5KN3A

Recombinant bovine skeletal calsequestrin, low-ca2+ form
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
347
structure length
347
Chain Sequence
GLDFPEYDGVDRVVNVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMDELILELAAQVLEDKGVGFGMVDSEKDAAVAKKLGLTEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDDNKLIGYFKNKDSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVSFVEAHKRSTLRKLKPESMYETWEDDLDGIHIVAFAEETDPDGYEFLETLKAVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFNIDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calsequestrin
publication title Characterization of Post-Translational Modifications to Calsequestrins of Cardiac and Skeletal Muscle.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 101
structure length 347
sequence length 347
ec nomenclature
pdb deposition date 2016-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kn3A03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kn3A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kn3A02
2JL4A 4IKHA 2LS5A 4GCIA 3GYKA 2VCXA 4DSQA 4LMWA 3M8NA 4IVFA 4XHMA 1BYEA 1FHEA 3ME8A 2LNSA 5CYYA 4GXZA 1F6MC 1TOFA 4K6XA 2H30A 14GSA 1GUKA 1GSYA 1MDJA 1SJZA 1UA5A 1ML6A 2LKUA 3GX8A 1QUWA 3HJOA 2C4JA 4NMUA 5D9XA 4AJ6A 4YAPA 2O87A 2VUPA 13GSA 1EOHA 4IW9A 3H79A 2EIQA 4DSRA 5L71A 2DJ1A 1SJ6A 5LCZA 1K3YA 5INYA 2H1GA 3CYNA 3VI7A 4TW5A 2F8AA 5DCGA 3UL3A 5ID2B 1G0TA 4IQ1A 4MK3A 3IDVA 3PR8A 3IV4A 1YEXA 1JLVA 4MJEA 3TJFA 5J5NA 4MH2A 4HQSA 2H75A 18GSA 1ILOA 3UBKA 1V58A 5DBQA 4PUAA 4RQXA 2H1BA 2VCQA 3TKSE 4BPYA 1MDIA 5B6MA 2VCZA 1O7UA 4WETA 4HI7A 4POBA 2P5QA 1BQ7A 3APOA 3QDNA 16GSA 3EU4A 3CTFA 1GP1A 4EDYA 3ZTLA 1TXXA 4NAXA 2AYTA 3LFLA 4DVCA 6GSWA 1GTBA 2J9HA 20GSA 2CZ3A 3NIVA 3ZMLA 1ZYEA 3J7Yb 3KP8A 2CX3A 5FHIA 3BJ5A 3DRNA 5G5EA 3VI5A 3ME7A 3TKQA 4MZCA 4K0NA 3GTUA 2YWOA 2PERA 4EL1A 2LRNA 5HQPA 3HXSA 4G10A 2H0HA 5JWQB 3ERFA 5CREA 2GDRA 4HDEA 2DC5A 1ZGNA 3TJGA 3P7XA 2LNTA 1W4VA 4FIWA 3QR6A 1V2AA 4PXOA 1G7EA 1TU7A 2LUSA 2QC7A 5D9WA 4CDOA 1F2EA 5D73A 4WBRD 5A5KA 2DSAA 4TR0A 3HJPA 4HOJA 3UVHA 1OC8A 2B1KA 2HI7A 2DIYA 2CV4A 4EKZA 2X99A 5IMCA 1E2YA 3M9JA 2WRTA 3CRUA 1WMJA 1ERTA 2RM6A 4K1FA 2L6DA 2L5LA 3D22A 2RM5A 1BJXA 2GGTA 3ED3A 1HNCA 3TDGA 3L9UA 4FH8A 4MH3A 4OWYA 4YAVA 5DQSA 4TR4A 4POMA 5B8BA 4QL9A 2IFQB 3K8NA 2WJUA 2C3QA 5G31A 2J23A 1T4ZA 4IJIA 5JWOB 2PN8A 3O6TA 4KDXA 2XPEA 4PUFC 2NDOA 1O81A 1B48A 3VURA 3ZIJA 3KM6A 4JE1A 2TIRA 4IELA 2GQKA 4I2TA 1NW2A 2PU9C 3DGQA 3D4MA 1V98A 3Q18A 3ZFLA 1R5PA 1EZKA 4IHUA 3DMLA 3KH7A 4I8BA 4ZXGA 2RIIA 1XFLA 3ZYWA 1BG5A 2CZ2A 5IQYA 2H66A 1H75A 2XBIA 1SK1A 2I1UA 1Z7PA 5ECLB 3E3EA 3MDKA 3ZLPA 3GX0A 1YF0A 3OR5A 3HYPA 3QPMA 5B8AA 2GZZA 1GTUA 1AAZA 1SKWB 4LLRA 4YH2A 3C71A 4L5LA 4N10A 2YANA 2HFDA 1HYUA 2G0FA 5J41A 3FR9A 1EP7A 4FO5A 4K2DA 2JSZA 3FZAA 2IMIA 1AW9A 2HT9A 3A2WA 2VLVA 1X9WB 4ECCA 1TTZA 3TB2A 1S3CA 3EVIA 1VF4A 4KNDA 3F9UA 2GSRA 1TJDA 1AXDA 5H5RA 3VWWA 4RQRA 1OC9B 4ZIJA 2C3TA 1PKWA 2GT5A 2FWGA 2HE3A 1FG4A 3HZ4A 1JFUA 4XRAA 2L57A 3VWVA 2FUG2 2CAIA 2C8UA 4KAEA 3ZL5A 3DD3A 5GSTA 1SU9A 3IBHA 4MPFA 5AIXA 1RK4A 3CXGA 4F0BA 1XWBA 3MNGA 4F2IA 3M0FA 1GTAA 4KUNA 3I43A 5LNKe 1UVZA 2FA8A 3TKSA 5CAXA 4LL4B 4MDCA 3UAPA 2IJYA 1X5DA 2H74A 1H4OA 4PQIA 5ECIB 3C1SA 3TOUA 4E8HA 2FWEA 5CP1A 3GNJA 1CQGA 4GSTA 1TK8B 1TI1A 3G7JA 4CHSA 2H0GA 4JBBA 4XS4A 1YDKA 2L4QA 2Z9SA 3CRTA 1SD9A 3GKXA 4RUVA 4L0UA 2E2GA 3BCIA 2CX4A 3W6GA 1A2JA 4MMMA 1ON4A 3S9FA 1U6TA 1GSSA 4K7IA 2PUKC 3KCMA 3LG6A 1QGVA 1AC1A 2X8CA 1GSUA 1ERUA 1OC3A 1XW5A 3FZ4A 3UVTA 4ISDA 4EXJA 2ZUPA 4D73B 2GVPA 1TRWA 2WFCA 4NV2A 2CT6A 1K0OA 2XPDA 3BBYA 4G9HA 4V2MA 4V1Ag 3SWLA 2RLIA 2B7JA 2R2JA 2MMAA 1FB6A 4V2NA 2VL2C 1SL2B 5H5QA 1YZXA 3FZ9A 2YJ7A 1XIYA 2A2RA 3W8SA 1UN2A 2DMLA 5D96A 1LBKA 17GSA 1SYRA 1YKCA 2VLTA 3LXZA 3KJYA 1GTIA 1A8LA 1TRSA 1X9SB 1X5EA 5DJLA 1FOVA 3F0IA 1A24A 3QCPA 3ZRDA 2C80A 3CSHA 4J56E 4TKYA 4Q5QA 11GSA 5A4UA 5HR0A 1TRVA 4EO3A 4HZ2A 1J0FA 1TP9A 1M7TA 2I3YA 5JCGA 5A4VA 3A5WA 4MP4A 5KN3A 1X9MB 4ZBBA 4LL1B 4ZILA 4I2UA 4D73A 4YQVA 1TDIA 1AUCA 2VOCA 4MF7A 4WR5A 4BA7A 3H4KA 5DQYA 2WULA 1SL1B 5IPHA 2YNXA 2KLXA 3F4RA 2CAQA 3GSTA 3WGEA 2TRXA 3KEBA 1B4PA 2MBSA 1EWXA 1OAZA 3KMOA 1PX6A 4YQUA 2P31A 1GSFA 4AGSA 2OE0A 2O7KA 1A0FA 2P0GA 4GWRA 2CQ9A 5E59A 4POLA 3L9VA 1XXUA 4FYUA 1K0MA 5ECPB 3AY8A 3MWHA 4K7OA 3RHCA 1Z9HA 2ON7A 1ACVA 2PVQA 4ILFA 2M72A 3RBTA 5B6NA 4PQHA 2H8LA 2E7PA 3W8JA 4GF0A 1ABAA 1DSBA 4XRDA 2DBCA 4AJ8A 6GSXA 3ZIVA 3CSJA 3DWVA 4J57E 3HDCA 1USBA 1NSWA 1UC7A 3F6DA 3UMAA 3QFBC 3US3A 2HRNA 3TRPA 3GKKA 5G1KA 3KH9A 3GTUB 4MZBA 2M46A 4F0CA 2B7KA 2CA8A 2WZ9A 4L8EA 4JR6A 3HHVA 2HLSA 2VCTA 2WB9A 5EY6A 1PD21 5JWRB 3GKMA 5JCUA 1WIKA 2HZFA 12GSA 2AUVA 3HVVA 3JCML 3E0UA 2FWFA 4KH7A 2VIMA 4KDUA 4BWQA 2C1YA 2DJ0A 1V9WA 4ZBAA 4KDYA 3CSIA 2V2GA 3RPNA 3P2AA 3A2XA 3DVWA 1XW6A 3FY7A 1TW9A 2B5EA 1MTCA 1XWGA 3DIEA 2GTUA 3C7MA 2QGVA 2XHFA 4PURA 5ELGA 2YWMA 3N5OA 3F4SA 4HJMA 1C72A 3D21A 3EMPA 2PGTA 2GQMA 3P90A 2EIOA 2DMMA 5KEJA 3EC3A 4F82A 7GSSA 3DEXA 5KN1A 5IMAA 4DSSB 4ECIA 3F3QA 2IIYA 5CNWA 1JZWA 4KX4A 3U6VA 2YV9A 2AV4A 1TU8A 2X64A 5A4WA 3P8WA 1XBSA 1RW1A 3ZFBA 1EV9A 1I9DA 1Q4JA 4ML6A 3FEUA 2R3XA 3SBCA 1R4WA 4JZQA 1LJRA 1T1VA 1U3AA 2N5AA 3U5RE 1WP0A 2GSQA 2LRCA 1B8XA 1VF1A 3EE2A 3HZ8A 3ERGA 2HSYA 2FCHA 2EC4A 4MA9A 2FNOA 5CO3A 3GUSA 3GRXA 5E4WA 2R4VA 3KP9A 4Q5RA 2IMDA 2WGRA 3GIXA 3TKRA 4N30A 5GAPD 3DYRA 1QXHA 4RI6A 5AN1A 2KUCA 4F03A 2H1DA 1IYIA 3O3TA 4WEYA 2VD1A 1GSEA 2K8VA 2IWTA 3HVXA 2WCIA 3TJBA 4XCSA 2ES7A 1OE7A 3L0HA 4EDZA 2WS2A 4DSSA 2OJLA 1HNAA 2ON5A 6GSYA 3ZREA 2PWJA 1SJIA 2DJKA 1FVKA 1WJKA 5D93A 3DKSA 3M9KA 4BVYA 3FRCA 4LA1A 3I6AA 1B4QA 4OFNA 4IGJA 5CRDA 2I9HA 2DJJA 2IMKA 3DXBA 4HQZA 3F4TA 3EYTA 5G30A 3RPPA 1T3BA 3QD9A 1NM3A 4MZWA 1MD3A 2F9SA 1XZOA 1GSDA 1FVJA 5G2ZA 3BOAA 4N0VA 4X43A 4ZB6A 2VD0A 3KTBA 4ZL9A 2FHEA 4WF5A 2DJ3A 1WPIA 5GZZB 5ENUA 3TCOA 3EURA 2H73A 2MYGA 4OO5A 1XW9A 4XS4B 4ZB8A 5KN0A 4Z7XA 2IMFA 4TR3A 2QKEA 5IMFA 3FW2A 1G6YA 2VM2A 3KXOA 4AJ7A 1ZYQB 4L0WA 1THOA 3D4TA 5FWGA 4FYCA 1TKDB 4GQCA 2K9FA 2ZCTA 2YOIA 2GSTA 8GSSA 1SKRB 3F63A 3F3RA 3HD5A 3IC4A 1FO5A 1GLQA 5HFGA 4EC0A 2GS3A 2V1MA 5DDLA 2FWHA 4PGTA 1SYXA 2V6OA 1F9MA 2KP2A 2L5OA 1M2DA 1YKAA 3C8EA 4F9ZA 4XS6A 2JU5A 4IP6A 5HR3A 1J08A 3KGKA 4GLTA 4MF5A 3EINA 2H72A 2O8VB 3GKNA 1WOUA 1Q98A 1JZRA 4TOPA 1WE0A 1KTEA 1DUGA 1R5AA 5J3RA 1YQ1A 3KD0A 4OFTA 3H1NA 2RUEA 5IIZA 3J7Yk 2L59A 1XPVA 3UARA 1AQXA 2LSTA 4WBJA 1N8JA 1W89A 3F8UA 1M2AA 2HNLA 4TRXA 2LEGA 2X8HA 3IHQA 2YZUA 3QAGA 4OO4A 3RHBA 22GSA 2LTKA 2YCDA 4GSNA 3LORA 1GUHA 4OMVA 2H19A 4DEJA 3FK8A 3HY2A 4Q5FA 6GSTA 1TI3A 4CW9A 2H0IA 3C73A 2ALBA 2JZTA 3KIJA 2AJQB 2A4VA 2H6YA 2MMNA 3H93A 2YWNA 2G2QA 1B9XC 4ID0A 2H71A 4HU9A 4K7NA 2R6KA 4O92A 4IQAA 3KTLA 2HSHA 3LXTA 3TJJA 2X8GA 5ECRB 2E0QA 3D0ZA 1VGLA 1ZOFA 1JZOA 1O8XA 1OYJA 1AQWA 1OKDA 1QMVA 3UOMA 1LU4A 2FD3A 2GSSA 2LRTA 1OVNA 4KCAA 3MSZA 2C0FA 3ZZXA 3CTGA 3FR6A 4WXTA 2DLXA 4HJ2A 19GSA 5AIVA 3HA9A 1A8YA 3WYWA 4KB3A 5J4UA 2CVBA 2NBSA 5IO0A 3GV1A 3I69A 4WKWA 1Y6EA 2JZSA 6GSSA 2HRFA 4XTSA 1DBYA 3A3TA 4PNFA 5IOXA 1A2MA 2OACA 4ULXA 4GTUA 2V6KA 2HZEB 5DALA 2H6XA 4GQFA 2B5XA 3APSA 1YJ6A 4KW6A 1VF2A 4IP1A 4K8MA 3KMNA 5EVOA 1DE2A 1SKSB 2I4AA 2MMZA 3TUEA 1GLPA 2K6VA 2KHPA 5DAKB 2YN1A 1PX7A 2O85A 2IPAA 4V2LA 1Y25A 2YWIA 2AHEA 2O89A 2OADA 3O76A 3WGDA 3CBUA 1SD8A 2GZPA 1T8EB 3FHKA 4QQ7A 2QSIA 4I97A 2H01A 4TVEA 3LWAA 3LYPA 1TRUA 2F3MA 3ISOA 3APQA 2F51A 2FY6A 4PX1A 1KBNA 1OE8A 1XWKA 1XWAA 4ECBA 3LJRA 5D8IA 2VL9A 1E6BA 2TRCP 3GHAA 2K18A 4LMVA 1M2BA 5HR2A 1QFNA 3QAWA 3I9V2 3IA1A 4HZ4A 1Z5YE 2MZCA 2VLUA 3GFKA 1NHYA 3TOTA 1XVQA 4NV5A 1KNGA 3PINA 1ST9A 4P3YB 5CRWA 2HZEA 5KN2A 1VF3A 2LQQA 3R2QA 4JU5A 1ERWA 2IL3A 4MCUA 4MJBA 4E8EA 1M0UA 3FKFA 2C0EA 1K0CA 4BVXA 4HEA2 4MF6A 4TXVA 1B9YC 1O85A 1A23A 3Q19A 2YJHA 5DAKA 1K0BA 1N2AA 5G1LA 4MJCA 2H76A 1EOGA 3NOFA 2MBTA 5AISA 2MMOA 3IRAA 3IAM2 5F07A 3IK7A 1PKZA 5ECNB 1ERVA 3IE3A 3ERWA 4RI7A 1Z7RA 2C0GA 1EEMA 4MABA 4K9ZA 1JHBA 1GUMA 2GLRA 1ZL9A 2WDUA 4O32A 1AQVA 3GL5A 3Q74A 5HFIA 2H6ZA 1GH2A 2VL2A 2NPBA 1PQNA 4O5RA 4NWYA 3VWXA 4TR1B 5ECQB 3CMIA 1K0NA 3VK9A 4KA0A 10GSA 4KCEA 4NPBA 4TXOB 1K0AA 2BMXA 3E9JB 1R26A 1SK2A 1VRSD 1GULA 2LQOA 2R5GA 4X0XA 2R37A 3HKRA 3C1RA 4ML1A 5ID2A 1AIUA 5H5SA 3KZQA 1O6JA 4L5OA 1J9BA 4JEDA 2XC2A 2REMA 1QQ2A 3TKSC 3NZNA 2VO4A 4NHZA 1EGOA 5IOWA 4NHWA 3GMFA 5IPGA 3UEMA 1V57A 3IR4A 3G7YA 4J2FA 1MDKA 1EGRA 5DCHA 4EF0A 5IMDA 2YPMA 2FGXA 5IMVA 3L78A 3G9BA 2YP6A 3TRQA 5LD0A 1U3IA 3GA4A 2OKAA 4OCEA 2OBKA 1NHOA 2H1AA 1THXA 5ECSA 3QOUA 3IPZA 3UBLA 5J9BA 1PSQA 3N9JA 2VM1A 2N5BA 1QK8A 3IAS2 4TR1A 1SL0B 3VPQA 1YY7A 1XWCA 4TXOA 5EPFA 1WRYA 4ZL8A 3RAZA 1FAAA 1SENA 4ZBDA 1PGTA 3GN3A 3MAKA 3QFAC 1PL2A 3GURA 3HVSA 5JCWA 5HFKA 5GAND 3QAVA 1V40A 3DVXA 5AGYA 3RDWA 3V1WA 2YZHA 1A0RP 2KOKA 4ZL7A 2HXKA 5ECMB 3A2VA 6GSUA 1T7PB 1WWJA 5DJMA 1ZMAA 1PA3A 2N5FA 1XOBA 1U88A 4G2EA 4EVMA 5IO2A 3ZVJD 2H70A 2VL3A 1TK5B 5F05A 3VLNA 1G7OA 2D2ZA 2BTOT 2OE1A 2ZNMA 1GNWA 4IJ3A 1JZDA 1URMA 3LEFA 5IM9A 1BX9A 2AAWA 2FA4A 4I5QA 4V1Ap 1ZCPA 5COHA 3M3MA 4WF4A 3VFIA 3FR3A 1S3AA 4AF2A 2LJAA 1EV4A 3IXRA 2JADA 4NXIA 2CVDA 1HD2A 4IBPA 2A2SA 2PVOC 3L4NA 4HS1A 2PPTA 2IFQA 3GSSA 3ZVJA 4QL7A 4N11A 4MLYA 2GZYA 2DIZA 2BJXA 5GSSA 2JACA 1O73A 3G7IA 4MJAA 1T4YA 1M99A 1MEKA 3LGCA 3ZMKA 3FYGA 3TJKA 3FZ5A 5D9TA 2L4CA 5ECHB 5ABRA 1DE1A 1Z3EA 4ZB9A 3UIWA 2IMEA 3TGZA 1GSQA 4EE0A 4HU7A 5CRHA 2V32A 3WT2A 5ECOB 2DJ2A 4WR4A 4EUYA 2FLSA 2EIRA 5F8BA 5D9VA 1F3BA 1S3DA 4O7HA 2CVKA 4I6XA 3LQ7A 1M9BA 2VCVA 1O8WA 2VAFA 2VCWA 3BD2A 3GH6A 3EMXA 5ELAA 3TRXA 4JR4A 1PN9A 1JLWA 1BEDA 3IK9A 1HNBA 4KE3A 2F8FA 1EP8A 2RUFA 2OE3A 2PMTA 3VPTA 2LJRA 3BCKA 1K3LA 3EU3A 1K3OA 3EWLA 4IS0A 2YV7A 4POKA 2NVLA 3L9SA 4PQ1A 1OC9A 4TN8A 3GL3A 1F37A 4XIHA 3VWUA 4ACSA 3LSZA 3M1GA 2LJKA 5ECKB 1T00A 1GNEA 4Q5NA 9GSSA 1RQMA 3IOSA 5G5FA 1IYHA 1PMTA 5DALB 3WD6A 5EL8A 1KEBA 2NTOA 3QMXA 5F06A 2XBQA 3HJMA 1K0DA 4G19A 1FB0A 1SK0A 3UJ1A 4KSOA 2C0DA 1G6WA 2B3SA 3PH9A 2L6CA 2GT6A 3WGXA 2B5YA 1OKTA 2JZRA 4JRRA 4MPGA 1MD4A 1XOAA 3D6IA 4XS1A 4YQMA 2OA7A 2KP1A 3H8QA 1Z6NA 4FYBA 3PGTA 2B1LA 1XCCA 1BAYA 1PRXA 2C3NA 2E2MA 1M9AA 4N0ZA 1FW1A 4IN0A 4BL7A 5B7CA 3GH9A 4OCFA 1X5CA 4X1UA 4OFMA 1TK0B 5J9CA 2K8SA 5F0GA 5CRGA 1GRXA 1PL1A 6GSVA 2LV3A 2B6MA 4BWSA 2AB6A 1X0RA 2PBJA 5IMZA 1I5GA 3D5JA 4KGIA 4PNGA 2HYXA 2OBIA 4GSSA 2IN3A 5C00A 3TKPA 3ZITA 1R7HA 1U87A 1A2LA 1YF1A 2JSYA 1GL8A 4ECJA 2M80A 4K0GA 4OD7A 2GQLA 1ZZYA 2I81A 3LYKA 4H86A 1XVWA 5HR1A 1GWCA 3F6FA 2V41A 3HCZA 2P5RA 1CQHA 4HUAA 1EEJA 3WT1A 3Q6OA 1HQOA 4GRFA 5C04A 5DVBA 1F3AA 5FT3A 1YEPA 1Z6MA 4KSMA
chains in the Genus database with same CATH superfamily
2JL4A 4IKHA 2LS5A 4GCIA 3GYKA 2VCXA 4DSQA 3EPTA 4LMWA 3M8NA 4IVFA 4XHMA 1BYEA 4Z2UA 1FHEA 3ME8A 2LNSA 5CYYA 4GXZA 1F6MC 1TOFA 4K6XA 3IHGA 2H30A 14GSA 1GUKA 1GSYA 1MDJA 1SJZA 1UA5A 1ML6A 2LKUA 3GX8A 1QUWA 3HJOA 2C4JA 4NMUA 5D9XA 4AJ6A 4YAPA 2O87A 2VUPA 13GSA 1EOHA 4IW9A 3H79A 2EIQA 4DSRA 5L71A 2DJ1A 1SJ6A 5LCZA 1K3YA 5INYA 2H1GA 3CYNA 3VI7A 4TW5A 2F8AA 5DCGA 3UL3A 5ID2B 1G0TA 4IQ1A 4MK3A 3IDVA 2QA2A 3PR8A 3IV4A 1YEXA 1JLVA 4MJEA 3TJFA 5J5NA 4MH2A 4HQSA 2H75A 18GSA 1ILOA 3UBKA 1V58A 5DBQA 4PUAA 4RQXA 2H1BA 2VCQA 3TKSE 4BPYA 1MDIA 5B6MA 2VCZA 1O7UA 4WETA 4HI7A 4POBA 2P5QA 1BQ7A 3APOA 3QDNA 16GSA 3EU4A 3CTFA 1GP1A 4EDYA 3ZTLA 1TXXA 4NAXA 2AYTA 3LFLA 4DVCA 6GSWA 1GTBA 2J9HA 20GSA 2CZ3A 3NIVA 3ZMLA 2HRKA 4G0KA 1ZYEA 3J7Yb 3KP8A 2CX3A 5FHIA 3BJ5A 3DRNA 5G5EA 3VI5A 3ME7A 3TKQA 4MZCA 4K0NA 3GTUA 2YWOA 2PERA 4EL1A 2LRNA 5HQPA 3LW9A 3HXSA 4G10A 2H0HA 5JWQB 3ERFA 5CREA 4EIPA 2GDRA 4HDEA 2DC5A 1ZGNA 3TJGA 3P7XA 2LNTA 1W4VA 4FIWA 3QR6A 1V2AA 4PXOA 1G7EA 1TU7A 2LUSA 2QC7A 5D9WA 4CDOA 1F2EA 5D73A 4WBRD 5A5KA 2DSAA 4TR0A 3HJPA 4HOJA 3UVHA 1OC8A 2B1KA 2HI7A 2DIYA 2CV4A 4EKZA 2X99A 5IMCA 1E2YA 3M9JA 2WRTA 3CRUA 1WMJA 1ERTA 2RM6A 4K1FA 2L6DA 2L5LA 3D22A 2RM5A 1BJXA 2GGTA 3ED3A 1HNCA 3TDGA 3L9UA 4FH8A 4MH3A 4OWYA 4YAVA 5DQSA 4TR4A 4POMA 5B8BA 4QL9A 2IFQB 3K8NA 2WJUA 2C3QA 5G31A 2J23A 1T4ZA 4IJIA 5JWOB 2PN8A 3O6TA 4KDXA 2XPEA 4PUFC 2NDOA 1O81A 1B48A 3VURA 3ZIJA 3KM6A 4JE1A 2TIRA 4IELA 2GQKA 4I2TA 1NW2A 2PU9C 3DGQA 3D4MA 2QA1A 1V98A 3Q18A 3ZFLA 2R0PA 1R5PA 1EZKA 4IHUA 3DMLA 3KH7A 4I8BA 4ZXGA 2RIIA 1XFLA 3ZYWA 1BG5A 2CZ2A 5IQYA 2H66A 1H75A 2XBIA 1SK1A 2I1UA 1Z7PA 5ECLB 3E3EA 3MDKA 3ZLPA 3GX0A 1YF0A 3OR5A 3HYPA 3QPMA 5B8AA 2GZZA 1GTUA 1AAZA 1SKWB 4LLRA 4YH2A 3C71A 4L5LA 4N10A 2YANA 2HFDA 1HYUA 2G0FA 5J41A 3FR9A 1EP7A 4FO5A 4K2DA 2JSZA 3FZAA 2IMIA 1AW9A 2HT9A 3A2WA 2VLVA 1X9WB 4ECCA 1TTZA 3TB2A 1S3CA 3EVIA 1VF4A 4KNDA 3F9UA 2GSRA 1TJDA 1AXDA 5H5RA 3VWWA 4RQRA 1OC9B 4ZIJA 2C3TA 1PKWA 2GT5A 2FWGA 2HE3A 1FG4A 3HZ4A 4YKFA 1JFUA 4XRAA 2L57A 3VWVA 2FUG2 2CAIA 2C8UA 4KAEA 3ZL5A 3DD3A 5GSTA 1SU9A 3IBHA 4MPFA 5AIXA 1RK4A 3CXGA 4F0BA 1XWBA 3MNGA 4F2IA 3M0FA 4PTSA 1GTAA 4KUNA 3I43A 5LNKe 1UVZA 2FA8A 3TKSA 5CAXA 4LL4B 4MDCA 3UAPA 2IJYA 5BRTA 1X5DA 2H74A 1H4OA 4PQIA 5ECIB 3C1SA 3TOUA 4E8HA 2FWEA 5CP1A 3GNJA 1CQGA 4GSTA 1TK8B 1TI1A 3G7JA 4CHSA 1M3JA 2H0GA 4JBBA 4XS4A 1YDKA 2L4QA 2Z9SA 3CRTA 1SD9A 3GKXA 4RUVA 4L0UA 2E2GA 3BCIA 2CX4A 3W6GA 1A2JA 4MMMA 2DKHA 1ON4A 3S9FA 1U6TA 1GSSA 4K7IA 2PUKC 3KCMA 3LG6A 1QGVA 1AC1A 2X8CA 1GSUA 1ERUA 1OC3A 1XW5A 3FZ4A 3UVTA 4ISDA 4EXJA 2ZUPA 4D73B 2GVPA 1TRWA 2WFCA 4NV2A 2CT6A 1K0OA 2XPDA 3BBYA 4USSA 4G9HA 4V2MA 4V1Ag 3SWLA 2RLIA 2B7JA 2R2JA 2MMAA 1FB6A 4V2NA 2VL2C 1SL2B 5H5QA 1YZXA 3FZ9A 2YJ7A 1XIYA 2A2RA 3W8SA 1UN2A 2X4AA 3HVNA 2DMLA 5D96A 1LBKA 17GSA 1SYRA 1YKCA 2VLTA 3LXZA 3KJYA 1GTIA 1A8LA 1TRSA 1X9SB 1X5EA 1PFOA 5DJLA 1FOVA 3F0IA 1A24A 3QCPA 3ZRDA 2C80A 3CSHA 4J56E 4TKYA 4Q5QA 11GSA 5A4UA 5HR0A 1TRVA 4EO3A 4HZ2A 1J0FA 1TP9A 1M7TA 2I3YA 5JCGA 5A4VA 3A5WA 4MP4A 5KN3A 1X9MB 4ZBBA 4LL1B 4ZILA 4I2UA 4D73A 4YQVA 1TDIA 1AUCA 2VOCA 4MF7A 4WR5A 4BA7A 3H4KA 5DQYA 2WULA 1SL1B 4CY6A 5IPHA 2YNXA 2KLXA 3F4RA 2CAQA 3GSTA 4HSCX 3WGEA 2TRXA 3KEBA 1B4PA 2MBSA 1EWXA 1OAZA 3KMOA 1PX6A 4YQUA 2P31A 1GSFA 4AGSA 2OE0A 2O7KA 1A0FA 2P0GA 4GWRA 2CQ9A 5E59A 4POLA 3L9VA 1XXUA 4FYUA 1K0MA 5ECPB 3AY8A 3MWHA 4K7OA 3RHCA 1Z9HA 2ON7A 1ACVA 2PVQA 4ILFA 2M72A 3RBTA 5B6NA 4PQHA 2H8LA 2E7PA 3W8JA 4GF0A 4KF9A 1ABAA 1DSBA 4XRDA 2DBCA 4AJ8A 6GSXA 3ZIVA 3CSJA 3DWVA 4J57E 3HDCA 1USBA 1NSWA 3CQFA 1UC7A 3F6DA 3UMAA 3QFBC 3US3A 2HRNA 3TRPA 3GKKA 5G1KA 3KH9A 3GTUB 4MZBA 2M46A 1ZYPA 4F0CA 2B7KA 2CA8A 2WZ9A 4L8EA 4JR6A 3HHVA 2HLSA 2VCTA 2WB9A 5EY6A 1PD21 5JWRB 3GKMA 5JCUA 1WIKA 2HZFA 12GSA 2AUVA 3HVVA 3JCML 3E0UA 2FWFA 4KH7A 2VIMA 4KDUA 4BWQA 2C1YA 2DJ0A 1V9WA 4ZBAA 4KDYA 3CSIA 2HSMA 2V2GA 3RPNA 3P2AA 3A2XA 3DVWA 1XW6A 3FY7A 1TW9A 2B5EA 1MTCA 1XWGA 3DIEA 2GTUA 3C7MA 2QGVA 2XHFA 4PURA 5ELGA 2YWMA 3N5OA 3F4SA 4HJMA 1C72A 3D21A 3EMPA 2PGTA 2GQMA 3P90A 2EIOA 2DMMA 5KEJA 3EC3A 4F82A 7GSSA 3DEXA 5KN1A 1S3RA 5IMAA 4DSSB 4ECIA 3F3QA 2IIYA 5CNWA 1JZWA 4KX4A 3U6VA 2YV9A 2AV4A 1TU8A 2X64A 5A4WA 3P8WA 1XBSA 1RW1A 3ZFBA 1EV9A 4K2XA 1I9DA 1Q4JA 4ML6A 3FEUA 4BVYB 2R3XA 3SBCA 1R4WA 4JZQA 1LJRA 1T1VA 1U3AA 2N5AA 3U5RE 1WP0A 2GSQA 2LRCA 1B8XA 1VF1A 3EE2A 3HZ8A 3ERGA 2HSYA 2FCHA 2EC4A 4MA9A 2FNOA 5CO3A 3GUSA 3GRXA 5E4WA 2R4VA 4Q5RA 3KP9A 2IMDA 2WGRA 3GIXA 3TKRA 4N30A 5GAPD 3DYRA 1QXHA 3PPUA 4RI6A 5AN1A 2KUCA 4F03A 2H1DA 1IYIA 3O3TA 4WEYA 2VD1A 1GSEA 2K8VA 2IWTA 3HVXA 2WCIA 3TJBA 4XCSA 2ES7A 1OE7A 3L0HA 4EDZA 2WS2A 4DSSA 2OJLA 1HNAA 2ON5A 6GSYA 3ZREA 2PWJA 1SJIA 2DJKA 1FVKA 1WJKA 5D93A 3DKSA 3M9KA 4BVYA 3FRCA 4LA1A 3I6AA 1B4QA 4OFNA 4IGJA 5CRDA 2I9HA 2DJJA 2IMKA 3DXBA 4HQZA 3F4TA 3EYTA 5G30A 3RPPA 1T3BA 3QD9A 1NM3A 4MZWA 1MD3A 2F9SA 1XZOA 1GSDA 1FVJA 5G2ZA 3BOAA 4N0VA 4X43A 4ZB6A 2VD0A 3KTBA 4ZL9A 2FHEA 4WF5A 2DJ3A 1WPIA 5GZZB 5ENUA 3TCOA 3EURA 2H73A 2MYGA 4OO5A 1XW9A 4XS4B 4ZB8A 5KN0A 4Z7XA 2IMFA 4TR3A 2QKEA 5IMFA 4K5SA 3FW2A 1G6YA 2VM2A 4O5QA 3KXOA 4AJ7A 1ZYQB 4L0WA 1THOA 3D4TA 5FWGA 4FYCA 1TKDB 4GQCA 2K9FA 2ZCTA 2YOIA 2GSTA 8GSSA 1SKRB 3F63A 3F3RA 3HD5A 3IC4A 1FO5A 1PN0A 1GLQA 5HFGA 4EC0A 2GS3A 2V1MA 5DDLA 2FWHA 4PGTA 1SYXA 2V6OA 1F9MA 2KP2A 2L5OA 1M2DA 1YKAA 3C8EA 4F9ZA 4XS6A 2JU5A 4IP6A 5HR3A 1J08A 3KGKA 4GLTA 4MF5A 3EINA 2H72A 2O8VB 3GKNA 1WOUA 1Q98A 1JZRA 4TOPA 1WE0A 1KTEA 1DUGA 1R5AA 5J3RA 1YQ1A 3KD0A 4OFTA 3H1NA 2RUEA 5IIZA 3J7Yk 2L59A 1XPVA 3UARA 1AQXA 2LSTA 4WBJA 1N8JA 1W89A 3F8UA 1M2AA 2HNLA 4TRXA 2LEGA 2X8HA 3IHQA 2YZUA 3QAGA 4OO4A 3RHBA 22GSA 2LTKA 2YCDA 4GSNA 3LORA 1GUHA 4OMVA 2H19A 4DEJA 3FK8A 3HY2A 4Q5FA 6GSTA 1TI3A 4CW9A 2H0IA 3C73A 2ALBA 2JZTA 3KIJA 2AJQB 2A4VA 2H6YA 2MMNA 3H93A 2YWNA 2G2QA 1B9XC 4ID0A 2H71A 4HU9A 4K7NA 2R6KA 4O92A 4IQAA 3KTLA 2HSHA 3LXTA 3TJJA 2X8GA 5ECRB 4X4JA 2E0QA 3D0ZA 1VGLA 1ZOFA 1JZOA 1O8XA 1OYJA 1AQWA 1OKDA 1QMVA 2DKIA 3UOMA 2R0CA 1LU4A 2FD3A 2R0GA 3A5IA 2GSSA 2LRTA 1OVNA 4KCAA 3MSZA 2C0FA 3ZZXA 3CTGA 3FR6A 4WXTA 2DLXA 4HJ2A 19GSA 5AIVA 3HA9A 1A8YA 3WYWA 4KB3A 5J4UA 2CVBA 2NBSA 5IO0A 3GV1A 3I69A 4WKWA 1Y6EA 2JZSA 6GSSA 2HRFA 4XTSA 1DBYA 3A3TA 4PNFA 5IOXA 1A2MA 2OACA 4ULXA 4GTUA 2V6KA 4G0IA 2HZEB 5DALA 2H6XA 4GQFA 5KOXA 2B5XA 3APSA 1YJ6A 4KW6A 1VF2A 4IP1A 4K8MA 3KMNA 4K5RA 5EVOA 1DE2A 1SKSB 2I4AA 2MMZA 3TUEA 1GLPA 2K6VA 2KHPA 5DAKB 2YN1A 1PX7A 2O85A 2IPAA 4V2LA 1Y25A 2YWIA 3R3EA 2AHEA 1FOHA 2O89A 4YKGA 2OADA 3O76A 3WGDA 3CBUA 1SD8A 2GZPA 1T8EB 3FHKA 4QQ7A 2QSIA 4I97A 2H01A 4TVEA 4O5UA 3LWAA 3LYPA 1TRUA 2F3MA 3ISOA 3APQA 2F51A 2FY6A 4PX1A 1KBNA 1OE8A 1XWKA 1XWAA 4ECBA 3LJRA 5D8IA 2VL9A 1E6BA 2TRCP 3GHAA 2K18A 4LMVA 5BMUA 1M2BA 5HR2A 1QFNA 3QAWA 3I9V2 3IA1A 4HZ4A 1Z5YE 2MZCA 2VLUA 3GFKA 1NHYA 3TOTA 3MIXA 1XVQA 4NV5A 1KNGA 3PINA 1ST9A 4P3YB 5CRWA 2HZEA 5KN2A 1VF3A 2LQQA 3R2QA 4JU5A 1ERWA 2IL3A 4MCUA 4MJBA 4E8EA 1M0UA 3FKFA 2C0EA 1K0CA 4BVXA 4HEA2 4MF6A 2X49A 4TXVA 1B9YC 1O85A 1A23A 3Q19A 2YJHA 5DAKA 1K0BA 1N2AA 5G1LA 4MJCA 2H76A 1EOGA 3NOFA 2MBTA 5AISA 2MMOA 3IRAA 3IAM2 5F07A 3IK7A 1XG8A 1PKZA 5ECNB 1ERVA 3IE3A 3ERWA 4RI7A 1Z7RA 2C0GA 1EEMA 4MABA 4K9ZA 1JHBA 1GUMA 2GLRA 1ZL9A 2WDUA 4O32A 1AQVA 4CY8A 3GL5A 3Q74A 5HFIA 2H6ZA 1GH2A 2VL2A 2NPBA 1PQNA 4O5RA 4NWYA 3VWXA 4TR1B 5ECQB 3CMIA 1K0NA 3VK9A 4KA0A 10GSA 4KCEA 4NPBA 4TXOB 1K0AA 2BMXA 3E9JB 1R26A 1SK2A 1VRSD 1GULA 1ZYNA 4A5PA 2LQOA 2R5GA 4X0XA 2R37A 3HKRA 2A4HA 3C1RA 4ML1A 5ID2A 1AIUA 5H5SA 3KZQA 1O6JA 3MYDA 4L5OA 1J9BA 4JEDA 2XC2A 2REMA 1QQ2A 3TKSC 3NZNA 2VO4A 4NHZA 1EGOA 5IOWA 4NHWA 3GMFA 5IPGA 3UEMA 1V57A 3IR4A 3G7YA 4J2FA 1MDKA 1EGRA 5DCHA 4EF0A 5IMDA 2YPMA 2FGXA 5IMVA 3L78A 3G9BA 2YP6A 3TRQA 5LD0A 1U3IA 3GA4A 2OKAA 4OCEA 2OBKA 1NHOA 2H1AA 1THXA 5ECSA 3QOUA 3IPZA 3UBLA 5J9BA 1PSQA 3N9JA 2VM1A 2N5BA 1QK8A 3IAS2 4TR1A 1SL0B 3VPQA 1YY7A 1XWCA 4TXOA 5EPFA 1WRYA 4ZL8A 3RAZA 1FAAA 1SENA 4ZBDA 1PGTA 3GN3A 3MAKA 3QFAC 1PL2A 3GURA 3HVSA 5JCWA 5HFKA 5GAND 3QAVA 1V40A 3DVXA 5AGYA 3RDWA 3V1WA 2YZHA 1A0RP 2KOKA 4ZL7A 2HXKA 5ECMB 3A2VA 6GSUA 1T7PB 1WWJA 5DJMA 1ZMAA 1PA3A 2N5FA 1XOBA 1U88A 4G2EA 4EVMA 5IO2A 3ZVJD 2H70A 2VL3A 1TK5B 5F05A 3VLNA 1G7OA 2D2ZA 2BTOT 2OE1A 2ZNMA 1GNWA 4IJ3A 1JZDA 4ICYA 1URMA 3LEFA 5IM9A 1BX9A 2AAWA 2FA4A 4I5QA 4V1Ap 1ZCPA 5COHA 3M3MA 4WF4A 3VFIA 3FR3A 1S3AA 4AF2A 2LJAA 1EV4A 3IXRA 2JADA 4NXIA 2CVDA 1HD2A 4IBPA 2A2SA 2PVOC 3L4NA 4HS1A 2PPTA 2IFQA 3GSSA 3ZVJA 4QL7A 4N11A 4MLYA 2GZYA 2DIZA 2BJXA 5GSSA 2UZ8A 2JACA 1O73A 3G7IA 4MJAA 1T4YA 1M99A 1MEKA 3LGCA 3ZMKA 3FYGA 3TJKA 3FZ5A 5D9TA 2L4CA 5ECHB 5ABRA 1DE1A 1Z3EA 4Z2RA 4ZB9A 3UIWA 2IMEA 3TGZA 1GSQA 4EE0A 4HU7A 5CRHA 2V32A 3WT2A 5ECOB 2DJ2A 4WR4A 4EUYA 2FLSA 2EIRA 5F8BA 5D9VA 1F3BA 1S3DA 4O7HA 2CVKA 4I6XA 3LQ7A 1M9BA 2VCVA 1O8WA 2VAFA 2VCWA 3BD2A 3GH6A 3EMXA 5ELAA 3TRXA 4JR4A 1PN9A 3IC8A 4Z2TA 1JLWA 1BEDA 3IK9A 1HNBA 4KE3A 4BL7B 2F8FA 1EP8A 2RUFA 2OE3A 2PMTA 3VPTA 2LJRA 3BCKA 1K3LA 3EU3A 1K3OA 3EWLA 4IS0A 2YV7A 4POKA 2NVLA 3L9SA 4PQ1A 1OC9A 4TN8A 3GL3A 1F37A 4XIHA 3VWUA 4ACSA 4G0LA 3LSZA 3M1GA 2LJKA 2A2PA 5ECKB 1T00A 4EIQA 1GNEA 4Q5NA 9GSSA 1RQMA 3IOSA 5G5FA 1IYHA 1PMTA 5DALB 3WD6A 5EL8A 1KEBA 2NTOA 3QMXA 5F06A 2XBQA 3HJMA 1K0DA 4G19A 1FB0A 1SK0A 3UJ1A 4KSOA 2C0DA 1G6WA 5KOWA 2B3SA 3PH9A 2L6CA 2GT6A 3WGXA 1M3IA 2B5YA 1OKTA 2JZRA 4JRRA 4MPGA 1MD4A 1XOAA 3D6IA 4XS1A 4YQMA 2OA7A 2KP1A 3H8QA 1Z6NA 4MNNA 4FYBA 3PGTA 2B1LA 1XCCA 1BAYA 1PRXA 2C3NA 2E2MA 1M9AA 4N0ZA 1FW1A 4IN0A 4BL7A 5B7CA 3GH9A 4OCFA 1X5CA 4X1UA 4OFMA 1TK0B 5J9CA 2K8SA 5F0GA 5CRGA 4BIKA 1GRXA 3FMWA 1PL1A 6GSVA 2LV3A 2B6MA 4BWSA 2AB6A 1X0RA 2PBJA 5IMZA 1I5GA 3D5JA 4KGIA 4PNGA 2HYXA 2OBIA 4GSSA 2IN3A 5C00A 3TKPA 3ZITA 1R7HA 1U87A 1A2LA 1YF1A 2JSYA 1GL8A 4ECJA 2M80A 4K0GA 2HRAA 4OD7A 2GQLA 1ZZYA 2I81A 3LYKA 4H86A 1XVWA 5HR1A 1GWCA 3F6FA 2V41A 3HCZA 2P5RA 1CQHA 4BVXB 4HUAA 1EEJA 3WT1A 4FQUA 3Q6OA 1HQOA 4GRFA 5C04A 5DVBA 1F3AA 5FT3A 1YEPA 1Z6MA 4KSMA
chains in the Genus database with same CATH topology
2JL4A 4IKHA 2LS5A 4GCIA 3GYKA 2VCXA 4DSQA 3EPTA 4LMWA 3M8NA 4IVFA 4XHMA 1BYEA 4Z2UA 1FHEA 3ME8A 2LNSA 5CYYA 4GXZA 1F6MC 1TOFA 4K6XA 3IHGA 2H30A 14GSA 1GUKA 1GSYA 1MDJA 1SJZA 1UA5A 1ML6A 2LKUA 3GX8A 1QUWA 3HJOA 2C4JA 4NMUA 5D9XA 4AJ6A 4YAPA 2O87A 2VUPA 13GSA 1EOHA 4IW9A 3H79A 2EIQA 4DSRA 5L71A 2DJ1A 1SJ6A 5LCZA 1K3YA 5INYA 2H1GA 3CYNA 3VI7A 4TW5A 2F8AA 5DCGA 3UL3A 5ID2B 1G0TA 4IQ1A 4MK3A 3IDVA 2QA2A 3PR8A 3IV4A 1YEXA 1JLVA 4MJEA 3TJFA 5J5NA 4MH2A 4HQSA 2H75A 18GSA 1ILOA 3UBKA 1V58A 5DBQA 4PUAA 4RQXA 2H1BA 2VCQA 3TKSE 4BPYA 1MDIA 5B6MA 2VCZA 1O7UA 4WETA 4HI7A 4POBA 2P5QA 1BQ7A 3APOA 3QDNA 16GSA 3EU4A 3CTFA 1GP1A 4EDYA 3ZTLA 1TXXA 4NAXA 2AYTA 3LFLA 4DVCA 6GSWA 1GTBA 2J9HA 20GSA 2CZ3A 3NIVA 3ZMLA 2HRKA 4G0KA 1ZYEA 3J7Yb 3KP8A 2CX3A 5FHIA 3BJ5A 3DRNA 5G5EA 3VI5A 3ME7A 3TKQA 4MZCA 4K0NA 3GTUA 2YWOA 2PERA 4EL1A 2LRNA 5HQPA 3LW9A 3HXSA 4G10A 2H0HA 5JWQB 3ERFA 5CREA 4EIPA 2GDRA 4HDEA 2DC5A 1ZGNA 3TJGA 3P7XA 2LNTA 1W4VA 4FIWA 3QR6A 1V2AA 4PXOA 1G7EA 1TU7A 2LUSA 2QC7A 5D9WA 4CDOA 1F2EA 5D73A 4WBRD 5A5KA 2DSAA 4TR0A 3HJPA 4HOJA 3UVHA 1OC8A 2B1KA 2HI7A 2DIYA 2CV4A 4EKZA 2X99A 5IMCA 1E2YA 3M9JA 2WRTA 3CRUA 1WMJA 1ERTA 2RM6A 4K1FA 2L6DA 2L5LA 3D22A 2RM5A 1BJXA 2GGTA 3ED3A 1HNCA 3TDGA 3L9UA 4FH8A 4MH3A 4OWYA 4YAVA 5DQSA 4TR4A 4POMA 5B8BA 4QL9A 2IFQB 3K8NA 2WJUA 2C3QA 5G31A 2J23A 1T4ZA 4IJIA 5JWOB 2PN8A 3O6TA 4KDXA 2XPEA 4PUFC 2NDOA 1O81A 1B48A 3VURA 3ZIJA 3KM6A 4JE1A 2TIRA 4IELA 2GQKA 4I2TA 1NW2A 2PU9C 3DGQA 3D4MA 2QA1A 1V98A 3Q18A 3ZFLA 2R0PA 1R5PA 1EZKA 4IHUA 3DMLA 3KH7A 4I8BA 4ZXGA 2RIIA 1XFLA 3ZYWA 1BG5A 2CZ2A 5IQYA 2H66A 1H75A 2XBIA 1SK1A 2I1UA 1Z7PA 5ECLB 3E3EA 3MDKA 3ZLPA 3GX0A 1YF0A 3OR5A 3HYPA 3QPMA 5B8AA 2GZZA 1GTUA 1AAZA 1SKWB 4LLRA 4YH2A 3C71A 4L5LA 4N10A 2YANA 2HFDA 1HYUA 2G0FA 5J41A 3FR9A 1EP7A 4FO5A 4K2DA 2JSZA 3FZAA 2IMIA 1AW9A 2HT9A 3A2WA 2VLVA 1X9WB 4ECCA 1TTZA 3TB2A 1S3CA 3EVIA 1VF4A 4KNDA 3F9UA 2GSRA 1TJDA 1AXDA 5H5RA 3VWWA 4RQRA 1OC9B 4ZIJA 2C3TA 1PKWA 2GT5A 2FWGA 2HE3A 1FG4A 3HZ4A 4YKFA 1JFUA 4XRAA 2L57A 3VWVA 2FUG2 2CAIA 2C8UA 4KAEA 3ZL5A 3DD3A 5GSTA 1SU9A 3IBHA 4MPFA 5AIXA 1RK4A 3CXGA 4F0BA 1XWBA 3MNGA 4F2IA 3M0FA 4PTSA 1GTAA 4KUNA 3I43A 5LNKe 1UVZA 2FA8A 3TKSA 5CAXA 4LL4B 4MDCA 3UAPA 2IJYA 5BRTA 1X5DA 2H74A 1H4OA 4PQIA 5ECIB 3C1SA 3TOUA 4E8HA 2FWEA 5CP1A 3GNJA 1CQGA 4GSTA 1TK8B 1TI1A 3G7JA 4CHSA 2H0GA 4JBBA 4XS4A 1YDKA 2L4QA 2Z9SA 3CRTA 1SD9A 3GKXA 4RUVA 4L0UA 2E2GA 3BCIA 2CX4A 3W6GA 1A2JA 4MMMA 2DKHA 1ON4A 3S9FA 1U6TA 1GSSA 4K7IA 2PUKC 3KCMA 3LG6A 1QGVA 1AC1A 2X8CA 1GSUA 1ERUA 1OC3A 1XW5A 3FZ4A 3UVTA 4ISDA 4EXJA 2ZUPA 4D73B 2GVPA 1TRWA 2WFCA 4NV2A 2CT6A 1K0OA 2XPDA 3BBYA 4USSA 4G9HA 4V2MA 4V1Ag 3SWLA 2RLIA 2B7JA 2R2JA 2MMAA 1FB6A 4V2NA 2VL2C 1SL2B 5H5QA 1YZXA 3FZ9A 2YJ7A 1XIYA 2A2RA 3W8SA 1UN2A 2X4AA 2DMLA 5D96A 1LBKA 17GSA 1SYRA 1YKCA 2VLTA 3LXZA 3KJYA 1GTIA 1A8LA 1TRSA 1X9SB 1X5EA 5DJLA 1FOVA 3F0IA 1A24A 3QCPA 3ZRDA 2C80A 3CSHA 4J56E 4TKYA 4Q5QA 11GSA 5A4UA 5HR0A 1TRVA 4EO3A 4HZ2A 1J0FA 1TP9A 1M7TA 2I3YA 5JCGA 5A4VA 3A5WA 4MP4A 5KN3A 1X9MB 4ZBBA 4LL1B 4ZILA 4I2UA 4D73A 4YQVA 1TDIA 1AUCA 2VOCA 4MF7A 4WR5A 4BA7A 3H4KA 5DQYA 2WULA 1SL1B 4CY6A 5IPHA 2YNXA 2KLXA 3F4RA 2CAQA 3GSTA 3WGEA 2TRXA 3KEBA 1B4PA 2MBSA 1EWXA 1OAZA 3KMOA 1PX6A 4YQUA 2P31A 1GSFA 4AGSA 2OE0A 2O7KA 1A0FA 2P0GA 4GWRA 2CQ9A 5E59A 4POLA 3L9VA 1XXUA 4FYUA 1K0MA 5ECPB 3AY8A 3MWHA 4K7OA 3RHCA 1Z9HA 2ON7A 1ACVA 2PVQA 4ILFA 2M72A 3RBTA 5B6NA 4PQHA 2H8LA 2E7PA 3W8JA 4GF0A 4KF9A 1ABAA 1DSBA 4XRDA 2DBCA 4AJ8A 6GSXA 3ZIVA 3CSJA 3DWVA 4J57E 3HDCA 1USBA 1NSWA 1UC7A 3F6DA 3UMAA 3QFBC 3US3A 2HRNA 3TRPA 3GKKA 5G1KA 3KH9A 3GTUB 4MZBA 2M46A 1ZYPA 4F0CA 2B7KA 2CA8A 2WZ9A 4L8EA 4JR6A 3HHVA 2HLSA 2VCTA 2WB9A 5EY6A 1PD21 5JWRB 3GKMA 5JCUA 1WIKA 2HZFA 12GSA 2AUVA 3HVVA 3JCML 3E0UA 2FWFA 4KH7A 2VIMA 4KDUA 4BWQA 2C1YA 2DJ0A 1V9WA 4ZBAA 4KDYA 3CSIA 2HSMA 2V2GA 3RPNA 3P2AA 3A2XA 3DVWA 1XW6A 3FY7A 1TW9A 2B5EA 1MTCA 1XWGA 3DIEA 2GTUA 3C7MA 2QGVA 2XHFA 4PURA 5ELGA 2YWMA 3N5OA 3F4SA 4HJMA 1C72A 3D21A 3EMPA 2PGTA 2GQMA 3P90A 2EIOA 2DMMA 5KEJA 3EC3A 4F82A 7GSSA 3DEXA 5KN1A 5IMAA 4DSSB 4ECIA 3F3QA 2IIYA 5CNWA 1JZWA 4KX4A 3U6VA 2YV9A 2AV4A 1TU8A 2X64A 5A4WA 3P8WA 1XBSA 1RW1A 3ZFBA 1EV9A 4K2XA 1I9DA 1Q4JA 4ML6A 3FEUA 4BVYB 2R3XA 3SBCA 1R4WA 4JZQA 1LJRA 1T1VA 1U3AA 2N5AA 3U5RE 1WP0A 2GSQA 2LRCA 1B8XA 1VF1A 3EE2A 3HZ8A 3ERGA 2HSYA 2FCHA 2EC4A 4MA9A 2FNOA 5CO3A 3GUSA 3GRXA 5E4WA 2R4VA 4Q5RA 3KP9A 2IMDA 2WGRA 3GIXA 3TKRA 4N30A 5GAPD 3DYRA 1QXHA 3PPUA 4RI6A 5AN1A 2KUCA 4F03A 2H1DA 1IYIA 3O3TA 4WEYA 2VD1A 1GSEA 2K8VA 2IWTA 3HVXA 2WCIA 3TJBA 4XCSA 2ES7A 1OE7A 3L0HA 4EDZA 2WS2A 4DSSA 2OJLA 1HNAA 2ON5A 6GSYA 3ZREA 2PWJA 1SJIA 2DJKA 1FVKA 1WJKA 5D93A 3DKSA 3M9KA 4BVYA 3FRCA 4LA1A 3I6AA 1B4QA 4OFNA 4IGJA 5CRDA 2I9HA 2DJJA 2IMKA 3DXBA 4HQZA 3F4TA 3EYTA 5G30A 3RPPA 1T3BA 3QD9A 1NM3A 4MZWA 1MD3A 2F9SA 1XZOA 1GSDA 1FVJA 5G2ZA 3BOAA 4N0VA 4X43A 4ZB6A 2VD0A 3KTBA 4ZL9A 2FHEA 4WF5A 2DJ3A 1WPIA 5GZZB 5ENUA 3TCOA 3EURA 2H73A 2MYGA 4OO5A 1XW9A 4XS4B 4ZB8A 5KN0A 4Z7XA 2IMFA 4TR3A 2QKEA 5IMFA 4K5SA 3FW2A 1G6YA 2VM2A 4O5QA 3KXOA 4AJ7A 1ZYQB 4L0WA 1THOA 3D4TA 5FWGA 4FYCA 1TKDB 4GQCA 2K9FA 2ZCTA 2YOIA 2GSTA 8GSSA 1SKRB 3F63A 3F3RA 3HD5A 3IC4A 1FO5A 1PN0A 1GLQA 5HFGA 4EC0A 2GS3A 2V1MA 5DDLA 2FWHA 4PGTA 1SYXA 2V6OA 1F9MA 2KP2A 2L5OA 1M2DA 1YKAA 3C8EA 4F9ZA 4XS6A 2JU5A 4IP6A 5HR3A 1J08A 3KGKA 4GLTA 4MF5A 3EINA 2H72A 2O8VB 3GKNA 1WOUA 1Q98A 1JZRA 4TOPA 1WE0A 1KTEA 1DUGA 1R5AA 5J3RA 1YQ1A 3KD0A 4OFTA 3H1NA 2RUEA 5IIZA 3J7Yk 2L59A 1XPVA 3UARA 1AQXA 2LSTA 4WBJA 1N8JA 1W89A 3F8UA 1M2AA 2HNLA 4TRXA 2LEGA 2X8HA 3IHQA 2YZUA 3QAGA 4OO4A 3RHBA 22GSA 2LTKA 2YCDA 4GSNA 3LORA 1GUHA 4OMVA 2H19A 4DEJA 3FK8A 3HY2A 4Q5FA 6GSTA 1TI3A 4CW9A 2H0IA 3C73A 2ALBA 2JZTA 3KIJA 2AJQB 2A4VA 2H6YA 2MMNA 3H93A 2YWNA 2G2QA 1B9XC 4ID0A 2H71A 4HU9A 4K7NA 2R6KA 4O92A 4IQAA 3KTLA 2HSHA 3LXTA 3TJJA 2X8GA 5ECRB 4X4JA 2E0QA 3D0ZA 1VGLA 1ZOFA 1JZOA 1O8XA 1OYJA 1AQWA 1OKDA 1QMVA 2DKIA 3UOMA 2R0CA 1LU4A 2FD3A 2R0GA 3A5IA 2GSSA 2LRTA 1OVNA 4KCAA 3MSZA 2C0FA 3ZZXA 3CTGA 3FR6A 4WXTA 2DLXA 4HJ2A 19GSA 5AIVA 3HA9A 1A8YA 3WYWA 4KB3A 5J4UA 2CVBA 2NBSA 5IO0A 3GV1A 3I69A 4WKWA 1Y6EA 2JZSA 6GSSA 2HRFA 4XTSA 1DBYA 3A3TA 4PNFA 5IOXA 1A2MA 2OACA 4ULXA 4GTUA 2V6KA 4G0IA 2HZEB 5DALA 2H6XA 4GQFA 5KOXA 2B5XA 3APSA 1YJ6A 4KW6A 1VF2A 4IP1A 4K8MA 3KMNA 4K5RA 5EVOA 1DE2A 1SKSB 2I4AA 2MMZA 3TUEA 1GLPA 2K6VA 2KHPA 5DAKB 2YN1A 1PX7A 2O85A 2IPAA 4V2LA 1Y25A 2YWIA 3R3EA 2AHEA 1FOHA 2O89A 4YKGA 2OADA 3O76A 3WGDA 3CBUA 1SD8A 2GZPA 1T8EB 3FHKA 4QQ7A 2QSIA 4I97A 2H01A 4TVEA 4O5UA 3LWAA 3LYPA 1TRUA 2F3MA 3ISOA 3APQA 2F51A 2FY6A 4PX1A 1KBNA 1OE8A 1XWKA 1XWAA 4ECBA 3LJRA 5D8IA 2VL9A 1E6BA 2TRCP 3GHAA 2K18A 4LMVA 5BMUA 1M2BA 5HR2A 1QFNA 3QAWA 3I9V2 3IA1A 4HZ4A 1Z5YE 2MZCA 2VLUA 3GFKA 1NHYA 3TOTA 3MIXA 1XVQA 4NV5A 1KNGA 3PINA 1ST9A 4P3YB 5CRWA 2HZEA 5KN2A 1VF3A 2LQQA 3R2QA 4JU5A 1ERWA 2IL3A 4MCUA 4MJBA 4E8EA 1M0UA 3FKFA 2C0EA 1K0CA 4BVXA 4HEA2 4MF6A 2X49A 4TXVA 1B9YC 1O85A 1A23A 3Q19A 2YJHA 5DAKA 1K0BA 1N2AA 5G1LA 4MJCA 2H76A 1EOGA 3NOFA 2MBTA 5AISA 2MMOA 3IRAA 3IAM2 5F07A 3IK7A 1PKZA 5ECNB 1ERVA 3IE3A 3ERWA 4RI7A 1Z7RA 2C0GA 1EEMA 4MABA 4K9ZA 1JHBA 1GUMA 2GLRA 1ZL9A 2WDUA 4O32A 1AQVA 4CY8A 3GL5A 3Q74A 5HFIA 2H6ZA 1GH2A 2VL2A 2NPBA 1PQNA 4O5RA 4NWYA 3VWXA 4TR1B 5ECQB 3CMIA 1K0NA 3VK9A 4KA0A 10GSA 4KCEA 4NPBA 4TXOB 1K0AA 2BMXA 3E9JB 1R26A 1SK2A 1VRSD 1GULA 1ZYNA 4A5PA 2LQOA 2R5GA 4X0XA 2R37A 3HKRA 2A4HA 3C1RA 4ML1A 5ID2A 1AIUA 5H5SA 3KZQA 1O6JA 3MYDA 4L5OA 1J9BA 4JEDA 2XC2A 2REMA 1QQ2A 3TKSC 3NZNA 2VO4A 4NHZA 1EGOA 5IOWA 4NHWA 3GMFA 5IPGA 3UEMA 1V57A 3IR4A 3G7YA 4J2FA 1MDKA 1EGRA 5DCHA 4EF0A 5IMDA 2YPMA 2FGXA 5IMVA 3L78A 3G9BA 2YP6A 3TRQA 5LD0A 1U3IA 3GA4A 2OKAA 4OCEA 2OBKA 1NHOA 2H1AA 1THXA 5ECSA 3QOUA 3IPZA 3UBLA 5J9BA 1PSQA 3N9JA 2VM1A 2N5BA 1QK8A 3IAS2 4TR1A 1SL0B 3VPQA 1YY7A 1XWCA 4TXOA 5EPFA 1WRYA 4ZL8A 3RAZA 1FAAA 1SENA 4ZBDA 1PGTA 3GN3A 3MAKA 3QFAC 1PL2A 3GURA 3HVSA 5JCWA 5HFKA 5GAND 3QAVA 1V40A 3DVXA 5AGYA 3RDWA 3V1WA 2YZHA 1A0RP 2KOKA 4ZL7A 2HXKA 5ECMB 3A2VA 6GSUA 1T7PB 1WWJA 5DJMA 1ZMAA 1PA3A 2N5FA 1XOBA 1U88A 4G2EA 4EVMA 5IO2A 3ZVJD 2H70A 2VL3A 1TK5B 5F05A 3VLNA 1G7OA 2D2ZA 2BTOT 2OE1A 2ZNMA 1GNWA 4IJ3A 1JZDA 4ICYA 1URMA 3LEFA 5IM9A 1BX9A 2AAWA 2FA4A 4I5QA 4V1Ap 1ZCPA 5COHA 3M3MA 4WF4A 3VFIA 3FR3A 1S3AA 4AF2A 2LJAA 1EV4A 3IXRA 2JADA 4NXIA 2CVDA 1HD2A 4IBPA 2A2SA 2PVOC 3L4NA 4HS1A 2PPTA 2IFQA 3GSSA 3ZVJA 4QL7A 4N11A 4MLYA 2GZYA 2DIZA 2BJXA 5GSSA 2UZ8A 2JACA 1O73A 3G7IA 4MJAA 1T4YA 1M99A 1MEKA 3LGCA 3ZMKA 3FYGA 3TJKA 3FZ5A 5D9TA 2L4CA 5ECHB 5ABRA 1DE1A 1Z3EA 4Z2RA 4ZB9A 3UIWA 2IMEA 3TGZA 1GSQA 4EE0A 4HU7A 5CRHA 2V32A 3WT2A 5ECOB 2DJ2A 4WR4A 4EUYA 2FLSA 2EIRA 5F8BA 5D9VA 1F3BA 1S3DA 4O7HA 2CVKA 4I6XA 3LQ7A 1M9BA 2VCVA 1O8WA 2VAFA 2VCWA 3BD2A 3GH6A 3EMXA 5ELAA 3TRXA 4JR4A 1PN9A 3IC8A 4Z2TA 1JLWA 1BEDA 3IK9A 1HNBA 4KE3A 4BL7B 2F8FA 1EP8A 2RUFA 2OE3A 2PMTA 3VPTA 2LJRA 3BCKA 1K3LA 3EU3A 1K3OA 3EWLA 4IS0A 2YV7A 4POKA 2NVLA 3L9SA 4PQ1A 1OC9A 4TN8A 3GL3A 1F37A 4XIHA 3VWUA 4ACSA 4G0LA 3LSZA 3M1GA 2LJKA 2A2PA 5ECKB 1T00A 4EIQA 1GNEA 4Q5NA 9GSSA 1RQMA 3IOSA 5G5FA 1IYHA 1PMTA 5DALB 3WD6A 5EL8A 1KEBA 2NTOA 3QMXA 5F06A 2XBQA 3HJMA 1K0DA 4G19A 1FB0A 1SK0A 3UJ1A 4KSOA 2C0DA 1G6WA 5KOWA 2B3SA 3PH9A 2L6CA 2GT6A 3WGXA 2B5YA 1OKTA 2JZRA 4JRRA 4MPGA 1MD4A 1XOAA 3D6IA 4XS1A 4YQMA 2OA7A 2KP1A 3H8QA 1Z6NA 4MNNA 4FYBA 3PGTA 2B1LA 1XCCA 1BAYA 1PRXA 2C3NA 2E2MA 1M9AA 4N0ZA 1FW1A 4IN0A 4BL7A 5B7CA 3GH9A 4OCFA 1X5CA 4X1UA 4OFMA 1TK0B 5J9CA 2K8SA 5F0GA 5CRGA 1GRXA 3FMWA 1PL1A 6GSVA 2LV3A 2B6MA 4BWSA 2AB6A 1X0RA 2PBJA 5IMZA 1I5GA 3D5JA 4KGIA 4PNGA 2HYXA 2OBIA 4GSSA 2IN3A 5C00A 3TKPA 3ZITA 1R7HA 1U87A 1A2LA 1YF1A 2JSYA 1GL8A 4ECJA 2M80A 4K0GA 2HRAA 4OD7A 2GQLA 1ZZYA 2I81A 3LYKA 4H86A 1XVWA 5HR1A 1GWCA 3F6FA 2V41A 3HCZA 2P5RA 1CQHA 4BVXB 4HUAA 1EEJA 3WT1A 4FQUA 3Q6OA 1HQOA 4GRFA 5C04A 5DVBA 1F3AA 5FT3A 1YEPA 1Z6MA 4KSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JL4 A;  4IKH A;  2LS5 A;  4GCI A;  3GYK A;  2VCX A;  4DSQ A;  4LMW A;  3M8N A;  4IVF A;  4XHM A;  1BYE A;  1FHE A;  3ME8 A;  2LNS A;  5CYY A;  4GXZ A;  1F6M C;  1TOF A;  4K6X A;  2H30 A;  14GS A;  1GUK A;  1GSY A;  1MDJ A;  1SJZ A;  1UA5 A;  1ML6 A;  2LKU A;  3GX8 A;  1QUW A;  3HJO A;  2C4J A;  4NMU A;  5D9X A;  4AJ6 A;  4YAP A;  2O87 A;  2VUP A;  13GS A;  1EOH A;  4IW9 A;  3H79 A;  2EIQ A;  4DSR A;  5L71 A;  2DJ1 A;  1SJ6 A;  5LCZ A;  1K3Y A;  5INY A;  2H1G A;  3CYN A;  3VI7 A;  4TW5 A;  2F8A A;  5DCG A;  3UL3 A;  5ID2 B;  1G0T A;  4IQ1 A;  4MK3 A;  3IDV A;  3PR8 A;  3IV4 A;  1YEX A;  1JLV A;  4MJE A;  3TJF A;  5J5N A;  4MH2 A;  4HQS A;  2H75 A;  18GS A;  1ILO A;  3UBK A;  1V58 A;  5DBQ A;  4PUA A;  4RQX A;  2H1B A;  2VCQ A;  3TKS E;  4BPY A;  1MDI A;  5B6M A;  2VCZ A;  1O7U A;  4WET A;  4HI7 A;  4POB A;  2P5Q A;  1BQ7 A;  3APO A;  3QDN A;  16GS A;  3EU4 A;  3CTF A;  1GP1 A;  4EDY A;  3ZTL A;  1TXX A;  4NAX A;  2AYT A;  3LFL A;  4DVC A;  6GSW A;  1GTB A;  2J9H A;  20GS A;  2CZ3 A;  3NIV A;  3ZML A;  1ZYE A;  3J7Y b;  3KP8 A;  2CX3 A;  5FHI A;  3BJ5 A;  3DRN A;  5G5E A;  3VI5 A;  3ME7 A;  3TKQ A;  4MZC A;  4K0N A;  3GTU A;  2YWO A;  2PER A;  4EL1 A;  2LRN A;  5HQP A;  3HXS A;  4G10 A;  2H0H A;  5JWQ B;  3ERF A;  5CRE A;  2GDR A;  4HDE A;  2DC5 A;  1ZGN A;  3TJG A;  3P7X A;  2LNT A;  1W4V A;  4FIW A;  3QR6 A;  1V2A A;  4PXO A;  1G7E A;  1TU7 A;  2LUS A;  2QC7 A;  5D9W A;  4CDO A;  1F2E A;  5D73 A;  4WBR D;  5A5K A;  2DSA A;  4TR0 A;  3HJP A;  4HOJ A;  3UVH A;  1OC8 A;  2B1K A;  2HI7 A;  2DIY A;  2CV4 A;  4EKZ A;  2X99 A;  5IMC A;  1E2Y A;  3M9J A;  2WRT A;  3CRU A;  1WMJ A;  1ERT A;  2RM6 A;  4K1F A;  2L6D A;  2L5L A;  3D22 A;  2RM5 A;  1BJX A;  2GGT A;  3ED3 A;  1HNC A;  3TDG A;  3L9U A;  4FH8 A;  4MH3 A;  4OWY A;  4YAV A;  5DQS A;  4TR4 A;  4POM A;  5B8B A;  4QL9 A;  2IFQ B;  3K8N A;  2WJU A;  2C3Q A;  5G31 A;  2J23 A;  1T4Z A;  4IJI A;  5JWO B;  2PN8 A;  3O6T A;  4KDX A;  2XPE A;  4PUF C;  2NDO A;  1O81 A;  1B48 A;  3VUR A;  3ZIJ A;  3KM6 A;  4JE1 A;  2TIR A;  4IEL A;  2GQK A;  4I2T A;  1NW2 A;  2PU9 C;  3DGQ A;  3D4M A;  1V98 A;  3Q18 A;  3ZFL A;  1R5P A;  1EZK A;  4IHU A;  3DML A;  3KH7 A;  4I8B A;  4ZXG A;  2RII A;  1XFL A;  3ZYW A;  1BG5 A;  2CZ2 A;  5IQY A;  2H66 A;  1H75 A;  2XBI A;  1SK1 A;  2I1U A;  1Z7P A;  5ECL B;  3E3E A;  3MDK A;  3ZLP A;  3GX0 A;  1YF0 A;  3OR5 A;  3HYP A;  3QPM A;  5B8A A;  2GZZ A;  1GTU A;  1AAZ A;  1SKW B;  4LLR A;  4YH2 A;  3C71 A;  4L5L A;  4N10 A;  2YAN A;  2HFD A;  1HYU A;  2G0F A;  5J41 A;  3FR9 A;  1EP7 A;  4FO5 A;  4K2D A;  2JSZ A;  3FZA A;  2IMI A;  1AW9 A;  2HT9 A;  3A2W A;  2VLV A;  1X9W B;  4ECC A;  1TTZ A;  3TB2 A;  1S3C A;  3EVI A;  1VF4 A;  4KND A;  3F9U A;  2GSR A;  1TJD A;  1AXD A;  5H5R A;  3VWW A;  4RQR A;  1OC9 B;  4ZIJ A;  2C3T A;  1PKW A;  2GT5 A;  2FWG A;  2HE3 A;  1FG4 A;  3HZ4 A;  1JFU A;  4XRA A;  2L57 A;  3VWV A;  2FUG 2;  2CAI A;  2C8U A;  4KAE A;  3ZL5 A;  3DD3 A;  5GST A;  1SU9 A;  3IBH A;  4MPF A;  5AIX A;  1RK4 A;  3CXG A;  4F0B A;  1XWB A;  3MNG A;  4F2I A;  3M0F A;  1GTA A;  4KUN A;  3I43 A;  5LNK e;  1UVZ A;  2FA8 A;  3TKS A;  5CAX A;  4LL4 B;  4MDC A;  3UAP A;  2IJY A;  1X5D A;  2H74 A;  1H4O A;  4PQI A;  5ECI B;  3C1S A;  3TOU A;  4E8H A;  2FWE A;  5CP1 A;  3GNJ A;  1CQG A;  4GST A;  1TK8 B;  1TI1 A;  3G7J A;  4CHS A;  2H0G A;  4JBB A;  4XS4 A;  1YDK A;  2L4Q A;  2Z9S A;  3CRT A;  1SD9 A;  3GKX A;  4RUV A;  4L0U A;  2E2G A;  3BCI A;  2CX4 A;  3W6G A;  1A2J A;  4MMM A;  1ON4 A;  3S9F A;  1U6T A;  1GSS A;  4K7I A;  2PUK C;  3KCM A;  3LG6 A;  1QGV A;  1AC1 A;  2X8C A;  1GSU A;  1ERU A;  1OC3 A;  1XW5 A;  3FZ4 A;  3UVT A;  4ISD A;  4EXJ A;  2ZUP A;  4D73 B;  2GVP A;  1TRW A;  2WFC A;  4NV2 A;  2CT6 A;  1K0O A;  2XPD A;  3BBY A;  4G9H A;  4V2M A;  4V1A g;  3SWL A;  2RLI A;  2B7J A;  2R2J A;  2MMA A;  1FB6 A;  4V2N A;  2VL2 C;  1SL2 B;  5H5Q A;  1YZX A;  3FZ9 A;  2YJ7 A;  1XIY A;  2A2R A;  3W8S A;  1UN2 A;  2DML A;  5D96 A;  1LBK A;  17GS A;  1SYR A;  1YKC A;  2VLT A;  3LXZ A;  3KJY A;  1GTI A;  1A8L A;  1TRS A;  1X9S B;  1X5E A;  5DJL A;  1FOV A;  3F0I A;  1A24 A;  3QCP A;  3ZRD A;  2C80 A;  3CSH A;  4J56 E;  4TKY A;  4Q5Q A;  11GS A;  5A4U A;  5HR0 A;  1TRV A;  4EO3 A;  4HZ2 A;  1J0F A;  1TP9 A;  1M7T A;  2I3Y A;  5JCG A;  5A4V A;  3A5W A;  4MP4 A;  5KN3 A;  1X9M B;  4ZBB A;  4LL1 B;  4ZIL A;  4I2U A;  4D73 A;  4YQV A;  1TDI A;  1AUC A;  2VOC A;  4MF7 A;  4WR5 A;  4BA7 A;  3H4K A;  5DQY A;  2WUL A;  1SL1 B;  5IPH A;  2YNX A;  2KLX A;  3F4R A;  2CAQ A;  3GST A;  3WGE A;  2TRX A;  3KEB A;  1B4P A;  2MBS A;  1EWX A;  1OAZ A;  3KMO A;  1PX6 A;  4YQU A;  2P31 A;  1GSF A;  4AGS A;  2OE0 A;  2O7K A;  1A0F A;  2P0G A;  4GWR A;  2CQ9 A;  5E59 A;  4POL A;  3L9V A;  1XXU A;  4FYU A;  1K0M A;  5ECP B;  3AY8 A;  3MWH A;  4K7O A;  3RHC A;  1Z9H A;  2ON7 A;  1ACV A;  2PVQ A;  4ILF A;  2M72 A;  3RBT A;  5B6N A;  4PQH A;  2H8L A;  2E7P A;  3W8J A;  4GF0 A;  1ABA A;  1DSB A;  4XRD A;  2DBC A;  4AJ8 A;  6GSX A;  3ZIV A;  3CSJ A;  3DWV A;  4J57 E;  3HDC A;  1USB A;  1NSW A;  1UC7 A;  3F6D A;  3UMA A;  3QFB C;  3US3 A;  2HRN A;  3TRP A;  3GKK A;  5G1K A;  3KH9 A;  3GTU B;  4MZB A;  2M46 A;  4F0C A;  2B7K A;  2CA8 A;  2WZ9 A;  4L8E A;  4JR6 A;  3HHV A;  2HLS A;  2VCT A;  2WB9 A;  5EY6 A;  1PD2 1;  5JWR B;  3GKM A;  5JCU A;  1WIK A;  2HZF A;  12GS A;  2AUV A;  3HVV A;  3JCM L;  3E0U A;  2FWF A;  4KH7 A;  2VIM A;  4KDU A;  4BWQ A;  2C1Y A;  2DJ0 A;  1V9W A;  4ZBA A;  4KDY A;  3CSI A;  2V2G A;  3RPN A;  3P2A A;  3A2X A;  3DVW A;  1XW6 A;  3FY7 A;  1TW9 A;  2B5E A;  1MTC A;  1XWG A;  3DIE A;  2GTU A;  3C7M A;  2QGV A;  2XHF A;  4PUR A;  5ELG A;  2YWM A;  3N5O A;  3F4S A;  4HJM A;  1C72 A;  3D21 A;  3EMP A;  2PGT A;  2GQM A;  3P90 A;  2EIO A;  2DMM A;  5KEJ A;  3EC3 A;  4F82 A;  7GSS A;  3DEX A;  5KN1 A;  5IMA A;  4DSS B;  4ECI A;  3F3Q A;  2IIY A;  5CNW A;  1JZW A;  4KX4 A;  3U6V A;  2YV9 A;  2AV4 A;  1TU8 A;  2X64 A;  5A4W A;  3P8W A;  1XBS A;  1RW1 A;  3ZFB A;  1EV9 A;  1I9D A;  1Q4J A;  4ML6 A;  3FEU A;  2R3X A;  3SBC A;  1R4W A;  4JZQ A;  1LJR A;  1T1V A;  1U3A A;  2N5A A;  3U5R E;  1WP0 A;  2GSQ A;  2LRC A;  1B8X A;  1VF1 A;  3EE2 A;  3HZ8 A;  3ERG A;  2HSY A;  2FCH A;  2EC4 A;  4MA9 A;  2FNO A;  5CO3 A;  3GUS A;  3GRX A;  5E4W A;  2R4V A;  3KP9 A;  4Q5R A;  2IMD A;  2WGR A;  3GIX A;  3TKR A;  4N30 A;  5GAP D;  3DYR A;  1QXH A;  4RI6 A;  5AN1 A;  2KUC A;  4F03 A;  2H1D A;  1IYI A;  3O3T A;  4WEY A;  2VD1 A;  1GSE A;  2K8V A;  2IWT A;  3HVX A;  2WCI A;  3TJB A;  4XCS A;  2ES7 A;  1OE7 A;  3L0H A;  4EDZ A;  2WS2 A;  4DSS A;  2OJL A;  1HNA A;  2ON5 A;  6GSY A;  3ZRE A;  2PWJ A;  1SJI A;  2DJK A;  1FVK A;  1WJK A;  5D93 A;  3DKS A;  3M9K A;  4BVY A;  3FRC A;  4LA1 A;  3I6A A;  1B4Q A;  4OFN A;  4IGJ A;  5CRD A;  2I9H A;  2DJJ A;  2IMK A;  3DXB A;  4HQZ A;  3F4T A;  3EYT A;  5G30 A;  3RPP A;  1T3B A;  3QD9 A;  1NM3 A;  4MZW A;  1MD3 A;  2F9S A;  1XZO A;  1GSD A;  1FVJ A;  5G2Z A;  3BOA A;  4N0V A;  4X43 A;  4ZB6 A;  2VD0 A;  3KTB A;  4ZL9 A;  2FHE A;  4WF5 A;  2DJ3 A;  1WPI A;  5GZZ B;  5ENU A;  3TCO A;  3EUR A;  2H73 A;  2MYG A;  4OO5 A;  1XW9 A;  4XS4 B;  4ZB8 A;  5KN0 A;  4Z7X A;  2IMF A;  4TR3 A;  2QKE A;  5IMF A;  3FW2 A;  1G6Y A;  2VM2 A;  3KXO A;  4AJ7 A;  1ZYQ B;  4L0W A;  1THO A;  3D4T A;  5FWG A;  4FYC A;  1TKD B;  4GQC A;  2K9F A;  2ZCT A;  2YOI A;  2GST A;  8GSS A;  1SKR B;  3F63 A;  3F3R A;  3HD5 A;  3IC4 A;  1FO5 A;  1GLQ A;  5HFG A;  4EC0 A;  2GS3 A;  2V1M A;  5DDL A;  2FWH A;  4PGT A;  1SYX A;  2V6O A;  1F9M A;  2KP2 A;  2L5O A;  1M2D A;  1YKA A;  3C8E A;  4F9Z A;  4XS6 A;  2JU5 A;  4IP6 A;  5HR3 A;  1J08 A;  3KGK A;  4GLT A;  4MF5 A;  3EIN A;  2H72 A;  2O8V B;  3GKN A;  1WOU A;  1Q98 A;  1JZR A;  4TOP A;  1WE0 A;  1KTE A;  1DUG A;  1R5A A;  5J3R A;  1YQ1 A;  3KD0 A;  4OFT A;  3H1N A;  2RUE A;  5IIZ A;  3J7Y k;  2L59 A;  1XPV A;  3UAR A;  1AQX A;  2LST A;  4WBJ A;  1N8J A;  1W89 A;  3F8U A;  1M2A A;  2HNL A;  4TRX A;  2LEG A;  2X8H A;  3IHQ A;  2YZU A;  3QAG A;  4OO4 A;  3RHB A;  22GS A;  2LTK A;  2YCD A;  4GSN A;  3LOR A;  1GUH A;  4OMV A;  2H19 A;  4DEJ A;  3FK8 A;  3HY2 A;  4Q5F A;  6GST A;  1TI3 A;  4CW9 A;  2H0I A;  3C73 A;  2ALB A;  2JZT A;  3KIJ A;  2AJQ B;  2A4V A;  2H6Y A;  2MMN A;  3H93 A;  2YWN A;  2G2Q A;  1B9X C;  4ID0 A;  2H71 A;  4HU9 A;  4K7N A;  2R6K A;  4O92 A;  4IQA A;  3KTL A;  2HSH A;  3LXT A;  3TJJ A;  2X8G A;  5ECR B;  2E0Q A;  3D0Z A;  1VGL A;  1ZOF A;  1JZO A;  1O8X A;  1OYJ A;  1AQW A;  1OKD A;  1QMV A;  3UOM A;  1LU4 A;  2FD3 A;  2GSS A;  2LRT A;  1OVN A;  4KCA A;  3MSZ A;  2C0F A;  3ZZX A;  3CTG A;  3FR6 A;  4WXT A;  2DLX A;  4HJ2 A;  19GS A;  5AIV A;  3HA9 A;  1A8Y A;  3WYW A;  4KB3 A;  5J4U A;  2CVB A;  2NBS A;  5IO0 A;  3GV1 A;  3I69 A;  4WKW A;  1Y6E A;  2JZS A;  6GSS A;  2HRF A;  4XTS A;  1DBY A;  3A3T A;  4PNF A;  5IOX A;  1A2M A;  2OAC A;  4ULX A;  4GTU A;  2V6K A;  2HZE B;  5DAL A;  2H6X A;  4GQF A;  2B5X A;  3APS A;  1YJ6 A;  4KW6 A;  1VF2 A;  4IP1 A;  4K8M A;  3KMN A;  5EVO A;  1DE2 A;  1SKS B;  2I4A A;  2MMZ A;  3TUE A;  1GLP A;  2K6V A;  2KHP A;  5DAK B;  2YN1 A;  1PX7 A;  2O85 A;  2IPA A;  4V2L A;  1Y25 A;  2YWI A;  2AHE A;  2O89 A;  2OAD A;  3O76 A;  3WGD A;  3CBU A;  1SD8 A;  2GZP A;  1T8E B;  3FHK A;  4QQ7 A;  2QSI A;  4I97 A;  2H01 A;  4TVE A;  3LWA A;  3LYP A;  1TRU A;  2F3M A;  3ISO A;  3APQ A;  2F51 A;  2FY6 A;  4PX1 A;  1KBN A;  1OE8 A;  1XWK A;  1XWA A;  4ECB A;  3LJR A;  5D8I A;  2VL9 A;  1E6B A;  2TRC P;  3GHA A;  2K18 A;  4LMV A;  1M2B A;  5HR2 A;  1QFN A;  3QAW A;  3I9V 2;  3IA1 A;  4HZ4 A;  1Z5Y E;  2MZC A;  2VLU A;  3GFK A;  1NHY A;  3TOT A;  1XVQ A;  4NV5 A;  1KNG A;  3PIN A;  1ST9 A;  4P3Y B;  5CRW A;  2HZE A;  5KN2 A;  1VF3 A;  2LQQ A;  3R2Q A;  4JU5 A;  1ERW A;  2IL3 A;  4MCU A;  4MJB A;  4E8E A;  1M0U A;  3FKF A;  2C0E A;  1K0C A;  4BVX A;  4HEA 2;  4MF6 A;  4TXV A;  1B9Y C;  1O85 A;  1A23 A;  3Q19 A;  2YJH A;  5DAK A;  1K0B A;  1N2A A;  5G1L A;  4MJC A;  2H76 A;  1EOG A;  3NOF A;  2MBT A;  5AIS A;  2MMO A;  3IRA A;  3IAM 2;  5F07 A;  3IK7 A;  1PKZ A;  5ECN B;  1ERV A;  3IE3 A;  3ERW A;  4RI7 A;  1Z7R A;  2C0G A;  1EEM A;  4MAB A;  4K9Z A;  1JHB A;  1GUM A;  2GLR A;  1ZL9 A;  2WDU A;  4O32 A;  1AQV A;  3GL5 A;  3Q74 A;  5HFI A;  2H6Z A;  1GH2 A;  2VL2 A;  2NPB A;  1PQN A;  4O5R A;  4NWY A;  3VWX A;  4TR1 B;  5ECQ B;  3CMI A;  1K0N A;  3VK9 A;  4KA0 A;  10GS A;  4KCE A;  4NPB A;  4TXO B;  1K0A A;  2BMX A;  3E9J B;  1R26 A;  1SK2 A;  1VRS D;  1GUL A;  2LQO A;  2R5G A;  4X0X A;  2R37 A;  3HKR A;  3C1R A;  4ML1 A;  5ID2 A;  1AIU A;  5H5S A;  3KZQ A;  1O6J A;  4L5O A;  1J9B A;  4JED A;  2XC2 A;  2REM A;  1QQ2 A;  3TKS C;  3NZN A;  2VO4 A;  4NHZ A;  1EGO A;  5IOW A;  4NHW A;  3GMF A;  5IPG A;  3UEM A;  1V57 A;  3IR4 A;  3G7Y A;  4J2F A;  1MDK A;  1EGR A;  5DCH A;  4EF0 A;  5IMD A;  2YPM A;  2FGX A;  5IMV A;  3L78 A;  3G9B A;  2YP6 A;  3TRQ A;  5LD0 A;  1U3I A;  3GA4 A;  2OKA A;  4OCE A;  2OBK A;  1NHO A;  2H1A A;  1THX A;  5ECS A;  3QOU A;  3IPZ A;  3UBL A;  5J9B A;  1PSQ A;  3N9J A;  2VM1 A;  2N5B A;  1QK8 A;  3IAS 2;  4TR1 A;  1SL0 B;  3VPQ A;  1YY7 A;  1XWC A;  4TXO A;  5EPF A;  1WRY A;  4ZL8 A;  3RAZ A;  1FAA A;  1SEN A;  4ZBD A;  1PGT A;  3GN3 A;  3MAK A;  3QFA C;  1PL2 A;  3GUR A;  3HVS A;  5JCW A;  5HFK A;  5GAN D;  3QAV A;  1V40 A;  3DVX A;  5AGY A;  3RDW A;  3V1W A;  2YZH A;  1A0R P;  2KOK A;  4ZL7 A;  2HXK A;  5ECM B;  3A2V A;  6GSU A;  1T7P B;  1WWJ A;  5DJM A;  1ZMA A;  1PA3 A;  2N5F A;  1XOB A;  1U88 A;  4G2E A;  4EVM A;  5IO2 A;  3ZVJ D;  2H70 A;  2VL3 A;  1TK5 B;  5F05 A;  3VLN A;  1G7O A;  2D2Z A;  2BTO T;  2OE1 A;  2ZNM A;  1GNW A;  4IJ3 A;  1JZD A;  1URM A;  3LEF A;  5IM9 A;  1BX9 A;  2AAW A;  2FA4 A;  4I5Q A;  4V1A p;  1ZCP A;  5COH A;  3M3M A;  4WF4 A;  3VFI A;  3FR3 A;  1S3A A;  4AF2 A;  2LJA A;  1EV4 A;  3IXR A;  2JAD A;  4NXI A;  2CVD A;  1HD2 A;  4IBP A;  2A2S A;  2PVO C;  3L4N A;  4HS1 A;  2PPT A;  2IFQ A;  3GSS A;  3ZVJ A;  4QL7 A;  4N11 A;  4MLY A;  2GZY A;  2DIZ A;  2BJX A;  5GSS A;  2JAC A;  1O73 A;  3G7I A;  4MJA A;  1T4Y A;  1M99 A;  1MEK A;  3LGC A;  3ZMK A;  3FYG A;  3TJK A;  3FZ5 A;  5D9T A;  2L4C A;  5ECH B;  5ABR A;  1DE1 A;  1Z3E A;  4ZB9 A;  3UIW A;  2IME A;  3TGZ A;  1GSQ A;  4EE0 A;  4HU7 A;  5CRH A;  2V32 A;  3WT2 A;  5ECO B;  2DJ2 A;  4WR4 A;  4EUY A;  2FLS A;  2EIR A;  5F8B A;  5D9V A;  1F3B A;  1S3D A;  4O7H A;  2CVK A;  4I6X A;  3LQ7 A;  1M9B A;  2VCV A;  1O8W A;  2VAF A;  2VCW A;  3BD2 A;  3GH6 A;  3EMX A;  5ELA A;  3TRX A;  4JR4 A;  1PN9 A;  1JLW A;  1BED A;  3IK9 A;  1HNB A;  4KE3 A;  2F8F A;  1EP8 A;  2RUF A;  2OE3 A;  2PMT A;  3VPT A;  2LJR A;  3BCK A;  1K3L A;  3EU3 A;  1K3O A;  3EWL A;  4IS0 A;  2YV7 A;  4POK A;  2NVL A;  3L9S A;  4PQ1 A;  1OC9 A;  4TN8 A;  3GL3 A;  1F37 A;  4XIH A;  3VWU A;  4ACS A;  3LSZ A;  3M1G A;  2LJK A;  5ECK B;  1T00 A;  1GNE A;  4Q5N A;  9GSS A;  1RQM A;  3IOS A;  5G5F A;  1IYH A;  1PMT A;  5DAL B;  3WD6 A;  5EL8 A;  1KEB A;  2NTO A;  3QMX A;  5F06 A;  2XBQ A;  3HJM A;  1K0D A;  4G19 A;  1FB0 A;  1SK0 A;  3UJ1 A;  4KSO A;  2C0D A;  1G6W A;  2B3S A;  3PH9 A;  2L6C A;  2GT6 A;  3WGX A;  2B5Y A;  1OKT A;  2JZR A;  4JRR A;  4MPG A;  1MD4 A;  1XOA A;  3D6I A;  4XS1 A;  4YQM A;  2OA7 A;  2KP1 A;  3H8Q A;  1Z6N A;  4FYB A;  3PGT A;  2B1L A;  1XCC A;  1BAY A;  1PRX A;  2C3N A;  2E2M A;  1M9A A;  4N0Z A;  1FW1 A;  4IN0 A;  4BL7 A;  5B7C A;  3GH9 A;  4OCF A;  1X5C A;  4X1U A;  4OFM A;  1TK0 B;  5J9C A;  2K8S A;  5F0G A;  5CRG A;  1GRX A;  1PL1 A;  6GSV A;  2LV3 A;  2B6M A;  4BWS A;  2AB6 A;  1X0R A;  2PBJ A;  5IMZ A;  1I5G A;  3D5J A;  4KGI A;  4PNG A;  2HYX A;  2OBI A;  4GSS A;  2IN3 A;  5C00 A;  3TKP A;  3ZIT A;  1R7H A;  1U87 A;  1A2L A;  1YF1 A;  2JSY A;  1GL8 A;  4ECJ A;  2M80 A;  4K0G A;  4OD7 A;  2GQL A;  1ZZY A;  2I81 A;  3LYK A;  4H86 A;  1XVW A;  5HR1 A;  1GWC A;  3F6F A;  2V41 A;  3HCZ A;  2P5R A;  1CQH A;  4HUA A;  1EEJ A;  3WT1 A;  3Q6O A;  1HQO A;  4GRF A;  5C04 A;  5DVB A;  1F3A A;  5FT3 A;  1YEP A;  1Z6M A;  4KSM A; 
#chains in the Genus database with same CATH topology
 2JL4 A;  4IKH A;  2LS5 A;  4GCI A;  3GYK A;  2VCX A;  4DSQ A;  3EPT A;  4LMW A;  3M8N A;  4IVF A;  4XHM A;  1BYE A;  4Z2U A;  1FHE A;  3ME8 A;  2LNS A;  5CYY A;  4GXZ A;  1F6M C;  1TOF A;  4K6X A;  3IHG A;  2H30 A;  14GS A;  1GUK A;  1GSY A;  1MDJ A;  1SJZ A;  1UA5 A;  1ML6 A;  2LKU A;  3GX8 A;  1QUW A;  3HJO A;  2C4J A;  4NMU A;  5D9X A;  4AJ6 A;  4YAP A;  2O87 A;  2VUP A;  13GS A;  1EOH A;  4IW9 A;  3H79 A;  2EIQ A;  4DSR A;  5L71 A;  2DJ1 A;  1SJ6 A;  5LCZ A;  1K3Y A;  5INY A;  2H1G A;  3CYN A;  3VI7 A;  4TW5 A;  2F8A A;  5DCG A;  3UL3 A;  5ID2 B;  1G0T A;  4IQ1 A;  4MK3 A;  3IDV A;  2QA2 A;  3PR8 A;  3IV4 A;  1YEX A;  1JLV A;  4MJE A;  3TJF A;  5J5N A;  4MH2 A;  4HQS A;  2H75 A;  18GS A;  1ILO A;  3UBK A;  1V58 A;  5DBQ A;  4PUA A;  4RQX A;  2H1B A;  2VCQ A;  3TKS E;  4BPY A;  1MDI A;  5B6M A;  2VCZ A;  1O7U A;  4WET A;  4HI7 A;  4POB A;  2P5Q A;  1BQ7 A;  3APO A;  3QDN A;  16GS A;  3EU4 A;  3CTF A;  1GP1 A;  4EDY A;  3ZTL A;  1TXX A;  4NAX A;  2AYT A;  3LFL A;  4DVC A;  6GSW A;  1GTB A;  2J9H A;  20GS A;  2CZ3 A;  3NIV A;  3ZML A;  2HRK A;  4G0K A;  1ZYE A;  3J7Y b;  3KP8 A;  2CX3 A;  5FHI A;  3BJ5 A;  3DRN A;  5G5E A;  3VI5 A;  3ME7 A;  3TKQ A;  4MZC A;  4K0N A;  3GTU A;  2YWO A;  2PER A;  4EL1 A;  2LRN A;  5HQP A;  3LW9 A;  3HXS A;  4G10 A;  2H0H A;  5JWQ B;  3ERF A;  5CRE A;  4EIP A;  2GDR A;  4HDE A;  2DC5 A;  1ZGN A;  3TJG A;  3P7X A;  2LNT A;  1W4V A;  4FIW A;  3QR6 A;  1V2A A;  4PXO A;  1G7E A;  1TU7 A;  2LUS A;  2QC7 A;  5D9W A;  4CDO A;  1F2E A;  5D73 A;  4WBR D;  5A5K A;  2DSA A;  4TR0 A;  3HJP A;  4HOJ A;  3UVH A;  1OC8 A;  2B1K A;  2HI7 A;  2DIY A;  2CV4 A;  4EKZ A;  2X99 A;  5IMC A;  1E2Y A;  3M9J A;  2WRT A;  3CRU A;  1WMJ A;  1ERT A;  2RM6 A;  4K1F A;  2L6D A;  2L5L A;  3D22 A;  2RM5 A;  1BJX A;  2GGT A;  3ED3 A;  1HNC A;  3TDG A;  3L9U A;  4FH8 A;  4MH3 A;  4OWY A;  4YAV A;  5DQS A;  4TR4 A;  4POM A;  5B8B A;  4QL9 A;  2IFQ B;  3K8N A;  2WJU A;  2C3Q A;  5G31 A;  2J23 A;  1T4Z A;  4IJI A;  5JWO B;  2PN8 A;  3O6T A;  4KDX A;  2XPE A;  4PUF C;  2NDO A;  1O81 A;  1B48 A;  3VUR A;  3ZIJ A;  3KM6 A;  4JE1 A;  2TIR A;  4IEL A;  2GQK A;  4I2T A;  1NW2 A;  2PU9 C;  3DGQ A;  3D4M A;  2QA1 A;  1V98 A;  3Q18 A;  3ZFL A;  2R0P A;  1R5P A;  1EZK A;  4IHU A;  3DML A;  3KH7 A;  4I8B A;  4ZXG A;  2RII A;  1XFL A;  3ZYW A;  1BG5 A;  2CZ2 A;  5IQY A;  2H66 A;  1H75 A;  2XBI A;  1SK1 A;  2I1U A;  1Z7P A;  5ECL B;  3E3E A;  3MDK A;  3ZLP A;  3GX0 A;  1YF0 A;  3OR5 A;  3HYP A;  3QPM A;  5B8A A;  2GZZ A;  1GTU A;  1AAZ A;  1SKW B;  4LLR A;  4YH2 A;  3C71 A;  4L5L A;  4N10 A;  2YAN A;  2HFD A;  1HYU A;  2G0F A;  5J41 A;  3FR9 A;  1EP7 A;  4FO5 A;  4K2D A;  2JSZ A;  3FZA A;  2IMI A;  1AW9 A;  2HT9 A;  3A2W A;  2VLV A;  1X9W B;  4ECC A;  1TTZ A;  3TB2 A;  1S3C A;  3EVI A;  1VF4 A;  4KND A;  3F9U A;  2GSR A;  1TJD A;  1AXD A;  5H5R A;  3VWW A;  4RQR A;  1OC9 B;  4ZIJ A;  2C3T A;  1PKW A;  2GT5 A;  2FWG A;  2HE3 A;  1FG4 A;  3HZ4 A;  4YKF A;  1JFU A;  4XRA A;  2L57 A;  3VWV A;  2FUG 2;  2CAI A;  2C8U A;  4KAE A;  3ZL5 A;  3DD3 A;  5GST A;  1SU9 A;  3IBH A;  4MPF A;  5AIX A;  1RK4 A;  3CXG A;  4F0B A;  1XWB A;  3MNG A;  4F2I A;  3M0F A;  4PTS A;  1GTA A;  4KUN A;  3I43 A;  5LNK e;  1UVZ A;  2FA8 A;  3TKS A;  5CAX A;  4LL4 B;  4MDC A;  3UAP A;  2IJY A;  5BRT A;  1X5D A;  2H74 A;  1H4O A;  4PQI A;  5ECI B;  3C1S A;  3TOU A;  4E8H A;  2FWE A;  5CP1 A;  3GNJ A;  1CQG A;  4GST A;  1TK8 B;  1TI1 A;  3G7J A;  4CHS A;  1M3J A;  2H0G A;  4JBB A;  4XS4 A;  1YDK A;  2L4Q A;  2Z9S A;  3CRT A;  1SD9 A;  3GKX A;  4RUV A;  4L0U A;  2E2G A;  3BCI A;  2CX4 A;  3W6G A;  1A2J A;  4MMM A;  2DKH A;  1ON4 A;  3S9F A;  1U6T A;  1GSS A;  4K7I A;  2PUK C;  3KCM A;  3LG6 A;  1QGV A;  1AC1 A;  2X8C A;  1GSU A;  1ERU A;  1OC3 A;  1XW5 A;  3FZ4 A;  3UVT A;  4ISD A;  4EXJ A;  2ZUP A;  4D73 B;  2GVP A;  1TRW A;  2WFC A;  4NV2 A;  2CT6 A;  1K0O A;  2XPD A;  3BBY A;  4USS A;  4G9H A;  4V2M A;  4V1A g;  3SWL A;  2RLI A;  2B7J A;  2R2J A;  2MMA A;  1FB6 A;  4V2N A;  2VL2 C;  1SL2 B;  5H5Q A;  1YZX A;  3FZ9 A;  2YJ7 A;  1XIY A;  2A2R A;  3W8S A;  1UN2 A;  2X4A A;  3HVN A;  2DML A;  5D96 A;  1LBK A;  17GS A;  1SYR A;  1YKC A;  2VLT A;  3LXZ A;  3KJY A;  1GTI A;  1A8L A;  1TRS A;  1X9S B;  1X5E A;  1PFO A;  5DJL A;  1FOV A;  3F0I A;  1A24 A;  3QCP A;  3ZRD A;  2C80 A;  3CSH A;  4J56 E;  4TKY A;  4Q5Q A;  11GS A;  5A4U A;  5HR0 A;  1TRV A;  4EO3 A;  4HZ2 A;  1J0F A;  1TP9 A;  1M7T A;  2I3Y A;  5JCG A;  5A4V A;  3A5W A;  4MP4 A;  5KN3 A;  1X9M B;  4ZBB A;  4LL1 B;  4ZIL A;  4I2U A;  4D73 A;  4YQV A;  1TDI A;  1AUC A;  2VOC A;  4MF7 A;  4WR5 A;  4BA7 A;  3H4K A;  5DQY A;  2WUL A;  1SL1 B;  4CY6 A;  5IPH A;  2YNX A;  2KLX A;  3F4R A;  2CAQ A;  3GST A;  4HSC X;  3WGE A;  2TRX A;  3KEB A;  1B4P A;  2MBS A;  1EWX A;  1OAZ A;  3KMO A;  1PX6 A;  4YQU A;  2P31 A;  1GSF A;  4AGS A;  2OE0 A;  2O7K A;  1A0F A;  2P0G A;  4GWR A;  2CQ9 A;  5E59 A;  4POL A;  3L9V A;  1XXU A;  4FYU A;  1K0M A;  5ECP B;  3AY8 A;  3MWH A;  4K7O A;  3RHC A;  1Z9H A;  2ON7 A;  1ACV A;  2PVQ A;  4ILF A;  2M72 A;  3RBT A;  5B6N A;  4PQH A;  2H8L A;  2E7P A;  3W8J A;  4GF0 A;  4KF9 A;  1ABA A;  1DSB A;  4XRD A;  2DBC A;  4AJ8 A;  6GSX A;  3ZIV A;  3CSJ A;  3DWV A;  4J57 E;  3HDC A;  1USB A;  1NSW A;  3CQF A;  1UC7 A;  3F6D A;  3UMA A;  3QFB C;  3US3 A;  2HRN A;  3TRP A;  3GKK A;  5G1K A;  3KH9 A;  3GTU B;  4MZB A;  2M46 A;  1ZYP A;  4F0C A;  2B7K A;  2CA8 A;  2WZ9 A;  4L8E A;  4JR6 A;  3HHV A;  2HLS A;  2VCT A;  2WB9 A;  5EY6 A;  1PD2 1;  5JWR B;  3GKM A;  5JCU A;  1WIK A;  2HZF A;  12GS A;  2AUV A;  3HVV A;  3JCM L;  3E0U A;  2FWF A;  4KH7 A;  2VIM A;  4KDU A;  4BWQ A;  2C1Y A;  2DJ0 A;  1V9W A;  4ZBA A;  4KDY A;  3CSI A;  2HSM A;  2V2G A;  3RPN A;  3P2A A;  3A2X A;  3DVW A;  1XW6 A;  3FY7 A;  1TW9 A;  2B5E A;  1MTC A;  1XWG A;  3DIE A;  2GTU A;  3C7M A;  2QGV A;  2XHF A;  4PUR A;  5ELG A;  2YWM A;  3N5O A;  3F4S A;  4HJM A;  1C72 A;  3D21 A;  3EMP A;  2PGT A;  2GQM A;  3P90 A;  2EIO A;  2DMM A;  5KEJ A;  3EC3 A;  4F82 A;  7GSS A;  3DEX A;  5KN1 A;  1S3R A;  5IMA A;  4DSS B;  4ECI A;  3F3Q A;  2IIY A;  5CNW A;  1JZW A;  4KX4 A;  3U6V A;  2YV9 A;  2AV4 A;  1TU8 A;  2X64 A;  5A4W A;  3P8W A;  1XBS A;  1RW1 A;  3ZFB A;  1EV9 A;  4K2X A;  1I9D A;  1Q4J A;  4ML6 A;  3FEU A;  4BVY B;  2R3X A;  3SBC A;  1R4W A;  4JZQ A;  1LJR A;  1T1V A;  1U3A A;  2N5A A;  3U5R E;  1WP0 A;  2GSQ A;  2LRC A;  1B8X A;  1VF1 A;  3EE2 A;  3HZ8 A;  3ERG A;  2HSY A;  2FCH A;  2EC4 A;  4MA9 A;  2FNO A;  5CO3 A;  3GUS A;  3GRX A;  5E4W A;  2R4V A;  4Q5R A;  3KP9 A;  2IMD A;  2WGR A;  3GIX A;  3TKR A;  4N30 A;  5GAP D;  3DYR A;  1QXH A;  3PPU A;  4RI6 A;  5AN1 A;  2KUC A;  4F03 A;  2H1D A;  1IYI A;  3O3T A;  4WEY A;  2VD1 A;  1GSE A;  2K8V A;  2IWT A;  3HVX A;  2WCI A;  3TJB A;  4XCS A;  2ES7 A;  1OE7 A;  3L0H A;  4EDZ A;  2WS2 A;  4DSS A;  2OJL A;  1HNA A;  2ON5 A;  6GSY A;  3ZRE A;  2PWJ A;  1SJI A;  2DJK A;  1FVK A;  1WJK A;  5D93 A;  3DKS A;  3M9K A;  4BVY A;  3FRC A;  4LA1 A;  3I6A A;  1B4Q A;  4OFN A;  4IGJ A;  5CRD A;  2I9H A;  2DJJ A;  2IMK A;  3DXB A;  4HQZ A;  3F4T A;  3EYT A;  5G30 A;  3RPP A;  1T3B A;  3QD9 A;  1NM3 A;  4MZW A;  1MD3 A;  2F9S A;  1XZO A;  1GSD A;  1FVJ A;  5G2Z A;  3BOA A;  4N0V A;  4X43 A;  4ZB6 A;  2VD0 A;  3KTB A;  4ZL9 A;  2FHE A;  4WF5 A;  2DJ3 A;  1WPI A;  5GZZ B;  5ENU A;  3TCO A;  3EUR A;  2H73 A;  2MYG A;  4OO5 A;  1XW9 A;  4XS4 B;  4ZB8 A;  5KN0 A;  4Z7X A;  2IMF A;  4TR3 A;  2QKE A;  5IMF A;  4K5S A;  3FW2 A;  1G6Y A;  2VM2 A;  4O5Q A;  3KXO A;  4AJ7 A;  1ZYQ B;  4L0W A;  1THO A;  3D4T A;  5FWG A;  4FYC A;  1TKD B;  4GQC A;  2K9F A;  2ZCT A;  2YOI A;  2GST A;  8GSS A;  1SKR B;  3F63 A;  3F3R A;  3HD5 A;  3IC4 A;  1FO5 A;  1PN0 A;  1GLQ A;  5HFG A;  4EC0 A;  2GS3 A;  2V1M A;  5DDL A;  2FWH A;  4PGT A;  1SYX A;  2V6O A;  1F9M A;  2KP2 A;  2L5O A;  1M2D A;  1YKA A;  3C8E A;  4F9Z A;  4XS6 A;  2JU5 A;  4IP6 A;  5HR3 A;  1J08 A;  3KGK A;  4GLT A;  4MF5 A;  3EIN A;  2H72 A;  2O8V B;  3GKN A;  1WOU A;  1Q98 A;  1JZR A;  4TOP A;  1WE0 A;  1KTE A;  1DUG A;  1R5A A;  5J3R A;  1YQ1 A;  3KD0 A;  4OFT A;  3H1N A;  2RUE A;  5IIZ A;  3J7Y k;  2L59 A;  1XPV A;  3UAR A;  1AQX A;  2LST A;  4WBJ A;  1N8J A;  1W89 A;  3F8U A;  1M2A A;  2HNL A;  4TRX A;  2LEG A;  2X8H A;  3IHQ A;  2YZU A;  3QAG A;  4OO4 A;  3RHB A;  22GS A;  2LTK A;  2YCD A;  4GSN A;  3LOR A;  1GUH A;  4OMV A;  2H19 A;  4DEJ A;  3FK8 A;  3HY2 A;  4Q5F A;  6GST A;  1TI3 A;  4CW9 A;  2H0I A;  3C73 A;  2ALB A;  2JZT A;  3KIJ A;  2AJQ B;  2A4V A;  2H6Y A;  2MMN A;  3H93 A;  2YWN A;  2G2Q A;  1B9X C;  4ID0 A;  2H71 A;  4HU9 A;  4K7N A;  2R6K A;  4O92 A;  4IQA A;  3KTL A;  2HSH A;  3LXT A;  3TJJ A;  2X8G A;  5ECR B;  4X4J A;  2E0Q A;  3D0Z A;  1VGL A;  1ZOF A;  1JZO A;  1O8X A;  1OYJ A;  1AQW A;  1OKD A;  1QMV A;  2DKI A;  3UOM A;  2R0C A;  1LU4 A;  2FD3 A;  2R0G A;  3A5I A;  2GSS A;  2LRT A;  1OVN A;  4KCA A;  3MSZ A;  2C0F A;  3ZZX A;  3CTG A;  3FR6 A;  4WXT A;  2DLX A;  4HJ2 A;  19GS A;  5AIV A;  3HA9 A;  1A8Y A;  3WYW A;  4KB3 A;  5J4U A;  2CVB A;  2NBS A;  5IO0 A;  3GV1 A;  3I69 A;  4WKW A;  1Y6E A;  2JZS A;  6GSS A;  2HRF A;  4XTS A;  1DBY A;  3A3T A;  4PNF A;  5IOX A;  1A2M A;  2OAC A;  4ULX A;  4GTU A;  2V6K A;  4G0I A;  2HZE B;  5DAL A;  2H6X A;  4GQF A;  5KOX A;  2B5X A;  3APS A;  1YJ6 A;  4KW6 A;  1VF2 A;  4IP1 A;  4K8M A;  3KMN A;  4K5R A;  5EVO A;  1DE2 A;  1SKS B;  2I4A A;  2MMZ A;  3TUE A;  1GLP A;  2K6V A;  2KHP A;  5DAK B;  2YN1 A;  1PX7 A;  2O85 A;  2IPA A;  4V2L A;  1Y25 A;  2YWI A;  3R3E A;  2AHE A;  1FOH A;  2O89 A;  4YKG A;  2OAD A;  3O76 A;  3WGD A;  3CBU A;  1SD8 A;  2GZP A;  1T8E B;  3FHK A;  4QQ7 A;  2QSI A;  4I97 A;  2H01 A;  4TVE A;  4O5U A;  3LWA A;  3LYP A;  1TRU A;  2F3M A;  3ISO A;  3APQ A;  2F51 A;  2FY6 A;  4PX1 A;  1KBN A;  1OE8 A;  1XWK A;  1XWA A;  4ECB A;  3LJR A;  5D8I A;  2VL9 A;  1E6B A;  2TRC P;  3GHA A;  2K18 A;  4LMV A;  5BMU A;  1M2B A;  5HR2 A;  1QFN A;  3QAW A;  3I9V 2;  3IA1 A;  4HZ4 A;  1Z5Y E;  2MZC A;  2VLU A;  3GFK A;  1NHY A;  3TOT A;  3MIX A;  1XVQ A;  4NV5 A;  1KNG A;  3PIN A;  1ST9 A;  4P3Y B;  5CRW A;  2HZE A;  5KN2 A;  1VF3 A;  2LQQ A;  3R2Q A;  4JU5 A;  1ERW A;  2IL3 A;  4MCU A;  4MJB A;  4E8E A;  1M0U A;  3FKF A;  2C0E A;  1K0C A;  4BVX A;  4HEA 2;  4MF6 A;  2X49 A;  4TXV A;  1B9Y C;  1O85 A;  1A23 A;  3Q19 A;  2YJH A;  5DAK A;  1K0B A;  1N2A A;  5G1L A;  4MJC A;  2H76 A;  1EOG A;  3NOF A;  2MBT A;  5AIS A;  2MMO A;  3IRA A;  3IAM 2;  5F07 A;  3IK7 A;  1XG8 A;  1PKZ A;  5ECN B;  1ERV A;  3IE3 A;  3ERW A;  4RI7 A;  1Z7R A;  2C0G A;  1EEM A;  4MAB A;  4K9Z A;  1JHB A;  1GUM A;  2GLR A;  1ZL9 A;  2WDU A;  4O32 A;  1AQV A;  4CY8 A;  3GL5 A;  3Q74 A;  5HFI A;  2H6Z A;  1GH2 A;  2VL2 A;  2NPB A;  1PQN A;  4O5R A;  4NWY A;  3VWX A;  4TR1 B;  5ECQ B;  3CMI A;  1K0N A;  3VK9 A;  4KA0 A;  10GS A;  4KCE A;  4NPB A;  4TXO B;  1K0A A;  2BMX A;  3E9J B;  1R26 A;  1SK2 A;  1VRS D;  1GUL A;  1ZYN A;  4A5P A;  2LQO A;  2R5G A;  4X0X A;  2R37 A;  3HKR A;  2A4H A;  3C1R A;  4ML1 A;  5ID2 A;  1AIU A;  5H5S A;  3KZQ A;  1O6J A;  3MYD A;  4L5O A;  1J9B A;  4JED A;  2XC2 A;  2REM A;  1QQ2 A;  3TKS C;  3NZN A;  2VO4 A;  4NHZ A;  1EGO A;  5IOW A;  4NHW A;  3GMF A;  5IPG A;  3UEM A;  1V57 A;  3IR4 A;  3G7Y A;  4J2F A;  1MDK A;  1EGR A;  5DCH A;  4EF0 A;  5IMD A;  2YPM A;  2FGX A;  5IMV A;  3L78 A;  3G9B A;  2YP6 A;  3TRQ A;  5LD0 A;  1U3I A;  3GA4 A;  2OKA A;  4OCE A;  2OBK A;  1NHO A;  2H1A A;  1THX A;  5ECS A;  3QOU A;  3IPZ A;  3UBL A;  5J9B A;  1PSQ A;  3N9J A;  2VM1 A;  2N5B A;  1QK8 A;  3IAS 2;  4TR1 A;  1SL0 B;  3VPQ A;  1YY7 A;  1XWC A;  4TXO A;  5EPF A;  1WRY A;  4ZL8 A;  3RAZ A;  1FAA A;  1SEN A;  4ZBD A;  1PGT A;  3GN3 A;  3MAK A;  3QFA C;  1PL2 A;  3GUR A;  3HVS A;  5JCW A;  5HFK A;  5GAN D;  3QAV A;  1V40 A;  3DVX A;  5AGY A;  3RDW A;  3V1W A;  2YZH A;  1A0R P;  2KOK A;  4ZL7 A;  2HXK A;  5ECM B;  3A2V A;  6GSU A;  1T7P B;  1WWJ A;  5DJM A;  1ZMA A;  1PA3 A;  2N5F A;  1XOB A;  1U88 A;  4G2E A;  4EVM A;  5IO2 A;  3ZVJ D;  2H70 A;  2VL3 A;  1TK5 B;  5F05 A;  3VLN A;  1G7O A;  2D2Z A;  2BTO T;  2OE1 A;  2ZNM A;  1GNW A;  4IJ3 A;  1JZD A;  4ICY A;  1URM A;  3LEF A;  5IM9 A;  1BX9 A;  2AAW A;  2FA4 A;  4I5Q A;  4V1A p;  1ZCP A;  5COH A;  3M3M A;  4WF4 A;  3VFI A;  3FR3 A;  1S3A A;  4AF2 A;  2LJA A;  1EV4 A;  3IXR A;  2JAD A;  4NXI A;  2CVD A;  1HD2 A;  4IBP A;  2A2S A;  2PVO C;  3L4N A;  4HS1 A;  2PPT A;  2IFQ A;  3GSS A;  3ZVJ A;  4QL7 A;  4N11 A;  4MLY A;  2GZY A;  2DIZ A;  2BJX A;  5GSS A;  2UZ8 A;  2JAC A;  1O73 A;  3G7I A;  4MJA A;  1T4Y A;  1M99 A;  1MEK A;  3LGC A;  3ZMK A;  3FYG A;  3TJK A;  3FZ5 A;  5D9T A;  2L4C A;  5ECH B;  5ABR A;  1DE1 A;  1Z3E A;  4Z2R A;  4ZB9 A;  3UIW A;  2IME A;  3TGZ A;  1GSQ A;  4EE0 A;  4HU7 A;  5CRH A;  2V32 A;  3WT2 A;  5ECO B;  2DJ2 A;  4WR4 A;  4EUY A;  2FLS A;  2EIR A;  5F8B A;  5D9V A;  1F3B A;  1S3D A;  4O7H A;  2CVK A;  4I6X A;  3LQ7 A;  1M9B A;  2VCV A;  1O8W A;  2VAF A;  2VCW A;  3BD2 A;  3GH6 A;  3EMX A;  5ELA A;  3TRX A;  4JR4 A;  1PN9 A;  3IC8 A;  4Z2T A;  1JLW A;  1BED A;  3IK9 A;  1HNB A;  4KE3 A;  4BL7 B;  2F8F A;  1EP8 A;  2RUF A;  2OE3 A;  2PMT A;  3VPT A;  2LJR A;  3BCK A;  1K3L A;  3EU3 A;  1K3O A;  3EWL A;  4IS0 A;  2YV7 A;  4POK A;  2NVL A;  3L9S A;  4PQ1 A;  1OC9 A;  4TN8 A;  3GL3 A;  1F37 A;  4XIH A;  3VWU A;  4ACS A;  4G0L A;  3LSZ A;  3M1G A;  2LJK A;  2A2P A;  5ECK B;  1T00 A;  4EIQ A;  1GNE A;  4Q5N A;  9GSS A;  1RQM A;  3IOS A;  5G5F A;  1IYH A;  1PMT A;  5DAL B;  3WD6 A;  5EL8 A;  1KEB A;  2NTO A;  3QMX A;  5F06 A;  2XBQ A;  3HJM A;  1K0D A;  4G19 A;  1FB0 A;  1SK0 A;  3UJ1 A;  4KSO A;  2C0D A;  1G6W A;  5KOW A;  2B3S A;  3PH9 A;  2L6C A;  2GT6 A;  3WGX A;  1M3I A;  2B5Y A;  1OKT A;  2JZR A;  4JRR A;  4MPG A;  1MD4 A;  1XOA A;  3D6I A;  4XS1 A;  4YQM A;  2OA7 A;  2KP1 A;  3H8Q A;  1Z6N A;  4MNN A;  4FYB A;  3PGT A;  2B1L A;  1XCC A;  1BAY A;  1PRX A;  2C3N A;  2E2M A;  1M9A A;  4N0Z A;  1FW1 A;  4IN0 A;  4BL7 A;  5B7C A;  3GH9 A;  4OCF A;  1X5C A;  4X1U A;  4OFM A;  1TK0 B;  5J9C A;  2K8S A;  5F0G A;  5CRG A;  4BIK A;  1GRX A;  3FMW A;  1PL1 A;  6GSV A;  2LV3 A;  2B6M A;  4BWS A;  2AB6 A;  1X0R A;  2PBJ A;  5IMZ A;  1I5G A;  3D5J A;  4KGI A;  4PNG A;  2HYX A;  2OBI A;  4GSS A;  2IN3 A;  5C00 A;  3TKP A;  3ZIT A;  1R7H A;  1U87 A;  1A2L A;  1YF1 A;  2JSY A;  1GL8 A;  4ECJ A;  2M80 A;  4K0G A;  2HRA A;  4OD7 A;  2GQL A;  1ZZY A;  2I81 A;  3LYK A;  4H86 A;  1XVW A;  5HR1 A;  1GWC A;  3F6F A;  2V41 A;  3HCZ A;  2P5R A;  1CQH A;  4BVX B;  4HUA A;  1EEJ A;  3WT1 A;  4FQU A;  3Q6O A;  1HQO A;  4GRF A;  5C04 A;  5DVB A;  1F3A A;  5FT3 A;  1YEP A;  1Z6M A;  4KSM A; 
#chains in the Genus database with same CATH homology
 2JL4 A;  4IKH A;  2LS5 A;  4GCI A;  3GYK A;  2VCX A;  4DSQ A;  3EPT A;  4LMW A;  3M8N A;  4IVF A;  4XHM A;  1BYE A;  4Z2U A;  1FHE A;  3ME8 A;  2LNS A;  5CYY A;  4GXZ A;  1F6M C;  1TOF A;  4K6X A;  3IHG A;  2H30 A;  14GS A;  1GUK A;  1GSY A;  1MDJ A;  1SJZ A;  1UA5 A;  1ML6 A;  2LKU A;  3GX8 A;  1QUW A;  3HJO A;  2C4J A;  4NMU A;  5D9X A;  4AJ6 A;  4YAP A;  2O87 A;  2VUP A;  13GS A;  1EOH A;  4IW9 A;  3H79 A;  2EIQ A;  4DSR A;  5L71 A;  2DJ1 A;  1SJ6 A;  5LCZ A;  1K3Y A;  5INY A;  2H1G A;  3CYN A;  3VI7 A;  4TW5 A;  2F8A A;  5DCG A;  3UL3 A;  5ID2 B;  1G0T A;  4IQ1 A;  4MK3 A;  3IDV A;  2QA2 A;  3PR8 A;  3IV4 A;  1YEX A;  1JLV A;  4MJE A;  3TJF A;  5J5N A;  4MH2 A;  4HQS A;  2H75 A;  18GS A;  1ILO A;  3UBK A;  1V58 A;  5DBQ A;  4PUA A;  4RQX A;  2H1B A;  2VCQ A;  3TKS E;  4BPY A;  1MDI A;  5B6M A;  2VCZ A;  1O7U A;  4WET A;  4HI7 A;  4POB A;  2P5Q A;  1BQ7 A;  3APO A;  3QDN A;  16GS A;  3EU4 A;  3CTF A;  1GP1 A;  4EDY A;  3ZTL A;  1TXX A;  4NAX A;  2AYT A;  3LFL A;  4DVC A;  6GSW A;  1GTB A;  2J9H A;  20GS A;  2CZ3 A;  3NIV A;  3ZML A;  2HRK A;  4G0K A;  1ZYE A;  3J7Y b;  3KP8 A;  2CX3 A;  5FHI A;  3BJ5 A;  3DRN A;  5G5E A;  3VI5 A;  3ME7 A;  3TKQ A;  4MZC A;  4K0N A;  3GTU A;  2YWO A;  2PER A;  4EL1 A;  2LRN A;  5HQP A;  3LW9 A;  3HXS A;  4G10 A;  2H0H A;  5JWQ B;  3ERF A;  5CRE A;  4EIP A;  2GDR A;  4HDE A;  2DC5 A;  1ZGN A;  3TJG A;  3P7X A;  2LNT A;  1W4V A;  4FIW A;  3QR6 A;  1V2A A;  4PXO A;  1G7E A;  1TU7 A;  2LUS A;  2QC7 A;  5D9W A;  4CDO A;  1F2E A;  5D73 A;  4WBR D;  5A5K A;  2DSA A;  4TR0 A;  3HJP A;  4HOJ A;  3UVH A;  1OC8 A;  2B1K A;  2HI7 A;  2DIY A;  2CV4 A;  4EKZ A;  2X99 A;  5IMC A;  1E2Y A;  3M9J A;  2WRT A;  3CRU A;  1WMJ A;  1ERT A;  2RM6 A;  4K1F A;  2L6D A;  2L5L A;  3D22 A;  2RM5 A;  1BJX A;  2GGT A;  3ED3 A;  1HNC A;  3TDG A;  3L9U A;  4FH8 A;  4MH3 A;  4OWY A;  4YAV A;  5DQS A;  4TR4 A;  4POM A;  5B8B A;  4QL9 A;  2IFQ B;  3K8N A;  2WJU A;  2C3Q A;  5G31 A;  2J23 A;  1T4Z A;  4IJI A;  5JWO B;  2PN8 A;  3O6T A;  4KDX A;  2XPE A;  4PUF C;  2NDO A;  1O81 A;  1B48 A;  3VUR A;  3ZIJ A;  3KM6 A;  4JE1 A;  2TIR A;  4IEL A;  2GQK A;  4I2T A;  1NW2 A;  2PU9 C;  3DGQ A;  3D4M A;  2QA1 A;  1V98 A;  3Q18 A;  3ZFL A;  2R0P A;  1R5P A;  1EZK A;  4IHU A;  3DML A;  3KH7 A;  4I8B A;  4ZXG A;  2RII A;  1XFL A;  3ZYW A;  1BG5 A;  2CZ2 A;  5IQY A;  2H66 A;  1H75 A;  2XBI A;  1SK1 A;  2I1U A;  1Z7P A;  5ECL B;  3E3E A;  3MDK A;  3ZLP A;  3GX0 A;  1YF0 A;  3OR5 A;  3HYP A;  3QPM A;  5B8A A;  2GZZ A;  1GTU A;  1AAZ A;  1SKW B;  4LLR A;  4YH2 A;  3C71 A;  4L5L A;  4N10 A;  2YAN A;  2HFD A;  1HYU A;  2G0F A;  5J41 A;  3FR9 A;  1EP7 A;  4FO5 A;  4K2D A;  2JSZ A;  3FZA A;  2IMI A;  1AW9 A;  2HT9 A;  3A2W A;  2VLV A;  1X9W B;  4ECC A;  1TTZ A;  3TB2 A;  1S3C A;  3EVI A;  1VF4 A;  4KND A;  3F9U A;  2GSR A;  1TJD A;  1AXD A;  5H5R A;  3VWW A;  4RQR A;  1OC9 B;  4ZIJ A;  2C3T A;  1PKW A;  2GT5 A;  2FWG A;  2HE3 A;  1FG4 A;  3HZ4 A;  4YKF A;  1JFU A;  4XRA A;  2L57 A;  3VWV A;  2FUG 2;  2CAI A;  2C8U A;  4KAE A;  3ZL5 A;  3DD3 A;  5GST A;  1SU9 A;  3IBH A;  4MPF A;  5AIX A;  1RK4 A;  3CXG A;  4F0B A;  1XWB A;  3MNG A;  4F2I A;  3M0F A;  4PTS A;  1GTA A;  4KUN A;  3I43 A;  5LNK e;  1UVZ A;  2FA8 A;  3TKS A;  5CAX A;  4LL4 B;  4MDC A;  3UAP A;  2IJY A;  5BRT A;  1X5D A;  2H74 A;  1H4O A;  4PQI A;  5ECI B;  3C1S A;  3TOU A;  4E8H A;  2FWE A;  5CP1 A;  3GNJ A;  1CQG A;  4GST A;  1TK8 B;  1TI1 A;  3G7J A;  4CHS A;  2H0G A;  4JBB A;  4XS4 A;  1YDK A;  2L4Q A;  2Z9S A;  3CRT A;  1SD9 A;  3GKX A;  4RUV A;  4L0U A;  2E2G A;  3BCI A;  2CX4 A;  3W6G A;  1A2J A;  4MMM A;  2DKH A;  1ON4 A;  3S9F A;  1U6T A;  1GSS A;  4K7I A;  2PUK C;  3KCM A;  3LG6 A;  1QGV A;  1AC1 A;  2X8C A;  1GSU A;  1ERU A;  1OC3 A;  1XW5 A;  3FZ4 A;  3UVT A;  4ISD A;  4EXJ A;  2ZUP A;  4D73 B;  2GVP A;  1TRW A;  2WFC A;  4NV2 A;  2CT6 A;  1K0O A;  2XPD A;  3BBY A;  4USS A;  4G9H A;  4V2M A;  4V1A g;  3SWL A;  2RLI A;  2B7J A;  2R2J A;  2MMA A;  1FB6 A;  4V2N A;  2VL2 C;  1SL2 B;  5H5Q A;  1YZX A;  3FZ9 A;  2YJ7 A;  1XIY A;  2A2R A;  3W8S A;  1UN2 A;  2X4A A;  2DML A;  5D96 A;  1LBK A;  17GS A;  1SYR A;  1YKC A;  2VLT A;  3LXZ A;  3KJY A;  1GTI A;  1A8L A;  1TRS A;  1X9S B;  1X5E A;  5DJL A;  1FOV A;  3F0I A;  1A24 A;  3QCP A;  3ZRD A;  2C80 A;  3CSH A;  4J56 E;  4TKY A;  4Q5Q A;  11GS A;  5A4U A;  5HR0 A;  1TRV A;  4EO3 A;  4HZ2 A;  1J0F A;  1TP9 A;  1M7T A;  2I3Y A;  5JCG A;  5A4V A;  3A5W A;  4MP4 A;  5KN3 A;  1X9M B;  4ZBB A;  4LL1 B;  4ZIL A;  4I2U A;  4D73 A;  4YQV A;  1TDI A;  1AUC A;  2VOC A;  4MF7 A;  4WR5 A;  4BA7 A;  3H4K A;  5DQY A;  2WUL A;  1SL1 B;  4CY6 A;  5IPH A;  2YNX A;  2KLX A;  3F4R A;  2CAQ A;  3GST A;  3WGE A;  2TRX A;  3KEB A;  1B4P A;  2MBS A;  1EWX A;  1OAZ A;  3KMO A;  1PX6 A;  4YQU A;  2P31 A;  1GSF A;  4AGS A;  2OE0 A;  2O7K A;  1A0F A;  2P0G A;  4GWR A;  2CQ9 A;  5E59 A;  4POL A;  3L9V A;  1XXU A;  4FYU A;  1K0M A;  5ECP B;  3AY8 A;  3MWH A;  4K7O A;  3RHC A;  1Z9H A;  2ON7 A;  1ACV A;  2PVQ A;  4ILF A;  2M72 A;  3RBT A;  5B6N A;  4PQH A;  2H8L A;  2E7P A;  3W8J A;  4GF0 A;  4KF9 A;  1ABA A;  1DSB A;  4XRD A;  2DBC A;  4AJ8 A;  6GSX A;  3ZIV A;  3CSJ A;  3DWV A;  4J57 E;  3HDC A;  1USB A;  1NSW A;  1UC7 A;  3F6D A;  3UMA A;  3QFB C;  3US3 A;  2HRN A;  3TRP A;  3GKK A;  5G1K A;  3KH9 A;  3GTU B;  4MZB A;  2M46 A;  1ZYP A;  4F0C A;  2B7K A;  2CA8 A;  2WZ9 A;  4L8E A;  4JR6 A;  3HHV A;  2HLS A;  2VCT A;  2WB9 A;  5EY6 A;  1PD2 1;  5JWR B;  3GKM A;  5JCU A;  1WIK A;  2HZF A;  12GS A;  2AUV A;  3HVV A;  3JCM L;  3E0U A;  2FWF A;  4KH7 A;  2VIM A;  4KDU A;  4BWQ A;  2C1Y A;  2DJ0 A;  1V9W A;  4ZBA A;  4KDY A;  3CSI A;  2HSM A;  2V2G A;  3RPN A;  3P2A A;  3A2X A;  3DVW A;  1XW6 A;  3FY7 A;  1TW9 A;  2B5E A;  1MTC A;  1XWG A;  3DIE A;  2GTU A;  3C7M A;  2QGV A;  2XHF A;  4PUR A;  5ELG A;  2YWM A;  3N5O A;  3F4S A;  4HJM A;  1C72 A;  3D21 A;  3EMP A;  2PGT A;  2GQM A;  3P90 A;  2EIO A;  2DMM A;  5KEJ A;  3EC3 A;  4F82 A;  7GSS A;  3DEX A;  5KN1 A;  5IMA A;  4DSS B;  4ECI A;  3F3Q A;  2IIY A;  5CNW A;  1JZW A;  4KX4 A;  3U6V A;  2YV9 A;  2AV4 A;  1TU8 A;  2X64 A;  5A4W A;  3P8W A;  1XBS A;  1RW1 A;  3ZFB A;  1EV9 A;  4K2X A;  1I9D A;  1Q4J A;  4ML6 A;  3FEU A;  4BVY B;  2R3X A;  3SBC A;  1R4W A;  4JZQ A;  1LJR A;  1T1V A;  1U3A A;  2N5A A;  3U5R E;  1WP0 A;  2GSQ A;  2LRC A;  1B8X A;  1VF1 A;  3EE2 A;  3HZ8 A;  3ERG A;  2HSY A;  2FCH A;  2EC4 A;  4MA9 A;  2FNO A;  5CO3 A;  3GUS A;  3GRX A;  5E4W A;  2R4V A;  4Q5R A;  3KP9 A;  2IMD A;  2WGR A;  3GIX A;  3TKR A;  4N30 A;  5GAP D;  3DYR A;  1QXH A;  3PPU A;  4RI6 A;  5AN1 A;  2KUC A;  4F03 A;  2H1D A;  1IYI A;  3O3T A;  4WEY A;  2VD1 A;  1GSE A;  2K8V A;  2IWT A;  3HVX A;  2WCI A;  3TJB A;  4XCS A;  2ES7 A;  1OE7 A;  3L0H A;  4EDZ A;  2WS2 A;  4DSS A;  2OJL A;  1HNA A;  2ON5 A;  6GSY A;  3ZRE A;  2PWJ A;  1SJI A;  2DJK A;  1FVK A;  1WJK A;  5D93 A;  3DKS A;  3M9K A;  4BVY A;  3FRC A;  4LA1 A;  3I6A A;  1B4Q A;  4OFN A;  4IGJ A;  5CRD A;  2I9H A;  2DJJ A;  2IMK A;  3DXB A;  4HQZ A;  3F4T A;  3EYT A;  5G30 A;  3RPP A;  1T3B A;  3QD9 A;  1NM3 A;  4MZW A;  1MD3 A;  2F9S A;  1XZO A;  1GSD A;  1FVJ A;  5G2Z A;  3BOA A;  4N0V A;  4X43 A;  4ZB6 A;  2VD0 A;  3KTB A;  4ZL9 A;  2FHE A;  4WF5 A;  2DJ3 A;  1WPI A;  5GZZ B;  5ENU A;  3TCO A;  3EUR A;  2H73 A;  2MYG A;  4OO5 A;  1XW9 A;  4XS4 B;  4ZB8 A;  5KN0 A;  4Z7X A;  2IMF A;  4TR3 A;  2QKE A;  5IMF A;  4K5S A;  3FW2 A;  1G6Y A;  2VM2 A;  4O5Q A;  3KXO A;  4AJ7 A;  1ZYQ B;  4L0W A;  1THO A;  3D4T A;  5FWG A;  4FYC A;  1TKD B;  4GQC A;  2K9F A;  2ZCT A;  2YOI A;  2GST A;  8GSS A;  1SKR B;  3F63 A;  3F3R A;  3HD5 A;  3IC4 A;  1FO5 A;  1PN0 A;  1GLQ A;  5HFG A;  4EC0 A;  2GS3 A;  2V1M A;  5DDL A;  2FWH A;  4PGT A;  1SYX A;  2V6O A;  1F9M A;  2KP2 A;  2L5O A;  1M2D A;  1YKA A;  3C8E A;  4F9Z A;  4XS6 A;  2JU5 A;  4IP6 A;  5HR3 A;  1J08 A;  3KGK A;  4GLT A;  4MF5 A;  3EIN A;  2H72 A;  2O8V B;  3GKN A;  1WOU A;  1Q98 A;  1JZR A;  4TOP A;  1WE0 A;  1KTE A;  1DUG A;  1R5A A;  5J3R A;  1YQ1 A;  3KD0 A;  4OFT A;  3H1N A;  2RUE A;  5IIZ A;  3J7Y k;  2L59 A;  1XPV A;  3UAR A;  1AQX A;  2LST A;  4WBJ A;  1N8J A;  1W89 A;  3F8U A;  1M2A A;  2HNL A;  4TRX A;  2LEG A;  2X8H A;  3IHQ A;  2YZU A;  3QAG A;  4OO4 A;  3RHB A;  22GS A;  2LTK A;  2YCD A;  4GSN A;  3LOR A;  1GUH A;  4OMV A;  2H19 A;  4DEJ A;  3FK8 A;  3HY2 A;  4Q5F A;  6GST A;  1TI3 A;  4CW9 A;  2H0I A;  3C73 A;  2ALB A;  2JZT A;  3KIJ A;  2AJQ B;  2A4V A;  2H6Y A;  2MMN A;  3H93 A;  2YWN A;  2G2Q A;  1B9X C;  4ID0 A;  2H71 A;  4HU9 A;  4K7N A;  2R6K A;  4O92 A;  4IQA A;  3KTL A;  2HSH A;  3LXT A;  3TJJ A;  2X8G A;  5ECR B;  4X4J A;  2E0Q A;  3D0Z A;  1VGL A;  1ZOF A;  1JZO A;  1O8X A;  1OYJ A;  1AQW A;  1OKD A;  1QMV A;  2DKI A;  3UOM A;  2R0C A;  1LU4 A;  2FD3 A;  2R0G A;  3A5I A;  2GSS A;  2LRT A;  1OVN A;  4KCA A;  3MSZ A;  2C0F A;  3ZZX A;  3CTG A;  3FR6 A;  4WXT A;  2DLX A;  4HJ2 A;  19GS A;  5AIV A;  3HA9 A;  1A8Y A;  3WYW A;  4KB3 A;  5J4U A;  2CVB A;  2NBS A;  5IO0 A;  3GV1 A;  3I69 A;  4WKW A;  1Y6E A;  2JZS A;  6GSS A;  2HRF A;  4XTS A;  1DBY A;  3A3T A;  4PNF A;  5IOX A;  1A2M A;  2OAC A;  4ULX A;  4GTU A;  2V6K A;  4G0I A;  2HZE B;  5DAL A;  2H6X A;  4GQF A;  5KOX A;  2B5X A;  3APS A;  1YJ6 A;  4KW6 A;  1VF2 A;  4IP1 A;  4K8M A;  3KMN A;  4K5R A;  5EVO A;  1DE2 A;  1SKS B;  2I4A A;  2MMZ A;  3TUE A;  1GLP A;  2K6V A;  2KHP A;  5DAK B;  2YN1 A;  1PX7 A;  2O85 A;  2IPA A;  4V2L A;  1Y25 A;  2YWI A;  3R3E A;  2AHE A;  1FOH A;  2O89 A;  4YKG A;  2OAD A;  3O76 A;  3WGD A;  3CBU A;  1SD8 A;  2GZP A;  1T8E B;  3FHK A;  4QQ7 A;  2QSI A;  4I97 A;  2H01 A;  4TVE A;  4O5U A;  3LWA A;  3LYP A;  1TRU A;  2F3M A;  3ISO A;  3APQ A;  2F51 A;  2FY6 A;  4PX1 A;  1KBN A;  1OE8 A;  1XWK A;  1XWA A;  4ECB A;  3LJR A;  5D8I A;  2VL9 A;  1E6B A;  2TRC P;  3GHA A;  2K18 A;  4LMV A;  5BMU A;  1M2B A;  5HR2 A;  1QFN A;  3QAW A;  3I9V 2;  3IA1 A;  4HZ4 A;  1Z5Y E;  2MZC A;  2VLU A;  3GFK A;  1NHY A;  3TOT A;  3MIX A;  1XVQ A;  4NV5 A;  1KNG A;  3PIN A;  1ST9 A;  4P3Y B;  5CRW A;  2HZE A;  5KN2 A;  1VF3 A;  2LQQ A;  3R2Q A;  4JU5 A;  1ERW A;  2IL3 A;  4MCU A;  4MJB A;  4E8E A;  1M0U A;  3FKF A;  2C0E A;  1K0C A;  4BVX A;  4HEA 2;  4MF6 A;  2X49 A;  4TXV A;  1B9Y C;  1O85 A;  1A23 A;  3Q19 A;  2YJH A;  5DAK A;  1K0B A;  1N2A A;  5G1L A;  4MJC A;  2H76 A;  1EOG A;  3NOF A;  2MBT A;  5AIS A;  2MMO A;  3IRA A;  3IAM 2;  5F07 A;  3IK7 A;  1PKZ A;  5ECN B;  1ERV A;  3IE3 A;  3ERW A;  4RI7 A;  1Z7R A;  2C0G A;  1EEM A;  4MAB A;  4K9Z A;  1JHB A;  1GUM A;  2GLR A;  1ZL9 A;  2WDU A;  4O32 A;  1AQV A;  4CY8 A;  3GL5 A;  3Q74 A;  5HFI A;  2H6Z A;  1GH2 A;  2VL2 A;  2NPB A;  1PQN A;  4O5R A;  4NWY A;  3VWX A;  4TR1 B;  5ECQ B;  3CMI A;  1K0N A;  3VK9 A;  4KA0 A;  10GS A;  4KCE A;  4NPB A;  4TXO B;  1K0A A;  2BMX A;  3E9J B;  1R26 A;  1SK2 A;  1VRS D;  1GUL A;  1ZYN A;  4A5P A;  2LQO A;  2R5G A;  4X0X A;  2R37 A;  3HKR A;  2A4H A;  3C1R A;  4ML1 A;  5ID2 A;  1AIU A;  5H5S A;  3KZQ A;  1O6J A;  3MYD A;  4L5O A;  1J9B A;  4JED A;  2XC2 A;  2REM A;  1QQ2 A;  3TKS C;  3NZN A;  2VO4 A;  4NHZ A;  1EGO A;  5IOW A;  4NHW A;  3GMF A;  5IPG A;  3UEM A;  1V57 A;  3IR4 A;  3G7Y A;  4J2F A;  1MDK A;  1EGR A;  5DCH A;  4EF0 A;  5IMD A;  2YPM A;  2FGX A;  5IMV A;  3L78 A;  3G9B A;  2YP6 A;  3TRQ A;  5LD0 A;  1U3I A;  3GA4 A;  2OKA A;  4OCE A;  2OBK A;  1NHO A;  2H1A A;  1THX A;  5ECS A;  3QOU A;  3IPZ A;  3UBL A;  5J9B A;  1PSQ A;  3N9J A;  2VM1 A;  2N5B A;  1QK8 A;  3IAS 2;  4TR1 A;  1SL0 B;  3VPQ A;  1YY7 A;  1XWC A;  4TXO A;  5EPF A;  1WRY A;  4ZL8 A;  3RAZ A;  1FAA A;  1SEN A;  4ZBD A;  1PGT A;  3GN3 A;  3MAK A;  3QFA C;  1PL2 A;  3GUR A;  3HVS A;  5JCW A;  5HFK A;  5GAN D;  3QAV A;  1V40 A;  3DVX A;  5AGY A;  3RDW A;  3V1W A;  2YZH A;  1A0R P;  2KOK A;  4ZL7 A;  2HXK A;  5ECM B;  3A2V A;  6GSU A;  1T7P B;  1WWJ A;  5DJM A;  1ZMA A;  1PA3 A;  2N5F A;  1XOB A;  1U88 A;  4G2E A;  4EVM A;  5IO2 A;  3ZVJ D;  2H70 A;  2VL3 A;  1TK5 B;  5F05 A;  3VLN A;  1G7O A;  2D2Z A;  2BTO T;  2OE1 A;  2ZNM A;  1GNW A;  4IJ3 A;  1JZD A;  4ICY A;  1URM A;  3LEF A;  5IM9 A;  1BX9 A;  2AAW A;  2FA4 A;  4I5Q A;  4V1A p;  1ZCP A;  5COH A;  3M3M A;  4WF4 A;  3VFI A;  3FR3 A;  1S3A A;  4AF2 A;  2LJA A;  1EV4 A;  3IXR A;  2JAD A;  4NXI A;  2CVD A;  1HD2 A;  4IBP A;  2A2S A;  2PVO C;  3L4N A;  4HS1 A;  2PPT A;  2IFQ A;  3GSS A;  3ZVJ A;  4QL7 A;  4N11 A;  4MLY A;  2GZY A;  2DIZ A;  2BJX A;  5GSS A;  2UZ8 A;  2JAC A;  1O73 A;  3G7I A;  4MJA A;  1T4Y A;  1M99 A;  1MEK A;  3LGC A;  3ZMK A;  3FYG A;  3TJK A;  3FZ5 A;  5D9T A;  2L4C A;  5ECH B;  5ABR A;  1DE1 A;  1Z3E A;  4Z2R A;  4ZB9 A;  3UIW A;  2IME A;  3TGZ A;  1GSQ A;  4EE0 A;  4HU7 A;  5CRH A;  2V32 A;  3WT2 A;  5ECO B;  2DJ2 A;  4WR4 A;  4EUY A;  2FLS A;  2EIR A;  5F8B A;  5D9V A;  1F3B A;  1S3D A;  4O7H A;  2CVK A;  4I6X A;  3LQ7 A;  1M9B A;  2VCV A;  1O8W A;  2VAF A;  2VCW A;  3BD2 A;  3GH6 A;  3EMX A;  5ELA A;  3TRX A;  4JR4 A;  1PN9 A;  3IC8 A;  4Z2T A;  1JLW A;  1BED A;  3IK9 A;  1HNB A;  4KE3 A;  4BL7 B;  2F8F A;  1EP8 A;  2RUF A;  2OE3 A;  2PMT A;  3VPT A;  2LJR A;  3BCK A;  1K3L A;  3EU3 A;  1K3O A;  3EWL A;  4IS0 A;  2YV7 A;  4POK A;  2NVL A;  3L9S A;  4PQ1 A;  1OC9 A;  4TN8 A;  3GL3 A;  1F37 A;  4XIH A;  3VWU A;  4ACS A;  4G0L A;  3LSZ A;  3M1G A;  2LJK A;  2A2P A;  5ECK B;  1T00 A;  4EIQ A;  1GNE A;  4Q5N A;  9GSS A;  1RQM A;  3IOS A;  5G5F A;  1IYH A;  1PMT A;  5DAL B;  3WD6 A;  5EL8 A;  1KEB A;  2NTO A;  3QMX A;  5F06 A;  2XBQ A;  3HJM A;  1K0D A;  4G19 A;  1FB0 A;  1SK0 A;  3UJ1 A;  4KSO A;  2C0D A;  1G6W A;  5KOW A;  2B3S A;  3PH9 A;  2L6C A;  2GT6 A;  3WGX A;  2B5Y A;  1OKT A;  2JZR A;  4JRR A;  4MPG A;  1MD4 A;  1XOA A;  3D6I A;  4XS1 A;  4YQM A;  2OA7 A;  2KP1 A;  3H8Q A;  1Z6N A;  4MNN A;  4FYB A;  3PGT A;  2B1L A;  1XCC A;  1BAY A;  1PRX A;  2C3N A;  2E2M A;  1M9A A;  4N0Z A;  1FW1 A;  4IN0 A;  4BL7 A;  5B7C A;  3GH9 A;  4OCF A;  1X5C A;  4X1U A;  4OFM A;  1TK0 B;  5J9C A;  2K8S A;  5F0G A;  5CRG A;  1GRX A;  3FMW A;  1PL1 A;  6GSV A;  2LV3 A;  2B6M A;  4BWS A;  2AB6 A;  1X0R A;  2PBJ A;  5IMZ A;  1I5G A;  3D5J A;  4KGI A;  4PNG A;  2HYX A;  2OBI A;  4GSS A;  2IN3 A;  5C00 A;  3TKP A;  3ZIT A;  1R7H A;  1U87 A;  1A2L A;  1YF1 A;  2JSY A;  1GL8 A;  4ECJ A;  2M80 A;  4K0G A;  2HRA A;  4OD7 A;  2GQL A;  1ZZY A;  2I81 A;  3LYK A;  4H86 A;  1XVW A;  5HR1 A;  1GWC A;  3F6F A;  2V41 A;  3HCZ A;  2P5R A;  1CQH A;  4BVX B;  4HUA A;  1EEJ A;  3WT1 A;  4FQU A;  3Q6O A;  1HQO A;  4GRF A;  5C04 A;  5DVB A;  1F3A A;  5FT3 A;  1YEP A;  1Z6M A;  4KSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...