3PH9A

Crystal structure of the human anterior gradient protein 3
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
133
structure length
133
Chain Sequence
PQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Anterior gradient protein 3 homolog
publication title Crystal structure of the human anterior gradient protein 3
rcsb
source organism Homo sapiens
total genus 45
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ph9A00
3RDWA 2VCVA 3FRCA 3KD0A 4NHWA 1EV9A 2AUVA 1TU8A 1PMTA 4POMA 2PMTA 2QC7A 2LNSA 1GSYA 3KMNA 4TR1B 1WIKA 16GSA 2JZTA 2YOIA 2KLXA 1GTBA 20GSA 3CYNA 3ZIJA 2H19A 1YZXA 4YQVA 5G30A 3FW2A 1ACVA 3TKPA 2PBJA 3I43A 3O6TA 3KM6A 4IVFA 1BEDA 1E6BA 4V1Ag 3GKKA 4EC0A 2H0IA 5D9XA 3BCKA 3PGTA 3KEBA 3HY2A 1SL1B 1K0MA 4KDUA 4F0CA 5G5FA 5ENUA 5CO3A 2WJUA 5G5EA 2Z9SA 5CREA 2OACA 3F6FA 3LYPA 2L59A 2DLXA 5DQSA 2F9SA 1EEJA 1Y6EA 4IP6A 4MCUA 1XWGA 1A2LA 1JFUA 3HVSA 2V6OA 3C73A 5D9WA 5C00A 1TRWA 4X0XA 2YZUA 1EOGA 2IJYA 2C80A 3EYTA 4GWRA 5JWQB 1XWCA 1B4PA 3G7YA 4MZBA 3GMFA 2L6CA 4RQRA 3VWWA 2I9HA 1Q4JA 2JL4A 2QSIA 1ST9A 4IBPA 4WETA 3GX8A 3P90A 3ZLPA 1F6MC 3DKSA 5AISA 1DE2A 4YQUA 3TJJA 3QFBC 4WBJA 3GSSA 2VCZA 3ZMLA 1PGTA 22GSA 1XWAA 4JBBA 3QFAC 3EU4A 1DBYA 1T00A 3L0HA 5IOXA 2C4JA 4K7NA 1WRYA 1VF1A 1TRVA 2E0QA 3DGQA 1Z7PA 5ECMB 3HJMA 3TGZA 2GLRA 1GLQA 1GSEA 4OO4A 1AC1A 2AAWA 2IMFA 4F9ZA 1JZOA 5JCGA 1UA5A 3C7MA 2LJRA 3QOUA 2ON7A 1K3LA 3TUEA 2K8SA 1VF2A 2DJJA 3KMOA 4ZL8A 2O8VB 4IKHA 3L9SA 1YKAA 1YEPA 1A0FA 4KW6A 4IJIA 1F9MA 4PNFA 1TK5B 1GUHA 1YEXA 2KP2A 3F8UA 1G6WA 2DJ0A 1W89A 3F0IA 1H4OA 2A2RA 5DBQA 3CRUA 4JE1A 2PERA 4EXJA 3QCPA 1EOHA 1USBA 5AIVA 6GSXA 3P2AA 1GUMA 2AV4A 2B5XA 2CV4A 2H72A 1TK0B 5ECLB 2RUFA 1DSBA 1SJZA 4ZBBA 3V1WA 1B9XC 4Q5NA 4ULXA 2CAIA 3ED3A 2OBKA 4LMWA 12GSA 6GSUA 1BX9A 4EDZA 3ME8A 2C0EA 3TOTA 3APQA 4BWQA 2DC5A 1PD21 1JZDA 2EIQA 5G31A 1K0OA 2MMNA 2PGTA 2LKUA 3FZ4A 1QFNA 2EIRA 1NSWA 2MBSA 1EZKA 1N2AA 3GIXA 1GULA 2VM1A 2CA8A 3H1NA 5D93A 4EKZA 5D9VA 3JCML 4ISDA 1XWBA 2N5FA 3QAGA 1HNCA 1T4ZA 4MLYA 2K8VA 5CRWA 4IW9A 2H8LA 2HNLA 5IMAA 3G7JA 5EL8A 4OFMA 3TKSC 1VGLA 3KTBA 2R3XA 4MJEA 2I1UA 1ERUA 1GSQA 3EVIA 1R5PA 2HLSA 4NMUA 3K8NA 3IC4A 3TRQA 1GSUA 2NPBA 3LORA 3GKNA 4RI7A 5KN2A 1OC8A 4LLRA 2H1GA 1U3IA 2LSTA 4L8EA 2C3QA 2YANA 1OC9A 3VI7A 4RQXA 2XPEA 3LXTA 1BYEA 2C3NA 1LU4A 1TRSA 3UVTA 2H1AA 2CX4A 4IHUA 4K0GA 3IV4A 4NPBA 2VCXA 2GVPA 4ZB9A 1TI1A 3ZREA 9GSSA 2PN8A 3TKSA 2B6MA 1ML6A 2F8AA 4OWYA 3ME7A 5F8BA 1E2YA 1TP9A 2P5QA 4L0WA 2FWEA 3FHKA 2YWIA 5INYA 4HDEA 2LJAA 2OA7A 2DIZA 1B48A 1F37A 3M3MA 1X9WB 4O32A 2CVDA 2AYTA 5EPFA 2FWFA 2YCDA 4NV5A 3L4NA 1TXXA 2RLIA 1WP0A 3CSHA 3GURA 4BA7A 1FVKA 1SD9A 3W6GA 4I5QA 4HZ2A 5ECPB 2I3YA 4F2IA 2FA8A 3FR6A 2PVOC 3E3EA 3TKSE 6GSSA 5ECRB 3EC3A 4WBRD 4MK3A 2ZUPA 3WGXA 4KUNA 1A2JA 5EY6A 1T3BA 2JZRA 1Z5YE 3PR8A 1SU9A 4PQHA 1XVQA 3J7Yk 1J0FA 3ZVJA 4NXIA 4DEJA 2OE1A 1GWCA 1ZZYA 5D96A 3ZITA 1YJ6A 4MMMA 1V9WA 3F4SA 4FH8A 3DMLA 1OE8A 2AJQB 2L6DA 2HZEA 2XBQA 1KEBA 2MMAA 3WGDA 1W4VA 4TXVA 3HZ8A 1PSQA 3KH9A 1O6JA 2ALBA 1ZCPA 4V2NA 4DSSB 1K0DA 1IYHA 1R4WA 2X8HA 1XIYA 3VWUA 4BVXA 4ZL7A 1A0RP 5B8BA 1FB6A 4OD7A 1SJ6A 1SK0A 2QGVA 2JSZA 5CNWA 1JZRA 4TR3A 2LUSA 2BMXA 4K0NA 4Q5RA 1XBSA 1GL8A 3E9JB 4NAXA 4RUVA 4HUAA 3KCMA 2H75A 1FAAA 2FY6A 2G0FA 4HU9A 1ZOFA 2YWNA 3F63A 3PH9A 5ECKB 2EIOA 2GTUA 3TJKA 4MPFA 1GSSA 3NIVA 1TK8B 1TJDA 3IBHA 3ERGA 1O8WA 3D0ZA 3S9FA 5A4WA 1M99A 1MDIA 5G1KA 1EGOA 1V40A 1A2MA 4KA0A 3CBUA 1QMVA 1GTUA 1A8YA 5IMVA 3TKQA 1ABAA 2L4CA 4D73A 2CAQA 4BVYA 1HNAA 1SYRA 5FHIA 2YV7A 3TJBA 2H66A 2GSRA 3L78A 5D9TA 3QPMA 1ZL9A 2IMIA 2MZCA 1GLPA 4MA9A 2VUPA 4GSNA 4MP4A 3KTLA 4V1Ap 4XHMA 4BWSA 2RIIA 5ECQB 2YPMA 3BOAA 3HD5A 1TRUA 1F3AA 4PGTA 2B5EA 5J41A 4JZQA 3F6DA 2OE3A 2VCWA 4J2FA 2EC4A 4K1FA 2H1DA 4HI7A 5KN0A 5HFKA 1RW1A 5J9CA 1LJRA 5DCGA 4IQ1A 1GP1A 4ECJA 1PX6A 4K7IA 1ON4A 10GSA 5IOWA 3KJYA 3RHBA 1B8XA 2M80A 3I6AA 2O85A 4P3YB 4MDCA 4O7HA 4ML6A 4GSTA 2HZFA 1R5AA 4EF0A 1A8LA 4TR1A 2N5AA 4FO5A 4XRDA 3E0UA 3C1SA 2XPDA 3A2XA 3IXRA 5ID2B 2VD1A 3A2WA 3MWHA 1SKRB 5JCWA 2GGTA 2H0HA 2VL3A 3BCIA 4ECBA 4I97A 1PRXA 1X5CA 2JZSA 1EWXA 2R4VA 3HXSA 4HZ4A 3HKRA 3GFKA 2H74A 3ERFA 2E2GA 18GSA 3HHVA 4ZBAA 4NV2A 1HYUA 3DVXA 1TDIA 2BTOT 3DEXA 2WRTA 3IRAA 4KCAA 5A4UA 4WR5A 5J4UA 2HXKA 2DJ3A 1AW9A 3QAWA 1M7TA 4KCEA 2LS5A 3ZFLA 3HJPA 2LRTA 3F4RA 2V6KA 4MH2A 4V2LA 4TR0A 3BJ5A 2NVLA 4KAEA 3VPTA 4AF2A 3RPNA 5KN1A 2K6VA 3BD2A 2E2MA 1TOFA 5JWRB 2J23A 5A4VA 5J3RA 3KP8A 4WEYA 5H5SA 2CVBA 2PUKC 3EU3A 1N8JA 1EV4A 2V1MA 1XCCA 3D4TA 3VK9A 2FNOA 2YWMA 1PN9A 1R26A 2J9HA 2ES7A 2QKEA 4GRFA 2H73A 3TJFA 1GTAA 4ACSA 1T7PB 2VM2A 3HVVA 1H75A 3D4MA 3H8QA 3VWXA 2GZPA 3Q18A 1LBKA 3APOA 3M9JA 5J9BA 3UBLA 4XCSA 2WGRA 3VPQA 5DALA 4QL9A 4KSOA 2GQLA 4K6XA 1K0AA 1GH2A 2VLTA 5IO0A 3IOSA 4CHSA 2X8GA 1V57A 2E7PA 2WZ9A 2H70A 2JU5A 2PPTA 3D22A 1NHYA 4Z7XA 2MYGA 1TW9A 2HT9A 3DIEA 1AQWA 1X0RA 1IYIA 4HEA2 4GTUA 4EDYA 5LNKe 2HRNA 1GTIA 2HYXA 4NHZA 5G2ZA 1G7OA 4POLA 5HQPA 1I9DA 1JZWA 2KHPA 3CTGA 3GA4A 3KXOA 4I6XA 2XBIA 5DQYA 2DJKA 5B6MA 2I4AA 1RQMA 2O7KA 3TOUA 5ELGA 1XOBA 4ZIJA 3A3TA 1EEMA 5GAPD 3GH6A 2FUG2 1VF3A 1ERWA 4TRXA 5FWGA 3SWLA 5KN3A 2X8CA 5D73A 4HS1A 2HSYA 5AN1A 3W8SA 6GSTA 4HOJA 1CQHA 4WR4A 2H76A 3GKXA 2VCTA 1G0TA 2HFDA 2C1YA 6GSVA 5IIZA 4JR6A 1M2AA 1WWJA 5HFGA 2M46A 1AXDA 1DUGA 2LQOA 5DAKB 4KGIA 4EL1A 1MTCA 3HCZA 3FEUA 3FY7A 3ZIVA 2ON5A 3UEMA 1CQGA 4MF7A 2TRXA 2AHEA 5IPGA 3C71A 3H4KA 3I9V2 4K7OA 2DMLA 1SKSB 4KH7A 2GZYA 1DE1A 2TRCP 3IE3A 2IFQB 3RBTA 3GTUB 4YQMA 3GX0A 3U6VA 1Y25A 1F3BA 2A2SA 2MMOA 4ILFA 2YZHA 4N0VA 1ZYEA 1FHEA 3LSZA 4TVEA 2YWOA 2YP6A 4EUYA 5IMDA 3IA1A 4KX4A 2V41A 4TN8A 3PINA 3GV1A 1S3AA 2L4QA 2R5GA 1BJXA 3QAVA 1THXA 1FW1A 3M0FA 5CRHA 1OE7A 2P31A 2V32A 3D6IA 2H1BA 5HFIA 1ZYQB 2R6KA 2R37A 3HZ4A 1Z7RA 1M0UA 4DSQA 5CRGA 1SD8A 1U88A 4TXOB 2YJ7A 1JHBA 1FVJA 4TR4A 5G1LA 4JU5A 2HSHA 3KGKA 1THOA 3I69A 5D8IA 3ISOA 4LL4B 4PUAA 2L57A 1T4YA 4BL7A 2WDUA 2ZCTA 2CZ3A 3GSTA 1SENA 1O7UA 2FA4A 3CMIA 5DVBA 5E4WA 5H5RA 5GAND 4JRRA 3GL3A 4XTSA 1M2DA 3TB2A 4CW9A 1U87A 1MDJA 1QK8A 2P5RA 4MABA 3KZQA 1NM3A 3QR6A 2JACA 1XW9A 1M9BA 3FKFA 1SK1A 2IN3A 2F8FA 2NTOA 2GSQA 4OMVA 4G19A 4LMVA 1PQNA 4FIWA 4I2TA 2GDRA 4QQ7A 3F9UA 2GSSA 5ECNB 1KTEA 3HYPA 4HJMA 2CZ2A 2H71A 1Z3EA 3N9JA 2GS3A 2IIYA 3J7Yb 3A5WA 1PL2A 2FGXA 2D2ZA 2CQ9A 4IN0A 2FCHA 2IMKA 2REMA 4G2EA 1SYXA 4XS4B 5ABRA 5HR1A 4DVCA 4H86A 1S3CA 5DDLA 2VAFA 2LJKA 4PX1A 2DSAA 2ZNMA 3SBCA 11GSA 3FYGA 2IMEA 1V2AA 3GUSA 4NWYA 4F0BA 2GQKA 2N5BA 1T1VA 1A23A 2IWTA 1XWKA 3P8WA 4ML1A 4BPYA 5F07A 2L5LA 1ZGNA 2O89A 1ILOA 3L9UA 4OO5A 2A4VA 4D73B 1OC3A 1SJIA 2OKAA 3WT1A 4N0ZA 4KSMA 1X5EA 1ERVA 2GSTA 2H30A 2H6ZA 1UVZA 3UARA 3FR9A 4TW5A 2VD0A 3CSIA 1A24A 1PA3A 4ID0A 4ZXGA 1BG5A 2C0GA 1RK4A 2LEGA 1U3AA 3N5OA 3R2QA 5L71A 2LV3A 1PKWA 4ZB6A 1HNBA 4PQIA 4V2MA 3Q19A 4KNDA 5E59A 3QMXA 3FR3A 5GSSA 3KIJA 1PKZA 2B5YA 1X9MB 1ZMAA 1C72A 3FZ9A 4OCFA 3FK8A 3GNJA 4J56E 2VOCA 17GSA 4FYBA 4OFTA 1BQ7A 5HR3A 4J57E 5F0GA 1XOAA 2WULA 4ECCA 4IELA 3HJOA 4EVMA 1WMJA 2LNTA 1TI3A 2C0DA 3RHCA 1QGVA 3ZFBA 3F3RA 4ZBDA 1B9YC 4MF6A 3WGEA 2MMZA 2B1KA 1MDKA 7GSSA 3KP9A 3LEFA 4FYCA 2O87A 1K0BA 1WOUA 1XFLA 2CVKA 3IHQA 1K3YA 3DWVA 4MJCA 3ERWA 2F3MA 3LQ7A 1XZOA 2HE3A 3MNGA 1AIUA 4K8MA 4PNGA 2VL9A 1FG4A 4OCEA 2NDOA 1Z9HA 3WYWA 5ECIB 1M2BA 2K9FA 2LTKA 5CP1A 4EO3A 5JWOB 1GRXA 19GSA 4ZB8A 1YQ1A 5DJLA 4L5LA 5CYYA 5HR0A 3OR5A 3VWVA 2H6YA 4TOPA 3CRTA 1VF4A 3IAS2 3GN3A 1Q98A 1SK2A 5FT3A 4K2DA 2MBTA 4N11A 5H5QA 2KP1A 3TCOA 3IR4A 4XS1A 1EP8A 3DYRA 4G9HA 2FLSA 3IAM2 3UIWA 3GHAA 2RM6A 5ID2A 1T8EB 1OKTA 1SL0B 4WF4A 4XRAA 1TKDB 3ZVJD 3GYKA 3LYKA 5GZZB 2VCQA 1AUCA 2VLVA 3UBKA 4JEDA 1YF0A 3DXBA 2H01A 5B6NA 5B7CA 4N10A 1AAZA 3DVWA 4WXTA 1QQ2A 4O92A 3WD6A 3UVHA 5AIXA 4POKA 1X5DA 1XW5A 1M9AA 2I81A 1K3OA 4YH2A 1X9SB 1QUWA 8GSSA 2L5OA 5DALB 1J9BA 2WB9A 4AJ8A 1GSDA 3VURA 1YF1A 1WE0A 3HDCA 1J08A 1XXUA 3L9VA 1JLWA 3EWLA 5CRDA 4HQZA 3F3QA 4IGJA 4IQAA 1TU7A 1XPVA 2WCIA 3VLNA 3GH9A 2RUEA 4IP1A 4MH3A 5LD0A 3TKRA 4MZWA 3GL5A 4X1UA 5IQYA 4YAVA 4JR4A 2PU9C 5IMFA 3M1GA 1B4QA 2JADA 3LWAA 2OADA 3ZTLA 2FWGA 4PXOA 2PWJA 4GQFA 1GNEA 2X64A 3M8NA 3LG6A 2VIMA 3O76A 1U6TA 1FB0A 4ECIA 3EMXA 2M72A 5ECHB 1YY7A 4X43A 5CAXA 1XW6A 5J5NA 3VI5A 5KEJA 2GZZA 3RAZA 3NZNA 5JCUA 5A5KA 4Q5FA 1HQOA 1EGRA 4HU7A 2F51A 2XHFA 2AB6A 2WFCA 3O3TA 2B1LA 4POBA 4GXZA 5ECOB 3D5JA 3UMAA 4GCIA 3EURA 3EMPA 3HA9A 4HJ2A 1OYJA 4DSRA 1GUKA 1Z6NA 3ZYWA 2DMMA 1R7HA 4FYUA 1K0NA 2YV9A 1OC9B 3H79A 4GF0A 3TRPA 4ZL9A 3UJ1A 1V98A 1URMA 3GKMA 6GSYA 3CTFA 3LJRA 2PVQA 2V2GA 2GT5A 3DD3A 1WPIA 3WT2A 2BJXA 3G7IA 1KNGA 2K18A 2DBCA 2TIRA 1S3DA 1HD2A 2VLUA 1KBNA 3Q74A 2JSYA 1O73A 5COHA 2B7KA 1YKCA 2YNXA 2LRNA 1AQXA 2C0FA 3U5RE 3F4TA 4MJAA 2H6XA 4E8HA 3BBYA 5AGYA 5DAKA 1OVNA 5F05A 2OBIA 4AJ7A 1PX7A 4KB3A 2CX3A 4XIHA 2B3SA 1MD4A 5IM9A 1G6YA 4TKYA 4IJ3A 1GSFA 4MJBA 5IPHA 4ZILA 4MPGA 2R2JA 3AY8A 4HQSA 4F82A 1YDKA 2B7JA 4XS6A 1WJKA 5IO2A 3RPPA 2IFQA 2RM5A 3GTUA 5HR2A 3DRNA 2YJHA 3C1RA 4PQ1A 1MD3A 5ELAA 4GQCA 1O81A 5DJMA 4WF5A 5F06A 3D21A 1QXHA 5B8AA 3IPZA 3UAPA 3C8EA 4KE3A 3TDGA 3H93A 4GLTA 4CDOA 3US3A 3M9KA 5IMCA 2DIYA 3A2VA 4N30A 4Q5QA 4I2UA 4KDXA 4E8EA 1OKDA 1XVWA 5C04A 3ZMKA 3VFIA 2HZEB 1UN2A 2IPAA 1SL2B 3UOMA 4L5OA 4QL7A 1V58A 1O85A 4RI6A 3EINA 3FZAA 2GQMA 2G2QA 3LFLA 4TXOA 1F2EA 2VL2C 3QD9A 2FWHA 4MF5A 6GSWA 2WS2A 2KOKA 5DCHA 3P7XA 1UC7A 4EE0A 2HI7A 1K0CA 4IS0A 3MDKA 4O5RA 4F03A 4AGSA 1BAYA 3IDVA 14GSA 4PUFC 2IL3A 2C8UA 3UL3A 3IK7A 3IK9A 3KH7A 1JLVA 3TRXA 4LA1A 4LL1B 4G10A 5IMZA 2VO4A 4OFNA 1ERTA 2GT6A 2YN1A 2X99A 3W8JA 3ZL5A 2XC2A 2KUCA 3EE2A 2DJ2A 1VRSD 2LRCA 2VL2A 13GSA 5LCZA 2OE0A 2CT6A 2C3TA 1TTZA 1FO5A 1NW2A 3QDNA 1GNWA 4AJ6A 3Q6OA 3MAKA 2OJLA 4K9ZA 2FHEA 1MEKA 2DJ1A 3CXGA 4DSSA 3LXZA 3ZRDA 1OAZA 4XS4A 3MSZA 2IMDA 4MZCA 1NHOA 2NBSA 1EP7A 2LQQA 4KDYA 1O8XA 3G9BA 2HRFA 1PL1A 3TJGA 3NOFA 2H0GA 1AQVA 3HVXA 1SKWB 2FD3A 5EVOA 1G7EA 4GSSA 3APSA 1I5GA 5ECSA 4L0UA 5GSTA 2P0GA 4WKWA 4PURA 1FOVA 3FZ5A 3CSJA 3GRXA 3LGCA 1Z6MA 3ZZXA 4I8BA 4YAPA
chains in the Genus database with same CATH superfamily
3RDWA 2VCVA 3FRCA 3KD0A 4NHWA 1EV9A 2AUVA 1TU8A 1PMTA 4POMA 2PMTA 2QC7A 2LNSA 1GSYA 3KMNA 4TR1B 1WIKA 16GSA 2JZTA 2YOIA 2KLXA 1GTBA 20GSA 3CYNA 3ZIJA 2H19A 1YZXA 4YQVA 5G30A 3FW2A 1ACVA 3TKPA 2PBJA 3I43A 3O6TA 3KM6A 4IVFA 1BEDA 1E6BA 4V1Ag 3GKKA 4EC0A 2H0IA 5D9XA 3BCKA 3PGTA 3KEBA 3HY2A 1SL1B 1K0MA 4KDUA 4F0CA 4MNNA 5G5FA 5ENUA 5CO3A 2WJUA 5G5EA 2Z9SA 5CREA 2OACA 3F6FA 3LYPA 2L59A 2DLXA 4Z2TA 5DQSA 2F9SA 1EEJA 1Y6EA 4IP6A 4MCUA 1XWGA 1A2LA 1JFUA 3HVSA 2V6OA 3C73A 5D9WA 5C00A 1TRWA 4X0XA 2YZUA 1EOGA 2IJYA 2C80A 3EYTA 4GWRA 5JWQB 1XWCA 1B4PA 3G7YA 4MZBA 3GMFA 2L6CA 4RQRA 3VWWA 2I9HA 1Q4JA 2JL4A 2QSIA 1ST9A 4IBPA 4WETA 3GX8A 3P90A 3ZLPA 1F6MC 3DKSA 5AISA 1DE2A 4YQUA 3TJJA 3QFBC 4WBJA 3GSSA 2VCZA 3ZMLA 1PGTA 22GSA 3FMWA 1XWAA 4JBBA 3QFAC 3EU4A 1DBYA 1T00A 3L0HA 5IOXA 2C4JA 4K7NA 1WRYA 1VF1A 1TRVA 2E0QA 3DGQA 1Z7PA 5ECMB 3HJMA 3TGZA 2GLRA 1GLQA 1GSEA 4OO4A 1AC1A 2AAWA 2IMFA 4F9ZA 1JZOA 5JCGA 1UA5A 3C7MA 2LJRA 3QOUA 2ON7A 1K3LA 3TUEA 2K8SA 1VF2A 2DJJA 3KMOA 4ZL8A 2O8VB 4IKHA 3L9SA 1YKAA 1YEPA 1A0FA 4KW6A 4IJIA 1F9MA 4PNFA 1TK5B 1GUHA 1YEXA 2KP2A 3F8UA 1G6WA 2DJ0A 1W89A 3F0IA 1H4OA 2A2RA 5DBQA 3CRUA 4JE1A 2PERA 4EXJA 3QCPA 1EOHA 1USBA 5AIVA 6GSXA 3P2AA 1GUMA 5BRTA 2AV4A 2B5XA 2CV4A 2H72A 4K2XA 1TK0B 5ECLB 2RUFA 1DSBA 1SJZA 4ZBBA 3V1WA 1B9XC 4Q5NA 4ULXA 2CAIA 3ED3A 2OBKA 4LMWA 12GSA 6GSUA 1BX9A 4EDZA 3ME8A 2C0EA 3TOTA 3APQA 4BWQA 2DC5A 1PD21 1JZDA 2EIQA 5G31A 1K0OA 2MMNA 2PGTA 2LKUA 3FZ4A 1QFNA 2EIRA 1NSWA 2MBSA 3IHGA 1EZKA 1N2AA 3GIXA 1GULA 2VM1A 2CA8A 3H1NA 5D93A 4EKZA 5D9VA 3JCML 4ISDA 1XWBA 2N5FA 3QAGA 1HNCA 1T4ZA 4MLYA 2K8VA 5CRWA 4IW9A 2H8LA 2HNLA 5IMAA 3G7JA 5EL8A 4OFMA 3TKSC 1VGLA 3KTBA 2R3XA 4MJEA 1PN0A 2I1UA 1ERUA 1GSQA 1PFOA 1R5PA 3EVIA 2HLSA 4NMUA 3K8NA 3IC4A 3TRQA 1GSUA 2NPBA 3LORA 3GKNA 4RI7A 5KN2A 1OC8A 4LLRA 2H1GA 1U3IA 3EPTA 2LSTA 4L8EA 2C3QA 2YANA 1OC9A 3VI7A 4RQXA 4EIQA 2XPEA 3LXTA 1BYEA 2C3NA 1LU4A 1TRSA 3UVTA 2H1AA 1ZYNA 4O5UA 2CX4A 4IHUA 4BL7B 4K0GA 3IV4A 4NPBA 4USSA 2VCXA 2GVPA 4ZB9A 1TI1A 3ZREA 9GSSA 2PN8A 3TKSA 2B6MA 1ML6A 2F8AA 4OWYA 3ME7A 5F8BA 1E2YA 1TP9A 2P5QA 4L0WA 2FWEA 3FHKA 2YWIA 5INYA 4HDEA 4X4JA 2LJAA 2OA7A 2DIZA 1B48A 1F37A 3M3MA 1X9WB 4O32A 2CVDA 2AYTA 5EPFA 2FWFA 2YCDA 4KF9A 4NV5A 3L4NA 1TXXA 2RLIA 1WP0A 3CSHA 3GURA 4BA7A 1FVKA 1SD9A 3W6GA 4I5QA 4HZ2A 5ECPB 2I3YA 4F2IA 2FA8A 3FR6A 2PVOC 3E3EA 3TKSE 6GSSA 5ECRB 3EC3A 4WBRD 4MK3A 2ZUPA 3WGXA 4KUNA 1A2JA 5EY6A 4YKFA 1T3BA 2JZRA 1Z5YE 3PR8A 1SU9A 4PQHA 1XVQA 3J7Yk 1J0FA 3ZVJA 4NXIA 4DEJA 2OE1A 1GWCA 1ZZYA 5D96A 3ZITA 1YJ6A 4MMMA 1V9WA 3F4SA 4FH8A 3DMLA 1OE8A 2AJQB 2L6DA 2HZEA 2XBQA 1KEBA 2MMAA 3WGDA 1W4VA 4TXVA 3HZ8A 1PSQA 3KH9A 1O6JA 2ALBA 1ZCPA 4V2NA 4DSSB 1K0DA 1IYHA 1R4WA 2X8HA 1XIYA 3VWUA 4BVXA 4ZL7A 1A0RP 5B8BA 1FB6A 4OD7A 1SJ6A 1SK0A 2QGVA 2JSZA 5CNWA 1JZRA 4TR3A 2LUSA 2BMXA 4K0NA 4Q5RA 1XBSA 1GL8A 3E9JB 4NAXA 4RUVA 4HUAA 4A5PA 3KCMA 2H75A 1FAAA 2FY6A 2G0FA 4HU9A 1ZOFA 2YWNA 3F63A 3PH9A 3LW9A 5ECKB 2EIOA 2GTUA 3TJKA 4MPFA 1GSSA 3NIVA 1TK8B 1TJDA 3IBHA 3ERGA 5BMUA 1O8WA 3D0ZA 3S9FA 5A4WA 1M99A 1MDIA 5G1KA 1EGOA 1V40A 1A2MA 4KA0A 3CBUA 1QMVA 1GTUA 1A8YA 5IMVA 3TKQA 1ABAA 2L4CA 4D73A 4G0KA 2CAQA 4BVYA 4Z2UA 1HNAA 1SYRA 5FHIA 2YV7A 3TJBA 2H66A 2GSRA 3L78A 5D9TA 3QPMA 1ZL9A 2IMIA 2MZCA 1GLPA 4MA9A 2VUPA 4GSNA 4MP4A 3KTLA 4V1Ap 4XHMA 4BWSA 4K5SA 2RIIA 5ECQB 2YPMA 3BOAA 3HD5A 1TRUA 1F3AA 4PGTA 2B5EA 5J41A 4JZQA 3F6DA 2OE3A 2VCWA 4J2FA 2EC4A 4K1FA 2H1DA 4HI7A 5KN0A 5HFKA 1RW1A 5J9CA 1LJRA 5DCGA 4IQ1A 1GP1A 4ECJA 1PX6A 4Z2RA 4K7IA 1ON4A 10GSA 1M3JA 5IOWA 3KJYA 3RHBA 1B8XA 2M80A 3I6AA 2O85A 4P3YB 4MDCA 4O7HA 4ML6A 4GSTA 2HZFA 2QA2A 1R5AA 4EF0A 4O5QA 1A8LA 4TR1A 2N5AA 4FO5A 4XRDA 3E0UA 3C1SA 2XPDA 3A2XA 3IXRA 5ID2B 2VD1A 3A2WA 3MWHA 1SKRB 5JCWA 2GGTA 2H0HA 2VL3A 3BCIA 4ECBA 4I97A 1PRXA 1X5CA 2JZSA 1EWXA 2R4VA 3HXSA 4HZ4A 3HKRA 3GFKA 2H74A 3ERFA 2E2GA 18GSA 3HHVA 4ZBAA 4NV2A 1HYUA 3DVXA 1TDIA 2BTOT 3DEXA 2WRTA 3IRAA 4KCAA 5A4UA 4WR5A 5J4UA 2HXKA 2DJ3A 1AW9A 3QAWA 1M7TA 4KCEA 2LS5A 3IC8A 3ZFLA 3HJPA 2LRTA 3F4RA 2V6KA 4MH2A 4V2LA 4TR0A 3BJ5A 2NVLA 1FOHA 4KAEA 3VPTA 4AF2A 3RPNA 5KN1A 2K6VA 3BD2A 2E2MA 1TOFA 5JWRB 2J23A 5A4VA 5J3RA 3KP8A 4WEYA 5H5SA 2CVBA 2PUKC 3EU3A 1N8JA 4BIKA 1EV4A 2V1MA 1XCCA 3D4TA 3VK9A 2FNOA 2YWMA 1PN9A 1R26A 2J9HA 2ES7A 2QKEA 4GRFA 2H73A 3TJFA 1GTAA 4ACSA 1T7PB 2VM2A 3HVVA 4FQUA 1H75A 3D4MA 3H8QA 3VWXA 2GZPA 3Q18A 1LBKA 3APOA 3M9JA 5J9BA 3UBLA 4XCSA 2WGRA 3VPQA 5DALA 4QL9A 4KSOA 2GQLA 4K6XA 1K0AA 1GH2A 2VLTA 5IO0A 3IOSA 4CHSA 2X8GA 1V57A 2E7PA 2WZ9A 2H70A 2JU5A 2PPTA 3D22A 1NHYA 4Z7XA 2MYGA 1TW9A 2HT9A 3DIEA 1AQWA 1X0RA 1IYIA 4HEA2 4GTUA 4EDYA 5LNKe 2HRNA 1GTIA 2HYXA 4NHZA 5G2ZA 1G7OA 4POLA 5HQPA 1I9DA 1JZWA 2KHPA 3CTGA 3GA4A 3KXOA 4I6XA 2XBIA 5DQYA 2DJKA 5B6MA 2I4AA 1RQMA 2O7KA 3TOUA 5ELGA 1XOBA 4ZIJA 3A3TA 1EEMA 2DKHA 5GAPD 3GH6A 2FUG2 1VF3A 2X49A 4PTSA 1ERWA 4TRXA 5FWGA 4CY8A 3SWLA 5KN3A 2X8CA 5D73A 4HS1A 2HSYA 5AN1A 3W8SA 6GSTA 4HOJA 1CQHA 4WR4A 2H76A 3GKXA 2VCTA 1G0TA 2HFDA 2C1YA 6GSVA 5IIZA 4JR6A 1M2AA 1WWJA 5HFGA 2M46A 1AXDA 1DUGA 3PPUA 2LQOA 5DAKB 4KGIA 4EL1A 1MTCA 3HCZA 3FEUA 3FY7A 3ZIVA 2ON5A 3UEMA 1CQGA 4MF7A 2TRXA 2AHEA 5IPGA 3C71A 3H4KA 3I9V2 4K7OA 2DMLA 1SKSB 4KH7A 2GZYA 4G0LA 1DE1A 2TRCP 3IE3A 2IFQB 3RBTA 3GTUB 4YQMA 3GX0A 3U6VA 1Y25A 1F3BA 2A2SA 2UZ8A 2MMOA 4ILFA 2YZHA 4N0VA 1ZYEA 1FHEA 3LSZA 4TVEA 2YWOA 2YP6A 4EUYA 5IMDA 3IA1A 4KX4A 2V41A 4TN8A 3PINA 2X4AA 3GV1A 1S3AA 2L4QA 2R5GA 1M3IA 3QAVA 1BJXA 1THXA 1FW1A 3M0FA 5CRHA 1OE7A 2P31A 3A5IA 2V32A 3D6IA 2H1BA 5HFIA 1ZYQB 2A2PA 2R6KA 2R37A 3HZ4A 1Z7RA 1M0UA 4DSQA 5CRGA 1SD8A 1U88A 4TXOB 2YJ7A 1JHBA 1FVJA 4TR4A 5G1LA 4JU5A 2HSHA 3KGKA 1THOA 3I69A 5D8IA 3ISOA 4LL4B 4PUAA 2L57A 1T4YA 4BL7A 2WDUA 2ZCTA 2CZ3A 3GSTA 1SENA 1O7UA 2FA4A 3CMIA 5DVBA 5E4WA 5H5RA 5GAND 4JRRA 3GL3A 4XTSA 1M2DA 3TB2A 4CW9A 1U87A 1MDJA 2HRAA 1QK8A 2P5RA 4MABA 3KZQA 1NM3A 3QR6A 2JACA 1XW9A 1M9BA 3FKFA 1SK1A 2IN3A 2F8FA 2NTOA 2GSQA 4OMVA 4G19A 4LMVA 1PQNA 4FIWA 4I2TA 2GDRA 4QQ7A 3F9UA 2GSSA 5ECNB 1KTEA 3HYPA 4HJMA 2CZ2A 2H71A 1Z3EA 2R0CA 3HVNA 3N9JA 2GS3A 2IIYA 3J7Yb 3A5WA 1PL2A 2FGXA 2D2ZA 2CQ9A 4IN0A 2FCHA 2IMKA 2REMA 2HRKA 4G2EA 1SYXA 4XS4B 5ABRA 5HR1A 4DVCA 4H86A 1S3CA 4K5RA 5KOXA 5DDLA 2VAFA 2LJKA 4PX1A 2DSAA 2ZNMA 3SBCA 11GSA 3FYGA 2IMEA 1V2AA 3GUSA 4NWYA 4F0BA 2GQKA 2N5BA 1T1VA 1A23A 2IWTA 1XWKA 3P8WA 4ML1A 4BPYA 5F07A 2L5LA 1ZGNA 2O89A 1ILOA 3L9UA 4OO5A 2A4VA 4D73B 1OC3A 1SJIA 2OKAA 3WT1A 4N0ZA 4KSMA 1X5EA 1ERVA 2GSTA 2H30A 2H6ZA 1UVZA 3UARA 3FR9A 4TW5A 2VD0A 3CSIA 1A24A 1PA3A 4ID0A 4ZXGA 1BG5A 2C0GA 1RK4A 2LEGA 1U3AA 3N5OA 3R2QA 5L71A 2LV3A 1PKWA 4ZB6A 1HNBA 4PQIA 4V2MA 3Q19A 4KNDA 5E59A 3QMXA 3FR3A 2HSMA 5GSSA 3KIJA 1PKZA 1XG8A 2B5YA 1X9MB 4YKGA 1ZMAA 1C72A 3FZ9A 4OCFA 3FK8A 3GNJA 4J56E 2VOCA 17GSA 4FYBA 4OFTA 1BQ7A 5HR3A 4J57E 5F0GA 1XOAA 2WULA 4ECCA 4IELA 3HJOA 4EVMA 1WMJA 2LNTA 1TI3A 2C0DA 3RHCA 1QGVA 3ZFBA 3F3RA 4ZBDA 1B9YC 4MF6A 4G0IA 3WGEA 2MMZA 2B1KA 1MDKA 7GSSA 3KP9A 3LEFA 4FYCA 2O87A 1K0BA 1WOUA 1XFLA 2CVKA 3IHQA 1K3YA 3DWVA 4MJCA 3ERWA 2F3MA 3LQ7A 1XZOA 2HE3A 3MNGA 1AIUA 4K8MA 4PNGA 2VL9A 1FG4A 4OCEA 2NDOA 1Z9HA 3WYWA 5ECIB 1M2BA 2K9FA 2LTKA 5CP1A 4EO3A 5JWOB 1GRXA 19GSA 4ZB8A 1YQ1A 5DJLA 4L5LA 5CYYA 5HR0A 3OR5A 3VWVA 2H6YA 4TOPA 3CRTA 1VF4A 3IAS2 3GN3A 1Q98A 1SK2A 5FT3A 4K2DA 2MBTA 4N11A 5H5QA 2KP1A 3TCOA 3IR4A 4XS1A 1EP8A 3DYRA 4G9HA 2FLSA 3IAM2 3UIWA 3GHAA 2RM6A 5ID2A 1T8EB 1OKTA 1SL0B 4WF4A 4XRAA 1TKDB 3ZVJD 3GYKA 3LYKA 5GZZB 2VCQA 1AUCA 2VLVA 3UBKA 4JEDA 1YF0A 3DXBA 2H01A 5B6NA 5B7CA 4N10A 1AAZA 3DVWA 4WXTA 1QQ2A 4O92A 3WD6A 3UVHA 5AIXA 4POKA 1X5DA 1XW5A 1M9AA 2I81A 3MIXA 1K3OA 4YH2A 1X9SB 1QUWA 2R0GA 8GSSA 2L5OA 5DALB 1J9BA 2WB9A 4AJ8A 1GSDA 3VURA 1YF1A 3MYDA 1WE0A 3HDCA 1J08A 1XXUA 3L9VA 1JLWA 3EWLA 5CRDA 4HQZA 3F3QA 4IGJA 4IQAA 1TU7A 1XPVA 2WCIA 3VLNA 3GH9A 2RUEA 4IP1A 4MH3A 5LD0A 3TKRA 4MZWA 3GL5A 4X1UA 5IQYA 4YAVA 4JR4A 2PU9C 5IMFA 3M1GA 1B4QA 2JADA 3LWAA 2OADA 3ZTLA 1S3RA 2FWGA 4PXOA 2PWJA 4GQFA 1GNEA 2X64A 3M8NA 3LG6A 2VIMA 3O76A 1U6TA 1FB0A 4ECIA 3EMXA 2M72A 5ECHB 1YY7A 4X43A 5CAXA 1XW6A 5J5NA 3VI5A 5KEJA 2GZZA 3RAZA 3NZNA 5JCUA 5A5KA 4Q5FA 1HQOA 1EGRA 4HU7A 2F51A 2XHFA 2AB6A 2WFCA 3O3TA 2B1LA 3R3EA 3CQFA 4POBA 4GXZA 5ECOB 3D5JA 1ZYPA 3UMAA 4GCIA 3EURA 3EMPA 3HA9A 4HJ2A 1OYJA 4DSRA 1GUKA 1Z6NA 3ZYWA 2DMMA 1R7HA 4FYUA 1K0NA 2YV9A 1OC9B 3H79A 4GF0A 3TRPA 4ZL9A 3UJ1A 1V98A 1URMA 3GKMA 6GSYA 3CTFA 3LJRA 2PVQA 2V2GA 2GT5A 3DD3A 1WPIA 3WT2A 2BJXA 3G7IA 1KNGA 2K18A 2DBCA 2TIRA 1S3DA 1HD2A 2VLUA 1KBNA 3Q74A 2JSYA 1O73A 5COHA 2B7KA 1YKCA 2YNXA 2LRNA 1AQXA 2C0FA 3U5RE 3F4TA 4MJAA 2H6XA 4E8HA 3BBYA 5AGYA 5DAKA 1OVNA 5F05A 2OBIA 4AJ7A 1PX7A 4KB3A 2CX3A 4XIHA 2B3SA 1MD4A 5IM9A 1G6YA 4TKYA 4IJ3A 1GSFA 2A4HA 4MJBA 5IPHA 4ZILA 4MPGA 2R2JA 3AY8A 4HQSA 4F82A 1YDKA 2B7JA 4XS6A 1WJKA 5IO2A 3RPPA 2IFQA 2RM5A 3GTUA 5HR2A 3DRNA 2YJHA 3C1RA 4PQ1A 4CY6A 1MD3A 5ELAA 4GQCA 1O81A 5DJMA 4WF5A 5F06A 3D21A 1QXHA 5B8AA 3IPZA 3UAPA 3C8EA 4KE3A 3TDGA 3H93A 4GLTA 4CDOA 3US3A 3M9KA 4ICYA 5IMCA 2DIYA 3A2VA 4N30A 4Q5QA 4I2UA 4KDXA 4E8EA 1OKDA 1XVWA 5C04A 3ZMKA 3VFIA 2HZEB 1UN2A 2IPAA 1SL2B 3UOMA 4L5OA 4QL7A 1V58A 1O85A 4RI6A 3EINA 3FZAA 4HSCX 2GQMA 2G2QA 3LFLA 4TXOA 1F2EA 2VL2C 3QD9A 2FWHA 4MF5A 4BVXB 6GSWA 2WS2A 2KOKA 5DCHA 3P7XA 1UC7A 4EE0A 4EIPA 2HI7A 1K0CA 4IS0A 3MDKA 4O5RA 4F03A 4AGSA 1BAYA 3IDVA 14GSA 4PUFC 2IL3A 2C8UA 3UL3A 3IK7A 3IK9A 3KH7A 2R0PA 1JLVA 3TRXA 4LA1A 4LL1B 4G10A 5IMZA 2VO4A 4OFNA 1ERTA 2GT6A 2YN1A 2X99A 3W8JA 3ZL5A 2XC2A 2KUCA 3EE2A 2DJ2A 1VRSD 2LRCA 2VL2A 13GSA 5LCZA 2OE0A 2CT6A 2C3TA 1TTZA 1FO5A 1NW2A 3QDNA 1GNWA 4AJ6A 3Q6OA 3MAKA 4BVYB 2OJLA 4K9ZA 2FHEA 1MEKA 2DJ1A 3CXGA 4DSSA 3LXZA 3ZRDA 1OAZA 4XS4A 3MSZA 2IMDA 4MZCA 1NHOA 2NBSA 1EP7A 2LQQA 5KOWA 4KDYA 2QA1A 1O8XA 3G9BA 2HRFA 1PL1A 3TJGA 3NOFA 2H0GA 1AQVA 3HVXA 1SKWB 2FD3A 5EVOA 1G7EA 4GSSA 3APSA 1I5GA 5ECSA 4L0UA 5GSTA 2P0GA 4WKWA 4PURA 1FOVA 3FZ5A 2DKIA 3CSJA 3GRXA 3LGCA 1Z6MA 3ZZXA 4I8BA 4YAPA
chains in the Genus database with same CATH topology
3RDWA 2VCVA 3FRCA 3KD0A 4NHWA 1EV9A 2AUVA 1TU8A 1PMTA 4POMA 2PMTA 2QC7A 2LNSA 1GSYA 3KMNA 4TR1B 1WIKA 16GSA 2JZTA 2YOIA 2KLXA 1GTBA 20GSA 3CYNA 3ZIJA 2H19A 1YZXA 4YQVA 5G30A 3FW2A 1ACVA 3TKPA 2PBJA 3I43A 3O6TA 3KM6A 4IVFA 1BEDA 1E6BA 4V1Ag 3GKKA 4EC0A 2H0IA 5D9XA 3BCKA 3PGTA 3KEBA 3HY2A 1SL1B 1K0MA 4KDUA 4F0CA 4MNNA 5G5FA 5ENUA 5CO3A 2WJUA 5G5EA 2Z9SA 5CREA 2OACA 3F6FA 3LYPA 2L59A 2DLXA 4Z2TA 5DQSA 2F9SA 1EEJA 1Y6EA 4IP6A 4MCUA 1XWGA 1A2LA 1JFUA 3HVSA 2V6OA 3C73A 5D9WA 5C00A 1TRWA 4X0XA 2YZUA 1EOGA 2IJYA 2C80A 3EYTA 4GWRA 5JWQB 1XWCA 1B4PA 3G7YA 4MZBA 3GMFA 2L6CA 4RQRA 3VWWA 2I9HA 1Q4JA 2JL4A 2QSIA 1ST9A 4IBPA 4WETA 3GX8A 3P90A 3ZLPA 1F6MC 3DKSA 5AISA 1DE2A 4YQUA 3TJJA 3QFBC 4WBJA 3GSSA 2VCZA 3ZMLA 1PGTA 22GSA 3FMWA 1XWAA 4JBBA 3QFAC 3EU4A 1DBYA 1T00A 3L0HA 5IOXA 2C4JA 4K7NA 1WRYA 1VF1A 1TRVA 2E0QA 3DGQA 1Z7PA 5ECMB 3HJMA 3TGZA 2GLRA 1GLQA 1GSEA 4OO4A 1AC1A 2AAWA 2IMFA 4F9ZA 1JZOA 5JCGA 1UA5A 3C7MA 2LJRA 3QOUA 2ON7A 1K3LA 3TUEA 2K8SA 1VF2A 2DJJA 3KMOA 4ZL8A 2O8VB 4IKHA 3L9SA 1YKAA 1YEPA 1A0FA 4KW6A 4IJIA 1F9MA 4PNFA 1TK5B 1GUHA 1YEXA 2KP2A 3F8UA 1G6WA 2DJ0A 1W89A 3F0IA 1H4OA 2A2RA 5DBQA 3CRUA 4JE1A 2PERA 4EXJA 3QCPA 1EOHA 1USBA 5AIVA 6GSXA 3P2AA 1GUMA 5BRTA 2AV4A 2B5XA 2CV4A 2H72A 4K2XA 1TK0B 5ECLB 2RUFA 1DSBA 1SJZA 4ZBBA 3V1WA 1B9XC 4Q5NA 4ULXA 2CAIA 3ED3A 2OBKA 4LMWA 12GSA 6GSUA 1BX9A 4EDZA 3ME8A 2C0EA 3TOTA 3APQA 4BWQA 2DC5A 1PD21 1JZDA 2EIQA 5G31A 1K0OA 2MMNA 2PGTA 2LKUA 3FZ4A 1QFNA 2EIRA 1NSWA 2MBSA 3IHGA 1EZKA 1N2AA 3GIXA 1GULA 2VM1A 2CA8A 3H1NA 5D93A 4EKZA 5D9VA 3JCML 4ISDA 1XWBA 2N5FA 3QAGA 1HNCA 1T4ZA 4MLYA 2K8VA 5CRWA 4IW9A 2H8LA 2HNLA 5IMAA 3G7JA 5EL8A 4OFMA 3TKSC 1VGLA 3KTBA 2R3XA 4MJEA 1PN0A 2I1UA 1ERUA 1GSQA 3EVIA 1R5PA 2HLSA 4NMUA 3K8NA 3IC4A 3TRQA 1GSUA 2NPBA 3LORA 3GKNA 4RI7A 5KN2A 1OC8A 4LLRA 2H1GA 1U3IA 3EPTA 2LSTA 4L8EA 2C3QA 2YANA 1OC9A 3VI7A 4RQXA 4EIQA 2XPEA 3LXTA 1BYEA 2C3NA 1LU4A 1TRSA 3UVTA 2H1AA 1ZYNA 4O5UA 2CX4A 4IHUA 4BL7B 4K0GA 3IV4A 4NPBA 4USSA 2VCXA 2GVPA 4ZB9A 1TI1A 3ZREA 9GSSA 2PN8A 3TKSA 2B6MA 1ML6A 2F8AA 4OWYA 3ME7A 5F8BA 1E2YA 1TP9A 2P5QA 4L0WA 2FWEA 3FHKA 2YWIA 5INYA 4HDEA 4X4JA 2LJAA 2OA7A 2DIZA 1B48A 1F37A 3M3MA 1X9WB 4O32A 2CVDA 2AYTA 5EPFA 2FWFA 2YCDA 4KF9A 4NV5A 3L4NA 1TXXA 2RLIA 1WP0A 3CSHA 3GURA 4BA7A 1FVKA 1SD9A 3W6GA 4I5QA 4HZ2A 5ECPB 2I3YA 4F2IA 2FA8A 3FR6A 2PVOC 3E3EA 3TKSE 6GSSA 5ECRB 3EC3A 4WBRD 4MK3A 2ZUPA 3WGXA 4KUNA 1A2JA 5EY6A 4YKFA 1T3BA 2JZRA 1Z5YE 3PR8A 1SU9A 4PQHA 1XVQA 3J7Yk 1J0FA 3ZVJA 4NXIA 4DEJA 2OE1A 1GWCA 1ZZYA 5D96A 3ZITA 1YJ6A 4MMMA 1V9WA 3F4SA 4FH8A 3DMLA 1OE8A 2AJQB 2L6DA 2HZEA 2XBQA 1KEBA 2MMAA 3WGDA 1W4VA 4TXVA 3HZ8A 1PSQA 3KH9A 1O6JA 2ALBA 1ZCPA 4V2NA 4DSSB 1K0DA 1IYHA 1R4WA 2X8HA 1XIYA 3VWUA 4BVXA 4ZL7A 1A0RP 5B8BA 1FB6A 4OD7A 1SJ6A 1SK0A 2QGVA 2JSZA 5CNWA 1JZRA 4TR3A 2LUSA 2BMXA 4K0NA 4Q5RA 1XBSA 1GL8A 3E9JB 4NAXA 4RUVA 4HUAA 4A5PA 3KCMA 2H75A 1FAAA 2FY6A 2G0FA 4HU9A 1ZOFA 2YWNA 3F63A 3PH9A 3LW9A 5ECKB 2EIOA 2GTUA 3TJKA 4MPFA 1GSSA 3NIVA 1TK8B 1TJDA 3IBHA 3ERGA 5BMUA 1O8WA 3D0ZA 3S9FA 5A4WA 1M99A 1MDIA 5G1KA 1EGOA 1V40A 1A2MA 4KA0A 3CBUA 1QMVA 1GTUA 1A8YA 5IMVA 3TKQA 1ABAA 2L4CA 4D73A 4G0KA 2CAQA 4BVYA 4Z2UA 1HNAA 1SYRA 5FHIA 2YV7A 3TJBA 2H66A 2GSRA 3L78A 5D9TA 3QPMA 1ZL9A 2IMIA 2MZCA 1GLPA 4MA9A 2VUPA 4GSNA 4MP4A 3KTLA 4V1Ap 4XHMA 4BWSA 4K5SA 2RIIA 5ECQB 2YPMA 3BOAA 3HD5A 1TRUA 1F3AA 4PGTA 2B5EA 5J41A 4JZQA 3F6DA 2OE3A 2VCWA 4J2FA 2EC4A 4K1FA 2H1DA 4HI7A 5KN0A 5HFKA 1RW1A 5J9CA 1LJRA 5DCGA 4IQ1A 1GP1A 4ECJA 1PX6A 4Z2RA 4K7IA 1ON4A 10GSA 5IOWA 3KJYA 3RHBA 1B8XA 2M80A 3I6AA 2O85A 4P3YB 4MDCA 4O7HA 4ML6A 4GSTA 2HZFA 2QA2A 1R5AA 4EF0A 4O5QA 1A8LA 4TR1A 2N5AA 4FO5A 4XRDA 3E0UA 3C1SA 2XPDA 3A2XA 3IXRA 5ID2B 2VD1A 3A2WA 3MWHA 1SKRB 5JCWA 2GGTA 2H0HA 2VL3A 3BCIA 4ECBA 4I97A 1PRXA 1X5CA 2JZSA 1EWXA 2R4VA 3HXSA 4HZ4A 3HKRA 3GFKA 2H74A 3ERFA 2E2GA 18GSA 3HHVA 4ZBAA 4NV2A 1HYUA 3DVXA 1TDIA 2BTOT 3DEXA 2WRTA 3IRAA 4KCAA 5A4UA 4WR5A 5J4UA 2HXKA 2DJ3A 1AW9A 3QAWA 1M7TA 4KCEA 2LS5A 3IC8A 3ZFLA 3HJPA 2LRTA 3F4RA 2V6KA 4MH2A 4V2LA 4TR0A 3BJ5A 2NVLA 1FOHA 4KAEA 3VPTA 4AF2A 3RPNA 5KN1A 2K6VA 3BD2A 2E2MA 1TOFA 5JWRB 2J23A 5A4VA 5J3RA 3KP8A 4WEYA 5H5SA 2CVBA 2PUKC 3EU3A 1N8JA 1EV4A 2V1MA 1XCCA 3D4TA 3VK9A 2FNOA 2YWMA 1PN9A 1R26A 2J9HA 2ES7A 2QKEA 4GRFA 2H73A 3TJFA 1GTAA 4ACSA 1T7PB 2VM2A 3HVVA 4FQUA 1H75A 3D4MA 3H8QA 3VWXA 2GZPA 3Q18A 1LBKA 3APOA 3M9JA 5J9BA 3UBLA 4XCSA 2WGRA 3VPQA 5DALA 4QL9A 4KSOA 2GQLA 4K6XA 1K0AA 1GH2A 2VLTA 5IO0A 3IOSA 4CHSA 2X8GA 1V57A 2E7PA 2WZ9A 2H70A 2JU5A 2PPTA 3D22A 1NHYA 4Z7XA 2MYGA 1TW9A 2HT9A 3DIEA 1AQWA 1X0RA 1IYIA 4HEA2 4GTUA 4EDYA 5LNKe 2HRNA 1GTIA 2HYXA 4NHZA 5G2ZA 1G7OA 4POLA 5HQPA 1I9DA 1JZWA 2KHPA 3CTGA 3GA4A 3KXOA 4I6XA 2XBIA 5DQYA 2DJKA 5B6MA 2I4AA 1RQMA 2O7KA 3TOUA 5ELGA 1XOBA 4ZIJA 3A3TA 1EEMA 2DKHA 5GAPD 3GH6A 2FUG2 1VF3A 2X49A 4PTSA 1ERWA 4TRXA 5FWGA 4CY8A 3SWLA 5KN3A 2X8CA 5D73A 4HS1A 2HSYA 5AN1A 3W8SA 6GSTA 4HOJA 1CQHA 4WR4A 2H76A 3GKXA 2VCTA 1G0TA 2HFDA 2C1YA 6GSVA 5IIZA 4JR6A 1M2AA 1WWJA 5HFGA 2M46A 1AXDA 1DUGA 3PPUA 2LQOA 5DAKB 4KGIA 4EL1A 1MTCA 3HCZA 3FEUA 3FY7A 3ZIVA 2ON5A 3UEMA 1CQGA 4MF7A 2TRXA 2AHEA 5IPGA 3C71A 3H4KA 3I9V2 4K7OA 2DMLA 1SKSB 4KH7A 2GZYA 4G0LA 1DE1A 2TRCP 3IE3A 2IFQB 3RBTA 3GTUB 4YQMA 3GX0A 3U6VA 1Y25A 1F3BA 2A2SA 2UZ8A 2MMOA 4ILFA 2YZHA 4N0VA 1ZYEA 1FHEA 3LSZA 4TVEA 2YWOA 2YP6A 4EUYA 5IMDA 3IA1A 4KX4A 2V41A 4TN8A 3PINA 2X4AA 3GV1A 1S3AA 2L4QA 2R5GA 1BJXA 3QAVA 1THXA 1FW1A 3M0FA 5CRHA 1OE7A 2P31A 3A5IA 2V32A 3D6IA 2H1BA 5HFIA 1ZYQB 2A2PA 2R6KA 2R37A 3HZ4A 1Z7RA 1M0UA 4DSQA 5CRGA 1SD8A 1U88A 4TXOB 2YJ7A 1JHBA 1FVJA 4TR4A 5G1LA 4JU5A 2HSHA 3KGKA 1THOA 3I69A 5D8IA 3ISOA 4LL4B 4PUAA 2L57A 1T4YA 4BL7A 2WDUA 2ZCTA 2CZ3A 3GSTA 1SENA 1O7UA 2FA4A 3CMIA 5DVBA 5E4WA 5H5RA 5GAND 4JRRA 3GL3A 4XTSA 1M2DA 3TB2A 4CW9A 1U87A 1MDJA 2HRAA 1QK8A 2P5RA 4MABA 3KZQA 1NM3A 3QR6A 2JACA 1XW9A 1M9BA 3FKFA 1SK1A 2IN3A 2F8FA 2NTOA 2GSQA 4OMVA 4G19A 4LMVA 1PQNA 4FIWA 4I2TA 2GDRA 4QQ7A 3F9UA 2GSSA 5ECNB 1KTEA 3HYPA 4HJMA 2CZ2A 2H71A 1Z3EA 2R0CA 3N9JA 2GS3A 2IIYA 3J7Yb 3A5WA 1PL2A 2FGXA 2D2ZA 2CQ9A 4IN0A 2FCHA 2IMKA 2REMA 2HRKA 4G2EA 1SYXA 4XS4B 5ABRA 5HR1A 4DVCA 4H86A 1S3CA 4K5RA 5KOXA 5DDLA 2VAFA 2LJKA 4PX1A 2DSAA 2ZNMA 3SBCA 11GSA 3FYGA 2IMEA 1V2AA 3GUSA 4NWYA 4F0BA 2GQKA 2N5BA 1T1VA 1A23A 2IWTA 1XWKA 3P8WA 4ML1A 4BPYA 5F07A 2L5LA 1ZGNA 2O89A 1ILOA 3L9UA 4OO5A 2A4VA 4D73B 1OC3A 1SJIA 2OKAA 3WT1A 4N0ZA 4KSMA 1X5EA 1ERVA 2GSTA 2H30A 2H6ZA 1UVZA 3UARA 3FR9A 4TW5A 2VD0A 3CSIA 1A24A 1PA3A 4ID0A 4ZXGA 1BG5A 2C0GA 1RK4A 2LEGA 1U3AA 3N5OA 3R2QA 5L71A 2LV3A 1PKWA 4ZB6A 1HNBA 4PQIA 4V2MA 3Q19A 4KNDA 5E59A 3QMXA 3FR3A 2HSMA 5GSSA 3KIJA 1PKZA 2B5YA 1X9MB 4YKGA 1ZMAA 1C72A 3FZ9A 4OCFA 3FK8A 3GNJA 4J56E 2VOCA 17GSA 4FYBA 4OFTA 1BQ7A 5HR3A 4J57E 5F0GA 1XOAA 2WULA 4ECCA 4IELA 3HJOA 4EVMA 1WMJA 2LNTA 1TI3A 2C0DA 3RHCA 1QGVA 3ZFBA 3F3RA 4ZBDA 1B9YC 4MF6A 4G0IA 3WGEA 2MMZA 2B1KA 1MDKA 7GSSA 3KP9A 3LEFA 4FYCA 2O87A 1K0BA 1WOUA 1XFLA 2CVKA 3IHQA 1K3YA 3DWVA 4MJCA 3ERWA 2F3MA 3LQ7A 1XZOA 2HE3A 3MNGA 1AIUA 4K8MA 4PNGA 2VL9A 1FG4A 4OCEA 2NDOA 1Z9HA 3WYWA 5ECIB 1M2BA 2K9FA 2LTKA 5CP1A 4EO3A 5JWOB 1GRXA 19GSA 4ZB8A 1YQ1A 5DJLA 4L5LA 5CYYA 5HR0A 3OR5A 3VWVA 2H6YA 4TOPA 3CRTA 1VF4A 3IAS2 3GN3A 1Q98A 1SK2A 5FT3A 4K2DA 2MBTA 4N11A 5H5QA 2KP1A 3TCOA 3IR4A 4XS1A 1EP8A 3DYRA 4G9HA 2FLSA 3IAM2 3UIWA 3GHAA 2RM6A 5ID2A 1T8EB 1OKTA 1SL0B 4WF4A 4XRAA 1TKDB 3ZVJD 3GYKA 3LYKA 5GZZB 2VCQA 1AUCA 2VLVA 3UBKA 4JEDA 1YF0A 3DXBA 2H01A 5B6NA 5B7CA 4N10A 1AAZA 3DVWA 4WXTA 1QQ2A 4O92A 3WD6A 3UVHA 5AIXA 4POKA 1X5DA 1XW5A 1M9AA 2I81A 3MIXA 1K3OA 4YH2A 1X9SB 1QUWA 2R0GA 8GSSA 2L5OA 5DALB 1J9BA 2WB9A 4AJ8A 1GSDA 3VURA 1YF1A 3MYDA 1WE0A 3HDCA 1J08A 1XXUA 3L9VA 1JLWA 3EWLA 5CRDA 4HQZA 3F3QA 4IGJA 4IQAA 1TU7A 1XPVA 2WCIA 3VLNA 3GH9A 2RUEA 4IP1A 4MH3A 5LD0A 3TKRA 4MZWA 3GL5A 4X1UA 5IQYA 4YAVA 4JR4A 2PU9C 5IMFA 3M1GA 1B4QA 2JADA 3LWAA 2OADA 3ZTLA 2FWGA 4PXOA 2PWJA 4GQFA 1GNEA 2X64A 3M8NA 3LG6A 2VIMA 3O76A 1U6TA 1FB0A 4ECIA 3EMXA 2M72A 5ECHB 1YY7A 4X43A 5CAXA 1XW6A 5J5NA 3VI5A 5KEJA 2GZZA 3RAZA 3NZNA 5JCUA 5A5KA 4Q5FA 1HQOA 1EGRA 4HU7A 2F51A 2XHFA 2AB6A 2WFCA 3O3TA 2B1LA 3R3EA 4POBA 4GXZA 5ECOB 3D5JA 1ZYPA 3UMAA 4GCIA 3EURA 3EMPA 3HA9A 4HJ2A 1OYJA 4DSRA 1GUKA 1Z6NA 3ZYWA 2DMMA 1R7HA 4FYUA 1K0NA 2YV9A 1OC9B 3H79A 4GF0A 3TRPA 4ZL9A 3UJ1A 1V98A 1URMA 3GKMA 6GSYA 3CTFA 3LJRA 2PVQA 2V2GA 2GT5A 3DD3A 1WPIA 3WT2A 2BJXA 3G7IA 1KNGA 2K18A 2DBCA 2TIRA 1S3DA 1HD2A 2VLUA 1KBNA 3Q74A 2JSYA 1O73A 5COHA 2B7KA 1YKCA 2YNXA 2LRNA 1AQXA 2C0FA 3U5RE 3F4TA 4MJAA 2H6XA 4E8HA 3BBYA 5AGYA 5DAKA 1OVNA 5F05A 2OBIA 4AJ7A 1PX7A 4KB3A 2CX3A 4XIHA 2B3SA 1MD4A 5IM9A 1G6YA 4TKYA 4IJ3A 1GSFA 2A4HA 4MJBA 5IPHA 4ZILA 4MPGA 2R2JA 3AY8A 4HQSA 4F82A 1YDKA 2B7JA 4XS6A 1WJKA 5IO2A 3RPPA 2IFQA 2RM5A 3GTUA 5HR2A 3DRNA 2YJHA 3C1RA 4PQ1A 4CY6A 1MD3A 5ELAA 4GQCA 1O81A 5DJMA 4WF5A 5F06A 3D21A 1QXHA 5B8AA 3IPZA 3UAPA 3C8EA 4KE3A 3TDGA 3H93A 4GLTA 4CDOA 3US3A 3M9KA 4ICYA 5IMCA 2DIYA 3A2VA 4N30A 4Q5QA 4I2UA 4KDXA 4E8EA 1OKDA 1XVWA 5C04A 3ZMKA 3VFIA 2HZEB 1UN2A 2IPAA 1SL2B 3UOMA 4L5OA 4QL7A 1V58A 1O85A 4RI6A 3EINA 3FZAA 2GQMA 2G2QA 3LFLA 4TXOA 1F2EA 2VL2C 3QD9A 2FWHA 4MF5A 4BVXB 6GSWA 2WS2A 2KOKA 5DCHA 3P7XA 1UC7A 4EE0A 4EIPA 2HI7A 1K0CA 4IS0A 3MDKA 4O5RA 4F03A 4AGSA 1BAYA 3IDVA 14GSA 4PUFC 2IL3A 2C8UA 3UL3A 3IK7A 3IK9A 3KH7A 2R0PA 1JLVA 3TRXA 4LA1A 4LL1B 4G10A 5IMZA 2VO4A 4OFNA 1ERTA 2GT6A 2YN1A 2X99A 3W8JA 3ZL5A 2XC2A 2KUCA 3EE2A 2DJ2A 1VRSD 2LRCA 2VL2A 13GSA 5LCZA 2OE0A 2CT6A 2C3TA 1TTZA 1FO5A 1NW2A 3QDNA 1GNWA 4AJ6A 3Q6OA 3MAKA 4BVYB 2OJLA 4K9ZA 2FHEA 1MEKA 2DJ1A 3CXGA 4DSSA 3LXZA 3ZRDA 1OAZA 4XS4A 3MSZA 2IMDA 4MZCA 1NHOA 2NBSA 1EP7A 2LQQA 5KOWA 4KDYA 2QA1A 1O8XA 3G9BA 2HRFA 1PL1A 3TJGA 3NOFA 2H0GA 1AQVA 3HVXA 1SKWB 2FD3A 5EVOA 1G7EA 4GSSA 3APSA 1I5GA 5ECSA 4L0UA 5GSTA 2P0GA 4WKWA 4PURA 1FOVA 3FZ5A 2DKIA 3CSJA 3GRXA 3LGCA 1Z6MA 3ZZXA 4I8BA 4YAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RDW A;  2VCV A;  3FRC A;  3KD0 A;  4NHW A;  1EV9 A;  2AUV A;  1TU8 A;  1PMT A;  4POM A;  2PMT A;  2QC7 A;  2LNS A;  1GSY A;  3KMN A;  4TR1 B;  1WIK A;  16GS A;  2JZT A;  2YOI A;  2KLX A;  1GTB A;  20GS A;  3CYN A;  3ZIJ A;  2H19 A;  1YZX A;  4YQV A;  5G30 A;  3FW2 A;  1ACV A;  3TKP A;  2PBJ A;  3I43 A;  3O6T A;  3KM6 A;  4IVF A;  1BED A;  1E6B A;  4V1A g;  3GKK A;  4EC0 A;  2H0I A;  5D9X A;  3BCK A;  3PGT A;  3KEB A;  3HY2 A;  1SL1 B;  1K0M A;  4KDU A;  4F0C A;  5G5F A;  5ENU A;  5CO3 A;  2WJU A;  5G5E A;  2Z9S A;  5CRE A;  2OAC A;  3F6F A;  3LYP A;  2L59 A;  2DLX A;  5DQS A;  2F9S A;  1EEJ A;  1Y6E A;  4IP6 A;  4MCU A;  1XWG A;  1A2L A;  1JFU A;  3HVS A;  2V6O A;  3C73 A;  5D9W A;  5C00 A;  1TRW A;  4X0X A;  2YZU A;  1EOG A;  2IJY A;  2C80 A;  3EYT A;  4GWR A;  5JWQ B;  1XWC A;  1B4P A;  3G7Y A;  4MZB A;  3GMF A;  2L6C A;  4RQR A;  3VWW A;  2I9H A;  1Q4J A;  2JL4 A;  2QSI A;  1ST9 A;  4IBP A;  4WET A;  3GX8 A;  3P90 A;  3ZLP A;  1F6M C;  3DKS A;  5AIS A;  1DE2 A;  4YQU A;  3TJJ A;  3QFB C;  4WBJ A;  3GSS A;  2VCZ A;  3ZML A;  1PGT A;  22GS A;  1XWA A;  4JBB A;  3QFA C;  3EU4 A;  1DBY A;  1T00 A;  3L0H A;  5IOX A;  2C4J A;  4K7N A;  1WRY A;  1VF1 A;  1TRV A;  2E0Q A;  3DGQ A;  1Z7P A;  5ECM B;  3HJM A;  3TGZ A;  2GLR A;  1GLQ A;  1GSE A;  4OO4 A;  1AC1 A;  2AAW A;  2IMF A;  4F9Z A;  1JZO A;  5JCG A;  1UA5 A;  3C7M A;  2LJR A;  3QOU A;  2ON7 A;  1K3L A;  3TUE A;  2K8S A;  1VF2 A;  2DJJ A;  3KMO A;  4ZL8 A;  2O8V B;  4IKH A;  3L9S A;  1YKA A;  1YEP A;  1A0F A;  4KW6 A;  4IJI A;  1F9M A;  4PNF A;  1TK5 B;  1GUH A;  1YEX A;  2KP2 A;  3F8U A;  1G6W A;  2DJ0 A;  1W89 A;  3F0I A;  1H4O A;  2A2R A;  5DBQ A;  3CRU A;  4JE1 A;  2PER A;  4EXJ A;  3QCP A;  1EOH A;  1USB A;  5AIV A;  6GSX A;  3P2A A;  1GUM A;  2AV4 A;  2B5X A;  2CV4 A;  2H72 A;  1TK0 B;  5ECL B;  2RUF A;  1DSB A;  1SJZ A;  4ZBB A;  3V1W A;  1B9X C;  4Q5N A;  4ULX A;  2CAI A;  3ED3 A;  2OBK A;  4LMW A;  12GS A;  6GSU A;  1BX9 A;  4EDZ A;  3ME8 A;  2C0E A;  3TOT A;  3APQ A;  4BWQ A;  2DC5 A;  1PD2 1;  1JZD A;  2EIQ A;  5G31 A;  1K0O A;  2MMN A;  2PGT A;  2LKU A;  3FZ4 A;  1QFN A;  2EIR A;  1NSW A;  2MBS A;  1EZK A;  1N2A A;  3GIX A;  1GUL A;  2VM1 A;  2CA8 A;  3H1N A;  5D93 A;  4EKZ A;  5D9V A;  3JCM L;  4ISD A;  1XWB A;  2N5F A;  3QAG A;  1HNC A;  1T4Z A;  4MLY A;  2K8V A;  5CRW A;  4IW9 A;  2H8L A;  2HNL A;  5IMA A;  3G7J A;  5EL8 A;  4OFM A;  3TKS C;  1VGL A;  3KTB A;  2R3X A;  4MJE A;  2I1U A;  1ERU A;  1GSQ A;  3EVI A;  1R5P A;  2HLS A;  4NMU A;  3K8N A;  3IC4 A;  3TRQ A;  1GSU A;  2NPB A;  3LOR A;  3GKN A;  4RI7 A;  5KN2 A;  1OC8 A;  4LLR A;  2H1G A;  1U3I A;  2LST A;  4L8E A;  2C3Q A;  2YAN A;  1OC9 A;  3VI7 A;  4RQX A;  2XPE A;  3LXT A;  1BYE A;  2C3N A;  1LU4 A;  1TRS A;  3UVT A;  2H1A A;  2CX4 A;  4IHU A;  4K0G A;  3IV4 A;  4NPB A;  2VCX A;  2GVP A;  4ZB9 A;  1TI1 A;  3ZRE A;  9GSS A;  2PN8 A;  3TKS A;  2B6M A;  1ML6 A;  2F8A A;  4OWY A;  3ME7 A;  5F8B A;  1E2Y A;  1TP9 A;  2P5Q A;  4L0W A;  2FWE A;  3FHK A;  2YWI A;  5INY A;  4HDE A;  2LJA A;  2OA7 A;  2DIZ A;  1B48 A;  1F37 A;  3M3M A;  1X9W B;  4O32 A;  2CVD A;  2AYT A;  5EPF A;  2FWF A;  2YCD A;  4NV5 A;  3L4N A;  1TXX A;  2RLI A;  1WP0 A;  3CSH A;  3GUR A;  4BA7 A;  1FVK A;  1SD9 A;  3W6G A;  4I5Q A;  4HZ2 A;  5ECP B;  2I3Y A;  4F2I A;  2FA8 A;  3FR6 A;  2PVO C;  3E3E A;  3TKS E;  6GSS A;  5ECR B;  3EC3 A;  4WBR D;  4MK3 A;  2ZUP A;  3WGX A;  4KUN A;  1A2J A;  5EY6 A;  1T3B A;  2JZR A;  1Z5Y E;  3PR8 A;  1SU9 A;  4PQH A;  1XVQ A;  3J7Y k;  1J0F A;  3ZVJ A;  4NXI A;  4DEJ A;  2OE1 A;  1GWC A;  1ZZY A;  5D96 A;  3ZIT A;  1YJ6 A;  4MMM A;  1V9W A;  3F4S A;  4FH8 A;  3DML A;  1OE8 A;  2AJQ B;  2L6D A;  2HZE A;  2XBQ A;  1KEB A;  2MMA A;  3WGD A;  1W4V A;  4TXV A;  3HZ8 A;  1PSQ A;  3KH9 A;  1O6J A;  2ALB A;  1ZCP A;  4V2N A;  4DSS B;  1K0D A;  1IYH A;  1R4W A;  2X8H A;  1XIY A;  3VWU A;  4BVX A;  4ZL7 A;  1A0R P;  5B8B A;  1FB6 A;  4OD7 A;  1SJ6 A;  1SK0 A;  2QGV A;  2JSZ A;  5CNW A;  1JZR A;  4TR3 A;  2LUS A;  2BMX A;  4K0N A;  4Q5R A;  1XBS A;  1GL8 A;  3E9J B;  4NAX A;  4RUV A;  4HUA A;  3KCM A;  2H75 A;  1FAA A;  2FY6 A;  2G0F A;  4HU9 A;  1ZOF A;  2YWN A;  3F63 A;  3PH9 A;  5ECK B;  2EIO A;  2GTU A;  3TJK A;  4MPF A;  1GSS A;  3NIV A;  1TK8 B;  1TJD A;  3IBH A;  3ERG A;  1O8W A;  3D0Z A;  3S9F A;  5A4W A;  1M99 A;  1MDI A;  5G1K A;  1EGO A;  1V40 A;  1A2M A;  4KA0 A;  3CBU A;  1QMV A;  1GTU A;  1A8Y A;  5IMV A;  3TKQ A;  1ABA A;  2L4C A;  4D73 A;  2CAQ A;  4BVY A;  1HNA A;  1SYR A;  5FHI A;  2YV7 A;  3TJB A;  2H66 A;  2GSR A;  3L78 A;  5D9T A;  3QPM A;  1ZL9 A;  2IMI A;  2MZC A;  1GLP A;  4MA9 A;  2VUP A;  4GSN A;  4MP4 A;  3KTL A;  4V1A p;  4XHM A;  4BWS A;  2RII A;  5ECQ B;  2YPM A;  3BOA A;  3HD5 A;  1TRU A;  1F3A A;  4PGT A;  2B5E A;  5J41 A;  4JZQ A;  3F6D A;  2OE3 A;  2VCW A;  4J2F A;  2EC4 A;  4K1F A;  2H1D A;  4HI7 A;  5KN0 A;  5HFK A;  1RW1 A;  5J9C A;  1LJR A;  5DCG A;  4IQ1 A;  1GP1 A;  4ECJ A;  1PX6 A;  4K7I A;  1ON4 A;  10GS A;  5IOW A;  3KJY A;  3RHB A;  1B8X A;  2M80 A;  3I6A A;  2O85 A;  4P3Y B;  4MDC A;  4O7H A;  4ML6 A;  4GST A;  2HZF A;  1R5A A;  4EF0 A;  1A8L A;  4TR1 A;  2N5A A;  4FO5 A;  4XRD A;  3E0U A;  3C1S A;  2XPD A;  3A2X A;  3IXR A;  5ID2 B;  2VD1 A;  3A2W A;  3MWH A;  1SKR B;  5JCW A;  2GGT A;  2H0H A;  2VL3 A;  3BCI A;  4ECB A;  4I97 A;  1PRX A;  1X5C A;  2JZS A;  1EWX A;  2R4V A;  3HXS A;  4HZ4 A;  3HKR A;  3GFK A;  2H74 A;  3ERF A;  2E2G A;  18GS A;  3HHV A;  4ZBA A;  4NV2 A;  1HYU A;  3DVX A;  1TDI A;  2BTO T;  3DEX A;  2WRT A;  3IRA A;  4KCA A;  5A4U A;  4WR5 A;  5J4U A;  2HXK A;  2DJ3 A;  1AW9 A;  3QAW A;  1M7T A;  4KCE A;  2LS5 A;  3ZFL A;  3HJP A;  2LRT A;  3F4R A;  2V6K A;  4MH2 A;  4V2L A;  4TR0 A;  3BJ5 A;  2NVL A;  4KAE A;  3VPT A;  4AF2 A;  3RPN A;  5KN1 A;  2K6V A;  3BD2 A;  2E2M A;  1TOF A;  5JWR B;  2J23 A;  5A4V A;  5J3R A;  3KP8 A;  4WEY A;  5H5S A;  2CVB A;  2PUK C;  3EU3 A;  1N8J A;  1EV4 A;  2V1M A;  1XCC A;  3D4T A;  3VK9 A;  2FNO A;  2YWM A;  1PN9 A;  1R26 A;  2J9H A;  2ES7 A;  2QKE A;  4GRF A;  2H73 A;  3TJF A;  1GTA A;  4ACS A;  1T7P B;  2VM2 A;  3HVV A;  1H75 A;  3D4M A;  3H8Q A;  3VWX A;  2GZP A;  3Q18 A;  1LBK A;  3APO A;  3M9J A;  5J9B A;  3UBL A;  4XCS A;  2WGR A;  3VPQ A;  5DAL A;  4QL9 A;  4KSO A;  2GQL A;  4K6X A;  1K0A A;  1GH2 A;  2VLT A;  5IO0 A;  3IOS A;  4CHS A;  2X8G A;  1V57 A;  2E7P A;  2WZ9 A;  2H70 A;  2JU5 A;  2PPT A;  3D22 A;  1NHY A;  4Z7X A;  2MYG A;  1TW9 A;  2HT9 A;  3DIE A;  1AQW A;  1X0R A;  1IYI A;  4HEA 2;  4GTU A;  4EDY A;  5LNK e;  2HRN A;  1GTI A;  2HYX A;  4NHZ A;  5G2Z A;  1G7O A;  4POL A;  5HQP A;  1I9D A;  1JZW A;  2KHP A;  3CTG A;  3GA4 A;  3KXO A;  4I6X A;  2XBI A;  5DQY A;  2DJK A;  5B6M A;  2I4A A;  1RQM A;  2O7K A;  3TOU A;  5ELG A;  1XOB A;  4ZIJ A;  3A3T A;  1EEM A;  5GAP D;  3GH6 A;  2FUG 2;  1VF3 A;  1ERW A;  4TRX A;  5FWG A;  3SWL A;  5KN3 A;  2X8C A;  5D73 A;  4HS1 A;  2HSY A;  5AN1 A;  3W8S A;  6GST A;  4HOJ A;  1CQH A;  4WR4 A;  2H76 A;  3GKX A;  2VCT A;  1G0T A;  2HFD A;  2C1Y A;  6GSV A;  5IIZ A;  4JR6 A;  1M2A A;  1WWJ A;  5HFG A;  2M46 A;  1AXD A;  1DUG A;  2LQO A;  5DAK B;  4KGI A;  4EL1 A;  1MTC A;  3HCZ A;  3FEU A;  3FY7 A;  3ZIV A;  2ON5 A;  3UEM A;  1CQG A;  4MF7 A;  2TRX A;  2AHE A;  5IPG A;  3C71 A;  3H4K A;  3I9V 2;  4K7O A;  2DML A;  1SKS B;  4KH7 A;  2GZY A;  1DE1 A;  2TRC P;  3IE3 A;  2IFQ B;  3RBT A;  3GTU B;  4YQM A;  3GX0 A;  3U6V A;  1Y25 A;  1F3B A;  2A2S A;  2MMO A;  4ILF A;  2YZH A;  4N0V A;  1ZYE A;  1FHE A;  3LSZ A;  4TVE A;  2YWO A;  2YP6 A;  4EUY A;  5IMD A;  3IA1 A;  4KX4 A;  2V41 A;  4TN8 A;  3PIN A;  3GV1 A;  1S3A A;  2L4Q A;  2R5G A;  1BJX A;  3QAV A;  1THX A;  1FW1 A;  3M0F A;  5CRH A;  1OE7 A;  2P31 A;  2V32 A;  3D6I A;  2H1B A;  5HFI A;  1ZYQ B;  2R6K A;  2R37 A;  3HZ4 A;  1Z7R A;  1M0U A;  4DSQ A;  5CRG A;  1SD8 A;  1U88 A;  4TXO B;  2YJ7 A;  1JHB A;  1FVJ A;  4TR4 A;  5G1L A;  4JU5 A;  2HSH A;  3KGK A;  1THO A;  3I69 A;  5D8I A;  3ISO A;  4LL4 B;  4PUA A;  2L57 A;  1T4Y A;  4BL7 A;  2WDU A;  2ZCT A;  2CZ3 A;  3GST A;  1SEN A;  1O7U A;  2FA4 A;  3CMI A;  5DVB A;  5E4W A;  5H5R A;  5GAN D;  4JRR A;  3GL3 A;  4XTS A;  1M2D A;  3TB2 A;  4CW9 A;  1U87 A;  1MDJ A;  1QK8 A;  2P5R A;  4MAB A;  3KZQ A;  1NM3 A;  3QR6 A;  2JAC A;  1XW9 A;  1M9B A;  3FKF A;  1SK1 A;  2IN3 A;  2F8F A;  2NTO A;  2GSQ A;  4OMV A;  4G19 A;  4LMV A;  1PQN A;  4FIW A;  4I2T A;  2GDR A;  4QQ7 A;  3F9U A;  2GSS A;  5ECN B;  1KTE A;  3HYP A;  4HJM A;  2CZ2 A;  2H71 A;  1Z3E A;  3N9J A;  2GS3 A;  2IIY A;  3J7Y b;  3A5W A;  1PL2 A;  2FGX A;  2D2Z A;  2CQ9 A;  4IN0 A;  2FCH A;  2IMK A;  2REM A;  4G2E A;  1SYX A;  4XS4 B;  5ABR A;  5HR1 A;  4DVC A;  4H86 A;  1S3C A;  5DDL A;  2VAF A;  2LJK A;  4PX1 A;  2DSA A;  2ZNM A;  3SBC A;  11GS A;  3FYG A;  2IME A;  1V2A A;  3GUS A;  4NWY A;  4F0B A;  2GQK A;  2N5B A;  1T1V A;  1A23 A;  2IWT A;  1XWK A;  3P8W A;  4ML1 A;  4BPY A;  5F07 A;  2L5L A;  1ZGN A;  2O89 A;  1ILO A;  3L9U A;  4OO5 A;  2A4V A;  4D73 B;  1OC3 A;  1SJI A;  2OKA A;  3WT1 A;  4N0Z A;  4KSM A;  1X5E A;  1ERV A;  2GST A;  2H30 A;  2H6Z A;  1UVZ A;  3UAR A;  3FR9 A;  4TW5 A;  2VD0 A;  3CSI A;  1A24 A;  1PA3 A;  4ID0 A;  4ZXG A;  1BG5 A;  2C0G A;  1RK4 A;  2LEG A;  1U3A A;  3N5O A;  3R2Q A;  5L71 A;  2LV3 A;  1PKW A;  4ZB6 A;  1HNB A;  4PQI A;  4V2M A;  3Q19 A;  4KND A;  5E59 A;  3QMX A;  3FR3 A;  5GSS A;  3KIJ A;  1PKZ A;  2B5Y A;  1X9M B;  1ZMA A;  1C72 A;  3FZ9 A;  4OCF A;  3FK8 A;  3GNJ A;  4J56 E;  2VOC A;  17GS A;  4FYB A;  4OFT A;  1BQ7 A;  5HR3 A;  4J57 E;  5F0G A;  1XOA A;  2WUL A;  4ECC A;  4IEL A;  3HJO A;  4EVM A;  1WMJ A;  2LNT A;  1TI3 A;  2C0D A;  3RHC A;  1QGV A;  3ZFB A;  3F3R A;  4ZBD A;  1B9Y C;  4MF6 A;  3WGE A;  2MMZ A;  2B1K A;  1MDK A;  7GSS A;  3KP9 A;  3LEF A;  4FYC A;  2O87 A;  1K0B A;  1WOU A;  1XFL A;  2CVK A;  3IHQ A;  1K3Y A;  3DWV A;  4MJC A;  3ERW A;  2F3M A;  3LQ7 A;  1XZO A;  2HE3 A;  3MNG A;  1AIU A;  4K8M A;  4PNG A;  2VL9 A;  1FG4 A;  4OCE A;  2NDO A;  1Z9H A;  3WYW A;  5ECI B;  1M2B A;  2K9F A;  2LTK A;  5CP1 A;  4EO3 A;  5JWO B;  1GRX A;  19GS A;  4ZB8 A;  1YQ1 A;  5DJL A;  4L5L A;  5CYY A;  5HR0 A;  3OR5 A;  3VWV A;  2H6Y A;  4TOP A;  3CRT A;  1VF4 A;  3IAS 2;  3GN3 A;  1Q98 A;  1SK2 A;  5FT3 A;  4K2D A;  2MBT A;  4N11 A;  5H5Q A;  2KP1 A;  3TCO A;  3IR4 A;  4XS1 A;  1EP8 A;  3DYR A;  4G9H A;  2FLS A;  3IAM 2;  3UIW A;  3GHA A;  2RM6 A;  5ID2 A;  1T8E B;  1OKT A;  1SL0 B;  4WF4 A;  4XRA A;  1TKD B;  3ZVJ D;  3GYK A;  3LYK A;  5GZZ B;  2VCQ A;  1AUC A;  2VLV A;  3UBK A;  4JED A;  1YF0 A;  3DXB A;  2H01 A;  5B6N A;  5B7C A;  4N10 A;  1AAZ A;  3DVW A;  4WXT A;  1QQ2 A;  4O92 A;  3WD6 A;  3UVH A;  5AIX A;  4POK A;  1X5D A;  1XW5 A;  1M9A A;  2I81 A;  1K3O A;  4YH2 A;  1X9S B;  1QUW A;  8GSS A;  2L5O A;  5DAL B;  1J9B A;  2WB9 A;  4AJ8 A;  1GSD A;  3VUR A;  1YF1 A;  1WE0 A;  3HDC A;  1J08 A;  1XXU A;  3L9V A;  1JLW A;  3EWL A;  5CRD A;  4HQZ A;  3F3Q A;  4IGJ A;  4IQA A;  1TU7 A;  1XPV A;  2WCI A;  3VLN A;  3GH9 A;  2RUE A;  4IP1 A;  4MH3 A;  5LD0 A;  3TKR A;  4MZW A;  3GL5 A;  4X1U A;  5IQY A;  4YAV A;  4JR4 A;  2PU9 C;  5IMF A;  3M1G A;  1B4Q A;  2JAD A;  3LWA A;  2OAD A;  3ZTL A;  2FWG A;  4PXO A;  2PWJ A;  4GQF A;  1GNE A;  2X64 A;  3M8N A;  3LG6 A;  2VIM A;  3O76 A;  1U6T A;  1FB0 A;  4ECI A;  3EMX A;  2M72 A;  5ECH B;  1YY7 A;  4X43 A;  5CAX A;  1XW6 A;  5J5N A;  3VI5 A;  5KEJ A;  2GZZ A;  3RAZ A;  3NZN A;  5JCU A;  5A5K A;  4Q5F A;  1HQO A;  1EGR A;  4HU7 A;  2F51 A;  2XHF A;  2AB6 A;  2WFC A;  3O3T A;  2B1L A;  4POB A;  4GXZ A;  5ECO B;  3D5J A;  3UMA A;  4GCI A;  3EUR A;  3EMP A;  3HA9 A;  4HJ2 A;  1OYJ A;  4DSR A;  1GUK A;  1Z6N A;  3ZYW A;  2DMM A;  1R7H A;  4FYU A;  1K0N A;  2YV9 A;  1OC9 B;  3H79 A;  4GF0 A;  3TRP A;  4ZL9 A;  3UJ1 A;  1V98 A;  1URM A;  3GKM A;  6GSY A;  3CTF A;  3LJR A;  2PVQ A;  2V2G A;  2GT5 A;  3DD3 A;  1WPI A;  3WT2 A;  2BJX A;  3G7I A;  1KNG A;  2K18 A;  2DBC A;  2TIR A;  1S3D A;  1HD2 A;  2VLU A;  1KBN A;  3Q74 A;  2JSY A;  1O73 A;  5COH A;  2B7K A;  1YKC A;  2YNX A;  2LRN A;  1AQX A;  2C0F A;  3U5R E;  3F4T A;  4MJA A;  2H6X A;  4E8H A;  3BBY A;  5AGY A;  5DAK A;  1OVN A;  5F05 A;  2OBI A;  4AJ7 A;  1PX7 A;  4KB3 A;  2CX3 A;  4XIH A;  2B3S A;  1MD4 A;  5IM9 A;  1G6Y A;  4TKY A;  4IJ3 A;  1GSF A;  4MJB A;  5IPH A;  4ZIL A;  4MPG A;  2R2J A;  3AY8 A;  4HQS A;  4F82 A;  1YDK A;  2B7J A;  4XS6 A;  1WJK A;  5IO2 A;  3RPP A;  2IFQ A;  2RM5 A;  3GTU A;  5HR2 A;  3DRN A;  2YJH A;  3C1R A;  4PQ1 A;  1MD3 A;  5ELA A;  4GQC A;  1O81 A;  5DJM A;  4WF5 A;  5F06 A;  3D21 A;  1QXH A;  5B8A A;  3IPZ A;  3UAP A;  3C8E A;  4KE3 A;  3TDG A;  3H93 A;  4GLT A;  4CDO A;  3US3 A;  3M9K A;  5IMC A;  2DIY A;  3A2V A;  4N30 A;  4Q5Q A;  4I2U A;  4KDX A;  4E8E A;  1OKD A;  1XVW A;  5C04 A;  3ZMK A;  3VFI A;  2HZE B;  1UN2 A;  2IPA A;  1SL2 B;  3UOM A;  4L5O A;  4QL7 A;  1V58 A;  1O85 A;  4RI6 A;  3EIN A;  3FZA A;  2GQM A;  2G2Q A;  3LFL A;  4TXO A;  1F2E A;  2VL2 C;  3QD9 A;  2FWH A;  4MF5 A;  6GSW A;  2WS2 A;  2KOK A;  5DCH A;  3P7X A;  1UC7 A;  4EE0 A;  2HI7 A;  1K0C A;  4IS0 A;  3MDK A;  4O5R A;  4F03 A;  4AGS A;  1BAY A;  3IDV A;  14GS A;  4PUF C;  2IL3 A;  2C8U A;  3UL3 A;  3IK7 A;  3IK9 A;  3KH7 A;  1JLV A;  3TRX A;  4LA1 A;  4LL1 B;  4G10 A;  5IMZ A;  2VO4 A;  4OFN A;  1ERT A;  2GT6 A;  2YN1 A;  2X99 A;  3W8J A;  3ZL5 A;  2XC2 A;  2KUC A;  3EE2 A;  2DJ2 A;  1VRS D;  2LRC A;  2VL2 A;  13GS A;  5LCZ A;  2OE0 A;  2CT6 A;  2C3T A;  1TTZ A;  1FO5 A;  1NW2 A;  3QDN A;  1GNW A;  4AJ6 A;  3Q6O A;  3MAK A;  2OJL A;  4K9Z A;  2FHE A;  1MEK A;  2DJ1 A;  3CXG A;  4DSS A;  3LXZ A;  3ZRD A;  1OAZ A;  4XS4 A;  3MSZ A;  2IMD A;  4MZC A;  1NHO A;  2NBS A;  1EP7 A;  2LQQ A;  4KDY A;  1O8X A;  3G9B A;  2HRF A;  1PL1 A;  3TJG A;  3NOF A;  2H0G A;  1AQV A;  3HVX A;  1SKW B;  2FD3 A;  5EVO A;  1G7E A;  4GSS A;  3APS A;  1I5G A;  5ECS A;  4L0U A;  5GST A;  2P0G A;  4WKW A;  4PUR A;  1FOV A;  3FZ5 A;  3CSJ A;  3GRX A;  3LGC A;  1Z6M A;  3ZZX A;  4I8B A;  4YAP A; 
#chains in the Genus database with same CATH topology
 3RDW A;  2VCV A;  3FRC A;  3KD0 A;  4NHW A;  1EV9 A;  2AUV A;  1TU8 A;  1PMT A;  4POM A;  2PMT A;  2QC7 A;  2LNS A;  1GSY A;  3KMN A;  4TR1 B;  1WIK A;  16GS A;  2JZT A;  2YOI A;  2KLX A;  1GTB A;  20GS A;  3CYN A;  3ZIJ A;  2H19 A;  1YZX A;  4YQV A;  5G30 A;  3FW2 A;  1ACV A;  3TKP A;  2PBJ A;  3I43 A;  3O6T A;  3KM6 A;  4IVF A;  1BED A;  1E6B A;  4V1A g;  3GKK A;  4EC0 A;  2H0I A;  5D9X A;  3BCK A;  3PGT A;  3KEB A;  3HY2 A;  1SL1 B;  1K0M A;  4KDU A;  4F0C A;  4MNN A;  5G5F A;  5ENU A;  5CO3 A;  2WJU A;  5G5E A;  2Z9S A;  5CRE A;  2OAC A;  3F6F A;  3LYP A;  2L59 A;  2DLX A;  4Z2T A;  5DQS A;  2F9S A;  1EEJ A;  1Y6E A;  4IP6 A;  4MCU A;  1XWG A;  1A2L A;  1JFU A;  3HVS A;  2V6O A;  3C73 A;  5D9W A;  5C00 A;  1TRW A;  4X0X A;  2YZU A;  1EOG A;  2IJY A;  2C80 A;  3EYT A;  4GWR A;  5JWQ B;  1XWC A;  1B4P A;  3G7Y A;  4MZB A;  3GMF A;  2L6C A;  4RQR A;  3VWW A;  2I9H A;  1Q4J A;  2JL4 A;  2QSI A;  1ST9 A;  4IBP A;  4WET A;  3GX8 A;  3P90 A;  3ZLP A;  1F6M C;  3DKS A;  5AIS A;  1DE2 A;  4YQU A;  3TJJ A;  3QFB C;  4WBJ A;  3GSS A;  2VCZ A;  3ZML A;  1PGT A;  22GS A;  3FMW A;  1XWA A;  4JBB A;  3QFA C;  3EU4 A;  1DBY A;  1T00 A;  3L0H A;  5IOX A;  2C4J A;  4K7N A;  1WRY A;  1VF1 A;  1TRV A;  2E0Q A;  3DGQ A;  1Z7P A;  5ECM B;  3HJM A;  3TGZ A;  2GLR A;  1GLQ A;  1GSE A;  4OO4 A;  1AC1 A;  2AAW A;  2IMF A;  4F9Z A;  1JZO A;  5JCG A;  1UA5 A;  3C7M A;  2LJR A;  3QOU A;  2ON7 A;  1K3L A;  3TUE A;  2K8S A;  1VF2 A;  2DJJ A;  3KMO A;  4ZL8 A;  2O8V B;  4IKH A;  3L9S A;  1YKA A;  1YEP A;  1A0F A;  4KW6 A;  4IJI A;  1F9M A;  4PNF A;  1TK5 B;  1GUH A;  1YEX A;  2KP2 A;  3F8U A;  1G6W A;  2DJ0 A;  1W89 A;  3F0I A;  1H4O A;  2A2R A;  5DBQ A;  3CRU A;  4JE1 A;  2PER A;  4EXJ A;  3QCP A;  1EOH A;  1USB A;  5AIV A;  6GSX A;  3P2A A;  1GUM A;  5BRT A;  2AV4 A;  2B5X A;  2CV4 A;  2H72 A;  4K2X A;  1TK0 B;  5ECL B;  2RUF A;  1DSB A;  1SJZ A;  4ZBB A;  3V1W A;  1B9X C;  4Q5N A;  4ULX A;  2CAI A;  3ED3 A;  2OBK A;  4LMW A;  12GS A;  6GSU A;  1BX9 A;  4EDZ A;  3ME8 A;  2C0E A;  3TOT A;  3APQ A;  4BWQ A;  2DC5 A;  1PD2 1;  1JZD A;  2EIQ A;  5G31 A;  1K0O A;  2MMN A;  2PGT A;  2LKU A;  3FZ4 A;  1QFN A;  2EIR A;  1NSW A;  2MBS A;  3IHG A;  1EZK A;  1N2A A;  3GIX A;  1GUL A;  2VM1 A;  2CA8 A;  3H1N A;  5D93 A;  4EKZ A;  5D9V A;  3JCM L;  4ISD A;  1XWB A;  2N5F A;  3QAG A;  1HNC A;  1T4Z A;  4MLY A;  2K8V A;  5CRW A;  4IW9 A;  2H8L A;  2HNL A;  5IMA A;  3G7J A;  5EL8 A;  4OFM A;  3TKS C;  1VGL A;  3KTB A;  2R3X A;  4MJE A;  1PN0 A;  2I1U A;  1ERU A;  1GSQ A;  1PFO A;  1R5P A;  3EVI A;  2HLS A;  4NMU A;  3K8N A;  3IC4 A;  3TRQ A;  1GSU A;  2NPB A;  3LOR A;  3GKN A;  4RI7 A;  5KN2 A;  1OC8 A;  4LLR A;  2H1G A;  1U3I A;  3EPT A;  2LST A;  4L8E A;  2C3Q A;  2YAN A;  1OC9 A;  3VI7 A;  4RQX A;  4EIQ A;  2XPE A;  3LXT A;  1BYE A;  2C3N A;  1LU4 A;  1TRS A;  3UVT A;  2H1A A;  1ZYN A;  4O5U A;  2CX4 A;  4IHU A;  4BL7 B;  4K0G A;  3IV4 A;  4NPB A;  4USS A;  2VCX A;  2GVP A;  4ZB9 A;  1TI1 A;  3ZRE A;  9GSS A;  2PN8 A;  3TKS A;  2B6M A;  1ML6 A;  2F8A A;  4OWY A;  3ME7 A;  5F8B A;  1E2Y A;  1TP9 A;  2P5Q A;  4L0W A;  2FWE A;  3FHK A;  2YWI A;  5INY A;  4HDE A;  4X4J A;  2LJA A;  2OA7 A;  2DIZ A;  1B48 A;  1F37 A;  3M3M A;  1X9W B;  4O32 A;  2CVD A;  2AYT A;  5EPF A;  2FWF A;  2YCD A;  4KF9 A;  4NV5 A;  3L4N A;  1TXX A;  2RLI A;  1WP0 A;  3CSH A;  3GUR A;  4BA7 A;  1FVK A;  1SD9 A;  3W6G A;  4I5Q A;  4HZ2 A;  5ECP B;  2I3Y A;  4F2I A;  2FA8 A;  3FR6 A;  2PVO C;  3E3E A;  3TKS E;  6GSS A;  5ECR B;  3EC3 A;  4WBR D;  4MK3 A;  2ZUP A;  3WGX A;  4KUN A;  1A2J A;  5EY6 A;  4YKF A;  1T3B A;  2JZR A;  1Z5Y E;  3PR8 A;  1SU9 A;  4PQH A;  1XVQ A;  3J7Y k;  1J0F A;  3ZVJ A;  4NXI A;  4DEJ A;  2OE1 A;  1GWC A;  1ZZY A;  5D96 A;  3ZIT A;  1YJ6 A;  4MMM A;  1V9W A;  3F4S A;  4FH8 A;  3DML A;  1OE8 A;  2AJQ B;  2L6D A;  2HZE A;  2XBQ A;  1KEB A;  2MMA A;  3WGD A;  1W4V A;  4TXV A;  3HZ8 A;  1PSQ A;  3KH9 A;  1O6J A;  2ALB A;  1ZCP A;  4V2N A;  4DSS B;  1K0D A;  1IYH A;  1R4W A;  2X8H A;  1XIY A;  3VWU A;  4BVX A;  4ZL7 A;  1A0R P;  5B8B A;  1FB6 A;  4OD7 A;  1SJ6 A;  1SK0 A;  2QGV A;  2JSZ A;  5CNW A;  1JZR A;  4TR3 A;  2LUS A;  2BMX A;  4K0N A;  4Q5R A;  1XBS A;  1GL8 A;  3E9J B;  4NAX A;  4RUV A;  4HUA A;  4A5P A;  3KCM A;  2H75 A;  1FAA A;  2FY6 A;  2G0F A;  4HU9 A;  1ZOF A;  2YWN A;  3F63 A;  3PH9 A;  3LW9 A;  5ECK B;  2EIO A;  2GTU A;  3TJK A;  4MPF A;  1GSS A;  3NIV A;  1TK8 B;  1TJD A;  3IBH A;  3ERG A;  5BMU A;  1O8W A;  3D0Z A;  3S9F A;  5A4W A;  1M99 A;  1MDI A;  5G1K A;  1EGO A;  1V40 A;  1A2M A;  4KA0 A;  3CBU A;  1QMV A;  1GTU A;  1A8Y A;  5IMV A;  3TKQ A;  1ABA A;  2L4C A;  4D73 A;  4G0K A;  2CAQ A;  4BVY A;  4Z2U A;  1HNA A;  1SYR A;  5FHI A;  2YV7 A;  3TJB A;  2H66 A;  2GSR A;  3L78 A;  5D9T A;  3QPM A;  1ZL9 A;  2IMI A;  2MZC A;  1GLP A;  4MA9 A;  2VUP A;  4GSN A;  4MP4 A;  3KTL A;  4V1A p;  4XHM A;  4BWS A;  4K5S A;  2RII A;  5ECQ B;  2YPM A;  3BOA A;  3HD5 A;  1TRU A;  1F3A A;  4PGT A;  2B5E A;  5J41 A;  4JZQ A;  3F6D A;  2OE3 A;  2VCW A;  4J2F A;  2EC4 A;  4K1F A;  2H1D A;  4HI7 A;  5KN0 A;  5HFK A;  1RW1 A;  5J9C A;  1LJR A;  5DCG A;  4IQ1 A;  1GP1 A;  4ECJ A;  1PX6 A;  4Z2R A;  4K7I A;  1ON4 A;  10GS A;  1M3J A;  5IOW A;  3KJY A;  3RHB A;  1B8X A;  2M80 A;  3I6A A;  2O85 A;  4P3Y B;  4MDC A;  4O7H A;  4ML6 A;  4GST A;  2HZF A;  2QA2 A;  1R5A A;  4EF0 A;  4O5Q A;  1A8L A;  4TR1 A;  2N5A A;  4FO5 A;  4XRD A;  3E0U A;  3C1S A;  2XPD A;  3A2X A;  3IXR A;  5ID2 B;  2VD1 A;  3A2W A;  3MWH A;  1SKR B;  5JCW A;  2GGT A;  2H0H A;  2VL3 A;  3BCI A;  4ECB A;  4I97 A;  1PRX A;  1X5C A;  2JZS A;  1EWX A;  2R4V A;  3HXS A;  4HZ4 A;  3HKR A;  3GFK A;  2H74 A;  3ERF A;  2E2G A;  18GS A;  3HHV A;  4ZBA A;  4NV2 A;  1HYU A;  3DVX A;  1TDI A;  2BTO T;  3DEX A;  2WRT A;  3IRA A;  4KCA A;  5A4U A;  4WR5 A;  5J4U A;  2HXK A;  2DJ3 A;  1AW9 A;  3QAW A;  1M7T A;  4KCE A;  2LS5 A;  3IC8 A;  3ZFL A;  3HJP A;  2LRT A;  3F4R A;  2V6K A;  4MH2 A;  4V2L A;  4TR0 A;  3BJ5 A;  2NVL A;  1FOH A;  4KAE A;  3VPT A;  4AF2 A;  3RPN A;  5KN1 A;  2K6V A;  3BD2 A;  2E2M A;  1TOF A;  5JWR B;  2J23 A;  5A4V A;  5J3R A;  3KP8 A;  4WEY A;  5H5S A;  2CVB A;  2PUK C;  3EU3 A;  1N8J A;  4BIK A;  1EV4 A;  2V1M A;  1XCC A;  3D4T A;  3VK9 A;  2FNO A;  2YWM A;  1PN9 A;  1R26 A;  2J9H A;  2ES7 A;  2QKE A;  4GRF A;  2H73 A;  3TJF A;  1GTA A;  4ACS A;  1T7P B;  2VM2 A;  3HVV A;  4FQU A;  1H75 A;  3D4M A;  3H8Q A;  3VWX A;  2GZP A;  3Q18 A;  1LBK A;  3APO A;  3M9J A;  5J9B A;  3UBL A;  4XCS A;  2WGR A;  3VPQ A;  5DAL A;  4QL9 A;  4KSO A;  2GQL A;  4K6X A;  1K0A A;  1GH2 A;  2VLT A;  5IO0 A;  3IOS A;  4CHS A;  2X8G A;  1V57 A;  2E7P A;  2WZ9 A;  2H70 A;  2JU5 A;  2PPT A;  3D22 A;  1NHY A;  4Z7X A;  2MYG A;  1TW9 A;  2HT9 A;  3DIE A;  1AQW A;  1X0R A;  1IYI A;  4HEA 2;  4GTU A;  4EDY A;  5LNK e;  2HRN A;  1GTI A;  2HYX A;  4NHZ A;  5G2Z A;  1G7O A;  4POL A;  5HQP A;  1I9D A;  1JZW A;  2KHP A;  3CTG A;  3GA4 A;  3KXO A;  4I6X A;  2XBI A;  5DQY A;  2DJK A;  5B6M A;  2I4A A;  1RQM A;  2O7K A;  3TOU A;  5ELG A;  1XOB A;  4ZIJ A;  3A3T A;  1EEM A;  2DKH A;  5GAP D;  3GH6 A;  2FUG 2;  1VF3 A;  2X49 A;  4PTS A;  1ERW A;  4TRX A;  5FWG A;  4CY8 A;  3SWL A;  5KN3 A;  2X8C A;  5D73 A;  4HS1 A;  2HSY A;  5AN1 A;  3W8S A;  6GST A;  4HOJ A;  1CQH A;  4WR4 A;  2H76 A;  3GKX A;  2VCT A;  1G0T A;  2HFD A;  2C1Y A;  6GSV A;  5IIZ A;  4JR6 A;  1M2A A;  1WWJ A;  5HFG A;  2M46 A;  1AXD A;  1DUG A;  3PPU A;  2LQO A;  5DAK B;  4KGI A;  4EL1 A;  1MTC A;  3HCZ A;  3FEU A;  3FY7 A;  3ZIV A;  2ON5 A;  3UEM A;  1CQG A;  4MF7 A;  2TRX A;  2AHE A;  5IPG A;  3C71 A;  3H4K A;  3I9V 2;  4K7O A;  2DML A;  1SKS B;  4KH7 A;  2GZY A;  4G0L A;  1DE1 A;  2TRC P;  3IE3 A;  2IFQ B;  3RBT A;  3GTU B;  4YQM A;  3GX0 A;  3U6V A;  1Y25 A;  1F3B A;  2A2S A;  2UZ8 A;  2MMO A;  4ILF A;  2YZH A;  4N0V A;  1ZYE A;  1FHE A;  3LSZ A;  4TVE A;  2YWO A;  2YP6 A;  4EUY A;  5IMD A;  3IA1 A;  4KX4 A;  2V41 A;  4TN8 A;  3PIN A;  2X4A A;  3GV1 A;  1S3A A;  2L4Q A;  2R5G A;  1M3I A;  3QAV A;  1BJX A;  1THX A;  1FW1 A;  3M0F A;  5CRH A;  1OE7 A;  2P31 A;  3A5I A;  2V32 A;  3D6I A;  2H1B A;  5HFI A;  1ZYQ B;  2A2P A;  2R6K A;  2R37 A;  3HZ4 A;  1Z7R A;  1M0U A;  4DSQ A;  5CRG A;  1SD8 A;  1U88 A;  4TXO B;  2YJ7 A;  1JHB A;  1FVJ A;  4TR4 A;  5G1L A;  4JU5 A;  2HSH A;  3KGK A;  1THO A;  3I69 A;  5D8I A;  3ISO A;  4LL4 B;  4PUA A;  2L57 A;  1T4Y A;  4BL7 A;  2WDU A;  2ZCT A;  2CZ3 A;  3GST A;  1SEN A;  1O7U A;  2FA4 A;  3CMI A;  5DVB A;  5E4W A;  5H5R A;  5GAN D;  4JRR A;  3GL3 A;  4XTS A;  1M2D A;  3TB2 A;  4CW9 A;  1U87 A;  1MDJ A;  2HRA A;  1QK8 A;  2P5R A;  4MAB A;  3KZQ A;  1NM3 A;  3QR6 A;  2JAC A;  1XW9 A;  1M9B A;  3FKF A;  1SK1 A;  2IN3 A;  2F8F A;  2NTO A;  2GSQ A;  4OMV A;  4G19 A;  4LMV A;  1PQN A;  4FIW A;  4I2T A;  2GDR A;  4QQ7 A;  3F9U A;  2GSS A;  5ECN B;  1KTE A;  3HYP A;  4HJM A;  2CZ2 A;  2H71 A;  1Z3E A;  2R0C A;  3HVN A;  3N9J A;  2GS3 A;  2IIY A;  3J7Y b;  3A5W A;  1PL2 A;  2FGX A;  2D2Z A;  2CQ9 A;  4IN0 A;  2FCH A;  2IMK A;  2REM A;  2HRK A;  4G2E A;  1SYX A;  4XS4 B;  5ABR A;  5HR1 A;  4DVC A;  4H86 A;  1S3C A;  4K5R A;  5KOX A;  5DDL A;  2VAF A;  2LJK A;  4PX1 A;  2DSA A;  2ZNM A;  3SBC A;  11GS A;  3FYG A;  2IME A;  1V2A A;  3GUS A;  4NWY A;  4F0B A;  2GQK A;  2N5B A;  1T1V A;  1A23 A;  2IWT A;  1XWK A;  3P8W A;  4ML1 A;  4BPY A;  5F07 A;  2L5L A;  1ZGN A;  2O89 A;  1ILO A;  3L9U A;  4OO5 A;  2A4V A;  4D73 B;  1OC3 A;  1SJI A;  2OKA A;  3WT1 A;  4N0Z A;  4KSM A;  1X5E A;  1ERV A;  2GST A;  2H30 A;  2H6Z A;  1UVZ A;  3UAR A;  3FR9 A;  4TW5 A;  2VD0 A;  3CSI A;  1A24 A;  1PA3 A;  4ID0 A;  4ZXG A;  1BG5 A;  2C0G A;  1RK4 A;  2LEG A;  1U3A A;  3N5O A;  3R2Q A;  5L71 A;  2LV3 A;  1PKW A;  4ZB6 A;  1HNB A;  4PQI A;  4V2M A;  3Q19 A;  4KND A;  5E59 A;  3QMX A;  3FR3 A;  2HSM A;  5GSS A;  3KIJ A;  1PKZ A;  1XG8 A;  2B5Y A;  1X9M B;  4YKG A;  1ZMA A;  1C72 A;  3FZ9 A;  4OCF A;  3FK8 A;  3GNJ A;  4J56 E;  2VOC A;  17GS A;  4FYB A;  4OFT A;  1BQ7 A;  5HR3 A;  4J57 E;  5F0G A;  1XOA A;  2WUL A;  4ECC A;  4IEL A;  3HJO A;  4EVM A;  1WMJ A;  2LNT A;  1TI3 A;  2C0D A;  3RHC A;  1QGV A;  3ZFB A;  3F3R A;  4ZBD A;  1B9Y C;  4MF6 A;  4G0I A;  3WGE A;  2MMZ A;  2B1K A;  1MDK A;  7GSS A;  3KP9 A;  3LEF A;  4FYC A;  2O87 A;  1K0B A;  1WOU A;  1XFL A;  2CVK A;  3IHQ A;  1K3Y A;  3DWV A;  4MJC A;  3ERW A;  2F3M A;  3LQ7 A;  1XZO A;  2HE3 A;  3MNG A;  1AIU A;  4K8M A;  4PNG A;  2VL9 A;  1FG4 A;  4OCE A;  2NDO A;  1Z9H A;  3WYW A;  5ECI B;  1M2B A;  2K9F A;  2LTK A;  5CP1 A;  4EO3 A;  5JWO B;  1GRX A;  19GS A;  4ZB8 A;  1YQ1 A;  5DJL A;  4L5L A;  5CYY A;  5HR0 A;  3OR5 A;  3VWV A;  2H6Y A;  4TOP A;  3CRT A;  1VF4 A;  3IAS 2;  3GN3 A;  1Q98 A;  1SK2 A;  5FT3 A;  4K2D A;  2MBT A;  4N11 A;  5H5Q A;  2KP1 A;  3TCO A;  3IR4 A;  4XS1 A;  1EP8 A;  3DYR A;  4G9H A;  2FLS A;  3IAM 2;  3UIW A;  3GHA A;  2RM6 A;  5ID2 A;  1T8E B;  1OKT A;  1SL0 B;  4WF4 A;  4XRA A;  1TKD B;  3ZVJ D;  3GYK A;  3LYK A;  5GZZ B;  2VCQ A;  1AUC A;  2VLV A;  3UBK A;  4JED A;  1YF0 A;  3DXB A;  2H01 A;  5B6N A;  5B7C A;  4N10 A;  1AAZ A;  3DVW A;  4WXT A;  1QQ2 A;  4O92 A;  3WD6 A;  3UVH A;  5AIX A;  4POK A;  1X5D A;  1XW5 A;  1M9A A;  2I81 A;  3MIX A;  1K3O A;  4YH2 A;  1X9S B;  1QUW A;  2R0G A;  8GSS A;  2L5O A;  5DAL B;  1J9B A;  2WB9 A;  4AJ8 A;  1GSD A;  3VUR A;  1YF1 A;  3MYD A;  1WE0 A;  3HDC A;  1J08 A;  1XXU A;  3L9V A;  1JLW A;  3EWL A;  5CRD A;  4HQZ A;  3F3Q A;  4IGJ A;  4IQA A;  1TU7 A;  1XPV A;  2WCI A;  3VLN A;  3GH9 A;  2RUE A;  4IP1 A;  4MH3 A;  5LD0 A;  3TKR A;  4MZW A;  3GL5 A;  4X1U A;  5IQY A;  4YAV A;  4JR4 A;  2PU9 C;  5IMF A;  3M1G A;  1B4Q A;  2JAD A;  3LWA A;  2OAD A;  3ZTL A;  1S3R A;  2FWG A;  4PXO A;  2PWJ A;  4GQF A;  1GNE A;  2X64 A;  3M8N A;  3LG6 A;  2VIM A;  3O76 A;  1U6T A;  1FB0 A;  4ECI A;  3EMX A;  2M72 A;  5ECH B;  1YY7 A;  4X43 A;  5CAX A;  1XW6 A;  5J5N A;  3VI5 A;  5KEJ A;  2GZZ A;  3RAZ A;  3NZN A;  5JCU A;  5A5K A;  4Q5F A;  1HQO A;  1EGR A;  4HU7 A;  2F51 A;  2XHF A;  2AB6 A;  2WFC A;  3O3T A;  2B1L A;  3R3E A;  3CQF A;  4POB A;  4GXZ A;  5ECO B;  3D5J A;  1ZYP A;  3UMA A;  4GCI A;  3EUR A;  3EMP A;  3HA9 A;  4HJ2 A;  1OYJ A;  4DSR A;  1GUK A;  1Z6N A;  3ZYW A;  2DMM A;  1R7H A;  4FYU A;  1K0N A;  2YV9 A;  1OC9 B;  3H79 A;  4GF0 A;  3TRP A;  4ZL9 A;  3UJ1 A;  1V98 A;  1URM A;  3GKM A;  6GSY A;  3CTF A;  3LJR A;  2PVQ A;  2V2G A;  2GT5 A;  3DD3 A;  1WPI A;  3WT2 A;  2BJX A;  3G7I A;  1KNG A;  2K18 A;  2DBC A;  2TIR A;  1S3D A;  1HD2 A;  2VLU A;  1KBN A;  3Q74 A;  2JSY A;  1O73 A;  5COH A;  2B7K A;  1YKC A;  2YNX A;  2LRN A;  1AQX A;  2C0F A;  3U5R E;  3F4T A;  4MJA A;  2H6X A;  4E8H A;  3BBY A;  5AGY A;  5DAK A;  1OVN A;  5F05 A;  2OBI A;  4AJ7 A;  1PX7 A;  4KB3 A;  2CX3 A;  4XIH A;  2B3S A;  1MD4 A;  5IM9 A;  1G6Y A;  4TKY A;  4IJ3 A;  1GSF A;  2A4H A;  4MJB A;  5IPH A;  4ZIL A;  4MPG A;  2R2J A;  3AY8 A;  4HQS A;  4F82 A;  1YDK A;  2B7J A;  4XS6 A;  1WJK A;  5IO2 A;  3RPP A;  2IFQ A;  2RM5 A;  3GTU A;  5HR2 A;  3DRN A;  2YJH A;  3C1R A;  4PQ1 A;  4CY6 A;  1MD3 A;  5ELA A;  4GQC A;  1O81 A;  5DJM A;  4WF5 A;  5F06 A;  3D21 A;  1QXH A;  5B8A A;  3IPZ A;  3UAP A;  3C8E A;  4KE3 A;  3TDG A;  3H93 A;  4GLT A;  4CDO A;  3US3 A;  3M9K A;  4ICY A;  5IMC A;  2DIY A;  3A2V A;  4N30 A;  4Q5Q A;  4I2U A;  4KDX A;  4E8E A;  1OKD A;  1XVW A;  5C04 A;  3ZMK A;  3VFI A;  2HZE B;  1UN2 A;  2IPA A;  1SL2 B;  3UOM A;  4L5O A;  4QL7 A;  1V58 A;  1O85 A;  4RI6 A;  3EIN A;  3FZA A;  4HSC X;  2GQM A;  2G2Q A;  3LFL A;  4TXO A;  1F2E A;  2VL2 C;  3QD9 A;  2FWH A;  4MF5 A;  4BVX B;  6GSW A;  2WS2 A;  2KOK A;  5DCH A;  3P7X A;  1UC7 A;  4EE0 A;  4EIP A;  2HI7 A;  1K0C A;  4IS0 A;  3MDK A;  4O5R A;  4F03 A;  4AGS A;  1BAY A;  3IDV A;  14GS A;  4PUF C;  2IL3 A;  2C8U A;  3UL3 A;  3IK7 A;  3IK9 A;  3KH7 A;  2R0P A;  1JLV A;  3TRX A;  4LA1 A;  4LL1 B;  4G10 A;  5IMZ A;  2VO4 A;  4OFN A;  1ERT A;  2GT6 A;  2YN1 A;  2X99 A;  3W8J A;  3ZL5 A;  2XC2 A;  2KUC A;  3EE2 A;  2DJ2 A;  1VRS D;  2LRC A;  2VL2 A;  13GS A;  5LCZ A;  2OE0 A;  2CT6 A;  2C3T A;  1TTZ A;  1FO5 A;  1NW2 A;  3QDN A;  1GNW A;  4AJ6 A;  3Q6O A;  3MAK A;  4BVY B;  2OJL A;  4K9Z A;  2FHE A;  1MEK A;  2DJ1 A;  3CXG A;  4DSS A;  3LXZ A;  3ZRD A;  1OAZ A;  4XS4 A;  3MSZ A;  2IMD A;  4MZC A;  1NHO A;  2NBS A;  1EP7 A;  2LQQ A;  5KOW A;  4KDY A;  2QA1 A;  1O8X A;  3G9B A;  2HRF A;  1PL1 A;  3TJG A;  3NOF A;  2H0G A;  1AQV A;  3HVX A;  1SKW B;  2FD3 A;  5EVO A;  1G7E A;  4GSS A;  3APS A;  1I5G A;  5ECS A;  4L0U A;  5GST A;  2P0G A;  4WKW A;  4PUR A;  1FOV A;  3FZ5 A;  2DKI A;  3CSJ A;  3GRX A;  3LGC A;  1Z6M A;  3ZZX A;  4I8B A;  4YAP A; 
#chains in the Genus database with same CATH homology
 3RDW A;  2VCV A;  3FRC A;  3KD0 A;  4NHW A;  1EV9 A;  2AUV A;  1TU8 A;  1PMT A;  4POM A;  2PMT A;  2QC7 A;  2LNS A;  1GSY A;  3KMN A;  4TR1 B;  1WIK A;  16GS A;  2JZT A;  2YOI A;  2KLX A;  1GTB A;  20GS A;  3CYN A;  3ZIJ A;  2H19 A;  1YZX A;  4YQV A;  5G30 A;  3FW2 A;  1ACV A;  3TKP A;  2PBJ A;  3I43 A;  3O6T A;  3KM6 A;  4IVF A;  1BED A;  1E6B A;  4V1A g;  3GKK A;  4EC0 A;  2H0I A;  5D9X A;  3BCK A;  3PGT A;  3KEB A;  3HY2 A;  1SL1 B;  1K0M A;  4KDU A;  4F0C A;  4MNN A;  5G5F A;  5ENU A;  5CO3 A;  2WJU A;  5G5E A;  2Z9S A;  5CRE A;  2OAC A;  3F6F A;  3LYP A;  2L59 A;  2DLX A;  4Z2T A;  5DQS A;  2F9S A;  1EEJ A;  1Y6E A;  4IP6 A;  4MCU A;  1XWG A;  1A2L A;  1JFU A;  3HVS A;  2V6O A;  3C73 A;  5D9W A;  5C00 A;  1TRW A;  4X0X A;  2YZU A;  1EOG A;  2IJY A;  2C80 A;  3EYT A;  4GWR A;  5JWQ B;  1XWC A;  1B4P A;  3G7Y A;  4MZB A;  3GMF A;  2L6C A;  4RQR A;  3VWW A;  2I9H A;  1Q4J A;  2JL4 A;  2QSI A;  1ST9 A;  4IBP A;  4WET A;  3GX8 A;  3P90 A;  3ZLP A;  1F6M C;  3DKS A;  5AIS A;  1DE2 A;  4YQU A;  3TJJ A;  3QFB C;  4WBJ A;  3GSS A;  2VCZ A;  3ZML A;  1PGT A;  22GS A;  3FMW A;  1XWA A;  4JBB A;  3QFA C;  3EU4 A;  1DBY A;  1T00 A;  3L0H A;  5IOX A;  2C4J A;  4K7N A;  1WRY A;  1VF1 A;  1TRV A;  2E0Q A;  3DGQ A;  1Z7P A;  5ECM B;  3HJM A;  3TGZ A;  2GLR A;  1GLQ A;  1GSE A;  4OO4 A;  1AC1 A;  2AAW A;  2IMF A;  4F9Z A;  1JZO A;  5JCG A;  1UA5 A;  3C7M A;  2LJR A;  3QOU A;  2ON7 A;  1K3L A;  3TUE A;  2K8S A;  1VF2 A;  2DJJ A;  3KMO A;  4ZL8 A;  2O8V B;  4IKH A;  3L9S A;  1YKA A;  1YEP A;  1A0F A;  4KW6 A;  4IJI A;  1F9M A;  4PNF A;  1TK5 B;  1GUH A;  1YEX A;  2KP2 A;  3F8U A;  1G6W A;  2DJ0 A;  1W89 A;  3F0I A;  1H4O A;  2A2R A;  5DBQ A;  3CRU A;  4JE1 A;  2PER A;  4EXJ A;  3QCP A;  1EOH A;  1USB A;  5AIV A;  6GSX A;  3P2A A;  1GUM A;  5BRT A;  2AV4 A;  2B5X A;  2CV4 A;  2H72 A;  4K2X A;  1TK0 B;  5ECL B;  2RUF A;  1DSB A;  1SJZ A;  4ZBB A;  3V1W A;  1B9X C;  4Q5N A;  4ULX A;  2CAI A;  3ED3 A;  2OBK A;  4LMW A;  12GS A;  6GSU A;  1BX9 A;  4EDZ A;  3ME8 A;  2C0E A;  3TOT A;  3APQ A;  4BWQ A;  2DC5 A;  1PD2 1;  1JZD A;  2EIQ A;  5G31 A;  1K0O A;  2MMN A;  2PGT A;  2LKU A;  3FZ4 A;  1QFN A;  2EIR A;  1NSW A;  2MBS A;  3IHG A;  1EZK A;  1N2A A;  3GIX A;  1GUL A;  2VM1 A;  2CA8 A;  3H1N A;  5D93 A;  4EKZ A;  5D9V A;  3JCM L;  4ISD A;  1XWB A;  2N5F A;  3QAG A;  1HNC A;  1T4Z A;  4MLY A;  2K8V A;  5CRW A;  4IW9 A;  2H8L A;  2HNL A;  5IMA A;  3G7J A;  5EL8 A;  4OFM A;  3TKS C;  1VGL A;  3KTB A;  2R3X A;  4MJE A;  1PN0 A;  2I1U A;  1ERU A;  1GSQ A;  3EVI A;  1R5P A;  2HLS A;  4NMU A;  3K8N A;  3IC4 A;  3TRQ A;  1GSU A;  2NPB A;  3LOR A;  3GKN A;  4RI7 A;  5KN2 A;  1OC8 A;  4LLR A;  2H1G A;  1U3I A;  3EPT A;  2LST A;  4L8E A;  2C3Q A;  2YAN A;  1OC9 A;  3VI7 A;  4RQX A;  4EIQ A;  2XPE A;  3LXT A;  1BYE A;  2C3N A;  1LU4 A;  1TRS A;  3UVT A;  2H1A A;  1ZYN A;  4O5U A;  2CX4 A;  4IHU A;  4BL7 B;  4K0G A;  3IV4 A;  4NPB A;  4USS A;  2VCX A;  2GVP A;  4ZB9 A;  1TI1 A;  3ZRE A;  9GSS A;  2PN8 A;  3TKS A;  2B6M A;  1ML6 A;  2F8A A;  4OWY A;  3ME7 A;  5F8B A;  1E2Y A;  1TP9 A;  2P5Q A;  4L0W A;  2FWE A;  3FHK A;  2YWI A;  5INY A;  4HDE A;  4X4J A;  2LJA A;  2OA7 A;  2DIZ A;  1B48 A;  1F37 A;  3M3M A;  1X9W B;  4O32 A;  2CVD A;  2AYT A;  5EPF A;  2FWF A;  2YCD A;  4KF9 A;  4NV5 A;  3L4N A;  1TXX A;  2RLI A;  1WP0 A;  3CSH A;  3GUR A;  4BA7 A;  1FVK A;  1SD9 A;  3W6G A;  4I5Q A;  4HZ2 A;  5ECP B;  2I3Y A;  4F2I A;  2FA8 A;  3FR6 A;  2PVO C;  3E3E A;  3TKS E;  6GSS A;  5ECR B;  3EC3 A;  4WBR D;  4MK3 A;  2ZUP A;  3WGX A;  4KUN A;  1A2J A;  5EY6 A;  4YKF A;  1T3B A;  2JZR A;  1Z5Y E;  3PR8 A;  1SU9 A;  4PQH A;  1XVQ A;  3J7Y k;  1J0F A;  3ZVJ A;  4NXI A;  4DEJ A;  2OE1 A;  1GWC A;  1ZZY A;  5D96 A;  3ZIT A;  1YJ6 A;  4MMM A;  1V9W A;  3F4S A;  4FH8 A;  3DML A;  1OE8 A;  2AJQ B;  2L6D A;  2HZE A;  2XBQ A;  1KEB A;  2MMA A;  3WGD A;  1W4V A;  4TXV A;  3HZ8 A;  1PSQ A;  3KH9 A;  1O6J A;  2ALB A;  1ZCP A;  4V2N A;  4DSS B;  1K0D A;  1IYH A;  1R4W A;  2X8H A;  1XIY A;  3VWU A;  4BVX A;  4ZL7 A;  1A0R P;  5B8B A;  1FB6 A;  4OD7 A;  1SJ6 A;  1SK0 A;  2QGV A;  2JSZ A;  5CNW A;  1JZR A;  4TR3 A;  2LUS A;  2BMX A;  4K0N A;  4Q5R A;  1XBS A;  1GL8 A;  3E9J B;  4NAX A;  4RUV A;  4HUA A;  4A5P A;  3KCM A;  2H75 A;  1FAA A;  2FY6 A;  2G0F A;  4HU9 A;  1ZOF A;  2YWN A;  3F63 A;  3PH9 A;  3LW9 A;  5ECK B;  2EIO A;  2GTU A;  3TJK A;  4MPF A;  1GSS A;  3NIV A;  1TK8 B;  1TJD A;  3IBH A;  3ERG A;  5BMU A;  1O8W A;  3D0Z A;  3S9F A;  5A4W A;  1M99 A;  1MDI A;  5G1K A;  1EGO A;  1V40 A;  1A2M A;  4KA0 A;  3CBU A;  1QMV A;  1GTU A;  1A8Y A;  5IMV A;  3TKQ A;  1ABA A;  2L4C A;  4D73 A;  4G0K A;  2CAQ A;  4BVY A;  4Z2U A;  1HNA A;  1SYR A;  5FHI A;  2YV7 A;  3TJB A;  2H66 A;  2GSR A;  3L78 A;  5D9T A;  3QPM A;  1ZL9 A;  2IMI A;  2MZC A;  1GLP A;  4MA9 A;  2VUP A;  4GSN A;  4MP4 A;  3KTL A;  4V1A p;  4XHM A;  4BWS A;  4K5S A;  2RII A;  5ECQ B;  2YPM A;  3BOA A;  3HD5 A;  1TRU A;  1F3A A;  4PGT A;  2B5E A;  5J41 A;  4JZQ A;  3F6D A;  2OE3 A;  2VCW A;  4J2F A;  2EC4 A;  4K1F A;  2H1D A;  4HI7 A;  5KN0 A;  5HFK A;  1RW1 A;  5J9C A;  1LJR A;  5DCG A;  4IQ1 A;  1GP1 A;  4ECJ A;  1PX6 A;  4Z2R A;  4K7I A;  1ON4 A;  10GS A;  5IOW A;  3KJY A;  3RHB A;  1B8X A;  2M80 A;  3I6A A;  2O85 A;  4P3Y B;  4MDC A;  4O7H A;  4ML6 A;  4GST A;  2HZF A;  2QA2 A;  1R5A A;  4EF0 A;  4O5Q A;  1A8L A;  4TR1 A;  2N5A A;  4FO5 A;  4XRD A;  3E0U A;  3C1S A;  2XPD A;  3A2X A;  3IXR A;  5ID2 B;  2VD1 A;  3A2W A;  3MWH A;  1SKR B;  5JCW A;  2GGT A;  2H0H A;  2VL3 A;  3BCI A;  4ECB A;  4I97 A;  1PRX A;  1X5C A;  2JZS A;  1EWX A;  2R4V A;  3HXS A;  4HZ4 A;  3HKR A;  3GFK A;  2H74 A;  3ERF A;  2E2G A;  18GS A;  3HHV A;  4ZBA A;  4NV2 A;  1HYU A;  3DVX A;  1TDI A;  2BTO T;  3DEX A;  2WRT A;  3IRA A;  4KCA A;  5A4U A;  4WR5 A;  5J4U A;  2HXK A;  2DJ3 A;  1AW9 A;  3QAW A;  1M7T A;  4KCE A;  2LS5 A;  3IC8 A;  3ZFL A;  3HJP A;  2LRT A;  3F4R A;  2V6K A;  4MH2 A;  4V2L A;  4TR0 A;  3BJ5 A;  2NVL A;  1FOH A;  4KAE A;  3VPT A;  4AF2 A;  3RPN A;  5KN1 A;  2K6V A;  3BD2 A;  2E2M A;  1TOF A;  5JWR B;  2J23 A;  5A4V A;  5J3R A;  3KP8 A;  4WEY A;  5H5S A;  2CVB A;  2PUK C;  3EU3 A;  1N8J A;  1EV4 A;  2V1M A;  1XCC A;  3D4T A;  3VK9 A;  2FNO A;  2YWM A;  1PN9 A;  1R26 A;  2J9H A;  2ES7 A;  2QKE A;  4GRF A;  2H73 A;  3TJF A;  1GTA A;  4ACS A;  1T7P B;  2VM2 A;  3HVV A;  4FQU A;  1H75 A;  3D4M A;  3H8Q A;  3VWX A;  2GZP A;  3Q18 A;  1LBK A;  3APO A;  3M9J A;  5J9B A;  3UBL A;  4XCS A;  2WGR A;  3VPQ A;  5DAL A;  4QL9 A;  4KSO A;  2GQL A;  4K6X A;  1K0A A;  1GH2 A;  2VLT A;  5IO0 A;  3IOS A;  4CHS A;  2X8G A;  1V57 A;  2E7P A;  2WZ9 A;  2H70 A;  2JU5 A;  2PPT A;  3D22 A;  1NHY A;  4Z7X A;  2MYG A;  1TW9 A;  2HT9 A;  3DIE A;  1AQW A;  1X0R A;  1IYI A;  4HEA 2;  4GTU A;  4EDY A;  5LNK e;  2HRN A;  1GTI A;  2HYX A;  4NHZ A;  5G2Z A;  1G7O A;  4POL A;  5HQP A;  1I9D A;  1JZW A;  2KHP A;  3CTG A;  3GA4 A;  3KXO A;  4I6X A;  2XBI A;  5DQY A;  2DJK A;  5B6M A;  2I4A A;  1RQM A;  2O7K A;  3TOU A;  5ELG A;  1XOB A;  4ZIJ A;  3A3T A;  1EEM A;  2DKH A;  5GAP D;  3GH6 A;  2FUG 2;  1VF3 A;  2X49 A;  4PTS A;  1ERW A;  4TRX A;  5FWG A;  4CY8 A;  3SWL A;  5KN3 A;  2X8C A;  5D73 A;  4HS1 A;  2HSY A;  5AN1 A;  3W8S A;  6GST A;  4HOJ A;  1CQH A;  4WR4 A;  2H76 A;  3GKX A;  2VCT A;  1G0T A;  2HFD A;  2C1Y A;  6GSV A;  5IIZ A;  4JR6 A;  1M2A A;  1WWJ A;  5HFG A;  2M46 A;  1AXD A;  1DUG A;  3PPU A;  2LQO A;  5DAK B;  4KGI A;  4EL1 A;  1MTC A;  3HCZ A;  3FEU A;  3FY7 A;  3ZIV A;  2ON5 A;  3UEM A;  1CQG A;  4MF7 A;  2TRX A;  2AHE A;  5IPG A;  3C71 A;  3H4K A;  3I9V 2;  4K7O A;  2DML A;  1SKS B;  4KH7 A;  2GZY A;  4G0L A;  1DE1 A;  2TRC P;  3IE3 A;  2IFQ B;  3RBT A;  3GTU B;  4YQM A;  3GX0 A;  3U6V A;  1Y25 A;  1F3B A;  2A2S A;  2UZ8 A;  2MMO A;  4ILF A;  2YZH A;  4N0V A;  1ZYE A;  1FHE A;  3LSZ A;  4TVE A;  2YWO A;  2YP6 A;  4EUY A;  5IMD A;  3IA1 A;  4KX4 A;  2V41 A;  4TN8 A;  3PIN A;  2X4A A;  3GV1 A;  1S3A A;  2L4Q A;  2R5G A;  1BJX A;  3QAV A;  1THX A;  1FW1 A;  3M0F A;  5CRH A;  1OE7 A;  2P31 A;  3A5I A;  2V32 A;  3D6I A;  2H1B A;  5HFI A;  1ZYQ B;  2A2P A;  2R6K A;  2R37 A;  3HZ4 A;  1Z7R A;  1M0U A;  4DSQ A;  5CRG A;  1SD8 A;  1U88 A;  4TXO B;  2YJ7 A;  1JHB A;  1FVJ A;  4TR4 A;  5G1L A;  4JU5 A;  2HSH A;  3KGK A;  1THO A;  3I69 A;  5D8I A;  3ISO A;  4LL4 B;  4PUA A;  2L57 A;  1T4Y A;  4BL7 A;  2WDU A;  2ZCT A;  2CZ3 A;  3GST A;  1SEN A;  1O7U A;  2FA4 A;  3CMI A;  5DVB A;  5E4W A;  5H5R A;  5GAN D;  4JRR A;  3GL3 A;  4XTS A;  1M2D A;  3TB2 A;  4CW9 A;  1U87 A;  1MDJ A;  2HRA A;  1QK8 A;  2P5R A;  4MAB A;  3KZQ A;  1NM3 A;  3QR6 A;  2JAC A;  1XW9 A;  1M9B A;  3FKF A;  1SK1 A;  2IN3 A;  2F8F A;  2NTO A;  2GSQ A;  4OMV A;  4G19 A;  4LMV A;  1PQN A;  4FIW A;  4I2T A;  2GDR A;  4QQ7 A;  3F9U A;  2GSS A;  5ECN B;  1KTE A;  3HYP A;  4HJM A;  2CZ2 A;  2H71 A;  1Z3E A;  2R0C A;  3N9J A;  2GS3 A;  2IIY A;  3J7Y b;  3A5W A;  1PL2 A;  2FGX A;  2D2Z A;  2CQ9 A;  4IN0 A;  2FCH A;  2IMK A;  2REM A;  2HRK A;  4G2E A;  1SYX A;  4XS4 B;  5ABR A;  5HR1 A;  4DVC A;  4H86 A;  1S3C A;  4K5R A;  5KOX A;  5DDL A;  2VAF A;  2LJK A;  4PX1 A;  2DSA A;  2ZNM A;  3SBC A;  11GS A;  3FYG A;  2IME A;  1V2A A;  3GUS A;  4NWY A;  4F0B A;  2GQK A;  2N5B A;  1T1V A;  1A23 A;  2IWT A;  1XWK A;  3P8W A;  4ML1 A;  4BPY A;  5F07 A;  2L5L A;  1ZGN A;  2O89 A;  1ILO A;  3L9U A;  4OO5 A;  2A4V A;  4D73 B;  1OC3 A;  1SJI A;  2OKA A;  3WT1 A;  4N0Z A;  4KSM A;  1X5E A;  1ERV A;  2GST A;  2H30 A;  2H6Z A;  1UVZ A;  3UAR A;  3FR9 A;  4TW5 A;  2VD0 A;  3CSI A;  1A24 A;  1PA3 A;  4ID0 A;  4ZXG A;  1BG5 A;  2C0G A;  1RK4 A;  2LEG A;  1U3A A;  3N5O A;  3R2Q A;  5L71 A;  2LV3 A;  1PKW A;  4ZB6 A;  1HNB A;  4PQI A;  4V2M A;  3Q19 A;  4KND A;  5E59 A;  3QMX A;  3FR3 A;  2HSM A;  5GSS A;  3KIJ A;  1PKZ A;  2B5Y A;  1X9M B;  4YKG A;  1ZMA A;  1C72 A;  3FZ9 A;  4OCF A;  3FK8 A;  3GNJ A;  4J56 E;  2VOC A;  17GS A;  4FYB A;  4OFT A;  1BQ7 A;  5HR3 A;  4J57 E;  5F0G A;  1XOA A;  2WUL A;  4ECC A;  4IEL A;  3HJO A;  4EVM A;  1WMJ A;  2LNT A;  1TI3 A;  2C0D A;  3RHC A;  1QGV A;  3ZFB A;  3F3R A;  4ZBD A;  1B9Y C;  4MF6 A;  4G0I A;  3WGE A;  2MMZ A;  2B1K A;  1MDK A;  7GSS A;  3KP9 A;  3LEF A;  4FYC A;  2O87 A;  1K0B A;  1WOU A;  1XFL A;  2CVK A;  3IHQ A;  1K3Y A;  3DWV A;  4MJC A;  3ERW A;  2F3M A;  3LQ7 A;  1XZO A;  2HE3 A;  3MNG A;  1AIU A;  4K8M A;  4PNG A;  2VL9 A;  1FG4 A;  4OCE A;  2NDO A;  1Z9H A;  3WYW A;  5ECI B;  1M2B A;  2K9F A;  2LTK A;  5CP1 A;  4EO3 A;  5JWO B;  1GRX A;  19GS A;  4ZB8 A;  1YQ1 A;  5DJL A;  4L5L A;  5CYY A;  5HR0 A;  3OR5 A;  3VWV A;  2H6Y A;  4TOP A;  3CRT A;  1VF4 A;  3IAS 2;  3GN3 A;  1Q98 A;  1SK2 A;  5FT3 A;  4K2D A;  2MBT A;  4N11 A;  5H5Q A;  2KP1 A;  3TCO A;  3IR4 A;  4XS1 A;  1EP8 A;  3DYR A;  4G9H A;  2FLS A;  3IAM 2;  3UIW A;  3GHA A;  2RM6 A;  5ID2 A;  1T8E B;  1OKT A;  1SL0 B;  4WF4 A;  4XRA A;  1TKD B;  3ZVJ D;  3GYK A;  3LYK A;  5GZZ B;  2VCQ A;  1AUC A;  2VLV A;  3UBK A;  4JED A;  1YF0 A;  3DXB A;  2H01 A;  5B6N A;  5B7C A;  4N10 A;  1AAZ A;  3DVW A;  4WXT A;  1QQ2 A;  4O92 A;  3WD6 A;  3UVH A;  5AIX A;  4POK A;  1X5D A;  1XW5 A;  1M9A A;  2I81 A;  3MIX A;  1K3O A;  4YH2 A;  1X9S B;  1QUW A;  2R0G A;  8GSS A;  2L5O A;  5DAL B;  1J9B A;  2WB9 A;  4AJ8 A;  1GSD A;  3VUR A;  1YF1 A;  3MYD A;  1WE0 A;  3HDC A;  1J08 A;  1XXU A;  3L9V A;  1JLW A;  3EWL A;  5CRD A;  4HQZ A;  3F3Q A;  4IGJ A;  4IQA A;  1TU7 A;  1XPV A;  2WCI A;  3VLN A;  3GH9 A;  2RUE A;  4IP1 A;  4MH3 A;  5LD0 A;  3TKR A;  4MZW A;  3GL5 A;  4X1U A;  5IQY A;  4YAV A;  4JR4 A;  2PU9 C;  5IMF A;  3M1G A;  1B4Q A;  2JAD A;  3LWA A;  2OAD A;  3ZTL A;  2FWG A;  4PXO A;  2PWJ A;  4GQF A;  1GNE A;  2X64 A;  3M8N A;  3LG6 A;  2VIM A;  3O76 A;  1U6T A;  1FB0 A;  4ECI A;  3EMX A;  2M72 A;  5ECH B;  1YY7 A;  4X43 A;  5CAX A;  1XW6 A;  5J5N A;  3VI5 A;  5KEJ A;  2GZZ A;  3RAZ A;  3NZN A;  5JCU A;  5A5K A;  4Q5F A;  1HQO A;  1EGR A;  4HU7 A;  2F51 A;  2XHF A;  2AB6 A;  2WFC A;  3O3T A;  2B1L A;  3R3E A;  4POB A;  4GXZ A;  5ECO B;  3D5J A;  1ZYP A;  3UMA A;  4GCI A;  3EUR A;  3EMP A;  3HA9 A;  4HJ2 A;  1OYJ A;  4DSR A;  1GUK A;  1Z6N A;  3ZYW A;  2DMM A;  1R7H A;  4FYU A;  1K0N A;  2YV9 A;  1OC9 B;  3H79 A;  4GF0 A;  3TRP A;  4ZL9 A;  3UJ1 A;  1V98 A;  1URM A;  3GKM A;  6GSY A;  3CTF A;  3LJR A;  2PVQ A;  2V2G A;  2GT5 A;  3DD3 A;  1WPI A;  3WT2 A;  2BJX A;  3G7I A;  1KNG A;  2K18 A;  2DBC A;  2TIR A;  1S3D A;  1HD2 A;  2VLU A;  1KBN A;  3Q74 A;  2JSY A;  1O73 A;  5COH A;  2B7K A;  1YKC A;  2YNX A;  2LRN A;  1AQX A;  2C0F A;  3U5R E;  3F4T A;  4MJA A;  2H6X A;  4E8H A;  3BBY A;  5AGY A;  5DAK A;  1OVN A;  5F05 A;  2OBI A;  4AJ7 A;  1PX7 A;  4KB3 A;  2CX3 A;  4XIH A;  2B3S A;  1MD4 A;  5IM9 A;  1G6Y A;  4TKY A;  4IJ3 A;  1GSF A;  2A4H A;  4MJB A;  5IPH A;  4ZIL A;  4MPG A;  2R2J A;  3AY8 A;  4HQS A;  4F82 A;  1YDK A;  2B7J A;  4XS6 A;  1WJK A;  5IO2 A;  3RPP A;  2IFQ A;  2RM5 A;  3GTU A;  5HR2 A;  3DRN A;  2YJH A;  3C1R A;  4PQ1 A;  4CY6 A;  1MD3 A;  5ELA A;  4GQC A;  1O81 A;  5DJM A;  4WF5 A;  5F06 A;  3D21 A;  1QXH A;  5B8A A;  3IPZ A;  3UAP A;  3C8E A;  4KE3 A;  3TDG A;  3H93 A;  4GLT A;  4CDO A;  3US3 A;  3M9K A;  4ICY A;  5IMC A;  2DIY A;  3A2V A;  4N30 A;  4Q5Q A;  4I2U A;  4KDX A;  4E8E A;  1OKD A;  1XVW A;  5C04 A;  3ZMK A;  3VFI A;  2HZE B;  1UN2 A;  2IPA A;  1SL2 B;  3UOM A;  4L5O A;  4QL7 A;  1V58 A;  1O85 A;  4RI6 A;  3EIN A;  3FZA A;  2GQM A;  2G2Q A;  3LFL A;  4TXO A;  1F2E A;  2VL2 C;  3QD9 A;  2FWH A;  4MF5 A;  4BVX B;  6GSW A;  2WS2 A;  2KOK A;  5DCH A;  3P7X A;  1UC7 A;  4EE0 A;  4EIP A;  2HI7 A;  1K0C A;  4IS0 A;  3MDK A;  4O5R A;  4F03 A;  4AGS A;  1BAY A;  3IDV A;  14GS A;  4PUF C;  2IL3 A;  2C8U A;  3UL3 A;  3IK7 A;  3IK9 A;  3KH7 A;  2R0P A;  1JLV A;  3TRX A;  4LA1 A;  4LL1 B;  4G10 A;  5IMZ A;  2VO4 A;  4OFN A;  1ERT A;  2GT6 A;  2YN1 A;  2X99 A;  3W8J A;  3ZL5 A;  2XC2 A;  2KUC A;  3EE2 A;  2DJ2 A;  1VRS D;  2LRC A;  2VL2 A;  13GS A;  5LCZ A;  2OE0 A;  2CT6 A;  2C3T A;  1TTZ A;  1FO5 A;  1NW2 A;  3QDN A;  1GNW A;  4AJ6 A;  3Q6O A;  3MAK A;  4BVY B;  2OJL A;  4K9Z A;  2FHE A;  1MEK A;  2DJ1 A;  3CXG A;  4DSS A;  3LXZ A;  3ZRD A;  1OAZ A;  4XS4 A;  3MSZ A;  2IMD A;  4MZC A;  1NHO A;  2NBS A;  1EP7 A;  2LQQ A;  5KOW A;  4KDY A;  2QA1 A;  1O8X A;  3G9B A;  2HRF A;  1PL1 A;  3TJG A;  3NOF A;  2H0G A;  1AQV A;  3HVX A;  1SKW B;  2FD3 A;  5EVO A;  1G7E A;  4GSS A;  3APS A;  1I5G A;  5ECS A;  4L0U A;  5GST A;  2P0G A;  4WKW A;  4PUR A;  1FOV A;  3FZ5 A;  2DKI A;  3CSJ A;  3GRX A;  3LGC A;  1Z6M A;  3ZZX A;  4I8B A;  4YAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...