5KN3A

Recombinant bovine skeletal calsequestrin, low-ca2+ form
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
347
structure length
347
Chain Sequence
GLDFPEYDGVDRVVNVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMDELILELAAQVLEDKGVGFGMVDSEKDAAVAKKLGLTEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDDNKLIGYFKNKDSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVSFVEAHKRSTLRKLKPESMYETWEDDLDGIHIVAFAEETDPDGYEFLETLKAVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFNIDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calsequestrin
publication title Characterization of Post-Translational Modifications to Calsequestrins of Cardiac and Skeletal Muscle.
pubmed doi rcsb
source organism Bos taurus
total genus 101
structure length 347
sequence length 347
ec nomenclature
pdb deposition date 2016-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kn3A03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kn3A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kn3A02
3RPNA 2WZ9A 4WF4A 2XPDA 4KX4A 1K0CA 1PA3A 5J3RA 1SYRA 3RHCA 1GLPA 4PURA 5J4UA 2DJJA 2R4VA 2YZHA 3UIWA 4ISDA 3DKSA 4GSNA 2C0EA 2LJKA 2K8VA 3LSZA 5DALB 2VOCA 3TKPA 3TJFA 2PWJA 4Q5RA 2LEGA 4P3YB 5KN1A 1CQHA 1AC1A 4X43A 1PX7A 3CTGA 3IV4A 5HR1A 2PU9C 3A2VA 4MZCA 1SJ6A 4FIWA 5DAKB 2PUKC 2JZRA 4ZL7A 1G7OA 2IWTA 1O85A 3FR9A 1FVKA 4XCSA 1ZOFA 2B6MA 5IMVA 3C8EA 1AXDA 1T4ZA 3P90A 4MP4A 5C04A 4MJAA 5COHA 2A4VA 1A0FA 5CRDA 1ZGNA 5J41A 2FA4A 4EDYA 2OA7A 2V1MA 3E0UA 5H5SA 3I69A 2XC2A 1UVZA 1PN9A 4XIHA 2IFQB 1KTEA 5CRWA 5G1KA 3HDCA 2K8SA 1A8LA 2NVLA 4LMVA 1S3AA 2MMOA 1YDKA 1M9BA 1GUKA 1GNWA 1K0BA 4O92A 4LA1A 3RHBA 3L9VA 1GSFA 2NTOA 2YN1A 2YPMA 4K0GA 1XVWA 1PL1A 1GL8A 4K1FA 1HNCA 1EV9A 2OBIA 5EVOA 1OYJA 4HU7A 1X5EA 3L9UA 4YQUA 4IW9A 4KSMA 1XIYA 4I6XA 2IN3A 3IE3A 4POBA 2YOIA 1SK1A 2GZZA 5DDLA 3TKSE 1PSQA 4MH3A 4GF0A 4HOJA 4XHMA 2XHFA 2VLUA 1SD9A 3HJOA 1O73A 4RI6A 1Z5YE 2H19A 2N5BA 1JHBA 1K0AA 1VF3A 1GNEA 4KDUA 1QMVA 2O87A 3QAVA 3IBHA 2LQQA 5F05A 3C7MA 4TR3A 1Z7PA 3F3QA 2ZUPA 3FZ5A 2LSTA 3LYPA 2R37A 1GRXA 3DIEA 1OE7A 2M80A 3TJJA 5EPFA 2H1DA 1SL0B 1Z7RA 4V2MA 1Y25A 4AGSA 1T8EB 2EIOA 1Q4JA 3UL3A 1X9MB 1WIKA 1M2AA 1F9MA 5ENUA 3TOUA 2OBKA 1YJ6A 4CW9A 3EE2A 2X8CA 2ES7A 3RBTA 5HFIA 4D73B 2VL9A 1T4YA 4L0UA 1M99A 2VCWA 4BL7A 1OC3A 3FR6A 4Z7XA 4GLTA 3FEUA 1R26A 2BJXA 2J9HA 3SBCA 3LG6A 4IGJA 2BTOT 3IAS2 2LKUA 3QR6A 1AIUA 1GSSA 2MYGA 3FK8A 4F2IA 1FG4A 4FO5A 3MDKA 3GKXA 1M2DA 1BX9A 2LQOA 1XVQA 1G6WA 3QD9A 3CYNA 2VAFA 3A5WA 3VWWA 1JZDA 3GH6A 2JL4A 4V2NA 4X0XA 1V2AA 3ZTLA 4MF6A 1VRSD 2CQ9A 2DLXA 4MMMA 5IQYA 2LTKA 1PKZA 2B5XA 5G30A 2VLVA 2A2RA 5ECMB 4JZQA 5CAXA 1GH2A 1W89A 4IS0A 1EEJA 1Z3EA 3ZMLA 4O32A 4V1Ag 4ML6A 5GAND 1OKTA 3GX0A 2YWMA 2CX3A 1ACVA 1RQMA 1B48A 3G7YA 3EURA 5CRHA 4POKA 4KCEA 1T7PB 4KAEA 3HHVA 1SD8A 2WFCA 1KBNA 3BBYA 4K7NA 5A5KA 1X0RA 2C80A 3EMXA 2Z9SA 1JLVA 5HQPA 2YWNA 1WP0A 4N11A 3GV1A 2B7JA 1U6TA 3F6FA 3PH9A 4E8EA 5GAPD 3LJRA 1V98A 4AJ7A 4WETA 5ID2A 2GSSA 1PKWA 4GSTA 1M9AA 2EIQA 1EGOA 4TW5A 1SKWB 5HFKA 2DMMA 14GSA 1PL2A 4PUFC 3H8QA 1PQNA 1H4OA 3UBKA 4YAVA 4MF5A 2VCVA 3MSZA 3UJ1A 3KD0A 4KW6A 4XS1A 3KP8A 3W6GA 1LJRA 2B5EA 5H5QA 3LWAA 4EO3A 4PNGA 4I2TA 3GTUA 1B4QA 4WBRD 4G10A 1F37A 3ZYWA 2VD1A 3EU4A 4OFNA 1WOUA 2JADA 2RUFA 1AW9A 4KCAA 3DMLA 1SU9A 5B8BA 4TN8A 4HJMA 3VPTA 5H5RA 3APOA 3DVXA 4IQAA 3WGEA 3IHQA 1LU4A 2ZCTA 3VPQA 2L5LA 3NZNA 3VI7A 3O3TA 1GTAA 3ERFA 3CXGA 2I1UA 3L78A 4NHZA 4OCEA 2IMIA 2HZEA 5IMAA 1URMA 22GSA 1TOFA 4IN0A 3ZLPA 3GIXA 2V6OA 3CBUA 4Q5NA 2HLSA 2YP6A 1BJXA 4QL7A 4OD7A 4PQHA 5IOXA 1SKRB 2DJKA 5KN0A 2EIRA 3VLNA 5ECQB 3LQ7A 2H72A 3KTLA 1FB6A 2I9HA 5GZZB 4TR4A 1YQ1A 2YV9A 4MJEA 4O7HA 2GQLA 2WCIA 1A24A 1S3CA 3KZQA 1GSEA 3TKRA 6GSTA 3ZFLA 4EDZA 2KOKA 4NMUA 2YANA 4K6XA 4TXVA 2B1KA 5JWRB 5B6NA 1FVJA 3M9JA 2X64A 4L8EA 7GSSA 2IMEA 3QFBC 1ZL9A 5CP1A 2RM5A 4GTUA 5KEJA 3HXSA 2TRXA 4N30A 2RLIA 2PERA 2PPTA 2WS2A 3FRCA 3GYKA 4GQCA 2F51A 4ECIA 3SWLA 3UVHA 3LXZA 2E2MA 1XBSA 2B7KA 2YV7A 1OE8A 2JSYA 2CVKA 2XPEA 2DSAA 3R2QA 1YKAA 3F63A 1TJDA 4JR6A 3FR3A 1XW9A 5G5FA 5DQYA 1SL1B 2H6XA 5KN2A 2FY6A 2P5QA 3FHKA 3U6VA 4ZIJA 3M0FA 3HZ8A 1XWCA 3IDVA 4IP6A 3LEFA 3FZ9A 2FNOA 1M7TA 4K0NA 2C3NA 3UEMA 1HNAA 4TRXA 4EC0A 2IMKA 5DAKA 1DE2A 1ERUA 4TR1B 2CAIA 2X8GA 1EGRA 2YJHA 5D9VA 1Z9HA 1XW5A 4L5LA 1G6YA 1V9WA 4L0WA 3O76A 10GSA 3GA4A 3KCMA 5IM9A 5ECSA 2R3XA 5JCGA 1NW2A 4GWRA 2F3MA 2DJ3A 5CRGA 3GH9A 5LNKe 5IO2A 3UBLA 1OC9B 5AN1A 4CHSA 1TW9A 2HZFA 4QL9A 2IFQA 2YCDA 4IQ1A 1R7HA 4KB3A 1O7UA 3H79A 5CREA 4MJCA 2VUPA 1EZKA 1TDIA 2R6KA 2VCZA 2H0GA 2B5YA 2TRCP 3P7XA 1SK2A 3OR5A 1E2YA 3APQA 2GVPA 6GSYA 3UOMA 3I6AA 1EP8A 2HI7A 4TR0A 3DXBA 1YZXA 4MABA 3WD6A 2RIIA 2FLSA 2MBSA 4HZ4A 2HSYA 1TU7A 1WJKA 3WGDA 1TRSA 1MD4A 2H01A 4ECJA 4JR4A 3HA9A 6GSXA 1HD2A 3O6TA 2AUVA 2LNSA 5INYA 3IAM2 4V2LA 4F03A 1Y6EA 4N0ZA 3KXOA 5G5EA 4HI7A 1K3OA 4ML1A 2GQMA 2L59A 3MAKA 1FOVA 2PGTA 3DVWA 2CZ2A 1BAYA 2PBJA 1FAAA 3F6DA 1EOHA 4L5OA 4ECBA 4IHUA 3Q19A 2H6ZA 3KGKA 3PINA 5IPGA 2FA8A 5C00A 2I4AA 1M2BA 5D9WA 4WR5A 2GLRA 1TXXA 3BOAA 4OFMA 5AGYA 1U3IA 5L71A 3WT1A 2LV3A 4BWQA 4D73A 1SK0A 2ZNMA 2L5OA 4OMVA 1H75A 3HY2A 1GTBA 4KDXA 3ME8A 1OVNA 4WF5A 1TI3A 4RQRA 2AYTA 1XWGA 1JZOA 3CSHA 2HT9A 3IK7A 5AIVA 2YNXA 2FGXA 3GL5A 4OO4A 2WGRA 3VWVA 3DRNA 3HCZA 2QC7A 4ZBBA 3E3EA 1PGTA 1O6JA 4MPGA 1EV4A 5FWGA 1K3LA 5HR0A 3GL3A 2FUG2 3I9V2 4PNFA 3FKFA 2DJ0A 4NV5A 4TVEA 2KHPA 2LJRA 5ECOB 3KP9A 5B8AA 2K6VA 4G19A 1EEMA 1Z6NA 3M3MA 1V58A 2HFDA 2CV4A 5IMDA 3GHAA 4ZXGA 4XS4A 3VWXA 5D9XA 4ECCA 4J57E 4EL1A 2GGTA 4HQSA 1R5AA 4HEA2 2IL3A 4CDOA 1MEKA 2PVOC 3TKSA 2H76A 2GSRA 6GSVA 3C71A 3TKQA 2IPAA 3W8JA 5CO3A 3QPMA 4FYCA 2H75A 1X5CA 3J7Yk 2FCHA 5GSTA 4I8BA 3GKNA 4RI7A 3TKSC 4EVMA 1ABAA 5KN3A 4DSSB 3F9UA 1K0NA 2TIRA 1FHEA 1A2MA 1BQ7A 2GQKA 2IIYA 4Q5FA 4TKYA 1EOGA 2GZPA 2C3QA 3N9JA 4IP1A 1QXHA 1XWBA 4RQXA 4HQZA 4KE3A 2PVQA 2HRFA 2DBCA 4EKZA 3C1RA 5AISA 4WKWA 2WULA 2VCXA 3ZL5A 1THXA 5DQSA 4FYBA 4GSSA 3TJBA 4BA7A 3QOUA 5D93A 4I5QA 1A23A 2L6CA 4ZL8A 1LBKA 4BVXA 2O89A 3D4MA 3US3A 3DYRA 3GN3A 2VO4A 1F6MC 2ON5A 5G2ZA 4GCIA 1Q98A 5HR3A 2VCQA 8GSSA 3QDNA 2OADA 3HJMA 4OFTA 2LNTA 5CNWA 1B8XA 1J9BA 3EU3A 1GTUA 3G7JA 2G2QA 2H1GA 5FT3A 1V40A 2RM6A 3TDGA 2H74A 4J56E 5ELAA 4ILFA 1AQXA 3TJGA 3ZREA 1B4PA 4ZBDA 2M72A 3VWUA 1ZCPA 3LFLA 3FZAA 5ECHB 1TRWA 1JZWA 2H70A 4F9ZA 3ED3A 2GDRA 3HYPA 4TXOA 3LYKA 1PX6A 1O81A 5J9CA 1MDKA 4IKHA 4HZ2A 4JBBA 3TUEA 3V1WA 1MD3A 4WBJA 3L4NA 3PR8A 2OE3A 4K7OA 3D5JA 3QCPA 2NDOA 2MMNA 3HVSA 5AIXA 3GKMA 3GX8A 2FWHA 1AUCA 4ULXA 3FYGA 3IRAA 3EC3A 1DBYA 1I9DA 4EF0A 4RUVA 19GSA 4YH2A 4OWYA 5F8BA 4X1UA 1A0RP 3HD5A 1SENA 1O8XA 1SL2B 2IMDA 3U5RE 5F06A 4HU9A 2GSQA 3EMPA 1JZRA 2VM1A 1WMJA 1GULA 1GUMA 4BPYA 4HS1A 1OKDA 1TP9A 2VL2A 4G2EA 2AV4A 2IJYA 2AJQB 3VK9A 1BEDA 3LXTA 1UC7A 1K0DA 4ACSA 3KTBA 3ISOA 4MJBA 1THOA 2DJ1A 2CZ3A 2HE3A 4OO5A 2YJ7A 4KA0A 2VL2C 4POLA 3BCIA 1SJIA 3HJPA 5E4WA 1W4VA 3EWLA 2O7KA 1A2LA 4YQVA 1Z6MA 2I81A 4WXTA 2X99A 5IOWA 1N2AA 4TR1A 1XZOA 2JSZA 3C1SA 5IMZA 4E8HA 4DSQA 4NXIA 4MA9A 5IMCA 4IVFA 4G9HA 2OJLA 1NSWA 5A4VA 5ELGA 4JE1A 4MLYA 3E9JB 3P2AA 1FO5A 3P8WA 1DUGA 2JACA 4FH8A 4ZB6A 2B3SA 1VF1A 5ECRB 4KNDA 1OC9A 5DALA 5GSSA 1YEPA 5B7CA 5ABRA 2L57A 2CAQA 1K0MA 3L0HA 2V2GA 1RW1A 3BD2A 3QMXA 3HVVA 3TGZA 2L4QA 2CVDA 2HRNA 2C8UA 1VF4A 3K8NA 2REMA 1C72A 1ERTA 2YWIA 4YQMA 4J2FA 2DC5A 1MDJA 4EXJA 5JWQB 1GP1A 3IR4A 4LL1B 3N5OA 11GSA 2MMAA 1KEBA 4IELA 2PMTA 3TB2A 3TJKA 4ZILA 1GLQA 3HZ4A 4DSRA 3GNJA 3CTFA 1TRUA 1PMTA 4PXOA 4K7IA 1N8JA 1ERVA 1WPIA 2LJAA 2VCTA 3CRTA 1YY7A 5F07A 1NHYA 4I2UA 2FD3A 4HDEA 2LRTA 4MZWA 4NV2A 3L9SA 3Q6OA 1PD21 3RDWA 1WE0A 2CVBA 1A8YA 4GXZA 4F0CA 3D4TA 4LMWA 3RPPA 3KH7A 2MMZA 3VFIA 2VLTA 4WEYA 5J9BA 5JCUA 4NAXA 3KH9A 3TOTA 5LD0A 1AQWA 4LLRA 2K9FA 2KP2A 3IXRA 5D9TA 5IO0A 2KUCA 5A4UA 1GUHA 4KUNA 2FWGA 3VI5A 3ZVJD 3ZMKA 4H86A 5D73A 2KLXA 4MK3A 4K8MA 3KMOA 2I3YA 2GS3A 5HR2A 3H4KA 2IMFA 1EWXA 1I5GA 13GSA 2ALBA 2RUEA 5JWOB 3F8UA 1SYXA 2GT5A 3ZITA 4LL4B 2CT6A 3BCKA 3H93A 2CA8A 1JLWA 3EYTA 1G0TA 3UAPA 3ERWA 4JRRA 2GT6A 3WGXA 4XRAA 2LRCA 4MH2A 2L6DA 3LGCA 3Q74A 3UVTA 4DVCA 3S9FA 3GFKA 1K3YA 4BWSA 2VL3A 2GTUA 3CSIA 1T1VA 4IJIA 6GSWA 4MCUA 3IK9A 3M1GA 3QAWA 3W8SA 3ME7A 4EUYA 1S3DA 1SJZA 1RK4A 2P5RA 3A3TA 1TK0B 4V1Ap 1KNGA 5ECIB 2P0GA 3IC4A 2QKEA 17GSA 2BMXA 1XCCA 1YEXA 4KGIA 1HYUA 2C3TA 4JU5A 2QSIA 2C0DA 1A2JA 3KIJA 4POMA 2MBTA 1TK5B 4F82A 1TKDB 3MWHA 3A2WA 3BJ5A 4JEDA 4XTSA 3UARA 5IPHA 1ZZYA 1QFNA 1OAZA 4AJ6A 1TK8B 1BG5A 4ZB8A 4N0VA 3D21A 2G0FA 1GSDA 1QUWA 2H1BA 3TCOA 4PUAA 2M46A 4WR4A 3KEBA 4NPBA 1XOAA 5ECPB 4PX1A 5D96A 4DSSA 2JZTA 1SKSB 3CRUA 2JZSA 16GSA 1GSUA 2H66A 1XOBA 2WJUA 5DVBA 4IBPA 1TU8A 5HFGA 3J7Yb 1PRXA 1ON4A 5ECNB 20GSA 3F4SA 2F8FA 1FB0A 2H1AA 1YF0A 2VM2A 2O85A 5LCZA 1XXUA 2OE0A 5DJMA 1TI1A 1NHOA 2X8HA 6GSSA 3M8NA 3GURA 3TRPA 1ML6A 4YAPA 5J5NA 4MPFA 5IMFA 2V41A 5B6MA 3DEXA 5ECKB 3FY7A 3C73A 3HKRA 5JCWA 4FYUA 2LUSA 3GKKA 2DIYA 1NM3A 2K18A 1HNBA 1IYHA 3NOFA 1BYEA 4XS4B 1WRYA 2C0GA 2A2SA 2C1YA 2DJ2A 1JFUA 3D6IA 2F9SA 2D2ZA 4MF7A 3JCML 4QQ7A 2HXKA 12GSA 2R2JA 3FZ4A 4XS6A 3H1NA 2WDUA 1O8WA 2HSHA 1XPVA 2V32A 3ZFBA 1IYIA 5A4WA 3M9KA 5DJLA 4F0BA 1F3BA 3AY8A 4ZBAA 3I43A 2L4CA 4OCFA 2F8AA 4KDYA 3CMIA 2LS5A 3QFAC 3ZVJA 4DEJA 4TOPA 2PN8A 3ERGA 4NWYA 2KP1A 3EINA 4AJ8A 3WYWA 2DMLA 4PQIA 1OC8A 3IA1A 2AHEA 2VIMA 2J23A 2LRNA 4KSOA 1GWCA 3KJYA 4NHWA 1XWAA 2E7PA 3NIVA 1DE1A 3RAZA 2QGVA 2AB6A 4AF2A 1E6BA 1T3BA 1TTZA 3GRXA 1F2EA 1HQOA 3QAGA 4MDCA 1MTCA 1CQGA 4MZBA 1X9SB 5ID2B 1XW6A 1QQ2A 3D0ZA 2JU5A 3MNGA 5DBQA 6GSUA 1VF2A 3TRQA 1R4WA 2C4JA 2H6YA 3G9BA 3GMFA 4N10A 5E59A 4K9ZA 2MZCA 3IOSA 4ID0A 2O8VB 2GZYA 3D22A 1USBA 1V57A 2ON7A 1T00A 2E2GA 5G31A 1U3AA 2CX4A 3F3RA 1ST9A 3GSSA 1R5PA 2YWOA 2WRTA 2EC4A 3ZIVA 4O5RA 3DD3A 3ZZXA 1AAZA 3GTUB 5FHIA 1MDIA 5ECLB 2B1LA 1J0FA 3F4TA 4BVYA 2C0FA 1U87A 2E0QA 2AAWA 1X5DA 1YKCA 1EP7A 3Q18A 1GTIA 3HVXA 4K2DA 5G1LA 2XBIA 2WB9A 3F4RA 2OKAA 3WT2A 2NPBA 2HNLA 4TXOB 1G7EA 4ZB9A 3FW2A 2H0IA 2XBQA 4PGTA 3F0IA 1B9XC 1X9WB 2H0HA 3DWVA 4Q5QA 1U88A 2DIZA 1XFLA 2HZEB 3GSTA 1ILOA 4IJ3A 1FW1A 5IIZA 2V6KA 2H8LA 3VURA 3TRXA 2N5FA 5D8IA 3A2XA 1UA5A 1ERWA 1YF1A 2R5GA 1B9YC 1UN2A 4EE0A 1XWKA 2P31A 4PQ1A 1ZYQB 1ZYEA 3ZIJA 1M0UA 5CYYA 4GRFA 1WWJA 2FWFA 4KH7A 1K0OA 2FHEA 3CSJA 1J08A 3UMAA 3LORA 4GQFA 1ZMAA 9GSSA 1TRVA 5EL8A 2NBSA 1VGLA 3G7IA 2OACA 4HUAA 2H71A 4XRDA 3KM6A 5EY6A 3ZRDA 1DSBA 1GSQA 2GSTA 5DCHA 3EVIA 3PGTA 2H30A 2HYXA 4ZL9A 5DCGA 18GSA 1QK8A 2N5AA 2VD0A 2YZUA 4HJ2A 2OE1A 3IPZA 1GSYA 5F0GA 1QGVA 3KMNA 1F3AA 1AQVA 3GUSA 2H73A 3DGQA 3APSA 2FWEA 4I97A
chains in the Genus database with same CATH superfamily
3RPNA 2WZ9A 4WF4A 2XPDA 4KX4A 1K0CA 1PA3A 5J3RA 1SYRA 3RHCA 1GLPA 4PURA 5J4UA 2DJJA 2R4VA 2YZHA 3UIWA 4ISDA 3DKSA 4GSNA 2C0EA 2LJKA 2K8VA 3LSZA 5DALB 2VOCA 3TKPA 3TJFA 2PWJA 4Q5RA 2LEGA 4P3YB 5KN1A 1CQHA 1AC1A 4X43A 1PX7A 3CTGA 3IV4A 5HR1A 2PU9C 3A2VA 4A5PA 4MZCA 1SJ6A 4FIWA 5DAKB 2PUKC 2JZRA 4ZL7A 1G7OA 2IWTA 1O85A 3FR9A 1FVKA 4XCSA 1ZOFA 2B6MA 5IMVA 3C8EA 1AXDA 1T4ZA 3P90A 4MP4A 5C04A 4MJAA 5COHA 2A4VA 1A0FA 5CRDA 1ZGNA 5J41A 2FA4A 4EDYA 2OA7A 2V1MA 3E0UA 5H5SA 3I69A 2XC2A 1UVZA 1XG8A 1PN9A 4XIHA 2IFQB 1KTEA 3EPTA 5CRWA 5G1KA 3HDCA 2K8SA 1A8LA 4Z2RA 2NVLA 4LMVA 1S3AA 2MMOA 1YDKA 4Z2TA 1M9BA 1GUKA 1GNWA 1K0BA 4O92A 4LA1A 3RHBA 3L9VA 1GSFA 2NTOA 2YN1A 2YPMA 4K0GA 1XVWA 1PL1A 1GL8A 4K1FA 1HNCA 1EV9A 2OBIA 5EVOA 1OYJA 4HU7A 1X5EA 4K5SA 3L9UA 4YQUA 4IW9A 4KSMA 1XIYA 4I6XA 2IN3A 3IE3A 4POBA 2YOIA 1SK1A 2GZZA 5DDLA 3TKSE 1PSQA 4MH3A 4GF0A 4HOJA 4XHMA 2XHFA 2VLUA 1SD9A 3HJOA 1O73A 4RI6A 1Z5YE 2H19A 4MNNA 2N5BA 1JHBA 1K0AA 1VF3A 1GNEA 4KDUA 1QMVA 2O87A 3QAVA 3IBHA 2LQQA 5F05A 3C7MA 4TR3A 1Z7PA 3F3QA 2ZUPA 3FZ5A 2LSTA 3LYPA 2R37A 1GRXA 3DIEA 1OE7A 2M80A 3TJJA 5EPFA 2H1DA 1SL0B 1Z7RA 4V2MA 1Y25A 4AGSA 1T8EB 2EIOA 1Q4JA 3UL3A 1X9MB 1WIKA 1M2AA 1F9MA 5ENUA 3TOUA 2OBKA 1YJ6A 4CW9A 3EE2A 2X8CA 2ES7A 3RBTA 5HFIA 4D73B 2VL9A 1T4YA 4L0UA 1M99A 2VCWA 4BL7A 1OC3A 3FR6A 4Z7XA 4GLTA 3FEUA 1R26A 2BJXA 2J9HA 3SBCA 3LG6A 4IGJA 2BTOT 3IAS2 2LKUA 3QR6A 1AIUA 1GSSA 2MYGA 3FK8A 4F2IA 1FG4A 4FO5A 3MDKA 3GKXA 1M2DA 1BX9A 2LQOA 1XVQA 1G6WA 3QD9A 3CYNA 2VAFA 3A5WA 3VWWA 1JZDA 3GH6A 2JL4A 4V2NA 4X0XA 1V2AA 3ZTLA 4MF6A 1VRSD 2CQ9A 2DLXA 4MMMA 5IQYA 2LTKA 1PKZA 2B5XA 5G30A 2VLVA 2A2RA 5ECMB 4JZQA 5CAXA 1GH2A 1W89A 3A5IA 4IS0A 1EEJA 1Z3EA 3ZMLA 4O32A 4V1Ag 4ML6A 5GAND 1OKTA 3GX0A 2YWMA 2CX3A 1ACVA 1RQMA 1B48A 3G7YA 3EURA 5CRHA 4POKA 4KCEA 3FMWA 1T7PB 4KAEA 3HHVA 1SD8A 2WFCA 1KBNA 3BBYA 4K7NA 5A5KA 1X0RA 2C80A 3EMXA 2Z9SA 1JLVA 5HQPA 2YWNA 1WP0A 4N11A 3GV1A 2B7JA 1U6TA 3F6FA 3PH9A 4E8EA 5GAPD 3LJRA 1V98A 4AJ7A 4WETA 5ID2A 2GSSA 1PKWA 4GSTA 1M9AA 2EIQA 1EGOA 4TW5A 1SKWB 5HFKA 2DMMA 14GSA 1PL2A 4PUFC 3H8QA 1PQNA 1H4OA 3UBKA 4YAVA 1PFOA 4MF5A 2VCVA 3MSZA 3UJ1A 3KD0A 4KW6A 4XS1A 3KP8A 5KOWA 3W6GA 1LJRA 2B5EA 5H5QA 3LWAA 4EO3A 4PNGA 4I2TA 3GTUA 1B4QA 2QA2A 4WBRD 2DKIA 4G10A 1F37A 3ZYWA 2VD1A 3EU4A 4OFNA 1ZYNA 1WOUA 2JADA 2RUFA 4BVXB 1AW9A 3MIXA 4KCAA 3DMLA 1SU9A 5B8BA 4TN8A 4HJMA 3VPTA 5H5RA 3APOA 3DVXA 4IQAA 3WGEA 3IHQA 1LU4A 2ZCTA 3VPQA 2L5LA 3NZNA 3VI7A 3O3TA 1GTAA 3ERFA 3CXGA 2I1UA 3L78A 4NHZA 4OCEA 2IMIA 2HZEA 5IMAA 1URMA 22GSA 1TOFA 4IN0A 3ZLPA 3GIXA 2V6OA 3CBUA 4Q5NA 2HLSA 1ZYPA 2YP6A 4X4JA 1BJXA 4QL7A 4OD7A 4PQHA 5IOXA 1SKRB 2DJKA 5KN0A 2EIRA 3VLNA 5ECQB 3LQ7A 1PN0A 2H72A 3KTLA 1FB6A 2I9HA 4FQUA 5GZZB 4TR4A 1YQ1A 2YV9A 4MJEA 4O7HA 2GQLA 2WCIA 1A24A 1S3CA 3KZQA 1GSEA 3TKRA 6GSTA 3ZFLA 4EDZA 2KOKA 4NMUA 2YANA 4K6XA 4TXVA 2B1KA 5JWRB 5B6NA 1FVJA 3M9JA 2X64A 4L8EA 7GSSA 2IMEA 4PTSA 3QFBC 1ZL9A 5CP1A 2RM5A 4GTUA 5KEJA 3HXSA 2TRXA 4N30A 2RLIA 2PERA 4O5QA 2PPTA 2WS2A 3FRCA 3GYKA 2DKHA 4GQCA 2F51A 4ECIA 3SWLA 3UVHA 3LXZA 2E2MA 1XBSA 2B7KA 2YV7A 1OE8A 2JSYA 2CVKA 2XPEA 2DSAA 3R2QA 1YKAA 3F63A 4G0IA 1TJDA 4JR6A 3FR3A 1XW9A 5G5FA 5DQYA 1SL1B 2R0GA 2H6XA 5KN2A 2FY6A 2P5QA 3FHKA 3U6VA 4ZIJA 3M0FA 3HZ8A 1XWCA 3IDVA 4IP6A 3LEFA 4K5RA 4EIPA 3FZ9A 4O5UA 2FNOA 1M7TA 4K0NA 1FOHA 2C3NA 3UEMA 1HNAA 4TRXA 4EC0A 2IMKA 5DAKA 1DE2A 1ERUA 4TR1B 2CAIA 2X8GA 1EGRA 2YJHA 5D9VA 1Z9HA 1XW5A 4L5LA 1G6YA 1V9WA 4L0WA 3O76A 10GSA 3GA4A 3KCMA 5IM9A 5ECSA 2R3XA 5JCGA 1NW2A 4GWRA 2F3MA 2DJ3A 5CRGA 3GH9A 5LNKe 1S3RA 5IO2A 3UBLA 1OC9B 5AN1A 4CHSA 1TW9A 2HZFA 4QL9A 2IFQA 2YCDA 4IQ1A 1R7HA 4KB3A 1O7UA 3H79A 5CREA 4MJCA 2VUPA 1EZKA 1TDIA 2R6KA 2VCZA 2H0GA 2B5YA 2TRCP 3P7XA 1SK2A 3OR5A 1E2YA 3APQA 2GVPA 6GSYA 3UOMA 3I6AA 1EP8A 2HI7A 4Z2UA 4TR0A 3DXBA 1YZXA 4MABA 3WD6A 2RIIA 2FLSA 2MBSA 4HZ4A 2HSYA 1TU7A 1WJKA 3WGDA 1TRSA 1MD4A 2H01A 4ECJA 4JR4A 3HA9A 6GSXA 1HD2A 3O6TA 2AUVA 2LNSA 5INYA 3IAM2 4V2LA 4F03A 1Y6EA 4N0ZA 3KXOA 5G5EA 4HI7A 1K3OA 4ML1A 2GQMA 2L59A 3MAKA 1FOVA 2PGTA 3DVWA 4BIKA 2CZ2A 1BAYA 2PBJA 1FAAA 3F6DA 1EOHA 4L5OA 4ECBA 4IHUA 3Q19A 2H6ZA 3KGKA 3PINA 5IPGA 2FA8A 5C00A 2I4AA 1M2BA 5D9WA 4WR5A 2GLRA 1TXXA 3BOAA 4OFMA 5AGYA 1U3IA 5L71A 3WT1A 2LV3A 4BWQA 4D73A 1SK0A 2ZNMA 2L5OA 4OMVA 1H75A 3HY2A 1GTBA 4KDXA 3ME8A 1OVNA 4WF5A 1TI3A 4RQRA 2AYTA 1XWGA 1JZOA 3CSHA 2HT9A 3IK7A 5AIVA 2YNXA 2FGXA 3GL5A 4OO4A 2WGRA 3VWVA 3DRNA 3HCZA 2QC7A 4ZBBA 3E3EA 1PGTA 1O6JA 4MPGA 1EV4A 5FWGA 1K3LA 5HR0A 3GL3A 2FUG2 3I9V2 4PNFA 3FKFA 2DJ0A 4NV5A 4TVEA 2KHPA 2LJRA 5ECOB 3KP9A 5B8AA 2K6VA 4G19A 1EEMA 4CY6A 1Z6NA 3M3MA 1V58A 2HFDA 4G0LA 2CV4A 5IMDA 3GHAA 4ZXGA 4XS4A 3VWXA 5D9XA 4ECCA 4J57E 4EL1A 2GGTA 4HQSA 1R5AA 4HEA2 2IL3A 4EIQA 4CDOA 1MEKA 2PVOC 3TKSA 2H76A 2GSRA 6GSVA 3C71A 3TKQA 2IPAA 3W8JA 5CO3A 3QPMA 4FYCA 2H75A 1X5CA 3J7Yk 2HRKA 2FCHA 5GSTA 4I8BA 3GKNA 4RI7A 3TKSC 4EVMA 1ABAA 5KN3A 4DSSB 3F9UA 1K0NA 2TIRA 1FHEA 1A2MA 1BQ7A 2GQKA 2IIYA 4Q5FA 4TKYA 1EOGA 2GZPA 2A2PA 2C3QA 3N9JA 4IP1A 1QXHA 1XWBA 4RQXA 4HQZA 3MYDA 4KE3A 2PVQA 2HRFA 2DBCA 4EKZA 3C1RA 5AISA 4WKWA 2WULA 2VCXA 3ZL5A 1THXA 5DQSA 4FYBA 4GSSA 3TJBA 4BA7A 3QOUA 4I5QA 5D93A 1A23A 2L6CA 4ZL8A 1LBKA 4BVXA 5KOXA 2O89A 3D4MA 3US3A 3DYRA 3GN3A 2VO4A 1F6MC 2ON5A 5G2ZA 4GCIA 1Q98A 5HR3A 2VCQA 8GSSA 3QDNA 2OADA 3HJMA 4OFTA 2LNTA 5CNWA 1B8XA 1J9BA 3EU3A 1GTUA 3G7JA 2G2QA 2H1GA 5FT3A 1V40A 2RM6A 3TDGA 2H74A 4J56E 5ELAA 4ILFA 1AQXA 3TJGA 3ZREA 1B4PA 4ZBDA 2M72A 3VWUA 1ZCPA 3LFLA 3FZAA 5ECHB 1TRWA 3IHGA 1JZWA 2H70A 4F9ZA 3ED3A 2GDRA 3HYPA 4TXOA 3LYKA 1PX6A 1O81A 5J9CA 1MDKA 4IKHA 4HZ2A 4JBBA 3TUEA 3V1WA 1MD3A 4WBJA 3L4NA 2X4AA 3PR8A 2OE3A 4K7OA 3D5JA 3QCPA 2NDOA 2MMNA 3HVSA 5AIXA 3GKMA 3GX8A 2FWHA 1AUCA 4ULXA 3FYGA 3IRAA 3EC3A 1DBYA 1I9DA 4EF0A 4RUVA 19GSA 4YH2A 4OWYA 5F8BA 4X1UA 1A0RP 3HD5A 1SENA 1O8XA 1SL2B 2IMDA 3U5RE 5F06A 4HU9A 2GSQA 4CY8A 3EMPA 1JZRA 2VM1A 1WMJA 1GULA 1GUMA 4BPYA 4HS1A 1OKDA 1TP9A 2VL2A 4G2EA 2AV4A 2IJYA 2AJQB 3VK9A 1BEDA 3LXTA 1UC7A 1K0DA 4ACSA 3KTBA 3ISOA 4MJBA 1THOA 2DJ1A 2CZ3A 2HE3A 4OO5A 2YJ7A 4KA0A 2VL2C 4POLA 3BCIA 1SJIA 3HJPA 5E4WA 1W4VA 3EWLA 2O7KA 1A2LA 4YQVA 1Z6MA 2I81A 4WXTA 2X99A 5IOWA 1N2AA 4TR1A 1XZOA 4BVYB 2JSZA 3C1SA 5IMZA 4E8HA 4DSQA 4NXIA 4MA9A 5IMCA 4IVFA 4G9HA 2OJLA 1NSWA 5A4VA 5ELGA 4JE1A 4MLYA 3E9JB 3P2AA 1FO5A 3P8WA 1DUGA 2JACA 4FH8A 4ZB6A 2B3SA 1VF1A 5ECRB 4KNDA 1OC9A 5DALA 5GSSA 1YEPA 5B7CA 5ABRA 2L57A 2CAQA 1K0MA 3L0HA 2V2GA 1RW1A 3BD2A 3QMXA 3HVVA 3TGZA 2L4QA 2CVDA 2HRNA 2C8UA 1VF4A 3K8NA 2REMA 1C72A 1ERTA 2YWIA 4YQMA 4J2FA 2DC5A 1MDJA 4EXJA 5JWQB 1GP1A 3IR4A 4LL1B 3N5OA 11GSA 2MMAA 1KEBA 4IELA 2PMTA 3TB2A 3TJKA 2R0CA 4ZILA 1GLQA 3HZ4A 4DSRA 3GNJA 3R3EA 3CTFA 1TRUA 1PMTA 4PXOA 4K7IA 1N8JA 1ERVA 1WPIA 2LJAA 2VCTA 3CRTA 1YY7A 5F07A 1NHYA 4I2UA 2FD3A 4HDEA 2LRTA 4MZWA 4NV2A 3L9SA 3Q6OA 1PD21 3RDWA 4K2XA 1WE0A 2CVBA 1A8YA 4GXZA 2UZ8A 4F0CA 3D4TA 4LMWA 3RPPA 3KH7A 2MMZA 3VFIA 2VLTA 4WEYA 5J9BA 1M3IA 4NAXA 5JCUA 3KH9A 3TOTA 5LD0A 1AQWA 2QA1A 4LLRA 2K9FA 2KP2A 3IXRA 5D9TA 5IO0A 2KUCA 5A4UA 3IC8A 1GUHA 4KUNA 2FWGA 3VI5A 3ZVJD 2HRAA 3ZMKA 4H86A 5D73A 2KLXA 4MK3A 4K8MA 3KMOA 2I3YA 2GS3A 5HR2A 3H4KA 2IMFA 1EWXA 1I5GA 13GSA 2ALBA 2RUEA 5JWOB 3F8UA 1SYXA 2GT5A 3ZITA 4LL4B 4KF9A 2CT6A 3BCKA 3H93A 2CA8A 2A4HA 1JLWA 3EYTA 1G0TA 3UAPA 3ERWA 4JRRA 2GT6A 3WGXA 4XRAA 2LRCA 4MH2A 2L6DA 3LGCA 3Q74A 3UVTA 5BMUA 4DVCA 3S9FA 3GFKA 1K3YA 4BWSA 2VL3A 2GTUA 3CSIA 1T1VA 4IJIA 6GSWA 4MCUA 3IK9A 3M1GA 3QAWA 3W8SA 3ME7A 4EUYA 1S3DA 1SJZA 1RK4A 2P5RA 3A3TA 1TK0B 4V1Ap 1KNGA 5ECIB 2P0GA 3IC4A 2QKEA 17GSA 2BMXA 1XCCA 1YEXA 4KGIA 1HYUA 2C3TA 4JU5A 2QSIA 2C0DA 1A2JA 3KIJA 4POMA 2MBTA 1TK5B 4F82A 1TKDB 3MWHA 3A2WA 3BJ5A 4JEDA 4XTSA 3UARA 5IPHA 1ZZYA 1QFNA 1OAZA 4AJ6A 1TK8B 1BG5A 4ZB8A 4N0VA 3D21A 2G0FA 1GSDA 1QUWA 2H1BA 3TCOA 4PUAA 2M46A 4WR4A 3KEBA 4NPBA 1XOAA 5ECPB 4PX1A 5D96A 4YKFA 4DSSA 2JZTA 1SKSB 3CRUA 2JZSA 16GSA 1GSUA 2H66A 1XOBA 2WJUA 5DVBA 4IBPA 1TU8A 5HFGA 3CQFA 3J7Yb 1PRXA 1ON4A 5ECNB 20GSA 3F4SA 2F8FA 1FB0A 2H1AA 1YF0A 2VM2A 2O85A 5LCZA 1XXUA 2OE0A 5DJMA 1TI1A 1NHOA 2X8HA 6GSSA 3M8NA 3GURA 3TRPA 1ML6A 4YAPA 5J5NA 4MPFA 2R0PA 5IMFA 2V41A 4BL7B 3DEXA 5ECKB 5B6MA 3FY7A 3C73A 3HKRA 3PPUA 5JCWA 4FYUA 2LUSA 3GKKA 2DIYA 1NM3A 2K18A 1HNBA 1IYHA 3NOFA 1BYEA 4ICYA 4XS4B 1WRYA 2C0GA 2A2SA 2C1YA 2DJ2A 1JFUA 3D6IA 2F9SA 2D2ZA 4MF7A 3JCML 4QQ7A 2HXKA 12GSA 2R2JA 3FZ4A 4XS6A 3H1NA 2WDUA 1O8WA 2HSHA 5BRTA 1XPVA 2V32A 3ZFBA 1IYIA 5A4WA 3M9KA 5DJLA 4F0BA 1F3BA 3AY8A 4ZBAA 3I43A 2L4CA 4OCFA 2F8AA 4KDYA 3CMIA 2LS5A 3QFAC 3ZVJA 4DEJA 4TOPA 2PN8A 3ERGA 4NWYA 2KP1A 3EINA 4AJ8A 3WYWA 2DMLA 4PQIA 1OC8A 3IA1A 2AHEA 2VIMA 2J23A 2LRNA 4KSOA 1GWCA 4YKGA 3KJYA 4NHWA 1XWAA 2E7PA 3NIVA 1DE1A 3RAZA 2QGVA 2AB6A 4AF2A 1E6BA 1T3BA 1TTZA 3GRXA 1F2EA 1HQOA 3QAGA 4MDCA 1MTCA 1CQGA 4MZBA 1X9SB 5ID2B 1XW6A 1QQ2A 3D0ZA 2JU5A 3MNGA 5DBQA 6GSUA 1VF2A 3TRQA 1R4WA 2C4JA 2H6YA 3G9BA 3GMFA 4N10A 5E59A 2HSMA 4K9ZA 2MZCA 3IOSA 3LW9A 4ID0A 1M3JA 2O8VB 2GZYA 3D22A 1USBA 1V57A 2ON7A 1T00A 2E2GA 5G31A 1U3AA 2CX4A 3F3RA 1ST9A 3GSSA 1R5PA 2YWOA 2WRTA 2EC4A 3ZIVA 4O5RA 3DD3A 3ZZXA 1AAZA 3GTUB 5FHIA 1MDIA 5ECLB 2B1LA 1J0FA 3F4TA 4BVYA 2C0FA 1U87A 2E0QA 2AAWA 1X5DA 1YKCA 1EP7A 3Q18A 1GTIA 3HVXA 4K2DA 5G1LA 2XBIA 2WB9A 3F4RA 2OKAA 3WT2A 2NPBA 2HNLA 4TXOB 1G7EA 4ZB9A 4USSA 3FW2A 2H0IA 2XBQA 4PGTA 3F0IA 1B9XC 1X9WB 2H0HA 3DWVA 4Q5QA 1U88A 2DIZA 1XFLA 2HZEB 3GSTA 1ILOA 4IJ3A 1FW1A 5IIZA 2V6KA 2H8LA 3VURA 3TRXA 2N5FA 3HVNA 5D8IA 3A2XA 4G0KA 1UA5A 1ERWA 1YF1A 2R5GA 1B9YC 1UN2A 4EE0A 1XWKA 2P31A 4PQ1A 1ZYQB 1ZYEA 3ZIJA 1M0UA 5CYYA 4GRFA 1WWJA 2FWFA 4KH7A 1K0OA 2FHEA 3CSJA 1J08A 3UMAA 3LORA 4GQFA 1ZMAA 9GSSA 1TRVA 5EL8A 2NBSA 1VGLA 3G7IA 2OACA 4HUAA 2H71A 4XRDA 3KM6A 5EY6A 3ZRDA 4HSCX 2X49A 1DSBA 1GSQA 2GSTA 5DCHA 3EVIA 3PGTA 2H30A 2HYXA 4ZL9A 5DCGA 18GSA 1QK8A 2N5AA 2VD0A 2YZUA 4HJ2A 2OE1A 3IPZA 1GSYA 5F0GA 1QGVA 3KMNA 1F3AA 1AQVA 3GUSA 2H73A 3DGQA 3APSA 2FWEA 4I97A
chains in the Genus database with same CATH topology
3RPNA 2WZ9A 4WF4A 2XPDA 4KX4A 1K0CA 1PA3A 5J3RA 1SYRA 3RHCA 1GLPA 4PURA 5J4UA 2DJJA 2R4VA 2YZHA 3UIWA 4ISDA 3DKSA 4GSNA 2C0EA 2LJKA 2K8VA 3LSZA 5DALB 2VOCA 3TKPA 3TJFA 2PWJA 4Q5RA 2LEGA 4P3YB 5KN1A 1CQHA 1AC1A 4X43A 1PX7A 3CTGA 3IV4A 5HR1A 2PU9C 3A2VA 4A5PA 4MZCA 1SJ6A 4FIWA 5DAKB 2PUKC 2JZRA 4ZL7A 1G7OA 2IWTA 1O85A 3FR9A 1FVKA 4XCSA 1ZOFA 2B6MA 5IMVA 3C8EA 1AXDA 1T4ZA 3P90A 4MP4A 5C04A 4MJAA 5COHA 2A4VA 1A0FA 5CRDA 1ZGNA 5J41A 2FA4A 4EDYA 2OA7A 2V1MA 3E0UA 5H5SA 3I69A 2XC2A 1UVZA 1PN9A 4XIHA 2IFQB 1KTEA 3EPTA 5CRWA 5G1KA 3HDCA 2K8SA 1A8LA 4Z2RA 2NVLA 4LMVA 1S3AA 2MMOA 1YDKA 4Z2TA 1M9BA 1GUKA 1GNWA 1K0BA 4O92A 4LA1A 3RHBA 3L9VA 1GSFA 2NTOA 2YN1A 2YPMA 4K0GA 1XVWA 1PL1A 1GL8A 4K1FA 1HNCA 1EV9A 2OBIA 5EVOA 1OYJA 4HU7A 1X5EA 4K5SA 3L9UA 4YQUA 4IW9A 4KSMA 1XIYA 4I6XA 2IN3A 3IE3A 4POBA 2YOIA 1SK1A 2GZZA 5DDLA 3TKSE 1PSQA 4MH3A 4GF0A 4HOJA 4XHMA 2XHFA 2VLUA 1SD9A 3HJOA 1O73A 4RI6A 1Z5YE 2H19A 4MNNA 2N5BA 1JHBA 1K0AA 1VF3A 1GNEA 4KDUA 1QMVA 2O87A 3QAVA 3IBHA 2LQQA 5F05A 3C7MA 4TR3A 1Z7PA 3F3QA 2ZUPA 3FZ5A 2LSTA 3LYPA 2R37A 1GRXA 3DIEA 1OE7A 2M80A 3TJJA 5EPFA 2H1DA 1SL0B 1Z7RA 4V2MA 1Y25A 4AGSA 1T8EB 2EIOA 1Q4JA 3UL3A 1X9MB 1WIKA 1M2AA 1F9MA 5ENUA 3TOUA 2OBKA 1YJ6A 4CW9A 3EE2A 2X8CA 2ES7A 3RBTA 5HFIA 4D73B 2VL9A 1T4YA 4L0UA 1M99A 2VCWA 4BL7A 1OC3A 3FR6A 4Z7XA 4GLTA 3FEUA 1R26A 2BJXA 2J9HA 3SBCA 3LG6A 4IGJA 2BTOT 3IAS2 2LKUA 3QR6A 1AIUA 1GSSA 2MYGA 3FK8A 4F2IA 1FG4A 4FO5A 3MDKA 3GKXA 1M2DA 1BX9A 2LQOA 1XVQA 1G6WA 3QD9A 3CYNA 2VAFA 3A5WA 3VWWA 1JZDA 3GH6A 2JL4A 4V2NA 4X0XA 1V2AA 3ZTLA 4MF6A 1VRSD 2CQ9A 2DLXA 4MMMA 5IQYA 2LTKA 1PKZA 2B5XA 5G30A 2VLVA 2A2RA 5ECMB 4JZQA 5CAXA 1GH2A 1W89A 3A5IA 4IS0A 1EEJA 1Z3EA 3ZMLA 4O32A 4V1Ag 4ML6A 5GAND 1OKTA 3GX0A 2YWMA 2CX3A 1ACVA 1RQMA 1B48A 3G7YA 3EURA 5CRHA 4POKA 4KCEA 3FMWA 1T7PB 4KAEA 3HHVA 1SD8A 2WFCA 1KBNA 3BBYA 4K7NA 5A5KA 1X0RA 2C80A 3EMXA 2Z9SA 1JLVA 5HQPA 2YWNA 1WP0A 4N11A 3GV1A 2B7JA 1U6TA 3F6FA 3PH9A 4E8EA 5GAPD 3LJRA 1V98A 4AJ7A 4WETA 5ID2A 2GSSA 1PKWA 4GSTA 1M9AA 2EIQA 1EGOA 4TW5A 1SKWB 5HFKA 2DMMA 14GSA 1PL2A 4PUFC 3H8QA 1PQNA 1H4OA 3UBKA 4YAVA 4MF5A 2VCVA 3MSZA 3UJ1A 3KD0A 4KW6A 4XS1A 3KP8A 5KOWA 3W6GA 1LJRA 2B5EA 5H5QA 3LWAA 4EO3A 4PNGA 4I2TA 3GTUA 1B4QA 2QA2A 4WBRD 2DKIA 4G10A 1F37A 3ZYWA 2VD1A 3EU4A 4OFNA 1ZYNA 1WOUA 2JADA 2RUFA 4BVXB 1AW9A 3MIXA 4KCAA 3DMLA 1SU9A 5B8BA 4TN8A 4HJMA 3VPTA 5H5RA 3APOA 3DVXA 4IQAA 3WGEA 3IHQA 1LU4A 2ZCTA 3VPQA 2L5LA 3NZNA 3VI7A 3O3TA 1GTAA 3ERFA 3CXGA 2I1UA 3L78A 4NHZA 4OCEA 2IMIA 2HZEA 5IMAA 1URMA 22GSA 1TOFA 4IN0A 3ZLPA 3GIXA 2V6OA 3CBUA 4Q5NA 2HLSA 1ZYPA 2YP6A 4X4JA 1BJXA 4QL7A 4OD7A 4PQHA 5IOXA 1SKRB 2DJKA 5KN0A 2EIRA 3VLNA 5ECQB 3LQ7A 1PN0A 2H72A 3KTLA 1FB6A 2I9HA 4FQUA 5GZZB 4TR4A 1YQ1A 2YV9A 4MJEA 4O7HA 2GQLA 2WCIA 1A24A 1S3CA 3KZQA 1GSEA 3TKRA 6GSTA 3ZFLA 4EDZA 2KOKA 4NMUA 2YANA 4K6XA 4TXVA 2B1KA 5JWRB 5B6NA 1FVJA 3M9JA 2X64A 4L8EA 7GSSA 2IMEA 4PTSA 3QFBC 1ZL9A 5CP1A 2RM5A 4GTUA 5KEJA 3HXSA 2TRXA 4N30A 2RLIA 2PERA 4O5QA 2PPTA 2WS2A 3FRCA 3GYKA 2DKHA 4GQCA 2F51A 4ECIA 3SWLA 3UVHA 3LXZA 2E2MA 1XBSA 2B7KA 2YV7A 1OE8A 2JSYA 2CVKA 2XPEA 2DSAA 3R2QA 1YKAA 3F63A 4G0IA 1TJDA 4JR6A 3FR3A 1XW9A 5G5FA 5DQYA 1SL1B 2R0GA 2H6XA 5KN2A 2FY6A 2P5QA 3FHKA 3U6VA 4ZIJA 3M0FA 3HZ8A 1XWCA 3IDVA 4IP6A 3LEFA 4K5RA 4EIPA 3FZ9A 4O5UA 2FNOA 1M7TA 4K0NA 1FOHA 2C3NA 3UEMA 1HNAA 4TRXA 4EC0A 2IMKA 5DAKA 1DE2A 1ERUA 4TR1B 2CAIA 2X8GA 1EGRA 2YJHA 5D9VA 1Z9HA 1XW5A 4L5LA 1G6YA 1V9WA 4L0WA 3O76A 10GSA 3GA4A 3KCMA 5IM9A 5ECSA 2R3XA 5JCGA 1NW2A 4GWRA 2F3MA 2DJ3A 5CRGA 3GH9A 5LNKe 5IO2A 3UBLA 1OC9B 5AN1A 4CHSA 1TW9A 2HZFA 4QL9A 2IFQA 2YCDA 4IQ1A 1R7HA 4KB3A 1O7UA 3H79A 5CREA 4MJCA 2VUPA 1EZKA 1TDIA 2R6KA 2VCZA 2H0GA 2B5YA 2TRCP 3P7XA 1SK2A 3OR5A 1E2YA 3APQA 2GVPA 6GSYA 3UOMA 3I6AA 1EP8A 2HI7A 4Z2UA 4TR0A 3DXBA 1YZXA 4MABA 3WD6A 2RIIA 2FLSA 2MBSA 4HZ4A 2HSYA 1TU7A 1WJKA 3WGDA 1TRSA 1MD4A 2H01A 4ECJA 4JR4A 3HA9A 6GSXA 1HD2A 3O6TA 2AUVA 2LNSA 5INYA 3IAM2 4V2LA 4F03A 1Y6EA 4N0ZA 3KXOA 5G5EA 4HI7A 1K3OA 4ML1A 2GQMA 2L59A 3MAKA 1FOVA 2PGTA 3DVWA 2CZ2A 1BAYA 2PBJA 1FAAA 3F6DA 1EOHA 4L5OA 4ECBA 4IHUA 3Q19A 2H6ZA 3KGKA 3PINA 5IPGA 2FA8A 5C00A 2I4AA 1M2BA 5D9WA 4WR5A 2GLRA 1TXXA 3BOAA 4OFMA 5AGYA 1U3IA 5L71A 3WT1A 2LV3A 4BWQA 4D73A 1SK0A 2ZNMA 2L5OA 4OMVA 1H75A 3HY2A 1GTBA 4KDXA 3ME8A 1OVNA 4WF5A 1TI3A 4RQRA 2AYTA 1XWGA 1JZOA 3CSHA 2HT9A 3IK7A 5AIVA 2YNXA 2FGXA 3GL5A 4OO4A 2WGRA 3VWVA 3DRNA 3HCZA 2QC7A 4ZBBA 3E3EA 1PGTA 1O6JA 4MPGA 1EV4A 5FWGA 1K3LA 5HR0A 3GL3A 2FUG2 3I9V2 4PNFA 3FKFA 2DJ0A 4NV5A 4TVEA 2KHPA 2LJRA 5ECOB 3KP9A 5B8AA 2K6VA 4G19A 1EEMA 4CY6A 1Z6NA 3M3MA 1V58A 2HFDA 4G0LA 2CV4A 5IMDA 3GHAA 4ZXGA 4XS4A 3VWXA 5D9XA 4ECCA 4J57E 4EL1A 2GGTA 4HQSA 1R5AA 4HEA2 2IL3A 4EIQA 4CDOA 1MEKA 2PVOC 3TKSA 2H76A 2GSRA 6GSVA 3C71A 3TKQA 2IPAA 3W8JA 5CO3A 3QPMA 4FYCA 2H75A 1X5CA 3J7Yk 2HRKA 2FCHA 5GSTA 4I8BA 3GKNA 4RI7A 3TKSC 4EVMA 1ABAA 5KN3A 4DSSB 3F9UA 1K0NA 2TIRA 1FHEA 1A2MA 1BQ7A 2GQKA 2IIYA 4Q5FA 4TKYA 1EOGA 2GZPA 2A2PA 2C3QA 3N9JA 4IP1A 1QXHA 1XWBA 4RQXA 4HQZA 3MYDA 4KE3A 2PVQA 2HRFA 2DBCA 4EKZA 3C1RA 5AISA 4WKWA 2WULA 2VCXA 3ZL5A 1THXA 5DQSA 4FYBA 4GSSA 3TJBA 4BA7A 3QOUA 4I5QA 5D93A 1A23A 2L6CA 4ZL8A 1LBKA 4BVXA 5KOXA 2O89A 3D4MA 3US3A 3DYRA 3GN3A 2VO4A 1F6MC 2ON5A 5G2ZA 4GCIA 1Q98A 5HR3A 2VCQA 8GSSA 3QDNA 2OADA 3HJMA 4OFTA 2LNTA 5CNWA 1B8XA 1J9BA 3EU3A 1GTUA 3G7JA 2G2QA 2H1GA 5FT3A 1V40A 2RM6A 3TDGA 2H74A 4J56E 5ELAA 4ILFA 1AQXA 3TJGA 3ZREA 1B4PA 4ZBDA 2M72A 3VWUA 1ZCPA 3LFLA 3FZAA 5ECHB 1TRWA 3IHGA 1JZWA 2H70A 4F9ZA 3ED3A 2GDRA 3HYPA 4TXOA 3LYKA 1PX6A 1O81A 5J9CA 1MDKA 4IKHA 4HZ2A 4JBBA 3TUEA 3V1WA 1MD3A 4WBJA 3L4NA 2X4AA 3PR8A 2OE3A 4K7OA 3D5JA 3QCPA 2NDOA 2MMNA 3HVSA 5AIXA 3GKMA 3GX8A 2FWHA 1AUCA 4ULXA 3FYGA 3IRAA 3EC3A 1DBYA 1I9DA 4EF0A 4RUVA 19GSA 4YH2A 4OWYA 5F8BA 4X1UA 1A0RP 3HD5A 1SENA 1O8XA 1SL2B 2IMDA 3U5RE 5F06A 4HU9A 2GSQA 4CY8A 3EMPA 1JZRA 2VM1A 1WMJA 1GULA 1GUMA 4BPYA 4HS1A 1OKDA 1TP9A 2VL2A 4G2EA 2AV4A 2IJYA 2AJQB 3VK9A 1BEDA 3LXTA 1UC7A 1K0DA 4ACSA 3KTBA 3ISOA 4MJBA 1THOA 2DJ1A 2CZ3A 2HE3A 4OO5A 2YJ7A 4KA0A 2VL2C 4POLA 3BCIA 1SJIA 3HJPA 5E4WA 1W4VA 3EWLA 2O7KA 1A2LA 4YQVA 1Z6MA 2I81A 4WXTA 2X99A 5IOWA 1N2AA 4TR1A 1XZOA 4BVYB 2JSZA 3C1SA 5IMZA 4E8HA 4DSQA 4NXIA 4MA9A 5IMCA 4IVFA 4G9HA 2OJLA 1NSWA 5A4VA 5ELGA 4JE1A 4MLYA 3E9JB 3P2AA 1FO5A 3P8WA 1DUGA 2JACA 4FH8A 4ZB6A 2B3SA 1VF1A 5ECRB 4KNDA 1OC9A 5DALA 5GSSA 1YEPA 5B7CA 5ABRA 2L57A 2CAQA 1K0MA 3L0HA 2V2GA 1RW1A 3BD2A 3QMXA 3HVVA 3TGZA 2L4QA 2CVDA 2HRNA 2C8UA 1VF4A 3K8NA 2REMA 1C72A 1ERTA 2YWIA 4YQMA 4J2FA 2DC5A 1MDJA 4EXJA 5JWQB 1GP1A 3IR4A 4LL1B 3N5OA 11GSA 2MMAA 1KEBA 4IELA 2PMTA 3TB2A 3TJKA 2R0CA 4ZILA 1GLQA 3HZ4A 4DSRA 3GNJA 3R3EA 3CTFA 1TRUA 1PMTA 4PXOA 4K7IA 1N8JA 1ERVA 1WPIA 2LJAA 2VCTA 3CRTA 1YY7A 5F07A 1NHYA 4I2UA 2FD3A 4HDEA 2LRTA 4MZWA 4NV2A 3L9SA 3Q6OA 1PD21 3RDWA 4K2XA 1WE0A 2CVBA 1A8YA 4GXZA 2UZ8A 4F0CA 3D4TA 4LMWA 3RPPA 3KH7A 2MMZA 3VFIA 2VLTA 4WEYA 5J9BA 5JCUA 4NAXA 3KH9A 3TOTA 5LD0A 1AQWA 2QA1A 4LLRA 2K9FA 2KP2A 3IXRA 5D9TA 5IO0A 2KUCA 5A4UA 3IC8A 1GUHA 4KUNA 2FWGA 3VI5A 3ZVJD 2HRAA 3ZMKA 4H86A 5D73A 2KLXA 4MK3A 4K8MA 3KMOA 2I3YA 2GS3A 5HR2A 3H4KA 2IMFA 1EWXA 1I5GA 13GSA 2ALBA 2RUEA 5JWOB 3F8UA 1SYXA 2GT5A 3ZITA 4LL4B 4KF9A 2CT6A 3BCKA 3H93A 2CA8A 2A4HA 1JLWA 3EYTA 1G0TA 3UAPA 3ERWA 4JRRA 2GT6A 3WGXA 4XRAA 2LRCA 4MH2A 2L6DA 3LGCA 3Q74A 3UVTA 5BMUA 4DVCA 3S9FA 3GFKA 1K3YA 4BWSA 2VL3A 2GTUA 3CSIA 1T1VA 4IJIA 6GSWA 4MCUA 3IK9A 3M1GA 3QAWA 3W8SA 3ME7A 4EUYA 1S3DA 1SJZA 1RK4A 2P5RA 3A3TA 1TK0B 4V1Ap 1KNGA 5ECIB 2P0GA 3IC4A 2QKEA 17GSA 2BMXA 1XCCA 1YEXA 4KGIA 1HYUA 2C3TA 4JU5A 2QSIA 2C0DA 1A2JA 3KIJA 4POMA 2MBTA 1TK5B 4F82A 1TKDB 3MWHA 3A2WA 3BJ5A 4JEDA 4XTSA 3UARA 5IPHA 1ZZYA 1QFNA 1OAZA 4AJ6A 1TK8B 1BG5A 4ZB8A 4N0VA 3D21A 2G0FA 1GSDA 1QUWA 2H1BA 3TCOA 4PUAA 2M46A 4WR4A 3KEBA 4NPBA 1XOAA 5ECPB 4PX1A 5D96A 4YKFA 4DSSA 2JZTA 1SKSB 3CRUA 2JZSA 16GSA 1GSUA 2H66A 1XOBA 2WJUA 5DVBA 4IBPA 1TU8A 5HFGA 3J7Yb 1PRXA 1ON4A 5ECNB 20GSA 3F4SA 2F8FA 1FB0A 2H1AA 1YF0A 2VM2A 2O85A 5LCZA 1XXUA 2OE0A 5DJMA 1TI1A 1NHOA 2X8HA 6GSSA 3M8NA 3GURA 3TRPA 1ML6A 4YAPA 5J5NA 4MPFA 2R0PA 5IMFA 2V41A 4BL7B 3DEXA 5ECKB 5B6MA 3FY7A 3C73A 3HKRA 3PPUA 5JCWA 4FYUA 2LUSA 3GKKA 2DIYA 1NM3A 2K18A 1HNBA 1IYHA 3NOFA 1BYEA 4ICYA 4XS4B 1WRYA 2C0GA 2A2SA 2C1YA 2DJ2A 1JFUA 3D6IA 2F9SA 2D2ZA 4MF7A 3JCML 4QQ7A 2HXKA 12GSA 2R2JA 3FZ4A 4XS6A 3H1NA 2WDUA 1O8WA 2HSHA 5BRTA 1XPVA 2V32A 3ZFBA 1IYIA 5A4WA 3M9KA 5DJLA 4F0BA 1F3BA 3AY8A 4ZBAA 3I43A 2L4CA 4OCFA 2F8AA 4KDYA 3CMIA 2LS5A 3QFAC 3ZVJA 4DEJA 4TOPA 2PN8A 3ERGA 4NWYA 2KP1A 3EINA 4AJ8A 3WYWA 2DMLA 4PQIA 1OC8A 3IA1A 2AHEA 2VIMA 2J23A 2LRNA 4KSOA 1GWCA 4YKGA 3KJYA 4NHWA 1XWAA 2E7PA 3NIVA 1DE1A 3RAZA 2QGVA 2AB6A 4AF2A 1E6BA 1T3BA 1TTZA 3GRXA 1F2EA 1HQOA 3QAGA 4MDCA 1MTCA 1CQGA 4MZBA 1X9SB 5ID2B 1XW6A 1QQ2A 3D0ZA 2JU5A 3MNGA 5DBQA 6GSUA 1VF2A 3TRQA 1R4WA 2C4JA 2H6YA 3G9BA 3GMFA 4N10A 5E59A 2HSMA 4K9ZA 2MZCA 3IOSA 3LW9A 4ID0A 2O8VB 2GZYA 3D22A 1USBA 1V57A 2ON7A 1T00A 2E2GA 5G31A 1U3AA 2CX4A 3F3RA 1ST9A 3GSSA 1R5PA 2YWOA 2WRTA 2EC4A 3ZIVA 4O5RA 3DD3A 3ZZXA 1AAZA 3GTUB 5FHIA 1MDIA 5ECLB 2B1LA 1J0FA 3F4TA 4BVYA 2C0FA 1U87A 2E0QA 2AAWA 1X5DA 1YKCA 1EP7A 3Q18A 1GTIA 3HVXA 4K2DA 5G1LA 2XBIA 2WB9A 3F4RA 2OKAA 3WT2A 2NPBA 2HNLA 4TXOB 1G7EA 4ZB9A 4USSA 3FW2A 2H0IA 2XBQA 4PGTA 3F0IA 1B9XC 1X9WB 2H0HA 3DWVA 4Q5QA 1U88A 2DIZA 1XFLA 2HZEB 3GSTA 1ILOA 4IJ3A 1FW1A 5IIZA 2V6KA 2H8LA 3VURA 3TRXA 2N5FA 5D8IA 3A2XA 4G0KA 1UA5A 1ERWA 1YF1A 2R5GA 1B9YC 1UN2A 4EE0A 1XWKA 2P31A 4PQ1A 1ZYQB 1ZYEA 3ZIJA 1M0UA 5CYYA 4GRFA 1WWJA 2FWFA 4KH7A 1K0OA 2FHEA 3CSJA 1J08A 3UMAA 3LORA 4GQFA 1ZMAA 9GSSA 1TRVA 5EL8A 2NBSA 1VGLA 3G7IA 2OACA 4HUAA 2H71A 4XRDA 3KM6A 5EY6A 3ZRDA 2X49A 1DSBA 1GSQA 2GSTA 5DCHA 3EVIA 3PGTA 2H30A 2HYXA 4ZL9A 5DCGA 18GSA 1QK8A 2N5AA 2VD0A 2YZUA 4HJ2A 2OE1A 3IPZA 1GSYA 5F0GA 1QGVA 3KMNA 1F3AA 1AQVA 3GUSA 2H73A 3DGQA 3APSA 2FWEA 4I97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RPN A;  2WZ9 A;  4WF4 A;  2XPD A;  4KX4 A;  1K0C A;  1PA3 A;  5J3R A;  1SYR A;  3RHC A;  1GLP A;  4PUR A;  5J4U A;  2DJJ A;  2R4V A;  2YZH A;  3UIW A;  4ISD A;  3DKS A;  4GSN A;  2C0E A;  2LJK A;  2K8V A;  3LSZ A;  5DAL B;  2VOC A;  3TKP A;  3TJF A;  2PWJ A;  4Q5R A;  2LEG A;  4P3Y B;  5KN1 A;  1CQH A;  1AC1 A;  4X43 A;  1PX7 A;  3CTG A;  3IV4 A;  5HR1 A;  2PU9 C;  3A2V A;  4MZC A;  1SJ6 A;  4FIW A;  5DAK B;  2PUK C;  2JZR A;  4ZL7 A;  1G7O A;  2IWT A;  1O85 A;  3FR9 A;  1FVK A;  4XCS A;  1ZOF A;  2B6M A;  5IMV A;  3C8E A;  1AXD A;  1T4Z A;  3P90 A;  4MP4 A;  5C04 A;  4MJA A;  5COH A;  2A4V A;  1A0F A;  5CRD A;  1ZGN A;  5J41 A;  2FA4 A;  4EDY A;  2OA7 A;  2V1M A;  3E0U A;  5H5S A;  3I69 A;  2XC2 A;  1UVZ A;  1PN9 A;  4XIH A;  2IFQ B;  1KTE A;  5CRW A;  5G1K A;  3HDC A;  2K8S A;  1A8L A;  2NVL A;  4LMV A;  1S3A A;  2MMO A;  1YDK A;  1M9B A;  1GUK A;  1GNW A;  1K0B A;  4O92 A;  4LA1 A;  3RHB A;  3L9V A;  1GSF A;  2NTO A;  2YN1 A;  2YPM A;  4K0G A;  1XVW A;  1PL1 A;  1GL8 A;  4K1F A;  1HNC A;  1EV9 A;  2OBI A;  5EVO A;  1OYJ A;  4HU7 A;  1X5E A;  3L9U A;  4YQU A;  4IW9 A;  4KSM A;  1XIY A;  4I6X A;  2IN3 A;  3IE3 A;  4POB A;  2YOI A;  1SK1 A;  2GZZ A;  5DDL A;  3TKS E;  1PSQ A;  4MH3 A;  4GF0 A;  4HOJ A;  4XHM A;  2XHF A;  2VLU A;  1SD9 A;  3HJO A;  1O73 A;  4RI6 A;  1Z5Y E;  2H19 A;  2N5B A;  1JHB A;  1K0A A;  1VF3 A;  1GNE A;  4KDU A;  1QMV A;  2O87 A;  3QAV A;  3IBH A;  2LQQ A;  5F05 A;  3C7M A;  4TR3 A;  1Z7P A;  3F3Q A;  2ZUP A;  3FZ5 A;  2LST A;  3LYP A;  2R37 A;  1GRX A;  3DIE A;  1OE7 A;  2M80 A;  3TJJ A;  5EPF A;  2H1D A;  1SL0 B;  1Z7R A;  4V2M A;  1Y25 A;  4AGS A;  1T8E B;  2EIO A;  1Q4J A;  3UL3 A;  1X9M B;  1WIK A;  1M2A A;  1F9M A;  5ENU A;  3TOU A;  2OBK A;  1YJ6 A;  4CW9 A;  3EE2 A;  2X8C A;  2ES7 A;  3RBT A;  5HFI A;  4D73 B;  2VL9 A;  1T4Y A;  4L0U A;  1M99 A;  2VCW A;  4BL7 A;  1OC3 A;  3FR6 A;  4Z7X A;  4GLT A;  3FEU A;  1R26 A;  2BJX A;  2J9H A;  3SBC A;  3LG6 A;  4IGJ A;  2BTO T;  3IAS 2;  2LKU A;  3QR6 A;  1AIU A;  1GSS A;  2MYG A;  3FK8 A;  4F2I A;  1FG4 A;  4FO5 A;  3MDK A;  3GKX A;  1M2D A;  1BX9 A;  2LQO A;  1XVQ A;  1G6W A;  3QD9 A;  3CYN A;  2VAF A;  3A5W A;  3VWW A;  1JZD A;  3GH6 A;  2JL4 A;  4V2N A;  4X0X A;  1V2A A;  3ZTL A;  4MF6 A;  1VRS D;  2CQ9 A;  2DLX A;  4MMM A;  5IQY A;  2LTK A;  1PKZ A;  2B5X A;  5G30 A;  2VLV A;  2A2R A;  5ECM B;  4JZQ A;  5CAX A;  1GH2 A;  1W89 A;  4IS0 A;  1EEJ A;  1Z3E A;  3ZML A;  4O32 A;  4V1A g;  4ML6 A;  5GAN D;  1OKT A;  3GX0 A;  2YWM A;  2CX3 A;  1ACV A;  1RQM A;  1B48 A;  3G7Y A;  3EUR A;  5CRH A;  4POK A;  4KCE A;  1T7P B;  4KAE A;  3HHV A;  1SD8 A;  2WFC A;  1KBN A;  3BBY A;  4K7N A;  5A5K A;  1X0R A;  2C80 A;  3EMX A;  2Z9S A;  1JLV A;  5HQP A;  2YWN A;  1WP0 A;  4N11 A;  3GV1 A;  2B7J A;  1U6T A;  3F6F A;  3PH9 A;  4E8E A;  5GAP D;  3LJR A;  1V98 A;  4AJ7 A;  4WET A;  5ID2 A;  2GSS A;  1PKW A;  4GST A;  1M9A A;  2EIQ A;  1EGO A;  4TW5 A;  1SKW B;  5HFK A;  2DMM A;  14GS A;  1PL2 A;  4PUF C;  3H8Q A;  1PQN A;  1H4O A;  3UBK A;  4YAV A;  4MF5 A;  2VCV A;  3MSZ A;  3UJ1 A;  3KD0 A;  4KW6 A;  4XS1 A;  3KP8 A;  3W6G A;  1LJR A;  2B5E A;  5H5Q A;  3LWA A;  4EO3 A;  4PNG A;  4I2T A;  3GTU A;  1B4Q A;  4WBR D;  4G10 A;  1F37 A;  3ZYW A;  2VD1 A;  3EU4 A;  4OFN A;  1WOU A;  2JAD A;  2RUF A;  1AW9 A;  4KCA A;  3DML A;  1SU9 A;  5B8B A;  4TN8 A;  4HJM A;  3VPT A;  5H5R A;  3APO A;  3DVX A;  4IQA A;  3WGE A;  3IHQ A;  1LU4 A;  2ZCT A;  3VPQ A;  2L5L A;  3NZN A;  3VI7 A;  3O3T A;  1GTA A;  3ERF A;  3CXG A;  2I1U A;  3L78 A;  4NHZ A;  4OCE A;  2IMI A;  2HZE A;  5IMA A;  1URM A;  22GS A;  1TOF A;  4IN0 A;  3ZLP A;  3GIX A;  2V6O A;  3CBU A;  4Q5N A;  2HLS A;  2YP6 A;  1BJX A;  4QL7 A;  4OD7 A;  4PQH A;  5IOX A;  1SKR B;  2DJK A;  5KN0 A;  2EIR A;  3VLN A;  5ECQ B;  3LQ7 A;  2H72 A;  3KTL A;  1FB6 A;  2I9H A;  5GZZ B;  4TR4 A;  1YQ1 A;  2YV9 A;  4MJE A;  4O7H A;  2GQL A;  2WCI A;  1A24 A;  1S3C A;  3KZQ A;  1GSE A;  3TKR A;  6GST A;  3ZFL A;  4EDZ A;  2KOK A;  4NMU A;  2YAN A;  4K6X A;  4TXV A;  2B1K A;  5JWR B;  5B6N A;  1FVJ A;  3M9J A;  2X64 A;  4L8E A;  7GSS A;  2IME A;  3QFB C;  1ZL9 A;  5CP1 A;  2RM5 A;  4GTU A;  5KEJ A;  3HXS A;  2TRX A;  4N30 A;  2RLI A;  2PER A;  2PPT A;  2WS2 A;  3FRC A;  3GYK A;  4GQC A;  2F51 A;  4ECI A;  3SWL A;  3UVH A;  3LXZ A;  2E2M A;  1XBS A;  2B7K A;  2YV7 A;  1OE8 A;  2JSY A;  2CVK A;  2XPE A;  2DSA A;  3R2Q A;  1YKA A;  3F63 A;  1TJD A;  4JR6 A;  3FR3 A;  1XW9 A;  5G5F A;  5DQY A;  1SL1 B;  2H6X A;  5KN2 A;  2FY6 A;  2P5Q A;  3FHK A;  3U6V A;  4ZIJ A;  3M0F A;  3HZ8 A;  1XWC A;  3IDV A;  4IP6 A;  3LEF A;  3FZ9 A;  2FNO A;  1M7T A;  4K0N A;  2C3N A;  3UEM A;  1HNA A;  4TRX A;  4EC0 A;  2IMK A;  5DAK A;  1DE2 A;  1ERU A;  4TR1 B;  2CAI A;  2X8G A;  1EGR A;  2YJH A;  5D9V A;  1Z9H A;  1XW5 A;  4L5L A;  1G6Y A;  1V9W A;  4L0W A;  3O76 A;  10GS A;  3GA4 A;  3KCM A;  5IM9 A;  5ECS A;  2R3X A;  5JCG A;  1NW2 A;  4GWR A;  2F3M A;  2DJ3 A;  5CRG A;  3GH9 A;  5LNK e;  5IO2 A;  3UBL A;  1OC9 B;  5AN1 A;  4CHS A;  1TW9 A;  2HZF A;  4QL9 A;  2IFQ A;  2YCD A;  4IQ1 A;  1R7H A;  4KB3 A;  1O7U A;  3H79 A;  5CRE A;  4MJC A;  2VUP A;  1EZK A;  1TDI A;  2R6K A;  2VCZ A;  2H0G A;  2B5Y A;  2TRC P;  3P7X A;  1SK2 A;  3OR5 A;  1E2Y A;  3APQ A;  2GVP A;  6GSY A;  3UOM A;  3I6A A;  1EP8 A;  2HI7 A;  4TR0 A;  3DXB A;  1YZX A;  4MAB A;  3WD6 A;  2RII A;  2FLS A;  2MBS A;  4HZ4 A;  2HSY A;  1TU7 A;  1WJK A;  3WGD A;  1TRS A;  1MD4 A;  2H01 A;  4ECJ A;  4JR4 A;  3HA9 A;  6GSX A;  1HD2 A;  3O6T A;  2AUV A;  2LNS A;  5INY A;  3IAM 2;  4V2L A;  4F03 A;  1Y6E A;  4N0Z A;  3KXO A;  5G5E A;  4HI7 A;  1K3O A;  4ML1 A;  2GQM A;  2L59 A;  3MAK A;  1FOV A;  2PGT A;  3DVW A;  2CZ2 A;  1BAY A;  2PBJ A;  1FAA A;  3F6D A;  1EOH A;  4L5O A;  4ECB A;  4IHU A;  3Q19 A;  2H6Z A;  3KGK A;  3PIN A;  5IPG A;  2FA8 A;  5C00 A;  2I4A A;  1M2B A;  5D9W A;  4WR5 A;  2GLR A;  1TXX A;  3BOA A;  4OFM A;  5AGY A;  1U3I A;  5L71 A;  3WT1 A;  2LV3 A;  4BWQ A;  4D73 A;  1SK0 A;  2ZNM A;  2L5O A;  4OMV A;  1H75 A;  3HY2 A;  1GTB A;  4KDX A;  3ME8 A;  1OVN A;  4WF5 A;  1TI3 A;  4RQR A;  2AYT A;  1XWG A;  1JZO A;  3CSH A;  2HT9 A;  3IK7 A;  5AIV A;  2YNX A;  2FGX A;  3GL5 A;  4OO4 A;  2WGR A;  3VWV A;  3DRN A;  3HCZ A;  2QC7 A;  4ZBB A;  3E3E A;  1PGT A;  1O6J A;  4MPG A;  1EV4 A;  5FWG A;  1K3L A;  5HR0 A;  3GL3 A;  2FUG 2;  3I9V 2;  4PNF A;  3FKF A;  2DJ0 A;  4NV5 A;  4TVE A;  2KHP A;  2LJR A;  5ECO B;  3KP9 A;  5B8A A;  2K6V A;  4G19 A;  1EEM A;  1Z6N A;  3M3M A;  1V58 A;  2HFD A;  2CV4 A;  5IMD A;  3GHA A;  4ZXG A;  4XS4 A;  3VWX A;  5D9X A;  4ECC A;  4J57 E;  4EL1 A;  2GGT A;  4HQS A;  1R5A A;  4HEA 2;  2IL3 A;  4CDO A;  1MEK A;  2PVO C;  3TKS A;  2H76 A;  2GSR A;  6GSV A;  3C71 A;  3TKQ A;  2IPA A;  3W8J A;  5CO3 A;  3QPM A;  4FYC A;  2H75 A;  1X5C A;  3J7Y k;  2FCH A;  5GST A;  4I8B A;  3GKN A;  4RI7 A;  3TKS C;  4EVM A;  1ABA A;  5KN3 A;  4DSS B;  3F9U A;  1K0N A;  2TIR A;  1FHE A;  1A2M A;  1BQ7 A;  2GQK A;  2IIY A;  4Q5F A;  4TKY A;  1EOG A;  2GZP A;  2C3Q A;  3N9J A;  4IP1 A;  1QXH A;  1XWB A;  4RQX A;  4HQZ A;  4KE3 A;  2PVQ A;  2HRF A;  2DBC A;  4EKZ A;  3C1R A;  5AIS A;  4WKW A;  2WUL A;  2VCX A;  3ZL5 A;  1THX A;  5DQS A;  4FYB A;  4GSS A;  3TJB A;  4BA7 A;  3QOU A;  5D93 A;  4I5Q A;  1A23 A;  2L6C A;  4ZL8 A;  1LBK A;  4BVX A;  2O89 A;  3D4M A;  3US3 A;  3DYR A;  3GN3 A;  2VO4 A;  1F6M C;  2ON5 A;  5G2Z A;  4GCI A;  1Q98 A;  5HR3 A;  2VCQ A;  8GSS A;  3QDN A;  2OAD A;  3HJM A;  4OFT A;  2LNT A;  5CNW A;  1B8X A;  1J9B A;  3EU3 A;  1GTU A;  3G7J A;  2G2Q A;  2H1G A;  5FT3 A;  1V40 A;  2RM6 A;  3TDG A;  2H74 A;  4J56 E;  5ELA A;  4ILF A;  1AQX A;  3TJG A;  3ZRE A;  1B4P A;  4ZBD A;  2M72 A;  3VWU A;  1ZCP A;  3LFL A;  3FZA A;  5ECH B;  1TRW A;  1JZW A;  2H70 A;  4F9Z A;  3ED3 A;  2GDR A;  3HYP A;  4TXO A;  3LYK A;  1PX6 A;  1O81 A;  5J9C A;  1MDK A;  4IKH A;  4HZ2 A;  4JBB A;  3TUE A;  3V1W A;  1MD3 A;  4WBJ A;  3L4N A;  3PR8 A;  2OE3 A;  4K7O A;  3D5J A;  3QCP A;  2NDO A;  2MMN A;  3HVS A;  5AIX A;  3GKM A;  3GX8 A;  2FWH A;  1AUC A;  4ULX A;  3FYG A;  3IRA A;  3EC3 A;  1DBY A;  1I9D A;  4EF0 A;  4RUV A;  19GS A;  4YH2 A;  4OWY A;  5F8B A;  4X1U A;  1A0R P;  3HD5 A;  1SEN A;  1O8X A;  1SL2 B;  2IMD A;  3U5R E;  5F06 A;  4HU9 A;  2GSQ A;  3EMP A;  1JZR A;  2VM1 A;  1WMJ A;  1GUL A;  1GUM A;  4BPY A;  4HS1 A;  1OKD A;  1TP9 A;  2VL2 A;  4G2E A;  2AV4 A;  2IJY A;  2AJQ B;  3VK9 A;  1BED A;  3LXT A;  1UC7 A;  1K0D A;  4ACS A;  3KTB A;  3ISO A;  4MJB A;  1THO A;  2DJ1 A;  2CZ3 A;  2HE3 A;  4OO5 A;  2YJ7 A;  4KA0 A;  2VL2 C;  4POL A;  3BCI A;  1SJI A;  3HJP A;  5E4W A;  1W4V A;  3EWL A;  2O7K A;  1A2L A;  4YQV A;  1Z6M A;  2I81 A;  4WXT A;  2X99 A;  5IOW A;  1N2A A;  4TR1 A;  1XZO A;  2JSZ A;  3C1S A;  5IMZ A;  4E8H A;  4DSQ A;  4NXI A;  4MA9 A;  5IMC A;  4IVF A;  4G9H A;  2OJL A;  1NSW A;  5A4V A;  5ELG A;  4JE1 A;  4MLY A;  3E9J B;  3P2A A;  1FO5 A;  3P8W A;  1DUG A;  2JAC A;  4FH8 A;  4ZB6 A;  2B3S A;  1VF1 A;  5ECR B;  4KND A;  1OC9 A;  5DAL A;  5GSS A;  1YEP A;  5B7C A;  5ABR A;  2L57 A;  2CAQ A;  1K0M A;  3L0H A;  2V2G A;  1RW1 A;  3BD2 A;  3QMX A;  3HVV A;  3TGZ A;  2L4Q A;  2CVD A;  2HRN A;  2C8U A;  1VF4 A;  3K8N A;  2REM A;  1C72 A;  1ERT A;  2YWI A;  4YQM A;  4J2F A;  2DC5 A;  1MDJ A;  4EXJ A;  5JWQ B;  1GP1 A;  3IR4 A;  4LL1 B;  3N5O A;  11GS A;  2MMA A;  1KEB A;  4IEL A;  2PMT A;  3TB2 A;  3TJK A;  4ZIL A;  1GLQ A;  3HZ4 A;  4DSR A;  3GNJ A;  3CTF A;  1TRU A;  1PMT A;  4PXO A;  4K7I A;  1N8J A;  1ERV A;  1WPI A;  2LJA A;  2VCT A;  3CRT A;  1YY7 A;  5F07 A;  1NHY A;  4I2U A;  2FD3 A;  4HDE A;  2LRT A;  4MZW A;  4NV2 A;  3L9S A;  3Q6O A;  1PD2 1;  3RDW A;  1WE0 A;  2CVB A;  1A8Y A;  4GXZ A;  4F0C A;  3D4T A;  4LMW A;  3RPP A;  3KH7 A;  2MMZ A;  3VFI A;  2VLT A;  4WEY A;  5J9B A;  5JCU A;  4NAX A;  3KH9 A;  3TOT A;  5LD0 A;  1AQW A;  4LLR A;  2K9F A;  2KP2 A;  3IXR A;  5D9T A;  5IO0 A;  2KUC A;  5A4U A;  1GUH A;  4KUN A;  2FWG A;  3VI5 A;  3ZVJ D;  3ZMK A;  4H86 A;  5D73 A;  2KLX A;  4MK3 A;  4K8M A;  3KMO A;  2I3Y A;  2GS3 A;  5HR2 A;  3H4K A;  2IMF A;  1EWX A;  1I5G A;  13GS A;  2ALB A;  2RUE A;  5JWO B;  3F8U A;  1SYX A;  2GT5 A;  3ZIT A;  4LL4 B;  2CT6 A;  3BCK A;  3H93 A;  2CA8 A;  1JLW A;  3EYT A;  1G0T A;  3UAP A;  3ERW A;  4JRR A;  2GT6 A;  3WGX A;  4XRA A;  2LRC A;  4MH2 A;  2L6D A;  3LGC A;  3Q74 A;  3UVT A;  4DVC A;  3S9F A;  3GFK A;  1K3Y A;  4BWS A;  2VL3 A;  2GTU A;  3CSI A;  1T1V A;  4IJI A;  6GSW A;  4MCU A;  3IK9 A;  3M1G A;  3QAW A;  3W8S A;  3ME7 A;  4EUY A;  1S3D A;  1SJZ A;  1RK4 A;  2P5R A;  3A3T A;  1TK0 B;  4V1A p;  1KNG A;  5ECI B;  2P0G A;  3IC4 A;  2QKE A;  17GS A;  2BMX A;  1XCC A;  1YEX A;  4KGI A;  1HYU A;  2C3T A;  4JU5 A;  2QSI A;  2C0D A;  1A2J A;  3KIJ A;  4POM A;  2MBT A;  1TK5 B;  4F82 A;  1TKD B;  3MWH A;  3A2W A;  3BJ5 A;  4JED A;  4XTS A;  3UAR A;  5IPH A;  1ZZY A;  1QFN A;  1OAZ A;  4AJ6 A;  1TK8 B;  1BG5 A;  4ZB8 A;  4N0V A;  3D21 A;  2G0F A;  1GSD A;  1QUW A;  2H1B A;  3TCO A;  4PUA A;  2M46 A;  4WR4 A;  3KEB A;  4NPB A;  1XOA A;  5ECP B;  4PX1 A;  5D96 A;  4DSS A;  2JZT A;  1SKS B;  3CRU A;  2JZS A;  16GS A;  1GSU A;  2H66 A;  1XOB A;  2WJU A;  5DVB A;  4IBP A;  1TU8 A;  5HFG A;  3J7Y b;  1PRX A;  1ON4 A;  5ECN B;  20GS A;  3F4S A;  2F8F A;  1FB0 A;  2H1A A;  1YF0 A;  2VM2 A;  2O85 A;  5LCZ A;  1XXU A;  2OE0 A;  5DJM A;  1TI1 A;  1NHO A;  2X8H A;  6GSS A;  3M8N A;  3GUR A;  3TRP A;  1ML6 A;  4YAP A;  5J5N A;  4MPF A;  5IMF A;  2V41 A;  5B6M A;  3DEX A;  5ECK B;  3FY7 A;  3C73 A;  3HKR A;  5JCW A;  4FYU A;  2LUS A;  3GKK A;  2DIY A;  1NM3 A;  2K18 A;  1HNB A;  1IYH A;  3NOF A;  1BYE A;  4XS4 B;  1WRY A;  2C0G A;  2A2S A;  2C1Y A;  2DJ2 A;  1JFU A;  3D6I A;  2F9S A;  2D2Z A;  4MF7 A;  3JCM L;  4QQ7 A;  2HXK A;  12GS A;  2R2J A;  3FZ4 A;  4XS6 A;  3H1N A;  2WDU A;  1O8W A;  2HSH A;  1XPV A;  2V32 A;  3ZFB A;  1IYI A;  5A4W A;  3M9K A;  5DJL A;  4F0B A;  1F3B A;  3AY8 A;  4ZBA A;  3I43 A;  2L4C A;  4OCF A;  2F8A A;  4KDY A;  3CMI A;  2LS5 A;  3QFA C;  3ZVJ A;  4DEJ A;  4TOP A;  2PN8 A;  3ERG A;  4NWY A;  2KP1 A;  3EIN A;  4AJ8 A;  3WYW A;  2DML A;  4PQI A;  1OC8 A;  3IA1 A;  2AHE A;  2VIM A;  2J23 A;  2LRN A;  4KSO A;  1GWC A;  3KJY A;  4NHW A;  1XWA A;  2E7P A;  3NIV A;  1DE1 A;  3RAZ A;  2QGV A;  2AB6 A;  4AF2 A;  1E6B A;  1T3B A;  1TTZ A;  3GRX A;  1F2E A;  1HQO A;  3QAG A;  4MDC A;  1MTC A;  1CQG A;  4MZB A;  1X9S B;  5ID2 B;  1XW6 A;  1QQ2 A;  3D0Z A;  2JU5 A;  3MNG A;  5DBQ A;  6GSU A;  1VF2 A;  3TRQ A;  1R4W A;  2C4J A;  2H6Y A;  3G9B A;  3GMF A;  4N10 A;  5E59 A;  4K9Z A;  2MZC A;  3IOS A;  4ID0 A;  2O8V B;  2GZY A;  3D22 A;  1USB A;  1V57 A;  2ON7 A;  1T00 A;  2E2G A;  5G31 A;  1U3A A;  2CX4 A;  3F3R A;  1ST9 A;  3GSS A;  1R5P A;  2YWO A;  2WRT A;  2EC4 A;  3ZIV A;  4O5R A;  3DD3 A;  3ZZX A;  1AAZ A;  3GTU B;  5FHI A;  1MDI A;  5ECL B;  2B1L A;  1J0F A;  3F4T A;  4BVY A;  2C0F A;  1U87 A;  2E0Q A;  2AAW A;  1X5D A;  1YKC A;  1EP7 A;  3Q18 A;  1GTI A;  3HVX A;  4K2D A;  5G1L A;  2XBI A;  2WB9 A;  3F4R A;  2OKA A;  3WT2 A;  2NPB A;  2HNL A;  4TXO B;  1G7E A;  4ZB9 A;  3FW2 A;  2H0I A;  2XBQ A;  4PGT A;  3F0I A;  1B9X C;  1X9W B;  2H0H A;  3DWV A;  4Q5Q A;  1U88 A;  2DIZ A;  1XFL A;  2HZE B;  3GST A;  1ILO A;  4IJ3 A;  1FW1 A;  5IIZ A;  2V6K A;  2H8L A;  3VUR A;  3TRX A;  2N5F A;  5D8I A;  3A2X A;  1UA5 A;  1ERW A;  1YF1 A;  2R5G A;  1B9Y C;  1UN2 A;  4EE0 A;  1XWK A;  2P31 A;  4PQ1 A;  1ZYQ B;  1ZYE A;  3ZIJ A;  1M0U A;  5CYY A;  4GRF A;  1WWJ A;  2FWF A;  4KH7 A;  1K0O A;  2FHE A;  3CSJ A;  1J08 A;  3UMA A;  3LOR A;  4GQF A;  1ZMA A;  9GSS A;  1TRV A;  5EL8 A;  2NBS A;  1VGL A;  3G7I A;  2OAC A;  4HUA A;  2H71 A;  4XRD A;  3KM6 A;  5EY6 A;  3ZRD A;  1DSB A;  1GSQ A;  2GST A;  5DCH A;  3EVI A;  3PGT A;  2H30 A;  2HYX A;  4ZL9 A;  5DCG A;  18GS A;  1QK8 A;  2N5A A;  2VD0 A;  2YZU A;  4HJ2 A;  2OE1 A;  3IPZ A;  1GSY A;  5F0G A;  1QGV A;  3KMN A;  1F3A A;  1AQV A;  3GUS A;  2H73 A;  3DGQ A;  3APS A;  2FWE A;  4I97 A; 
#chains in the Genus database with same CATH topology
 3RPN A;  2WZ9 A;  4WF4 A;  2XPD A;  4KX4 A;  1K0C A;  1PA3 A;  5J3R A;  1SYR A;  3RHC A;  1GLP A;  4PUR A;  5J4U A;  2DJJ A;  2R4V A;  2YZH A;  3UIW A;  4ISD A;  3DKS A;  4GSN A;  2C0E A;  2LJK A;  2K8V A;  3LSZ A;  5DAL B;  2VOC A;  3TKP A;  3TJF A;  2PWJ A;  4Q5R A;  2LEG A;  4P3Y B;  5KN1 A;  1CQH A;  1AC1 A;  4X43 A;  1PX7 A;  3CTG A;  3IV4 A;  5HR1 A;  2PU9 C;  3A2V A;  4A5P A;  4MZC A;  1SJ6 A;  4FIW A;  5DAK B;  2PUK C;  2JZR A;  4ZL7 A;  1G7O A;  2IWT A;  1O85 A;  3FR9 A;  1FVK A;  4XCS A;  1ZOF A;  2B6M A;  5IMV A;  3C8E A;  1AXD A;  1T4Z A;  3P90 A;  4MP4 A;  5C04 A;  4MJA A;  5COH A;  2A4V A;  1A0F A;  5CRD A;  1ZGN A;  5J41 A;  2FA4 A;  4EDY A;  2OA7 A;  2V1M A;  3E0U A;  5H5S A;  3I69 A;  2XC2 A;  1UVZ A;  1XG8 A;  1PN9 A;  4XIH A;  2IFQ B;  1KTE A;  3EPT A;  5CRW A;  5G1K A;  3HDC A;  2K8S A;  1A8L A;  4Z2R A;  2NVL A;  4LMV A;  1S3A A;  2MMO A;  1YDK A;  4Z2T A;  1M9B A;  1GUK A;  1GNW A;  1K0B A;  4O92 A;  4LA1 A;  3RHB A;  3L9V A;  1GSF A;  2NTO A;  2YN1 A;  2YPM A;  4K0G A;  1XVW A;  1PL1 A;  1GL8 A;  4K1F A;  1HNC A;  1EV9 A;  2OBI A;  5EVO A;  1OYJ A;  4HU7 A;  1X5E A;  4K5S A;  3L9U A;  4YQU A;  4IW9 A;  4KSM A;  1XIY A;  4I6X A;  2IN3 A;  3IE3 A;  4POB A;  2YOI A;  1SK1 A;  2GZZ A;  5DDL A;  3TKS E;  1PSQ A;  4MH3 A;  4GF0 A;  4HOJ A;  4XHM A;  2XHF A;  2VLU A;  1SD9 A;  3HJO A;  1O73 A;  4RI6 A;  1Z5Y E;  2H19 A;  4MNN A;  2N5B A;  1JHB A;  1K0A A;  1VF3 A;  1GNE A;  4KDU A;  1QMV A;  2O87 A;  3QAV A;  3IBH A;  2LQQ A;  5F05 A;  3C7M A;  4TR3 A;  1Z7P A;  3F3Q A;  2ZUP A;  3FZ5 A;  2LST A;  3LYP A;  2R37 A;  1GRX A;  3DIE A;  1OE7 A;  2M80 A;  3TJJ A;  5EPF A;  2H1D A;  1SL0 B;  1Z7R A;  4V2M A;  1Y25 A;  4AGS A;  1T8E B;  2EIO A;  1Q4J A;  3UL3 A;  1X9M B;  1WIK A;  1M2A A;  1F9M A;  5ENU A;  3TOU A;  2OBK A;  1YJ6 A;  4CW9 A;  3EE2 A;  2X8C A;  2ES7 A;  3RBT A;  5HFI A;  4D73 B;  2VL9 A;  1T4Y A;  4L0U A;  1M99 A;  2VCW A;  4BL7 A;  1OC3 A;  3FR6 A;  4Z7X A;  4GLT A;  3FEU A;  1R26 A;  2BJX A;  2J9H A;  3SBC A;  3LG6 A;  4IGJ A;  2BTO T;  3IAS 2;  2LKU A;  3QR6 A;  1AIU A;  1GSS A;  2MYG A;  3FK8 A;  4F2I A;  1FG4 A;  4FO5 A;  3MDK A;  3GKX A;  1M2D A;  1BX9 A;  2LQO A;  1XVQ A;  1G6W A;  3QD9 A;  3CYN A;  2VAF A;  3A5W A;  3VWW A;  1JZD A;  3GH6 A;  2JL4 A;  4V2N A;  4X0X A;  1V2A A;  3ZTL A;  4MF6 A;  1VRS D;  2CQ9 A;  2DLX A;  4MMM A;  5IQY A;  2LTK A;  1PKZ A;  2B5X A;  5G30 A;  2VLV A;  2A2R A;  5ECM B;  4JZQ A;  5CAX A;  1GH2 A;  1W89 A;  3A5I A;  4IS0 A;  1EEJ A;  1Z3E A;  3ZML A;  4O32 A;  4V1A g;  4ML6 A;  5GAN D;  1OKT A;  3GX0 A;  2YWM A;  2CX3 A;  1ACV A;  1RQM A;  1B48 A;  3G7Y A;  3EUR A;  5CRH A;  4POK A;  4KCE A;  3FMW A;  1T7P B;  4KAE A;  3HHV A;  1SD8 A;  2WFC A;  1KBN A;  3BBY A;  4K7N A;  5A5K A;  1X0R A;  2C80 A;  3EMX A;  2Z9S A;  1JLV A;  5HQP A;  2YWN A;  1WP0 A;  4N11 A;  3GV1 A;  2B7J A;  1U6T A;  3F6F A;  3PH9 A;  4E8E A;  5GAP D;  3LJR A;  1V98 A;  4AJ7 A;  4WET A;  5ID2 A;  2GSS A;  1PKW A;  4GST A;  1M9A A;  2EIQ A;  1EGO A;  4TW5 A;  1SKW B;  5HFK A;  2DMM A;  14GS A;  1PL2 A;  4PUF C;  3H8Q A;  1PQN A;  1H4O A;  3UBK A;  4YAV A;  1PFO A;  4MF5 A;  2VCV A;  3MSZ A;  3UJ1 A;  3KD0 A;  4KW6 A;  4XS1 A;  3KP8 A;  5KOW A;  3W6G A;  1LJR A;  2B5E A;  5H5Q A;  3LWA A;  4EO3 A;  4PNG A;  4I2T A;  3GTU A;  1B4Q A;  2QA2 A;  4WBR D;  2DKI A;  4G10 A;  1F37 A;  3ZYW A;  2VD1 A;  3EU4 A;  4OFN A;  1ZYN A;  1WOU A;  2JAD A;  2RUF A;  4BVX B;  1AW9 A;  3MIX A;  4KCA A;  3DML A;  1SU9 A;  5B8B A;  4TN8 A;  4HJM A;  3VPT A;  5H5R A;  3APO A;  3DVX A;  4IQA A;  3WGE A;  3IHQ A;  1LU4 A;  2ZCT A;  3VPQ A;  2L5L A;  3NZN A;  3VI7 A;  3O3T A;  1GTA A;  3ERF A;  3CXG A;  2I1U A;  3L78 A;  4NHZ A;  4OCE A;  2IMI A;  2HZE A;  5IMA A;  1URM A;  22GS A;  1TOF A;  4IN0 A;  3ZLP A;  3GIX A;  2V6O A;  3CBU A;  4Q5N A;  2HLS A;  1ZYP A;  2YP6 A;  4X4J A;  1BJX A;  4QL7 A;  4OD7 A;  4PQH A;  5IOX A;  1SKR B;  2DJK A;  5KN0 A;  2EIR A;  3VLN A;  5ECQ B;  3LQ7 A;  1PN0 A;  2H72 A;  3KTL A;  1FB6 A;  2I9H A;  4FQU A;  5GZZ B;  4TR4 A;  1YQ1 A;  2YV9 A;  4MJE A;  4O7H A;  2GQL A;  2WCI A;  1A24 A;  1S3C A;  3KZQ A;  1GSE A;  3TKR A;  6GST A;  3ZFL A;  4EDZ A;  2KOK A;  4NMU A;  2YAN A;  4K6X A;  4TXV A;  2B1K A;  5JWR B;  5B6N A;  1FVJ A;  3M9J A;  2X64 A;  4L8E A;  7GSS A;  2IME A;  4PTS A;  3QFB C;  1ZL9 A;  5CP1 A;  2RM5 A;  4GTU A;  5KEJ A;  3HXS A;  2TRX A;  4N30 A;  2RLI A;  2PER A;  4O5Q A;  2PPT A;  2WS2 A;  3FRC A;  3GYK A;  2DKH A;  4GQC A;  2F51 A;  4ECI A;  3SWL A;  3UVH A;  3LXZ A;  2E2M A;  1XBS A;  2B7K A;  2YV7 A;  1OE8 A;  2JSY A;  2CVK A;  2XPE A;  2DSA A;  3R2Q A;  1YKA A;  3F63 A;  4G0I A;  1TJD A;  4JR6 A;  3FR3 A;  1XW9 A;  5G5F A;  5DQY A;  1SL1 B;  2R0G A;  2H6X A;  5KN2 A;  2FY6 A;  2P5Q A;  3FHK A;  3U6V A;  4ZIJ A;  3M0F A;  3HZ8 A;  1XWC A;  3IDV A;  4IP6 A;  3LEF A;  4K5R A;  4EIP A;  3FZ9 A;  4O5U A;  2FNO A;  1M7T A;  4K0N A;  1FOH A;  2C3N A;  3UEM A;  1HNA A;  4TRX A;  4EC0 A;  2IMK A;  5DAK A;  1DE2 A;  1ERU A;  4TR1 B;  2CAI A;  2X8G A;  1EGR A;  2YJH A;  5D9V A;  1Z9H A;  1XW5 A;  4L5L A;  1G6Y A;  1V9W A;  4L0W A;  3O76 A;  10GS A;  3GA4 A;  3KCM A;  5IM9 A;  5ECS A;  2R3X A;  5JCG A;  1NW2 A;  4GWR A;  2F3M A;  2DJ3 A;  5CRG A;  3GH9 A;  5LNK e;  1S3R A;  5IO2 A;  3UBL A;  1OC9 B;  5AN1 A;  4CHS A;  1TW9 A;  2HZF A;  4QL9 A;  2IFQ A;  2YCD A;  4IQ1 A;  1R7H A;  4KB3 A;  1O7U A;  3H79 A;  5CRE A;  4MJC A;  2VUP A;  1EZK A;  1TDI A;  2R6K A;  2VCZ A;  2H0G A;  2B5Y A;  2TRC P;  3P7X A;  1SK2 A;  3OR5 A;  1E2Y A;  3APQ A;  2GVP A;  6GSY A;  3UOM A;  3I6A A;  1EP8 A;  2HI7 A;  4Z2U A;  4TR0 A;  3DXB A;  1YZX A;  4MAB A;  3WD6 A;  2RII A;  2FLS A;  2MBS A;  4HZ4 A;  2HSY A;  1TU7 A;  1WJK A;  3WGD A;  1TRS A;  1MD4 A;  2H01 A;  4ECJ A;  4JR4 A;  3HA9 A;  6GSX A;  1HD2 A;  3O6T A;  2AUV A;  2LNS A;  5INY A;  3IAM 2;  4V2L A;  4F03 A;  1Y6E A;  4N0Z A;  3KXO A;  5G5E A;  4HI7 A;  1K3O A;  4ML1 A;  2GQM A;  2L59 A;  3MAK A;  1FOV A;  2PGT A;  3DVW A;  4BIK A;  2CZ2 A;  1BAY A;  2PBJ A;  1FAA A;  3F6D A;  1EOH A;  4L5O A;  4ECB A;  4IHU A;  3Q19 A;  2H6Z A;  3KGK A;  3PIN A;  5IPG A;  2FA8 A;  5C00 A;  2I4A A;  1M2B A;  5D9W A;  4WR5 A;  2GLR A;  1TXX A;  3BOA A;  4OFM A;  5AGY A;  1U3I A;  5L71 A;  3WT1 A;  2LV3 A;  4BWQ A;  4D73 A;  1SK0 A;  2ZNM A;  2L5O A;  4OMV A;  1H75 A;  3HY2 A;  1GTB A;  4KDX A;  3ME8 A;  1OVN A;  4WF5 A;  1TI3 A;  4RQR A;  2AYT A;  1XWG A;  1JZO A;  3CSH A;  2HT9 A;  3IK7 A;  5AIV A;  2YNX A;  2FGX A;  3GL5 A;  4OO4 A;  2WGR A;  3VWV A;  3DRN A;  3HCZ A;  2QC7 A;  4ZBB A;  3E3E A;  1PGT A;  1O6J A;  4MPG A;  1EV4 A;  5FWG A;  1K3L A;  5HR0 A;  3GL3 A;  2FUG 2;  3I9V 2;  4PNF A;  3FKF A;  2DJ0 A;  4NV5 A;  4TVE A;  2KHP A;  2LJR A;  5ECO B;  3KP9 A;  5B8A A;  2K6V A;  4G19 A;  1EEM A;  4CY6 A;  1Z6N A;  3M3M A;  1V58 A;  2HFD A;  4G0L A;  2CV4 A;  5IMD A;  3GHA A;  4ZXG A;  4XS4 A;  3VWX A;  5D9X A;  4ECC A;  4J57 E;  4EL1 A;  2GGT A;  4HQS A;  1R5A A;  4HEA 2;  2IL3 A;  4EIQ A;  4CDO A;  1MEK A;  2PVO C;  3TKS A;  2H76 A;  2GSR A;  6GSV A;  3C71 A;  3TKQ A;  2IPA A;  3W8J A;  5CO3 A;  3QPM A;  4FYC A;  2H75 A;  1X5C A;  3J7Y k;  2HRK A;  2FCH A;  5GST A;  4I8B A;  3GKN A;  4RI7 A;  3TKS C;  4EVM A;  1ABA A;  5KN3 A;  4DSS B;  3F9U A;  1K0N A;  2TIR A;  1FHE A;  1A2M A;  1BQ7 A;  2GQK A;  2IIY A;  4Q5F A;  4TKY A;  1EOG A;  2GZP A;  2A2P A;  2C3Q A;  3N9J A;  4IP1 A;  1QXH A;  1XWB A;  4RQX A;  4HQZ A;  3MYD A;  4KE3 A;  2PVQ A;  2HRF A;  2DBC A;  4EKZ A;  3C1R A;  5AIS A;  4WKW A;  2WUL A;  2VCX A;  3ZL5 A;  1THX A;  5DQS A;  4FYB A;  4GSS A;  3TJB A;  4BA7 A;  3QOU A;  4I5Q A;  5D93 A;  1A23 A;  2L6C A;  4ZL8 A;  1LBK A;  4BVX A;  5KOX A;  2O89 A;  3D4M A;  3US3 A;  3DYR A;  3GN3 A;  2VO4 A;  1F6M C;  2ON5 A;  5G2Z A;  4GCI A;  1Q98 A;  5HR3 A;  2VCQ A;  8GSS A;  3QDN A;  2OAD A;  3HJM A;  4OFT A;  2LNT A;  5CNW A;  1B8X A;  1J9B A;  3EU3 A;  1GTU A;  3G7J A;  2G2Q A;  2H1G A;  5FT3 A;  1V40 A;  2RM6 A;  3TDG A;  2H74 A;  4J56 E;  5ELA A;  4ILF A;  1AQX A;  3TJG A;  3ZRE A;  1B4P A;  4ZBD A;  2M72 A;  3VWU A;  1ZCP A;  3LFL A;  3FZA A;  5ECH B;  1TRW A;  3IHG A;  1JZW A;  2H70 A;  4F9Z A;  3ED3 A;  2GDR A;  3HYP A;  4TXO A;  3LYK A;  1PX6 A;  1O81 A;  5J9C A;  1MDK A;  4IKH A;  4HZ2 A;  4JBB A;  3TUE A;  3V1W A;  1MD3 A;  4WBJ A;  3L4N A;  2X4A A;  3PR8 A;  2OE3 A;  4K7O A;  3D5J A;  3QCP A;  2NDO A;  2MMN A;  3HVS A;  5AIX A;  3GKM A;  3GX8 A;  2FWH A;  1AUC A;  4ULX A;  3FYG A;  3IRA A;  3EC3 A;  1DBY A;  1I9D A;  4EF0 A;  4RUV A;  19GS A;  4YH2 A;  4OWY A;  5F8B A;  4X1U A;  1A0R P;  3HD5 A;  1SEN A;  1O8X A;  1SL2 B;  2IMD A;  3U5R E;  5F06 A;  4HU9 A;  2GSQ A;  4CY8 A;  3EMP A;  1JZR A;  2VM1 A;  1WMJ A;  1GUL A;  1GUM A;  4BPY A;  4HS1 A;  1OKD A;  1TP9 A;  2VL2 A;  4G2E A;  2AV4 A;  2IJY A;  2AJQ B;  3VK9 A;  1BED A;  3LXT A;  1UC7 A;  1K0D A;  4ACS A;  3KTB A;  3ISO A;  4MJB A;  1THO A;  2DJ1 A;  2CZ3 A;  2HE3 A;  4OO5 A;  2YJ7 A;  4KA0 A;  2VL2 C;  4POL A;  3BCI A;  1SJI A;  3HJP A;  5E4W A;  1W4V A;  3EWL A;  2O7K A;  1A2L A;  4YQV A;  1Z6M A;  2I81 A;  4WXT A;  2X99 A;  5IOW A;  1N2A A;  4TR1 A;  1XZO A;  4BVY B;  2JSZ A;  3C1S A;  5IMZ A;  4E8H A;  4DSQ A;  4NXI A;  4MA9 A;  5IMC A;  4IVF A;  4G9H A;  2OJL A;  1NSW A;  5A4V A;  5ELG A;  4JE1 A;  4MLY A;  3E9J B;  3P2A A;  1FO5 A;  3P8W A;  1DUG A;  2JAC A;  4FH8 A;  4ZB6 A;  2B3S A;  1VF1 A;  5ECR B;  4KND A;  1OC9 A;  5DAL A;  5GSS A;  1YEP A;  5B7C A;  5ABR A;  2L57 A;  2CAQ A;  1K0M A;  3L0H A;  2V2G A;  1RW1 A;  3BD2 A;  3QMX A;  3HVV A;  3TGZ A;  2L4Q A;  2CVD A;  2HRN A;  2C8U A;  1VF4 A;  3K8N A;  2REM A;  1C72 A;  1ERT A;  2YWI A;  4YQM A;  4J2F A;  2DC5 A;  1MDJ A;  4EXJ A;  5JWQ B;  1GP1 A;  3IR4 A;  4LL1 B;  3N5O A;  11GS A;  2MMA A;  1KEB A;  4IEL A;  2PMT A;  3TB2 A;  3TJK A;  2R0C A;  4ZIL A;  1GLQ A;  3HZ4 A;  4DSR A;  3GNJ A;  3R3E A;  3CTF A;  1TRU A;  1PMT A;  4PXO A;  4K7I A;  1N8J A;  1ERV A;  1WPI A;  2LJA A;  2VCT A;  3CRT A;  1YY7 A;  5F07 A;  1NHY A;  4I2U A;  2FD3 A;  4HDE A;  2LRT A;  4MZW A;  4NV2 A;  3L9S A;  3Q6O A;  1PD2 1;  3RDW A;  4K2X A;  1WE0 A;  2CVB A;  1A8Y A;  4GXZ A;  2UZ8 A;  4F0C A;  3D4T A;  4LMW A;  3RPP A;  3KH7 A;  2MMZ A;  3VFI A;  2VLT A;  4WEY A;  5J9B A;  1M3I A;  4NAX A;  5JCU A;  3KH9 A;  3TOT A;  5LD0 A;  1AQW A;  2QA1 A;  4LLR A;  2K9F A;  2KP2 A;  3IXR A;  5D9T A;  5IO0 A;  2KUC A;  5A4U A;  3IC8 A;  1GUH A;  4KUN A;  2FWG A;  3VI5 A;  3ZVJ D;  2HRA A;  3ZMK A;  4H86 A;  5D73 A;  2KLX A;  4MK3 A;  4K8M A;  3KMO A;  2I3Y A;  2GS3 A;  5HR2 A;  3H4K A;  2IMF A;  1EWX A;  1I5G A;  13GS A;  2ALB A;  2RUE A;  5JWO B;  3F8U A;  1SYX A;  2GT5 A;  3ZIT A;  4LL4 B;  4KF9 A;  2CT6 A;  3BCK A;  3H93 A;  2CA8 A;  2A4H A;  1JLW A;  3EYT A;  1G0T A;  3UAP A;  3ERW A;  4JRR A;  2GT6 A;  3WGX A;  4XRA A;  2LRC A;  4MH2 A;  2L6D A;  3LGC A;  3Q74 A;  3UVT A;  5BMU A;  4DVC A;  3S9F A;  3GFK A;  1K3Y A;  4BWS A;  2VL3 A;  2GTU A;  3CSI A;  1T1V A;  4IJI A;  6GSW A;  4MCU A;  3IK9 A;  3M1G A;  3QAW A;  3W8S A;  3ME7 A;  4EUY A;  1S3D A;  1SJZ A;  1RK4 A;  2P5R A;  3A3T A;  1TK0 B;  4V1A p;  1KNG A;  5ECI B;  2P0G A;  3IC4 A;  2QKE A;  17GS A;  2BMX A;  1XCC A;  1YEX A;  4KGI A;  1HYU A;  2C3T A;  4JU5 A;  2QSI A;  2C0D A;  1A2J A;  3KIJ A;  4POM A;  2MBT A;  1TK5 B;  4F82 A;  1TKD B;  3MWH A;  3A2W A;  3BJ5 A;  4JED A;  4XTS A;  3UAR A;  5IPH A;  1ZZY A;  1QFN A;  1OAZ A;  4AJ6 A;  1TK8 B;  1BG5 A;  4ZB8 A;  4N0V A;  3D21 A;  2G0F A;  1GSD A;  1QUW A;  2H1B A;  3TCO A;  4PUA A;  2M46 A;  4WR4 A;  3KEB A;  4NPB A;  1XOA A;  5ECP B;  4PX1 A;  5D96 A;  4YKF A;  4DSS A;  2JZT A;  1SKS B;  3CRU A;  2JZS A;  16GS A;  1GSU A;  2H66 A;  1XOB A;  2WJU A;  5DVB A;  4IBP A;  1TU8 A;  5HFG A;  3CQF A;  3J7Y b;  1PRX A;  1ON4 A;  5ECN B;  20GS A;  3F4S A;  2F8F A;  1FB0 A;  2H1A A;  1YF0 A;  2VM2 A;  2O85 A;  5LCZ A;  1XXU A;  2OE0 A;  5DJM A;  1TI1 A;  1NHO A;  2X8H A;  6GSS A;  3M8N A;  3GUR A;  3TRP A;  1ML6 A;  4YAP A;  5J5N A;  4MPF A;  2R0P A;  5IMF A;  2V41 A;  4BL7 B;  3DEX A;  5ECK B;  5B6M A;  3FY7 A;  3C73 A;  3HKR A;  3PPU A;  5JCW A;  4FYU A;  2LUS A;  3GKK A;  2DIY A;  1NM3 A;  2K18 A;  1HNB A;  1IYH A;  3NOF A;  1BYE A;  4ICY A;  4XS4 B;  1WRY A;  2C0G A;  2A2S A;  2C1Y A;  2DJ2 A;  1JFU A;  3D6I A;  2F9S A;  2D2Z A;  4MF7 A;  3JCM L;  4QQ7 A;  2HXK A;  12GS A;  2R2J A;  3FZ4 A;  4XS6 A;  3H1N A;  2WDU A;  1O8W A;  2HSH A;  5BRT A;  1XPV A;  2V32 A;  3ZFB A;  1IYI A;  5A4W A;  3M9K A;  5DJL A;  4F0B A;  1F3B A;  3AY8 A;  4ZBA A;  3I43 A;  2L4C A;  4OCF A;  2F8A A;  4KDY A;  3CMI A;  2LS5 A;  3QFA C;  3ZVJ A;  4DEJ A;  4TOP A;  2PN8 A;  3ERG A;  4NWY A;  2KP1 A;  3EIN A;  4AJ8 A;  3WYW A;  2DML A;  4PQI A;  1OC8 A;  3IA1 A;  2AHE A;  2VIM A;  2J23 A;  2LRN A;  4KSO A;  1GWC A;  4YKG A;  3KJY A;  4NHW A;  1XWA A;  2E7P A;  3NIV A;  1DE1 A;  3RAZ A;  2QGV A;  2AB6 A;  4AF2 A;  1E6B A;  1T3B A;  1TTZ A;  3GRX A;  1F2E A;  1HQO A;  3QAG A;  4MDC A;  1MTC A;  1CQG A;  4MZB A;  1X9S B;  5ID2 B;  1XW6 A;  1QQ2 A;  3D0Z A;  2JU5 A;  3MNG A;  5DBQ A;  6GSU A;  1VF2 A;  3TRQ A;  1R4W A;  2C4J A;  2H6Y A;  3G9B A;  3GMF A;  4N10 A;  5E59 A;  2HSM A;  4K9Z A;  2MZC A;  3IOS A;  3LW9 A;  4ID0 A;  1M3J A;  2O8V B;  2GZY A;  3D22 A;  1USB A;  1V57 A;  2ON7 A;  1T00 A;  2E2G A;  5G31 A;  1U3A A;  2CX4 A;  3F3R A;  1ST9 A;  3GSS A;  1R5P A;  2YWO A;  2WRT A;  2EC4 A;  3ZIV A;  4O5R A;  3DD3 A;  3ZZX A;  1AAZ A;  3GTU B;  5FHI A;  1MDI A;  5ECL B;  2B1L A;  1J0F A;  3F4T A;  4BVY A;  2C0F A;  1U87 A;  2E0Q A;  2AAW A;  1X5D A;  1YKC A;  1EP7 A;  3Q18 A;  1GTI A;  3HVX A;  4K2D A;  5G1L A;  2XBI A;  2WB9 A;  3F4R A;  2OKA A;  3WT2 A;  2NPB A;  2HNL A;  4TXO B;  1G7E A;  4ZB9 A;  4USS A;  3FW2 A;  2H0I A;  2XBQ A;  4PGT A;  3F0I A;  1B9X C;  1X9W B;  2H0H A;  3DWV A;  4Q5Q A;  1U88 A;  2DIZ A;  1XFL A;  2HZE B;  3GST A;  1ILO A;  4IJ3 A;  1FW1 A;  5IIZ A;  2V6K A;  2H8L A;  3VUR A;  3TRX A;  2N5F A;  3HVN A;  5D8I A;  3A2X A;  4G0K A;  1UA5 A;  1ERW A;  1YF1 A;  2R5G A;  1B9Y C;  1UN2 A;  4EE0 A;  1XWK A;  2P31 A;  4PQ1 A;  1ZYQ B;  1ZYE A;  3ZIJ A;  1M0U A;  5CYY A;  4GRF A;  1WWJ A;  2FWF A;  4KH7 A;  1K0O A;  2FHE A;  3CSJ A;  1J08 A;  3UMA A;  3LOR A;  4GQF A;  1ZMA A;  9GSS A;  1TRV A;  5EL8 A;  2NBS A;  1VGL A;  3G7I A;  2OAC A;  4HUA A;  2H71 A;  4XRD A;  3KM6 A;  5EY6 A;  3ZRD A;  4HSC X;  2X49 A;  1DSB A;  1GSQ A;  2GST A;  5DCH A;  3EVI A;  3PGT A;  2H30 A;  2HYX A;  4ZL9 A;  5DCG A;  18GS A;  1QK8 A;  2N5A A;  2VD0 A;  2YZU A;  4HJ2 A;  2OE1 A;  3IPZ A;  1GSY A;  5F0G A;  1QGV A;  3KMN A;  1F3A A;  1AQV A;  3GUS A;  2H73 A;  3DGQ A;  3APS A;  2FWE A;  4I97 A; 
#chains in the Genus database with same CATH homology
 3RPN A;  2WZ9 A;  4WF4 A;  2XPD A;  4KX4 A;  1K0C A;  1PA3 A;  5J3R A;  1SYR A;  3RHC A;  1GLP A;  4PUR A;  5J4U A;  2DJJ A;  2R4V A;  2YZH A;  3UIW A;  4ISD A;  3DKS A;  4GSN A;  2C0E A;  2LJK A;  2K8V A;  3LSZ A;  5DAL B;  2VOC A;  3TKP A;  3TJF A;  2PWJ A;  4Q5R A;  2LEG A;  4P3Y B;  5KN1 A;  1CQH A;  1AC1 A;  4X43 A;  1PX7 A;  3CTG A;  3IV4 A;  5HR1 A;  2PU9 C;  3A2V A;  4A5P A;  4MZC A;  1SJ6 A;  4FIW A;  5DAK B;  2PUK C;  2JZR A;  4ZL7 A;  1G7O A;  2IWT A;  1O85 A;  3FR9 A;  1FVK A;  4XCS A;  1ZOF A;  2B6M A;  5IMV A;  3C8E A;  1AXD A;  1T4Z A;  3P90 A;  4MP4 A;  5C04 A;  4MJA A;  5COH A;  2A4V A;  1A0F A;  5CRD A;  1ZGN A;  5J41 A;  2FA4 A;  4EDY A;  2OA7 A;  2V1M A;  3E0U A;  5H5S A;  3I69 A;  2XC2 A;  1UVZ A;  1PN9 A;  4XIH A;  2IFQ B;  1KTE A;  3EPT A;  5CRW A;  5G1K A;  3HDC A;  2K8S A;  1A8L A;  4Z2R A;  2NVL A;  4LMV A;  1S3A A;  2MMO A;  1YDK A;  4Z2T A;  1M9B A;  1GUK A;  1GNW A;  1K0B A;  4O92 A;  4LA1 A;  3RHB A;  3L9V A;  1GSF A;  2NTO A;  2YN1 A;  2YPM A;  4K0G A;  1XVW A;  1PL1 A;  1GL8 A;  4K1F A;  1HNC A;  1EV9 A;  2OBI A;  5EVO A;  1OYJ A;  4HU7 A;  1X5E A;  4K5S A;  3L9U A;  4YQU A;  4IW9 A;  4KSM A;  1XIY A;  4I6X A;  2IN3 A;  3IE3 A;  4POB A;  2YOI A;  1SK1 A;  2GZZ A;  5DDL A;  3TKS E;  1PSQ A;  4MH3 A;  4GF0 A;  4HOJ A;  4XHM A;  2XHF A;  2VLU A;  1SD9 A;  3HJO A;  1O73 A;  4RI6 A;  1Z5Y E;  2H19 A;  4MNN A;  2N5B A;  1JHB A;  1K0A A;  1VF3 A;  1GNE A;  4KDU A;  1QMV A;  2O87 A;  3QAV A;  3IBH A;  2LQQ A;  5F05 A;  3C7M A;  4TR3 A;  1Z7P A;  3F3Q A;  2ZUP A;  3FZ5 A;  2LST A;  3LYP A;  2R37 A;  1GRX A;  3DIE A;  1OE7 A;  2M80 A;  3TJJ A;  5EPF A;  2H1D A;  1SL0 B;  1Z7R A;  4V2M A;  1Y25 A;  4AGS A;  1T8E B;  2EIO A;  1Q4J A;  3UL3 A;  1X9M B;  1WIK A;  1M2A A;  1F9M A;  5ENU A;  3TOU A;  2OBK A;  1YJ6 A;  4CW9 A;  3EE2 A;  2X8C A;  2ES7 A;  3RBT A;  5HFI A;  4D73 B;  2VL9 A;  1T4Y A;  4L0U A;  1M99 A;  2VCW A;  4BL7 A;  1OC3 A;  3FR6 A;  4Z7X A;  4GLT A;  3FEU A;  1R26 A;  2BJX A;  2J9H A;  3SBC A;  3LG6 A;  4IGJ A;  2BTO T;  3IAS 2;  2LKU A;  3QR6 A;  1AIU A;  1GSS A;  2MYG A;  3FK8 A;  4F2I A;  1FG4 A;  4FO5 A;  3MDK A;  3GKX A;  1M2D A;  1BX9 A;  2LQO A;  1XVQ A;  1G6W A;  3QD9 A;  3CYN A;  2VAF A;  3A5W A;  3VWW A;  1JZD A;  3GH6 A;  2JL4 A;  4V2N A;  4X0X A;  1V2A A;  3ZTL A;  4MF6 A;  1VRS D;  2CQ9 A;  2DLX A;  4MMM A;  5IQY A;  2LTK A;  1PKZ A;  2B5X A;  5G30 A;  2VLV A;  2A2R A;  5ECM B;  4JZQ A;  5CAX A;  1GH2 A;  1W89 A;  3A5I A;  4IS0 A;  1EEJ A;  1Z3E A;  3ZML A;  4O32 A;  4V1A g;  4ML6 A;  5GAN D;  1OKT A;  3GX0 A;  2YWM A;  2CX3 A;  1ACV A;  1RQM A;  1B48 A;  3G7Y A;  3EUR A;  5CRH A;  4POK A;  4KCE A;  3FMW A;  1T7P B;  4KAE A;  3HHV A;  1SD8 A;  2WFC A;  1KBN A;  3BBY A;  4K7N A;  5A5K A;  1X0R A;  2C80 A;  3EMX A;  2Z9S A;  1JLV A;  5HQP A;  2YWN A;  1WP0 A;  4N11 A;  3GV1 A;  2B7J A;  1U6T A;  3F6F A;  3PH9 A;  4E8E A;  5GAP D;  3LJR A;  1V98 A;  4AJ7 A;  4WET A;  5ID2 A;  2GSS A;  1PKW A;  4GST A;  1M9A A;  2EIQ A;  1EGO A;  4TW5 A;  1SKW B;  5HFK A;  2DMM A;  14GS A;  1PL2 A;  4PUF C;  3H8Q A;  1PQN A;  1H4O A;  3UBK A;  4YAV A;  4MF5 A;  2VCV A;  3MSZ A;  3UJ1 A;  3KD0 A;  4KW6 A;  4XS1 A;  3KP8 A;  5KOW A;  3W6G A;  1LJR A;  2B5E A;  5H5Q A;  3LWA A;  4EO3 A;  4PNG A;  4I2T A;  3GTU A;  1B4Q A;  2QA2 A;  4WBR D;  2DKI A;  4G10 A;  1F37 A;  3ZYW A;  2VD1 A;  3EU4 A;  4OFN A;  1ZYN A;  1WOU A;  2JAD A;  2RUF A;  4BVX B;  1AW9 A;  3MIX A;  4KCA A;  3DML A;  1SU9 A;  5B8B A;  4TN8 A;  4HJM A;  3VPT A;  5H5R A;  3APO A;  3DVX A;  4IQA A;  3WGE A;  3IHQ A;  1LU4 A;  2ZCT A;  3VPQ A;  2L5L A;  3NZN A;  3VI7 A;  3O3T A;  1GTA A;  3ERF A;  3CXG A;  2I1U A;  3L78 A;  4NHZ A;  4OCE A;  2IMI A;  2HZE A;  5IMA A;  1URM A;  22GS A;  1TOF A;  4IN0 A;  3ZLP A;  3GIX A;  2V6O A;  3CBU A;  4Q5N A;  2HLS A;  1ZYP A;  2YP6 A;  4X4J A;  1BJX A;  4QL7 A;  4OD7 A;  4PQH A;  5IOX A;  1SKR B;  2DJK A;  5KN0 A;  2EIR A;  3VLN A;  5ECQ B;  3LQ7 A;  1PN0 A;  2H72 A;  3KTL A;  1FB6 A;  2I9H A;  4FQU A;  5GZZ B;  4TR4 A;  1YQ1 A;  2YV9 A;  4MJE A;  4O7H A;  2GQL A;  2WCI A;  1A24 A;  1S3C A;  3KZQ A;  1GSE A;  3TKR A;  6GST A;  3ZFL A;  4EDZ A;  2KOK A;  4NMU A;  2YAN A;  4K6X A;  4TXV A;  2B1K A;  5JWR B;  5B6N A;  1FVJ A;  3M9J A;  2X64 A;  4L8E A;  7GSS A;  2IME A;  4PTS A;  3QFB C;  1ZL9 A;  5CP1 A;  2RM5 A;  4GTU A;  5KEJ A;  3HXS A;  2TRX A;  4N30 A;  2RLI A;  2PER A;  4O5Q A;  2PPT A;  2WS2 A;  3FRC A;  3GYK A;  2DKH A;  4GQC A;  2F51 A;  4ECI A;  3SWL A;  3UVH A;  3LXZ A;  2E2M A;  1XBS A;  2B7K A;  2YV7 A;  1OE8 A;  2JSY A;  2CVK A;  2XPE A;  2DSA A;  3R2Q A;  1YKA A;  3F63 A;  4G0I A;  1TJD A;  4JR6 A;  3FR3 A;  1XW9 A;  5G5F A;  5DQY A;  1SL1 B;  2R0G A;  2H6X A;  5KN2 A;  2FY6 A;  2P5Q A;  3FHK A;  3U6V A;  4ZIJ A;  3M0F A;  3HZ8 A;  1XWC A;  3IDV A;  4IP6 A;  3LEF A;  4K5R A;  4EIP A;  3FZ9 A;  4O5U A;  2FNO A;  1M7T A;  4K0N A;  1FOH A;  2C3N A;  3UEM A;  1HNA A;  4TRX A;  4EC0 A;  2IMK A;  5DAK A;  1DE2 A;  1ERU A;  4TR1 B;  2CAI A;  2X8G A;  1EGR A;  2YJH A;  5D9V A;  1Z9H A;  1XW5 A;  4L5L A;  1G6Y A;  1V9W A;  4L0W A;  3O76 A;  10GS A;  3GA4 A;  3KCM A;  5IM9 A;  5ECS A;  2R3X A;  5JCG A;  1NW2 A;  4GWR A;  2F3M A;  2DJ3 A;  5CRG A;  3GH9 A;  5LNK e;  5IO2 A;  3UBL A;  1OC9 B;  5AN1 A;  4CHS A;  1TW9 A;  2HZF A;  4QL9 A;  2IFQ A;  2YCD A;  4IQ1 A;  1R7H A;  4KB3 A;  1O7U A;  3H79 A;  5CRE A;  4MJC A;  2VUP A;  1EZK A;  1TDI A;  2R6K A;  2VCZ A;  2H0G A;  2B5Y A;  2TRC P;  3P7X A;  1SK2 A;  3OR5 A;  1E2Y A;  3APQ A;  2GVP A;  6GSY A;  3UOM A;  3I6A A;  1EP8 A;  2HI7 A;  4Z2U A;  4TR0 A;  3DXB A;  1YZX A;  4MAB A;  3WD6 A;  2RII A;  2FLS A;  2MBS A;  4HZ4 A;  2HSY A;  1TU7 A;  1WJK A;  3WGD A;  1TRS A;  1MD4 A;  2H01 A;  4ECJ A;  4JR4 A;  3HA9 A;  6GSX A;  1HD2 A;  3O6T A;  2AUV A;  2LNS A;  5INY A;  3IAM 2;  4V2L A;  4F03 A;  1Y6E A;  4N0Z A;  3KXO A;  5G5E A;  4HI7 A;  1K3O A;  4ML1 A;  2GQM A;  2L59 A;  3MAK A;  1FOV A;  2PGT A;  3DVW A;  2CZ2 A;  1BAY A;  2PBJ A;  1FAA A;  3F6D A;  1EOH A;  4L5O A;  4ECB A;  4IHU A;  3Q19 A;  2H6Z A;  3KGK A;  3PIN A;  5IPG A;  2FA8 A;  5C00 A;  2I4A A;  1M2B A;  5D9W A;  4WR5 A;  2GLR A;  1TXX A;  3BOA A;  4OFM A;  5AGY A;  1U3I A;  5L71 A;  3WT1 A;  2LV3 A;  4BWQ A;  4D73 A;  1SK0 A;  2ZNM A;  2L5O A;  4OMV A;  1H75 A;  3HY2 A;  1GTB A;  4KDX A;  3ME8 A;  1OVN A;  4WF5 A;  1TI3 A;  4RQR A;  2AYT A;  1XWG A;  1JZO A;  3CSH A;  2HT9 A;  3IK7 A;  5AIV A;  2YNX A;  2FGX A;  3GL5 A;  4OO4 A;  2WGR A;  3VWV A;  3DRN A;  3HCZ A;  2QC7 A;  4ZBB A;  3E3E A;  1PGT A;  1O6J A;  4MPG A;  1EV4 A;  5FWG A;  1K3L A;  5HR0 A;  3GL3 A;  2FUG 2;  3I9V 2;  4PNF A;  3FKF A;  2DJ0 A;  4NV5 A;  4TVE A;  2KHP A;  2LJR A;  5ECO B;  3KP9 A;  5B8A A;  2K6V A;  4G19 A;  1EEM A;  4CY6 A;  1Z6N A;  3M3M A;  1V58 A;  2HFD A;  4G0L A;  2CV4 A;  5IMD A;  3GHA A;  4ZXG A;  4XS4 A;  3VWX A;  5D9X A;  4ECC A;  4J57 E;  4EL1 A;  2GGT A;  4HQS A;  1R5A A;  4HEA 2;  2IL3 A;  4EIQ A;  4CDO A;  1MEK A;  2PVO C;  3TKS A;  2H76 A;  2GSR A;  6GSV A;  3C71 A;  3TKQ A;  2IPA A;  3W8J A;  5CO3 A;  3QPM A;  4FYC A;  2H75 A;  1X5C A;  3J7Y k;  2HRK A;  2FCH A;  5GST A;  4I8B A;  3GKN A;  4RI7 A;  3TKS C;  4EVM A;  1ABA A;  5KN3 A;  4DSS B;  3F9U A;  1K0N A;  2TIR A;  1FHE A;  1A2M A;  1BQ7 A;  2GQK A;  2IIY A;  4Q5F A;  4TKY A;  1EOG A;  2GZP A;  2A2P A;  2C3Q A;  3N9J A;  4IP1 A;  1QXH A;  1XWB A;  4RQX A;  4HQZ A;  3MYD A;  4KE3 A;  2PVQ A;  2HRF A;  2DBC A;  4EKZ A;  3C1R A;  5AIS A;  4WKW A;  2WUL A;  2VCX A;  3ZL5 A;  1THX A;  5DQS A;  4FYB A;  4GSS A;  3TJB A;  4BA7 A;  3QOU A;  4I5Q A;  5D93 A;  1A23 A;  2L6C A;  4ZL8 A;  1LBK A;  4BVX A;  5KOX A;  2O89 A;  3D4M A;  3US3 A;  3DYR A;  3GN3 A;  2VO4 A;  1F6M C;  2ON5 A;  5G2Z A;  4GCI A;  1Q98 A;  5HR3 A;  2VCQ A;  8GSS A;  3QDN A;  2OAD A;  3HJM A;  4OFT A;  2LNT A;  5CNW A;  1B8X A;  1J9B A;  3EU3 A;  1GTU A;  3G7J A;  2G2Q A;  2H1G A;  5FT3 A;  1V40 A;  2RM6 A;  3TDG A;  2H74 A;  4J56 E;  5ELA A;  4ILF A;  1AQX A;  3TJG A;  3ZRE A;  1B4P A;  4ZBD A;  2M72 A;  3VWU A;  1ZCP A;  3LFL A;  3FZA A;  5ECH B;  1TRW A;  3IHG A;  1JZW A;  2H70 A;  4F9Z A;  3ED3 A;  2GDR A;  3HYP A;  4TXO A;  3LYK A;  1PX6 A;  1O81 A;  5J9C A;  1MDK A;  4IKH A;  4HZ2 A;  4JBB A;  3TUE A;  3V1W A;  1MD3 A;  4WBJ A;  3L4N A;  2X4A A;  3PR8 A;  2OE3 A;  4K7O A;  3D5J A;  3QCP A;  2NDO A;  2MMN A;  3HVS A;  5AIX A;  3GKM A;  3GX8 A;  2FWH A;  1AUC A;  4ULX A;  3FYG A;  3IRA A;  3EC3 A;  1DBY A;  1I9D A;  4EF0 A;  4RUV A;  19GS A;  4YH2 A;  4OWY A;  5F8B A;  4X1U A;  1A0R P;  3HD5 A;  1SEN A;  1O8X A;  1SL2 B;  2IMD A;  3U5R E;  5F06 A;  4HU9 A;  2GSQ A;  4CY8 A;  3EMP A;  1JZR A;  2VM1 A;  1WMJ A;  1GUL A;  1GUM A;  4BPY A;  4HS1 A;  1OKD A;  1TP9 A;  2VL2 A;  4G2E A;  2AV4 A;  2IJY A;  2AJQ B;  3VK9 A;  1BED A;  3LXT A;  1UC7 A;  1K0D A;  4ACS A;  3KTB A;  3ISO A;  4MJB A;  1THO A;  2DJ1 A;  2CZ3 A;  2HE3 A;  4OO5 A;  2YJ7 A;  4KA0 A;  2VL2 C;  4POL A;  3BCI A;  1SJI A;  3HJP A;  5E4W A;  1W4V A;  3EWL A;  2O7K A;  1A2L A;  4YQV A;  1Z6M A;  2I81 A;  4WXT A;  2X99 A;  5IOW A;  1N2A A;  4TR1 A;  1XZO A;  4BVY B;  2JSZ A;  3C1S A;  5IMZ A;  4E8H A;  4DSQ A;  4NXI A;  4MA9 A;  5IMC A;  4IVF A;  4G9H A;  2OJL A;  1NSW A;  5A4V A;  5ELG A;  4JE1 A;  4MLY A;  3E9J B;  3P2A A;  1FO5 A;  3P8W A;  1DUG A;  2JAC A;  4FH8 A;  4ZB6 A;  2B3S A;  1VF1 A;  5ECR B;  4KND A;  1OC9 A;  5DAL A;  5GSS A;  1YEP A;  5B7C A;  5ABR A;  2L57 A;  2CAQ A;  1K0M A;  3L0H A;  2V2G A;  1RW1 A;  3BD2 A;  3QMX A;  3HVV A;  3TGZ A;  2L4Q A;  2CVD A;  2HRN A;  2C8U A;  1VF4 A;  3K8N A;  2REM A;  1C72 A;  1ERT A;  2YWI A;  4YQM A;  4J2F A;  2DC5 A;  1MDJ A;  4EXJ A;  5JWQ B;  1GP1 A;  3IR4 A;  4LL1 B;  3N5O A;  11GS A;  2MMA A;  1KEB A;  4IEL A;  2PMT A;  3TB2 A;  3TJK A;  2R0C A;  4ZIL A;  1GLQ A;  3HZ4 A;  4DSR A;  3GNJ A;  3R3E A;  3CTF A;  1TRU A;  1PMT A;  4PXO A;  4K7I A;  1N8J A;  1ERV A;  1WPI A;  2LJA A;  2VCT A;  3CRT A;  1YY7 A;  5F07 A;  1NHY A;  4I2U A;  2FD3 A;  4HDE A;  2LRT A;  4MZW A;  4NV2 A;  3L9S A;  3Q6O A;  1PD2 1;  3RDW A;  4K2X A;  1WE0 A;  2CVB A;  1A8Y A;  4GXZ A;  2UZ8 A;  4F0C A;  3D4T A;  4LMW A;  3RPP A;  3KH7 A;  2MMZ A;  3VFI A;  2VLT A;  4WEY A;  5J9B A;  5JCU A;  4NAX A;  3KH9 A;  3TOT A;  5LD0 A;  1AQW A;  2QA1 A;  4LLR A;  2K9F A;  2KP2 A;  3IXR A;  5D9T A;  5IO0 A;  2KUC A;  5A4U A;  3IC8 A;  1GUH A;  4KUN A;  2FWG A;  3VI5 A;  3ZVJ D;  2HRA A;  3ZMK A;  4H86 A;  5D73 A;  2KLX A;  4MK3 A;  4K8M A;  3KMO A;  2I3Y A;  2GS3 A;  5HR2 A;  3H4K A;  2IMF A;  1EWX A;  1I5G A;  13GS A;  2ALB A;  2RUE A;  5JWO B;  3F8U A;  1SYX A;  2GT5 A;  3ZIT A;  4LL4 B;  4KF9 A;  2CT6 A;  3BCK A;  3H93 A;  2CA8 A;  2A4H A;  1JLW A;  3EYT A;  1G0T A;  3UAP A;  3ERW A;  4JRR A;  2GT6 A;  3WGX A;  4XRA A;  2LRC A;  4MH2 A;  2L6D A;  3LGC A;  3Q74 A;  3UVT A;  5BMU A;  4DVC A;  3S9F A;  3GFK A;  1K3Y A;  4BWS A;  2VL3 A;  2GTU A;  3CSI A;  1T1V A;  4IJI A;  6GSW A;  4MCU A;  3IK9 A;  3M1G A;  3QAW A;  3W8S A;  3ME7 A;  4EUY A;  1S3D A;  1SJZ A;  1RK4 A;  2P5R A;  3A3T A;  1TK0 B;  4V1A p;  1KNG A;  5ECI B;  2P0G A;  3IC4 A;  2QKE A;  17GS A;  2BMX A;  1XCC A;  1YEX A;  4KGI A;  1HYU A;  2C3T A;  4JU5 A;  2QSI A;  2C0D A;  1A2J A;  3KIJ A;  4POM A;  2MBT A;  1TK5 B;  4F82 A;  1TKD B;  3MWH A;  3A2W A;  3BJ5 A;  4JED A;  4XTS A;  3UAR A;  5IPH A;  1ZZY A;  1QFN A;  1OAZ A;  4AJ6 A;  1TK8 B;  1BG5 A;  4ZB8 A;  4N0V A;  3D21 A;  2G0F A;  1GSD A;  1QUW A;  2H1B A;  3TCO A;  4PUA A;  2M46 A;  4WR4 A;  3KEB A;  4NPB A;  1XOA A;  5ECP B;  4PX1 A;  5D96 A;  4YKF A;  4DSS A;  2JZT A;  1SKS B;  3CRU A;  2JZS A;  16GS A;  1GSU A;  2H66 A;  1XOB A;  2WJU A;  5DVB A;  4IBP A;  1TU8 A;  5HFG A;  3J7Y b;  1PRX A;  1ON4 A;  5ECN B;  20GS A;  3F4S A;  2F8F A;  1FB0 A;  2H1A A;  1YF0 A;  2VM2 A;  2O85 A;  5LCZ A;  1XXU A;  2OE0 A;  5DJM A;  1TI1 A;  1NHO A;  2X8H A;  6GSS A;  3M8N A;  3GUR A;  3TRP A;  1ML6 A;  4YAP A;  5J5N A;  4MPF A;  2R0P A;  5IMF A;  2V41 A;  4BL7 B;  3DEX A;  5ECK B;  5B6M A;  3FY7 A;  3C73 A;  3HKR A;  3PPU A;  5JCW A;  4FYU A;  2LUS A;  3GKK A;  2DIY A;  1NM3 A;  2K18 A;  1HNB A;  1IYH A;  3NOF A;  1BYE A;  4ICY A;  4XS4 B;  1WRY A;  2C0G A;  2A2S A;  2C1Y A;  2DJ2 A;  1JFU A;  3D6I A;  2F9S A;  2D2Z A;  4MF7 A;  3JCM L;  4QQ7 A;  2HXK A;  12GS A;  2R2J A;  3FZ4 A;  4XS6 A;  3H1N A;  2WDU A;  1O8W A;  2HSH A;  5BRT A;  1XPV A;  2V32 A;  3ZFB A;  1IYI A;  5A4W A;  3M9K A;  5DJL A;  4F0B A;  1F3B A;  3AY8 A;  4ZBA A;  3I43 A;  2L4C A;  4OCF A;  2F8A A;  4KDY A;  3CMI A;  2LS5 A;  3QFA C;  3ZVJ A;  4DEJ A;  4TOP A;  2PN8 A;  3ERG A;  4NWY A;  2KP1 A;  3EIN A;  4AJ8 A;  3WYW A;  2DML A;  4PQI A;  1OC8 A;  3IA1 A;  2AHE A;  2VIM A;  2J23 A;  2LRN A;  4KSO A;  1GWC A;  4YKG A;  3KJY A;  4NHW A;  1XWA A;  2E7P A;  3NIV A;  1DE1 A;  3RAZ A;  2QGV A;  2AB6 A;  4AF2 A;  1E6B A;  1T3B A;  1TTZ A;  3GRX A;  1F2E A;  1HQO A;  3QAG A;  4MDC A;  1MTC A;  1CQG A;  4MZB A;  1X9S B;  5ID2 B;  1XW6 A;  1QQ2 A;  3D0Z A;  2JU5 A;  3MNG A;  5DBQ A;  6GSU A;  1VF2 A;  3TRQ A;  1R4W A;  2C4J A;  2H6Y A;  3G9B A;  3GMF A;  4N10 A;  5E59 A;  2HSM A;  4K9Z A;  2MZC A;  3IOS A;  3LW9 A;  4ID0 A;  2O8V B;  2GZY A;  3D22 A;  1USB A;  1V57 A;  2ON7 A;  1T00 A;  2E2G A;  5G31 A;  1U3A A;  2CX4 A;  3F3R A;  1ST9 A;  3GSS A;  1R5P A;  2YWO A;  2WRT A;  2EC4 A;  3ZIV A;  4O5R A;  3DD3 A;  3ZZX A;  1AAZ A;  3GTU B;  5FHI A;  1MDI A;  5ECL B;  2B1L A;  1J0F A;  3F4T A;  4BVY A;  2C0F A;  1U87 A;  2E0Q A;  2AAW A;  1X5D A;  1YKC A;  1EP7 A;  3Q18 A;  1GTI A;  3HVX A;  4K2D A;  5G1L A;  2XBI A;  2WB9 A;  3F4R A;  2OKA A;  3WT2 A;  2NPB A;  2HNL A;  4TXO B;  1G7E A;  4ZB9 A;  4USS A;  3FW2 A;  2H0I A;  2XBQ A;  4PGT A;  3F0I A;  1B9X C;  1X9W B;  2H0H A;  3DWV A;  4Q5Q A;  1U88 A;  2DIZ A;  1XFL A;  2HZE B;  3GST A;  1ILO A;  4IJ3 A;  1FW1 A;  5IIZ A;  2V6K A;  2H8L A;  3VUR A;  3TRX A;  2N5F A;  5D8I A;  3A2X A;  4G0K A;  1UA5 A;  1ERW A;  1YF1 A;  2R5G A;  1B9Y C;  1UN2 A;  4EE0 A;  1XWK A;  2P31 A;  4PQ1 A;  1ZYQ B;  1ZYE A;  3ZIJ A;  1M0U A;  5CYY A;  4GRF A;  1WWJ A;  2FWF A;  4KH7 A;  1K0O A;  2FHE A;  3CSJ A;  1J08 A;  3UMA A;  3LOR A;  4GQF A;  1ZMA A;  9GSS A;  1TRV A;  5EL8 A;  2NBS A;  1VGL A;  3G7I A;  2OAC A;  4HUA A;  2H71 A;  4XRD A;  3KM6 A;  5EY6 A;  3ZRD A;  2X49 A;  1DSB A;  1GSQ A;  2GST A;  5DCH A;  3EVI A;  3PGT A;  2H30 A;  2HYX A;  4ZL9 A;  5DCG A;  18GS A;  1QK8 A;  2N5A A;  2VD0 A;  2YZU A;  4HJ2 A;  2OE1 A;  3IPZ A;  1GSY A;  5F0G A;  1QGV A;  3KMN A;  1F3A A;  1AQV A;  3GUS A;  2H73 A;  3DGQ A;  3APS A;  2FWE A;  4I97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...