5ECMB 3GHAA 1X0RA 1VRSD 2E2GA 1EP7A 1BG5A 3ZFBA 5EL8A 5IO0A 2VL2A 4ZBAA 1EWXA 2H66A 1ERWA 3DYRA 16GSA 2DKIA 3R2QA 2YWOA 2RLIA 3EYTA 3FR9A 1GUMA 1ZMAA 2VOCA 1BQ7A 1M2BA 1ZYQB 2NTOA 4GTUA 3GURA 4IVFA 4WR4A 4BIKA 2C3TA 1Z7PA 3KH7A 3GV1A 1YY7A 3LXTA 3ZIJA 3HHVA 4GF0A 5HR1A 5LCZA 2V6OA 3FYGA 1OAZA 1M9AA 1U6TA 3HJOA 4OMVA 4KNDA 3UBKA 1GTAA 1OYJA 3KMNA 3BOAA 2WCIA 2EIRA 2LJRA 5B6NA 5EVOA 4TR1A 4ECIA 4F82A 3Q74A 2X4AA 4N30A 2H0GA 3QAWA 2IN3A 4N0ZA 4OO4A 2VCWA 2L5LA 3DRNA 1YF1A 2B7JA 5CO3A 3IAM2 3GH6A 2YWIA 2JSZA 3EINA 1PMTA 5ELAA 1A0RP 1CQHA 1XVWA 5G31A 6GSUA 1K3YA 5AN1A 2IWTA 3CQFA 2MBTA 2CA8A 3ERFA 3TJBA 3FKFA 1FHEA 3A5WA 3F3QA 2HZEB 4J56E 3VPQA 4IBPA 3IV4A 2E7PA 1PN9A 3O6TA 1GWCA 3Q18A 2I1UA 2OBKA 2VD0A 5ENUA 2VCQA 4OFNA 4MZCA 3UEMA 3F8UA 1U87A 1B9YC 3WT2A 5B8AA 18GSA 5A4UA 1AW9A 4KCEA 1HYUA 2D2ZA 2J23A 3AY8A 1HNCA 4KDYA 2OACA 5C04A 4X1UA 3CSIA 8GSSA 4DSSA 3FEUA 2FLSA 3DVXA 3ZVJD 4GSSA 4XRDA 1GULA 1PRXA 2B3SA 14GSA 3M9JA 1SYRA 3MSZA 5CRGA 2MMZA 2HXKA 3F9UA 1R5AA 2TIRA 1VF2A 4V1Ap 2X8GA 4X4JA 1QQ2A 2YV9A 2P5QA 3U6VA 2RM5A 3I43A 2HNLA 1OE8A 5A4WA 3UAPA 2CVDA 1G6YA 4EVMA 3P90A 4HDEA 1TP9A 1TK0B 3OR5A 4A5PA 1YDKA 1O73A 2LV3A 4BVXB 1K0NA 1X9WB 4QL7A 1M0UA 3TB2A 4V1Ag 3IE3A 4MP4A 4XTSA 3RHCA 1SJIA 1X5CA 4O92A 1HD2A 3C1RA 1TI3A 3MNGA 1Y6EA 5H5SA 2CX4A 5JCWA 2LSTA 4YKFA 4EE0A 4TOPA 13GSA 2AJQB 3KJYA 2DJ2A 2CT6A 2P5RA 4XS4A 5B6MA 5DALA 3EU3A 3PR8A 4K5SA 2H1BA 1OE7A 1YKAA 2B1KA 2HZFA 4YQVA 1B8XA 2YZUA 4F9ZA 5JWQB 5H5QA 2JACA 3H8QA 4WR5A 3RPPA 2YJ7A 3GX0A 3QR6A 1BYEA 2GQLA 1XBSA 1ERVA 4KA0A 3HVSA 3LYPA 5JWOB 2HT9A 2FHEA 4AJ6A 1G7OA 1ACVA 2FWFA 4IN0A 2CZ3A 3TKRA 4QL9A 3DKSA 1XWKA 3HJMA 5IO2A 2CQ9A 2CAIA 3O3TA 2C8UA 4O5UA 4EDZA 4MDCA 2K8VA 1GH2A 4WBRD 1K0AA 4G19A 5B8BA 1GSQA 1DSBA 2V1MA 1ERUA 3LEFA 4BVYA 4N10A 1PKZA 1SD8A 10GSA 2L59A 5ECHB 2GQKA 2IFQA 4NXIA 2LUSA 5DBQA 2FNOA 2DMMA 3QAVA 4ACSA 1XIYA 3VLNA 2OE0A 1ILOA 3FK8A 3EPTA 6GSWA 3EVIA 1E2YA 3VURA 3EE2A 4XCSA 3VI5A 1NHOA 5E4WA 4XHMA 2VL3A 2QKEA 3P7XA 1K3LA 2DJJA 1WIKA 1AQVA 4IQ1A 1WRYA 2OJLA 3GX8A 1DUGA 2G2QA 3KP9A 1XWAA 5JCGA 4HJMA 3RPNA 4Q5FA 2FWHA 3VI7A 4D73B 2KLXA 2RIIA 1ZGNA 5LNKe 2GSTA 3HZ8A 5AISA 2VLUA 3HVNA 3KZQA 1AAZA 1PKWA 1G7EA 4EXJA 2HYXA 11GSA 3KGKA 3P8WA 1O85A 3FR3A 7GSSA 4HUAA 2XBQA 3HD5A 2B7KA 4MA9A 2B5EA 4G0IA 5J4UA 1XCCA 3D4TA 3H1NA 2C0GA 4MZBA 2H1DA 4OFMA 3EMXA 1M3IA 2MMAA 5G2ZA 1UVZA 1A8LA 4HQZA 3FY7A 1M2DA 1YKCA 4ZL9A 2H0IA 2R2JA 4GCIA 3FW2A 1J0FA 4FYUA 4ID0A 5GZZB 1X5EA 2CV4A 1ZYPA 2F9SA 5CAXA 2JZTA 2WZ9A 3UVTA 4GQCA 3F63A 2IPAA 3F3RA 3WGEA 1GTBA 2XBIA 3GKMA 5A5KA 4MABA 2B5XA 5ECRB 3GKNA 4EDYA 4I5QA 5COHA 4IGJA 2LTKA 4KH7A 3GL3A 2GQMA 5G1KA 1PL2A 1URMA 1LBKA 4L0WA 3TGZA 2AUVA 3IOSA 1ZL9A 1QK8A 2F8AA 2ON7A 2FD3A 2V32A 3QOUA 2YOIA 5DQSA 2IMDA 1K0OA 4HZ2A 4K0GA 3D4MA 5AIXA 1A24A 1ZYNA 4CY8A 4JEDA 3RHBA 3DVWA 3GTUA 1LJRA 3LORA 2L4QA 1V58A 2B5YA 4FYBA 1K0BA 4PURA 2H73A 4KDXA 2FUG2 3ZFLA 4BL7B 3D21A 3PH9A 2HE3A 4RI6A 2EIQA 1H75A 3H4KA 4G0KA 2NPBA 1A0FA 4HU9A 3APQA 2AAWA 2VL9A 12GSA 1YF0A 5CRHA 1G6WA 4I2UA 5D9VA 4LL1B 3C71A 5DQYA 1H4OA 3QAGA 4OWYA 1MDJA 4ILFA 1MDIA 4K9ZA 1MD4A 1FVJA 3WGXA 1FOHA 1JHBA 5JCUA 3FMWA 4OFTA 1TRSA 2X64A 3GN3A 3M8NA 2IJYA 4GSNA 1SENA 1UA5A 2TRCP 4ECCA 2R0GA 5BMUA 22GSA 2WB9A 3FR6A 1TJDA 1SJZA 3ME8A 2GT5A 3RBTA 4EL1A 2ZCTA 5IMFA 2GSRA 4E8EA 3VK9A 5IMVA 4K0NA 1SL2B 2WS2A 6GSXA 4PGTA 1T8EB 2DIZA 5GAND 3F6FA 5HFIA 5FHIA 3RAZA 2QA1A 5KN0A 1GUKA 1F6MC 4ISDA 1NHYA 2AHEA 2QA2A 3W8JA 2GVPA 1O7UA 5A4VA 3WT1A 1T4YA 2XPEA 4I97A 1U3IA 3GIXA 4K2XA 3GUSA 4HZ4A 5ABRA 1OKDA 4RQXA 2XPDA 2ES7A 1O81A 5C00A 1XZOA 2CVKA 3QD9A 3D6IA 5G1LA 2H01A 2GLRA 4KB3A 5ECPB 1AXDA 3I9V2 2VD1A 3TRQA 3F4TA 1PA3A 4LMVA 2PUKC 1JZOA 2HSMA 5L71A 2L5OA 5ECOB 1USBA 3GL5A 1E6BA 4V2LA 2C80A 4BWSA 3HY2A 4PQIA 3TKPA 1F9MA 4HI7A 1B4QA 5HR3A 1KNGA 1W4VA 3LXZA 2R0PA 4MJBA 1RK4A 3NOFA 3C1SA 3L9VA 1DE2A 5G30A 3APSA 5IMZA 4FQUA 3VWVA 5KN1A 1GSSA 1Z5YE 2VM2A 3UMAA 5ECKB 1MD3A 2YANA 1EGOA 2I81A 4RQRA 4KUNA 4Q5NA 2DJKA 5F8BA 1KTEA 5IOXA 2N5FA 2K8SA 3GRXA 3IK9A 3KM6A 4K7IA 1ZYEA 3BCIA 1EZKA 4CW9A 3CBUA 3KXOA 4K1FA 3TDGA 1XWBA 4KW6A 1K0CA 1YZXA 4XIHA 2PU9C 5D8IA 1YJ6A 1FW1A 2JU5A 4J57E 2LQQA 1XFLA 1UC7A 1FAAA 2H72A 3FZ9A 3GH9A 4FIWA 1GSFA 1JZWA 4K7NA 1ZOFA 2NVLA 4MH2A 1Z6MA 4TRXA 4N0VA 3KIJA 4PNGA 1GLPA 2UZ8A 3I69A 2P31A 3A2WA 4J2FA 1OC8A 3TOTA 4MPFA 3Q6OA 3ME7A 1AQXA 2QC7A 3UJ1A 2RM6A 3HCZA 2LNSA 4ZIJA 2LJKA 1T00A 4FH8A 2F51A 5G5EA 4EC0A 4V2MA 2IMFA 1TU8A 3EURA 3EWLA 4YQUA 2O89A 1Q4JA 3L9UA 2PERA
chains in the Genus database with same CATH topology
1M7TA 3HKRA 1SK1A 2NDOA 1T4ZA 1F3AA 3HYPA 1G0TA 4OD7A 5KOWA 2HFDA 4ZB8A 1TW9A 2HRAA 2JADA 3E0UA 3UL3A 1SKWB 1SK2A 4O5QA 4XS6A 4TXVA 4POLA 2HLSA 4MK3A 2H6XA 4KGIA 4POMA 5CREA 1GLQA 2K9FA 2DJ3A 1JFUA 6GSTA 1AC1A 2O85A 1HNAA 4WKWA 2KOKA 2YJHA 3TKSC 5EPFA 3WGDA 2DKHA 19GSA 3GSTA 5GSSA 1TDIA 3IHGA 3ZMKA 2FWGA 3HXSA 4EIQA 4WF4A 4BPYA 4DEJA 2JZRA 3C73A 2R0CA 5F06A 4MH3A 3ERGA 2B1LA 3V1WA 3QCPA 1K0DA 5HQPA 2M72A 3QFAC 4JZQA 1WP0A 2GZPA 5IMAA 5LD0A 3IRAA 3M3MA 3TKSA 4HQSA 5D93A 3IXRA 5DAKB 2MZCA 3EMPA 4PTSA 2FWEA 1ZCPA 2N5BA 3GFKA 5ECIB 1AUCA 2HZEA 3KP8A 5DVBA 2V6KA 1QUWA 1XW6A 4ZBDA 4TN8A 6GSYA 4KF9A 1S3DA 1IYHA 1XWGA 1YQ1A 2L6CA 1TXXA 3FZ4A 4G9HA 4Q5QA 1X9SB 3ZL5A 2V2GA 3M9KA 2C0DA 1TKDB 2R5GA 4HOJA 1THXA 5BRTA 2QSIA 3BJ5A 2E2MA 3IC4A 5D96A 1TU7A 1V40A 3LJRA 2DLXA 3ERWA 3F0IA 4V2NA 2VLTA 2VUPA 2O7KA 3GNJA 2MYGA 2PWJA 3TUEA 1A2JA 4IJIA 4WXTA 3SWLA 2FY6A 4TVEA 4YAVA 3IAS2 4Z2TA 2VLVA 3K8NA 1GL8A 2BTOT 2A4HA 4YAPA 4ZILA 3DIEA 3TRXA 2G0FA 4Q5RA 3EC3A 3FRCA 5D9WA 5AIVA 3HVXA 2WJUA 1TRWA 4IELA 1A2MA 5KN3A 3CRTA 4H86A 1U88A 2CX3A 4F2IA 2I3YA 4BVXA 2FGXA 4MMMA 3G7JA 2YP6A 4GQFA 5IQYA 3QDNA 2GSSA 4CHSA 6GSSA 4K2DA 4K8MA 1FOVA 1EV4A 5ID2B 3IA1A 4WEYA 3A5IA 3TKQA 3D5JA 2OE3A 4NMUA 2R3XA 3QMXA 3PPUA 3TJFA 1A2LA 1TI1A 1SK0A 5ECLB 1OC9B 1THOA 1BX9A 5HFGA 2WRTA 2YWNA 1EEJA 4MPGA 4CDOA 2E0QA 1F2EA 2PBJA 2F8FA 3TKSE 1I5GA 5CYYA 1PN0A 1FB0A 5IPHA 3J7Yk 1ABAA 4PQHA 2WGRA 1V2AA 2V41A 3BD2A 4Z7XA 3DMLA 1SL1B 5F0GA 4IS0A 2DSAA 3ISOA 1N8JA 5DJLA 1B4PA 2QGVA 4ML1A 3ZIVA 2GZZA 4IP6A 2DIYA 2H8LA 2VIMA 3DD3A 3LG6A 4USSA 2LRNA 2YZHA 3NIVA 3LQ7A 3CMIA 2DC5A 1VF3A 5DCHA 1WPIA 3KH9A 4KSMA 2H6YA 2IL3A 3EU4A 1SJ6A 3W8SA 2LS5A 1GSYA 4Z2UA 1WWJA 2WFCA 1TOFA 4JRRA 3F4SA 2A4VA 3SBCA 1GNEA 5INYA 2DJ0A 1EP8A 4ZB6A 3UBLA 3S9FA 5KOXA 3CXGA 2A2PA 3CRUA 4PUAA 3DWVA 4TR1B 2PVOC 4D73A 3KTLA 1GUHA 4MNNA 3TCOA 2A2SA 3US3A 2LNTA 2VCZA 1O8WA 3H79A 1OKTA 1WE0A 1PL1A 4GWRA 2LQOA 3G9BA 5ELGA 1JLWA 4ZL8A 3Q19A 3IDVA 1LU4A 5EY6A 4LL4B 3HZ4A 4TR0A 3VWWA 2H76A 4EUYA 3GMFA 2L4CA 1V9WA 1YEPA 4LLRA 5CNWA 1B48A 2O8VB 5E59A 2LJAA 4ULXA 4EKZA 2AYTA 3FZ5A 2EIOA 2ALBA 2WULA 3G7YA 1A8YA 2JL4A 1XWCA 4KCAA 4ZBBA 1T7PB 2R6KA 2VAFA 1R5PA 1FB6A 4QQ7A 4JBBA 3ZTLA 4WETA 3M1GA 2HRKA 3TJKA 4DSSB 3L0HA 5DCGA 1WMJA 3LGCA 1GSDA 2C3QA 2P0GA 2KUCA 3MWHA 2OKAA 2GGTA 3KD0A 1MTCA 3VPTA 3BBYA 4X0XA 3ZZXA 3WD6A 1T1VA 5D9XA 4O32A 1SYXA 2GSQA 1UN2A 3RDWA 2OA7A 2M46A 2M80A 1XPVA 3TOUA 2H71A 1Q98A 4AGSA 3KEBA 3C8EA 2AB6A 3FZAA 1X5DA 2VO4A 4FYCA 4MJAA 5IOWA 4MZWA 4BL7A 2YCDA 5CP1A 9GSSA 2O87A 2JSYA 3TJGA 1C72A 4I8BA 5HR2A 3GYKA 1N2AA 4YH2A 2L6DA 1SL0B 3LYKA 4XS4B 5DALB 4AF2A 2C0FA 1F3BA 5IM9A 2CAQA 3IBHA 1R4WA 3VWXA 3UOMA 2AV4A 2YV7A 4TXOB 3UVHA 1DE1A 2VCXA 4IP1A 3CTGA 2VM1A 4HU7A 5IIZA 4FO5A 5J5NA 4DSQA 4WF5A 4MJEA 4OCEA 1XVQA 3ZMLA 2K18A 4TR3A 4GRFA 2L57A 4L5OA 3A2XA 1K0MA 5DDLA 4NV2A 3GA4A 4JR6A 1Z9HA 4KE3A 2GTUA 1S3AA 4XRAA 2DMLA 1A23A 4TKYA 3LFLA 2YPMA 1PX7A 2NBSA 2H1GA 1T3BA 4BVYB 1ON4A 3ZYWA 1PX6A 2ZUPA 1YEXA 1O8XA 2LRCA 2I9HA 1S3CA 1I9DA 2IFQB 5IMCA 4PUFC 20GSA 2BJXA 2GT6A 3GSSA 2Z9SA 5KN2A 3NZNA 3A3TA 1VGLA 3F6DA 5D73A 4NPBA 1GP1A 2HSHA 4O5RA 4IKHA 3FHKA 5ECQB 1VF4A 1TK8B 3F4RA 4I6XA 1BEDA 3D0ZA 1SKSB 5H5RA 4GSTA 3HVVA 4GXZA 2DJ1A 2HSYA 2IMEA 2GDRA 4G10A 2LEGA 1NSWA 4K6XA 4Z2RA 2VCTA 3QFBC 1OVNA 4IW9A 1TK5B 5D9TA 5JWRB 2C3NA 4BWQA 2C1YA 2H30A 5IMDA 1GNWA 2MMOA 1EV9A 3VWUA 1F37A 1ZZYA 3E3EA 3HA9A 2HRFA 2J9HA 5FT3A 1DBYA 1GRXA 5B7CA 2XC2A 2H74A 2ON5A 3M0FA 4X43A 1XOBA 4EO3A 4MF5A 5CRWA 1MDKA 2X49A 4NV5A 2JZSA 2H19A 2HI7A 1ERTA 3LWAA 5ECSA 2YWMA 4EIPA 4TXOA 2X8HA 1NW2A 3ED3A 1TTZA 1VF1A 2PN8A 4BA7A 1O6JA 5ECNB 2LRTA 4HEA2 3U5RE 5J9BA 3MDKA 2YNXA 2H1AA 1TRVA 1QMVA 4ECBA 4MJCA 4NAXA 3CTFA 1GTUA 1TRUA 2PMTA 1EOHA 5GAPD 1R26A 2I4AA 4L0UA 2C0EA 2K6VA 1BAYA 3CYNA 4KSOA 2EC4A 3O76A 3UIWA 4EF0A 1BJXA 1M99A 4P3YB 5HR0A 1M2AA 3GTUB 4F03A 5GSTA 4MLYA 3DEXA 4F0CA 1RW1A 3IHQA 1FG4A 1V98A 4TW5A 2X8CA 4PX1A 1Y25A 4IHUA 2R4VA 3IR4A 3UARA 2A2RA 4MCUA 4N11A 3L9SA 3BCKA 1R7HA 4DSRA 1K3OA 3CSHA 1M9BA 1PSQA 2KP2A 4K5RA 4IQAA 4O7HA 2FCHA 1QGVA 3D22A 2C4JA 4MF6A 3KCMA 3CSJA 1EOGA 2KP1A 1PQNA 4JE1A 3GKXA 2H75A 4ML6A 2H6ZA 2REMA 4OO5A 1Z7RA 4PXOA 1AQWA 3PINA 2CZ2A 3N9JA 4L8EA 4POBA 4LMWA 3ZVJA 1HNBA 3L4NA 2PVQA 1J9BA 4YKGA 3VFIA 2CVBA 3KTBA 2IIYA 2BMXA 2KHPA 4HJ2A 5G5FA 5HFKA 1OC3A 3H93A 2IMKA 2MMNA 4ZB9A 1ST9A 3E9JB 2VCVA 4WBJA 5KEJA 1WJKA 5AGYA 3DGQA 5FWGA 2GZYA 4E8HA 4KDUA 5DAKA 1QXHA 3LSZA 1CQGA 1Z3EA 1SU9A 1XXUA 2PPTA 1PD21 1J08A 1Z6NA 4IJ3A 4NHZA 1KBNA 4NWYA 3J7Yb 4GLTA 4G0LA 1KEBA 4L5LA 3G7IA 3HDCA 3IK7A 3KMOA 5J9CA 4HS1A 2N5AA 2RUEA 4ECJA 4JR4A 3DXBA 3GKKA 4RUVA 4ICYA 3ZRDA 4YQMA 4TR4A 5DJMA 1X9MB 1FO5A 1QFNA 2R37A 4MF7A 3LW9A 3P2AA 2DBCA 4XS1A 3TRPA 5J3RA 3PGTA 5CRDA 1JZDA 1AIUA 4ZL7A 1XOAA 2FA4A 2OADA 1JZRA 4NHWA 4POKA 1HQOA 3MYDA 2TRXA 3IC8A 1W89A 4PNFA 1NM3A 3ZITA 2MBSA 2X99A 4JU5A 1PGTA 1U3AA 3W6GA 4DVCA 2PGTA 2H0HA 1SKRB 2XHFA 1EEMA 2GS3A 2IMIA 3L78A 1WOUA 1GTIA 6GSVA 5F07A 4CY6A 1V57A 3IPZA 3C7MA 3QPMA 4KAEA 4PQ1A 1XW9A 3MIXA 4OCFA 4KX4A 2B6MA 1ML6A 2ZNMA 3MAKA 5J41A 1SD9A 3APOA 17GSA 3ZREA 2FA8A 2WDUA 1MEKA 1B9XC 5ID2A 1FVKA 1EGRA 2OBIA 4K7OA 2YN1A 1IYIA 4I2TA 3A2VA 1JLVA 5F05A 4AJ8A 1OC9A 3N5OA 2VL2C 4G2EA 4LA1A 4AJ7A 5IPGA 2F3MA 2OE1A 3ZLPA 1XW5A 3R3EA 3TJJA 2RUFA 2LKUA 2HRNA 3I6AA 2H70A 1RQMA 4RI7A 1GSEA 3JCML 4F0BA 1GSUA 4ZXGA 3WYWA 3HJPA 5ECMB 3GHAA 1X0RA 1VRSD 2E2GA 1EP7A 1BG5A 3ZFBA 5EL8A 5IO0A 2VL2A 4ZBAA 1EWXA 2H66A 1ERWA 3DYRA 16GSA 2DKIA 3R2QA 2YWOA 2RLIA 3EYTA 3FR9A 1GUMA 1ZMAA 2VOCA 1BQ7A 1M2BA 1ZYQB 2NTOA 4GTUA 3GURA 4IVFA 4WR4A 2C3TA 1Z7PA 3KH7A 3GV1A 1YY7A 3LXTA 3ZIJA 3HHVA 4GF0A 5HR1A 5LCZA 2V6OA 3FYGA 1OAZA 1M9AA 1U6TA 3HJOA 4OMVA 4KNDA 3UBKA 1GTAA 1OYJA 3KMNA 3BOAA 2WCIA 2EIRA 2LJRA 5B6NA 5EVOA 4TR1A 4ECIA 4F82A 3Q74A 2X4AA 4N30A 2H0GA 3QAWA 2IN3A 4N0ZA 4OO4A 2VCWA 2L5LA 3DRNA 1YF1A 2B7JA 5CO3A 3IAM2 3GH6A 2YWIA 2JSZA 3EINA 1PMTA 5ELAA 1A0RP 1CQHA 1XVWA 5G31A 6GSUA 1K3YA 5AN1A 2IWTA 2MBTA 2CA8A 3ERFA 3TJBA 3FKFA 1FHEA 3A5WA 3F3QA 2HZEB 4J56E 3VPQA 4IBPA 3IV4A 2E7PA 1PN9A 3O6TA 1GWCA 3Q18A 2I1UA 2OBKA 2VD0A 5ENUA 2VCQA 4OFNA 4MZCA 3UEMA 3F8UA 1U87A 1B9YC 3WT2A 5B8AA 18GSA 5A4UA 1AW9A 4KCEA 1HYUA 2D2ZA 2J23A 3AY8A 1HNCA 4KDYA 2OACA 5C04A 4X1UA 3CSIA 8GSSA 4DSSA 3FEUA 2FLSA 3DVXA 3ZVJD 4GSSA 4XRDA 1GULA 1PRXA 2B3SA 14GSA 3M9JA 1SYRA 3MSZA 5CRGA 2MMZA 2HXKA 3F9UA 1R5AA 2TIRA 1VF2A 4V1Ap 2X8GA 4X4JA 1QQ2A 2YV9A 2P5QA 3U6VA 2RM5A 3I43A 2HNLA 1OE8A 5A4WA 3UAPA 2CVDA 1G6YA 4EVMA 3P90A 4HDEA 1TP9A 1TK0B 3OR5A 4A5PA 1YDKA 1O73A 2LV3A 4BVXB 1K0NA 1X9WB 4QL7A 1M0UA 3TB2A 4V1Ag 3IE3A 4MP4A 4XTSA 3RHCA 1SJIA 1X5CA 4O92A 1HD2A 3C1RA 1TI3A 3MNGA 1Y6EA 5H5SA 2CX4A 5JCWA 2LSTA 4YKFA 4EE0A 4TOPA 13GSA 2AJQB 3KJYA 2DJ2A 2CT6A 2P5RA 4XS4A 5B6MA 5DALA 3EU3A 3PR8A 4K5SA 2H1BA 1OE7A 1YKAA 2B1KA 2HZFA 4YQVA 1B8XA 2YZUA 4F9ZA 5JWQB 5H5QA 2JACA 3H8QA 4WR5A 3RPPA 2YJ7A 3GX0A 3QR6A 1BYEA 2GQLA 1XBSA 1ERVA 4KA0A 3HVSA 3LYPA 5JWOB 2HT9A 2FHEA 4AJ6A 1G7OA 1ACVA 2FWFA 4IN0A 2CZ3A 3TKRA 4QL9A 3DKSA 1XWKA 3HJMA 5IO2A 2CQ9A 2CAIA 3O3TA 2C8UA 4O5UA 4EDZA 4MDCA 2K8VA 1GH2A 4WBRD 1K0AA 4G19A 5B8BA 1GSQA 1DSBA 2V1MA 1ERUA 3LEFA 4BVYA 4N10A 1PKZA 1SD8A 10GSA 2L59A 5ECHB 2GQKA 2IFQA 4NXIA 2LUSA 5DBQA 2FNOA 2DMMA 3QAVA 4ACSA 1XIYA 3VLNA 2OE0A 1ILOA 3FK8A 3EPTA 6GSWA 3EVIA 1E2YA 3VURA 3EE2A 4XCSA 3VI5A 1NHOA 5E4WA 4XHMA 2VL3A 2QKEA 3P7XA 1K3LA 2DJJA 1WIKA 1AQVA 4IQ1A 1WRYA 2OJLA 3GX8A 1DUGA 2G2QA 3KP9A 1XWAA 5JCGA 4HJMA 3RPNA 4Q5FA 2FWHA 3VI7A 4D73B 2KLXA 2RIIA 1ZGNA 5LNKe 2GSTA 3HZ8A 5AISA 2VLUA 3KZQA 1AAZA 1PKWA 1G7EA 4EXJA 2HYXA 11GSA 3KGKA 3P8WA 1O85A 3FR3A 7GSSA 4HUAA 2XBQA 3HD5A 2B7KA 4MA9A 2B5EA 4G0IA 5J4UA 1XCCA 3D4TA 3H1NA 2C0GA 4MZBA 2H1DA 4OFMA 3EMXA 2MMAA 5G2ZA 1UVZA 1A8LA 4HQZA 3FY7A 1M2DA 1YKCA 4ZL9A 2H0IA 2R2JA 4GCIA 3FW2A 1J0FA 4FYUA 4ID0A 5GZZB 1X5EA 2CV4A 1ZYPA 2F9SA 5CAXA 2JZTA 2WZ9A 3UVTA 4GQCA 3F63A 2IPAA 3F3RA 3WGEA 1GTBA 2XBIA 3GKMA 5A5KA 4MABA 2B5XA 5ECRB 3GKNA 4EDYA 4I5QA 5COHA 4IGJA 2LTKA 4KH7A 3GL3A 2GQMA 5G1KA 1PL2A 1URMA 1LBKA 4L0WA 3TGZA 2AUVA 3IOSA 1ZL9A 1QK8A 2F8AA 2ON7A 2FD3A 2V32A 3QOUA 2YOIA 5DQSA 2IMDA 1K0OA 4HZ2A 4K0GA 3D4MA 5AIXA 1A24A 1ZYNA 4CY8A 4JEDA 3RHBA 3DVWA 3GTUA 1LJRA 3LORA 2L4QA 1V58A 2B5YA 4FYBA 1K0BA 4PURA 2H73A 4KDXA 2FUG2 3ZFLA 4BL7B 3D21A 3PH9A 2HE3A 4RI6A 2EIQA 1H75A 3H4KA 4G0KA 2NPBA 1A0FA 4HU9A 3APQA 2AAWA 2VL9A 12GSA 1YF0A 5CRHA 1G6WA 4I2UA 5D9VA 4LL1B 3C71A 5DQYA 1H4OA 3QAGA 4OWYA 1MDJA 4ILFA 1MDIA 4K9ZA 1MD4A 1FVJA 3WGXA 1FOHA 1JHBA 5JCUA 3FMWA 4OFTA 1TRSA 2X64A 3GN3A 3M8NA 2IJYA 4GSNA 1SENA 1UA5A 2TRCP 4ECCA 2R0GA 5BMUA 22GSA 2WB9A 3FR6A 1TJDA 1SJZA 3ME8A 2GT5A 3RBTA 4EL1A 2ZCTA 5IMFA 2GSRA 4E8EA 3VK9A 5IMVA 4K0NA 1SL2B 2WS2A 6GSXA 4PGTA 1T8EB 2DIZA 5GAND 3F6FA 5HFIA 5FHIA 3RAZA 2QA1A 5KN0A 1GUKA 1F6MC 4ISDA 1NHYA 2AHEA 2QA2A 3W8JA 2GVPA 1O7UA 5A4VA 3WT1A 1T4YA 2XPEA 4I97A 1U3IA 3GIXA 4K2XA 3GUSA 4HZ4A 5ABRA 1OKDA 4RQXA 2XPDA 2ES7A 1O81A 5C00A 1XZOA 2CVKA 3QD9A 3D6IA 5G1LA 2H01A 2GLRA 4KB3A 5ECPB 1AXDA 3I9V2 2VD1A 3TRQA 3F4TA 1PA3A 4LMVA 2PUKC 1JZOA 2HSMA 5L71A 2L5OA 5ECOB 1USBA 3GL5A 1E6BA 4V2LA 2C80A 4BWSA 3HY2A 4PQIA 3TKPA 1F9MA 4HI7A 1B4QA 5HR3A 1KNGA 1W4VA 3LXZA 2R0PA 4MJBA 1RK4A 3NOFA 3C1SA 3L9VA 1DE2A 5G30A 3APSA 5IMZA 4FQUA 3VWVA 5KN1A 1GSSA 1Z5YE 2VM2A 3UMAA 5ECKB 1MD3A 2YANA 1EGOA 2I81A 4RQRA 4KUNA 4Q5NA 2DJKA 5F8BA 1KTEA 5IOXA 2N5FA 2K8SA 3GRXA 3IK9A 3KM6A 4K7IA 1ZYEA 3BCIA 1EZKA 4CW9A 3CBUA 3KXOA 4K1FA 3TDGA 1XWBA 4KW6A 1K0CA 1YZXA 4XIHA 2PU9C 5D8IA 1YJ6A 1FW1A 2JU5A 4J57E 2LQQA 1XFLA 1UC7A 1FAAA 2H72A 3FZ9A 3GH9A 4FIWA 1GSFA 1JZWA 4K7NA 1ZOFA 2NVLA 4MH2A 1Z6MA 4TRXA 4N0VA 3KIJA 4PNGA 1GLPA 2UZ8A 3I69A 2P31A 3A2WA 4J2FA 1OC8A 3TOTA 4MPFA 3Q6OA 3ME7A 1AQXA 2QC7A 3UJ1A 2RM6A 3HCZA 2LNSA 4ZIJA 2LJKA 1T00A 4FH8A 2F51A 5G5EA 4EC0A 4V2MA 2IMFA 1TU8A 3EURA 3EWLA 4YQUA 2O89A 1Q4JA 3L9UA 2PERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M7T A;  3HKR A;  1SK1 A;  2NDO A;  1T4Z A;  1F3A A;  3HYP A;  1G0T A;  4OD7 A;  2HFD A;  4ZB8 A;  1TW9 A;  2JAD A;  3E0U A;  3UL3 A;  1SKW B;  1SK2 A;  4XS6 A;  4TXV A;  4POL A;  2HLS A;  4MK3 A;  2H6X A;  4KGI A;  4POM A;  5CRE A;  1GLQ A;  2K9F A;  2DJ3 A;  1JFU A;  6GST A;  1AC1 A;  2O85 A;  1HNA A;  4WKW A;  2KOK A;  2YJH A;  3TKS C;  5EPF A;  3WGD A;  19GS A;  3GST A;  5GSS A;  1TDI A;  3ZMK A;  2FWG A;  3HXS A;  4WF4 A;  4BPY A;  4DEJ A;  2JZR A;  3C73 A;  5F06 A;  4MH3 A;  3ERG A;  2B1L A;  3V1W A;  3QCP A;  1K0D A;  5HQP A;  2M72 A;  3QFA C;  4JZQ A;  1WP0 A;  2GZP A;  5IMA A;  5LD0 A;  3IRA A;  3M3M A;  3TKS A;  4HQS A;  5D93 A;  3IXR A;  5DAK B;  2MZC A;  3EMP A;  2FWE A;  1ZCP A;  2N5B A;  3GFK A;  5ECI B;  1AUC A;  2HZE A;  3KP8 A;  5DVB A;  2V6K A;  1QUW A;  1XW6 A;  4ZBD A;  4TN8 A;  6GSY A;  1S3D A;  1IYH A;  1XWG A;  1YQ1 A;  2L6C A;  1TXX A;  3FZ4 A;  4G9H A;  4Q5Q A;  1X9S B;  3ZL5 A;  2V2G A;  3M9K A;  2C0D A;  1TKD B;  2R5G A;  4HOJ A;  1THX A;  2QSI A;  3BJ5 A;  2E2M A;  3IC4 A;  5D96 A;  1TU7 A;  1V40 A;  3LJR A;  2DLX A;  3ERW A;  3F0I A;  4V2N A;  2VLT A;  2VUP A;  2O7K A;  3GNJ A;  2MYG A;  2PWJ A;  3TUE A;  1A2J A;  4IJI A;  4WXT A;  3SWL A;  2FY6 A;  4TVE A;  4YAV A;  3IAS 2;  2VLV A;  3K8N A;  1GL8 A;  2BTO T;  4YAP A;  4ZIL A;  3DIE A;  3TRX A;  2G0F A;  4Q5R A;  3EC3 A;  3FRC A;  5D9W A;  5AIV A;  3HVX A;  2WJU A;  1TRW A;  4IEL A;  1A2M A;  5KN3 A;  3CRT A;  4H86 A;  1U88 A;  2CX3 A;  4F2I A;  2I3Y A;  4BVX A;  2FGX A;  4MMM A;  3G7J A;  2YP6 A;  4GQF A;  5IQY A;  3QDN A;  2GSS A;  4CHS A;  6GSS A;  4K2D A;  4K8M A;  1FOV A;  1EV4 A;  5ID2 B;  3IA1 A;  4WEY A;  3TKQ A;  3D5J A;  2OE3 A;  4NMU A;  2R3X A;  3QMX A;  3TJF A;  1A2L A;  1TI1 A;  1SK0 A;  5ECL B;  1OC9 B;  1THO A;  1BX9 A;  5HFG A;  2WRT A;  2YWN A;  1EEJ A;  4MPG A;  4CDO A;  2E0Q A;  1F2E A;  2PBJ A;  2F8F A;  3TKS E;  1I5G A;  5CYY A;  1FB0 A;  5IPH A;  3J7Y k;  1ABA A;  4PQH A;  2WGR A;  1V2A A;  2V41 A;  3BD2 A;  4Z7X A;  3DML A;  1SL1 B;  5F0G A;  4IS0 A;  2DSA A;  3ISO A;  1N8J A;  1B4P A;  2QGV A;  4ML1 A;  3ZIV A;  2GZZ A;  4IP6 A;  2DIY A;  2H8L A;  2VIM A;  3DD3 A;  3LG6 A;  2LRN A;  2YZH A;  3NIV A;  3LQ7 A;  3CMI A;  2DC5 A;  1VF3 A;  5DCH A;  1WPI A;  3KH9 A;  4KSM A;  2H6Y A;  2IL3 A;  3EU4 A;  1SJ6 A;  3W8S A;  2LS5 A;  1GSY A;  1WWJ A;  2WFC A;  1TOF A;  4JRR A;  3F4S A;  2A4V A;  3SBC A;  1GNE A;  5INY A;  2DJ0 A;  1EP8 A;  4ZB6 A;  3UBL A;  3S9F A;  3CXG A;  3CRU A;  4PUA A;  3DWV A;  4TR1 B;  2PVO C;  4D73 A;  3KTL A;  1GUH A;  3TCO A;  2A2S A;  3US3 A;  2LNT A;  2VCZ A;  1O8W A;  3H79 A;  1OKT A;  1WE0 A;  1PL1 A;  4GWR A;  2LQO A;  3G9B A;  5ELG A;  1JLW A;  4ZL8 A;  3Q19 A;  3IDV A;  1LU4 A;  5EY6 A;  4LL4 B;  3HZ4 A;  4TR0 A;  3VWW A;  2H76 A;  4EUY A;  3GMF A;  2L4C A;  1V9W A;  1YEP A;  4LLR A;  5CNW A;  1B48 A;  2O8V B;  5E59 A;  2LJA A;  4ULX A;  4EKZ A;  2AYT A;  3FZ5 A;  2EIO A;  2ALB A;  2WUL A;  3G7Y A;  1A8Y A;  2JL4 A;  1XWC A;  4KCA A;  4ZBB A;  1T7P B;  2R6K A;  2VAF A;  1R5P A;  1FB6 A;  4QQ7 A;  4JBB A;  3ZTL A;  4WET A;  3M1G A;  3TJK A;  4DSS B;  3L0H A;  5DCG A;  1WMJ A;  3LGC A;  1GSD A;  2C3Q A;  2P0G A;  2KUC A;  3MWH A;  2OKA A;  2GGT A;  3KD0 A;  1MTC A;  3VPT A;  3BBY A;  4X0X A;  3ZZX A;  3WD6 A;  1T1V A;  5D9X A;  4O32 A;  1SYX A;  2GSQ A;  1UN2 A;  3RDW A;  2OA7 A;  2M46 A;  2M80 A;  1XPV A;  3TOU A;  2H71 A;  1Q98 A;  4AGS A;  3KEB A;  3C8E A;  2AB6 A;  3FZA A;  1X5D A;  2VO4 A;  4FYC A;  4MJA A;  5IOW A;  4MZW A;  4BL7 A;  2YCD A;  5CP1 A;  9GSS A;  2O87 A;  2JSY A;  3TJG A;  1C72 A;  4I8B A;  5HR2 A;  3GYK A;  1N2A A;  4YH2 A;  2L6D A;  1SL0 B;  3LYK A;  4XS4 B;  5DAL B;  4AF2 A;  2C0F A;  1F3B A;  5IM9 A;  2CAQ A;  3IBH A;  1R4W A;  3VWX A;  3UOM A;  2AV4 A;  2YV7 A;  4TXO B;  3UVH A;  1DE1 A;  2VCX A;  4IP1 A;  3CTG A;  2VM1 A;  4HU7 A;  5IIZ A;  4FO5 A;  5J5N A;  4DSQ A;  4WF5 A;  4MJE A;  4OCE A;  1XVQ A;  3ZML A;  2K18 A;  4TR3 A;  4GRF A;  2L57 A;  4L5O A;  3A2X A;  1K0M A;  5DDL A;  4NV2 A;  3GA4 A;  4JR6 A;  1Z9H A;  4KE3 A;  2GTU A;  1S3A A;  4XRA A;  2DML A;  1A23 A;  4TKY A;  3LFL A;  2YPM A;  1PX7 A;  2NBS A;  2H1G A;  1T3B A;  1ON4 A;  3ZYW A;  1PX6 A;  2ZUP A;  1YEX A;  1O8X A;  2LRC A;  2I9H A;  1S3C A;  1I9D A;  2IFQ B;  5IMC A;  4PUF C;  20GS A;  2BJX A;  2GT6 A;  3GSS A;  2Z9S A;  5KN2 A;  3NZN A;  3A3T A;  1VGL A;  3F6D A;  5D73 A;  4NPB A;  1GP1 A;  2HSH A;  4O5R A;  4IKH A;  3FHK A;  5ECQ B;  1VF4 A;  1TK8 B;  3F4R A;  4I6X A;  1BED A;  3D0Z A;  1SKS B;  5H5R A;  4GST A;  3HVV A;  4GXZ A;  2DJ1 A;  2HSY A;  2IME A;  2GDR A;  4G10 A;  2LEG A;  1NSW A;  4K6X A;  2VCT A;  3QFB C;  1OVN A;  4IW9 A;  1TK5 B;  5D9T A;  5JWR B;  2C3N A;  4BWQ A;  2C1Y A;  2H30 A;  5IMD A;  1GNW A;  2MMO A;  1EV9 A;  3VWU A;  1F37 A;  1ZZY A;  3E3E A;  3HA9 A;  2HRF A;  2J9H A;  5FT3 A;  1DBY A;  1GRX A;  5B7C A;  2XC2 A;  2H74 A;  2ON5 A;  3M0F A;  4X43 A;  1XOB A;  4EO3 A;  4MF5 A;  5CRW A;  1MDK A;  4NV5 A;  2JZS A;  2H19 A;  2HI7 A;  1ERT A;  3LWA A;  5ECS A;  2YWM A;  4TXO A;  2X8H A;  1NW2 A;  3ED3 A;  1TTZ A;  1VF1 A;  2PN8 A;  4BA7 A;  1O6J A;  5ECN B;  2LRT A;  4HEA 2;  3U5R E;  5J9B A;  3MDK A;  2YNX A;  2H1A A;  1TRV A;  1QMV A;  4ECB A;  4MJC A;  4NAX A;  3CTF A;  1GTU A;  1TRU A;  2PMT A;  1EOH A;  5GAP D;  1R26 A;  2I4A A;  4L0U A;  2C0E A;  2K6V A;  1BAY A;  3CYN A;  4KSO A;  2EC4 A;  3O76 A;  3UIW A;  4EF0 A;  1BJX A;  1M99 A;  4P3Y B;  5HR0 A;  1M2A A;  3GTU B;  4F03 A;  5GST A;  4MLY A;  3DEX A;  4F0C A;  1RW1 A;  3IHQ A;  1FG4 A;  1V98 A;  4TW5 A;  2X8C A;  4PX1 A;  1Y25 A;  4IHU A;  2R4V A;  3IR4 A;  3UAR A;  2A2R A;  4MCU A;  4N11 A;  3L9S A;  3BCK A;  1R7H A;  4DSR A;  1K3O A;  3CSH A;  1M9B A;  1PSQ A;  2KP2 A;  4IQA A;  4O7H A;  2FCH A;  1QGV A;  3D22 A;  2C4J A;  4MF6 A;  3KCM A;  3CSJ A;  1EOG A;  2KP1 A;  1PQN A;  4JE1 A;  3GKX A;  2H75 A;  4ML6 A;  2H6Z A;  2REM A;  4OO5 A;  1Z7R A;  4PXO A;  1AQW A;  3PIN A;  2CZ2 A;  3N9J A;  4L8E A;  4POB A;  4LMW A;  3ZVJ A;  1HNB A;  3L4N A;  2PVQ A;  1J9B A;  3VFI A;  2CVB A;  3KTB A;  2IIY A;  2BMX A;  2KHP A;  4HJ2 A;  5G5F A;  5HFK A;  1OC3 A;  3H93 A;  2IMK A;  2MMN A;  4ZB9 A;  1ST9 A;  3E9J B;  2VCV A;  4WBJ A;  5KEJ A;  1WJK A;  5AGY A;  3DGQ A;  5FWG A;  2GZY A;  4E8H A;  4KDU A;  5DAK A;  1QXH A;  3LSZ A;  1CQG A;  1Z3E A;  1SU9 A;  1XXU A;  2PPT A;  1PD2 1;  1J08 A;  1Z6N A;  4IJ3 A;  4NHZ A;  1KBN A;  4NWY A;  3J7Y b;  4GLT A;  1KEB A;  4L5L A;  3G7I A;  3HDC A;  3IK7 A;  3KMO A;  5J9C A;  4HS1 A;  2N5A A;  2RUE A;  4ECJ A;  4JR4 A;  3DXB A;  3GKK A;  4RUV A;  3ZRD A;  4YQM A;  4TR4 A;  5DJM A;  1X9M B;  1FO5 A;  1QFN A;  2R37 A;  4MF7 A;  3P2A A;  2DBC A;  4XS1 A;  3TRP A;  5J3R A;  3PGT A;  5CRD A;  1JZD A;  1AIU A;  4ZL7 A;  1XOA A;  2FA4 A;  2OAD A;  1JZR A;  4NHW A;  4POK A;  1HQO A;  2TRX A;  1W89 A;  4PNF A;  1NM3 A;  3ZIT A;  2MBS A;  2X99 A;  4JU5 A;  1PGT A;  1U3A A;  3W6G A;  4DVC A;  2PGT A;  2H0H A;  1SKR B;  2XHF A;  1EEM A;  2GS3 A;  2IMI A;  3L78 A;  1WOU A;  1GTI A;  6GSV A;  5F07 A;  1V57 A;  3IPZ A;  3C7M A;  3QPM A;  4KAE A;  4PQ1 A;  1XW9 A;  4OCF A;  4KX4 A;  2B6M A;  1ML6 A;  2ZNM A;  3MAK A;  5J41 A;  1SD9 A;  3APO A;  17GS A;  3ZRE A;  2FA8 A;  2WDU A;  1MEK A;  1B9X C;  5ID2 A;  1FVK A;  1EGR A;  2OBI A;  4K7O A;  2YN1 A;  1IYI A;  4I2T A;  3A2V A;  1JLV A;  5F05 A;  4AJ8 A;  1OC9 A;  3N5O A;  2VL2 C;  4G2E A;  4LA1 A;  4AJ7 A;  5IPG A;  2F3M A;  2OE1 A;  3ZLP A;  1XW5 A;  3TJJ A;  2RUF A;  2LKU A;  2HRN A;  3I6A A;  2H70 A;  1RQM A;  4RI7 A;  1GSE A;  3JCM L;  4F0B A;  1GSU A;  4ZXG A;  3WYW A;  3HJP A;  5ECM B;  3GHA A;  1X0R A;  1VRS D;  2E2G A;  1EP7 A;  1BG5 A;  3ZFB A;  5EL8 A;  5IO0 A;  2VL2 A;  4ZBA A;  1EWX A;  2H66 A;  1ERW A;  3DYR A;  16GS A;  3R2Q A;  2YWO A;  2RLI A;  3EYT A;  3FR9 A;  1GUM A;  1ZMA A;  2VOC A;  1BQ7 A;  1M2B A;  1ZYQ B;  2NTO A;  4GTU A;  3GUR A;  4IVF A;  4WR4 A;  2C3T A;  1Z7P A;  3KH7 A;  3GV1 A;  1YY7 A;  3LXT A;  3ZIJ A;  3HHV A;  4GF0 A;  5HR1 A;  5LCZ A;  2V6O A;  3FYG A;  1OAZ A;  1M9A A;  1U6T A;  3HJO A;  4OMV A;  4KND A;  3UBK A;  1GTA A;  1OYJ A;  3KMN A;  3BOA A;  2WCI A;  2EIR A;  2LJR A;  5B6N A;  5EVO A;  4TR1 A;  4ECI A;  4F82 A;  3Q74 A;  4N30 A;  2H0G A;  3QAW A;  2IN3 A;  4N0Z A;  4OO4 A;  2VCW A;  2L5L A;  3DRN A;  1YF1 A;  2B7J A;  5CO3 A;  3IAM 2;  3GH6 A;  2YWI A;  2JSZ A;  3EIN A;  1PMT A;  5ELA A;  1A0R P;  1CQH A;  1XVW A;  5G31 A;  6GSU A;  1K3Y A;  5AN1 A;  2IWT A;  2MBT A;  2CA8 A;  3ERF A;  3TJB A;  3FKF A;  1FHE A;  3A5W A;  3F3Q A;  2HZE B;  4J56 E;  3VPQ A;  4IBP A;  3IV4 A;  2E7P A;  1PN9 A;  3O6T A;  1GWC A;  3Q18 A;  2I1U A;  2OBK A;  2VD0 A;  5ENU A;  2VCQ A;  4OFN A;  4MZC A;  3UEM A;  3F8U A;  1U87 A;  1B9Y C;  3WT2 A;  5B8A A;  18GS A;  5A4U A;  1AW9 A;  4KCE A;  1HYU A;  2D2Z A;  2J23 A;  3AY8 A;  1HNC A;  4KDY A;  2OAC A;  5C04 A;  4X1U A;  3CSI A;  8GSS A;  4DSS A;  3FEU A;  2FLS A;  3DVX A;  3ZVJ D;  4GSS A;  4XRD A;  1GUL A;  1PRX A;  2B3S A;  14GS A;  3M9J A;  1SYR A;  3MSZ A;  5CRG A;  2MMZ A;  2HXK A;  3F9U A;  1R5A A;  2TIR A;  1VF2 A;  4V1A p;  2X8G A;  1QQ2 A;  2YV9 A;  2P5Q A;  3U6V A;  2RM5 A;  3I43 A;  2HNL A;  1OE8 A;  5A4W A;  3UAP A;  2CVD A;  1G6Y A;  4EVM A;  3P90 A;  4HDE A;  1TP9 A;  1TK0 B;  3OR5 A;  1YDK A;  1O73 A;  2LV3 A;  1K0N A;  1X9W B;  4QL7 A;  1M0U A;  3TB2 A;  4V1A g;  3IE3 A;  4MP4 A;  4XTS A;  3RHC A;  1SJI A;  1X5C A;  4O92 A;  1HD2 A;  3C1R A;  1TI3 A;  3MNG A;  1Y6E A;  5H5S A;  2CX4 A;  5JCW A;  2LST A;  4EE0 A;  4TOP A;  13GS A;  2AJQ B;  3KJY A;  2DJ2 A;  2CT6 A;  2P5R A;  4XS4 A;  5B6M A;  5DAL A;  3EU3 A;  3PR8 A;  2H1B A;  1OE7 A;  1YKA A;  2B1K A;  2HZF A;  4YQV A;  1B8X A;  2YZU A;  4F9Z A;  5JWQ B;  5H5Q A;  2JAC A;  3H8Q A;  4WR5 A;  3RPP A;  2YJ7 A;  3GX0 A;  3QR6 A;  1BYE A;  2GQL A;  1XBS A;  1ERV A;  4KA0 A;  3HVS A;  3LYP A;  5JWO B;  2HT9 A;  2FHE A;  4AJ6 A;  1G7O A;  1ACV A;  2FWF A;  4IN0 A;  2CZ3 A;  3TKR A;  4QL9 A;  3DKS A;  1XWK A;  3HJM A;  5IO2 A;  2CQ9 A;  2CAI A;  3O3T A;  2C8U A;  4EDZ A;  4MDC A;  2K8V A;  1GH2 A;  1K0A A;  4G19 A;  4WBR D;  5B8B A;  1GSQ A;  1DSB A;  2V1M A;  1ERU A;  3LEF A;  4BVY A;  4N10 A;  1PKZ A;  1SD8 A;  10GS A;  2L59 A;  5ECH B;  2GQK A;  2IFQ A;  4NXI A;  2LUS A;  5DBQ A;  2FNO A;  2DMM A;  3QAV A;  4ACS A;  1XIY A;  3VLN A;  2OE0 A;  1ILO A;  3FK8 A;  6GSW A;  3EVI A;  1E2Y A;  3VUR A;  3EE2 A;  4XCS A;  3VI5 A;  1NHO A;  5E4W A;  4XHM A;  2VL3 A;  2QKE A;  3P7X A;  1K3L A;  2DJJ A;  1WIK A;  1AQV A;  4IQ1 A;  1WRY A;  2OJL A;  3GX8 A;  1DUG A;  2G2Q A;  3KP9 A;  1XWA A;  5JCG A;  4HJM A;  3RPN A;  4Q5F A;  2FWH A;  3VI7 A;  4D73 B;  2KLX A;  2RII A;  1ZGN A;  5LNK e;  2GST A;  3HZ8 A;  5AIS A;  2VLU A;  3KZQ A;  1AAZ A;  1PKW A;  1G7E A;  4EXJ A;  2HYX A;  11GS A;  3KGK A;  3P8W A;  1O85 A;  3FR3 A;  7GSS A;  4HUA A;  2XBQ A;  3HD5 A;  2B7K A;  4MA9 A;  2B5E A;  5J4U A;  1XCC A;  3D4T A;  3H1N A;  2C0G A;  4MZB A;  2H1D A;  4OFM A;  3EMX A;  2MMA A;  5G2Z A;  1UVZ A;  1A8L A;  4HQZ A;  3FY7 A;  1M2D A;  1YKC A;  4ZL9 A;  2H0I A;  2R2J A;  4GCI A;  3FW2 A;  1J0F A;  4FYU A;  4ID0 A;  5GZZ B;  1X5E A;  2CV4 A;  2F9S A;  5CAX A;  2JZT A;  2WZ9 A;  3UVT A;  4GQC A;  3F63 A;  2IPA A;  3F3R A;  3WGE A;  1GTB A;  2XBI A;  3GKM A;  5A5K A;  4MAB A;  2B5X A;  5ECR B;  3GKN A;  4EDY A;  4I5Q A;  5COH A;  4IGJ A;  2LTK A;  4KH7 A;  3GL3 A;  2GQM A;  5G1K A;  1PL2 A;  1URM A;  1LBK A;  4L0W A;  3TGZ A;  2AUV A;  3IOS A;  1ZL9 A;  1QK8 A;  2F8A A;  2ON7 A;  2FD3 A;  2V32 A;  3QOU A;  2YOI A;  5DQS A;  2IMD A;  1K0O A;  4HZ2 A;  4K0G A;  3D4M A;  5AIX A;  1A24 A;  4JED A;  3RHB A;  3DVW A;  3GTU A;  1LJR A;  3LOR A;  2L4Q A;  1V58 A;  2B5Y A;  4FYB A;  1K0B A;  4PUR A;  2H73 A;  4KDX A;  2FUG 2;  3ZFL A;  3D21 A;  3PH9 A;  2HE3 A;  4RI6 A;  2EIQ A;  1H75 A;  3H4K A;  2NPB A;  1A0F A;  4HU9 A;  3APQ A;  2AAW A;  2VL9 A;  12GS A;  1YF0 A;  5CRH A;  1G6W A;  4I2U A;  5D9V A;  4LL1 B;  3C71 A;  5DQY A;  1H4O A;  3QAG A;  4OWY A;  1MDJ A;  4ILF A;  1MDI A;  4K9Z A;  1MD4 A;  1FVJ A;  3WGX A;  1JHB A;  5JCU A;  4OFT A;  1TRS A;  2X64 A;  3GN3 A;  3M8N A;  2IJY A;  4GSN A;  1SEN A;  1UA5 A;  2TRC P;  4ECC A;  22GS A;  2WB9 A;  3FR6 A;  1TJD A;  1SJZ A;  3ME8 A;  2GT5 A;  3RBT A;  4EL1 A;  2ZCT A;  5IMF A;  2GSR A;  4E8E A;  3VK9 A;  5IMV A;  4K0N A;  1SL2 B;  2WS2 A;  6GSX A;  4PGT A;  1T8E B;  2DIZ A;  5GAN D;  3F6F A;  2PER A;  5HFI A;  5FHI A;  3RAZ A;  5KN0 A;  1GUK A;  1F6M C;  4ISD A;  1NHY A;  2AHE A;  3W8J A;  2GVP A;  1O7U A;  5A4V A;  3WT1 A;  1T4Y A;  2XPE A;  4I97 A;  1U3I A;  3GIX A;  3GUS A;  4HZ4 A;  5ABR A;  1OKD A;  4RQX A;  2XPD A;  2ES7 A;  1O81 A;  5C00 A;  1XZO A;  2CVK A;  3QD9 A;  3D6I A;  5G1L A;  2H01 A;  2GLR A;  4KB3 A;  5ECP B;  1AXD A;  3I9V 2;  2VD1 A;  3TRQ A;  3F4T A;  1PA3 A;  4LMV A;  2PUK C;  1JZO A;  5L71 A;  2L5O A;  5ECO B;  1USB A;  3GL5 A;  1E6B A;  4V2L A;  2C80 A;  4BWS A;  3HY2 A;  4PQI A;  3TKP A;  1F9M A;  4HI7 A;  1B4Q A;  5HR3 A;  1KNG A;  1W4V A;  3LXZ A;  4MJB A;  1RK4 A;  3NOF A;  3C1S A;  3L9V A;  1DE2 A;  5G30 A;  3APS A;  5IMZ A;  3VWV A;  5KN1 A;  1GSS A;  1Z5Y E;  2VM2 A;  3UMA A;  5ECK B;  1MD3 A;  2YAN A;  1EGO A;  2I81 A;  4RQR A;  4KUN A;  4Q5N A;  2DJK A;  5F8B A;  1KTE A;  5IOX A;  2N5F A;  2K8S A;  3GRX A;  3IK9 A;  3KM6 A;  4K7I A;  1ZYE A;  3BCI A;  1EZK A;  4CW9 A;  3CBU A;  3KXO A;  4K1F A;  3TDG A;  1XWB A;  4KW6 A;  1K0C A;  1YZX A;  4XIH A;  2PU9 C;  5D8I A;  1YJ6 A;  1FW1 A;  2JU5 A;  4J57 E;  2LQQ A;  1XFL A;  1UC7 A;  1FAA A;  2H72 A;  3FZ9 A;  3GH9 A;  4FIW A;  1GSF A;  1JZW A;  4K7N A;  1ZOF A;  2NVL A;  4MH2 A;  1Z6M A;  4TRX A;  4N0V A;  3KIJ A;  4PNG A;  1GLP A;  3I69 A;  2P31 A;  3A2W A;  4J2F A;  1OC8 A;  3TOT A;  4MPF A;  3Q6O A;  3ME7 A;  1AQX A;  2QC7 A;  3UJ1 A;  2RM6 A;  3HCZ A;  2LNS A;  4ZIJ A;  2LJK A;  1T00 A;  4FH8 A;  2F51 A;  5G5E A;  4EC0 A;  4V2M A;  2IMF A;  1TU8 A;  3EUR A;  3EWL A;  4YQU A;  2O89 A;  1Q4J A;  3L9U A;  5DJL A; 
#chains in the Genus database with same CATH topology
 1M7T A;  3HKR A;  1SK1 A;  2NDO A;  1T4Z A;  1F3A A;  3HYP A;  1G0T A;  4OD7 A;  5KOW A;  2HFD A;  4ZB8 A;  1TW9 A;  2HRA A;  2JAD A;  3E0U A;  3UL3 A;  1SKW B;  1SK2 A;  4O5Q A;  4XS6 A;  4TXV A;  4POL A;  2HLS A;  4MK3 A;  2H6X A;  4KGI A;  4POM A;  5CRE A;  1GLQ A;  2K9F A;  2DJ3 A;  1JFU A;  6GST A;  1AC1 A;  2O85 A;  1HNA A;  4WKW A;  2KOK A;  2YJH A;  3TKS C;  5EPF A;  3WGD A;  2DKH A;  19GS A;  3GST A;  5GSS A;  1TDI A;  3IHG A;  3ZMK A;  2FWG A;  3HXS A;  4EIQ A;  4WF4 A;  4BPY A;  4DEJ A;  2JZR A;  3C73 A;  2R0C A;  5F06 A;  4MH3 A;  3ERG A;  2B1L A;  3V1W A;  3QCP A;  1K0D A;  5HQP A;  2M72 A;  3QFA C;  4JZQ A;  1WP0 A;  2GZP A;  5IMA A;  5LD0 A;  3IRA A;  3M3M A;  3TKS A;  4HQS A;  5D93 A;  3IXR A;  5DAK B;  2MZC A;  3EMP A;  4PTS A;  2FWE A;  1ZCP A;  2N5B A;  3GFK A;  5ECI B;  1AUC A;  2HZE A;  3KP8 A;  5DVB A;  2V6K A;  1QUW A;  1XW6 A;  4ZBD A;  4TN8 A;  6GSY A;  4KF9 A;  1S3D A;  1IYH A;  1XWG A;  1YQ1 A;  2L6C A;  1TXX A;  3FZ4 A;  4G9H A;  4Q5Q A;  1X9S B;  3ZL5 A;  2V2G A;  3M9K A;  2C0D A;  1TKD B;  2R5G A;  4HOJ A;  1THX A;  5BRT A;  2QSI A;  3BJ5 A;  2E2M A;  3IC4 A;  5D96 A;  1TU7 A;  1V40 A;  3LJR A;  2DLX A;  3ERW A;  3F0I A;  4V2N A;  2VLT A;  2VUP A;  2O7K A;  3GNJ A;  2MYG A;  2PWJ A;  3TUE A;  1A2J A;  4IJI A;  4WXT A;  3SWL A;  2FY6 A;  4TVE A;  4YAV A;  3IAS 2;  4Z2T A;  2VLV A;  3K8N A;  1GL8 A;  2BTO T;  2A4H A;  4YAP A;  4ZIL A;  3DIE A;  3TRX A;  2G0F A;  4Q5R A;  3EC3 A;  3FRC A;  5D9W A;  5AIV A;  3HVX A;  2WJU A;  1TRW A;  4IEL A;  1A2M A;  5KN3 A;  3CRT A;  4H86 A;  1U88 A;  2CX3 A;  4F2I A;  2I3Y A;  4BVX A;  2FGX A;  4MMM A;  3G7J A;  2YP6 A;  4GQF A;  5IQY A;  3QDN A;  2GSS A;  4CHS A;  6GSS A;  4K2D A;  4K8M A;  1FOV A;  1S3R A;  1EV4 A;  5ID2 B;  3IA1 A;  4WEY A;  3A5I A;  3TKQ A;  3D5J A;  2OE3 A;  4NMU A;  2R3X A;  3QMX A;  3PPU A;  3TJF A;  1A2L A;  1TI1 A;  1SK0 A;  5ECL B;  1OC9 B;  1THO A;  1BX9 A;  5HFG A;  2WRT A;  2YWN A;  1EEJ A;  4MPG A;  4CDO A;  2E0Q A;  1F2E A;  2PBJ A;  2F8F A;  3TKS E;  1I5G A;  5CYY A;  1PN0 A;  1FB0 A;  5IPH A;  3J7Y k;  1ABA A;  4PQH A;  2WGR A;  1V2A A;  2V41 A;  3BD2 A;  4Z7X A;  3DML A;  1SL1 B;  1XG8 A;  5F0G A;  4IS0 A;  2DSA A;  3ISO A;  1N8J A;  5DJL A;  1B4P A;  2QGV A;  4ML1 A;  3ZIV A;  2GZZ A;  4IP6 A;  2DIY A;  2H8L A;  2VIM A;  3DD3 A;  3LG6 A;  4USS A;  2LRN A;  2YZH A;  3NIV A;  3LQ7 A;  3CMI A;  2DC5 A;  1VF3 A;  5DCH A;  1WPI A;  3KH9 A;  4KSM A;  2H6Y A;  2IL3 A;  3EU4 A;  1SJ6 A;  3W8S A;  2LS5 A;  1GSY A;  4Z2U A;  1WWJ A;  2WFC A;  1TOF A;  4JRR A;  3F4S A;  2A4V A;  3SBC A;  1GNE A;  5INY A;  2DJ0 A;  1EP8 A;  4ZB6 A;  3UBL A;  3S9F A;  5KOX A;  3CXG A;  2A2P A;  3CRU A;  4PUA A;  3DWV A;  4TR1 B;  2PVO C;  4D73 A;  3KTL A;  1GUH A;  4MNN A;  3TCO A;  2A2S A;  3US3 A;  2LNT A;  2VCZ A;  1O8W A;  3H79 A;  1OKT A;  1WE0 A;  1PL1 A;  4GWR A;  2LQO A;  3G9B A;  5ELG A;  1JLW A;  4ZL8 A;  3Q19 A;  3IDV A;  1LU4 A;  5EY6 A;  4LL4 B;  3HZ4 A;  4TR0 A;  3VWW A;  2H76 A;  4EUY A;  3GMF A;  2L4C A;  4HSC X;  1V9W A;  1YEP A;  4LLR A;  5CNW A;  1B48 A;  2O8V B;  5E59 A;  2LJA A;  4ULX A;  4EKZ A;  2AYT A;  3FZ5 A;  2EIO A;  2ALB A;  2WUL A;  3G7Y A;  1A8Y A;  2JL4 A;  1XWC A;  4KCA A;  4ZBB A;  1T7P B;  2R6K A;  2VAF A;  1R5P A;  1FB6 A;  4QQ7 A;  4JBB A;  3ZTL A;  4WET A;  3M1G A;  2HRK A;  3TJK A;  4DSS B;  3L0H A;  5DCG A;  1WMJ A;  3LGC A;  1GSD A;  2C3Q A;  2P0G A;  2KUC A;  3MWH A;  2OKA A;  2GGT A;  3KD0 A;  1MTC A;  3VPT A;  3BBY A;  4X0X A;  3ZZX A;  3WD6 A;  1T1V A;  5D9X A;  4O32 A;  1SYX A;  2GSQ A;  1UN2 A;  3RDW A;  2OA7 A;  2M46 A;  2M80 A;  1XPV A;  3TOU A;  2H71 A;  1Q98 A;  4AGS A;  3KEB A;  3C8E A;  2AB6 A;  3FZA A;  1X5D A;  2VO4 A;  4FYC A;  4MJA A;  5IOW A;  1M3J A;  4MZW A;  4BL7 A;  2YCD A;  5CP1 A;  9GSS A;  2O87 A;  2JSY A;  3TJG A;  1C72 A;  4I8B A;  5HR2 A;  3GYK A;  1N2A A;  4YH2 A;  2L6D A;  1SL0 B;  3LYK A;  4XS4 B;  5DAL B;  4AF2 A;  2C0F A;  1F3B A;  5IM9 A;  2CAQ A;  3IBH A;  1R4W A;  3VWX A;  3UOM A;  2AV4 A;  2YV7 A;  4TXO B;  3UVH A;  1DE1 A;  2VCX A;  4IP1 A;  3CTG A;  2VM1 A;  4HU7 A;  5IIZ A;  4FO5 A;  5J5N A;  4DSQ A;  4WF5 A;  4MJE A;  4OCE A;  1XVQ A;  3ZML A;  2K18 A;  4TR3 A;  4GRF A;  2L57 A;  4L5O A;  3A2X A;  1K0M A;  5DDL A;  4NV2 A;  3GA4 A;  4JR6 A;  1Z9H A;  4KE3 A;  2GTU A;  1S3A A;  4XRA A;  2DML A;  1A23 A;  4TKY A;  3LFL A;  2YPM A;  1PX7 A;  2NBS A;  2H1G A;  1T3B A;  4BVY B;  1ON4 A;  3ZYW A;  1PX6 A;  2ZUP A;  1YEX A;  1O8X A;  2LRC A;  2I9H A;  1S3C A;  1I9D A;  2IFQ B;  5IMC A;  4PUF C;  20GS A;  2BJX A;  2GT6 A;  3GSS A;  2Z9S A;  5KN2 A;  3NZN A;  3A3T A;  1VGL A;  3F6D A;  5D73 A;  4NPB A;  1GP1 A;  1PFO A;  2HSH A;  4O5R A;  4IKH A;  3FHK A;  5ECQ B;  1VF4 A;  1TK8 B;  3F4R A;  4I6X A;  1BED A;  3D0Z A;  1SKS B;  5H5R A;  4GST A;  3HVV A;  4GXZ A;  2DJ1 A;  2HSY A;  2IME A;  2GDR A;  4G10 A;  2LEG A;  1NSW A;  4K6X A;  4Z2R A;  2VCT A;  3QFB C;  1OVN A;  4IW9 A;  1TK5 B;  5D9T A;  5JWR B;  2C3N A;  4BWQ A;  2C1Y A;  2H30 A;  5IMD A;  1GNW A;  2MMO A;  1EV9 A;  3VWU A;  1F37 A;  1ZZY A;  3E3E A;  3HA9 A;  2HRF A;  2J9H A;  5FT3 A;  1DBY A;  1GRX A;  5B7C A;  2XC2 A;  2H74 A;  2ON5 A;  3M0F A;  4X43 A;  1XOB A;  4EO3 A;  4MF5 A;  5CRW A;  1MDK A;  2X49 A;  4NV5 A;  2JZS A;  2H19 A;  2HI7 A;  1ERT A;  3LWA A;  5ECS A;  2YWM A;  4EIP A;  4TXO A;  2X8H A;  1NW2 A;  3ED3 A;  1TTZ A;  1VF1 A;  2PN8 A;  4BA7 A;  1O6J A;  5ECN B;  2LRT A;  4HEA 2;  3U5R E;  5J9B A;  3MDK A;  2YNX A;  2H1A A;  1TRV A;  1QMV A;  4ECB A;  4MJC A;  4NAX A;  3CTF A;  1GTU A;  1TRU A;  2PMT A;  1EOH A;  5GAP D;  1R26 A;  2I4A A;  4L0U A;  2C0E A;  2K6V A;  1BAY A;  3CYN A;  4KSO A;  2EC4 A;  3O76 A;  3UIW A;  4EF0 A;  1BJX A;  1M99 A;  4P3Y B;  5HR0 A;  1M2A A;  3GTU B;  4F03 A;  5GST A;  4MLY A;  3DEX A;  4F0C A;  1RW1 A;  3IHQ A;  1FG4 A;  1V98 A;  4TW5 A;  2X8C A;  4PX1 A;  1Y25 A;  4IHU A;  2R4V A;  3IR4 A;  3UAR A;  2A2R A;  4MCU A;  4N11 A;  3L9S A;  3BCK A;  1R7H A;  4DSR A;  1K3O A;  3CSH A;  1M9B A;  1PSQ A;  2KP2 A;  4K5R A;  4IQA A;  4O7H A;  2FCH A;  1QGV A;  3D22 A;  2C4J A;  4MF6 A;  3KCM A;  3CSJ A;  1EOG A;  2KP1 A;  1PQN A;  4JE1 A;  3GKX A;  2H75 A;  4ML6 A;  2H6Z A;  2REM A;  4OO5 A;  1Z7R A;  4PXO A;  1AQW A;  3PIN A;  2CZ2 A;  3N9J A;  4L8E A;  4POB A;  4LMW A;  3ZVJ A;  1HNB A;  3L4N A;  2PVQ A;  1J9B A;  4YKG A;  3VFI A;  2CVB A;  3KTB A;  2IIY A;  2BMX A;  2KHP A;  4HJ2 A;  5G5F A;  5HFK A;  1OC3 A;  3H93 A;  2IMK A;  2MMN A;  4ZB9 A;  1ST9 A;  3E9J B;  2VCV A;  4WBJ A;  5KEJ A;  1WJK A;  5AGY A;  3DGQ A;  5FWG A;  2GZY A;  4E8H A;  4KDU A;  5DAK A;  1QXH A;  3LSZ A;  1CQG A;  1Z3E A;  1SU9 A;  1XXU A;  2PPT A;  1PD2 1;  1J08 A;  1Z6N A;  4IJ3 A;  4NHZ A;  1KBN A;  4NWY A;  3J7Y b;  4GLT A;  4G0L A;  1KEB A;  4L5L A;  3G7I A;  3HDC A;  3IK7 A;  3KMO A;  5J9C A;  4HS1 A;  2N5A A;  2RUE A;  4ECJ A;  4JR4 A;  3DXB A;  3GKK A;  4RUV A;  4ICY A;  3ZRD A;  4YQM A;  4TR4 A;  5DJM A;  1X9M B;  1FO5 A;  1QFN A;  2R37 A;  4MF7 A;  3LW9 A;  3P2A A;  2DBC A;  4XS1 A;  3TRP A;  5J3R A;  3PGT A;  5CRD A;  1JZD A;  1AIU A;  4ZL7 A;  1XOA A;  2FA4 A;  2OAD A;  1JZR A;  4NHW A;  4POK A;  1HQO A;  3MYD A;  2TRX A;  3IC8 A;  1W89 A;  4PNF A;  1NM3 A;  3ZIT A;  2MBS A;  2X99 A;  4JU5 A;  1PGT A;  1U3A A;  3W6G A;  4DVC A;  2PGT A;  2H0H A;  1SKR B;  2XHF A;  1EEM A;  2GS3 A;  2IMI A;  3L78 A;  1WOU A;  1GTI A;  6GSV A;  5F07 A;  4CY6 A;  1V57 A;  3IPZ A;  3C7M A;  3QPM A;  4KAE A;  4PQ1 A;  1XW9 A;  3MIX A;  4OCF A;  4KX4 A;  2B6M A;  1ML6 A;  2ZNM A;  3MAK A;  5J41 A;  1SD9 A;  3APO A;  17GS A;  3ZRE A;  2FA8 A;  2WDU A;  1MEK A;  1B9X C;  5ID2 A;  1FVK A;  1EGR A;  2OBI A;  4K7O A;  2YN1 A;  1IYI A;  4I2T A;  3A2V A;  1JLV A;  5F05 A;  4AJ8 A;  1OC9 A;  3N5O A;  2VL2 C;  4G2E A;  4LA1 A;  4AJ7 A;  5IPG A;  2F3M A;  2OE1 A;  3ZLP A;  1XW5 A;  3R3E A;  3TJJ A;  2RUF A;  2LKU A;  2HRN A;  3I6A A;  2H70 A;  1RQM A;  4RI7 A;  1GSE A;  3JCM L;  4F0B A;  1GSU A;  4ZXG A;  3WYW A;  3HJP A;  5ECM B;  3GHA A;  1X0R A;  1VRS D;  2E2G A;  1EP7 A;  1BG5 A;  3ZFB A;  5EL8 A;  5IO0 A;  2VL2 A;  4ZBA A;  1EWX A;  2H66 A;  1ERW A;  3DYR A;  16GS A;  2DKI A;  3R2Q A;  2YWO A;  2RLI A;  3EYT A;  3FR9 A;  1GUM A;  1ZMA A;  2VOC A;  1BQ7 A;  1M2B A;  1ZYQ B;  2NTO A;  4GTU A;  3GUR A;  4IVF A;  4WR4 A;  4BIK A;  2C3T A;  1Z7P A;  3KH7 A;  3GV1 A;  1YY7 A;  3LXT A;  3ZIJ A;  3HHV A;  4GF0 A;  5HR1 A;  5LCZ A;  2V6O A;  3FYG A;  1OAZ A;  1M9A A;  1U6T A;  3HJO A;  4OMV A;  4KND A;  3UBK A;  1GTA A;  1OYJ A;  3KMN A;  3BOA A;  2WCI A;  2EIR A;  2LJR A;  5B6N A;  5EVO A;  4TR1 A;  4ECI A;  4F82 A;  3Q74 A;  2X4A A;  4N30 A;  2H0G A;  3QAW A;  2IN3 A;  4N0Z A;  4OO4 A;  2VCW A;  2L5L A;  3DRN A;  1YF1 A;  2B7J A;  5CO3 A;  3IAM 2;  3GH6 A;  2YWI A;  2JSZ A;  3EIN A;  1PMT A;  5ELA A;  1A0R P;  1CQH A;  1XVW A;  5G31 A;  6GSU A;  1K3Y A;  5AN1 A;  2IWT A;  3CQF A;  2MBT A;  2CA8 A;  3ERF A;  3TJB A;  3FKF A;  1FHE A;  3A5W A;  3F3Q A;  2HZE B;  4J56 E;  3VPQ A;  4IBP A;  3IV4 A;  2E7P A;  1PN9 A;  3O6T A;  1GWC A;  3Q18 A;  2I1U A;  2OBK A;  2VD0 A;  5ENU A;  2VCQ A;  4OFN A;  4MZC A;  3UEM A;  3F8U A;  1U87 A;  1B9Y C;  3WT2 A;  5B8A A;  18GS A;  5A4U A;  1AW9 A;  4KCE A;  1HYU A;  2D2Z A;  2J23 A;  3AY8 A;  1HNC A;  4KDY A;  2OAC A;  5C04 A;  4X1U A;  3CSI A;  8GSS A;  4DSS A;  3FEU A;  2FLS A;  3DVX A;  3ZVJ D;  4GSS A;  4XRD A;  1GUL A;  1PRX A;  2B3S A;  14GS A;  3M9J A;  1SYR A;  3MSZ A;  5CRG A;  2MMZ A;  2HXK A;  3F9U A;  1R5A A;  2TIR A;  1VF2 A;  4V1A p;  2X8G A;  4X4J A;  1QQ2 A;  2YV9 A;  2P5Q A;  3U6V A;  2RM5 A;  3I43 A;  2HNL A;  1OE8 A;  5A4W A;  3UAP A;  2CVD A;  1G6Y A;  4EVM A;  3P90 A;  4HDE A;  1TP9 A;  1TK0 B;  3OR5 A;  4A5P A;  1YDK A;  1O73 A;  2LV3 A;  4BVX B;  1K0N A;  1X9W B;  4QL7 A;  1M0U A;  3TB2 A;  4V1A g;  3IE3 A;  4MP4 A;  4XTS A;  3RHC A;  1SJI A;  1X5C A;  4O92 A;  1HD2 A;  3C1R A;  1TI3 A;  3MNG A;  1Y6E A;  5H5S A;  2CX4 A;  5JCW A;  2LST A;  4YKF A;  4EE0 A;  4TOP A;  13GS A;  2AJQ B;  3KJY A;  2DJ2 A;  2CT6 A;  2P5R A;  4XS4 A;  5B6M A;  5DAL A;  3EU3 A;  3PR8 A;  4K5S A;  2H1B A;  1OE7 A;  1YKA A;  2B1K A;  2HZF A;  4YQV A;  1B8X A;  2YZU A;  4F9Z A;  5JWQ B;  5H5Q A;  2JAC A;  3H8Q A;  4WR5 A;  3RPP A;  2YJ7 A;  3GX0 A;  3QR6 A;  1BYE A;  2GQL A;  1XBS A;  1ERV A;  4KA0 A;  3HVS A;  3LYP A;  5JWO B;  2HT9 A;  2FHE A;  4AJ6 A;  1G7O A;  1ACV A;  2FWF A;  4IN0 A;  2CZ3 A;  3TKR A;  4QL9 A;  3DKS A;  1XWK A;  3HJM A;  5IO2 A;  2CQ9 A;  2CAI A;  3O3T A;  2C8U A;  4O5U A;  4EDZ A;  4MDC A;  2K8V A;  1GH2 A;  4WBR D;  1K0A A;  4G19 A;  5B8B A;  1GSQ A;  1DSB A;  2V1M A;  1ERU A;  3LEF A;  4BVY A;  4N10 A;  1PKZ A;  1SD8 A;  10GS A;  2L59 A;  5ECH B;  2GQK A;  2IFQ A;  4NXI A;  2LUS A;  5DBQ A;  2FNO A;  2DMM A;  3QAV A;  4ACS A;  1XIY A;  3VLN A;  2OE0 A;  1ILO A;  3FK8 A;  3EPT A;  6GSW A;  3EVI A;  1E2Y A;  3VUR A;  3EE2 A;  4XCS A;  3VI5 A;  1NHO A;  5E4W A;  4XHM A;  2VL3 A;  2QKE A;  3P7X A;  1K3L A;  2DJJ A;  1WIK A;  1AQV A;  4IQ1 A;  1WRY A;  2OJL A;  3GX8 A;  1DUG A;  2G2Q A;  3KP9 A;  1XWA A;  5JCG A;  4HJM A;  3RPN A;  4Q5F A;  2FWH A;  3VI7 A;  4D73 B;  2KLX A;  2RII A;  1ZGN A;  5LNK e;  2GST A;  3HZ8 A;  5AIS A;  2VLU A;  3HVN A;  3KZQ A;  1AAZ A;  1PKW A;  1G7E A;  4EXJ A;  2HYX A;  11GS A;  3KGK A;  3P8W A;  1O85 A;  3FR3 A;  7GSS A;  4HUA A;  2XBQ A;  3HD5 A;  2B7K A;  4MA9 A;  2B5E A;  4G0I A;  5J4U A;  1XCC A;  3D4T A;  3H1N A;  2C0G A;  4MZB A;  2H1D A;  4OFM A;  3EMX A;  1M3I A;  2MMA A;  5G2Z A;  1UVZ A;  1A8L A;  4HQZ A;  3FY7 A;  1M2D A;  1YKC A;  4ZL9 A;  2H0I A;  2R2J A;  4GCI A;  3FW2 A;  1J0F A;  4FYU A;  4ID0 A;  5GZZ B;  1X5E A;  2CV4 A;  1ZYP A;  2F9S A;  5CAX A;  2JZT A;  2WZ9 A;  3UVT A;  4GQC A;  3F63 A;  2IPA A;  3F3R A;  3WGE A;  1GTB A;  2XBI A;  3GKM A;  5A5K A;  4MAB A;  2B5X A;  5ECR B;  3GKN A;  4EDY A;  4I5Q A;  5COH A;  4IGJ A;  2LTK A;  4KH7 A;  3GL3 A;  2GQM A;  5G1K A;  1PL2 A;  1URM A;  1LBK A;  4L0W A;  3TGZ A;  2AUV A;  3IOS A;  1ZL9 A;  1QK8 A;  2F8A A;  2ON7 A;  2FD3 A;  2V32 A;  3QOU A;  2YOI A;  5DQS A;  2IMD A;  1K0O A;  4HZ2 A;  4K0G A;  3D4M A;  5AIX A;  1A24 A;  1ZYN A;  4CY8 A;  4JED A;  3RHB A;  3DVW A;  3GTU A;  1LJR A;  3LOR A;  2L4Q A;  1V58 A;  2B5Y A;  4FYB A;  1K0B A;  4PUR A;  2H73 A;  4KDX A;  2FUG 2;  3ZFL A;  4BL7 B;  3D21 A;  3PH9 A;  2HE3 A;  4RI6 A;  2EIQ A;  1H75 A;  3H4K A;  4G0K A;  2NPB A;  1A0F A;  4HU9 A;  3APQ A;  2AAW A;  2VL9 A;  12GS A;  1YF0 A;  5CRH A;  1G6W A;  4I2U A;  5D9V A;  4LL1 B;  3C71 A;  5DQY A;  1H4O A;  3QAG A;  4OWY A;  1MDJ A;  4ILF A;  1MDI A;  4K9Z A;  1MD4 A;  1FVJ A;  3WGX A;  1FOH A;  1JHB A;  5JCU A;  3FMW A;  4OFT A;  1TRS A;  2X64 A;  3GN3 A;  3M8N A;  2IJY A;  4GSN A;  1SEN A;  1UA5 A;  2TRC P;  4ECC A;  2R0G A;  5BMU A;  22GS A;  2WB9 A;  3FR6 A;  1TJD A;  1SJZ A;  3ME8 A;  2GT5 A;  3RBT A;  4EL1 A;  2ZCT A;  5IMF A;  2GSR A;  4E8E A;  3VK9 A;  5IMV A;  4K0N A;  1SL2 B;  2WS2 A;  6GSX A;  4PGT A;  1T8E B;  2DIZ A;  5GAN D;  3F6F A;  5HFI A;  5FHI A;  3RAZ A;  2QA1 A;  5KN0 A;  1GUK A;  1F6M C;  4ISD A;  1NHY A;  2AHE A;  2QA2 A;  3W8J A;  2GVP A;  1O7U A;  5A4V A;  3WT1 A;  1T4Y A;  2XPE A;  4I97 A;  1U3I A;  3GIX A;  4K2X A;  3GUS A;  4HZ4 A;  5ABR A;  1OKD A;  4RQX A;  2XPD A;  2ES7 A;  1O81 A;  5C00 A;  1XZO A;  2CVK A;  3QD9 A;  3D6I A;  5G1L A;  2H01 A;  2GLR A;  4KB3 A;  5ECP B;  1AXD A;  3I9V 2;  2VD1 A;  3TRQ A;  3F4T A;  1PA3 A;  4LMV A;  2PUK C;  1JZO A;  2HSM A;  5L71 A;  2L5O A;  5ECO B;  1USB A;  3GL5 A;  1E6B A;  4V2L A;  2C80 A;  4BWS A;  3HY2 A;  4PQI A;  3TKP A;  1F9M A;  4HI7 A;  1B4Q A;  5HR3 A;  1KNG A;  1W4V A;  3LXZ A;  2R0P A;  4MJB A;  1RK4 A;  3NOF A;  3C1S A;  3L9V A;  1DE2 A;  5G30 A;  3APS A;  5IMZ A;  4FQU A;  3VWV A;  5KN1 A;  1GSS A;  1Z5Y E;  2VM2 A;  3UMA A;  5ECK B;  1MD3 A;  2YAN A;  1EGO A;  2I81 A;  4RQR A;  4KUN A;  4Q5N A;  2DJK A;  5F8B A;  1KTE A;  5IOX A;  2N5F A;  2K8S A;  3GRX A;  3IK9 A;  3KM6 A;  4K7I A;  1ZYE A;  3BCI A;  1EZK A;  4CW9 A;  3CBU A;  3KXO A;  4K1F A;  3TDG A;  1XWB A;  4KW6 A;  1K0C A;  1YZX A;  4XIH A;  2PU9 C;  5D8I A;  1YJ6 A;  1FW1 A;  2JU5 A;  4J57 E;  2LQQ A;  1XFL A;  1UC7 A;  1FAA A;  2H72 A;  3FZ9 A;  3GH9 A;  4FIW A;  1GSF A;  1JZW A;  4K7N A;  1ZOF A;  2NVL A;  4MH2 A;  1Z6M A;  4TRX A;  4N0V A;  3KIJ A;  4PNG A;  1GLP A;  2UZ8 A;  3I69 A;  2P31 A;  3A2W A;  4J2F A;  1OC8 A;  3TOT A;  4MPF A;  3Q6O A;  3ME7 A;  1AQX A;  2QC7 A;  3UJ1 A;  2RM6 A;  3HCZ A;  2LNS A;  4ZIJ A;  2LJK A;  1T00 A;  4FH8 A;  2F51 A;  5G5E A;  4EC0 A;  4V2M A;  2IMF A;  1TU8 A;  3EUR A;  3EWL A;  4YQU A;  2O89 A;  1Q4J A;  3L9U A;  2PER A; 
#chains in the Genus database with same CATH homology
 1M7T A;  3HKR A;  1SK1 A;  2NDO A;  1T4Z A;  1F3A A;  3HYP A;  1G0T A;  4OD7 A;  5KOW A;  2HFD A;  4ZB8 A;  1TW9 A;  2HRA A;  2JAD A;  3E0U A;  3UL3 A;  1SKW B;  1SK2 A;  4O5Q A;  4XS6 A;  4TXV A;  4POL A;  2HLS A;  4MK3 A;  2H6X A;  4KGI A;  4POM A;  5CRE A;  1GLQ A;  2K9F A;  2DJ3 A;  1JFU A;  6GST A;  1AC1 A;  2O85 A;  1HNA A;  4WKW A;  2KOK A;  2YJH A;  3TKS C;  5EPF A;  3WGD A;  2DKH A;  19GS A;  3GST A;  5GSS A;  1TDI A;  3IHG A;  3ZMK A;  2FWG A;  3HXS A;  4EIQ A;  4WF4 A;  4BPY A;  4DEJ A;  2JZR A;  3C73 A;  2R0C A;  5F06 A;  4MH3 A;  3ERG A;  2B1L A;  3V1W A;  3QCP A;  1K0D A;  5HQP A;  2M72 A;  3QFA C;  4JZQ A;  1WP0 A;  2GZP A;  5IMA A;  5LD0 A;  3IRA A;  3M3M A;  3TKS A;  4HQS A;  5D93 A;  3IXR A;  5DAK B;  2MZC A;  3EMP A;  4PTS A;  2FWE A;  1ZCP A;  2N5B A;  3GFK A;  5ECI B;  1AUC A;  2HZE A;  3KP8 A;  5DVB A;  2V6K A;  1QUW A;  1XW6 A;  4ZBD A;  4TN8 A;  6GSY A;  4KF9 A;  1S3D A;  1IYH A;  1XWG A;  1YQ1 A;  2L6C A;  1TXX A;  3FZ4 A;  4G9H A;  4Q5Q A;  1X9S B;  3ZL5 A;  2V2G A;  3M9K A;  2C0D A;  1TKD B;  2R5G A;  4HOJ A;  1THX A;  5BRT A;  2QSI A;  3BJ5 A;  2E2M A;  3IC4 A;  5D96 A;  1TU7 A;  1V40 A;  3LJR A;  2DLX A;  3ERW A;  3F0I A;  4V2N A;  2VLT A;  2VUP A;  2O7K A;  3GNJ A;  2MYG A;  2PWJ A;  3TUE A;  1A2J A;  4IJI A;  4WXT A;  3SWL A;  2FY6 A;  4TVE A;  4YAV A;  3IAS 2;  4Z2T A;  2VLV A;  3K8N A;  1GL8 A;  2BTO T;  2A4H A;  4YAP A;  4ZIL A;  3DIE A;  3TRX A;  2G0F A;  4Q5R A;  3EC3 A;  3FRC A;  5D9W A;  5AIV A;  3HVX A;  2WJU A;  1TRW A;  4IEL A;  1A2M A;  5KN3 A;  3CRT A;  4H86 A;  1U88 A;  2CX3 A;  4F2I A;  2I3Y A;  4BVX A;  2FGX A;  4MMM A;  3G7J A;  2YP6 A;  4GQF A;  5IQY A;  3QDN A;  2GSS A;  4CHS A;  6GSS A;  4K2D A;  4K8M A;  1FOV A;  1EV4 A;  5ID2 B;  3IA1 A;  4WEY A;  3A5I A;  3TKQ A;  3D5J A;  2OE3 A;  4NMU A;  2R3X A;  3QMX A;  3PPU A;  3TJF A;  1A2L A;  1TI1 A;  1SK0 A;  5ECL B;  1OC9 B;  1THO A;  1BX9 A;  5HFG A;  2WRT A;  2YWN A;  1EEJ A;  4MPG A;  4CDO A;  2E0Q A;  1F2E A;  2PBJ A;  2F8F A;  3TKS E;  1I5G A;  5CYY A;  1PN0 A;  1FB0 A;  5IPH A;  3J7Y k;  1ABA A;  4PQH A;  2WGR A;  1V2A A;  2V41 A;  3BD2 A;  4Z7X A;  3DML A;  1SL1 B;  5F0G A;  4IS0 A;  2DSA A;  3ISO A;  1N8J A;  5DJL A;  1B4P A;  2QGV A;  4ML1 A;  3ZIV A;  2GZZ A;  4IP6 A;  2DIY A;  2H8L A;  2VIM A;  3DD3 A;  3LG6 A;  4USS A;  2LRN A;  2YZH A;  3NIV A;  3LQ7 A;  3CMI A;  2DC5 A;  1VF3 A;  5DCH A;  1WPI A;  3KH9 A;  4KSM A;  2H6Y A;  2IL3 A;  3EU4 A;  1SJ6 A;  3W8S A;  2LS5 A;  1GSY A;  4Z2U A;  1WWJ A;  2WFC A;  1TOF A;  4JRR A;  3F4S A;  2A4V A;  3SBC A;  1GNE A;  5INY A;  2DJ0 A;  1EP8 A;  4ZB6 A;  3UBL A;  3S9F A;  5KOX A;  3CXG A;  2A2P A;  3CRU A;  4PUA A;  3DWV A;  4TR1 B;  2PVO C;  4D73 A;  3KTL A;  1GUH A;  4MNN A;  3TCO A;  2A2S A;  3US3 A;  2LNT A;  2VCZ A;  1O8W A;  3H79 A;  1OKT A;  1WE0 A;  1PL1 A;  4GWR A;  2LQO A;  3G9B A;  5ELG A;  1JLW A;  4ZL8 A;  3Q19 A;  3IDV A;  1LU4 A;  5EY6 A;  4LL4 B;  3HZ4 A;  4TR0 A;  3VWW A;  2H76 A;  4EUY A;  3GMF A;  2L4C A;  1V9W A;  1YEP A;  4LLR A;  5CNW A;  1B48 A;  2O8V B;  5E59 A;  2LJA A;  4ULX A;  4EKZ A;  2AYT A;  3FZ5 A;  2EIO A;  2ALB A;  2WUL A;  3G7Y A;  1A8Y A;  2JL4 A;  1XWC A;  4KCA A;  4ZBB A;  1T7P B;  2R6K A;  2VAF A;  1R5P A;  1FB6 A;  4QQ7 A;  4JBB A;  3ZTL A;  4WET A;  3M1G A;  2HRK A;  3TJK A;  4DSS B;  3L0H A;  5DCG A;  1WMJ A;  3LGC A;  1GSD A;  2C3Q A;  2P0G A;  2KUC A;  3MWH A;  2OKA A;  2GGT A;  3KD0 A;  1MTC A;  3VPT A;  3BBY A;  4X0X A;  3ZZX A;  3WD6 A;  1T1V A;  5D9X A;  4O32 A;  1SYX A;  2GSQ A;  1UN2 A;  3RDW A;  2OA7 A;  2M46 A;  2M80 A;  1XPV A;  3TOU A;  2H71 A;  1Q98 A;  4AGS A;  3KEB A;  3C8E A;  2AB6 A;  3FZA A;  1X5D A;  2VO4 A;  4FYC A;  4MJA A;  5IOW A;  4MZW A;  4BL7 A;  2YCD A;  5CP1 A;  9GSS A;  2O87 A;  2JSY A;  3TJG A;  1C72 A;  4I8B A;  5HR2 A;  3GYK A;  1N2A A;  4YH2 A;  2L6D A;  1SL0 B;  3LYK A;  4XS4 B;  5DAL B;  4AF2 A;  2C0F A;  1F3B A;  5IM9 A;  2CAQ A;  3IBH A;  1R4W A;  3VWX A;  3UOM A;  2AV4 A;  2YV7 A;  4TXO B;  3UVH A;  1DE1 A;  2VCX A;  4IP1 A;  3CTG A;  2VM1 A;  4HU7 A;  5IIZ A;  4FO5 A;  5J5N A;  4DSQ A;  4WF5 A;  4MJE A;  4OCE A;  1XVQ A;  3ZML A;  2K18 A;  4TR3 A;  4GRF A;  2L57 A;  4L5O A;  3A2X A;  1K0M A;  5DDL A;  4NV2 A;  3GA4 A;  4JR6 A;  1Z9H A;  4KE3 A;  2GTU A;  1S3A A;  4XRA A;  2DML A;  1A23 A;  4TKY A;  3LFL A;  2YPM A;  1PX7 A;  2NBS A;  2H1G A;  1T3B A;  4BVY B;  1ON4 A;  3ZYW A;  1PX6 A;  2ZUP A;  1YEX A;  1O8X A;  2LRC A;  2I9H A;  1S3C A;  1I9D A;  2IFQ B;  5IMC A;  4PUF C;  20GS A;  2BJX A;  2GT6 A;  3GSS A;  2Z9S A;  5KN2 A;  3NZN A;  3A3T A;  1VGL A;  3F6D A;  5D73 A;  4NPB A;  1GP1 A;  2HSH A;  4O5R A;  4IKH A;  3FHK A;  5ECQ B;  1VF4 A;  1TK8 B;  3F4R A;  4I6X A;  1BED A;  3D0Z A;  1SKS B;  5H5R A;  4GST A;  3HVV A;  4GXZ A;  2DJ1 A;  2HSY A;  2IME A;  2GDR A;  4G10 A;  2LEG A;  1NSW A;  4K6X A;  4Z2R A;  2VCT A;  3QFB C;  1OVN A;  4IW9 A;  1TK5 B;  5D9T A;  5JWR B;  2C3N A;  4BWQ A;  2C1Y A;  2H30 A;  5IMD A;  1GNW A;  2MMO A;  1EV9 A;  3VWU A;  1F37 A;  1ZZY A;  3E3E A;  3HA9 A;  2HRF A;  2J9H A;  5FT3 A;  1DBY A;  1GRX A;  5B7C A;  2XC2 A;  2H74 A;  2ON5 A;  3M0F A;  4X43 A;  1XOB A;  4EO3 A;  4MF5 A;  5CRW A;  1MDK A;  2X49 A;  4NV5 A;  2JZS A;  2H19 A;  2HI7 A;  1ERT A;  3LWA A;  5ECS A;  2YWM A;  4EIP A;  4TXO A;  2X8H A;  1NW2 A;  3ED3 A;  1TTZ A;  1VF1 A;  2PN8 A;  4BA7 A;  1O6J A;  5ECN B;  2LRT A;  4HEA 2;  3U5R E;  5J9B A;  3MDK A;  2YNX A;  2H1A A;  1TRV A;  1QMV A;  4ECB A;  4MJC A;  4NAX A;  3CTF A;  1GTU A;  1TRU A;  2PMT A;  1EOH A;  5GAP D;  1R26 A;  2I4A A;  4L0U A;  2C0E A;  2K6V A;  1BAY A;  3CYN A;  4KSO A;  2EC4 A;  3O76 A;  3UIW A;  4EF0 A;  1BJX A;  1M99 A;  4P3Y B;  5HR0 A;  1M2A A;  3GTU B;  4F03 A;  5GST A;  4MLY A;  3DEX A;  4F0C A;  1RW1 A;  3IHQ A;  1FG4 A;  1V98 A;  4TW5 A;  2X8C A;  4PX1 A;  1Y25 A;  4IHU A;  2R4V A;  3IR4 A;  3UAR A;  2A2R A;  4MCU A;  4N11 A;  3L9S A;  3BCK A;  1R7H A;  4DSR A;  1K3O A;  3CSH A;  1M9B A;  1PSQ A;  2KP2 A;  4K5R A;  4IQA A;  4O7H A;  2FCH A;  1QGV A;  3D22 A;  2C4J A;  4MF6 A;  3KCM A;  3CSJ A;  1EOG A;  2KP1 A;  1PQN A;  4JE1 A;  3GKX A;  2H75 A;  4ML6 A;  2H6Z A;  2REM A;  4OO5 A;  1Z7R A;  4PXO A;  1AQW A;  3PIN A;  2CZ2 A;  3N9J A;  4L8E A;  4POB A;  4LMW A;  3ZVJ A;  1HNB A;  3L4N A;  2PVQ A;  1J9B A;  4YKG A;  3VFI A;  2CVB A;  3KTB A;  2IIY A;  2BMX A;  2KHP A;  4HJ2 A;  5G5F A;  5HFK A;  1OC3 A;  3H93 A;  2IMK A;  2MMN A;  4ZB9 A;  1ST9 A;  3E9J B;  2VCV A;  4WBJ A;  5KEJ A;  1WJK A;  5AGY A;  3DGQ A;  5FWG A;  2GZY A;  4E8H A;  4KDU A;  5DAK A;  1QXH A;  3LSZ A;  1CQG A;  1Z3E A;  1SU9 A;  1XXU A;  2PPT A;  1PD2 1;  1J08 A;  1Z6N A;  4IJ3 A;  4NHZ A;  1KBN A;  4NWY A;  3J7Y b;  4GLT A;  4G0L A;  1KEB A;  4L5L A;  3G7I A;  3HDC A;  3IK7 A;  3KMO A;  5J9C A;  4HS1 A;  2N5A A;  2RUE A;  4ECJ A;  4JR4 A;  3DXB A;  3GKK A;  4RUV A;  4ICY A;  3ZRD A;  4YQM A;  4TR4 A;  5DJM A;  1X9M B;  1FO5 A;  1QFN A;  2R37 A;  4MF7 A;  3LW9 A;  3P2A A;  2DBC A;  4XS1 A;  3TRP A;  5J3R A;  3PGT A;  5CRD A;  1JZD A;  1AIU A;  4ZL7 A;  1XOA A;  2FA4 A;  2OAD A;  1JZR A;  4NHW A;  4POK A;  1HQO A;  3MYD A;  2TRX A;  3IC8 A;  1W89 A;  4PNF A;  1NM3 A;  3ZIT A;  2MBS A;  2X99 A;  4JU5 A;  1PGT A;  1U3A A;  3W6G A;  4DVC A;  2PGT A;  2H0H A;  1SKR B;  2XHF A;  1EEM A;  2GS3 A;  2IMI A;  3L78 A;  1WOU A;  1GTI A;  6GSV A;  5F07 A;  4CY6 A;  1V57 A;  3IPZ A;  3C7M A;  3QPM A;  4KAE A;  4PQ1 A;  1XW9 A;  3MIX A;  4OCF A;  4KX4 A;  2B6M A;  1ML6 A;  2ZNM A;  3MAK A;  5J41 A;  1SD9 A;  3APO A;  17GS A;  3ZRE A;  2FA8 A;  2WDU A;  1MEK A;  1B9X C;  5ID2 A;  1FVK A;  1EGR A;  2OBI A;  4K7O A;  2YN1 A;  1IYI A;  4I2T A;  3A2V A;  1JLV A;  5F05 A;  4AJ8 A;  1OC9 A;  3N5O A;  2VL2 C;  4G2E A;  4LA1 A;  4AJ7 A;  5IPG A;  2F3M A;  2OE1 A;  3ZLP A;  1XW5 A;  3R3E A;  3TJJ A;  2RUF A;  2LKU A;  2HRN A;  3I6A A;  2H70 A;  1RQM A;  4RI7 A;  1GSE A;  3JCM L;  4F0B A;  1GSU A;  4ZXG A;  3WYW A;  3HJP A;  5ECM B;  3GHA A;  1X0R A;  1VRS D;  2E2G A;  1EP7 A;  1BG5 A;  3ZFB A;  5EL8 A;  5IO0 A;  2VL2 A;  4ZBA A;  1EWX A;  2H66 A;  1ERW A;  3DYR A;  16GS A;  2DKI A;  3R2Q A;  2YWO A;  2RLI A;  3EYT A;  3FR9 A;  1GUM A;  1ZMA A;  2VOC A;  1BQ7 A;  1M2B A;  1ZYQ B;  2NTO A;  4GTU A;  3GUR A;  4IVF A;  4WR4 A;  2C3T A;  1Z7P A;  3KH7 A;  3GV1 A;  1YY7 A;  3LXT A;  3ZIJ A;  3HHV A;  4GF0 A;  5HR1 A;  5LCZ A;  2V6O A;  3FYG A;  1OAZ A;  1M9A A;  1U6T A;  3HJO A;  4OMV A;  4KND A;  3UBK A;  1GTA A;  1OYJ A;  3KMN A;  3BOA A;  2WCI A;  2EIR A;  2LJR A;  5B6N A;  5EVO A;  4TR1 A;  4ECI A;  4F82 A;  3Q74 A;  2X4A A;  4N30 A;  2H0G A;  3QAW A;  2IN3 A;  4N0Z A;  4OO4 A;  2VCW A;  2L5L A;  3DRN A;  1YF1 A;  2B7J A;  5CO3 A;  3IAM 2;  3GH6 A;  2YWI A;  2JSZ A;  3EIN A;  1PMT A;  5ELA A;  1A0R P;  1CQH A;  1XVW A;  5G31 A;  6GSU A;  1K3Y A;  5AN1 A;  2IWT A;  2MBT A;  2CA8 A;  3ERF A;  3TJB A;  3FKF A;  1FHE A;  3A5W A;  3F3Q A;  2HZE B;  4J56 E;  3VPQ A;  4IBP A;  3IV4 A;  2E7P A;  1PN9 A;  3O6T A;  1GWC A;  3Q18 A;  2I1U A;  2OBK A;  2VD0 A;  5ENU A;  2VCQ A;  4OFN A;  4MZC A;  3UEM A;  3F8U A;  1U87 A;  1B9Y C;  3WT2 A;  5B8A A;  18GS A;  5A4U A;  1AW9 A;  4KCE A;  1HYU A;  2D2Z A;  2J23 A;  3AY8 A;  1HNC A;  4KDY A;  2OAC A;  5C04 A;  4X1U A;  3CSI A;  8GSS A;  4DSS A;  3FEU A;  2FLS A;  3DVX A;  3ZVJ D;  4GSS A;  4XRD A;  1GUL A;  1PRX A;  2B3S A;  14GS A;  3M9J A;  1SYR A;  3MSZ A;  5CRG A;  2MMZ A;  2HXK A;  3F9U A;  1R5A A;  2TIR A;  1VF2 A;  4V1A p;  2X8G A;  4X4J A;  1QQ2 A;  2YV9 A;  2P5Q A;  3U6V A;  2RM5 A;  3I43 A;  2HNL A;  1OE8 A;  5A4W A;  3UAP A;  2CVD A;  1G6Y A;  4EVM A;  3P90 A;  4HDE A;  1TP9 A;  1TK0 B;  3OR5 A;  4A5P A;  1YDK A;  1O73 A;  2LV3 A;  4BVX B;  1K0N A;  1X9W B;  4QL7 A;  1M0U A;  3TB2 A;  4V1A g;  3IE3 A;  4MP4 A;  4XTS A;  3RHC A;  1SJI A;  1X5C A;  4O92 A;  1HD2 A;  3C1R A;  1TI3 A;  3MNG A;  1Y6E A;  5H5S A;  2CX4 A;  5JCW A;  2LST A;  4YKF A;  4EE0 A;  4TOP A;  13GS A;  2AJQ B;  3KJY A;  2DJ2 A;  2CT6 A;  2P5R A;  4XS4 A;  5B6M A;  5DAL A;  3EU3 A;  3PR8 A;  4K5S A;  2H1B A;  1OE7 A;  1YKA A;  2B1K A;  2HZF A;  4YQV A;  1B8X A;  2YZU A;  4F9Z A;  5JWQ B;  5H5Q A;  2JAC A;  3H8Q A;  4WR5 A;  3RPP A;  2YJ7 A;  3GX0 A;  3QR6 A;  1BYE A;  2GQL A;  1XBS A;  1ERV A;  4KA0 A;  3HVS A;  3LYP A;  5JWO B;  2HT9 A;  2FHE A;  4AJ6 A;  1G7O A;  1ACV A;  2FWF A;  4IN0 A;  2CZ3 A;  3TKR A;  4QL9 A;  3DKS A;  1XWK A;  3HJM A;  5IO2 A;  2CQ9 A;  2CAI A;  3O3T A;  2C8U A;  4O5U A;  4EDZ A;  4MDC A;  2K8V A;  1GH2 A;  4WBR D;  1K0A A;  4G19 A;  5B8B A;  1GSQ A;  1DSB A;  2V1M A;  1ERU A;  3LEF A;  4BVY A;  4N10 A;  1PKZ A;  1SD8 A;  10GS A;  2L59 A;  5ECH B;  2GQK A;  2IFQ A;  4NXI A;  2LUS A;  5DBQ A;  2FNO A;  2DMM A;  3QAV A;  4ACS A;  1XIY A;  3VLN A;  2OE0 A;  1ILO A;  3FK8 A;  3EPT A;  6GSW A;  3EVI A;  1E2Y A;  3VUR A;  3EE2 A;  4XCS A;  3VI5 A;  1NHO A;  5E4W A;  4XHM A;  2VL3 A;  2QKE A;  3P7X A;  1K3L A;  2DJJ A;  1WIK A;  1AQV A;  4IQ1 A;  1WRY A;  2OJL A;  3GX8 A;  1DUG A;  2G2Q A;  3KP9 A;  1XWA A;  5JCG A;  4HJM A;  3RPN A;  4Q5F A;  2FWH A;  3VI7 A;  4D73 B;  2KLX A;  2RII A;  1ZGN A;  5LNK e;  2GST A;  3HZ8 A;  5AIS A;  2VLU A;  3KZQ A;  1AAZ A;  1PKW A;  1G7E A;  4EXJ A;  2HYX A;  11GS A;  3KGK A;  3P8W A;  1O85 A;  3FR3 A;  7GSS A;  4HUA A;  2XBQ A;  3HD5 A;  2B7K A;  4MA9 A;  2B5E A;  4G0I A;  5J4U A;  1XCC A;  3D4T A;  3H1N A;  2C0G A;  4MZB A;  2H1D A;  4OFM A;  3EMX A;  2MMA A;  5G2Z A;  1UVZ A;  1A8L A;  4HQZ A;  3FY7 A;  1M2D A;  1YKC A;  4ZL9 A;  2H0I A;  2R2J A;  4GCI A;  3FW2 A;  1J0F A;  4FYU A;  4ID0 A;  5GZZ B;  1X5E A;  2CV4 A;  1ZYP A;  2F9S A;  5CAX A;  2JZT A;  2WZ9 A;  3UVT A;  4GQC A;  3F63 A;  2IPA A;  3F3R A;  3WGE A;  1GTB A;  2XBI A;  3GKM A;  5A5K A;  4MAB A;  2B5X A;  5ECR B;  3GKN A;  4EDY A;  4I5Q A;  5COH A;  4IGJ A;  2LTK A;  4KH7 A;  3GL3 A;  2GQM A;  5G1K A;  1PL2 A;  1URM A;  1LBK A;  4L0W A;  3TGZ A;  2AUV A;  3IOS A;  1ZL9 A;  1QK8 A;  2F8A A;  2ON7 A;  2FD3 A;  2V32 A;  3QOU A;  2YOI A;  5DQS A;  2IMD A;  1K0O A;  4HZ2 A;  4K0G A;  3D4M A;  5AIX A;  1A24 A;  1ZYN A;  4CY8 A;  4JED A;  3RHB A;  3DVW A;  3GTU A;  1LJR A;  3LOR A;  2L4Q A;  1V58 A;  2B5Y A;  4FYB A;  1K0B A;  4PUR A;  2H73 A;  4KDX A;  2FUG 2;  3ZFL A;  4BL7 B;  3D21 A;  3PH9 A;  2HE3 A;  4RI6 A;  2EIQ A;  1H75 A;  3H4K A;  4G0K A;  2NPB A;  1A0F A;  4HU9 A;  3APQ A;  2AAW A;  2VL9 A;  12GS A;  1YF0 A;  5CRH A;  1G6W A;  4I2U A;  5D9V A;  4LL1 B;  3C71 A;  5DQY A;  1H4O A;  3QAG A;  4OWY A;  1MDJ A;  4ILF A;  1MDI A;  4K9Z A;  1MD4 A;  1FVJ A;  3WGX A;  1FOH A;  1JHB A;  5JCU A;  3FMW A;  4OFT A;  1TRS A;  2X64 A;  3GN3 A;  3M8N A;  2IJY A;  4GSN A;  1SEN A;  1UA5 A;  2TRC P;  4ECC A;  2R0G A;  5BMU A;  22GS A;  2WB9 A;  3FR6 A;  1TJD A;  1SJZ A;  3ME8 A;  2GT5 A;  3RBT A;  4EL1 A;  2ZCT A;  5IMF A;  2GSR A;  4E8E A;  3VK9 A;  5IMV A;  4K0N A;  1SL2 B;  2WS2 A;  6GSX A;  4PGT A;  1T8E B;  2DIZ A;  5GAN D;  3F6F A;  5HFI A;  5FHI A;  3RAZ A;  2QA1 A;  5KN0 A;  1GUK A;  1F6M C;  4ISD A;  1NHY A;  2AHE A;  2QA2 A;  3W8J A;  2GVP A;  1O7U A;  5A4V A;  3WT1 A;  1T4Y A;  2XPE A;  4I97 A;  1U3I A;  3GIX A;  4K2X A;  3GUS A;  4HZ4 A;  5ABR A;  1OKD A;  4RQX A;  2XPD A;  2ES7 A;  1O81 A;  5C00 A;  1XZO A;  2CVK A;  3QD9 A;  3D6I A;  5G1L A;  2H01 A;  2GLR A;  4KB3 A;  5ECP B;  1AXD A;  3I9V 2;  2VD1 A;  3TRQ A;  3F4T A;  1PA3 A;  4LMV A;  2PUK C;  1JZO A;  2HSM A;  5L71 A;  2L5O A;  5ECO B;  1USB A;  3GL5 A;  1E6B A;  4V2L A;  2C80 A;  4BWS A;  3HY2 A;  4PQI A;  3TKP A;  1F9M A;  4HI7 A;  1B4Q A;  5HR3 A;  1KNG A;  1W4V A;  3LXZ A;  2R0P A;  4MJB A;  1RK4 A;  3NOF A;  3C1S A;  3L9V A;  1DE2 A;  5G30 A;  3APS A;  5IMZ A;  4FQU A;  3VWV A;  5KN1 A;  1GSS A;  1Z5Y E;  2VM2 A;  3UMA A;  5ECK B;  1MD3 A;  2YAN A;  1EGO A;  2I81 A;  4RQR A;  4KUN A;  4Q5N A;  2DJK A;  5F8B A;  1KTE A;  5IOX A;  2N5F A;  2K8S A;  3GRX A;  3IK9 A;  3KM6 A;  4K7I A;  1ZYE A;  3BCI A;  1EZK A;  4CW9 A;  3CBU A;  3KXO A;  4K1F A;  3TDG A;  1XWB A;  4KW6 A;  1K0C A;  1YZX A;  4XIH A;  2PU9 C;  5D8I A;  1YJ6 A;  1FW1 A;  2JU5 A;  4J57 E;  2LQQ A;  1XFL A;  1UC7 A;  1FAA A;  2H72 A;  3FZ9 A;  3GH9 A;  4FIW A;  1GSF A;  1JZW A;  4K7N A;  1ZOF A;  2NVL A;  4MH2 A;  1Z6M A;  4TRX A;  4N0V A;  3KIJ A;  4PNG A;  1GLP A;  2UZ8 A;  3I69 A;  2P31 A;  3A2W A;  4J2F A;  1OC8 A;  3TOT A;  4MPF A;  3Q6O A;  3ME7 A;  1AQX A;  2QC7 A;  3UJ1 A;  2RM6 A;  3HCZ A;  2LNS A;  4ZIJ A;  2LJK A;  1T00 A;  4FH8 A;  2F51 A;  5G5E A;  4EC0 A;  4V2M A;  2IMF A;  1TU8 A;  3EUR A;  3EWL A;  4YQU A;  2O89 A;  1Q4J A;  3L9U A;  2PER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...