4WBRD

Structure of bradyrhizobium japonicum scoi with copper bound
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
157
Chain Sequence
AIGGPFQLTDQNGKAVTDKSLKGKPTLIFFGYTHCPDVCPTSLFEISEVLRAMGKDADKVNAIFISVDPERDTPATMKNYLSSFDPHLEGLSGDPAEIAKVITSYRVYAKKVPTKDGDYTMDHTALIYLMDRDGRFVSPFNLKRTPEEAAADLKRYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blr1131 protein
publication title Structure of Bradyrhizobium japonicum ScoI with copper bound
rcsb
source organism Bradyrhizobium diazoefficiens
molecule tags Chaperone
total genus 52
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4wbrD00
2VLVA 3VWVA 1ZYQB 2B7KA 1JFUA 3IK9A 4K0GA 2H0IA 3RBTA 2VCQA 1GP1A 3LG6A 1RK4A 2DIYA 1U87A 2TRXA 1R4WA 3GH6A 4JU5A 3I9V2 1EEJA 1WIKA 5ECNB 5DDLA 3JCML 3WGXA 2GQMA 2P31A 2HFDA 2PN8A 1UN2A 2N5FA 1TU8A 3IRAA 5JCWA 2GSTA 3C8EA 5ENUA 2R6KA 1M9AA 4L5OA 4XIHA 1HNAA 1THXA 1A2JA 4GWRA 3QAVA 2P5QA 4KDUA 1PX7A 1T00A 5CP1A 2JZRA 4MJCA 1K0DA 1HQOA 4ZL9A 3F9UA 2CV4A 1YEPA 2HYXA 5EPFA 4O5RA 5D9VA 5F05A 18GSA 2J23A 2DC5A 5JWQB 4L0UA 2V1MA 3KZQA 1FVKA 3PGTA 3M9JA 1ERTA 1GSYA 4WKWA 4GXZA 1F3BA 5INYA 3TKSC 4KDYA 4GLTA 2HLSA 4GSTA 19GSA 1B48A 3HVXA 1X5CA 4DSQA 1A8LA 4E8HA 3LQ7A 4MLYA 3EVIA 5IO2A 1BX9A 3UVTA 2PVOC 3QAGA 3UJ1A 1QUWA 1WJKA 5H5QA 2H73A 2OJLA 4MP4A 2VO4A 1T1VA 4MPGA 2WZ9A 2DMMA 3FZ5A 4V2MA 6GSWA 2HNLA 2I3YA 4L5LA 2FGXA 4GSNA 2F8FA 1YJ6A 2DMLA 4IQ1A 3RHCA 3UBKA 3D0ZA 1GULA 20GSA 3TJKA 1YKAA 3DKSA 5AIXA 4GQCA 4XRDA 1SYXA 1SD9A 3QPMA 5DCHA 4IGJA 4I2UA 2DBCA 3VURA 4HZ2A 3P8WA 2IL3A 3HHVA 4F0BA 4TR0A 4I6XA 2LS5A 2GGTA 2LRTA 4JBBA 4ZILA 3IBHA 3BJ5A 3TKRA 1XWBA 2VD0A 3TKSE 5ECHB 4N30A 4YQMA 3DRNA 4NAXA 2GT5A 4OMVA 4ECCA 3KMNA 3TJGA 2YCDA 4QQ7A 4J57E 2DJ3A 1LU4A 4MZWA 2O8VB 3CYNA 3M9KA 5DAKA 4EKZA 1Z9HA 2WJUA 4LL4B 1OC9B 3GH9A 5A5KA 3EURA 2EIRA 1OYJA 5KN3A 1X9SB 2VCZA 1IYHA 3IR4A 3GMFA 1I5GA 2ZUPA 5B6NA 2L4QA 3LEFA 3DMLA 1NSWA 4KDXA 3F4RA 1TRVA 5IOWA 1CQHA 4WR4A 4GRFA 1LJRA 3MWHA 1OAZA 2MMAA 4L0WA 5G5EA 3IXRA 4TXOB 1ZYEA 1Q4JA 3CSJA 1PL2A 3FYGA 3OR5A 4ILFA 3GL5A 2RIIA 3N9JA 1GH2A 4K6XA 1G7OA 4IQAA 5CAXA 1SL1B 1YZXA 5CYYA 1FVJA 1Z7PA 5HR1A 1M99A 1SKRB 1UA5A 2H74A 4EE0A 3IV4A 1KNGA 1MTCA 2R3XA 3VWXA 1EV4A 5IPHA 3IOSA 5D73A 4PXOA 1GUKA 4XRAA 4XS1A 3PINA 3VK9A 1O8XA 3QAWA 4JR6A 3ME7A 3GHAA 3KTLA 1T8EB 1OC8A 1J08A 4KA0A 5LD0A 2HRFA 2H70A 2C0DA 2L5OA 3C71A 4N10A 3PR8A 1ERWA 1FO5A 4Z7XA 3DIEA 1X0RA 2CZ2A 1GSFA 2XPDA 5ABRA 2VD1A 3FEUA 4OFTA 3ZREA 4TXOA 1ZCPA 22GSA 4OCFA 3UL3A 2K8SA 2VLTA 2J9HA 3A2WA 1O8WA 1WP0A 2GZZA 3KP8A 4EC0A 3CSHA 1K0CA 1DUGA 3TKQA 4F0CA 1USBA 1X5EA 6GSSA 2P5RA 3KXOA 1R7HA 3GL3A 4WF5A 2VM1A 2MBSA 5IMCA 1XFLA 2FWHA 1SKSB 4IKHA 2GQKA 3W6GA 5B8BA 2VIMA 17GSA 4KE3A 2X99A 2VCTA 3UARA 3QDNA 4KSOA 4WXTA 2V41A 4KGIA 1U3IA 2JU5A 4TR4A 2GZYA 3F6DA 4MH2A 5J9CA 4IP1A 4KSMA 4K7OA 3E3EA 1THOA 1NHOA 1Z3EA 2L6CA 4OO5A 1FG4A 5CRHA 4MF6A 2CT6A 4MJBA 2WGRA 1SD8A 1U6TA 3LSZA 4HQZA 4PURA 4FYUA 4K7NA 4ACSA 5F07A 3HDCA 2R37A 1MD4A 2PPTA 4V2NA 2HT9A 4PGTA 4BA7A 1F9MA 3LORA 2YZHA 5G1LA 1G6WA 3TOTA 10GSA 5FT3A 4TR1B 2E0QA 3D22A 3F3RA 4F2IA 4HU9A 3M0FA 4EL1A 2VL3A 2H6YA 4POLA 1QMVA 4Q5NA 4Q5FA 1Y6EA 1VF1A 1SK1A 3HJMA 3KM6A 5EVOA 2CA8A 2N5AA 1PD21 1CQGA 4JRRA 3FRCA 4N0VA 1AC1A 2KP2A 2LRCA 2B6MA 4O32A 2PU9C 2PBJA 1F3AA 2HE3A 5J3RA 2GSSA 3F0IA 1NHYA 3TKSA 1TRUA 5ECMB 8GSSA 3DWVA 5B6MA 2IJYA 4IJIA 2JSYA 2YWIA 3VI7A 3W8JA 2PERA 1SL0B 2PMTA 4IN0A 4PQHA 5GZZB 4POMA 5IOXA 1ZOFA 3H4KA 2H6XA 4G10A 4TR3A 1V9WA 1MD3A 1F37A 4ML6A 5B7CA 1YEXA 5A4UA 1AUCA 1VGLA 3D21A 2LNSA 4ZIJA 2O89A 1H4OA 5H5SA 2GSRA 4RI6A 3R2QA 1GSSA 4OD7A 1DBYA 2L4CA 3FR3A 5F8BA 1VRSD 4J2FA 1TJDA 2KOKA 5ID2B 2VL2C 3GX0A 4FIWA 3WGEA 4I2TA 2O87A 3KD0A 2MMZA 2H0GA 1VF3A 2WDUA 2K6VA 2IN3A 1QXHA 4MJAA 1XW9A 3J7Yb 2BTOT 1NM3A 1SK2A 4I5QA 1BJXA 1EZKA 1XWGA 1K3YA 1EV9A 4F03A 1XWCA 5D9XA 1JLVA 4MPFA 5AISA 1GNEA 1BQ7A 2E7PA 1YQ1A 3I69A 4ECIA 1WWJA 2NVLA 3KH7A 4LA1A 3RPNA 13GSA 1FW1A 2G0FA 4HUAA 4I97A 4JR4A 3ZVJD 2IIYA 3TGZA 4ZBAA 2LTKA 4EF0A 4DEJA 3EE2A 2QKEA 3Q19A 2H19A 5G1KA 1TK5B 5EL8A 2WB9A 2R2JA 1O7UA 4AGSA 4GQFA 4N0ZA 1E6BA 1J9BA 5KN2A 1TK0B 4F82A 5GSTA 3SBCA 1GWCA 2OE0A 4OFMA 3ZRDA 2AJQB 2H71A 2XBQA 5J9BA 3S9FA 5CRDA 2H0HA 2XBIA 1F6MC 5IMZA 3SWLA 3WT2A 1GTUA 2QGVA 4LMWA 3WT1A 3APSA 4PQIA 4MH3A 3KJYA 2ON5A 2KUCA 4KH7A 4OWYA 5C00A 5FWGA 3F63A 4JEDA 4V1Ag 3QFAC 5JCUA 4FH8A 3U6VA 2DJ2A 5D9TA 1M9BA 1TP9A 1YY7A 1YF1A 3HY2A 1VF4A 1EP7A 5JCGA 1K0AA 2FUG2 3IPZA 1G7EA 4HOJA 5JWOB 1AXDA 4ECJA 2F9SA 2C0EA 4MCUA 4MZBA 1GSEA 1V2AA 2YNXA 5IMVA 1J0FA 3L4NA 2FWEA 1H75A 2IMEA 3ZYWA 1ML6A 2DJJA 4ISDA 3ZLPA 2YPMA 4AJ7A 2H1BA 2M72A 1ILOA 3ME8A 3CSIA 1GRXA 2C3TA 2JZTA 2HSYA 4XTSA 3MSZA 2I9HA 2C3QA 5C04A 2YV7A 5L71A 1EEMA 4L8EA 4JE1A 3Q18A 1PKWA 1PRXA 3J7Yk 3TB2A 3TKPA 1G6YA 4POBA 3NIVA 4LLRA 3TRQA 3LXZA 2RUFA 5D9WA 1M2DA 1EGRA 3VPQA 4GF0A 4HS1A 3LFLA 2YOIA 4PUFC 3FZ4A 5DALB 1WOUA 2E2MA 2WS2A 3LGCA 4ZXGA 4NPBA 3GUSA 2L5LA 5DVBA 3TJBA 2MMNA 2JL4A 5IMAA 3IC4A 1S3CA 1SJIA 1EGOA 3UAPA 1JZWA 4POKA 4IW9A 3HJPA 4XS4B 1WRYA 1XZOA 1T4YA 1YDKA 4TRXA 3O76A 2HZEB 4J56E 1GTAA 4Q5QA 3DVXA 1PX6A 3APQA 4EUYA 2OACA 4K2DA 2JACA 3CRTA 5HR0A 2OKAA 4WETA 2IMDA 2C0GA 1KEBA 4EVMA 1Z6NA 5LNKe 2N5BA 3P90A 4IP6A 2L6DA 1ZZYA 4IVFA 4HEA2 4XCSA 2FNOA 1FHEA 2H1DA 2YWOA 1O85A 3FHKA 2BJXA 2GT6A 3GKXA 4IS0A 2OADA 4TKYA 4ULXA 2C4JA 4IELA 3CRUA 2LJRA 2DJ0A 3O6TA 1OC9A 3L9VA 2YJHA 3HKRA 5DALA 2CQ9A 7GSSA 2TIRA 2H8LA 1XOAA 1QFNA 3H8QA 3QCPA 3IAM2 4NMUA 2A2RA 2OE1A 2C1YA 2FCHA 1V40A 4HU7A 1EOHA 4WF4A 2H1AA 3G9BA 5DJLA 4EDYA 2IWTA 1Z5YE 5J5NA 1SENA 4XS4A 5JWRB 2H30A 2HZEA 2AV4A 3GSSA 4D73B 1WE0A 5A4VA 3GIXA 3DGQA 3KTBA 1MDKA 1TK8B 3GX8A 1MDIA 5IIZA 3GSTA 4EXJA 3TRPA 4HDEA 1TI3A 1GLQA 3Q74A 2RLIA 3UIWA 2CAQA 2RM6A 3LYKA 5GAPD 2VCVA 4H86A 5HFKA 1SU9A 3F4TA 2F51A 2NPBA 3GA4A 2YWNA 3FR6A 2YP6A 2B3SA 1V58A 4Q5RA 2CVBA 3NOFA 1AQWA 3I6AA 2B7JA 2K9FA 3VI5A 4RUVA 1YF0A 1A24A 3GKNA 5D93A 2CAIA 5B8AA 2C8UA 2VL2A 1K0OA 2ALBA 4GCIA 1Z7RA 1URMA 1ERUA 1HNCA 3U5RE 4YAPA 1XW6A 3G7JA 3IAS2 1U3AA 1GTIA 3C7MA 2XC2A 2I4AA 3UBLA 2XHFA 5ELGA 2X64A 3GYKA 2FWGA 1HD2A 1KTEA 1I9DA 3BD2A 2NTOA 1LBKA 1K0MA 4MJEA 3KP9A 1O81A 2G2QA 5ECKB 14GSA 6GSTA 3CTGA 1AQXA 2LJAA 3FKFA 4EO3A 2GTUA 4HZ4A 3C1SA 2X8GA 1V98A 3RAZA 3D6IA 3ISOA 2F3MA 6GSYA 9GSSA 1JZOA 3KCMA 1GUMA 1QK8A 1PN9A 5KEJA 3QOUA 4ZB9A 3GNJA 3HD5A 1TTZA 1XIYA 2LUSA 2AHEA 3CBUA 4DSSB 1TI1A 1GUHA 2H6ZA 3FZAA 4V2LA 2LV3A 1TKDB 6GSVA 4HQSA 4MMMA 3AY8A 3ED3A 1TRWA 1HYUA 3GURA 3M3MA 3HVVA 3MDKA 3EYTA 4PX1A 2FA8A 4ML1A 3VWWA 4MK3A 4XHMA 5FHIA 5HQPA 2LRNA 4O92A 2YJ7A 3DD3A 2V32A 6GSXA 4ZL7A 2HZFA 3FZ9A 1M0UA 2PUKC 4I8BA 1VF2A 3RPPA 5AIVA 2ON7A 4TR1A 3GV1A 3UOMA 5H5RA 3QFBC 4IHUA 4RI7A 5G31A 1Q98A 2C0FA 3ZMLA 5ELAA 3VLNA 4OCEA 2YN1A 1OKTA 1PL1A 1XVWA 3C73A 2M80A 1PMTA 3A2XA 1AAZA 4KB3A 1G0TA 3APOA 5DQSA 4NHZA 2EIQA 2WFCA 1FAAA 2WULA 4RQXA 4QL7A 1SK0A 2H01A 2PGTA 4KAEA 5CRWA 4DSSA 3F6FA 4XS6A 4CDOA 2L57A 3LXTA 3TRXA 4IJ3A 3GKKA 3FW2A 4PQ1A 3D4MA 2K18A 1ST9A 5DCGA 2AYTA 2ES7A 2RUEA 5DJMA 4NXIA 5CO3A 2B5YA 2F8AA 2ZCTA 4K1FA 2FY6A 3E9JB 3LYPA 4K0NA 3EU3A 4BWSA 1PGTA 1QGVA 2VLUA 2YV9A 2B1KA 1JHBA 2IMKA 2IMIA 4YAVA 4KX4A 1RW1A 1IYIA 4BPYA 2ZNMA 1X9MB 2X8HA 2LKUA 2GS3A 1XPVA 2B5EA 3TCOA 3TJJA 5HFIA 1JLWA 5ID2A 3CMIA 3EU4A 1B9XC 4K8MA 2QC7A 1B9YC 5J41A 1U88A 1GSDA 2I81A 4V1Ap 5KN1A 4NV2A 3LWAA 3UEMA 4AJ8A 4EDZA 2LNTA 2IPAA 4FYCA 1W89A 3L9SA 2MBTA 1AIUA 1GLPA 3QMXA 1K0NA 4E8EA 1M7TA 2FA4A 3D5JA 1C72A 5G5FA 3A2VA 4BL7A 1ZL9A 2REMA 3V1WA 2LEGA 1X5DA 3L0HA 1XW5A 5A4WA 2I1UA 3KH9A 1O6JA 1JZDA 2LSTA 3HJOA 4JZQA 1OE7A 3VWUA 5D8IA 3GRXA 3ERFA 3N5OA 3ZITA 4GSSA 2HRNA 3ZTLA 3E0UA 2YZUA 1A2LA 2P0GA 16GSA 4GTUA 3ZIJA 2VCXA 1JZRA 3O3TA 2YWMA 1MDJA 2B1LA 2PWJA 4O7HA 3EMXA 1ABAA 1XCCA 5DAKB 3FY7A 3VFIA 1M2BA 3TDGA 3L9UA 1GTBA 5EY6A 1R5PA 1R5AA 1EP8A 1A0RP 3IHQA 2XPEA 1KBNA 1ACVA 4MABA 3D4TA 1B4QA 3ZL5A 1OVNA 4YQUA 2TRCP 5DBQA 3DVWA 5HFGA 4X1UA 1O73A 1TOFA 5G2ZA 2FWFA 4MF7A 1GNWA 2DSAA 2VCWA 2PVQA 1BEDA 1TDIA 1WPIA 3PH9A 3ZMKA 2DJKA 2WRTA 2AB6A 2NDOA 3BOAA 1ON4A 3WGDA 2LQQA 4X43A 4AF2A 2KHPA 3EMPA 4WBRD 4YH2A 3HXSA 1MEKA 2LQOA 1XXUA 5DQYA 3EWLA 1EOGA 4ECBA 3WYWA 1X9WB 1B4PA 4LL1B 4K7IA 3RHBA 4RQRA 5ECOB 3KGKA 4DVCA 1AW9A 2CX4A 4CW9A 2C3NA 2HSHA 4WEYA 1DSBA 4ZL8A 2V6OA 3DEXA 3K8NA 5G30A 1XVQA 2CX3A 4NWYA 5E4WA 1YKCA 1PKZA 2VUPA 1UVZA 4N11A 5IQYA 2JADA 5ECSA 4FYBA 4AJ6A 3IK7A 5ECRB 1BG5A 1F2EA 4OFNA 3HZ8A 2GSQA 3G7IA 2GQLA 3I43A 5F0GA 3EINA 1S3DA 2M46A 4P3YB 4BVXA 1WMJA 5CNWA 2KLXA 3TOUA 3BCKA 2JZSA 2KP1A 3DYRA 3FK8A 3ERWA 4PNFA 5AGYA 2VAFA 3GKMA 1BAYA 2GLRA 2NBSA 4MDCA 1A8YA 2FHEA 2A4VA 2GZPA 2VOCA 3WD6A 1PSQA 2O85A 1FB0A 5F06A 2IFQB 1ERVA 3ZFBA 3HA9A 2X8CA 1UC7A 3UMAA 3ERGA 3US3A 3H93A 4KW6A 3H79A 2EC4A 5IO0A 3ZIVA 4FO5A 4KCAA 5IPGA 3FR9A 4ID0A 3IDVA 3EC3A 2WCIA 1HNBA 1TW9A 3CTFA 2H1GA 1FOVA 2FLSA 1A0FA 5IM9A 1TRSA 1OC3A 3MNGA 4HI7A 1DE2A 1SYRA 2V2GA 1RQMA 3HYPA 1AQVA 1E2YA 1K3OA 2V6KA 3QR6A 3A5WA 4HJMA 3UVHA 3ZZXA 2HXKA 1A23A 4TOPA 3M8NA 4KUNA 2RM5A 4HJ2A 3GTUB 5HR3A 4NHWA 3G7YA 3KEBA 5GSSA 2H72A 1SJZA 2L59A 3F4SA 1W4VA 5CREA 4D73A 2GVPA 1OE8A 1GSUA 4QL9A 4WBJA 5J4UA 1ZMAA 1DE1A 2EIOA 4K9ZA 2IFQA 2VM2A 5GAND 3GN3A 2YANA 4ZB8A 4TVEA 2AAWA 4MA9A 2DIZA 3IA1A 2OBKA 2LJKA 4ZBBA 4BVYA 1K0BA 1TXXA 1QQ2A 1PQNA 2DLXA 3F8UA 4TN8A 3W8SA 4X0XA 1FB6A 3P2AA 4BWQA 2H76A 3A3TA 1B8XA 4DSRA 3LJRA 1T3BA 2CVKA 2O7KA 3DXBA 1K3LA 3F3QA 3BBYA 4IBPA 4PNGA 2GDRA 5CRGA 2MMOA 5ECLB 2H75A 1XWKA 4NV5A 3VPTA 4G19A 4MF5A 3Q6OA 3GTUA 1XWAA 5ECPB 11GSA 1SL2B 5IMDA 2C80A 1ZGNA 3M1GA 3KMOA 2OA7A 3RDWA 2HI7A 1TU7A 1Y25A 5HR2A 1N8JA 2OBIA 1GSQA 2K8VA 3H1NA 1S3AA 1N2AA 3CXGA 5KN0A 1T4ZA 3BCIA 4G2EA 3QD9A 3IE3A 1SKWB 6GSUA 1SJ6A 3ZVJA 3L78A 2R4VA 2H66A 2MYGA 5AN1A 1XBSA 2D2ZA 2Z9SA 1V57A 3GFKA 4LMVA 4WR5A 2A2SA 5D96A 2R5GA 3ZFLA 4F9ZA 1OKDA 4KNDA 3MAKA 4MZCA 4YQVA 4KCEA 5E59A 5ECIB 5ECQB 3TUEA 1PA3A 2CZ3A 3P7XA 2JSZA 12GSA 3HCZA 1NW2A 2BMXA 4ZB6A 4G9HA 2B5XA 2IMFA 2MZCA 4CHSA 1R26A 1XOBA 5LCZA 1T7PB 2QSIA 3NZNA 3HVSA 1BYEA 1GL8A 4TW5A 1Z6MA 4OO4A 4TXVA 2E2GA 3HZ4A 2FD3A 1EWXA 3C1RA 2AUVA 1A2MA 2OE3A 2VL9A 4ZBDA 4PUAA 1M2AA 2CVDA 3KIJA 5COHA 2DJ1A 5IMFA 3TJFA
chains in the Genus database with same CATH superfamily
4K2XA 2VLVA 3VWVA 1ZYQB 2B7KA 1JFUA 3IK9A 4K0GA 2H0IA 3RBTA 2VCQA 1GP1A 3LG6A 1RK4A 2DIYA 1U87A 2TRXA 1R4WA 3GH6A 4JU5A 3I9V2 1EEJA 1WIKA 5ECNB 5DDLA 3JCML 3WGXA 2GQMA 2P31A 2HFDA 2PN8A 1UN2A 2N5FA 1TU8A 3IRAA 5JCWA 2GSTA 3C8EA 5ENUA 2R6KA 1M9AA 4L5OA 4XIHA 1HNAA 3FMWA 1THXA 1A2JA 4GWRA 4USSA 3QAVA 2P5QA 4KDUA 1PX7A 1T00A 5CP1A 2JZRA 4MJCA 1K0DA 1HQOA 4ZL9A 3F9UA 2CV4A 1YEPA 2HYXA 5EPFA 4O5RA 5D9VA 5F05A 18GSA 2J23A 2DC5A 5JWQB 4L0UA 2V1MA 3KZQA 1FVKA 3PGTA 3M9JA 1ERTA 1GSYA 4WKWA 4GXZA 1F3BA 5INYA 3TKSC 4KDYA 4GLTA 2HLSA 4GSTA 19GSA 1B48A 3HVXA 1X5CA 4DSQA 1A8LA 4E8HA 3LQ7A 4MLYA 3EVIA 5IO2A 1BX9A 3UVTA 4YKFA 2PVOC 3QAGA 3UJ1A 1QUWA 1WJKA 5H5QA 2H73A 2OJLA 1M3JA 4MP4A 2VO4A 1T1VA 4MPGA 2WZ9A 2DMMA 3FZ5A 4V2MA 6GSWA 2HNLA 2I3YA 4L5LA 2FGXA 4GSNA 2F8FA 1YJ6A 2DMLA 4IQ1A 3RHCA 3UBKA 3D0ZA 1GULA 20GSA 3TJKA 1YKAA 3DKSA 5AIXA 3MYDA 4GQCA 4XRDA 1SYXA 1SD9A 3QPMA 5DCHA 4IGJA 4I2UA 2DBCA 3VURA 4HZ2A 3P8WA 2IL3A 3HHVA 4F0BA 4TR0A 4I6XA 2LS5A 2GGTA 2LRTA 4JBBA 4ZILA 3IBHA 3BJ5A 3TKRA 1XWBA 2VD0A 3TKSE 5ECHB 4N30A 4YQMA 3DRNA 4NAXA 2GT5A 4OMVA 4ECCA 3KMNA 3TJGA 2YCDA 4QQ7A 4J57E 2DJ3A 1LU4A 4MZWA 2O8VB 3CYNA 3M9KA 3IHGA 5DAKA 4EKZA 1Z9HA 2WJUA 4LL4B 1OC9B 3GH9A 5A5KA 3EURA 2EIRA 1OYJA 5KN3A 1X9SB 2VCZA 1IYHA 3IR4A 3GMFA 1I5GA 2ZUPA 5B6NA 2L4QA 3LEFA 3DMLA 1NSWA 4KDXA 3F4RA 1TRVA 5IOWA 1CQHA 4WR4A 2X4AA 4GRFA 1LJRA 3MWHA 1OAZA 2MMAA 4L0WA 5G5EA 3IXRA 4TXOB 1ZYEA 1Q4JA 3CSJA 1PL2A 3FYGA 3OR5A 4ILFA 3GL5A 4HSCX 2RIIA 3N9JA 1GH2A 4K6XA 1G7OA 4IQAA 5CAXA 1SL1B 1YZXA 5CYYA 1FVJA 1Z7PA 5HR1A 1M99A 1SKRB 1UA5A 2H74A 4EE0A 3IV4A 4Z2UA 1KNGA 1MTCA 2R3XA 3VWXA 1EV4A 5IPHA 3IOSA 5D73A 4PXOA 1GUKA 4XRAA 4XS1A 3PINA 5KOXA 3VK9A 1O8XA 3QAWA 4JR6A 3ME7A 3GHAA 3KTLA 1T8EB 1OC8A 1J08A 4KA0A 5LD0A 2HRFA 2H70A 2C0DA 2L5OA 3C71A 4N10A 3PR8A 1ERWA 1FO5A 4Z7XA 3DIEA 1X0RA 2CZ2A 1GSFA 2XPDA 5ABRA 2VD1A 3FEUA 4OFTA 3ZREA 4TXOA 1ZCPA 22GSA 4OCFA 3UL3A 2K8SA 2VLTA 2J9HA 3A2WA 1O8WA 1WP0A 2GZZA 3KP8A 4EC0A 3CSHA 1K0CA 1DUGA 3TKQA 4F0CA 1USBA 1X5EA 6GSSA 2P5RA 3KXOA 4CY8A 1R7HA 3GL3A 4WF5A 2VM1A 2MBSA 5IMCA 1XFLA 2FWHA 1SKSB 4IKHA 2GQKA 3W6GA 5B8BA 2VIMA 17GSA 4KE3A 2X99A 2VCTA 3UARA 3QDNA 4KSOA 4WXTA 2V41A 4KGIA 1U3IA 2JU5A 4TR4A 2GZYA 3F6DA 4MH2A 5J9CA 4IP1A 4KSMA 4K7OA 3E3EA 1THOA 1NHOA 1Z3EA 2L6CA 4OO5A 1FG4A 5CRHA 4MF6A 2CT6A 4MJBA 2WGRA 1SD8A 1U6TA 3LSZA 4HQZA 4A5PA 4PURA 4FYUA 4G0IA 4K7NA 4ACSA 5F07A 3HDCA 2R37A 1MD4A 2PPTA 4V2NA 2HT9A 4PGTA 4BA7A 1F9MA 3LORA 2YZHA 5G1LA 2DKIA 1G6WA 3TOTA 10GSA 5FT3A 4TR1B 2E0QA 3D22A 3F3RA 4K5RA 4F2IA 2QA2A 4HU9A 3M0FA 4EL1A 2VL3A 2H6YA 4POLA 1QMVA 4Q5NA 4Q5FA 1PN0A 1Y6EA 1VF1A 1SK1A 3HJMA 3KM6A 5EVOA 2CA8A 2N5AA 1PD21 1CQGA 4JRRA 3EPTA 3FRCA 4N0VA 1AC1A 2KP2A 2LRCA 2B6MA 4O32A 2PU9C 2PBJA 1F3AA 2HE3A 5J3RA 2GSSA 3F0IA 1NHYA 3TKSA 1TRUA 5ECMB 8GSSA 3DWVA 5B6MA 2IJYA 4IJIA 2JSYA 2YWIA 3VI7A 3W8JA 2PERA 1SL0B 2PMTA 4IN0A 4PQHA 5GZZB 4POMA 5IOXA 4KF9A 1ZOFA 1PFOA 3H4KA 2H6XA 4G10A 4TR3A 1V9WA 1MD3A 1F37A 4ML6A 5B7CA 1YEXA 5A4UA 1AUCA 1VGLA 3D21A 2LNSA 2QA1A 4ZIJA 2O89A 1H4OA 3LW9A 5H5SA 2GSRA 4RI6A 3R2QA 1GSSA 4OD7A 1DBYA 2L4CA 3FR3A 5F8BA 1VRSD 4J2FA 1TJDA 2KOKA 5ID2B 2VL2C 3GX0A 4FIWA 3WGEA 4I2TA 2O87A 3KD0A 2MMZA 2H0GA 1VF3A 2WDUA 2K6VA 2IN3A 1QXHA 4MJAA 1XW9A 3J7Yb 2BTOT 1NM3A 1SK2A 4I5QA 1BJXA 1EZKA 1XWGA 1K3YA 1EV9A 4F03A 1XWCA 5D9XA 1JLVA 4MPFA 5AISA 1GNEA 1BQ7A 2E7PA 1YQ1A 3I69A 4ECIA 1WWJA 2HSMA 2NVLA 3KH7A 4LA1A 3RPNA 13GSA 1FW1A 2G0FA 4HUAA 4I97A 4JR4A 3ZVJD 2IIYA 3TGZA 4ZBAA 2LTKA 4EF0A 4DEJA 3EE2A 2QKEA 3Q19A 2H19A 5G1KA 1TK5B 5EL8A 2WB9A 2R2JA 1O7UA 4AGSA 4GQFA 4N0ZA 1E6BA 1J9BA 5KN2A 1TK0B 4F82A 5GSTA 3SBCA 1GWCA 2OE0A 4OFMA 4O5QA 3ZRDA 2AJQB 2H71A 2XBQA 5J9BA 3S9FA 5CRDA 2H0HA 2XBIA 1F6MC 5IMZA 3SWLA 3WT2A 1GTUA 2QGVA 4LMWA 3WT1A 3APSA 4PQIA 4MH3A 3KJYA 2ON5A 2KUCA 4KH7A 4OWYA 5C00A 5FWGA 3F63A 4JEDA 4V1Ag 3QFAC 5JCUA 4FH8A 3U6VA 2DJ2A 5D9TA 1M9BA 1TP9A 1YY7A 1YF1A 3HY2A 1VF4A 1EP7A 5JCGA 1K0AA 2FUG2 3IPZA 4MNNA 1G7EA 4HOJA 5JWOB 1AXDA 4ECJA 2F9SA 2C0EA 4MCUA 4MZBA 1GSEA 1V2AA 2YNXA 5IMVA 3IC8A 1J0FA 3L4NA 2FWEA 1H75A 2IMEA 3ZYWA 1ML6A 2DJJA 4ISDA 3ZLPA 2YPMA 4AJ7A 2H1BA 2M72A 1ILOA 3ME8A 3CSIA 1GRXA 2C3TA 2JZTA 2HSYA 4XTSA 3MSZA 2I9HA 2C3QA 5C04A 2YV7A 5L71A 1EEMA 4L8EA 4JE1A 3Q18A 1PKWA 1PRXA 3J7Yk 3TB2A 3TKPA 1G6YA 4POBA 3NIVA 4LLRA 3TRQA 3LXZA 2RUFA 5D9WA 1M2DA 1EGRA 3VPQA 4GF0A 4HS1A 3LFLA 2YOIA 4PUFC 3FZ4A 5DALB 1WOUA 2E2MA 3PPUA 2WS2A 3LGCA 4ZXGA 4X4JA 4NPBA 3GUSA 2L5LA 5DVBA 3HVNA 3TJBA 2MMNA 2JL4A 5IMAA 3IC4A 1S3CA 1SJIA 1EGOA 3UAPA 1JZWA 4POKA 4IW9A 3HJPA 4XS4B 1WRYA 1XZOA 1T4YA 1YDKA 4TRXA 3O76A 2HZEB 4J56E 1GTAA 4Q5QA 3DVXA 1PX6A 3APQA 4EUYA 2OACA 4K2DA 2JACA 3CRTA 5HR0A 2OKAA 4WETA 2IMDA 2C0GA 1KEBA 4EVMA 1Z6NA 5LNKe 2N5BA 3P90A 4IP6A 2L6DA 1ZZYA 4IVFA 4HEA2 4XCSA 2FNOA 1FHEA 2H1DA 2YWOA 1O85A 3FHKA 2BJXA 2GT6A 3GKXA 4IS0A 2OADA 4TKYA 4ULXA 2C4JA 4IELA 3CRUA 2LJRA 2DJ0A 3O6TA 1OC9A 3L9VA 2YJHA 3HKRA 5DALA 2CQ9A 7GSSA 2TIRA 2H8LA 1XOAA 1QFNA 3H8QA 3QCPA 3IAM2 4NMUA 2A2RA 2OE1A 2C1YA 2FCHA 1V40A 4HU7A 1EOHA 4WF4A 2H1AA 3G9BA 2R0CA 5DJLA 4EDYA 2IWTA 1Z5YE 5J5NA 1SENA 4XS4A 5JWRB 2H30A 2HZEA 2AV4A 3GSSA 4D73B 1WE0A 5A4VA 3GIXA 3DGQA 3KTBA 1MDKA 1TK8B 3GX8A 1MDIA 3A5IA 5IIZA 3GSTA 4EXJA 3TRPA 4HDEA 1TI3A 1GLQA 3Q74A 2RLIA 3UIWA 2CAQA 2RM6A 3LYKA 5GAPD 2VCVA 4H86A 5HFKA 4G0KA 1SU9A 3F4TA 2F51A 2NPBA 3GA4A 2YWNA 3FR6A 2YP6A 2B3SA 1V58A 4Q5RA 2CVBA 3NOFA 1AQWA 3I6AA 2B7JA 2K9FA 3VI5A 4RUVA 1YF0A 1A24A 3GKNA 5D93A 2CAIA 1S3RA 5B8AA 2C8UA 2VL2A 1K0OA 2ALBA 4GCIA 1Z7RA 1URMA 1ERUA 1HNCA 3U5RE 4YAPA 1XW6A 2HRKA 3G7JA 3IAS2 1U3AA 1GTIA 3C7MA 2XC2A 2I4AA 3UBLA 2XHFA 5ELGA 2X64A 3GYKA 2FWGA 1HD2A 1KTEA 1I9DA 3BD2A 2NTOA 1LBKA 1K0MA 4MJEA 3KP9A 1O81A 2G2QA 5ECKB 14GSA 2HRAA 6GSTA 3CTGA 1AQXA 1FOHA 2LJAA 3FKFA 4EO3A 2GTUA 4HZ4A 3C1SA 2X8GA 1V98A 3RAZA 3D6IA 3ISOA 1ZYPA 2F3MA 6GSYA 9GSSA 1JZOA 3KCMA 1GUMA 1QK8A 1PN9A 5KEJA 3QOUA 4ZB9A 3GNJA 3HD5A 1TTZA 1XIYA 2LUSA 2AHEA 3CBUA 4DSSB 1TI1A 1GUHA 2H6ZA 3FZAA 4V2LA 2LV3A 1TKDB 6GSVA 4HQSA 4MMMA 3AY8A 3ED3A 1TRWA 3CQFA 1HYUA 3GURA 3M3MA 3HVVA 3MDKA 3EYTA 4PX1A 2FA8A 4ML1A 3VWWA 4MK3A 4XHMA 5FHIA 5HQPA 2LRNA 4O92A 2YJ7A 3DD3A 2V32A 6GSXA 4ZL7A 2HZFA 3FZ9A 1M0UA 2PUKC 4I8BA 1VF2A 3RPPA 5AIVA 2ON7A 4TR1A 3GV1A 3UOMA 5H5RA 3QFBC 4IHUA 4RI7A 5G31A 1Q98A 2C0FA 3ZMLA 5ELAA 3VLNA 4OCEA 2YN1A 1OKTA 1PL1A 1XG8A 1XVWA 3C73A 2M80A 1PMTA 3A2XA 4BIKA 1AAZA 4KB3A 1G0TA 3APOA 5DQSA 4NHZA 2EIQA 2WFCA 1FAAA 2WULA 4RQXA 4QL7A 1SK0A 2H01A 2PGTA 4KAEA 5CRWA 4DSSA 3F6FA 4XS6A 4CDOA 2L57A 3LXTA 3TRXA 4IJ3A 3GKKA 3FW2A 4PQ1A 5KOWA 3D4MA 2K18A 1ST9A 5DCGA 2AYTA 2ES7A 2RUEA 5DJMA 4NXIA 5CO3A 2B5YA 2F8AA 2ZCTA 4K1FA 2FY6A 3E9JB 4BL7B 3LYPA 4K0NA 3EU3A 4BWSA 1PGTA 1QGVA 2VLUA 2YV9A 2B1KA 2A2PA 1JHBA 2IMKA 2IMIA 4YAVA 4KX4A 1RW1A 1IYIA 4BPYA 2ZNMA 1X9MB 2X8HA 2LKUA 2GS3A 1XPVA 2B5EA 3TCOA 3TJJA 5HFIA 1JLWA 5ID2A 4YKGA 3CMIA 3EU4A 1B9XC 4K8MA 4CY6A 2QC7A 1B9YC 5J41A 1U88A 1GSDA 2I81A 4V1Ap 5KN1A 4NV2A 3LWAA 3UEMA 4AJ8A 4EDZA 2LNTA 2IPAA 4FYCA 1W89A 3L9SA 2UZ8A 2MBTA 1AIUA 1GLPA 3QMXA 1K0NA 4E8EA 1M7TA 2FA4A 3D5JA 1C72A 5G5FA 3A2VA 4BL7A 1ZL9A 2REMA 3V1WA 2LEGA 1X5DA 3L0HA 1XW5A 5A4WA 2I1UA 3KH9A 1O6JA 1JZDA 2LSTA 3HJOA 4JZQA 1OE7A 3VWUA 5D8IA 3GRXA 3ERFA 3N5OA 4PTSA 3ZITA 4GSSA 2HRNA 3ZTLA 4K5SA 3E0UA 2YZUA 1A2LA 2P0GA 3MIXA 5BMUA 16GSA 4GTUA 3ZIJA 2VCXA 1JZRA 3O3TA 2YWMA 1MDJA 2B1LA 2PWJA 4O7HA 3EMXA 1ABAA 1XCCA 5DAKB 3FY7A 3VFIA 1M2BA 3TDGA 3L9UA 1GTBA 5EY6A 1R5PA 1R5AA 1EP8A 2R0PA 1A0RP 3IHQA 4G0LA 2XPEA 1KBNA 1ACVA 4MABA 3D4TA 1B4QA 3ZL5A 1OVNA 4YQUA 2TRCP 5DBQA 3DVWA 5HFGA 4X1UA 1O73A 1TOFA 5G2ZA 1M3IA 2FWFA 4MF7A 1GNWA 2DSAA 2VCWA 2PVQA 1BEDA 1TDIA 1WPIA 4Z2RA 3PH9A 3ZMKA 2DJKA 2WRTA 2AB6A 2NDOA 3BOAA 1ON4A 3WGDA 2LQQA 4BVXB 4X43A 4AF2A 2KHPA 3EMPA 4WBRD 4YH2A 3HXSA 1MEKA 2LQOA 4EIQA 1XXUA 5DQYA 3EWLA 1EOGA 4ECBA 3WYWA 1X9WB 1B4PA 4LL1B 4K7IA 3RHBA 4RQRA 5ECOB 3KGKA 4DVCA 1AW9A 2CX4A 4CW9A 2C3NA 2HSHA 4WEYA 1DSBA 4ZL8A 2V6OA 3DEXA 3K8NA 5G30A 1XVQA 2CX3A 4NWYA 5E4WA 1YKCA 1PKZA 2VUPA 1UVZA 4N11A 5IQYA 2JADA 5ECSA 4FYBA 4AJ6A 3IK7A 5ECRB 1BG5A 3R3EA 1F2EA 2A4HA 4OFNA 3HZ8A 2GSQA 3G7IA 2GQLA 3I43A 5F0GA 3EINA 1S3DA 2M46A 4P3YB 4BVXA 1WMJA 5CNWA 2KLXA 3TOUA 3BCKA 2JZSA 2KP1A 3DYRA 3FK8A 3ERWA 4PNFA 5AGYA 2VAFA 3GKMA 1BAYA 2GLRA 2NBSA 4MDCA 1A8YA 2FHEA 2A4VA 2GZPA 2VOCA 3WD6A 1PSQA 2O85A 1FB0A 5F06A 2IFQB 1ERVA 3ZFBA 3HA9A 2X8CA 1UC7A 3UMAA 3ERGA 3US3A 3H93A 4KW6A 4BVYB 1ZYNA 3H79A 2EC4A 5IO0A 3ZIVA 4FO5A 4KCAA 2DKHA 5IPGA 3FR9A 4ID0A 3IDVA 3EC3A 2WCIA 1HNBA 1TW9A 3CTFA 2H1GA 1FOVA 2FLSA 1A0FA 5IM9A 1TRSA 1OC3A 3MNGA 4HI7A 1DE2A 1SYRA 2V2GA 1RQMA 3HYPA 1AQVA 1E2YA 1K3OA 2V6KA 3QR6A 3A5WA 4HJMA 3UVHA 3ZZXA 2HXKA 1A23A 4TOPA 2R0GA 3M8NA 4KUNA 2RM5A 4HJ2A 3GTUB 5HR3A 4NHWA 3G7YA 3KEBA 5GSSA 2H72A 1SJZA 2L59A 3F4SA 1W4VA 5CREA 4D73A 2GVPA 1OE8A 1GSUA 4QL9A 4WBJA 5J4UA 1ZMAA 1DE1A 2EIOA 4K9ZA 2IFQA 2VM2A 5GAND 3GN3A 2YANA 4ZB8A 4TVEA 2AAWA 4MA9A 2DIZA 3IA1A 2OBKA 2LJKA 4ZBBA 4BVYA 1K0BA 1TXXA 1QQ2A 1PQNA 4O5UA 2DLXA 3F8UA 4TN8A 3W8SA 4X0XA 1FB6A 3P2AA 4EIPA 4BWQA 2H76A 3A3TA 1B8XA 4DSRA 3LJRA 1T3BA 2CVKA 2O7KA 3DXBA 1K3LA 3F3QA 3BBYA 4IBPA 4PNGA 2GDRA 5CRGA 2MMOA 5ECLB 2H75A 1XWKA 4NV5A 3VPTA 4G19A 2X49A 4MF5A 5BRTA 3Q6OA 3GTUA 1XWAA 5ECPB 11GSA 1SL2B 5IMDA 2C80A 1ZGNA 3M1GA 3KMOA 2OA7A 3RDWA 2HI7A 1TU7A 1Y25A 5HR2A 1N8JA 4FQUA 2OBIA 1GSQA 2K8VA 3H1NA 1S3AA 1N2AA 3CXGA 5KN0A 1T4ZA 3BCIA 4G2EA 3QD9A 3IE3A 1SKWB 6GSUA 1SJ6A 3ZVJA 3L78A 2R4VA 2H66A 2MYGA 5AN1A 1XBSA 2D2ZA 2Z9SA 1V57A 3GFKA 4LMVA 4WR5A 2A2SA 5D96A 2R5GA 3ZFLA 4F9ZA 1OKDA 4KNDA 3MAKA 4MZCA 4YQVA 4KCEA 5E59A 5ECIB 5ECQB 3TUEA 1PA3A 2CZ3A 3P7XA 2JSZA 12GSA 3HCZA 1NW2A 2BMXA 4ZB6A 4G9HA 2B5XA 2IMFA 2MZCA 4CHSA 1R26A 1XOBA 5LCZA 1T7PB 2QSIA 3NZNA 3HVSA 1BYEA 1GL8A 4TW5A 1Z6MA 4ICYA 4OO4A 4TXVA 2E2GA 3HZ4A 2FD3A 1EWXA 4Z2TA 3C1RA 2AUVA 1A2MA 2OE3A 2VL9A 4ZBDA 4PUAA 1M2AA 2CVDA 3KIJA 5COHA 2DJ1A 5IMFA 3TJFA
chains in the Genus database with same CATH topology
4K2XA 2VLVA 3VWVA 1ZYQB 2B7KA 1JFUA 3IK9A 4K0GA 2H0IA 3RBTA 2VCQA 1GP1A 3LG6A 1RK4A 2DIYA 1U87A 2TRXA 1R4WA 3GH6A 4JU5A 3I9V2 1EEJA 1WIKA 5ECNB 5DDLA 3JCML 3WGXA 2GQMA 2P31A 2HFDA 2PN8A 1UN2A 2N5FA 1TU8A 3IRAA 5JCWA 2GSTA 3C8EA 5ENUA 2R6KA 1M9AA 4L5OA 4XIHA 1HNAA 3FMWA 1THXA 1A2JA 4GWRA 4USSA 3QAVA 2P5QA 4KDUA 1PX7A 1T00A 5CP1A 2JZRA 4MJCA 1K0DA 1HQOA 4ZL9A 3F9UA 2CV4A 1YEPA 2HYXA 5EPFA 4O5RA 5D9VA 5F05A 18GSA 2J23A 2DC5A 5JWQB 4L0UA 2V1MA 3KZQA 1FVKA 3PGTA 3M9JA 1ERTA 1GSYA 4WKWA 4GXZA 1F3BA 5INYA 3TKSC 4KDYA 4GLTA 2HLSA 4GSTA 19GSA 1B48A 3HVXA 1X5CA 4DSQA 1A8LA 4E8HA 3LQ7A 4MLYA 3EVIA 5IO2A 1BX9A 3UVTA 4YKFA 2PVOC 3QAGA 3UJ1A 1QUWA 1WJKA 5H5QA 2H73A 2OJLA 4MP4A 2VO4A 1T1VA 4MPGA 2WZ9A 2DMMA 3FZ5A 4V2MA 6GSWA 2HNLA 2I3YA 4L5LA 2FGXA 4GSNA 2F8FA 1YJ6A 2DMLA 4IQ1A 3RHCA 3UBKA 3D0ZA 1GULA 20GSA 3TJKA 1YKAA 3DKSA 5AIXA 3MYDA 4GQCA 4XRDA 1SYXA 1SD9A 3QPMA 5DCHA 4IGJA 4I2UA 2DBCA 3VURA 4HZ2A 3P8WA 2IL3A 3HHVA 4F0BA 4TR0A 4I6XA 2LS5A 2GGTA 2LRTA 4JBBA 4ZILA 3IBHA 3BJ5A 3TKRA 1XWBA 2VD0A 3TKSE 5ECHB 4N30A 4YQMA 3DRNA 4NAXA 2GT5A 4OMVA 4ECCA 3KMNA 3TJGA 2YCDA 4QQ7A 4J57E 2DJ3A 1LU4A 4MZWA 2O8VB 3CYNA 3M9KA 3IHGA 5DAKA 4EKZA 1Z9HA 2WJUA 4LL4B 1OC9B 3GH9A 5A5KA 3EURA 2EIRA 1OYJA 5KN3A 1X9SB 2VCZA 1IYHA 3IR4A 3GMFA 1I5GA 2ZUPA 5B6NA 2L4QA 3LEFA 3DMLA 1NSWA 4KDXA 3F4RA 1TRVA 5IOWA 1CQHA 4WR4A 2X4AA 4GRFA 1LJRA 3MWHA 1OAZA 2MMAA 4L0WA 5G5EA 3IXRA 4TXOB 1ZYEA 1Q4JA 3CSJA 1PL2A 3FYGA 3OR5A 4ILFA 3GL5A 2RIIA 3N9JA 1GH2A 4K6XA 1G7OA 4IQAA 5CAXA 1SL1B 1YZXA 5CYYA 1FVJA 1Z7PA 5HR1A 1M99A 1SKRB 1UA5A 2H74A 4EE0A 3IV4A 4Z2UA 1KNGA 1MTCA 2R3XA 3VWXA 1EV4A 5IPHA 3IOSA 5D73A 4PXOA 1GUKA 4XRAA 4XS1A 3PINA 5KOXA 3VK9A 1O8XA 3QAWA 4JR6A 3ME7A 3GHAA 3KTLA 1T8EB 1OC8A 1J08A 4KA0A 5LD0A 2HRFA 2H70A 2C0DA 2L5OA 3C71A 4N10A 3PR8A 1ERWA 1FO5A 4Z7XA 3DIEA 1X0RA 2CZ2A 1GSFA 2XPDA 5ABRA 2VD1A 3FEUA 4OFTA 3ZREA 4TXOA 1ZCPA 22GSA 4OCFA 3UL3A 2K8SA 2VLTA 2J9HA 3A2WA 1O8WA 1WP0A 2GZZA 3KP8A 4EC0A 3CSHA 1K0CA 1DUGA 3TKQA 4F0CA 1USBA 1X5EA 6GSSA 2P5RA 3KXOA 4CY8A 1R7HA 3GL3A 4WF5A 2VM1A 2MBSA 5IMCA 1XFLA 2FWHA 1SKSB 4IKHA 2GQKA 3W6GA 5B8BA 2VIMA 17GSA 4KE3A 2X99A 2VCTA 3UARA 3QDNA 4KSOA 4WXTA 2V41A 4KGIA 1U3IA 2JU5A 4TR4A 2GZYA 3F6DA 4MH2A 5J9CA 4IP1A 4KSMA 4K7OA 3E3EA 1THOA 1NHOA 1Z3EA 2L6CA 4OO5A 1FG4A 5CRHA 4MF6A 2CT6A 4MJBA 2WGRA 1SD8A 1U6TA 3LSZA 4HQZA 4A5PA 4PURA 4FYUA 4G0IA 4K7NA 4ACSA 5F07A 3HDCA 2R37A 1MD4A 2PPTA 4V2NA 2HT9A 4PGTA 4BA7A 1F9MA 3LORA 2YZHA 5G1LA 2DKIA 1G6WA 3TOTA 10GSA 5FT3A 4TR1B 2E0QA 3D22A 3F3RA 4K5RA 4F2IA 2QA2A 4HU9A 3M0FA 4EL1A 2VL3A 2H6YA 4POLA 1QMVA 4Q5NA 4Q5FA 1PN0A 1Y6EA 1VF1A 1SK1A 3HJMA 3KM6A 5EVOA 2CA8A 2N5AA 1PD21 1CQGA 4JRRA 3EPTA 3FRCA 4N0VA 1AC1A 2KP2A 2LRCA 2B6MA 4O32A 2PU9C 2PBJA 1F3AA 2HE3A 5J3RA 2GSSA 3F0IA 1NHYA 3TKSA 1TRUA 5ECMB 8GSSA 3DWVA 5B6MA 2IJYA 4IJIA 2JSYA 2YWIA 3VI7A 3W8JA 2PERA 1SL0B 2PMTA 4IN0A 4PQHA 5GZZB 4POMA 5IOXA 4KF9A 1ZOFA 3H4KA 2H6XA 4G10A 4TR3A 1V9WA 1MD3A 1F37A 4ML6A 5B7CA 1YEXA 5A4UA 1AUCA 1VGLA 3D21A 2LNSA 2QA1A 4ZIJA 2O89A 1H4OA 3LW9A 5H5SA 2GSRA 4RI6A 3R2QA 1GSSA 4OD7A 1DBYA 2L4CA 3FR3A 5F8BA 1VRSD 4J2FA 1TJDA 2KOKA 5ID2B 2VL2C 3GX0A 4FIWA 3WGEA 4I2TA 2O87A 3KD0A 2MMZA 2H0GA 1VF3A 2WDUA 2K6VA 2IN3A 1QXHA 4MJAA 1XW9A 3J7Yb 2BTOT 1NM3A 1SK2A 4I5QA 1BJXA 1EZKA 1XWGA 1K3YA 1EV9A 4F03A 1XWCA 5D9XA 1JLVA 4MPFA 5AISA 1GNEA 1BQ7A 2E7PA 1YQ1A 3I69A 4ECIA 1WWJA 2HSMA 2NVLA 3KH7A 4LA1A 3RPNA 13GSA 1FW1A 2G0FA 4HUAA 4I97A 4JR4A 3ZVJD 2IIYA 3TGZA 4ZBAA 2LTKA 4EF0A 4DEJA 3EE2A 2QKEA 3Q19A 2H19A 5G1KA 1TK5B 5EL8A 2WB9A 2R2JA 1O7UA 4AGSA 4GQFA 4N0ZA 1E6BA 1J9BA 5KN2A 1TK0B 4F82A 5GSTA 3SBCA 1GWCA 2OE0A 4OFMA 4O5QA 3ZRDA 2AJQB 2H71A 2XBQA 5J9BA 3S9FA 5CRDA 2H0HA 2XBIA 1F6MC 5IMZA 3SWLA 3WT2A 1GTUA 2QGVA 4LMWA 3WT1A 3APSA 4PQIA 4MH3A 3KJYA 2ON5A 2KUCA 4KH7A 4OWYA 5C00A 5FWGA 3F63A 4JEDA 4V1Ag 3QFAC 5JCUA 4FH8A 3U6VA 2DJ2A 5D9TA 1M9BA 1TP9A 1YY7A 1YF1A 3HY2A 1VF4A 1EP7A 5JCGA 1K0AA 2FUG2 3IPZA 4MNNA 1G7EA 4HOJA 5JWOB 1AXDA 4ECJA 2F9SA 2C0EA 4MCUA 4MZBA 1GSEA 1V2AA 2YNXA 5IMVA 3IC8A 1J0FA 3L4NA 2FWEA 1H75A 2IMEA 3ZYWA 1ML6A 2DJJA 4ISDA 3ZLPA 2YPMA 4AJ7A 2H1BA 2M72A 1ILOA 3ME8A 3CSIA 1GRXA 2C3TA 2JZTA 2HSYA 4XTSA 3MSZA 2I9HA 2C3QA 5C04A 2YV7A 5L71A 1EEMA 4L8EA 4JE1A 3Q18A 1PKWA 1PRXA 3J7Yk 3TB2A 3TKPA 1G6YA 4POBA 3NIVA 4LLRA 3TRQA 3LXZA 2RUFA 5D9WA 1M2DA 1EGRA 3VPQA 4GF0A 4HS1A 3LFLA 2YOIA 4PUFC 3FZ4A 5DALB 1WOUA 2E2MA 3PPUA 2WS2A 3LGCA 4ZXGA 4X4JA 4NPBA 3GUSA 2L5LA 5DVBA 3TJBA 2MMNA 2JL4A 5IMAA 3IC4A 1S3CA 1SJIA 1EGOA 3UAPA 1JZWA 4POKA 4IW9A 3HJPA 4XS4B 1WRYA 1XZOA 1T4YA 1YDKA 4TRXA 3O76A 2HZEB 4J56E 1GTAA 4Q5QA 3DVXA 1PX6A 3APQA 4EUYA 2OACA 4K2DA 2JACA 3CRTA 5HR0A 2OKAA 4WETA 2IMDA 2C0GA 1KEBA 4EVMA 1Z6NA 5LNKe 2N5BA 3P90A 4IP6A 2L6DA 1ZZYA 4IVFA 4HEA2 4XCSA 2FNOA 1FHEA 2H1DA 2YWOA 1O85A 3FHKA 2BJXA 2GT6A 3GKXA 4IS0A 2OADA 4TKYA 4ULXA 2C4JA 4IELA 3CRUA 2LJRA 2DJ0A 3O6TA 1OC9A 3L9VA 2YJHA 3HKRA 5DALA 2CQ9A 7GSSA 2TIRA 2H8LA 1XOAA 1QFNA 3H8QA 3QCPA 3IAM2 4NMUA 2A2RA 2OE1A 2C1YA 2FCHA 1V40A 4HU7A 1EOHA 4WF4A 2H1AA 3G9BA 2R0CA 5DJLA 4EDYA 2IWTA 1Z5YE 5J5NA 1SENA 4XS4A 5JWRB 2H30A 2HZEA 2AV4A 3GSSA 4D73B 1WE0A 5A4VA 3GIXA 3DGQA 3KTBA 1MDKA 1TK8B 3GX8A 1MDIA 3A5IA 5IIZA 3GSTA 4EXJA 3TRPA 4HDEA 1TI3A 1GLQA 3Q74A 2RLIA 3UIWA 2CAQA 2RM6A 3LYKA 5GAPD 2VCVA 4H86A 5HFKA 4G0KA 1SU9A 3F4TA 2F51A 2NPBA 3GA4A 2YWNA 3FR6A 2YP6A 2B3SA 1V58A 4Q5RA 2CVBA 3NOFA 1AQWA 3I6AA 2B7JA 2K9FA 3VI5A 4RUVA 1YF0A 1A24A 3GKNA 5D93A 2CAIA 5B8AA 2C8UA 2VL2A 1K0OA 2ALBA 4GCIA 1Z7RA 1URMA 1ERUA 1HNCA 3U5RE 4YAPA 1XW6A 2HRKA 3G7JA 3IAS2 1U3AA 1GTIA 3C7MA 2XC2A 2I4AA 3UBLA 2XHFA 5ELGA 2X64A 3GYKA 2FWGA 1HD2A 1KTEA 1I9DA 3BD2A 2NTOA 1LBKA 1K0MA 4MJEA 3KP9A 1O81A 2G2QA 5ECKB 14GSA 2HRAA 6GSTA 3CTGA 1AQXA 1FOHA 2LJAA 3FKFA 4EO3A 2GTUA 4HZ4A 3C1SA 2X8GA 1V98A 3RAZA 3D6IA 3ISOA 1ZYPA 2F3MA 6GSYA 9GSSA 1JZOA 3KCMA 1GUMA 1QK8A 1PN9A 5KEJA 3QOUA 4ZB9A 3GNJA 3HD5A 1TTZA 1XIYA 2LUSA 2AHEA 3CBUA 4DSSB 1TI1A 1GUHA 2H6ZA 3FZAA 4V2LA 2LV3A 1TKDB 6GSVA 4HQSA 4MMMA 3AY8A 3ED3A 1TRWA 1HYUA 3GURA 3M3MA 3HVVA 3MDKA 3EYTA 4PX1A 2FA8A 4ML1A 3VWWA 4MK3A 4XHMA 5FHIA 5HQPA 2LRNA 4O92A 2YJ7A 3DD3A 2V32A 6GSXA 4ZL7A 2HZFA 3FZ9A 1M0UA 2PUKC 4I8BA 1VF2A 3RPPA 5AIVA 2ON7A 4TR1A 3GV1A 3UOMA 5H5RA 3QFBC 4IHUA 4RI7A 5G31A 1Q98A 2C0FA 3ZMLA 5ELAA 3VLNA 4OCEA 2YN1A 1OKTA 1PL1A 1XVWA 3C73A 2M80A 1PMTA 3A2XA 1AAZA 4KB3A 1G0TA 3APOA 5DQSA 4NHZA 2EIQA 2WFCA 1FAAA 2WULA 4RQXA 4QL7A 1SK0A 2H01A 2PGTA 4KAEA 5CRWA 4DSSA 3F6FA 4XS6A 4CDOA 2L57A 3LXTA 3TRXA 4IJ3A 3GKKA 3FW2A 4PQ1A 5KOWA 3D4MA 2K18A 1ST9A 5DCGA 2AYTA 2ES7A 2RUEA 5DJMA 4NXIA 5CO3A 2B5YA 2F8AA 2ZCTA 4K1FA 2FY6A 3E9JB 4BL7B 3LYPA 4K0NA 3EU3A 4BWSA 1PGTA 1QGVA 2VLUA 2YV9A 2B1KA 2A2PA 1JHBA 2IMKA 2IMIA 4YAVA 4KX4A 1RW1A 1IYIA 4BPYA 2ZNMA 1X9MB 2X8HA 2LKUA 2GS3A 1XPVA 2B5EA 3TCOA 3TJJA 5HFIA 1JLWA 5ID2A 4YKGA 3CMIA 3EU4A 1B9XC 4K8MA 4CY6A 2QC7A 1B9YC 5J41A 1U88A 1GSDA 2I81A 4V1Ap 5KN1A 4NV2A 3LWAA 3UEMA 4AJ8A 4EDZA 2LNTA 2IPAA 4FYCA 1W89A 3L9SA 2UZ8A 2MBTA 1AIUA 1GLPA 3QMXA 1K0NA 4E8EA 1M7TA 2FA4A 3D5JA 1C72A 5G5FA 3A2VA 4BL7A 1ZL9A 2REMA 3V1WA 2LEGA 1X5DA 3L0HA 1XW5A 5A4WA 2I1UA 3KH9A 1O6JA 1JZDA 2LSTA 3HJOA 4JZQA 1OE7A 3VWUA 5D8IA 3GRXA 3ERFA 3N5OA 4PTSA 3ZITA 4GSSA 2HRNA 3ZTLA 4K5SA 3E0UA 2YZUA 1A2LA 2P0GA 3MIXA 5BMUA 16GSA 4GTUA 3ZIJA 2VCXA 1JZRA 3O3TA 2YWMA 1MDJA 2B1LA 2PWJA 4O7HA 3EMXA 1ABAA 1XCCA 5DAKB 3FY7A 3VFIA 1M2BA 3TDGA 3L9UA 1GTBA 5EY6A 1R5PA 1R5AA 1EP8A 2R0PA 1A0RP 3IHQA 4G0LA 2XPEA 1KBNA 1ACVA 4MABA 3D4TA 1B4QA 3ZL5A 1OVNA 4YQUA 2TRCP 5DBQA 3DVWA 5HFGA 4X1UA 1O73A 1TOFA 5G2ZA 2FWFA 4MF7A 1GNWA 2DSAA 2VCWA 2PVQA 1BEDA 1TDIA 1WPIA 4Z2RA 3PH9A 3ZMKA 2DJKA 2WRTA 2AB6A 2NDOA 3BOAA 1ON4A 3WGDA 2LQQA 4BVXB 4X43A 4AF2A 2KHPA 3EMPA 4WBRD 4YH2A 3HXSA 1MEKA 2LQOA 4EIQA 1XXUA 5DQYA 3EWLA 1EOGA 4ECBA 3WYWA 1X9WB 1B4PA 4LL1B 4K7IA 3RHBA 4RQRA 5ECOB 3KGKA 4DVCA 1AW9A 2CX4A 4CW9A 2C3NA 2HSHA 4WEYA 1DSBA 4ZL8A 2V6OA 3DEXA 3K8NA 5G30A 1XVQA 2CX3A 4NWYA 5E4WA 1YKCA 1PKZA 2VUPA 1UVZA 4N11A 5IQYA 2JADA 5ECSA 4FYBA 4AJ6A 3IK7A 5ECRB 1BG5A 3R3EA 1F2EA 2A4HA 4OFNA 3HZ8A 2GSQA 3G7IA 2GQLA 3I43A 5F0GA 3EINA 1S3DA 2M46A 4P3YB 4BVXA 1WMJA 5CNWA 2KLXA 3TOUA 3BCKA 2JZSA 2KP1A 3DYRA 3FK8A 3ERWA 4PNFA 5AGYA 2VAFA 3GKMA 1BAYA 2GLRA 2NBSA 4MDCA 1A8YA 2FHEA 2A4VA 2GZPA 2VOCA 3WD6A 1PSQA 2O85A 1FB0A 5F06A 2IFQB 1ERVA 3ZFBA 3HA9A 2X8CA 1UC7A 3UMAA 3ERGA 3US3A 3H93A 4KW6A 4BVYB 1ZYNA 3H79A 2EC4A 5IO0A 3ZIVA 4FO5A 2DKHA 4KCAA 5IPGA 3FR9A 4ID0A 3IDVA 3EC3A 2WCIA 1HNBA 1TW9A 3CTFA 2H1GA 1FOVA 2FLSA 1A0FA 5IM9A 1TRSA 1OC3A 3MNGA 4HI7A 1DE2A 1SYRA 2V2GA 1RQMA 3HYPA 1AQVA 1E2YA 1K3OA 2V6KA 3QR6A 3A5WA 4HJMA 3UVHA 3ZZXA 2HXKA 1A23A 4TOPA 2R0GA 3M8NA 4KUNA 2RM5A 4HJ2A 3GTUB 5HR3A 4NHWA 3G7YA 3KEBA 5GSSA 2H72A 1SJZA 2L59A 3F4SA 1W4VA 5CREA 4D73A 2GVPA 1OE8A 1GSUA 4QL9A 4WBJA 5J4UA 1ZMAA 1DE1A 2EIOA 4K9ZA 2IFQA 2VM2A 5GAND 3GN3A 2YANA 4ZB8A 4TVEA 2AAWA 4MA9A 2DIZA 3IA1A 2OBKA 2LJKA 4ZBBA 4BVYA 1K0BA 1TXXA 1QQ2A 1PQNA 4O5UA 2DLXA 3F8UA 4TN8A 3W8SA 4X0XA 1FB6A 3P2AA 4EIPA 4BWQA 2H76A 3A3TA 1B8XA 4DSRA 3LJRA 1T3BA 2CVKA 2O7KA 3DXBA 1K3LA 3F3QA 3BBYA 4IBPA 4PNGA 2GDRA 5CRGA 2MMOA 5ECLB 2H75A 1XWKA 4NV5A 3VPTA 4G19A 2X49A 4MF5A 5BRTA 3Q6OA 3GTUA 1XWAA 5ECPB 11GSA 1SL2B 5IMDA 2C80A 1ZGNA 3M1GA 3KMOA 2OA7A 3RDWA 2HI7A 1TU7A 1Y25A 5HR2A 1N8JA 4FQUA 2OBIA 1GSQA 2K8VA 3H1NA 1S3AA 1N2AA 3CXGA 5KN0A 1T4ZA 3BCIA 4G2EA 3QD9A 3IE3A 1SKWB 6GSUA 1SJ6A 3ZVJA 3L78A 2R4VA 2H66A 2MYGA 5AN1A 1XBSA 2D2ZA 2Z9SA 1V57A 3GFKA 4LMVA 4WR5A 2A2SA 5D96A 2R5GA 3ZFLA 4F9ZA 1OKDA 4KNDA 3MAKA 4MZCA 4YQVA 4KCEA 5E59A 5ECIB 5ECQB 3TUEA 1PA3A 2CZ3A 3P7XA 2JSZA 12GSA 3HCZA 1NW2A 2BMXA 4ZB6A 4G9HA 2B5XA 2IMFA 2MZCA 4CHSA 1R26A 1XOBA 5LCZA 1T7PB 2QSIA 3NZNA 3HVSA 1BYEA 1GL8A 4TW5A 1Z6MA 4ICYA 4OO4A 4TXVA 2E2GA 3HZ4A 2FD3A 1EWXA 4Z2TA 3C1RA 2AUVA 1A2MA 2OE3A 2VL9A 4ZBDA 4PUAA 1M2AA 2CVDA 3KIJA 5COHA 2DJ1A 5IMFA 3TJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLV A;  3VWV A;  1ZYQ B;  2B7K A;  1JFU A;  3IK9 A;  4K0G A;  2H0I A;  3RBT A;  2VCQ A;  1GP1 A;  3LG6 A;  1RK4 A;  2DIY A;  1U87 A;  2TRX A;  1R4W A;  3GH6 A;  4JU5 A;  3I9V 2;  1EEJ A;  1WIK A;  5ECN B;  5DDL A;  3JCM L;  3WGX A;  2GQM A;  2P31 A;  2HFD A;  2PN8 A;  1UN2 A;  2N5F A;  1TU8 A;  3IRA A;  5JCW A;  2GST A;  3C8E A;  5ENU A;  2R6K A;  1M9A A;  4L5O A;  4XIH A;  1HNA A;  1THX A;  1A2J A;  4GWR A;  3QAV A;  2P5Q A;  4KDU A;  1PX7 A;  1T00 A;  5CP1 A;  2JZR A;  4MJC A;  1K0D A;  1HQO A;  4ZL9 A;  3F9U A;  2CV4 A;  1YEP A;  2HYX A;  5EPF A;  4O5R A;  5D9V A;  5F05 A;  18GS A;  2J23 A;  2DC5 A;  5JWQ B;  4L0U A;  2V1M A;  3KZQ A;  1FVK A;  3PGT A;  3M9J A;  1ERT A;  1GSY A;  4WKW A;  4GXZ A;  1F3B A;  5INY A;  3TKS C;  4KDY A;  4GLT A;  2HLS A;  4GST A;  19GS A;  1B48 A;  3HVX A;  1X5C A;  4DSQ A;  1A8L A;  4E8H A;  3LQ7 A;  4MLY A;  3EVI A;  5IO2 A;  1BX9 A;  3UVT A;  2PVO C;  3QAG A;  3UJ1 A;  1QUW A;  1WJK A;  5H5Q A;  2H73 A;  2OJL A;  4MP4 A;  2VO4 A;  1T1V A;  4MPG A;  2WZ9 A;  2DMM A;  3FZ5 A;  4V2M A;  6GSW A;  2HNL A;  2I3Y A;  4L5L A;  2FGX A;  4GSN A;  2F8F A;  1YJ6 A;  2DML A;  4IQ1 A;  3RHC A;  3UBK A;  3D0Z A;  1GUL A;  20GS A;  3TJK A;  1YKA A;  3DKS A;  5AIX A;  4GQC A;  4XRD A;  1SYX A;  1SD9 A;  3QPM A;  5DCH A;  4IGJ A;  4I2U A;  2DBC A;  3VUR A;  4HZ2 A;  3P8W A;  2IL3 A;  3HHV A;  4F0B A;  4TR0 A;  4I6X A;  2LS5 A;  2GGT A;  2LRT A;  4JBB A;  4ZIL A;  3IBH A;  3BJ5 A;  3TKR A;  1XWB A;  2VD0 A;  3TKS E;  5ECH B;  4N30 A;  4YQM A;  3DRN A;  4NAX A;  2GT5 A;  4OMV A;  4ECC A;  3KMN A;  3TJG A;  2YCD A;  4QQ7 A;  4J57 E;  2DJ3 A;  1LU4 A;  4MZW A;  2O8V B;  3CYN A;  3M9K A;  5DAK A;  4EKZ A;  1Z9H A;  2WJU A;  4LL4 B;  1OC9 B;  3GH9 A;  5A5K A;  3EUR A;  2EIR A;  1OYJ A;  5KN3 A;  1X9S B;  2VCZ A;  1IYH A;  3IR4 A;  3GMF A;  1I5G A;  2ZUP A;  5B6N A;  2L4Q A;  3LEF A;  3DML A;  1NSW A;  4KDX A;  3F4R A;  1TRV A;  5IOW A;  1CQH A;  4WR4 A;  4GRF A;  1LJR A;  3MWH A;  1OAZ A;  2MMA A;  4L0W A;  5G5E A;  3IXR A;  4TXO B;  1ZYE A;  1Q4J A;  3CSJ A;  1PL2 A;  3FYG A;  3OR5 A;  4ILF A;  3GL5 A;  2RII A;  3N9J A;  1GH2 A;  4K6X A;  1G7O A;  4IQA A;  5CAX A;  1SL1 B;  1YZX A;  5CYY A;  1FVJ A;  1Z7P A;  5HR1 A;  1M99 A;  1SKR B;  1UA5 A;  2H74 A;  4EE0 A;  3IV4 A;  1KNG A;  1MTC A;  2R3X A;  3VWX A;  1EV4 A;  5IPH A;  3IOS A;  5D73 A;  4PXO A;  1GUK A;  4XRA A;  4XS1 A;  3PIN A;  3VK9 A;  1O8X A;  3QAW A;  4JR6 A;  3ME7 A;  3GHA A;  3KTL A;  1T8E B;  1OC8 A;  1J08 A;  4KA0 A;  5LD0 A;  2HRF A;  2H70 A;  2C0D A;  2L5O A;  3C71 A;  4N10 A;  3PR8 A;  1ERW A;  1FO5 A;  4Z7X A;  3DIE A;  1X0R A;  2CZ2 A;  1GSF A;  2XPD A;  5ABR A;  2VD1 A;  3FEU A;  4OFT A;  3ZRE A;  4TXO A;  1ZCP A;  22GS A;  4OCF A;  3UL3 A;  2K8S A;  2VLT A;  2J9H A;  3A2W A;  1O8W A;  1WP0 A;  2GZZ A;  3KP8 A;  4EC0 A;  3CSH A;  1K0C A;  1DUG A;  3TKQ A;  4F0C A;  1USB A;  1X5E A;  6GSS A;  2P5R A;  3KXO A;  1R7H A;  3GL3 A;  4WF5 A;  2VM1 A;  2MBS A;  5IMC A;  1XFL A;  2FWH A;  1SKS B;  4IKH A;  2GQK A;  3W6G A;  5B8B A;  2VIM A;  17GS A;  4KE3 A;  2X99 A;  2VCT A;  3UAR A;  3QDN A;  4KSO A;  4WXT A;  2V41 A;  4KGI A;  1U3I A;  2JU5 A;  4TR4 A;  2GZY A;  3F6D A;  4MH2 A;  5J9C A;  4IP1 A;  4KSM A;  4K7O A;  3E3E A;  1THO A;  1NHO A;  1Z3E A;  2L6C A;  4OO5 A;  1FG4 A;  5CRH A;  4MF6 A;  2CT6 A;  4MJB A;  2WGR A;  1SD8 A;  1U6T A;  3LSZ A;  4HQZ A;  4PUR A;  4FYU A;  4K7N A;  4ACS A;  5F07 A;  3HDC A;  2R37 A;  1MD4 A;  2PPT A;  4V2N A;  2HT9 A;  4PGT A;  4BA7 A;  1F9M A;  3LOR A;  2YZH A;  5G1L A;  1G6W A;  3TOT A;  10GS A;  5FT3 A;  4TR1 B;  2E0Q A;  3D22 A;  3F3R A;  4F2I A;  4HU9 A;  3M0F A;  4EL1 A;  2VL3 A;  2H6Y A;  4POL A;  1QMV A;  4Q5N A;  4Q5F A;  1Y6E A;  1VF1 A;  1SK1 A;  3HJM A;  3KM6 A;  5EVO A;  2CA8 A;  2N5A A;  1PD2 1;  1CQG A;  4JRR A;  3FRC A;  4N0V A;  1AC1 A;  2KP2 A;  2LRC A;  2B6M A;  4O32 A;  2PU9 C;  2PBJ A;  1F3A A;  2HE3 A;  5J3R A;  2GSS A;  3F0I A;  1NHY A;  3TKS A;  1TRU A;  5ECM B;  8GSS A;  3DWV A;  5B6M A;  2IJY A;  4IJI A;  2JSY A;  2YWI A;  3VI7 A;  3W8J A;  2PER A;  1SL0 B;  2PMT A;  4IN0 A;  4PQH A;  5GZZ B;  4POM A;  5IOX A;  1ZOF A;  3H4K A;  2H6X A;  4G10 A;  4TR3 A;  1V9W A;  1MD3 A;  1F37 A;  4ML6 A;  5B7C A;  1YEX A;  5A4U A;  1AUC A;  1VGL A;  3D21 A;  2LNS A;  4ZIJ A;  2O89 A;  1H4O A;  5H5S A;  2GSR A;  4RI6 A;  3R2Q A;  1GSS A;  4OD7 A;  1DBY A;  2L4C A;  3FR3 A;  5F8B A;  1VRS D;  4J2F A;  1TJD A;  2KOK A;  5ID2 B;  2VL2 C;  3GX0 A;  4FIW A;  3WGE A;  4I2T A;  2O87 A;  3KD0 A;  2MMZ A;  2H0G A;  1VF3 A;  2WDU A;  2K6V A;  2IN3 A;  1QXH A;  4MJA A;  1XW9 A;  3J7Y b;  2BTO T;  1NM3 A;  1SK2 A;  4I5Q A;  1BJX A;  1EZK A;  1XWG A;  1K3Y A;  1EV9 A;  4F03 A;  1XWC A;  5D9X A;  1JLV A;  4MPF A;  5AIS A;  1GNE A;  1BQ7 A;  2E7P A;  1YQ1 A;  3I69 A;  4ECI A;  1WWJ A;  2NVL A;  3KH7 A;  4LA1 A;  3RPN A;  13GS A;  1FW1 A;  2G0F A;  4HUA A;  4I97 A;  4JR4 A;  3ZVJ D;  2IIY A;  3TGZ A;  4ZBA A;  2LTK A;  4EF0 A;  4DEJ A;  3EE2 A;  2QKE A;  3Q19 A;  2H19 A;  5G1K A;  1TK5 B;  5EL8 A;  2WB9 A;  2R2J A;  1O7U A;  4AGS A;  4GQF A;  4N0Z A;  1E6B A;  1J9B A;  5KN2 A;  1TK0 B;  4F82 A;  5GST A;  3SBC A;  1GWC A;  2OE0 A;  4OFM A;  3ZRD A;  2AJQ B;  2H71 A;  2XBQ A;  5J9B A;  3S9F A;  5CRD A;  2H0H A;  2XBI A;  1F6M C;  5IMZ A;  3SWL A;  3WT2 A;  1GTU A;  2QGV A;  4LMW A;  3WT1 A;  3APS A;  4PQI A;  4MH3 A;  3KJY A;  2ON5 A;  2KUC A;  4KH7 A;  4OWY A;  5C00 A;  5FWG A;  3F63 A;  4JED A;  4V1A g;  3QFA C;  5JCU A;  4FH8 A;  3U6V A;  2DJ2 A;  5D9T A;  1M9B A;  1TP9 A;  1YY7 A;  1YF1 A;  3HY2 A;  1VF4 A;  1EP7 A;  5JCG A;  1K0A A;  2FUG 2;  3IPZ A;  1G7E A;  4HOJ A;  5JWO B;  1AXD A;  4ECJ A;  2F9S A;  2C0E A;  4MCU A;  4MZB A;  1GSE A;  1V2A A;  2YNX A;  5IMV A;  1J0F A;  3L4N A;  2FWE A;  1H75 A;  2IME A;  3ZYW A;  1ML6 A;  2DJJ A;  4ISD A;  3ZLP A;  2YPM A;  4AJ7 A;  2H1B A;  2M72 A;  1ILO A;  3ME8 A;  3CSI A;  1GRX A;  2C3T A;  2JZT A;  2HSY A;  4XTS A;  3MSZ A;  2I9H A;  2C3Q A;  5C04 A;  2YV7 A;  5L71 A;  1EEM A;  4L8E A;  4JE1 A;  3Q18 A;  1PKW A;  1PRX A;  3J7Y k;  3TB2 A;  3TKP A;  1G6Y A;  4POB A;  3NIV A;  4LLR A;  3TRQ A;  3LXZ A;  2RUF A;  5D9W A;  1M2D A;  1EGR A;  3VPQ A;  4GF0 A;  4HS1 A;  3LFL A;  2YOI A;  4PUF C;  3FZ4 A;  5DAL B;  1WOU A;  2E2M A;  2WS2 A;  3LGC A;  4ZXG A;  4NPB A;  3GUS A;  2L5L A;  5DVB A;  3TJB A;  2MMN A;  2JL4 A;  5IMA A;  3IC4 A;  1S3C A;  1SJI A;  1EGO A;  3UAP A;  1JZW A;  4POK A;  4IW9 A;  3HJP A;  4XS4 B;  1WRY A;  1XZO A;  1T4Y A;  1YDK A;  4TRX A;  3O76 A;  2HZE B;  4J56 E;  1GTA A;  4Q5Q A;  3DVX A;  1PX6 A;  3APQ A;  4EUY A;  2OAC A;  4K2D A;  2JAC A;  3CRT A;  5HR0 A;  2OKA A;  4WET A;  2IMD A;  2C0G A;  1KEB A;  4EVM A;  1Z6N A;  5LNK e;  2N5B A;  3P90 A;  4IP6 A;  2L6D A;  1ZZY A;  4IVF A;  4HEA 2;  4XCS A;  2FNO A;  1FHE A;  2H1D A;  2YWO A;  1O85 A;  3FHK A;  2BJX A;  2GT6 A;  3GKX A;  4IS0 A;  2OAD A;  4TKY A;  4ULX A;  2C4J A;  4IEL A;  3CRU A;  2LJR A;  2DJ0 A;  3O6T A;  1OC9 A;  3L9V A;  2YJH A;  3HKR A;  5DAL A;  2CQ9 A;  7GSS A;  2TIR A;  2H8L A;  1XOA A;  1QFN A;  3H8Q A;  3QCP A;  3IAM 2;  4NMU A;  2A2R A;  2OE1 A;  2C1Y A;  2FCH A;  1V40 A;  4HU7 A;  1EOH A;  4WF4 A;  2H1A A;  3G9B A;  5DJL A;  4EDY A;  2IWT A;  1Z5Y E;  5J5N A;  1SEN A;  4XS4 A;  5JWR B;  2H30 A;  2HZE A;  2AV4 A;  3GSS A;  4D73 B;  1WE0 A;  5A4V A;  3GIX A;  3DGQ A;  3KTB A;  1MDK A;  1TK8 B;  3GX8 A;  1MDI A;  5IIZ A;  3GST A;  4EXJ A;  3TRP A;  4HDE A;  1TI3 A;  1GLQ A;  3Q74 A;  2RLI A;  3UIW A;  2CAQ A;  2RM6 A;  3LYK A;  5GAP D;  2VCV A;  4H86 A;  5HFK A;  1SU9 A;  3F4T A;  2F51 A;  2NPB A;  3GA4 A;  2YWN A;  3FR6 A;  2YP6 A;  2B3S A;  1V58 A;  4Q5R A;  2CVB A;  3NOF A;  1AQW A;  3I6A A;  2B7J A;  2K9F A;  3VI5 A;  4RUV A;  1YF0 A;  1A24 A;  3GKN A;  5D93 A;  2CAI A;  5B8A A;  2C8U A;  2VL2 A;  1K0O A;  2ALB A;  4GCI A;  1Z7R A;  1URM A;  1ERU A;  1HNC A;  3U5R E;  4YAP A;  1XW6 A;  3G7J A;  3IAS 2;  1U3A A;  1GTI A;  3C7M A;  2XC2 A;  2I4A A;  3UBL A;  2XHF A;  5ELG A;  2X64 A;  3GYK A;  2FWG A;  1HD2 A;  1KTE A;  1I9D A;  3BD2 A;  2NTO A;  1LBK A;  1K0M A;  4MJE A;  3KP9 A;  1O81 A;  2G2Q A;  5ECK B;  14GS A;  6GST A;  3CTG A;  1AQX A;  2LJA A;  3FKF A;  4EO3 A;  2GTU A;  4HZ4 A;  3C1S A;  2X8G A;  1V98 A;  3RAZ A;  3D6I A;  3ISO A;  2F3M A;  6GSY A;  9GSS A;  1JZO A;  3KCM A;  1GUM A;  1QK8 A;  1PN9 A;  5KEJ A;  3QOU A;  4ZB9 A;  3GNJ A;  3HD5 A;  1TTZ A;  1XIY A;  2LUS A;  2AHE A;  3CBU A;  4DSS B;  1TI1 A;  1GUH A;  2H6Z A;  3FZA A;  4V2L A;  2LV3 A;  1TKD B;  6GSV A;  4HQS A;  4MMM A;  3AY8 A;  3ED3 A;  1TRW A;  1HYU A;  3GUR A;  3M3M A;  3HVV A;  3MDK A;  3EYT A;  4PX1 A;  2FA8 A;  4ML1 A;  3VWW A;  4MK3 A;  4XHM A;  5FHI A;  5HQP A;  2LRN A;  4O92 A;  2YJ7 A;  3DD3 A;  2V32 A;  6GSX A;  4ZL7 A;  2HZF A;  3FZ9 A;  1M0U A;  2PUK C;  4I8B A;  1VF2 A;  3RPP A;  5AIV A;  2ON7 A;  4TR1 A;  3GV1 A;  3UOM A;  5H5R A;  3QFB C;  4IHU A;  4RI7 A;  5G31 A;  1Q98 A;  2C0F A;  3ZML A;  5ELA A;  3VLN A;  4OCE A;  2YN1 A;  1OKT A;  1PL1 A;  1XVW A;  3C73 A;  2M80 A;  1PMT A;  3A2X A;  1AAZ A;  4KB3 A;  1G0T A;  3APO A;  5DQS A;  4NHZ A;  2EIQ A;  2WFC A;  1FAA A;  2WUL A;  4RQX A;  4QL7 A;  1SK0 A;  2H01 A;  2PGT A;  4KAE A;  5CRW A;  4DSS A;  3F6F A;  4XS6 A;  4CDO A;  2L57 A;  3LXT A;  3TRX A;  4IJ3 A;  3GKK A;  3FW2 A;  4PQ1 A;  3D4M A;  2K18 A;  1ST9 A;  5DCG A;  2AYT A;  2ES7 A;  2RUE A;  5DJM A;  4NXI A;  5CO3 A;  2B5Y A;  2F8A A;  2ZCT A;  4K1F A;  2FY6 A;  3E9J B;  3LYP A;  4K0N A;  3EU3 A;  4BWS A;  1PGT A;  1QGV A;  2VLU A;  2YV9 A;  2B1K A;  1JHB A;  2IMK A;  2IMI A;  4YAV A;  4KX4 A;  1RW1 A;  1IYI A;  4BPY A;  2ZNM A;  1X9M B;  2X8H A;  2LKU A;  2GS3 A;  1XPV A;  2B5E A;  3TCO A;  3TJJ A;  5HFI A;  1JLW A;  5ID2 A;  3CMI A;  3EU4 A;  1B9X C;  4K8M A;  2QC7 A;  1B9Y C;  5J41 A;  1U88 A;  1GSD A;  2I81 A;  4V1A p;  5KN1 A;  4NV2 A;  3LWA A;  3UEM A;  4AJ8 A;  4EDZ A;  2LNT A;  2IPA A;  4FYC A;  1W89 A;  3L9S A;  2MBT A;  1AIU A;  1GLP A;  3QMX A;  1K0N A;  4E8E A;  1M7T A;  2FA4 A;  3D5J A;  1C72 A;  5G5F A;  3A2V A;  4BL7 A;  1ZL9 A;  2REM A;  3V1W A;  2LEG A;  1X5D A;  3L0H A;  1XW5 A;  5A4W A;  2I1U A;  3KH9 A;  1O6J A;  1JZD A;  2LST A;  3HJO A;  4JZQ A;  1OE7 A;  3VWU A;  5D8I A;  3GRX A;  3ERF A;  3N5O A;  3ZIT A;  4GSS A;  2HRN A;  3ZTL A;  3E0U A;  2YZU A;  1A2L A;  2P0G A;  16GS A;  4GTU A;  3ZIJ A;  2VCX A;  1JZR A;  3O3T A;  2YWM A;  1MDJ A;  2B1L A;  2PWJ A;  4O7H A;  3EMX A;  1ABA A;  1XCC A;  5DAK B;  3FY7 A;  3VFI A;  1M2B A;  3TDG A;  3L9U A;  1GTB A;  5EY6 A;  1R5P A;  1R5A A;  1EP8 A;  1A0R P;  3IHQ A;  2XPE A;  1KBN A;  1ACV A;  4MAB A;  3D4T A;  1B4Q A;  3ZL5 A;  1OVN A;  4YQU A;  2TRC P;  5DBQ A;  3DVW A;  5HFG A;  4X1U A;  1O73 A;  1TOF A;  5G2Z A;  2FWF A;  4MF7 A;  1GNW A;  2DSA A;  2VCW A;  2PVQ A;  1BED A;  1TDI A;  1WPI A;  3PH9 A;  3ZMK A;  2DJK A;  2WRT A;  2AB6 A;  2NDO A;  3BOA A;  1ON4 A;  3WGD A;  2LQQ A;  4X43 A;  4AF2 A;  2KHP A;  3EMP A;  4WBR D;  4YH2 A;  3HXS A;  1MEK A;  2LQO A;  1XXU A;  5DQY A;  3EWL A;  1EOG A;  4ECB A;  3WYW A;  1X9W B;  1B4P A;  4LL1 B;  4K7I A;  3RHB A;  4RQR A;  5ECO B;  3KGK A;  4DVC A;  1AW9 A;  2CX4 A;  4CW9 A;  2C3N A;  2HSH A;  4WEY A;  1DSB A;  4ZL8 A;  2V6O A;  3DEX A;  3K8N A;  5G30 A;  1XVQ A;  2CX3 A;  4NWY A;  5E4W A;  1YKC A;  1PKZ A;  2VUP A;  1UVZ A;  4N11 A;  5IQY A;  2JAD A;  5ECS A;  4FYB A;  4AJ6 A;  3IK7 A;  5ECR B;  1BG5 A;  1F2E A;  4OFN A;  3HZ8 A;  2GSQ A;  3G7I A;  2GQL A;  3I43 A;  5F0G A;  3EIN A;  1S3D A;  2M46 A;  4P3Y B;  4BVX A;  1WMJ A;  5CNW A;  2KLX A;  3TOU A;  3BCK A;  2JZS A;  2KP1 A;  3DYR A;  3FK8 A;  3ERW A;  4PNF A;  5AGY A;  2VAF A;  3GKM A;  1BAY A;  2GLR A;  2NBS A;  4MDC A;  1A8Y A;  2FHE A;  2A4V A;  2GZP A;  2VOC A;  3WD6 A;  1PSQ A;  2O85 A;  1FB0 A;  5F06 A;  2IFQ B;  1ERV A;  3ZFB A;  3HA9 A;  2X8C A;  1UC7 A;  3UMA A;  3ERG A;  3US3 A;  3H93 A;  4KW6 A;  3H79 A;  2EC4 A;  5IO0 A;  3ZIV A;  4FO5 A;  4KCA A;  5IPG A;  3FR9 A;  4ID0 A;  3IDV A;  3EC3 A;  2WCI A;  1HNB A;  1TW9 A;  3CTF A;  2H1G A;  1FOV A;  2FLS A;  1A0F A;  5IM9 A;  1TRS A;  1OC3 A;  3MNG A;  4HI7 A;  1DE2 A;  1SYR A;  2V2G A;  1RQM A;  3HYP A;  1AQV A;  1E2Y A;  1K3O A;  2V6K A;  3QR6 A;  3A5W A;  4HJM A;  3UVH A;  3ZZX A;  2HXK A;  1A23 A;  4TOP A;  3M8N A;  4KUN A;  2RM5 A;  4HJ2 A;  3GTU B;  5HR3 A;  4NHW A;  3G7Y A;  3KEB A;  5GSS A;  2H72 A;  1SJZ A;  2L59 A;  3F4S A;  1W4V A;  5CRE A;  4D73 A;  2GVP A;  1OE8 A;  1GSU A;  4QL9 A;  4WBJ A;  5J4U A;  1ZMA A;  1DE1 A;  2EIO A;  4K9Z A;  2IFQ A;  2VM2 A;  5GAN D;  3GN3 A;  2YAN A;  4ZB8 A;  4TVE A;  2AAW A;  4MA9 A;  2DIZ A;  3IA1 A;  2OBK A;  2LJK A;  4ZBB A;  4BVY A;  1K0B A;  1TXX A;  1QQ2 A;  1PQN A;  2DLX A;  3F8U A;  4TN8 A;  3W8S A;  4X0X A;  1FB6 A;  3P2A A;  4BWQ A;  2H76 A;  3A3T A;  1B8X A;  4DSR A;  3LJR A;  1T3B A;  2CVK A;  2O7K A;  3DXB A;  1K3L A;  3F3Q A;  3BBY A;  4IBP A;  4PNG A;  2GDR A;  5CRG A;  2MMO A;  5ECL B;  2H75 A;  1XWK A;  4NV5 A;  3VPT A;  4G19 A;  4MF5 A;  3Q6O A;  3GTU A;  1XWA A;  5ECP B;  11GS A;  1SL2 B;  5IMD A;  2C80 A;  1ZGN A;  3M1G A;  3KMO A;  2OA7 A;  3RDW A;  2HI7 A;  1TU7 A;  1Y25 A;  5HR2 A;  1N8J A;  2OBI A;  1GSQ A;  2K8V A;  3H1N A;  1S3A A;  1N2A A;  3CXG A;  5KN0 A;  1T4Z A;  3BCI A;  4G2E A;  3QD9 A;  3IE3 A;  1SKW B;  6GSU A;  1SJ6 A;  3ZVJ A;  3L78 A;  2R4V A;  2H66 A;  2MYG A;  5AN1 A;  1XBS A;  2D2Z A;  2Z9S A;  1V57 A;  3GFK A;  4LMV A;  4WR5 A;  2A2S A;  5D96 A;  2R5G A;  3ZFL A;  4F9Z A;  1OKD A;  4KND A;  3MAK A;  4MZC A;  4YQV A;  4KCE A;  5E59 A;  5ECI B;  5ECQ B;  3TUE A;  1PA3 A;  2CZ3 A;  3P7X A;  2JSZ A;  12GS A;  3HCZ A;  1NW2 A;  2BMX A;  4ZB6 A;  4G9H A;  2B5X A;  2IMF A;  2MZC A;  4CHS A;  1R26 A;  1XOB A;  5LCZ A;  1T7P B;  2QSI A;  3NZN A;  3HVS A;  1BYE A;  1GL8 A;  4TW5 A;  1Z6M A;  4OO4 A;  4TXV A;  2E2G A;  3HZ4 A;  2FD3 A;  1EWX A;  3C1R A;  2AUV A;  1A2M A;  2OE3 A;  2VL9 A;  4ZBD A;  4PUA A;  1M2A A;  2CVD A;  3KIJ A;  5COH A;  2DJ1 A;  5IMF A;  3TJF A; 
#chains in the Genus database with same CATH topology
 4K2X A;  2VLV A;  3VWV A;  1ZYQ B;  2B7K A;  1JFU A;  3IK9 A;  4K0G A;  2H0I A;  3RBT A;  2VCQ A;  1GP1 A;  3LG6 A;  1RK4 A;  2DIY A;  1U87 A;  2TRX A;  1R4W A;  3GH6 A;  4JU5 A;  3I9V 2;  1EEJ A;  1WIK A;  5ECN B;  5DDL A;  3JCM L;  3WGX A;  2GQM A;  2P31 A;  2HFD A;  2PN8 A;  1UN2 A;  2N5F A;  1TU8 A;  3IRA A;  5JCW A;  2GST A;  3C8E A;  5ENU A;  2R6K A;  1M9A A;  4L5O A;  4XIH A;  1HNA A;  3FMW A;  1THX A;  1A2J A;  4GWR A;  4USS A;  3QAV A;  2P5Q A;  4KDU A;  1PX7 A;  1T00 A;  5CP1 A;  2JZR A;  4MJC A;  1K0D A;  1HQO A;  4ZL9 A;  3F9U A;  2CV4 A;  1YEP A;  2HYX A;  5EPF A;  4O5R A;  5D9V A;  5F05 A;  18GS A;  2J23 A;  2DC5 A;  5JWQ B;  4L0U A;  2V1M A;  3KZQ A;  1FVK A;  3PGT A;  3M9J A;  1ERT A;  1GSY A;  4WKW A;  4GXZ A;  1F3B A;  5INY A;  3TKS C;  4KDY A;  4GLT A;  2HLS A;  4GST A;  19GS A;  1B48 A;  3HVX A;  1X5C A;  4DSQ A;  1A8L A;  4E8H A;  3LQ7 A;  4MLY A;  3EVI A;  5IO2 A;  1BX9 A;  3UVT A;  4YKF A;  2PVO C;  3QAG A;  3UJ1 A;  1QUW A;  1WJK A;  5H5Q A;  2H73 A;  2OJL A;  1M3J A;  4MP4 A;  2VO4 A;  1T1V A;  4MPG A;  2WZ9 A;  2DMM A;  3FZ5 A;  4V2M A;  6GSW A;  2HNL A;  2I3Y A;  4L5L A;  2FGX A;  4GSN A;  2F8F A;  1YJ6 A;  2DML A;  4IQ1 A;  3RHC A;  3UBK A;  3D0Z A;  1GUL A;  20GS A;  3TJK A;  1YKA A;  3DKS A;  5AIX A;  3MYD A;  4GQC A;  4XRD A;  1SYX A;  1SD9 A;  3QPM A;  5DCH A;  4IGJ A;  4I2U A;  2DBC A;  3VUR A;  4HZ2 A;  3P8W A;  2IL3 A;  3HHV A;  4F0B A;  4TR0 A;  4I6X A;  2LS5 A;  2GGT A;  2LRT A;  4JBB A;  4ZIL A;  3IBH A;  3BJ5 A;  3TKR A;  1XWB A;  2VD0 A;  3TKS E;  5ECH B;  4N30 A;  4YQM A;  3DRN A;  4NAX A;  2GT5 A;  4OMV A;  4ECC A;  3KMN A;  3TJG A;  2YCD A;  4QQ7 A;  4J57 E;  2DJ3 A;  1LU4 A;  4MZW A;  2O8V B;  3CYN A;  3M9K A;  3IHG A;  5DAK A;  4EKZ A;  1Z9H A;  2WJU A;  4LL4 B;  1OC9 B;  3GH9 A;  5A5K A;  3EUR A;  2EIR A;  1OYJ A;  5KN3 A;  1X9S B;  2VCZ A;  1IYH A;  3IR4 A;  3GMF A;  1I5G A;  2ZUP A;  5B6N A;  2L4Q A;  3LEF A;  3DML A;  1NSW A;  4KDX A;  3F4R A;  1TRV A;  5IOW A;  1CQH A;  4WR4 A;  2X4A A;  4GRF A;  1LJR A;  3MWH A;  1OAZ A;  2MMA A;  4L0W A;  5G5E A;  3IXR A;  4TXO B;  1ZYE A;  1Q4J A;  3CSJ A;  1PL2 A;  3FYG A;  3OR5 A;  4ILF A;  3GL5 A;  4HSC X;  2RII A;  3N9J A;  1GH2 A;  4K6X A;  1G7O A;  4IQA A;  5CAX A;  1SL1 B;  1YZX A;  5CYY A;  1FVJ A;  1Z7P A;  5HR1 A;  1M99 A;  1SKR B;  1UA5 A;  2H74 A;  4EE0 A;  3IV4 A;  4Z2U A;  1KNG A;  1MTC A;  2R3X A;  3VWX A;  1EV4 A;  5IPH A;  3IOS A;  5D73 A;  4PXO A;  1GUK A;  4XRA A;  4XS1 A;  3PIN A;  5KOX A;  3VK9 A;  1O8X A;  3QAW A;  4JR6 A;  3ME7 A;  3GHA A;  3KTL A;  1T8E B;  1OC8 A;  1J08 A;  4KA0 A;  5LD0 A;  2HRF A;  2H70 A;  2C0D A;  2L5O A;  3C71 A;  4N10 A;  3PR8 A;  1ERW A;  1FO5 A;  4Z7X A;  3DIE A;  1X0R A;  2CZ2 A;  1GSF A;  2XPD A;  5ABR A;  2VD1 A;  3FEU A;  4OFT A;  3ZRE A;  4TXO A;  1ZCP A;  22GS A;  4OCF A;  3UL3 A;  2K8S A;  2VLT A;  2J9H A;  3A2W A;  1O8W A;  1WP0 A;  2GZZ A;  3KP8 A;  4EC0 A;  3CSH A;  1K0C A;  1DUG A;  3TKQ A;  4F0C A;  1USB A;  1X5E A;  6GSS A;  2P5R A;  3KXO A;  4CY8 A;  1R7H A;  3GL3 A;  4WF5 A;  2VM1 A;  2MBS A;  5IMC A;  1XFL A;  2FWH A;  1SKS B;  4IKH A;  2GQK A;  3W6G A;  5B8B A;  2VIM A;  17GS A;  4KE3 A;  2X99 A;  2VCT A;  3UAR A;  3QDN A;  4KSO A;  4WXT A;  2V41 A;  4KGI A;  1U3I A;  2JU5 A;  4TR4 A;  2GZY A;  3F6D A;  4MH2 A;  5J9C A;  4IP1 A;  4KSM A;  4K7O A;  3E3E A;  1THO A;  1NHO A;  1Z3E A;  2L6C A;  4OO5 A;  1FG4 A;  5CRH A;  4MF6 A;  2CT6 A;  4MJB A;  2WGR A;  1SD8 A;  1U6T A;  3LSZ A;  4HQZ A;  4A5P A;  4PUR A;  4FYU A;  4G0I A;  4K7N A;  4ACS A;  5F07 A;  3HDC A;  2R37 A;  1MD4 A;  2PPT A;  4V2N A;  2HT9 A;  4PGT A;  4BA7 A;  1F9M A;  3LOR A;  2YZH A;  5G1L A;  2DKI A;  1G6W A;  3TOT A;  10GS A;  5FT3 A;  4TR1 B;  2E0Q A;  3D22 A;  3F3R A;  4K5R A;  4F2I A;  2QA2 A;  4HU9 A;  3M0F A;  4EL1 A;  2VL3 A;  2H6Y A;  4POL A;  1QMV A;  4Q5N A;  4Q5F A;  1PN0 A;  1Y6E A;  1VF1 A;  1SK1 A;  3HJM A;  3KM6 A;  5EVO A;  2CA8 A;  2N5A A;  1PD2 1;  1CQG A;  4JRR A;  3EPT A;  3FRC A;  4N0V A;  1AC1 A;  2KP2 A;  2LRC A;  2B6M A;  4O32 A;  2PU9 C;  2PBJ A;  1F3A A;  2HE3 A;  5J3R A;  2GSS A;  3F0I A;  1NHY A;  3TKS A;  1TRU A;  5ECM B;  8GSS A;  3DWV A;  5B6M A;  2IJY A;  4IJI A;  2JSY A;  2YWI A;  3VI7 A;  3W8J A;  2PER A;  1SL0 B;  2PMT A;  4IN0 A;  4PQH A;  5GZZ B;  4POM A;  5IOX A;  4KF9 A;  1ZOF A;  1PFO A;  3H4K A;  2H6X A;  4G10 A;  4TR3 A;  1V9W A;  1MD3 A;  1F37 A;  4ML6 A;  5B7C A;  1YEX A;  5A4U A;  1AUC A;  1VGL A;  3D21 A;  2LNS A;  2QA1 A;  4ZIJ A;  2O89 A;  1H4O A;  3LW9 A;  5H5S A;  2GSR A;  4RI6 A;  3R2Q A;  1GSS A;  4OD7 A;  1DBY A;  2L4C A;  3FR3 A;  5F8B A;  1VRS D;  4J2F A;  1TJD A;  2KOK A;  5ID2 B;  2VL2 C;  3GX0 A;  4FIW A;  3WGE A;  4I2T A;  2O87 A;  3KD0 A;  2MMZ A;  2H0G A;  1VF3 A;  2WDU A;  2K6V A;  2IN3 A;  1QXH A;  4MJA A;  1XW9 A;  3J7Y b;  2BTO T;  1NM3 A;  1SK2 A;  4I5Q A;  1BJX A;  1EZK A;  1XWG A;  1K3Y A;  1EV9 A;  4F03 A;  1XWC A;  5D9X A;  1JLV A;  4MPF A;  5AIS A;  1GNE A;  1BQ7 A;  2E7P A;  1YQ1 A;  3I69 A;  4ECI A;  1WWJ A;  2HSM A;  2NVL A;  3KH7 A;  4LA1 A;  3RPN A;  13GS A;  1FW1 A;  2G0F A;  4HUA A;  4I97 A;  4JR4 A;  3ZVJ D;  2IIY A;  3TGZ A;  4ZBA A;  2LTK A;  4EF0 A;  4DEJ A;  3EE2 A;  2QKE A;  3Q19 A;  2H19 A;  5G1K A;  1TK5 B;  5EL8 A;  2WB9 A;  2R2J A;  1O7U A;  4AGS A;  4GQF A;  4N0Z A;  1E6B A;  1J9B A;  5KN2 A;  1TK0 B;  4F82 A;  5GST A;  3SBC A;  1GWC A;  2OE0 A;  4OFM A;  4O5Q A;  3ZRD A;  2AJQ B;  2H71 A;  2XBQ A;  5J9B A;  3S9F A;  5CRD A;  2H0H A;  2XBI A;  1F6M C;  5IMZ A;  3SWL A;  3WT2 A;  1GTU A;  2QGV A;  4LMW A;  3WT1 A;  3APS A;  4PQI A;  4MH3 A;  3KJY A;  2ON5 A;  2KUC A;  4KH7 A;  4OWY A;  5C00 A;  5FWG A;  3F63 A;  4JED A;  4V1A g;  3QFA C;  5JCU A;  4FH8 A;  3U6V A;  2DJ2 A;  5D9T A;  1M9B A;  1TP9 A;  1YY7 A;  1YF1 A;  3HY2 A;  1VF4 A;  1EP7 A;  5JCG A;  1K0A A;  2FUG 2;  3IPZ A;  4MNN A;  1G7E A;  4HOJ A;  5JWO B;  1AXD A;  4ECJ A;  2F9S A;  2C0E A;  4MCU A;  4MZB A;  1GSE A;  1V2A A;  2YNX A;  5IMV A;  3IC8 A;  1J0F A;  3L4N A;  2FWE A;  1H75 A;  2IME A;  3ZYW A;  1ML6 A;  2DJJ A;  4ISD A;  3ZLP A;  2YPM A;  4AJ7 A;  2H1B A;  2M72 A;  1ILO A;  3ME8 A;  3CSI A;  1GRX A;  2C3T A;  2JZT A;  2HSY A;  4XTS A;  3MSZ A;  2I9H A;  2C3Q A;  5C04 A;  2YV7 A;  5L71 A;  1EEM A;  4L8E A;  4JE1 A;  3Q18 A;  1PKW A;  1PRX A;  3J7Y k;  3TB2 A;  3TKP A;  1G6Y A;  4POB A;  3NIV A;  4LLR A;  3TRQ A;  3LXZ A;  2RUF A;  5D9W A;  1M2D A;  1EGR A;  3VPQ A;  4GF0 A;  4HS1 A;  3LFL A;  2YOI A;  4PUF C;  3FZ4 A;  5DAL B;  1WOU A;  2E2M A;  3PPU A;  2WS2 A;  3LGC A;  4ZXG A;  4X4J A;  4NPB A;  3GUS A;  2L5L A;  5DVB A;  3HVN A;  3TJB A;  2MMN A;  2JL4 A;  5IMA A;  3IC4 A;  1S3C A;  1SJI A;  1EGO A;  3UAP A;  1JZW A;  4POK A;  4IW9 A;  3HJP A;  4XS4 B;  1WRY A;  1XZO A;  1T4Y A;  1YDK A;  4TRX A;  3O76 A;  2HZE B;  4J56 E;  1GTA A;  4Q5Q A;  3DVX A;  1PX6 A;  3APQ A;  4EUY A;  2OAC A;  4K2D A;  2JAC A;  3CRT A;  5HR0 A;  2OKA A;  4WET A;  2IMD A;  2C0G A;  1KEB A;  4EVM A;  1Z6N A;  5LNK e;  2N5B A;  3P90 A;  4IP6 A;  2L6D A;  1ZZY A;  4IVF A;  4HEA 2;  4XCS A;  2FNO A;  1FHE A;  2H1D A;  2YWO A;  1O85 A;  3FHK A;  2BJX A;  2GT6 A;  3GKX A;  4IS0 A;  2OAD A;  4TKY A;  4ULX A;  2C4J A;  4IEL A;  3CRU A;  2LJR A;  2DJ0 A;  3O6T A;  1OC9 A;  3L9V A;  2YJH A;  3HKR A;  5DAL A;  2CQ9 A;  7GSS A;  2TIR A;  2H8L A;  1XOA A;  1QFN A;  3H8Q A;  3QCP A;  3IAM 2;  4NMU A;  2A2R A;  2OE1 A;  2C1Y A;  2FCH A;  1V40 A;  4HU7 A;  1EOH A;  4WF4 A;  2H1A A;  3G9B A;  2R0C A;  5DJL A;  4EDY A;  2IWT A;  1Z5Y E;  5J5N A;  1SEN A;  4XS4 A;  5JWR B;  2H30 A;  2HZE A;  2AV4 A;  3GSS A;  4D73 B;  1WE0 A;  5A4V A;  3GIX A;  3DGQ A;  3KTB A;  1MDK A;  1TK8 B;  3GX8 A;  1MDI A;  3A5I A;  5IIZ A;  3GST A;  4EXJ A;  3TRP A;  4HDE A;  1TI3 A;  1GLQ A;  3Q74 A;  2RLI A;  3UIW A;  2CAQ A;  2RM6 A;  3LYK A;  5GAP D;  2VCV A;  4H86 A;  5HFK A;  4G0K A;  1SU9 A;  3F4T A;  2F51 A;  2NPB A;  3GA4 A;  2YWN A;  3FR6 A;  2YP6 A;  2B3S A;  1V58 A;  4Q5R A;  2CVB A;  3NOF A;  1AQW A;  3I6A A;  2B7J A;  2K9F A;  3VI5 A;  4RUV A;  1YF0 A;  1A24 A;  3GKN A;  5D93 A;  2CAI A;  1S3R A;  5B8A A;  2C8U A;  2VL2 A;  1K0O A;  2ALB A;  4GCI A;  1Z7R A;  1URM A;  1ERU A;  1HNC A;  3U5R E;  4YAP A;  1XW6 A;  2HRK A;  3G7J A;  3IAS 2;  1U3A A;  1GTI A;  3C7M A;  2XC2 A;  2I4A A;  3UBL A;  2XHF A;  5ELG A;  2X64 A;  3GYK A;  2FWG A;  1HD2 A;  1KTE A;  1I9D A;  3BD2 A;  2NTO A;  1LBK A;  1K0M A;  4MJE A;  3KP9 A;  1O81 A;  2G2Q A;  5ECK B;  14GS A;  2HRA A;  6GST A;  3CTG A;  1AQX A;  1FOH A;  2LJA A;  3FKF A;  4EO3 A;  2GTU A;  4HZ4 A;  3C1S A;  2X8G A;  1V98 A;  3RAZ A;  3D6I A;  3ISO A;  1ZYP A;  2F3M A;  6GSY A;  9GSS A;  1JZO A;  3KCM A;  1GUM A;  1QK8 A;  1PN9 A;  5KEJ A;  3QOU A;  4ZB9 A;  3GNJ A;  3HD5 A;  1TTZ A;  1XIY A;  2LUS A;  2AHE A;  3CBU A;  4DSS B;  1TI1 A;  1GUH A;  2H6Z A;  3FZA A;  4V2L A;  2LV3 A;  1TKD B;  6GSV A;  4HQS A;  4MMM A;  3AY8 A;  3ED3 A;  1TRW A;  3CQF A;  1HYU A;  3GUR A;  3M3M A;  3HVV A;  3MDK A;  3EYT A;  4PX1 A;  2FA8 A;  4ML1 A;  3VWW A;  4MK3 A;  4XHM A;  5FHI A;  5HQP A;  2LRN A;  4O92 A;  2YJ7 A;  3DD3 A;  2V32 A;  6GSX A;  4ZL7 A;  2HZF A;  3FZ9 A;  1M0U A;  2PUK C;  4I8B A;  1VF2 A;  3RPP A;  5AIV A;  2ON7 A;  4TR1 A;  3GV1 A;  3UOM A;  5H5R A;  3QFB C;  4IHU A;  4RI7 A;  5G31 A;  1Q98 A;  2C0F A;  3ZML A;  5ELA A;  3VLN A;  4OCE A;  2YN1 A;  1OKT A;  1PL1 A;  1XG8 A;  1XVW A;  3C73 A;  2M80 A;  1PMT A;  3A2X A;  4BIK A;  1AAZ A;  4KB3 A;  1G0T A;  3APO A;  5DQS A;  4NHZ A;  2EIQ A;  2WFC A;  1FAA A;  2WUL A;  4RQX A;  4QL7 A;  1SK0 A;  2H01 A;  2PGT A;  4KAE A;  5CRW A;  4DSS A;  3F6F A;  4XS6 A;  4CDO A;  2L57 A;  3LXT A;  3TRX A;  4IJ3 A;  3GKK A;  3FW2 A;  4PQ1 A;  5KOW A;  3D4M A;  2K18 A;  1ST9 A;  5DCG A;  2AYT A;  2ES7 A;  2RUE A;  5DJM A;  4NXI A;  5CO3 A;  2B5Y A;  2F8A A;  2ZCT A;  4K1F A;  2FY6 A;  3E9J B;  4BL7 B;  3LYP A;  4K0N A;  3EU3 A;  4BWS A;  1PGT A;  1QGV A;  2VLU A;  2YV9 A;  2B1K A;  2A2P A;  1JHB A;  2IMK A;  2IMI A;  4YAV A;  4KX4 A;  1RW1 A;  1IYI A;  4BPY A;  2ZNM A;  1X9M B;  2X8H A;  2LKU A;  2GS3 A;  1XPV A;  2B5E A;  3TCO A;  3TJJ A;  5HFI A;  1JLW A;  5ID2 A;  4YKG A;  3CMI A;  3EU4 A;  1B9X C;  4K8M A;  4CY6 A;  2QC7 A;  1B9Y C;  5J41 A;  1U88 A;  1GSD A;  2I81 A;  4V1A p;  5KN1 A;  4NV2 A;  3LWA A;  3UEM A;  4AJ8 A;  4EDZ A;  2LNT A;  2IPA A;  4FYC A;  1W89 A;  3L9S A;  2UZ8 A;  2MBT A;  1AIU A;  1GLP A;  3QMX A;  1K0N A;  4E8E A;  1M7T A;  2FA4 A;  3D5J A;  1C72 A;  5G5F A;  3A2V A;  4BL7 A;  1ZL9 A;  2REM A;  3V1W A;  2LEG A;  1X5D A;  3L0H A;  1XW5 A;  5A4W A;  2I1U A;  3KH9 A;  1O6J A;  1JZD A;  2LST A;  3HJO A;  4JZQ A;  1OE7 A;  3VWU A;  5D8I A;  3GRX A;  3ERF A;  3N5O A;  4PTS A;  3ZIT A;  4GSS A;  2HRN A;  3ZTL A;  4K5S A;  3E0U A;  2YZU A;  1A2L A;  2P0G A;  3MIX A;  5BMU A;  16GS A;  4GTU A;  3ZIJ A;  2VCX A;  1JZR A;  3O3T A;  2YWM A;  1MDJ A;  2B1L A;  2PWJ A;  4O7H A;  3EMX A;  1ABA A;  1XCC A;  5DAK B;  3FY7 A;  3VFI A;  1M2B A;  3TDG A;  3L9U A;  1GTB A;  5EY6 A;  1R5P A;  1R5A A;  1EP8 A;  2R0P A;  1A0R P;  3IHQ A;  4G0L A;  2XPE A;  1KBN A;  1ACV A;  4MAB A;  3D4T A;  1B4Q A;  3ZL5 A;  1OVN A;  4YQU A;  2TRC P;  5DBQ A;  3DVW A;  5HFG A;  4X1U A;  1O73 A;  1TOF A;  5G2Z A;  1M3I A;  2FWF A;  4MF7 A;  1GNW A;  2DSA A;  2VCW A;  2PVQ A;  1BED A;  1TDI A;  1WPI A;  4Z2R A;  3PH9 A;  3ZMK A;  2DJK A;  2WRT A;  2AB6 A;  2NDO A;  3BOA A;  1ON4 A;  3WGD A;  2LQQ A;  4BVX B;  4X43 A;  4AF2 A;  2KHP A;  3EMP A;  4WBR D;  4YH2 A;  3HXS A;  1MEK A;  2LQO A;  4EIQ A;  1XXU A;  5DQY A;  3EWL A;  1EOG A;  4ECB A;  3WYW A;  1X9W B;  1B4P A;  4LL1 B;  4K7I A;  3RHB A;  4RQR A;  5ECO B;  3KGK A;  4DVC A;  1AW9 A;  2CX4 A;  4CW9 A;  2C3N A;  2HSH A;  4WEY A;  1DSB A;  4ZL8 A;  2V6O A;  3DEX A;  3K8N A;  5G30 A;  1XVQ A;  2CX3 A;  4NWY A;  5E4W A;  1YKC A;  1PKZ A;  2VUP A;  1UVZ A;  4N11 A;  5IQY A;  2JAD A;  5ECS A;  4FYB A;  4AJ6 A;  3IK7 A;  5ECR B;  1BG5 A;  3R3E A;  1F2E A;  2A4H A;  4OFN A;  3HZ8 A;  2GSQ A;  3G7I A;  2GQL A;  3I43 A;  5F0G A;  3EIN A;  1S3D A;  2M46 A;  4P3Y B;  4BVX A;  1WMJ A;  5CNW A;  2KLX A;  3TOU A;  3BCK A;  2JZS A;  2KP1 A;  3DYR A;  3FK8 A;  3ERW A;  4PNF A;  5AGY A;  2VAF A;  3GKM A;  1BAY A;  2GLR A;  2NBS A;  4MDC A;  1A8Y A;  2FHE A;  2A4V A;  2GZP A;  2VOC A;  3WD6 A;  1PSQ A;  2O85 A;  1FB0 A;  5F06 A;  2IFQ B;  1ERV A;  3ZFB A;  3HA9 A;  2X8C A;  1UC7 A;  3UMA A;  3ERG A;  3US3 A;  3H93 A;  4KW6 A;  4BVY B;  1ZYN A;  3H79 A;  2EC4 A;  5IO0 A;  3ZIV A;  4FO5 A;  4KCA A;  2DKH A;  5IPG A;  3FR9 A;  4ID0 A;  3IDV A;  3EC3 A;  2WCI A;  1HNB A;  1TW9 A;  3CTF A;  2H1G A;  1FOV A;  2FLS A;  1A0F A;  5IM9 A;  1TRS A;  1OC3 A;  3MNG A;  4HI7 A;  1DE2 A;  1SYR A;  2V2G A;  1RQM A;  3HYP A;  1AQV A;  1E2Y A;  1K3O A;  2V6K A;  3QR6 A;  3A5W A;  4HJM A;  3UVH A;  3ZZX A;  2HXK A;  1A23 A;  4TOP A;  2R0G A;  3M8N A;  4KUN A;  2RM5 A;  4HJ2 A;  3GTU B;  5HR3 A;  4NHW A;  3G7Y A;  3KEB A;  5GSS A;  2H72 A;  1SJZ A;  2L59 A;  3F4S A;  1W4V A;  5CRE A;  4D73 A;  2GVP A;  1OE8 A;  1GSU A;  4QL9 A;  4WBJ A;  5J4U A;  1ZMA A;  1DE1 A;  2EIO A;  4K9Z A;  2IFQ A;  2VM2 A;  5GAN D;  3GN3 A;  2YAN A;  4ZB8 A;  4TVE A;  2AAW A;  4MA9 A;  2DIZ A;  3IA1 A;  2OBK A;  2LJK A;  4ZBB A;  4BVY A;  1K0B A;  1TXX A;  1QQ2 A;  1PQN A;  4O5U A;  2DLX A;  3F8U A;  4TN8 A;  3W8S A;  4X0X A;  1FB6 A;  3P2A A;  4EIP A;  4BWQ A;  2H76 A;  3A3T A;  1B8X A;  4DSR A;  3LJR A;  1T3B A;  2CVK A;  2O7K A;  3DXB A;  1K3L A;  3F3Q A;  3BBY A;  4IBP A;  4PNG A;  2GDR A;  5CRG A;  2MMO A;  5ECL B;  2H75 A;  1XWK A;  4NV5 A;  3VPT A;  4G19 A;  2X49 A;  4MF5 A;  5BRT A;  3Q6O A;  3GTU A;  1XWA A;  5ECP B;  11GS A;  1SL2 B;  5IMD A;  2C80 A;  1ZGN A;  3M1G A;  3KMO A;  2OA7 A;  3RDW A;  2HI7 A;  1TU7 A;  1Y25 A;  5HR2 A;  1N8J A;  4FQU A;  2OBI A;  1GSQ A;  2K8V A;  3H1N A;  1S3A A;  1N2A A;  3CXG A;  5KN0 A;  1T4Z A;  3BCI A;  4G2E A;  3QD9 A;  3IE3 A;  1SKW B;  6GSU A;  1SJ6 A;  3ZVJ A;  3L78 A;  2R4V A;  2H66 A;  2MYG A;  5AN1 A;  1XBS A;  2D2Z A;  2Z9S A;  1V57 A;  3GFK A;  4LMV A;  4WR5 A;  2A2S A;  5D96 A;  2R5G A;  3ZFL A;  4F9Z A;  1OKD A;  4KND A;  3MAK A;  4MZC A;  4YQV A;  4KCE A;  5E59 A;  5ECI B;  5ECQ B;  3TUE A;  1PA3 A;  2CZ3 A;  3P7X A;  2JSZ A;  12GS A;  3HCZ A;  1NW2 A;  2BMX A;  4ZB6 A;  4G9H A;  2B5X A;  2IMF A;  2MZC A;  4CHS A;  1R26 A;  1XOB A;  5LCZ A;  1T7P B;  2QSI A;  3NZN A;  3HVS A;  1BYE A;  1GL8 A;  4TW5 A;  1Z6M A;  4ICY A;  4OO4 A;  4TXV A;  2E2G A;  3HZ4 A;  2FD3 A;  1EWX A;  4Z2T A;  3C1R A;  2AUV A;  1A2M A;  2OE3 A;  2VL9 A;  4ZBD A;  4PUA A;  1M2A A;  2CVD A;  3KIJ A;  5COH A;  2DJ1 A;  5IMF A;  3TJF A; 
#chains in the Genus database with same CATH homology
 4K2X A;  2VLV A;  3VWV A;  1ZYQ B;  2B7K A;  1JFU A;  3IK9 A;  4K0G A;  2H0I A;  3RBT A;  2VCQ A;  1GP1 A;  3LG6 A;  1RK4 A;  2DIY A;  1U87 A;  2TRX A;  1R4W A;  3GH6 A;  4JU5 A;  3I9V 2;  1EEJ A;  1WIK A;  5ECN B;  5DDL A;  3JCM L;  3WGX A;  2GQM A;  2P31 A;  2HFD A;  2PN8 A;  1UN2 A;  2N5F A;  1TU8 A;  3IRA A;  5JCW A;  2GST A;  3C8E A;  5ENU A;  2R6K A;  1M9A A;  4L5O A;  4XIH A;  1HNA A;  3FMW A;  1THX A;  1A2J A;  4GWR A;  4USS A;  3QAV A;  2P5Q A;  4KDU A;  1PX7 A;  1T00 A;  5CP1 A;  2JZR A;  4MJC A;  1K0D A;  1HQO A;  4ZL9 A;  3F9U A;  2CV4 A;  1YEP A;  2HYX A;  5EPF A;  4O5R A;  5D9V A;  5F05 A;  18GS A;  2J23 A;  2DC5 A;  5JWQ B;  4L0U A;  2V1M A;  3KZQ A;  1FVK A;  3PGT A;  3M9J A;  1ERT A;  1GSY A;  4WKW A;  4GXZ A;  1F3B A;  5INY A;  3TKS C;  4KDY A;  4GLT A;  2HLS A;  4GST A;  19GS A;  1B48 A;  3HVX A;  1X5C A;  4DSQ A;  1A8L A;  4E8H A;  3LQ7 A;  4MLY A;  3EVI A;  5IO2 A;  1BX9 A;  3UVT A;  4YKF A;  2PVO C;  3QAG A;  3UJ1 A;  1QUW A;  1WJK A;  5H5Q A;  2H73 A;  2OJL A;  4MP4 A;  2VO4 A;  1T1V A;  4MPG A;  2WZ9 A;  2DMM A;  3FZ5 A;  4V2M A;  6GSW A;  2HNL A;  2I3Y A;  4L5L A;  2FGX A;  4GSN A;  2F8F A;  1YJ6 A;  2DML A;  4IQ1 A;  3RHC A;  3UBK A;  3D0Z A;  1GUL A;  20GS A;  3TJK A;  1YKA A;  3DKS A;  5AIX A;  3MYD A;  4GQC A;  4XRD A;  1SYX A;  1SD9 A;  3QPM A;  5DCH A;  4IGJ A;  4I2U A;  2DBC A;  3VUR A;  4HZ2 A;  3P8W A;  2IL3 A;  3HHV A;  4F0B A;  4TR0 A;  4I6X A;  2LS5 A;  2GGT A;  2LRT A;  4JBB A;  4ZIL A;  3IBH A;  3BJ5 A;  3TKR A;  1XWB A;  2VD0 A;  3TKS E;  5ECH B;  4N30 A;  4YQM A;  3DRN A;  4NAX A;  2GT5 A;  4OMV A;  4ECC A;  3KMN A;  3TJG A;  2YCD A;  4QQ7 A;  4J57 E;  2DJ3 A;  1LU4 A;  4MZW A;  2O8V B;  3CYN A;  3M9K A;  3IHG A;  5DAK A;  4EKZ A;  1Z9H A;  2WJU A;  4LL4 B;  1OC9 B;  3GH9 A;  5A5K A;  3EUR A;  2EIR A;  1OYJ A;  5KN3 A;  1X9S B;  2VCZ A;  1IYH A;  3IR4 A;  3GMF A;  1I5G A;  2ZUP A;  5B6N A;  2L4Q A;  3LEF A;  3DML A;  1NSW A;  4KDX A;  3F4R A;  1TRV A;  5IOW A;  1CQH A;  4WR4 A;  2X4A A;  4GRF A;  1LJR A;  3MWH A;  1OAZ A;  2MMA A;  4L0W A;  5G5E A;  3IXR A;  4TXO B;  1ZYE A;  1Q4J A;  3CSJ A;  1PL2 A;  3FYG A;  3OR5 A;  4ILF A;  3GL5 A;  2RII A;  3N9J A;  1GH2 A;  4K6X A;  1G7O A;  4IQA A;  5CAX A;  1SL1 B;  1YZX A;  5CYY A;  1FVJ A;  1Z7P A;  5HR1 A;  1M99 A;  1SKR B;  1UA5 A;  2H74 A;  4EE0 A;  3IV4 A;  4Z2U A;  1KNG A;  1MTC A;  2R3X A;  3VWX A;  1EV4 A;  5IPH A;  3IOS A;  5D73 A;  4PXO A;  1GUK A;  4XRA A;  4XS1 A;  3PIN A;  5KOX A;  3VK9 A;  1O8X A;  3QAW A;  4JR6 A;  3ME7 A;  3GHA A;  3KTL A;  1T8E B;  1OC8 A;  1J08 A;  4KA0 A;  5LD0 A;  2HRF A;  2H70 A;  2C0D A;  2L5O A;  3C71 A;  4N10 A;  3PR8 A;  1ERW A;  1FO5 A;  4Z7X A;  3DIE A;  1X0R A;  2CZ2 A;  1GSF A;  2XPD A;  5ABR A;  2VD1 A;  3FEU A;  4OFT A;  3ZRE A;  4TXO A;  1ZCP A;  22GS A;  4OCF A;  3UL3 A;  2K8S A;  2VLT A;  2J9H A;  3A2W A;  1O8W A;  1WP0 A;  2GZZ A;  3KP8 A;  4EC0 A;  3CSH A;  1K0C A;  1DUG A;  3TKQ A;  4F0C A;  1USB A;  1X5E A;  6GSS A;  2P5R A;  3KXO A;  4CY8 A;  1R7H A;  3GL3 A;  4WF5 A;  2VM1 A;  2MBS A;  5IMC A;  1XFL A;  2FWH A;  1SKS B;  4IKH A;  2GQK A;  3W6G A;  5B8B A;  2VIM A;  17GS A;  4KE3 A;  2X99 A;  2VCT A;  3UAR A;  3QDN A;  4KSO A;  4WXT A;  2V41 A;  4KGI A;  1U3I A;  2JU5 A;  4TR4 A;  2GZY A;  3F6D A;  4MH2 A;  5J9C A;  4IP1 A;  4KSM A;  4K7O A;  3E3E A;  1THO A;  1NHO A;  1Z3E A;  2L6C A;  4OO5 A;  1FG4 A;  5CRH A;  4MF6 A;  2CT6 A;  4MJB A;  2WGR A;  1SD8 A;  1U6T A;  3LSZ A;  4HQZ A;  4A5P A;  4PUR A;  4FYU A;  4G0I A;  4K7N A;  4ACS A;  5F07 A;  3HDC A;  2R37 A;  1MD4 A;  2PPT A;  4V2N A;  2HT9 A;  4PGT A;  4BA7 A;  1F9M A;  3LOR A;  2YZH A;  5G1L A;  2DKI A;  1G6W A;  3TOT A;  10GS A;  5FT3 A;  4TR1 B;  2E0Q A;  3D22 A;  3F3R A;  4K5R A;  4F2I A;  2QA2 A;  4HU9 A;  3M0F A;  4EL1 A;  2VL3 A;  2H6Y A;  4POL A;  1QMV A;  4Q5N A;  4Q5F A;  1PN0 A;  1Y6E A;  1VF1 A;  1SK1 A;  3HJM A;  3KM6 A;  5EVO A;  2CA8 A;  2N5A A;  1PD2 1;  1CQG A;  4JRR A;  3EPT A;  3FRC A;  4N0V A;  1AC1 A;  2KP2 A;  2LRC A;  2B6M A;  4O32 A;  2PU9 C;  2PBJ A;  1F3A A;  2HE3 A;  5J3R A;  2GSS A;  3F0I A;  1NHY A;  3TKS A;  1TRU A;  5ECM B;  8GSS A;  3DWV A;  5B6M A;  2IJY A;  4IJI A;  2JSY A;  2YWI A;  3VI7 A;  3W8J A;  2PER A;  1SL0 B;  2PMT A;  4IN0 A;  4PQH A;  5GZZ B;  4POM A;  5IOX A;  4KF9 A;  1ZOF A;  3H4K A;  2H6X A;  4G10 A;  4TR3 A;  1V9W A;  1MD3 A;  1F37 A;  4ML6 A;  5B7C A;  1YEX A;  5A4U A;  1AUC A;  1VGL A;  3D21 A;  2LNS A;  2QA1 A;  4ZIJ A;  2O89 A;  1H4O A;  3LW9 A;  5H5S A;  2GSR A;  4RI6 A;  3R2Q A;  1GSS A;  4OD7 A;  1DBY A;  2L4C A;  3FR3 A;  5F8B A;  1VRS D;  4J2F A;  1TJD A;  2KOK A;  5ID2 B;  2VL2 C;  3GX0 A;  4FIW A;  3WGE A;  4I2T A;  2O87 A;  3KD0 A;  2MMZ A;  2H0G A;  1VF3 A;  2WDU A;  2K6V A;  2IN3 A;  1QXH A;  4MJA A;  1XW9 A;  3J7Y b;  2BTO T;  1NM3 A;  1SK2 A;  4I5Q A;  1BJX A;  1EZK A;  1XWG A;  1K3Y A;  1EV9 A;  4F03 A;  1XWC A;  5D9X A;  1JLV A;  4MPF A;  5AIS A;  1GNE A;  1BQ7 A;  2E7P A;  1YQ1 A;  3I69 A;  4ECI A;  1WWJ A;  2HSM A;  2NVL A;  3KH7 A;  4LA1 A;  3RPN A;  13GS A;  1FW1 A;  2G0F A;  4HUA A;  4I97 A;  4JR4 A;  3ZVJ D;  2IIY A;  3TGZ A;  4ZBA A;  2LTK A;  4EF0 A;  4DEJ A;  3EE2 A;  2QKE A;  3Q19 A;  2H19 A;  5G1K A;  1TK5 B;  5EL8 A;  2WB9 A;  2R2J A;  1O7U A;  4AGS A;  4GQF A;  4N0Z A;  1E6B A;  1J9B A;  5KN2 A;  1TK0 B;  4F82 A;  5GST A;  3SBC A;  1GWC A;  2OE0 A;  4OFM A;  4O5Q A;  3ZRD A;  2AJQ B;  2H71 A;  2XBQ A;  5J9B A;  3S9F A;  5CRD A;  2H0H A;  2XBI A;  1F6M C;  5IMZ A;  3SWL A;  3WT2 A;  1GTU A;  2QGV A;  4LMW A;  3WT1 A;  3APS A;  4PQI A;  4MH3 A;  3KJY A;  2ON5 A;  2KUC A;  4KH7 A;  4OWY A;  5C00 A;  5FWG A;  3F63 A;  4JED A;  4V1A g;  3QFA C;  5JCU A;  4FH8 A;  3U6V A;  2DJ2 A;  5D9T A;  1M9B A;  1TP9 A;  1YY7 A;  1YF1 A;  3HY2 A;  1VF4 A;  1EP7 A;  5JCG A;  1K0A A;  2FUG 2;  3IPZ A;  4MNN A;  1G7E A;  4HOJ A;  5JWO B;  1AXD A;  4ECJ A;  2F9S A;  2C0E A;  4MCU A;  4MZB A;  1GSE A;  1V2A A;  2YNX A;  5IMV A;  3IC8 A;  1J0F A;  3L4N A;  2FWE A;  1H75 A;  2IME A;  3ZYW A;  1ML6 A;  2DJJ A;  4ISD A;  3ZLP A;  2YPM A;  4AJ7 A;  2H1B A;  2M72 A;  1ILO A;  3ME8 A;  3CSI A;  1GRX A;  2C3T A;  2JZT A;  2HSY A;  4XTS A;  3MSZ A;  2I9H A;  2C3Q A;  5C04 A;  2YV7 A;  5L71 A;  1EEM A;  4L8E A;  4JE1 A;  3Q18 A;  1PKW A;  1PRX A;  3J7Y k;  3TB2 A;  3TKP A;  1G6Y A;  4POB A;  3NIV A;  4LLR A;  3TRQ A;  3LXZ A;  2RUF A;  5D9W A;  1M2D A;  1EGR A;  3VPQ A;  4GF0 A;  4HS1 A;  3LFL A;  2YOI A;  4PUF C;  3FZ4 A;  5DAL B;  1WOU A;  2E2M A;  3PPU A;  2WS2 A;  3LGC A;  4ZXG A;  4X4J A;  4NPB A;  3GUS A;  2L5L A;  5DVB A;  3TJB A;  2MMN A;  2JL4 A;  5IMA A;  3IC4 A;  1S3C A;  1SJI A;  1EGO A;  3UAP A;  1JZW A;  4POK A;  4IW9 A;  3HJP A;  4XS4 B;  1WRY A;  1XZO A;  1T4Y A;  1YDK A;  4TRX A;  3O76 A;  2HZE B;  4J56 E;  1GTA A;  4Q5Q A;  3DVX A;  1PX6 A;  3APQ A;  4EUY A;  2OAC A;  4K2D A;  2JAC A;  3CRT A;  5HR0 A;  2OKA A;  4WET A;  2IMD A;  2C0G A;  1KEB A;  4EVM A;  1Z6N A;  5LNK e;  2N5B A;  3P90 A;  4IP6 A;  2L6D A;  1ZZY A;  4IVF A;  4HEA 2;  4XCS A;  2FNO A;  1FHE A;  2H1D A;  2YWO A;  1O85 A;  3FHK A;  2BJX A;  2GT6 A;  3GKX A;  4IS0 A;  2OAD A;  4TKY A;  4ULX A;  2C4J A;  4IEL A;  3CRU A;  2LJR A;  2DJ0 A;  3O6T A;  1OC9 A;  3L9V A;  2YJH A;  3HKR A;  5DAL A;  2CQ9 A;  7GSS A;  2TIR A;  2H8L A;  1XOA A;  1QFN A;  3H8Q A;  3QCP A;  3IAM 2;  4NMU A;  2A2R A;  2OE1 A;  2C1Y A;  2FCH A;  1V40 A;  4HU7 A;  1EOH A;  4WF4 A;  2H1A A;  3G9B A;  2R0C A;  5DJL A;  4EDY A;  2IWT A;  1Z5Y E;  5J5N A;  1SEN A;  4XS4 A;  5JWR B;  2H30 A;  2HZE A;  2AV4 A;  3GSS A;  4D73 B;  1WE0 A;  5A4V A;  3GIX A;  3DGQ A;  3KTB A;  1MDK A;  1TK8 B;  3GX8 A;  1MDI A;  3A5I A;  5IIZ A;  3GST A;  4EXJ A;  3TRP A;  4HDE A;  1TI3 A;  1GLQ A;  3Q74 A;  2RLI A;  3UIW A;  2CAQ A;  2RM6 A;  3LYK A;  5GAP D;  2VCV A;  4H86 A;  5HFK A;  4G0K A;  1SU9 A;  3F4T A;  2F51 A;  2NPB A;  3GA4 A;  2YWN A;  3FR6 A;  2YP6 A;  2B3S A;  1V58 A;  4Q5R A;  2CVB A;  3NOF A;  1AQW A;  3I6A A;  2B7J A;  2K9F A;  3VI5 A;  4RUV A;  1YF0 A;  1A24 A;  3GKN A;  5D93 A;  2CAI A;  5B8A A;  2C8U A;  2VL2 A;  1K0O A;  2ALB A;  4GCI A;  1Z7R A;  1URM A;  1ERU A;  1HNC A;  3U5R E;  4YAP A;  1XW6 A;  2HRK A;  3G7J A;  3IAS 2;  1U3A A;  1GTI A;  3C7M A;  2XC2 A;  2I4A A;  3UBL A;  2XHF A;  5ELG A;  2X64 A;  3GYK A;  2FWG A;  1HD2 A;  1KTE A;  1I9D A;  3BD2 A;  2NTO A;  1LBK A;  1K0M A;  4MJE A;  3KP9 A;  1O81 A;  2G2Q A;  5ECK B;  14GS A;  2HRA A;  6GST A;  3CTG A;  1AQX A;  1FOH A;  2LJA A;  3FKF A;  4EO3 A;  2GTU A;  4HZ4 A;  3C1S A;  2X8G A;  1V98 A;  3RAZ A;  3D6I A;  3ISO A;  1ZYP A;  2F3M A;  6GSY A;  9GSS A;  1JZO A;  3KCM A;  1GUM A;  1QK8 A;  1PN9 A;  5KEJ A;  3QOU A;  4ZB9 A;  3GNJ A;  3HD5 A;  1TTZ A;  1XIY A;  2LUS A;  2AHE A;  3CBU A;  4DSS B;  1TI1 A;  1GUH A;  2H6Z A;  3FZA A;  4V2L A;  2LV3 A;  1TKD B;  6GSV A;  4HQS A;  4MMM A;  3AY8 A;  3ED3 A;  1TRW A;  1HYU A;  3GUR A;  3M3M A;  3HVV A;  3MDK A;  3EYT A;  4PX1 A;  2FA8 A;  4ML1 A;  3VWW A;  4MK3 A;  4XHM A;  5FHI A;  5HQP A;  2LRN A;  4O92 A;  2YJ7 A;  3DD3 A;  2V32 A;  6GSX A;  4ZL7 A;  2HZF A;  3FZ9 A;  1M0U A;  2PUK C;  4I8B A;  1VF2 A;  3RPP A;  5AIV A;  2ON7 A;  4TR1 A;  3GV1 A;  3UOM A;  5H5R A;  3QFB C;  4IHU A;  4RI7 A;  5G31 A;  1Q98 A;  2C0F A;  3ZML A;  5ELA A;  3VLN A;  4OCE A;  2YN1 A;  1OKT A;  1PL1 A;  1XVW A;  3C73 A;  2M80 A;  1PMT A;  3A2X A;  1AAZ A;  4KB3 A;  1G0T A;  3APO A;  5DQS A;  4NHZ A;  2EIQ A;  2WFC A;  1FAA A;  2WUL A;  4RQX A;  4QL7 A;  1SK0 A;  2H01 A;  2PGT A;  4KAE A;  5CRW A;  4DSS A;  3F6F A;  4XS6 A;  4CDO A;  2L57 A;  3LXT A;  3TRX A;  4IJ3 A;  3GKK A;  3FW2 A;  4PQ1 A;  5KOW A;  3D4M A;  2K18 A;  1ST9 A;  5DCG A;  2AYT A;  2ES7 A;  2RUE A;  5DJM A;  4NXI A;  5CO3 A;  2B5Y A;  2F8A A;  2ZCT A;  4K1F A;  2FY6 A;  3E9J B;  4BL7 B;  3LYP A;  4K0N A;  3EU3 A;  4BWS A;  1PGT A;  1QGV A;  2VLU A;  2YV9 A;  2B1K A;  2A2P A;  1JHB A;  2IMK A;  2IMI A;  4YAV A;  4KX4 A;  1RW1 A;  1IYI A;  4BPY A;  2ZNM A;  1X9M B;  2X8H A;  2LKU A;  2GS3 A;  1XPV A;  2B5E A;  3TCO A;  3TJJ A;  5HFI A;  1JLW A;  5ID2 A;  4YKG A;  3CMI A;  3EU4 A;  1B9X C;  4K8M A;  4CY6 A;  2QC7 A;  1B9Y C;  5J41 A;  1U88 A;  1GSD A;  2I81 A;  4V1A p;  5KN1 A;  4NV2 A;  3LWA A;  3UEM A;  4AJ8 A;  4EDZ A;  2LNT A;  2IPA A;  4FYC A;  1W89 A;  3L9S A;  2UZ8 A;  2MBT A;  1AIU A;  1GLP A;  3QMX A;  1K0N A;  4E8E A;  1M7T A;  2FA4 A;  3D5J A;  1C72 A;  5G5F A;  3A2V A;  4BL7 A;  1ZL9 A;  2REM A;  3V1W A;  2LEG A;  1X5D A;  3L0H A;  1XW5 A;  5A4W A;  2I1U A;  3KH9 A;  1O6J A;  1JZD A;  2LST A;  3HJO A;  4JZQ A;  1OE7 A;  3VWU A;  5D8I A;  3GRX A;  3ERF A;  3N5O A;  4PTS A;  3ZIT A;  4GSS A;  2HRN A;  3ZTL A;  4K5S A;  3E0U A;  2YZU A;  1A2L A;  2P0G A;  3MIX A;  5BMU A;  16GS A;  4GTU A;  3ZIJ A;  2VCX A;  1JZR A;  3O3T A;  2YWM A;  1MDJ A;  2B1L A;  2PWJ A;  4O7H A;  3EMX A;  1ABA A;  1XCC A;  5DAK B;  3FY7 A;  3VFI A;  1M2B A;  3TDG A;  3L9U A;  1GTB A;  5EY6 A;  1R5P A;  1R5A A;  1EP8 A;  2R0P A;  1A0R P;  3IHQ A;  4G0L A;  2XPE A;  1KBN A;  1ACV A;  4MAB A;  3D4T A;  1B4Q A;  3ZL5 A;  1OVN A;  4YQU A;  2TRC P;  5DBQ A;  3DVW A;  5HFG A;  4X1U A;  1O73 A;  1TOF A;  5G2Z A;  2FWF A;  4MF7 A;  1GNW A;  2DSA A;  2VCW A;  2PVQ A;  1BED A;  1TDI A;  1WPI A;  4Z2R A;  3PH9 A;  3ZMK A;  2DJK A;  2WRT A;  2AB6 A;  2NDO A;  3BOA A;  1ON4 A;  3WGD A;  2LQQ A;  4BVX B;  4X43 A;  4AF2 A;  2KHP A;  3EMP A;  4WBR D;  4YH2 A;  3HXS A;  1MEK A;  2LQO A;  4EIQ A;  1XXU A;  5DQY A;  3EWL A;  1EOG A;  4ECB A;  3WYW A;  1X9W B;  1B4P A;  4LL1 B;  4K7I A;  3RHB A;  4RQR A;  5ECO B;  3KGK A;  4DVC A;  1AW9 A;  2CX4 A;  4CW9 A;  2C3N A;  2HSH A;  4WEY A;  1DSB A;  4ZL8 A;  2V6O A;  3DEX A;  3K8N A;  5G30 A;  1XVQ A;  2CX3 A;  4NWY A;  5E4W A;  1YKC A;  1PKZ A;  2VUP A;  1UVZ A;  4N11 A;  5IQY A;  2JAD A;  5ECS A;  4FYB A;  4AJ6 A;  3IK7 A;  5ECR B;  1BG5 A;  3R3E A;  1F2E A;  2A4H A;  4OFN A;  3HZ8 A;  2GSQ A;  3G7I A;  2GQL A;  3I43 A;  5F0G A;  3EIN A;  1S3D A;  2M46 A;  4P3Y B;  4BVX A;  1WMJ A;  5CNW A;  2KLX A;  3TOU A;  3BCK A;  2JZS A;  2KP1 A;  3DYR A;  3FK8 A;  3ERW A;  4PNF A;  5AGY A;  2VAF A;  3GKM A;  1BAY A;  2GLR A;  2NBS A;  4MDC A;  1A8Y A;  2FHE A;  2A4V A;  2GZP A;  2VOC A;  3WD6 A;  1PSQ A;  2O85 A;  1FB0 A;  5F06 A;  2IFQ B;  1ERV A;  3ZFB A;  3HA9 A;  2X8C A;  1UC7 A;  3UMA A;  3ERG A;  3US3 A;  3H93 A;  4KW6 A;  4BVY B;  1ZYN A;  3H79 A;  2EC4 A;  5IO0 A;  3ZIV A;  4FO5 A;  2DKH A;  4KCA A;  5IPG A;  3FR9 A;  4ID0 A;  3IDV A;  3EC3 A;  2WCI A;  1HNB A;  1TW9 A;  3CTF A;  2H1G A;  1FOV A;  2FLS A;  1A0F A;  5IM9 A;  1TRS A;  1OC3 A;  3MNG A;  4HI7 A;  1DE2 A;  1SYR A;  2V2G A;  1RQM A;  3HYP A;  1AQV A;  1E2Y A;  1K3O A;  2V6K A;  3QR6 A;  3A5W A;  4HJM A;  3UVH A;  3ZZX A;  2HXK A;  1A23 A;  4TOP A;  2R0G A;  3M8N A;  4KUN A;  2RM5 A;  4HJ2 A;  3GTU B;  5HR3 A;  4NHW A;  3G7Y A;  3KEB A;  5GSS A;  2H72 A;  1SJZ A;  2L59 A;  3F4S A;  1W4V A;  5CRE A;  4D73 A;  2GVP A;  1OE8 A;  1GSU A;  4QL9 A;  4WBJ A;  5J4U A;  1ZMA A;  1DE1 A;  2EIO A;  4K9Z A;  2IFQ A;  2VM2 A;  5GAN D;  3GN3 A;  2YAN A;  4ZB8 A;  4TVE A;  2AAW A;  4MA9 A;  2DIZ A;  3IA1 A;  2OBK A;  2LJK A;  4ZBB A;  4BVY A;  1K0B A;  1TXX A;  1QQ2 A;  1PQN A;  4O5U A;  2DLX A;  3F8U A;  4TN8 A;  3W8S A;  4X0X A;  1FB6 A;  3P2A A;  4EIP A;  4BWQ A;  2H76 A;  3A3T A;  1B8X A;  4DSR A;  3LJR A;  1T3B A;  2CVK A;  2O7K A;  3DXB A;  1K3L A;  3F3Q A;  3BBY A;  4IBP A;  4PNG A;  2GDR A;  5CRG A;  2MMO A;  5ECL B;  2H75 A;  1XWK A;  4NV5 A;  3VPT A;  4G19 A;  2X49 A;  4MF5 A;  5BRT A;  3Q6O A;  3GTU A;  1XWA A;  5ECP B;  11GS A;  1SL2 B;  5IMD A;  2C80 A;  1ZGN A;  3M1G A;  3KMO A;  2OA7 A;  3RDW A;  2HI7 A;  1TU7 A;  1Y25 A;  5HR2 A;  1N8J A;  4FQU A;  2OBI A;  1GSQ A;  2K8V A;  3H1N A;  1S3A A;  1N2A A;  3CXG A;  5KN0 A;  1T4Z A;  3BCI A;  4G2E A;  3QD9 A;  3IE3 A;  1SKW B;  6GSU A;  1SJ6 A;  3ZVJ A;  3L78 A;  2R4V A;  2H66 A;  2MYG A;  5AN1 A;  1XBS A;  2D2Z A;  2Z9S A;  1V57 A;  3GFK A;  4LMV A;  4WR5 A;  2A2S A;  5D96 A;  2R5G A;  3ZFL A;  4F9Z A;  1OKD A;  4KND A;  3MAK A;  4MZC A;  4YQV A;  4KCE A;  5E59 A;  5ECI B;  5ECQ B;  3TUE A;  1PA3 A;  2CZ3 A;  3P7X A;  2JSZ A;  12GS A;  3HCZ A;  1NW2 A;  2BMX A;  4ZB6 A;  4G9H A;  2B5X A;  2IMF A;  2MZC A;  4CHS A;  1R26 A;  1XOB A;  5LCZ A;  1T7P B;  2QSI A;  3NZN A;  3HVS A;  1BYE A;  1GL8 A;  4TW5 A;  1Z6M A;  4ICY A;  4OO4 A;  4TXV A;  2E2G A;  3HZ4 A;  2FD3 A;  1EWX A;  4Z2T A;  3C1R A;  2AUV A;  1A2M A;  2OE3 A;  2VL9 A;  4ZBD A;  4PUA A;  1M2A A;  2CVD A;  3KIJ A;  5COH A;  2DJ1 A;  5IMF A;  3TJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...