3IA1A

Crystal structure of thio-disulfide isomerase from thermus thermophilus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
143
structure length
143
Chain Sequence
AVKPGEPLPDFLLLDPKGQPVTPATVSKPAVIVFWASWCTVCKAEFPGLHRVAEETGVPFYVISREPRDTREVVLEYMKTYPRFIPLLASDRDRPHEVAARFKVLGQPWTFVVDREGKVVALFAGRAGREALLDALLLAGADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thio-disulfide isomerase/thioredoxin
publication title Crystal structure of thio-disulfide isomerase from Thermus thermophilus
rcsb
source organism Thermus thermophilus
total genus 39
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ia1A00
3DVXA 2H0GA 5F07A 4E8EA 4AGSA 5ECOB 1XOBA 4IJ3A 1CQHA 4MJEA 2GSSA 3H79A 3C7MA 6GSWA 2VO4A 1XBSA 3IOSA 3LXTA 3NIVA 1HQOA 2DSAA 4K7OA 2E2MA 2L4QA 4N10A 3EYTA 3KH7A 3RBTA 1Y6EA 4DSQA 2F8FA 2AV4A 1ILOA 1O7UA 1OE7A 1O8XA 3VLNA 2B7KA 1K3YA 3JCML 4YQMA 5HFKA 3FW2A 3LFLA 4E8HA 2MBSA 3VPQA 1ZCPA 2TRCP 1O85A 3DRNA 2CX4A 3VFIA 1K0AA 3GH6A 2GGTA 3CYNA 3H93A 2C0GA 20GSA 3BCKA 5IMFA 5J9CA 1AQWA 5E59A 3ZITA 4NHZA 1TXXA 2YCDA 2RLIA 1YF1A 2OADA 1KEBA 2RUEA 4OWYA 1ACVA 4IP6A 3SBCA 1TW9A 4IQ1A 2CA8A 3APOA 1G7OA 4MDCA 5J9BA 2IN3A 2IMDA 1A23A 5CO3A 1TU8A 4LL1B 1XWAA 4EVMA 4D73A 4HQSA 2R6KA 3PH9A 10GSA 2PGTA 2R37A 3LGCA 2OJLA 2H8LA 1SK2A 5AISA 5IMVA 4K7IA 1C72A 4MF6A 2L6DA 2B1KA 1GNWA 2DIYA 2BJXA 2LV3A 4ISDA 2GQKA 4Q5RA 2K9FA 3BJ5A 1FB0A 1YF0A 5CRHA 3TJGA 1XCCA 3FKFA 1S3CA 5JCUA 2DJ1A 4Q5QA 5DAKA 1YKCA 1OKDA 3A2VA 2V6OA 3IHQA 2LQQA 3ISOA 1OC8A 2O85A 4NV2A 1GSYA 22GSA 3F8UA 4OFTA 3ZIJA 2IFQA 4F03A 2GZZA 5LNKe 1Q4JA 1PKZA 1JFUA 3TJKA 1XWGA 1U3IA 2AYTA 3TUEA 2YJHA 5DJLA 3C1SA 2I4AA 4TXOA 3EC3A 2YOIA 5ECKB 2H71A 2RM6A 4I6XA 1XXUA 2LRTA 1VF3A 1M2DA 1OAZA 1TK0B 5AN1A 1SYRA 2ZCTA 4Z7XA 2WZ9A 1S3AA 2HSYA 3A3TA 1THXA 2YZUA 4IELA 1YY7A 5A4UA 2YWNA 5JWQB 3O6TA 2PBJA 2O8VB 2IPAA 2YP6A 2CVKA 2PWJA 3UL3A 4AJ7A 4OO4A 3A2XA 3HVVA 3E3EA 3WGDA 5D8IA 4F0BA 4IKHA 3EVIA 1AC1A 2LQOA 3TKSE 2L5LA 3ED3A 3CSHA 1M0UA 5C04A 1K3OA 1AQXA 3ERFA 3ZREA 3MAKA 1S3DA 1SL2B 3C1RA 3L4NA 1VF1A 1AUCA 4IS0A 2IMKA 3TRXA 4H86A 5IQYA 1A2LA 4RQRA 1WRYA 1X5CA 3L78A 2B1LA 2HLSA 3ZZXA 2DBCA 2DJ3A 1T8EB 1K0MA 3NZNA 1X5EA 3RAZA 5IO2A 2LTKA 4KH7A 4FH8A 3A5WA 3TOTA 4MP4A 5E4WA 4KGIA 1XIYA 4EC0A 1NW2A 5DDLA 2FWGA 4V2MA 3IC4A 2DJJA 2H66A 2VLTA 4KA0A 3FZ9A 3LEFA 6GSSA 1GTAA 1DBYA 4EL1A 1GSEA 2YPMA 2C3NA 1PRXA 3H1NA 4DEJA 2NDOA 3GSTA 3KIJA 3UBKA 3H4KA 1SKRB 1JZOA 2ES7A 5EY6A 5L71A 3KJYA 1ERVA 2ALBA 4V2LA 2K8VA 4DVCA 2JZSA 4IN0A 2VIMA 2KHPA 4V2NA 1K0NA 5J3RA 3C8EA 3QCPA 5LCZA 2J23A 1LU4A 1A0FA 2VL9A 3DIEA 4Q5FA 5GSSA 4K2DA 5DVBA 4D73B 4DSSB 1VRSD 3L0HA 4MJCA 2H1BA 5DCHA 4ZBBA 1MDJA 3ME8A 4XS6A 1NHYA 1PA3A 4OO5A 3D4MA 3GIXA 4YAPA 5CAXA 5CYYA 3DEXA 1PGTA 2N5BA 4KDYA 4DSRA 1TU7A 2KLXA 3TJFA 4NXIA 2VD0A 3LG6A 2IFQB 4KB3A 5D9VA 4LMVA 4P3YB 4TR0A 4K8MA 2CT6A 4LLRA 1TI1A 4TXOB 17GSA 1EGRA 5G2ZA 1F37A 1FB6A 3SWLA 3UARA 1X9MB 4ID0A 2R5GA 2YZHA 5JCGA 5IPHA 1M99A 5CRDA 3VPTA 4F0CA 3QR6A 5JWOB 1GSDA 1OC3A 1USBA 1G7EA 5AGYA 4TR1B 3RDWA 2OBKA 4BWQA 2VCVA 4KE3A 3DWVA 2XC2A 3KMOA 4TXVA 3OR5A 4GSNA 4KSMA 3CBUA 4IQAA 4G2EA 2XHFA 4CHSA 4JBBA 4K0GA 1N8JA 3HA9A 3F63A 2NVLA 2MZCA 3TJJA 1BAYA 1FG4A 3GSSA 3L9UA 1YZXA 3GRXA 1FO5A 4I97A 4PGTA 5ID2B 1ERWA 4I5QA 2FUG2 1XFLA 4GTUA 5H5SA 4KUNA 1OC9A 2PVQA 3P2AA 1J08A 1EGOA 1QFNA 2VLVA 2H01A 3F3QA 3UAPA 2J9HA 3EMXA 5IOWA 2M72A 2JSZA 1GUMA 4XS4A 1RK4A 2GLRA 5LD0A 4KSOA 3HCZA 5INYA 3I69A 4O32A 3TRQA 3BCIA 3IAS2 3I6AA 3WD6A 4GXZA 1JZRA 4RUVA 3WT2A 2BTOT 3F4SA 4G9HA 2WDUA 4LMWA 3WGEA 3A2WA 1MDIA 4O7HA 4OCFA 2KP1A 4ZB9A 1PL1A 3K8NA 4XIHA 2H19A 2CVBA 2C0FA 4L0WA 2X64A 3GV1A 4EDZA 4CW9A 1PL2A 3EU3A 5G31A 3EU4A 1K0OA 2P31A 3GL3A 2G2QA 1VGLA 4L0UA 2BMXA 2VOCA 4KCEA 3IK7A 2HZEA 5IIZA 2CV4A 4HU7A 2P5RA 1UVZA 4JU5A 2FA4A 5IMAA 1IYHA 1XOAA 5IMCA 1U87A 4XRAA 3KCMA 3HZ4A 4L5OA 3HJOA 4GCIA 3Q6OA 2FY6A 4EKZA 5DALB 3FR6A 2DMLA 4N0ZA 5HFIA 3CTFA 1XW5A 1R5PA 1UA5A 2YANA 3GTUB 2CAIA 4MK3A 4IGJA 1I5GA 1BYEA 2YN1A 1JLWA 3Q18A 2F8AA 5KN2A 1TKDB 5FHIA 3ZL5A 3TJBA 2I3YA 1KTEA 5IOXA 1E2YA 2V1MA 3KTLA 1AQVA 3QFAC 3IAM2 4HZ2A 3U6VA 3CRTA 3KEBA 4PUAA 2LJRA 1GLQA 1JZWA 2H0IA 1GSSA 5GZZB 1ZGNA 2PPTA 2IMFA 1JHBA 5EPFA 3AY8A 2LJKA 1R4WA 5ECNB 2LSTA 3FZ4A 2ON5A 3TKRA 5HR3A 3LYKA 2C3TA 1QUWA 3LORA 1YJ6A 2DMMA 3ZFLA 4KCAA 1PD21 5KN1A 4ZB8A 4ECJA 2TIRA 4MH2A 4QL7A 4POLA 9GSSA 1AXDA 1PKWA 1MTCA 4I2TA 2L5OA 2HZFA 3QPMA 1A0RP 3VI5A 3D4TA 4XTSA 1SJ6A 1TK8B 3QAWA 2IIYA 3LQ7A 2LUSA 2WULA 3KH9A 3FZAA 3GN3A 4MZCA 3F0IA 3TGZA 1EZKA 1X5DA 3RHBA 3LXZA 3APSA 3LJRA 4MJAA 5F0GA 1FOVA 2C80A 3IA1A 1E6BA 4K9ZA 4ACSA 1MD3A 1J0FA 3G7IA 3GURA 3GFKA 3ZMLA 3US3A 5D9XA 2PERA 2E2GA 3FYGA 1O81A 1XZOA 5F06A 2X99A 5G5FA 3MNGA 4ZL7A 4FIWA 2OA7A 1EEMA 1XW6A 2FA8A 3RPPA 2C8UA 1GWCA 1Z7RA 3ZIVA 1H75A 12GSA 1ZMAA 4NMUA 5D96A 3M8NA 5H5RA 4F2IA 3EE2A 5AIXA 1XW9A 3UEMA 5ECQB 2WGRA 3TDGA 3W8SA 1WOUA 2C3QA 2QC7A 3Q19A 3IV4A 3UOMA 4IHUA 1G6YA 1FVJA 4EDYA 1ABAA 3ZFBA 2VM2A 3I9V2 4MPGA 6GSTA 2P5QA 3TKQA 5ECRB 3ZLPA 3W6GA 5CP1A 4N30A 4KDUA 3O76A 5JCWA 3ZVJA 2RIIA 4J2FA 1UN2A 4WXTA 1V2AA 1XPVA 4EXJA 1NHOA 2YWIA 1DSBA 3HVSA 2EIQA 2H30A 4V1Ap 2YNXA 2QGVA 1WP0A 5B8BA 1T7PB 3M9KA 1YEXA 1AAZA 1MDKA 3DXBA 3QMXA 4WR4A 1TRSA 1F3AA 3F6DA 3QDNA 2DC5A 1TRUA 1OYJA 1QGVA 4XCSA 1SKWB 1Z5YE 3D6IA 4TN8A 1U3AA 5KN0A 1EEJA 1X0RA 1GUKA 2H70A 3M3MA 4K0NA 5HR0A 4K1FA 1FHEA 4XRDA 2GT5A 1XWKA 1TRVA 4FYBA 3LWAA 2DJKA 3DGQA 3FHKA 1NM3A 3ME7A 3QD9A 4L5LA 5IMDA 3UMAA 5ECPB 5ECLB 3GKXA 1XVWA 3KP8A 3HJMA 2M46A 4ECCA 11GSA 5COHA 1BEDA 1THOA 4ULXA 2K6VA 2R3XA 3PR8A 2MMAA 3HKRA 2JSYA 1ZZYA 2GSRA 2E7PA 3FK8A 1WE0A 1A2MA 5D9TA 4YQUA 3TKPA 2B6MA 1M9AA 1W89A 2P0GA 4ML1A 4MH3A 3F4TA 1K0DA 4GSTA 2NBSA 1UC7A 5EL8A 1BQ7A 2AUVA 4KNDA 3GX0A 4PX1A 3BBYA 3HDCA 3R2QA 1V40A 4GQCA 2WJUA 5KEJA 2DIZA 2MMZA 5D73A 3D22A 3W8JA 3VWUA 2N5FA 2H1GA 3CMIA 1T4ZA 3VWXA 2H72A 5DAKB 4GWRA 2OE1A 5KN3A 4HS1A 1TRWA 4O92A 5B6NA 2V6KA 1TK5B 4PNFA 3HJPA 2YWMA 1GULA 2FCHA 4TOPA 5HR1A 4JE1A 14GSA 5EVOA 4NWYA 1TP9A 1KBNA 2F3MA 2I9HA 3BOAA 4NHWA 4GQFA 4HUAA 2H75A 4ECIA 1U88A 3DKSA 2GSQA 4ZL8A 5F05A 2E0QA 2VL2A 2MYGA 1Y25A 2PVOC 3CXGA 2D2ZA 5J41A 3UJ1A 1B4QA 1F3BA 4XHMA 4ECBA 3ZMKA 1ZOFA 1SJIA 2HRFA 4EE0A 2B7JA 4Q5NA 3HD5A 4TRXA 5F8BA 1F2EA 2FNOA 4MABA 3P90A 3LSZA 6GSXA 3RHCA 3F9UA 4IP1A 1Q98A 5CRWA 4QL9A 4HQZA 1M7TA 1GP1A 5DQYA 5J4UA 3D21A 5CRGA 1OE8A 5C00A 3VURA 4N0VA 2OBIA 5IMZA 1ML6A 2FLSA 1SJZA 2H1DA 3IRAA 4HEA2 5DBQA 2HSHA 3EINA 2FWEA 2JADA 2X8CA 3P8WA 4PQ1A 1GSQA 2VLUA 2JU5A 4HOJA 4IVFA 4OD7A 3CSJA 4FYCA 3IXRA 3QOUA 1R26A 1WIKA 3WYWA 2B5YA 4J57E 3MDKA 2M80A 4WBRD 3I43A 2DJ0A 4X43A 2IL3A 4JR4A 4BVYA 5ELGA 3GUSA 1U6TA 3KM6A 4WF5A 5G1KA 2GVPA 2QKEA 3KP9A 2JZRA 1YKAA 4V1Ag 13GSA 2X8HA 5HFGA 1K0BA 1ON4A 1RW1A 4F82A 2QSIA 2K8SA 3ZTLA 2EIOA 2VCQA 2DJ2A 3LYPA 3KZQA 2FD3A 1TOFA 3PGTA 2XBIA 2HI7A 1VF4A 1SD9A 5B8AA 2V2GA 3EURA 1ZL9A 4GLTA 2LRCA 3GMFA 4OFNA 2PMTA 4TR4A 1SYXA 1SKSB 2H1AA 3D5JA 3GL5A 3HVXA 1Z9HA 3M1GA 2LJAA 4KDXA 2VCWA 2K18A 2OE3A 4LA1A 4AJ8A 1YDKA 3U5RE 5ECSA 1X9WB 1LBKA 3IDVA 4FO5A 1SL0B 1SD8A 1QMVA 1MD4A 4WEYA 4RI7A 4OCEA 3G7YA 5A5KA 2MBTA 2FGXA 2LKUA 3TKSA 4GF0A 2GSTA 3ZRDA 4ZBAA 1PQNA 1GRXA 4G19A 2CQ9A 2YV9A 5ENUA 4IW9A 2GS3A 1B4PA 5B7CA 2GQMA 4MMMA 3UIWA 3BD2A 2WCIA 2WB9A 1EWXA 1PMTA 2VCZA 2WS2A 2RM5A 5IPGA 2ZUPA 1M9BA 5ECHB 5IM9A 1EV9A 1QQ2A 1N2AA 1DE2A 4MA9A 2L4CA 4MPFA 1F9MA 2AB6A 1V9WA 2L57A 4ZBDA 1XVQA 1GL8A 1WPIA 5JWRB 3KGKA 3PINA 5ABRA 4X0XA 2VM1A 3G7JA 3Q74A 4O5RA 8GSSA 4PNGA 2HFDA 1JZDA 3FR3A 2A4VA 4POMA 4YQVA 1LJRA 5G30A 2GZPA 5FWGA 1I9DA 3IPZA 3E9JB 2H73A 3HYPA 3FRCA 2AJQB 3N5OA 2KP2A 4N11A 4DSSA 5CNWA 1T1VA 3KD0A 5DJMA 2GZYA 1OC9B 3C73A 3KXOA 6GSVA 2H76A 4BL7A 2IMEA 1EV4A 2LS5A 1PN9A 2OKAA 3M0FA 2R2JA 2VAFA 3HY2A 1V98A 1J9BA 2MMNA 1TDIA 4ML6A 4WBJA 3CSIA 4JZQA 2F51A 1O73A 1GSFA 4XS4B 3D0ZA 1B9YC 3TRPA 3GX8A 1QK8A 4PXOA 2LEGA 1BJXA 2N5AA 4I2UA 4WR5A 2CVDA 4TR3A 5HQPA 1B8XA 4JR6A 3GKMA 2XBQA 4AF2A 1A8YA 2C0DA 2CZ3A 3ZYWA 4KAEA 4HJ2A 1W4VA 2IMIA 1ZYEA 2H0HA 1GTBA 7GSSA 1GH2A 3V1WA 4MZBA 4TR1A 2JL4A 5B6MA 1G6WA 4YAVA 3UVHA 3CTGA 1T4YA 2EIRA 2OE0A 3G9BA 2EC4A 4EUYA 3H8QA 1SK1A 4EO3A 2HZEB 3S9FA 3GHAA 4MCUA 2C4JA 4KX4A 1FW1A 1DUGA 2O7KA 4J56E 2YV7A 2JZTA 2ON7A 3GA4A 2NTOA 2AHEA 1BX9A 4EF0A 1Z6MA 1O8WA 3P7XA 3ERWA 3QFBC 4F9ZA 1WMJA 1VF2A 4RQXA 1FAAA 5GAPD 1GTUA 5ID2A 2VCTA 4BWSA 3WGXA 2KUCA 3J7Yk 2XPDA 3F6FA 4MF7A 4ZIJA 3MWHA 18GSA 3VI7A 3TCOA 1IYIA 2JACA 3FY7A 1R5AA 2C0EA 1HNCA 1M2BA 1NSWA 5IO0A 1Z6NA 3FEUA 1G0TA 2RUFA 1T3BA 3TB2A 2FHEA 3HXSA 3APQA 4NAXA 1EOHA 2FWFA 1SL1B 4ILFA 2TRXA 4RI6A 2VL2C 4KW6A 3QAGA 4MF5A 1WWJA 2VUPA 1B9XC 3N9JA 3IK9A 1HD2A 5D9WA 4ZXGA 1TJDA 2HE3A 1XWCA 2X8GA 2L6CA 2O89A 3MSZA 2KOKA 3DYRA 1KNGA 1BG5A 3L9SA 2B3SA 1X9SB 2VCXA 2Z9SA 3CRUA 5DQSA 1TI3A 1GLPA 1R7HA 4GSSA 5A4VA 2GDRA 4YH2A 1ZYQB 1EOGA 2I81A 1K0CA 2HRNA 1WJKA 1F6MC 3VWVA 2B5XA 2YJ7A 2FWHA 1AW9A 4PQIA 3KMNA 19GSA 4HI7A 3GNJA 1ERTA 2G0FA 2H6ZA 3IBHA 5DALA 5A4WA 3J7Yb 2MMOA 5AIVA 3IR4A 2ZNMA 3FR9A 4JEDA 1SU9A 2CX3A 2PUKC 3GTUA 3RPNA 2VL3A 5G1LA 1EP8A 6GSUA 3DVWA 4NPBA 1K3LA 4WETA 3FZ5A 5GSTA 2GT6A 1TTZA 4CDOA 4HDEA 1OVNA 1V58A 4NV5A 4IBPA 4JRRA 4OMVA 3DD3A 4HU9A 2H6XA 2I1UA 2CZ2A 4ZB6A 4HZ4A 1HNBA 1XWBA 3O3TA 3UVTA 3GH9A 4HJMA 3ZVJD 2REMA 6GSYA 3QAVA 1GUHA 3M9JA 1AIUA 1PX6A 1JLVA 2LNTA 5G5EA 2H74A 3C71A 2NPBA 2CAQA 5HR2A 1GSUA 3UBLA 2XPEA 3GKNA 5FT3A 2H6YA 1HNAA 3E0UA 4X1UA 3EWLA 3HHVA 4TW5A 3F4RA 2WRTA 2VD1A 1EP7A 5H5QA 1YEPA 2F9SA 1V57A 1URMA 3HZ8A 2R4VA 5ECIB 1PX7A 1Z3EA 2O87A 3L9VA 1GNEA 3DMLA 2IJYA 3F3RA 4XS1A 3GYKA 2YWOA 3GKKA 4L8EA 4K6XA 2LNSA 3IE3A 2HT9A 1GTIA 4I8BA 2LRNA 1H4OA 4WKWA 1SENA 4MJBA 5ELAA 1Z7PA 4TVEA 4PQHA 1PSQA 1YQ1A 1T00A 1A8LA 1CQGA 3TKSC 4MLYA 4MZWA 2HNLA 4PUFC 2OACA 3ERGA 2PU9C 4AJ6A 2IWTA 1OKTA 5DCGA 16GSA 4G10A 2HXKA 1A2JA 1DE1A 1M2AA 1HYUA 2V41A 4BPYA 2L59A 4FYUA 4GRFA 3WT1A 2AAWA 1A24A 4BA7A 2PN8A 4ZL9A 2WFCA 2B5EA 4WF4A 1B48A 5CREA 1SK0A 2C1YA 2A2RA 4TKYA 1FVKA 1MEKA 3NOFA 4ZILA 4K7NA 2HYXA 2DLXA 4POKA 3VK9A 1ERUA 4BVXA 4QQ7A 1ST9A 2GTUA 4IJIA 5GAND 4OFMA 5ECMB 5J5NA 1O6JA 1RQMA 2V32A 3EMPA 2A2SA 2GQLA 4LL4B 4PURA 3VWWA 3TOUA 1QXHA 4POBA 5D93A 3KTBA
chains in the Genus database with same CATH superfamily
2R0PA 3DVXA 2H0GA 5F07A 4E8EA 4AGSA 5ECOB 1XOBA 4IJ3A 1CQHA 4MJEA 2GSSA 3H79A 3C7MA 6GSWA 2VO4A 1XBSA 3IOSA 3LXTA 3NIVA 1HQOA 2DSAA 1PN0A 4K7OA 2E2MA 2L4QA 4N10A 3EYTA 3KH7A 3RBTA 1Y6EA 4DSQA 2F8FA 2AV4A 1ILOA 1O7UA 1OE7A 2X4AA 1O8XA 3VLNA 2B7KA 1K3YA 3JCML 4YQMA 5HFKA 3FW2A 3LFLA 4E8HA 2MBSA 3VPQA 1ZCPA 2TRCP 1O85A 3DRNA 2CX4A 2HRAA 3VFIA 1K0AA 3GH6A 2GGTA 3CYNA 3H93A 2C0GA 20GSA 3BCKA 5IMFA 5J9CA 1AQWA 5E59A 3ZITA 2QA1A 4NHZA 1TXXA 2YCDA 2RLIA 1YF1A 2OADA 4USSA 1KEBA 2RUEA 4OWYA 1ACVA 4IP6A 3SBCA 1TW9A 4IQ1A 2CA8A 3APOA 1G7OA 4MDCA 5J9BA 2IN3A 2IMDA 1A23A 4PTSA 5CO3A 1TU8A 4LL1B 1XWAA 4EVMA 4BIKA 4D73A 4HQSA 2R6KA 3PH9A 10GSA 2PGTA 2R37A 3LGCA 2OJLA 2H8LA 1SK2A 5AISA 5IMVA 4K7IA 1C72A 4MF6A 2L6DA 2B1KA 1GNWA 2DIYA 2BJXA 2LV3A 4ISDA 2GQKA 4Q5RA 2K9FA 3BJ5A 1FB0A 1YF0A 5CRHA 2QA2A 3TJGA 1XCCA 3FKFA 1S3CA 4MNNA 5JCUA 2DJ1A 4Q5QA 5DAKA 1YKCA 1OKDA 3A2VA 2V6OA 3IHQA 2LQQA 3ISOA 1OC8A 2O85A 4NV2A 1GSYA 22GSA 3F8UA 4OFTA 3ZIJA 2IFQA 4F03A 2GZZA 5LNKe 1Q4JA 1PKZA 1JFUA 3TJKA 1XWGA 1U3IA 3R3EA 2AYTA 3TUEA 2YJHA 5DJLA 3C1SA 2I4AA 4TXOA 3EC3A 2YOIA 5ECKB 2H71A 2RM6A 4I6XA 1XXUA 2LRTA 4Z2RA 1VF3A 1M2DA 1OAZA 1TK0B 5AN1A 1SYRA 2ZCTA 4Z7XA 2WZ9A 4HSCX 1S3AA 2HSYA 3A3TA 1THXA 4O5UA 4G0KA 2YZUA 4IELA 1YY7A 5A4UA 2YWNA 5JWQB 3O6TA 2PBJA 2O8VB 2IPAA 2YP6A 2CVKA 2PWJA 3UL3A 4AJ7A 1M3IA 4OO4A 3A2XA 3HVVA 3E3EA 3WGDA 5D8IA 4F0BA 4IKHA 3EVIA 1AC1A 2LQOA 4FQUA 3TKSE 2L5LA 3ED3A 3CSHA 1M0UA 5C04A 1K3OA 1AQXA 3ERFA 3ZREA 3MAKA 1S3DA 1SL2B 3C1RA 3L4NA 1VF1A 1AUCA 4IS0A 2IMKA 3TRXA 4KF9A 4H86A 5IQYA 1A2LA 4RQRA 1WRYA 1X5CA 3L78A 2B1LA 2HLSA 3ZZXA 2DBCA 2DJ3A 1T8EB 1K0MA 3NZNA 1X5EA 3IC8A 3RAZA 5IO2A 2LTKA 4KH7A 4FH8A 3A5WA 3TOTA 4MP4A 5E4WA 4KGIA 1XIYA 4EC0A 1NW2A 5DDLA 2FWGA 4V2MA 3IC4A 2DJJA 2H66A 2VLTA 4KA0A 3FZ9A 3LEFA 6GSSA 1GTAA 1DBYA 4EL1A 1GSEA 2YPMA 2C3NA 1PRXA 3H1NA 4DEJA 2NDOA 3GSTA 3KIJA 3UBKA 3H4KA 1SKRB 1JZOA 2ES7A 5EY6A 5L71A 1M3JA 3KJYA 1ERVA 2ALBA 4V2LA 2K8VA 4DVCA 2JZSA 4IN0A 2VIMA 2KHPA 4V2NA 1K0NA 5J3RA 3C8EA 3QCPA 5LCZA 2J23A 1LU4A 1A0FA 2VL9A 3DIEA 4Q5FA 5GSSA 4K2DA 5DVBA 4D73B 4DSSB 1VRSD 3L0HA 4MJCA 2H1BA 5DCHA 4ZBBA 1MDJA 3ME8A 4XS6A 1NHYA 1PA3A 4OO5A 3D4MA 3GIXA 4YAPA 5CAXA 5CYYA 3DEXA 1PGTA 2N5BA 4KDYA 4DSRA 1TU7A 2KLXA 3TJFA 4NXIA 2VD0A 3LG6A 2IFQB 4KB3A 5D9VA 4LMVA 4P3YB 4TR0A 4K8MA 2CT6A 4LLRA 1TI1A 4TXOB 17GSA 1EGRA 5G2ZA 1F37A 1FB6A 3SWLA 3UARA 1X9MB 4ID0A 2R5GA 2YZHA 5JCGA 5IPHA 1M99A 5CRDA 3VPTA 4F0CA 3QR6A 5JWOB 1GSDA 1OC3A 1USBA 1G7EA 5AGYA 4TR1B 3RDWA 2A2PA 2OBKA 2X49A 4BWQA 2VCVA 4KE3A 3DWVA 2XC2A 3KMOA 4TXVA 3OR5A 4GSNA 4KSMA 3CBUA 4IQAA 4G2EA 2XHFA 4CHSA 4JBBA 4K0GA 1N8JA 3HA9A 3F63A 2NVLA 2MZCA 3TJJA 1BAYA 1FG4A 3GSSA 3L9UA 1YZXA 3GRXA 1FO5A 4I97A 1ZYPA 4PGTA 5ID2B 1ERWA 4I5QA 2FUG2 1XFLA 4GTUA 5H5SA 4KUNA 1OC9A 2PVQA 3P2AA 1J08A 1EGOA 4CY6A 1QFNA 2VLVA 4A5PA 2H01A 3F3QA 3UAPA 2J9HA 4X4JA 3EMXA 5IOWA 2M72A 2JSZA 1GUMA 4XS4A 1RK4A 2GLRA 5LD0A 4KSOA 3HCZA 5INYA 3I69A 4O32A 3TRQA 1PFOA 3BCIA 3IAS2 3I6AA 3WD6A 4GXZA 1JZRA 4RUVA 2DKIA 3WT2A 2BTOT 3F4SA 4G9HA 2WDUA 4LMWA 3WGEA 3A2WA 1MDIA 4O7HA 4OCFA 2KP1A 4ZB9A 1PL1A 3K8NA 4XIHA 2H19A 2CVBA 2R0CA 2C0FA 4L0WA 2X64A 3GV1A 4EDZA 4CW9A 1PL2A 3EU3A 5G31A 3EU4A 1ZYNA 1K0OA 2P31A 3GL3A 2G2QA 1VGLA 4L0UA 2BMXA 2VOCA 4KCEA 3IK7A 2HZEA 5IIZA 2CV4A 4HU7A 2P5RA 1UVZA 4JU5A 2FA4A 5IMAA 1IYHA 1XOAA 5IMCA 1U87A 4XRAA 3KCMA 3HZ4A 4L5OA 3HJOA 4GCIA 3Q6OA 2FY6A 4EKZA 5DALB 3FR6A 2DMLA 4N0ZA 5HFIA 3CTFA 3A5IA 1XW5A 1R5PA 1UA5A 2YANA 3GTUB 2CAIA 4MK3A 4IGJA 1I5GA 1BYEA 2YN1A 1JLWA 3Q18A 2F8AA 5KN2A 1TKDB 5FHIA 3ZL5A 3TJBA 2I3YA 1KTEA 5IOXA 1E2YA 4Z2UA 2V1MA 3KTLA 1AQVA 3QFAC 3IAM2 4HZ2A 3U6VA 3CRTA 3KEBA 4PUAA 2LJRA 1GLQA 1JZWA 2H0IA 1GSSA 5GZZB 1ZGNA 2HSMA 2PPTA 2IMFA 1JHBA 5EPFA 3AY8A 2LJKA 1R4WA 5ECNB 2LSTA 3FZ4A 2ON5A 3TKRA 5HR3A 3LYKA 2C3TA 1QUWA 3LORA 1YJ6A 2DMMA 3ZFLA 4KCAA 1PD21 5KN1A 4ZB8A 4ECJA 2TIRA 1FOHA 4MH2A 4QL7A 4POLA 9GSSA 1AXDA 1PKWA 1MTCA 4I2TA 2L5OA 2HZFA 3QPMA 1A0RP 3VI5A 3D4TA 4XTSA 1SJ6A 1TK8B 3QAWA 4K2XA 2IIYA 3LQ7A 2LUSA 2WULA 3KH9A 3FZAA 3GN3A 4MZCA 3F0IA 3TGZA 1EZKA 1X5DA 3RHBA 3LXZA 3APSA 3LJRA 4MJAA 5F0GA 1FOVA 2C80A 3IA1A 1E6BA 4K9ZA 4ACSA 1MD3A 1J0FA 3G7IA 3GURA 3GFKA 3ZMLA 3US3A 5BMUA 5D9XA 2PERA 2E2GA 3FYGA 1O81A 1XZOA 5F06A 2X99A 5G5FA 3MNGA 4ZL7A 4FIWA 2OA7A 1EEMA 1XW6A 2FA8A 3RPPA 2A4HA 2C8UA 1GWCA 1Z7RA 3ZIVA 1H75A 12GSA 1ZMAA 4NMUA 5D96A 3M8NA 5H5RA 4F2IA 3EE2A 5AIXA 1XW9A 3UEMA 5ECQB 2WGRA 3TDGA 3W8SA 1WOUA 2C3QA 2QC7A 3Q19A 4BVXB 3IV4A 3UOMA 4IHUA 1G6YA 1FVJA 4EDYA 1ABAA 3ZFBA 2VM2A 3I9V2 4MPGA 3IHGA 6GSTA 2P5QA 3TKQA 5ECRB 3ZLPA 3W6GA 5CP1A 4N30A 4KDUA 3O76A 5JCWA 3ZVJA 2RIIA 4J2FA 1UN2A 4WXTA 1V2AA 1XPVA 4EXJA 1NHOA 2YWIA 3CQFA 1DSBA 3HVSA 2EIQA 2H30A 4V1Ap 2YNXA 2QGVA 1WP0A 5B8BA 1T7PB 3M9KA 1YEXA 1AAZA 1MDKA 3DXBA 3QMXA 4WR4A 1TRSA 1F3AA 3F6DA 3QDNA 2DC5A 1TRUA 1OYJA 1QGVA 4XCSA 1SKWB 1Z5YE 3D6IA 4TN8A 1U3AA 5KN0A 1EEJA 1X0RA 1GUKA 2H70A 3M3MA 4K0NA 5HR0A 4K1FA 1FHEA 4XRDA 2GT5A 1XWKA 1TRVA 4FYBA 3LWAA 2DJKA 3DGQA 3FHKA 1NM3A 3ME7A 3QD9A 4L5LA 5IMDA 4ICYA 3UMAA 5ECPB 5ECLB 3GKXA 1XVWA 3KP8A 3HJMA 2M46A 4ECCA 11GSA 5COHA 1BEDA 1THOA 4ULXA 2K6VA 4YKFA 2R3XA 3PR8A 2MMAA 3HKRA 2JSYA 1ZZYA 2GSRA 2E7PA 3FK8A 1WE0A 1A2MA 5D9TA 4YQUA 3TKPA 2B6MA 1M9AA 1W89A 2P0GA 4ML1A 4MH3A 3F4TA 1K0DA 4GSTA 2NBSA 1UC7A 5EL8A 5KOWA 1BQ7A 2AUVA 4KNDA 3GX0A 4PX1A 3BBYA 3HDCA 3R2QA 1V40A 4GQCA 2WJUA 5KEJA 2DIZA 2MMZA 4EIQA 5D73A 3D22A 3W8JA 3VWUA 2N5FA 2H1GA 3CMIA 1T4ZA 3VWXA 2H72A 5DAKB 4GWRA 2OE1A 5KN3A 4HS1A 1TRWA 4O92A 5B6NA 2V6KA 1TK5B 4PNFA 3HJPA 2YWMA 1GULA 2FCHA 4TOPA 5HR1A 4JE1A 14GSA 5EVOA 4NWYA 1TP9A 1KBNA 2F3MA 2I9HA 3BOAA 4NHWA 4GQFA 3PPUA 4HUAA 2H75A 4ECIA 1U88A 3DKSA 2GSQA 4ZL8A 5F05A 2E0QA 2VL2A 2MYGA 1Y25A 2PVOC 3CXGA 2D2ZA 5J41A 3UJ1A 1B4QA 1F3BA 4XHMA 4ECBA 3ZMKA 4G0LA 1ZOFA 1SJIA 2HRFA 4EE0A 2B7JA 4Q5NA 3HD5A 4TRXA 5F8BA 1F2EA 2FNOA 4MABA 3P90A 3LSZA 4CY8A 6GSXA 3RHCA 3F9UA 4IP1A 1Q98A 5CRWA 4QL9A 4HQZA 1M7TA 1GP1A 5DQYA 5J4UA 3D21A 5CRGA 1OE8A 5C00A 3VURA 4N0VA 2OBIA 5IMZA 1ML6A 2FLSA 1SJZA 2H1DA 3IRAA 4HEA2 5DBQA 2HSHA 3EINA 2FWEA 2JADA 2X8CA 3FMWA 3P8WA 4PQ1A 1GSQA 2VLUA 2JU5A 4HOJA 4IVFA 4OD7A 3CSJA 4FYCA 3IXRA 3QOUA 1R26A 1WIKA 3WYWA 2B5YA 4J57E 3MDKA 2M80A 4Z2TA 4WBRD 3I43A 2DJ0A 4X43A 2IL3A 4JR4A 4BVYA 5ELGA 3GUSA 1U6TA 3MYDA 3KM6A 4WF5A 5G1KA 2GVPA 2QKEA 3KP9A 2JZRA 1YKAA 4V1Ag 13GSA 2X8HA 5HFGA 1K0BA 1ON4A 4K5SA 1RW1A 4F82A 2QSIA 2K8SA 3ZTLA 2EIOA 2VCQA 2DJ2A 3LYPA 3KZQA 2FD3A 1TOFA 3PGTA 2XBIA 2HI7A 1VF4A 1SD9A 5B8AA 2V2GA 3EURA 1ZL9A 4GLTA 2LRCA 3GMFA 4OFNA 2PMTA 4TR4A 1SYXA 1SKSB 2H1AA 3LW9A 3D5JA 3GL5A 3HVXA 1Z9HA 3M1GA 2LJAA 4KDXA 2VCWA 2K18A 2OE3A 4LA1A 4AJ8A 1YDKA 3U5RE 5ECSA 1X9WB 1LBKA 3IDVA 4FO5A 1SL0B 1SD8A 1QMVA 1MD4A 4WEYA 4RI7A 4OCEA 3G7YA 5A5KA 2MBTA 2FGXA 2LKUA 3TKSA 4GF0A 2GSTA 3ZRDA 4ZBAA 1PQNA 1GRXA 4G19A 2CQ9A 2YV9A 5ENUA 4IW9A 2GS3A 1B4PA 5B7CA 2GQMA 4MMMA 3UIWA 3BD2A 2WCIA 2WB9A 1EWXA 1PMTA 2VCZA 2WS2A 2RM5A 5IPGA 2ZUPA 1M9BA 5ECHB 1XG8A 5IM9A 1EV9A 1QQ2A 1N2AA 1DE2A 4MA9A 2L4CA 4MPFA 1F9MA 2AB6A 1V9WA 2L57A 4ZBDA 1XVQA 1GL8A 1WPIA 5JWRB 3KGKA 3PINA 5ABRA 5BRTA 4X0XA 2VM1A 3G7JA 3Q74A 4O5RA 8GSSA 4PNGA 2HFDA 4YKGA 1JZDA 3FR3A 2A4VA 4POMA 4YQVA 1LJRA 5G30A 2GZPA 5FWGA 1I9DA 3IPZA 3E9JB 2H73A 3HYPA 3FRCA 2AJQB 3N5OA 2KP2A 4G0IA 4N11A 4DSSA 5CNWA 1T1VA 3KD0A 5DJMA 2GZYA 1OC9B 3C73A 3KXOA 6GSVA 2H76A 4BL7A 2IMEA 1EV4A 2LS5A 1PN9A 2OKAA 3M0FA 2R2JA 2VAFA 3HY2A 1V98A 1J9BA 2MMNA 1TDIA 4ML6A 4WBJA 3CSIA 4BVYB 4JZQA 2F51A 1O73A 1GSFA 4XS4B 3D0ZA 1B9YC 3TRPA 3GX8A 1QK8A 4PXOA 2LEGA 1BJXA 2N5AA 4I2UA 4WR5A 2DKHA 2CVDA 4TR3A 5HQPA 1B8XA 4JR6A 3GKMA 2XBQA 4AF2A 1A8YA 2C0DA 2CZ3A 3ZYWA 4KAEA 4HJ2A 1W4VA 2IMIA 1ZYEA 4O5QA 2H0HA 1GTBA 7GSSA 1GH2A 3V1WA 4MZBA 4TR1A 2JL4A 5B6MA 1G6WA 4YAVA 3UVHA 3EPTA 3CTGA 1T4YA 2EIRA 2OE0A 3G9BA 2EC4A 4EUYA 3H8QA 1SK1A 4EO3A 2HZEB 3S9FA 3GHAA 4MCUA 2C4JA 4KX4A 1FW1A 1DUGA 2O7KA 4J56E 2YV7A 2JZTA 2ON7A 3GA4A 2NTOA 2AHEA 1BX9A 5KOXA 4EF0A 1Z6MA 1O8WA 3P7XA 3ERWA 3QFBC 4F9ZA 1WMJA 1VF2A 4RQXA 1FAAA 5GAPD 1GTUA 5ID2A 2VCTA 4BWSA 2HRKA 3MIXA 3WGXA 4K5RA 2KUCA 3J7Yk 2XPDA 3F6FA 4MF7A 4ZIJA 3MWHA 18GSA 3VI7A 3TCOA 1IYIA 2JACA 3FY7A 1R5AA 2C0EA 1HNCA 1M2BA 1NSWA 5IO0A 1Z6NA 3FEUA 1G0TA 2RUFA 1T3BA 3TB2A 2FHEA 3HXSA 3APQA 4NAXA 1EOHA 2FWFA 1SL1B 4ILFA 2TRXA 4RI6A 2VL2C 4KW6A 3QAGA 4MF5A 1WWJA 2VUPA 1B9XC 3N9JA 3IK9A 1HD2A 5D9WA 4ZXGA 1TJDA 2HE3A 1XWCA 2X8GA 2L6CA 2O89A 3MSZA 2KOKA 3DYRA 1KNGA 1BG5A 3L9SA 2B3SA 1X9SB 2VCXA 2Z9SA 3CRUA 5DQSA 1TI3A 1GLPA 1R7HA 4GSSA 5A4VA 2GDRA 4YH2A 1ZYQB 1EOGA 2I81A 1K0CA 2HRNA 1WJKA 1F6MC 3VWVA 2B5XA 2YJ7A 2FWHA 1AW9A 4BL7B 4PQIA 3KMNA 19GSA 4HI7A 3GNJA 1ERTA 2G0FA 2H6ZA 3IBHA 5DALA 5A4WA 3J7Yb 2MMOA 5AIVA 3IR4A 2ZNMA 3FR9A 4JEDA 1SU9A 2CX3A 2PUKC 3GTUA 3RPNA 2VL3A 5G1LA 1EP8A 6GSUA 3DVWA 3HVNA 4NPBA 1K3LA 4WETA 3FZ5A 5GSTA 2GT6A 1TTZA 4CDOA 4HDEA 1OVNA 1V58A 4NV5A 4IBPA 4JRRA 4OMVA 3DD3A 4HU9A 2H6XA 2I1UA 2CZ2A 4ZB6A 4HZ4A 1HNBA 1XWBA 3O3TA 3UVTA 3GH9A 4HJMA 3ZVJD 2REMA 6GSYA 3QAVA 1GUHA 3M9JA 1AIUA 1PX6A 1JLVA 2LNTA 5G5EA 2H74A 3C71A 2NPBA 2CAQA 5HR2A 1GSUA 3UBLA 2XPEA 3GKNA 5FT3A 2H6YA 1HNAA 3E0UA 4X1UA 3EWLA 3HHVA 4TW5A 3F4RA 2WRTA 2VD1A 1EP7A 5H5QA 1YEPA 2F9SA 1V57A 1URMA 3HZ8A 4EIPA 2R4VA 5ECIB 1PX7A 1Z3EA 2O87A 3L9VA 1GNEA 3DMLA 2IJYA 3F3RA 4XS1A 3GYKA 2YWOA 3GKKA 4L8EA 4K6XA 2LNSA 3IE3A 2HT9A 1GTIA 4I8BA 2LRNA 1H4OA 4WKWA 1SENA 4MJBA 5ELAA 1Z7PA 4TVEA 4PQHA 1PSQA 1YQ1A 1T00A 1A8LA 1CQGA 3TKSC 4MLYA 4MZWA 2R0GA 2HNLA 4PUFC 2OACA 3ERGA 2PU9C 4AJ6A 2IWTA 1OKTA 5DCGA 16GSA 4G10A 2HXKA 1A2JA 1DE1A 1M2AA 1HYUA 2V41A 4BPYA 2L59A 4FYUA 4GRFA 3WT1A 2AAWA 1A24A 4BA7A 2PN8A 4ZL9A 2WFCA 1S3RA 2B5EA 4WF4A 1B48A 5CREA 1SK0A 2C1YA 2A2RA 4TKYA 1FVKA 1MEKA 3NOFA 4ZILA 4K7NA 2HYXA 2DLXA 4POKA 3VK9A 1ERUA 4BVXA 4QQ7A 1ST9A 2GTUA 4IJIA 5GAND 4OFMA 5ECMB 5J5NA 1O6JA 1RQMA 2V32A 3EMPA 2A2SA 2GQLA 4LL4B 4PURA 3VWWA 3TOUA 1QXHA 2UZ8A 4POBA 5D93A 3KTBA
chains in the Genus database with same CATH topology
2R0PA 3DVXA 2H0GA 5F07A 4E8EA 4AGSA 5ECOB 1XOBA 4IJ3A 1CQHA 4MJEA 2GSSA 3H79A 3C7MA 6GSWA 2VO4A 1XBSA 3IOSA 3LXTA 3NIVA 1HQOA 2DSAA 1PN0A 4K7OA 2E2MA 2L4QA 4N10A 3EYTA 3KH7A 3RBTA 1Y6EA 4DSQA 2F8FA 2AV4A 1ILOA 1O7UA 1OE7A 2X4AA 1O8XA 3VLNA 2B7KA 1K3YA 3JCML 4YQMA 5HFKA 3FW2A 3LFLA 4E8HA 2MBSA 3VPQA 1ZCPA 2TRCP 1O85A 3DRNA 2CX4A 2HRAA 3VFIA 1K0AA 3GH6A 2GGTA 3CYNA 3H93A 2C0GA 20GSA 3BCKA 5IMFA 5J9CA 1AQWA 5E59A 3ZITA 2QA1A 4NHZA 1TXXA 2YCDA 2RLIA 1YF1A 2OADA 4USSA 1KEBA 2RUEA 4OWYA 1ACVA 4IP6A 3SBCA 1TW9A 4IQ1A 2CA8A 3APOA 1G7OA 4MDCA 5J9BA 2IN3A 2IMDA 1A23A 4PTSA 5CO3A 1TU8A 4LL1B 1XWAA 4EVMA 4D73A 4HQSA 2R6KA 3PH9A 10GSA 2PGTA 2R37A 3LGCA 2OJLA 2H8LA 1SK2A 5AISA 5IMVA 4K7IA 1C72A 4MF6A 2L6DA 2B1KA 1GNWA 2DIYA 2BJXA 2LV3A 4ISDA 2GQKA 4Q5RA 2K9FA 3BJ5A 1FB0A 1YF0A 5CRHA 2QA2A 3TJGA 1XCCA 3FKFA 1S3CA 4MNNA 5JCUA 2DJ1A 4Q5QA 5DAKA 1YKCA 1OKDA 3A2VA 2V6OA 3IHQA 2LQQA 3ISOA 1OC8A 2O85A 4NV2A 1GSYA 22GSA 3F8UA 4OFTA 3ZIJA 2IFQA 4F03A 2GZZA 5LNKe 1Q4JA 1PKZA 1JFUA 3TJKA 1XWGA 1U3IA 3R3EA 2AYTA 3TUEA 2YJHA 5DJLA 3C1SA 2I4AA 4TXOA 3EC3A 2YOIA 5ECKB 2H71A 2RM6A 4I6XA 1XXUA 2LRTA 4Z2RA 1VF3A 1M2DA 1OAZA 1TK0B 5AN1A 1SYRA 2ZCTA 4Z7XA 2WZ9A 1S3AA 2HSYA 3A3TA 1THXA 4O5UA 4G0KA 2YZUA 4IELA 1YY7A 5A4UA 2YWNA 5JWQB 3O6TA 2PBJA 2O8VB 2IPAA 2YP6A 2CVKA 2PWJA 3UL3A 4AJ7A 4OO4A 3A2XA 3HVVA 3E3EA 3WGDA 5D8IA 4F0BA 4IKHA 3EVIA 1AC1A 2LQOA 4FQUA 3TKSE 2L5LA 3ED3A 3CSHA 1M0UA 5C04A 1K3OA 1AQXA 3ERFA 3ZREA 3MAKA 1S3DA 1SL2B 3C1RA 3L4NA 1VF1A 1AUCA 4IS0A 2IMKA 3TRXA 4KF9A 4H86A 5IQYA 1A2LA 4RQRA 1WRYA 1X5CA 3L78A 2B1LA 2HLSA 3ZZXA 2DBCA 2DJ3A 1T8EB 1K0MA 3NZNA 1X5EA 3IC8A 3RAZA 5IO2A 2LTKA 4KH7A 4FH8A 3A5WA 3TOTA 4MP4A 5E4WA 4KGIA 1XIYA 4EC0A 1NW2A 5DDLA 2FWGA 4V2MA 3IC4A 2DJJA 2H66A 2VLTA 4KA0A 3FZ9A 3LEFA 6GSSA 1GTAA 1DBYA 4EL1A 1GSEA 2YPMA 2C3NA 1PRXA 3H1NA 4DEJA 2NDOA 3GSTA 3KIJA 3UBKA 3H4KA 1SKRB 1JZOA 2ES7A 5EY6A 5L71A 3KJYA 1ERVA 2ALBA 4V2LA 2K8VA 4DVCA 2JZSA 4IN0A 2VIMA 2KHPA 4V2NA 1K0NA 5J3RA 3C8EA 3QCPA 5LCZA 2J23A 1LU4A 1A0FA 2VL9A 3DIEA 4Q5FA 5GSSA 4K2DA 5DVBA 4D73B 4DSSB 1VRSD 3L0HA 4MJCA 2H1BA 5DCHA 4ZBBA 1MDJA 3ME8A 4XS6A 1NHYA 1PA3A 4OO5A 3D4MA 3GIXA 4YAPA 5CAXA 5CYYA 3DEXA 1PGTA 2N5BA 4KDYA 4DSRA 1TU7A 2KLXA 3TJFA 4NXIA 2VD0A 3LG6A 2IFQB 4KB3A 5D9VA 4LMVA 4P3YB 4TR0A 4K8MA 2CT6A 4LLRA 1TI1A 4TXOB 17GSA 1EGRA 5G2ZA 1F37A 1FB6A 3SWLA 3UARA 1X9MB 4ID0A 2R5GA 2YZHA 5JCGA 5IPHA 1M99A 5CRDA 3VPTA 4F0CA 3QR6A 5JWOB 1GSDA 1OC3A 1USBA 1G7EA 5AGYA 4TR1B 3RDWA 2A2PA 2OBKA 2X49A 4BWQA 2VCVA 4KE3A 3DWVA 2XC2A 3KMOA 4TXVA 3OR5A 4GSNA 4KSMA 3CBUA 4IQAA 4G2EA 2XHFA 4CHSA 4JBBA 4K0GA 1N8JA 3HA9A 3F63A 2NVLA 2MZCA 3TJJA 1BAYA 1FG4A 3GSSA 3L9UA 1YZXA 3GRXA 1FO5A 4I97A 1ZYPA 4PGTA 5ID2B 1ERWA 4I5QA 2FUG2 1XFLA 4GTUA 5H5SA 4KUNA 1OC9A 2PVQA 3P2AA 1J08A 1EGOA 4CY6A 1QFNA 2VLVA 4A5PA 2H01A 3F3QA 3UAPA 2J9HA 4X4JA 3EMXA 5IOWA 2M72A 2JSZA 1GUMA 4XS4A 1RK4A 2GLRA 5LD0A 4KSOA 3HCZA 5INYA 3I69A 4O32A 3TRQA 3BCIA 3IAS2 3I6AA 3WD6A 4GXZA 1JZRA 4RUVA 2DKIA 3WT2A 2BTOT 3F4SA 4G9HA 2WDUA 4LMWA 3WGEA 3A2WA 1MDIA 4O7HA 4OCFA 2KP1A 4ZB9A 1PL1A 3K8NA 4XIHA 2H19A 2CVBA 2R0CA 2C0FA 4L0WA 2X64A 3GV1A 4EDZA 4CW9A 1PL2A 3EU3A 5G31A 3EU4A 1ZYNA 1K0OA 2P31A 3GL3A 2G2QA 1VGLA 4L0UA 2BMXA 2VOCA 4KCEA 3IK7A 2HZEA 5IIZA 2CV4A 4HU7A 2P5RA 1UVZA 4JU5A 2FA4A 5IMAA 1IYHA 1XOAA 5IMCA 1U87A 4XRAA 3KCMA 3HZ4A 4L5OA 3HJOA 4GCIA 3Q6OA 2FY6A 4EKZA 5DALB 3FR6A 2DMLA 4N0ZA 5HFIA 3CTFA 3A5IA 1XW5A 1R5PA 1UA5A 2YANA 3GTUB 2CAIA 4MK3A 4IGJA 1I5GA 1BYEA 2YN1A 1JLWA 3Q18A 2F8AA 5KN2A 1TKDB 5FHIA 3ZL5A 3TJBA 2I3YA 1KTEA 5IOXA 1E2YA 4Z2UA 2V1MA 3KTLA 1AQVA 3QFAC 3IAM2 4HZ2A 3U6VA 3CRTA 3KEBA 4PUAA 2LJRA 1GLQA 1JZWA 2H0IA 1GSSA 5GZZB 1ZGNA 2HSMA 2PPTA 2IMFA 1JHBA 5EPFA 3AY8A 2LJKA 1R4WA 5ECNB 2LSTA 3FZ4A 2ON5A 3TKRA 5HR3A 3LYKA 2C3TA 1QUWA 3LORA 1YJ6A 2DMMA 3ZFLA 4KCAA 1PD21 5KN1A 4ZB8A 4ECJA 2TIRA 1FOHA 4MH2A 4QL7A 4POLA 9GSSA 1AXDA 1PKWA 1MTCA 4I2TA 2L5OA 2HZFA 3QPMA 1A0RP 3VI5A 3D4TA 4XTSA 1SJ6A 1TK8B 3QAWA 4K2XA 2IIYA 3LQ7A 2LUSA 2WULA 3KH9A 3FZAA 3GN3A 4MZCA 3F0IA 3TGZA 1EZKA 1X5DA 3RHBA 3LXZA 3APSA 3LJRA 4MJAA 5F0GA 1FOVA 2C80A 3IA1A 1E6BA 4K9ZA 4ACSA 1MD3A 1J0FA 3G7IA 3GURA 3GFKA 3ZMLA 3US3A 5BMUA 5D9XA 2PERA 2E2GA 3FYGA 1O81A 1XZOA 5F06A 2X99A 5G5FA 3MNGA 4ZL7A 4FIWA 2OA7A 1EEMA 1XW6A 2FA8A 3RPPA 2A4HA 2C8UA 1GWCA 1Z7RA 3ZIVA 1H75A 12GSA 1ZMAA 4NMUA 5D96A 3M8NA 5H5RA 4F2IA 3EE2A 5AIXA 1XW9A 3UEMA 5ECQB 2WGRA 3TDGA 3W8SA 1WOUA 2C3QA 2QC7A 3Q19A 4BVXB 3IV4A 3UOMA 4IHUA 1G6YA 1FVJA 4EDYA 1ABAA 3ZFBA 2VM2A 3I9V2 4MPGA 3IHGA 6GSTA 2P5QA 3TKQA 5ECRB 3ZLPA 3W6GA 5CP1A 4N30A 4KDUA 3O76A 5JCWA 3ZVJA 2RIIA 4J2FA 1UN2A 4WXTA 1V2AA 1XPVA 4EXJA 1NHOA 2YWIA 1DSBA 3HVSA 2EIQA 2H30A 4V1Ap 2YNXA 2QGVA 1WP0A 5B8BA 1T7PB 3M9KA 1YEXA 1AAZA 1MDKA 3DXBA 3QMXA 4WR4A 1TRSA 1F3AA 3F6DA 3QDNA 2DC5A 1TRUA 1OYJA 1QGVA 4XCSA 1SKWB 1Z5YE 3D6IA 4TN8A 1U3AA 5KN0A 1EEJA 1X0RA 1GUKA 2H70A 3M3MA 4K0NA 5HR0A 4K1FA 1FHEA 4XRDA 2GT5A 1XWKA 1TRVA 4FYBA 3LWAA 2DJKA 3DGQA 3FHKA 1NM3A 3ME7A 3QD9A 4L5LA 5IMDA 4ICYA 3UMAA 5ECPB 5ECLB 3GKXA 1XVWA 3KP8A 3HJMA 2M46A 4ECCA 11GSA 5COHA 1BEDA 1THOA 4ULXA 2K6VA 4YKFA 2R3XA 3PR8A 2MMAA 3HKRA 2JSYA 1ZZYA 2GSRA 2E7PA 3FK8A 1WE0A 1A2MA 5D9TA 4YQUA 3TKPA 2B6MA 1M9AA 1W89A 2P0GA 4ML1A 4MH3A 3F4TA 1K0DA 4GSTA 2NBSA 1UC7A 5EL8A 5KOWA 1BQ7A 2AUVA 4KNDA 3GX0A 4PX1A 3BBYA 3HDCA 3R2QA 1V40A 4GQCA 2WJUA 5KEJA 2DIZA 2MMZA 4EIQA 5D73A 3D22A 3W8JA 3VWUA 2N5FA 2H1GA 3CMIA 1T4ZA 3VWXA 2H72A 5DAKB 4GWRA 2OE1A 5KN3A 4HS1A 1TRWA 4O92A 5B6NA 2V6KA 1TK5B 4PNFA 3HJPA 2YWMA 1GULA 2FCHA 4TOPA 5HR1A 4JE1A 14GSA 5EVOA 4NWYA 1TP9A 1KBNA 2F3MA 2I9HA 3BOAA 4NHWA 4GQFA 3PPUA 4HUAA 2H75A 4ECIA 1U88A 3DKSA 2GSQA 4ZL8A 5F05A 2E0QA 2VL2A 2MYGA 1Y25A 2PVOC 3CXGA 2D2ZA 5J41A 3UJ1A 1B4QA 1F3BA 4XHMA 4ECBA 3ZMKA 4G0LA 1ZOFA 1SJIA 2HRFA 4EE0A 2B7JA 4Q5NA 3HD5A 4TRXA 5F8BA 1F2EA 2FNOA 4MABA 3P90A 3LSZA 4CY8A 6GSXA 3RHCA 3F9UA 4IP1A 1Q98A 5CRWA 4QL9A 4HQZA 1M7TA 1GP1A 5DQYA 5J4UA 3D21A 5CRGA 1OE8A 5C00A 3VURA 4N0VA 2OBIA 5IMZA 1ML6A 2FLSA 1SJZA 2H1DA 3IRAA 4HEA2 5DBQA 2HSHA 3EINA 2FWEA 2JADA 2X8CA 3FMWA 3P8WA 4PQ1A 1GSQA 2VLUA 2JU5A 4HOJA 4IVFA 4OD7A 3CSJA 4FYCA 3IXRA 3QOUA 1R26A 1WIKA 3WYWA 2B5YA 4J57E 3MDKA 2M80A 4Z2TA 4WBRD 3I43A 2DJ0A 4X43A 2IL3A 4JR4A 4BVYA 5ELGA 3GUSA 1U6TA 3MYDA 3KM6A 4WF5A 5G1KA 2GVPA 2QKEA 3KP9A 2JZRA 1YKAA 4V1Ag 13GSA 2X8HA 5HFGA 1K0BA 1ON4A 4K5SA 1RW1A 4F82A 2QSIA 2K8SA 3ZTLA 2EIOA 2VCQA 2DJ2A 3LYPA 3KZQA 2FD3A 1TOFA 3PGTA 2XBIA 2HI7A 1VF4A 1SD9A 5B8AA 2V2GA 3EURA 1ZL9A 4GLTA 2LRCA 3GMFA 4OFNA 2PMTA 4TR4A 1SYXA 1SKSB 2H1AA 3LW9A 3D5JA 3GL5A 3HVXA 1Z9HA 3M1GA 2LJAA 4KDXA 2VCWA 2K18A 2OE3A 4LA1A 4AJ8A 1YDKA 3U5RE 5ECSA 1X9WB 1LBKA 3IDVA 4FO5A 1SL0B 1SD8A 1QMVA 1MD4A 4WEYA 4RI7A 4OCEA 3G7YA 5A5KA 2MBTA 2FGXA 2LKUA 3TKSA 4GF0A 2GSTA 3ZRDA 4ZBAA 1PQNA 1GRXA 4G19A 2CQ9A 2YV9A 5ENUA 4IW9A 2GS3A 1B4PA 5B7CA 2GQMA 4MMMA 3UIWA 3BD2A 2WCIA 2WB9A 1EWXA 1PMTA 2VCZA 2WS2A 2RM5A 5IPGA 2ZUPA 1M9BA 5ECHB 5IM9A 1EV9A 1QQ2A 1N2AA 1DE2A 4MA9A 2L4CA 4MPFA 1F9MA 2AB6A 1V9WA 2L57A 4ZBDA 1XVQA 1GL8A 1WPIA 5JWRB 3KGKA 3PINA 5ABRA 5BRTA 4X0XA 2VM1A 3G7JA 3Q74A 4O5RA 8GSSA 4PNGA 2HFDA 4YKGA 1JZDA 3FR3A 2A4VA 4POMA 4YQVA 1LJRA 5G30A 2GZPA 5FWGA 1I9DA 3IPZA 3E9JB 2H73A 3HYPA 3FRCA 2AJQB 3N5OA 2KP2A 4G0IA 4N11A 4DSSA 5CNWA 1T1VA 3KD0A 5DJMA 2GZYA 1OC9B 3C73A 3KXOA 6GSVA 2H76A 4BL7A 2IMEA 1EV4A 2LS5A 1PN9A 2OKAA 3M0FA 2R2JA 2VAFA 3HY2A 1V98A 1J9BA 2MMNA 1TDIA 4ML6A 4WBJA 3CSIA 4BVYB 4JZQA 2F51A 1O73A 1GSFA 4XS4B 3D0ZA 1B9YC 3TRPA 3GX8A 1QK8A 4PXOA 2LEGA 1BJXA 2N5AA 4I2UA 4WR5A 2DKHA 2CVDA 4TR3A 5HQPA 1B8XA 4JR6A 3GKMA 2XBQA 4AF2A 1A8YA 2C0DA 2CZ3A 3ZYWA 4KAEA 4HJ2A 1W4VA 2IMIA 1ZYEA 4O5QA 2H0HA 1GTBA 7GSSA 1GH2A 3V1WA 4MZBA 4TR1A 2JL4A 5B6MA 1G6WA 4YAVA 3UVHA 3EPTA 3CTGA 1T4YA 2EIRA 2OE0A 3G9BA 2EC4A 4EUYA 3H8QA 1SK1A 4EO3A 2HZEB 3S9FA 3GHAA 4MCUA 2C4JA 4KX4A 1FW1A 1DUGA 2O7KA 4J56E 2YV7A 2JZTA 2ON7A 3GA4A 2NTOA 2AHEA 1BX9A 5KOXA 4EF0A 1Z6MA 1O8WA 3P7XA 3ERWA 3QFBC 4F9ZA 1WMJA 1VF2A 4RQXA 1FAAA 5GAPD 1GTUA 5ID2A 2VCTA 4BWSA 2HRKA 3MIXA 3WGXA 4K5RA 2KUCA 3J7Yk 2XPDA 3F6FA 4MF7A 4ZIJA 3MWHA 18GSA 3VI7A 3TCOA 1IYIA 2JACA 3FY7A 1R5AA 2C0EA 1HNCA 1M2BA 1NSWA 5IO0A 1Z6NA 3FEUA 1G0TA 2RUFA 1T3BA 3TB2A 2FHEA 3HXSA 3APQA 4NAXA 1EOHA 2FWFA 1SL1B 4ILFA 2TRXA 4RI6A 2VL2C 4KW6A 3QAGA 4MF5A 1WWJA 2VUPA 1B9XC 3N9JA 3IK9A 1HD2A 5D9WA 4ZXGA 1TJDA 2HE3A 1XWCA 2X8GA 2L6CA 2O89A 3MSZA 2KOKA 3DYRA 1KNGA 1BG5A 3L9SA 2B3SA 1X9SB 2VCXA 2Z9SA 3CRUA 5DQSA 1TI3A 1GLPA 1R7HA 4GSSA 5A4VA 2GDRA 4YH2A 1ZYQB 1EOGA 2I81A 1K0CA 2HRNA 1WJKA 1F6MC 3VWVA 2B5XA 2YJ7A 2FWHA 1AW9A 4BL7B 4PQIA 3KMNA 19GSA 4HI7A 3GNJA 1ERTA 2G0FA 2H6ZA 3IBHA 5DALA 5A4WA 3J7Yb 2MMOA 5AIVA 3IR4A 2ZNMA 3FR9A 4JEDA 1SU9A 2CX3A 2PUKC 3GTUA 3RPNA 2VL3A 5G1LA 1EP8A 6GSUA 3DVWA 4NPBA 1K3LA 4WETA 3FZ5A 5GSTA 2GT6A 1TTZA 4CDOA 4HDEA 1OVNA 1V58A 4NV5A 4IBPA 4JRRA 4OMVA 3DD3A 4HU9A 2H6XA 2I1UA 2CZ2A 4ZB6A 4HZ4A 1HNBA 1XWBA 3O3TA 3UVTA 3GH9A 4HJMA 3ZVJD 2REMA 6GSYA 3QAVA 1GUHA 3M9JA 1AIUA 1PX6A 1JLVA 2LNTA 5G5EA 2H74A 3C71A 2NPBA 2CAQA 5HR2A 1GSUA 3UBLA 2XPEA 3GKNA 5FT3A 2H6YA 1HNAA 3E0UA 4X1UA 3EWLA 3HHVA 4TW5A 3F4RA 2WRTA 2VD1A 1EP7A 5H5QA 1YEPA 2F9SA 1V57A 1URMA 3HZ8A 4EIPA 2R4VA 5ECIB 1PX7A 1Z3EA 2O87A 3L9VA 1GNEA 3DMLA 2IJYA 3F3RA 4XS1A 3GYKA 2YWOA 3GKKA 4L8EA 4K6XA 2LNSA 3IE3A 2HT9A 1GTIA 4I8BA 2LRNA 1H4OA 4WKWA 1SENA 4MJBA 5ELAA 1Z7PA 4TVEA 4PQHA 1PSQA 1YQ1A 1T00A 1A8LA 1CQGA 3TKSC 4MLYA 4MZWA 2R0GA 2HNLA 4PUFC 2OACA 3ERGA 2PU9C 4AJ6A 2IWTA 1OKTA 5DCGA 16GSA 4G10A 2HXKA 1A2JA 1DE1A 1M2AA 1HYUA 2V41A 4BPYA 2L59A 4FYUA 4GRFA 3WT1A 2AAWA 1A24A 4BA7A 2PN8A 4ZL9A 2WFCA 2B5EA 4WF4A 1B48A 5CREA 1SK0A 2C1YA 2A2RA 4TKYA 1FVKA 1MEKA 3NOFA 4ZILA 4K7NA 2HYXA 2DLXA 4POKA 3VK9A 1ERUA 4BVXA 4QQ7A 1ST9A 2GTUA 4IJIA 5GAND 4OFMA 5ECMB 5J5NA 1O6JA 1RQMA 2V32A 3EMPA 2A2SA 2GQLA 4LL4B 4PURA 3VWWA 3TOUA 1QXHA 2UZ8A 4POBA 5D93A 3KTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVX A;  2H0G A;  5F07 A;  4E8E A;  4AGS A;  5ECO B;  1XOB A;  4IJ3 A;  1CQH A;  4MJE A;  2GSS A;  3H79 A;  3C7M A;  6GSW A;  2VO4 A;  1XBS A;  3IOS A;  3LXT A;  3NIV A;  1HQO A;  2DSA A;  4K7O A;  2E2M A;  2L4Q A;  4N10 A;  3EYT A;  3KH7 A;  3RBT A;  1Y6E A;  4DSQ A;  2F8F A;  2AV4 A;  1ILO A;  1O7U A;  1OE7 A;  1O8X A;  3VLN A;  2B7K A;  1K3Y A;  3JCM L;  4YQM A;  5HFK A;  3FW2 A;  3LFL A;  4E8H A;  2MBS A;  3VPQ A;  1ZCP A;  2TRC P;  1O85 A;  3DRN A;  2CX4 A;  3VFI A;  1K0A A;  3GH6 A;  2GGT A;  3CYN A;  3H93 A;  2C0G A;  20GS A;  3BCK A;  5IMF A;  5J9C A;  1AQW A;  5E59 A;  3ZIT A;  4NHZ A;  1TXX A;  2YCD A;  2RLI A;  1YF1 A;  2OAD A;  1KEB A;  2RUE A;  4OWY A;  1ACV A;  4IP6 A;  3SBC A;  1TW9 A;  4IQ1 A;  2CA8 A;  3APO A;  1G7O A;  4MDC A;  5J9B A;  2IN3 A;  2IMD A;  1A23 A;  5CO3 A;  1TU8 A;  4LL1 B;  1XWA A;  4EVM A;  4D73 A;  4HQS A;  2R6K A;  3PH9 A;  10GS A;  2PGT A;  2R37 A;  3LGC A;  2OJL A;  2H8L A;  1SK2 A;  5AIS A;  5IMV A;  4K7I A;  1C72 A;  4MF6 A;  2L6D A;  2B1K A;  1GNW A;  2DIY A;  2BJX A;  2LV3 A;  4ISD A;  2GQK A;  4Q5R A;  2K9F A;  3BJ5 A;  1FB0 A;  1YF0 A;  5CRH A;  3TJG A;  1XCC A;  3FKF A;  1S3C A;  5JCU A;  2DJ1 A;  4Q5Q A;  5DAK A;  1YKC A;  1OKD A;  3A2V A;  2V6O A;  3IHQ A;  2LQQ A;  3ISO A;  1OC8 A;  2O85 A;  4NV2 A;  1GSY A;  22GS A;  3F8U A;  4OFT A;  3ZIJ A;  2IFQ A;  4F03 A;  2GZZ A;  5LNK e;  1Q4J A;  1PKZ A;  1JFU A;  3TJK A;  1XWG A;  1U3I A;  2AYT A;  3TUE A;  2YJH A;  5DJL A;  3C1S A;  2I4A A;  4TXO A;  3EC3 A;  2YOI A;  5ECK B;  2H71 A;  2RM6 A;  4I6X A;  1XXU A;  2LRT A;  1VF3 A;  1M2D A;  1OAZ A;  1TK0 B;  5AN1 A;  1SYR A;  2ZCT A;  4Z7X A;  2WZ9 A;  1S3A A;  2HSY A;  3A3T A;  1THX A;  2YZU A;  4IEL A;  1YY7 A;  5A4U A;  2YWN A;  5JWQ B;  3O6T A;  2PBJ A;  2O8V B;  2IPA A;  2YP6 A;  2CVK A;  2PWJ A;  3UL3 A;  4AJ7 A;  4OO4 A;  3A2X A;  3HVV A;  3E3E A;  3WGD A;  5D8I A;  4F0B A;  4IKH A;  3EVI A;  1AC1 A;  2LQO A;  3TKS E;  2L5L A;  3ED3 A;  3CSH A;  1M0U A;  5C04 A;  1K3O A;  1AQX A;  3ERF A;  3ZRE A;  3MAK A;  1S3D A;  1SL2 B;  3C1R A;  3L4N A;  1VF1 A;  1AUC A;  4IS0 A;  2IMK A;  3TRX A;  4H86 A;  5IQY A;  1A2L A;  4RQR A;  1WRY A;  1X5C A;  3L78 A;  2B1L A;  2HLS A;  3ZZX A;  2DBC A;  2DJ3 A;  1T8E B;  1K0M A;  3NZN A;  1X5E A;  3RAZ A;  5IO2 A;  2LTK A;  4KH7 A;  4FH8 A;  3A5W A;  3TOT A;  4MP4 A;  5E4W A;  4KGI A;  1XIY A;  4EC0 A;  1NW2 A;  5DDL A;  2FWG A;  4V2M A;  3IC4 A;  2DJJ A;  2H66 A;  2VLT A;  4KA0 A;  3FZ9 A;  3LEF A;  6GSS A;  1GTA A;  1DBY A;  4EL1 A;  1GSE A;  2YPM A;  2C3N A;  1PRX A;  3H1N A;  4DEJ A;  2NDO A;  3GST A;  3KIJ A;  3UBK A;  3H4K A;  1SKR B;  1JZO A;  2ES7 A;  5EY6 A;  5L71 A;  3KJY A;  1ERV A;  2ALB A;  4V2L A;  2K8V A;  4DVC A;  2JZS A;  4IN0 A;  2VIM A;  2KHP A;  4V2N A;  1K0N A;  5J3R A;  3C8E A;  3QCP A;  5LCZ A;  2J23 A;  1LU4 A;  1A0F A;  2VL9 A;  3DIE A;  4Q5F A;  5GSS A;  4K2D A;  5DVB A;  4D73 B;  4DSS B;  1VRS D;  3L0H A;  4MJC A;  2H1B A;  5DCH A;  4ZBB A;  1MDJ A;  3ME8 A;  4XS6 A;  1NHY A;  1PA3 A;  4OO5 A;  3D4M A;  3GIX A;  4YAP A;  5CAX A;  5CYY A;  3DEX A;  1PGT A;  2N5B A;  4KDY A;  4DSR A;  1TU7 A;  2KLX A;  3TJF A;  4NXI A;  2VD0 A;  3LG6 A;  2IFQ B;  4KB3 A;  5D9V A;  4LMV A;  4P3Y B;  4TR0 A;  4K8M A;  2CT6 A;  4LLR A;  1TI1 A;  4TXO B;  17GS A;  1EGR A;  5G2Z A;  1F37 A;  1FB6 A;  3SWL A;  3UAR A;  1X9M B;  4ID0 A;  2R5G A;  2YZH A;  5JCG A;  5IPH A;  1M99 A;  5CRD A;  3VPT A;  4F0C A;  3QR6 A;  5JWO B;  1GSD A;  1OC3 A;  1USB A;  1G7E A;  5AGY A;  4TR1 B;  3RDW A;  2OBK A;  4BWQ A;  2VCV A;  4KE3 A;  3DWV A;  2XC2 A;  3KMO A;  4TXV A;  3OR5 A;  4GSN A;  4KSM A;  3CBU A;  4IQA A;  4G2E A;  2XHF A;  4CHS A;  4JBB A;  4K0G A;  1N8J A;  3HA9 A;  3F63 A;  2NVL A;  2MZC A;  3TJJ A;  1BAY A;  1FG4 A;  3GSS A;  3L9U A;  1YZX A;  3GRX A;  1FO5 A;  4I97 A;  4PGT A;  5ID2 B;  1ERW A;  4I5Q A;  2FUG 2;  1XFL A;  4GTU A;  5H5S A;  4KUN A;  1OC9 A;  2PVQ A;  3P2A A;  1J08 A;  1EGO A;  1QFN A;  2VLV A;  2H01 A;  3F3Q A;  3UAP A;  2J9H A;  3EMX A;  5IOW A;  2M72 A;  2JSZ A;  1GUM A;  4XS4 A;  1RK4 A;  2GLR A;  5LD0 A;  4KSO A;  3HCZ A;  5INY A;  3I69 A;  4O32 A;  3TRQ A;  3BCI A;  3IAS 2;  3I6A A;  3WD6 A;  4GXZ A;  1JZR A;  4RUV A;  3WT2 A;  2BTO T;  3F4S A;  4G9H A;  2WDU A;  4LMW A;  3WGE A;  3A2W A;  1MDI A;  4O7H A;  4OCF A;  2KP1 A;  4ZB9 A;  1PL1 A;  3K8N A;  4XIH A;  2H19 A;  2CVB A;  2C0F A;  4L0W A;  2X64 A;  3GV1 A;  4EDZ A;  4CW9 A;  1PL2 A;  3EU3 A;  5G31 A;  3EU4 A;  1K0O A;  2P31 A;  3GL3 A;  2G2Q A;  1VGL A;  4L0U A;  2BMX A;  2VOC A;  4KCE A;  3IK7 A;  2HZE A;  5IIZ A;  2CV4 A;  4HU7 A;  2P5R A;  1UVZ A;  4JU5 A;  2FA4 A;  5IMA A;  1IYH A;  1XOA A;  5IMC A;  1U87 A;  4XRA A;  3KCM A;  3HZ4 A;  4L5O A;  3HJO A;  4GCI A;  3Q6O A;  2FY6 A;  4EKZ A;  5DAL B;  3FR6 A;  2DML A;  4N0Z A;  5HFI A;  3CTF A;  1XW5 A;  1R5P A;  1UA5 A;  2YAN A;  3GTU B;  2CAI A;  4MK3 A;  4IGJ A;  1I5G A;  1BYE A;  2YN1 A;  1JLW A;  3Q18 A;  2F8A A;  5KN2 A;  1TKD B;  5FHI A;  3ZL5 A;  3TJB A;  2I3Y A;  1KTE A;  5IOX A;  1E2Y A;  2V1M A;  3KTL A;  1AQV A;  3QFA C;  3IAM 2;  4HZ2 A;  3U6V A;  3CRT A;  3KEB A;  4PUA A;  2LJR A;  1GLQ A;  1JZW A;  2H0I A;  1GSS A;  5GZZ B;  1ZGN A;  2PPT A;  2IMF A;  1JHB A;  5EPF A;  3AY8 A;  2LJK A;  1R4W A;  5ECN B;  2LST A;  3FZ4 A;  2ON5 A;  3TKR A;  5HR3 A;  3LYK A;  2C3T A;  1QUW A;  3LOR A;  1YJ6 A;  2DMM A;  3ZFL A;  4KCA A;  1PD2 1;  5KN1 A;  4ZB8 A;  4ECJ A;  2TIR A;  4MH2 A;  4QL7 A;  4POL A;  9GSS A;  1AXD A;  1PKW A;  1MTC A;  4I2T A;  2L5O A;  2HZF A;  3QPM A;  1A0R P;  3VI5 A;  3D4T A;  4XTS A;  1SJ6 A;  1TK8 B;  3QAW A;  2IIY A;  3LQ7 A;  2LUS A;  2WUL A;  3KH9 A;  3FZA A;  3GN3 A;  4MZC A;  3F0I A;  3TGZ A;  1EZK A;  1X5D A;  3RHB A;  3LXZ A;  3APS A;  3LJR A;  4MJA A;  5F0G A;  1FOV A;  2C80 A;  3IA1 A;  1E6B A;  4K9Z A;  4ACS A;  1MD3 A;  1J0F A;  3G7I A;  3GUR A;  3GFK A;  3ZML A;  3US3 A;  5D9X A;  2PER A;  2E2G A;  3FYG A;  1O81 A;  1XZO A;  5F06 A;  2X99 A;  5G5F A;  3MNG A;  4ZL7 A;  4FIW A;  2OA7 A;  1EEM A;  1XW6 A;  2FA8 A;  3RPP A;  2C8U A;  1GWC A;  1Z7R A;  3ZIV A;  1H75 A;  12GS A;  1ZMA A;  4NMU A;  5D96 A;  3M8N A;  5H5R A;  4F2I A;  3EE2 A;  5AIX A;  1XW9 A;  3UEM A;  5ECQ B;  2WGR A;  3TDG A;  3W8S A;  1WOU A;  2C3Q A;  2QC7 A;  3Q19 A;  3IV4 A;  3UOM A;  4IHU A;  1G6Y A;  1FVJ A;  4EDY A;  1ABA A;  3ZFB A;  2VM2 A;  3I9V 2;  4MPG A;  6GST A;  2P5Q A;  3TKQ A;  5ECR B;  3ZLP A;  3W6G A;  5CP1 A;  4N30 A;  4KDU A;  3O76 A;  5JCW A;  3ZVJ A;  2RII A;  4J2F A;  1UN2 A;  4WXT A;  1V2A A;  1XPV A;  4EXJ A;  1NHO A;  2YWI A;  1DSB A;  3HVS A;  2EIQ A;  2H30 A;  4V1A p;  2YNX A;  2QGV A;  1WP0 A;  5B8B A;  1T7P B;  3M9K A;  1YEX A;  1AAZ A;  1MDK A;  3DXB A;  3QMX A;  4WR4 A;  1TRS A;  1F3A A;  3F6D A;  3QDN A;  2DC5 A;  1TRU A;  1OYJ A;  1QGV A;  4XCS A;  1SKW B;  1Z5Y E;  3D6I A;  4TN8 A;  1U3A A;  5KN0 A;  1EEJ A;  1X0R A;  1GUK A;  2H70 A;  3M3M A;  4K0N A;  5HR0 A;  4K1F A;  1FHE A;  4XRD A;  2GT5 A;  1XWK A;  1TRV A;  4FYB A;  3LWA A;  2DJK A;  3DGQ A;  3FHK A;  1NM3 A;  3ME7 A;  3QD9 A;  4L5L A;  5IMD A;  3UMA A;  5ECP B;  5ECL B;  3GKX A;  1XVW A;  3KP8 A;  3HJM A;  2M46 A;  4ECC A;  11GS A;  5COH A;  1BED A;  1THO A;  4ULX A;  2K6V A;  2R3X A;  3PR8 A;  2MMA A;  3HKR A;  2JSY A;  1ZZY A;  2GSR A;  2E7P A;  3FK8 A;  1WE0 A;  1A2M A;  5D9T A;  4YQU A;  3TKP A;  2B6M A;  1M9A A;  1W89 A;  2P0G A;  4ML1 A;  4MH3 A;  3F4T A;  1K0D A;  4GST A;  2NBS A;  1UC7 A;  5EL8 A;  1BQ7 A;  2AUV A;  4KND A;  3GX0 A;  4PX1 A;  3BBY A;  3HDC A;  3R2Q A;  1V40 A;  4GQC A;  2WJU A;  5KEJ A;  2DIZ A;  2MMZ A;  5D73 A;  3D22 A;  3W8J A;  3VWU A;  2N5F A;  2H1G A;  3CMI A;  1T4Z A;  3VWX A;  2H72 A;  5DAK B;  4GWR A;  2OE1 A;  5KN3 A;  4HS1 A;  1TRW A;  4O92 A;  5B6N A;  2V6K A;  1TK5 B;  4PNF A;  3HJP A;  2YWM A;  1GUL A;  2FCH A;  4TOP A;  5HR1 A;  4JE1 A;  14GS A;  5EVO A;  4NWY A;  1TP9 A;  1KBN A;  2F3M A;  2I9H A;  3BOA A;  4NHW A;  4GQF A;  4HUA A;  2H75 A;  4ECI A;  1U88 A;  3DKS A;  2GSQ A;  4ZL8 A;  5F05 A;  2E0Q A;  2VL2 A;  2MYG A;  1Y25 A;  2PVO C;  3CXG A;  2D2Z A;  5J41 A;  3UJ1 A;  1B4Q A;  1F3B A;  4XHM A;  4ECB A;  3ZMK A;  1ZOF A;  1SJI A;  2HRF A;  4EE0 A;  2B7J A;  4Q5N A;  3HD5 A;  4TRX A;  5F8B A;  1F2E A;  2FNO A;  4MAB A;  3P90 A;  3LSZ A;  6GSX A;  3RHC A;  3F9U A;  4IP1 A;  1Q98 A;  5CRW A;  4QL9 A;  4HQZ A;  1M7T A;  1GP1 A;  5DQY A;  5J4U A;  3D21 A;  5CRG A;  1OE8 A;  5C00 A;  3VUR A;  4N0V A;  2OBI A;  5IMZ A;  1ML6 A;  2FLS A;  1SJZ A;  2H1D A;  3IRA A;  4HEA 2;  5DBQ A;  2HSH A;  3EIN A;  2FWE A;  2JAD A;  2X8C A;  3P8W A;  4PQ1 A;  1GSQ A;  2VLU A;  2JU5 A;  4HOJ A;  4IVF A;  4OD7 A;  3CSJ A;  4FYC A;  3IXR A;  3QOU A;  1R26 A;  1WIK A;  3WYW A;  2B5Y A;  4J57 E;  3MDK A;  2M80 A;  4WBR D;  3I43 A;  2DJ0 A;  4X43 A;  2IL3 A;  4JR4 A;  4BVY A;  5ELG A;  3GUS A;  1U6T A;  3KM6 A;  4WF5 A;  5G1K A;  2GVP A;  2QKE A;  3KP9 A;  2JZR A;  1YKA A;  4V1A g;  13GS A;  2X8H A;  5HFG A;  1K0B A;  1ON4 A;  1RW1 A;  4F82 A;  2QSI A;  2K8S A;  3ZTL A;  2EIO A;  2VCQ A;  2DJ2 A;  3LYP A;  3KZQ A;  2FD3 A;  1TOF A;  3PGT A;  2XBI A;  2HI7 A;  1VF4 A;  1SD9 A;  5B8A A;  2V2G A;  3EUR A;  1ZL9 A;  4GLT A;  2LRC A;  3GMF A;  4OFN A;  2PMT A;  4TR4 A;  1SYX A;  1SKS B;  2H1A A;  3D5J A;  3GL5 A;  3HVX A;  1Z9H A;  3M1G A;  2LJA A;  4KDX A;  2VCW A;  2K18 A;  2OE3 A;  4LA1 A;  4AJ8 A;  1YDK A;  3U5R E;  5ECS A;  1X9W B;  1LBK A;  3IDV A;  4FO5 A;  1SL0 B;  1SD8 A;  1QMV A;  1MD4 A;  4WEY A;  4RI7 A;  4OCE A;  3G7Y A;  5A5K A;  2MBT A;  2FGX A;  2LKU A;  3TKS A;  4GF0 A;  2GST A;  3ZRD A;  4ZBA A;  1PQN A;  1GRX A;  4G19 A;  2CQ9 A;  2YV9 A;  5ENU A;  4IW9 A;  2GS3 A;  1B4P A;  5B7C A;  2GQM A;  4MMM A;  3UIW A;  3BD2 A;  2WCI A;  2WB9 A;  1EWX A;  1PMT A;  2VCZ A;  2WS2 A;  2RM5 A;  5IPG A;  2ZUP A;  1M9B A;  5ECH B;  5IM9 A;  1EV9 A;  1QQ2 A;  1N2A A;  1DE2 A;  4MA9 A;  2L4C A;  4MPF A;  1F9M A;  2AB6 A;  1V9W A;  2L57 A;  4ZBD A;  1XVQ A;  1GL8 A;  1WPI A;  5JWR B;  3KGK A;  3PIN A;  5ABR A;  4X0X A;  2VM1 A;  3G7J A;  3Q74 A;  4O5R A;  8GSS A;  4PNG A;  2HFD A;  1JZD A;  3FR3 A;  2A4V A;  4POM A;  4YQV A;  1LJR A;  5G30 A;  2GZP A;  5FWG A;  1I9D A;  3IPZ A;  3E9J B;  2H73 A;  3HYP A;  3FRC A;  2AJQ B;  3N5O A;  2KP2 A;  4N11 A;  4DSS A;  5CNW A;  1T1V A;  3KD0 A;  5DJM A;  2GZY A;  1OC9 B;  3C73 A;  3KXO A;  6GSV A;  2H76 A;  4BL7 A;  2IME A;  1EV4 A;  2LS5 A;  1PN9 A;  2OKA A;  3M0F A;  2R2J A;  2VAF A;  3HY2 A;  1V98 A;  1J9B A;  2MMN A;  1TDI A;  4ML6 A;  4WBJ A;  3CSI A;  4JZQ A;  2F51 A;  1O73 A;  1GSF A;  4XS4 B;  3D0Z A;  1B9Y C;  3TRP A;  3GX8 A;  1QK8 A;  4PXO A;  2LEG A;  1BJX A;  2N5A A;  4I2U A;  4WR5 A;  2CVD A;  4TR3 A;  5HQP A;  1B8X A;  4JR6 A;  3GKM A;  2XBQ A;  4AF2 A;  1A8Y A;  2C0D A;  2CZ3 A;  3ZYW A;  4KAE A;  4HJ2 A;  1W4V A;  2IMI A;  1ZYE A;  2H0H A;  1GTB A;  7GSS A;  1GH2 A;  3V1W A;  4MZB A;  4TR1 A;  2JL4 A;  5B6M A;  1G6W A;  4YAV A;  3UVH A;  3CTG A;  1T4Y A;  2EIR A;  2OE0 A;  3G9B A;  2EC4 A;  4EUY A;  3H8Q A;  1SK1 A;  4EO3 A;  2HZE B;  3S9F A;  3GHA A;  4MCU A;  2C4J A;  4KX4 A;  1FW1 A;  1DUG A;  2O7K A;  4J56 E;  2YV7 A;  2JZT A;  2ON7 A;  3GA4 A;  2NTO A;  2AHE A;  1BX9 A;  4EF0 A;  1Z6M A;  1O8W A;  3P7X A;  3ERW A;  3QFB C;  4F9Z A;  1WMJ A;  1VF2 A;  4RQX A;  1FAA A;  5GAP D;  1GTU A;  5ID2 A;  2VCT A;  4BWS A;  3WGX A;  2KUC A;  3J7Y k;  2XPD A;  3F6F A;  4MF7 A;  4ZIJ A;  3MWH A;  18GS A;  3VI7 A;  3TCO A;  1IYI A;  2JAC A;  3FY7 A;  1R5A A;  2C0E A;  1HNC A;  1M2B A;  1NSW A;  5IO0 A;  1Z6N A;  3FEU A;  1G0T A;  2RUF A;  1T3B A;  3TB2 A;  2FHE A;  3HXS A;  3APQ A;  4NAX A;  1EOH A;  2FWF A;  1SL1 B;  4ILF A;  2TRX A;  4RI6 A;  2VL2 C;  4KW6 A;  3QAG A;  4MF5 A;  1WWJ A;  2VUP A;  1B9X C;  3N9J A;  3IK9 A;  1HD2 A;  5D9W A;  4ZXG A;  1TJD A;  2HE3 A;  1XWC A;  2X8G A;  2L6C A;  2O89 A;  3MSZ A;  2KOK A;  3DYR A;  1KNG A;  1BG5 A;  3L9S A;  2B3S A;  1X9S B;  2VCX A;  2Z9S A;  3CRU A;  5DQS A;  1TI3 A;  1GLP A;  1R7H A;  4GSS A;  5A4V A;  2GDR A;  4YH2 A;  1ZYQ B;  1EOG A;  2I81 A;  1K0C A;  2HRN A;  1WJK A;  1F6M C;  3VWV A;  2B5X A;  2YJ7 A;  2FWH A;  1AW9 A;  4PQI A;  3KMN A;  19GS A;  4HI7 A;  3GNJ A;  1ERT A;  2G0F A;  2H6Z A;  3IBH A;  5DAL A;  5A4W A;  3J7Y b;  2MMO A;  5AIV A;  3IR4 A;  2ZNM A;  3FR9 A;  4JED A;  1SU9 A;  2CX3 A;  2PUK C;  3GTU A;  3RPN A;  2VL3 A;  5G1L A;  1EP8 A;  6GSU A;  3DVW A;  4NPB A;  1K3L A;  4WET A;  3FZ5 A;  5GST A;  2GT6 A;  1TTZ A;  4CDO A;  4HDE A;  1OVN A;  1V58 A;  4NV5 A;  4IBP A;  4JRR A;  4OMV A;  3DD3 A;  4HU9 A;  2H6X A;  2I1U A;  2CZ2 A;  4ZB6 A;  4HZ4 A;  1HNB A;  1XWB A;  3O3T A;  3UVT A;  3GH9 A;  4HJM A;  3ZVJ D;  2REM A;  6GSY A;  3QAV A;  1GUH A;  3M9J A;  1AIU A;  1PX6 A;  1JLV A;  2LNT A;  5G5E A;  2H74 A;  3C71 A;  2NPB A;  2CAQ A;  5HR2 A;  1GSU A;  3UBL A;  2XPE A;  3GKN A;  5FT3 A;  2H6Y A;  1HNA A;  3E0U A;  4X1U A;  3EWL A;  3HHV A;  4TW5 A;  3F4R A;  2WRT A;  2VD1 A;  1EP7 A;  5H5Q A;  1YEP A;  2F9S A;  1V57 A;  1URM A;  3HZ8 A;  2R4V A;  5ECI B;  1PX7 A;  1Z3E A;  2O87 A;  3L9V A;  1GNE A;  3DML A;  2IJY A;  3F3R A;  4XS1 A;  3GYK A;  2YWO A;  3GKK A;  4L8E A;  4K6X A;  2LNS A;  3IE3 A;  2HT9 A;  1GTI A;  4I8B A;  2LRN A;  1H4O A;  4WKW A;  1SEN A;  4MJB A;  5ELA A;  1Z7P A;  4TVE A;  4PQH A;  1PSQ A;  1YQ1 A;  1T00 A;  1A8L A;  1CQG A;  3TKS C;  4MLY A;  4MZW A;  2HNL A;  4PUF C;  2OAC A;  3ERG A;  2PU9 C;  4AJ6 A;  2IWT A;  1OKT A;  5DCG A;  16GS A;  4G10 A;  2HXK A;  1A2J A;  1DE1 A;  1M2A A;  1HYU A;  2V41 A;  4BPY A;  2L59 A;  4FYU A;  4GRF A;  3WT1 A;  2AAW A;  1A24 A;  4BA7 A;  2PN8 A;  4ZL9 A;  2WFC A;  2B5E A;  4WF4 A;  1B48 A;  5CRE A;  1SK0 A;  2C1Y A;  2A2R A;  4TKY A;  1FVK A;  1MEK A;  3NOF A;  4ZIL A;  4K7N A;  2HYX A;  2DLX A;  4POK A;  3VK9 A;  1ERU A;  4BVX A;  4QQ7 A;  1ST9 A;  2GTU A;  4IJI A;  5GAN D;  4OFM A;  5ECM B;  5J5N A;  1O6J A;  1RQM A;  2V32 A;  3EMP A;  2A2S A;  2GQL A;  4LL4 B;  4PUR A;  3VWW A;  3TOU A;  1QXH A;  4POB A;  5D93 A;  3KTB A; 
#chains in the Genus database with same CATH topology
 2R0P A;  3DVX A;  2H0G A;  5F07 A;  4E8E A;  4AGS A;  5ECO B;  1XOB A;  4IJ3 A;  1CQH A;  4MJE A;  2GSS A;  3H79 A;  3C7M A;  6GSW A;  2VO4 A;  1XBS A;  3IOS A;  3LXT A;  3NIV A;  1HQO A;  2DSA A;  1PN0 A;  4K7O A;  2E2M A;  2L4Q A;  4N10 A;  3EYT A;  3KH7 A;  3RBT A;  1Y6E A;  4DSQ A;  2F8F A;  2AV4 A;  1ILO A;  1O7U A;  1OE7 A;  2X4A A;  1O8X A;  3VLN A;  2B7K A;  1K3Y A;  3JCM L;  4YQM A;  5HFK A;  3FW2 A;  3LFL A;  4E8H A;  2MBS A;  3VPQ A;  1ZCP A;  2TRC P;  1O85 A;  3DRN A;  2CX4 A;  2HRA A;  3VFI A;  1K0A A;  3GH6 A;  2GGT A;  3CYN A;  3H93 A;  2C0G A;  20GS A;  3BCK A;  5IMF A;  5J9C A;  1AQW A;  5E59 A;  3ZIT A;  2QA1 A;  4NHZ A;  1TXX A;  2YCD A;  2RLI A;  1YF1 A;  2OAD A;  4USS A;  1KEB A;  2RUE A;  4OWY A;  1ACV A;  4IP6 A;  3SBC A;  1TW9 A;  4IQ1 A;  2CA8 A;  3APO A;  1G7O A;  4MDC A;  5J9B A;  2IN3 A;  2IMD A;  1A23 A;  4PTS A;  5CO3 A;  1TU8 A;  4LL1 B;  1XWA A;  4EVM A;  4BIK A;  4D73 A;  4HQS A;  2R6K A;  3PH9 A;  10GS A;  2PGT A;  2R37 A;  3LGC A;  2OJL A;  2H8L A;  1SK2 A;  5AIS A;  5IMV A;  4K7I A;  1C72 A;  4MF6 A;  2L6D A;  2B1K A;  1GNW A;  2DIY A;  2BJX A;  2LV3 A;  4ISD A;  2GQK A;  4Q5R A;  2K9F A;  3BJ5 A;  1FB0 A;  1YF0 A;  5CRH A;  2QA2 A;  3TJG A;  1XCC A;  3FKF A;  1S3C A;  4MNN A;  5JCU A;  2DJ1 A;  4Q5Q A;  5DAK A;  1YKC A;  1OKD A;  3A2V A;  2V6O A;  3IHQ A;  2LQQ A;  3ISO A;  1OC8 A;  2O85 A;  4NV2 A;  1GSY A;  22GS A;  3F8U A;  4OFT A;  3ZIJ A;  2IFQ A;  4F03 A;  2GZZ A;  5LNK e;  1Q4J A;  1PKZ A;  1JFU A;  3TJK A;  1XWG A;  1U3I A;  3R3E A;  2AYT A;  3TUE A;  2YJH A;  5DJL A;  3C1S A;  2I4A A;  4TXO A;  3EC3 A;  2YOI A;  5ECK B;  2H71 A;  2RM6 A;  4I6X A;  1XXU A;  2LRT A;  4Z2R A;  1VF3 A;  1M2D A;  1OAZ A;  1TK0 B;  5AN1 A;  1SYR A;  2ZCT A;  4Z7X A;  2WZ9 A;  4HSC X;  1S3A A;  2HSY A;  3A3T A;  1THX A;  4O5U A;  4G0K A;  2YZU A;  4IEL A;  1YY7 A;  5A4U A;  2YWN A;  5JWQ B;  3O6T A;  2PBJ A;  2O8V B;  2IPA A;  2YP6 A;  2CVK A;  2PWJ A;  3UL3 A;  4AJ7 A;  1M3I A;  4OO4 A;  3A2X A;  3HVV A;  3E3E A;  3WGD A;  5D8I A;  4F0B A;  4IKH A;  3EVI A;  1AC1 A;  2LQO A;  4FQU A;  3TKS E;  2L5L A;  3ED3 A;  3CSH A;  1M0U A;  5C04 A;  1K3O A;  1AQX A;  3ERF A;  3ZRE A;  3MAK A;  1S3D A;  1SL2 B;  3C1R A;  3L4N A;  1VF1 A;  1AUC A;  4IS0 A;  2IMK A;  3TRX A;  4KF9 A;  4H86 A;  5IQY A;  1A2L A;  4RQR A;  1WRY A;  1X5C A;  3L78 A;  2B1L A;  2HLS A;  3ZZX A;  2DBC A;  2DJ3 A;  1T8E B;  1K0M A;  3NZN A;  1X5E A;  3IC8 A;  3RAZ A;  5IO2 A;  2LTK A;  4KH7 A;  4FH8 A;  3A5W A;  3TOT A;  4MP4 A;  5E4W A;  4KGI A;  1XIY A;  4EC0 A;  1NW2 A;  5DDL A;  2FWG A;  4V2M A;  3IC4 A;  2DJJ A;  2H66 A;  2VLT A;  4KA0 A;  3FZ9 A;  3LEF A;  6GSS A;  1GTA A;  1DBY A;  4EL1 A;  1GSE A;  2YPM A;  2C3N A;  1PRX A;  3H1N A;  4DEJ A;  2NDO A;  3GST A;  3KIJ A;  3UBK A;  3H4K A;  1SKR B;  1JZO A;  2ES7 A;  5EY6 A;  5L71 A;  1M3J A;  3KJY A;  1ERV A;  2ALB A;  4V2L A;  2K8V A;  4DVC A;  2JZS A;  4IN0 A;  2VIM A;  2KHP A;  4V2N A;  1K0N A;  5J3R A;  3C8E A;  3QCP A;  5LCZ A;  2J23 A;  1LU4 A;  1A0F A;  2VL9 A;  3DIE A;  4Q5F A;  5GSS A;  4K2D A;  5DVB A;  4D73 B;  4DSS B;  1VRS D;  3L0H A;  4MJC A;  2H1B A;  5DCH A;  4ZBB A;  1MDJ A;  3ME8 A;  4XS6 A;  1NHY A;  1PA3 A;  4OO5 A;  3D4M A;  3GIX A;  4YAP A;  5CAX A;  5CYY A;  3DEX A;  1PGT A;  2N5B A;  4KDY A;  4DSR A;  1TU7 A;  2KLX A;  3TJF A;  4NXI A;  2VD0 A;  3LG6 A;  2IFQ B;  4KB3 A;  5D9V A;  4LMV A;  4P3Y B;  4TR0 A;  4K8M A;  2CT6 A;  4LLR A;  1TI1 A;  4TXO B;  17GS A;  1EGR A;  5G2Z A;  1F37 A;  1FB6 A;  3SWL A;  3UAR A;  1X9M B;  4ID0 A;  2R5G A;  2YZH A;  5JCG A;  5IPH A;  1M99 A;  5CRD A;  3VPT A;  4F0C A;  3QR6 A;  5JWO B;  1GSD A;  1OC3 A;  1USB A;  1G7E A;  5AGY A;  4TR1 B;  3RDW A;  2A2P A;  2OBK A;  2X49 A;  4BWQ A;  2VCV A;  4KE3 A;  3DWV A;  2XC2 A;  3KMO A;  4TXV A;  3OR5 A;  4GSN A;  4KSM A;  3CBU A;  4IQA A;  4G2E A;  2XHF A;  4CHS A;  4JBB A;  4K0G A;  1N8J A;  3HA9 A;  3F63 A;  2NVL A;  2MZC A;  3TJJ A;  1BAY A;  1FG4 A;  3GSS A;  3L9U A;  1YZX A;  3GRX A;  1FO5 A;  4I97 A;  1ZYP A;  4PGT A;  5ID2 B;  1ERW A;  4I5Q A;  2FUG 2;  1XFL A;  4GTU A;  5H5S A;  4KUN A;  1OC9 A;  2PVQ A;  3P2A A;  1J08 A;  1EGO A;  4CY6 A;  1QFN A;  2VLV A;  4A5P A;  2H01 A;  3F3Q A;  3UAP A;  2J9H A;  4X4J A;  3EMX A;  5IOW A;  2M72 A;  2JSZ A;  1GUM A;  4XS4 A;  1RK4 A;  2GLR A;  5LD0 A;  4KSO A;  3HCZ A;  5INY A;  3I69 A;  4O32 A;  3TRQ A;  1PFO A;  3BCI A;  3IAS 2;  3I6A A;  3WD6 A;  4GXZ A;  1JZR A;  4RUV A;  2DKI A;  3WT2 A;  2BTO T;  3F4S A;  4G9H A;  2WDU A;  4LMW A;  3WGE A;  3A2W A;  1MDI A;  4O7H A;  4OCF A;  2KP1 A;  4ZB9 A;  1PL1 A;  3K8N A;  4XIH A;  2H19 A;  2CVB A;  2R0C A;  2C0F A;  4L0W A;  2X64 A;  3GV1 A;  4EDZ A;  4CW9 A;  1PL2 A;  3EU3 A;  5G31 A;  3EU4 A;  1ZYN A;  1K0O A;  2P31 A;  3GL3 A;  2G2Q A;  1VGL A;  4L0U A;  2BMX A;  2VOC A;  4KCE A;  3IK7 A;  2HZE A;  5IIZ A;  2CV4 A;  4HU7 A;  2P5R A;  1UVZ A;  4JU5 A;  2FA4 A;  5IMA A;  1IYH A;  1XOA A;  5IMC A;  1U87 A;  4XRA A;  3KCM A;  3HZ4 A;  4L5O A;  3HJO A;  4GCI A;  3Q6O A;  2FY6 A;  4EKZ A;  5DAL B;  3FR6 A;  2DML A;  4N0Z A;  5HFI A;  3CTF A;  3A5I A;  1XW5 A;  1R5P A;  1UA5 A;  2YAN A;  3GTU B;  2CAI A;  4MK3 A;  4IGJ A;  1I5G A;  1BYE A;  2YN1 A;  1JLW A;  3Q18 A;  2F8A A;  5KN2 A;  1TKD B;  5FHI A;  3ZL5 A;  3TJB A;  2I3Y A;  1KTE A;  5IOX A;  1E2Y A;  4Z2U A;  2V1M A;  3KTL A;  1AQV A;  3QFA C;  3IAM 2;  4HZ2 A;  3U6V A;  3CRT A;  3KEB A;  4PUA A;  2LJR A;  1GLQ A;  1JZW A;  2H0I A;  1GSS A;  5GZZ B;  1ZGN A;  2HSM A;  2PPT A;  2IMF A;  1JHB A;  5EPF A;  3AY8 A;  2LJK A;  1R4W A;  5ECN B;  2LST A;  3FZ4 A;  2ON5 A;  3TKR A;  5HR3 A;  3LYK A;  2C3T A;  1QUW A;  3LOR A;  1YJ6 A;  2DMM A;  3ZFL A;  4KCA A;  1PD2 1;  5KN1 A;  4ZB8 A;  4ECJ A;  2TIR A;  1FOH A;  4MH2 A;  4QL7 A;  4POL A;  9GSS A;  1AXD A;  1PKW A;  1MTC A;  4I2T A;  2L5O A;  2HZF A;  3QPM A;  1A0R P;  3VI5 A;  3D4T A;  4XTS A;  1SJ6 A;  1TK8 B;  3QAW A;  4K2X A;  2IIY A;  3LQ7 A;  2LUS A;  2WUL A;  3KH9 A;  3FZA A;  3GN3 A;  4MZC A;  3F0I A;  3TGZ A;  1EZK A;  1X5D A;  3RHB A;  3LXZ A;  3APS A;  3LJR A;  4MJA A;  5F0G A;  1FOV A;  2C80 A;  3IA1 A;  1E6B A;  4K9Z A;  4ACS A;  1MD3 A;  1J0F A;  3G7I A;  3GUR A;  3GFK A;  3ZML A;  3US3 A;  5BMU A;  5D9X A;  2PER A;  2E2G A;  3FYG A;  1O81 A;  1XZO A;  5F06 A;  2X99 A;  5G5F A;  3MNG A;  4ZL7 A;  4FIW A;  2OA7 A;  1EEM A;  1XW6 A;  2FA8 A;  3RPP A;  2A4H A;  2C8U A;  1GWC A;  1Z7R A;  3ZIV A;  1H75 A;  12GS A;  1ZMA A;  4NMU A;  5D96 A;  3M8N A;  5H5R A;  4F2I A;  3EE2 A;  5AIX A;  1XW9 A;  3UEM A;  5ECQ B;  2WGR A;  3TDG A;  3W8S A;  1WOU A;  2C3Q A;  2QC7 A;  3Q19 A;  4BVX B;  3IV4 A;  3UOM A;  4IHU A;  1G6Y A;  1FVJ A;  4EDY A;  1ABA A;  3ZFB A;  2VM2 A;  3I9V 2;  4MPG A;  3IHG A;  6GST A;  2P5Q A;  3TKQ A;  5ECR B;  3ZLP A;  3W6G A;  5CP1 A;  4N30 A;  4KDU A;  3O76 A;  5JCW A;  3ZVJ A;  2RII A;  4J2F A;  1UN2 A;  4WXT A;  1V2A A;  1XPV A;  4EXJ A;  1NHO A;  2YWI A;  3CQF A;  1DSB A;  3HVS A;  2EIQ A;  2H30 A;  4V1A p;  2YNX A;  2QGV A;  1WP0 A;  5B8B A;  1T7P B;  3M9K A;  1YEX A;  1AAZ A;  1MDK A;  3DXB A;  3QMX A;  4WR4 A;  1TRS A;  1F3A A;  3F6D A;  3QDN A;  2DC5 A;  1TRU A;  1OYJ A;  1QGV A;  4XCS A;  1SKW B;  1Z5Y E;  3D6I A;  4TN8 A;  1U3A A;  5KN0 A;  1EEJ A;  1X0R A;  1GUK A;  2H70 A;  3M3M A;  4K0N A;  5HR0 A;  4K1F A;  1FHE A;  4XRD A;  2GT5 A;  1XWK A;  1TRV A;  4FYB A;  3LWA A;  2DJK A;  3DGQ A;  3FHK A;  1NM3 A;  3ME7 A;  3QD9 A;  4L5L A;  5IMD A;  4ICY A;  3UMA A;  5ECP B;  5ECL B;  3GKX A;  1XVW A;  3KP8 A;  3HJM A;  2M46 A;  4ECC A;  11GS A;  5COH A;  1BED A;  1THO A;  4ULX A;  2K6V A;  4YKF A;  2R3X A;  3PR8 A;  2MMA A;  3HKR A;  2JSY A;  1ZZY A;  2GSR A;  2E7P A;  3FK8 A;  1WE0 A;  1A2M A;  5D9T A;  4YQU A;  3TKP A;  2B6M A;  1M9A A;  1W89 A;  2P0G A;  4ML1 A;  4MH3 A;  3F4T A;  1K0D A;  4GST A;  2NBS A;  1UC7 A;  5EL8 A;  5KOW A;  1BQ7 A;  2AUV A;  4KND A;  3GX0 A;  4PX1 A;  3BBY A;  3HDC A;  3R2Q A;  1V40 A;  4GQC A;  2WJU A;  5KEJ A;  2DIZ A;  2MMZ A;  4EIQ A;  5D73 A;  3D22 A;  3W8J A;  3VWU A;  2N5F A;  2H1G A;  3CMI A;  1T4Z A;  3VWX A;  2H72 A;  5DAK B;  4GWR A;  2OE1 A;  5KN3 A;  4HS1 A;  1TRW A;  4O92 A;  5B6N A;  2V6K A;  1TK5 B;  4PNF A;  3HJP A;  2YWM A;  1GUL A;  2FCH A;  4TOP A;  5HR1 A;  4JE1 A;  14GS A;  5EVO A;  4NWY A;  1TP9 A;  1KBN A;  2F3M A;  2I9H A;  3BOA A;  4NHW A;  4GQF A;  3PPU A;  4HUA A;  2H75 A;  4ECI A;  1U88 A;  3DKS A;  2GSQ A;  4ZL8 A;  5F05 A;  2E0Q A;  2VL2 A;  2MYG A;  1Y25 A;  2PVO C;  3CXG A;  2D2Z A;  5J41 A;  3UJ1 A;  1B4Q A;  1F3B A;  4XHM A;  4ECB A;  3ZMK A;  4G0L A;  1ZOF A;  1SJI A;  2HRF A;  4EE0 A;  2B7J A;  4Q5N A;  3HD5 A;  4TRX A;  5F8B A;  1F2E A;  2FNO A;  4MAB A;  3P90 A;  3LSZ A;  4CY8 A;  6GSX A;  3RHC A;  3F9U A;  4IP1 A;  1Q98 A;  5CRW A;  4QL9 A;  4HQZ A;  1M7T A;  1GP1 A;  5DQY A;  5J4U A;  3D21 A;  5CRG A;  1OE8 A;  5C00 A;  3VUR A;  4N0V A;  2OBI A;  5IMZ A;  1ML6 A;  2FLS A;  1SJZ A;  2H1D A;  3IRA A;  4HEA 2;  5DBQ A;  2HSH A;  3EIN A;  2FWE A;  2JAD A;  2X8C A;  3FMW A;  3P8W A;  4PQ1 A;  1GSQ A;  2VLU A;  2JU5 A;  4HOJ A;  4IVF A;  4OD7 A;  3CSJ A;  4FYC A;  3IXR A;  3QOU A;  1R26 A;  1WIK A;  3WYW A;  2B5Y A;  4J57 E;  3MDK A;  2M80 A;  4Z2T A;  4WBR D;  3I43 A;  2DJ0 A;  4X43 A;  2IL3 A;  4JR4 A;  4BVY A;  5ELG A;  3GUS A;  1U6T A;  3MYD A;  3KM6 A;  4WF5 A;  5G1K A;  2GVP A;  2QKE A;  3KP9 A;  2JZR A;  1YKA A;  4V1A g;  13GS A;  2X8H A;  5HFG A;  1K0B A;  1ON4 A;  4K5S A;  1RW1 A;  4F82 A;  2QSI A;  2K8S A;  3ZTL A;  2EIO A;  2VCQ A;  2DJ2 A;  3LYP A;  3KZQ A;  2FD3 A;  1TOF A;  3PGT A;  2XBI A;  2HI7 A;  1VF4 A;  1SD9 A;  5B8A A;  2V2G A;  3EUR A;  1ZL9 A;  4GLT A;  2LRC A;  3GMF A;  4OFN A;  2PMT A;  4TR4 A;  1SYX A;  1SKS B;  2H1A A;  3LW9 A;  3D5J A;  3GL5 A;  3HVX A;  1Z9H A;  3M1G A;  2LJA A;  4KDX A;  2VCW A;  2K18 A;  2OE3 A;  4LA1 A;  4AJ8 A;  1YDK A;  3U5R E;  5ECS A;  1X9W B;  1LBK A;  3IDV A;  4FO5 A;  1SL0 B;  1SD8 A;  1QMV A;  1MD4 A;  4WEY A;  4RI7 A;  4OCE A;  3G7Y A;  5A5K A;  2MBT A;  2FGX A;  2LKU A;  3TKS A;  4GF0 A;  2GST A;  3ZRD A;  4ZBA A;  1PQN A;  1GRX A;  4G19 A;  2CQ9 A;  2YV9 A;  5ENU A;  4IW9 A;  2GS3 A;  1B4P A;  5B7C A;  2GQM A;  4MMM A;  3UIW A;  3BD2 A;  2WCI A;  2WB9 A;  1EWX A;  1PMT A;  2VCZ A;  2WS2 A;  2RM5 A;  5IPG A;  2ZUP A;  1M9B A;  5ECH B;  1XG8 A;  5IM9 A;  1EV9 A;  1QQ2 A;  1N2A A;  1DE2 A;  4MA9 A;  2L4C A;  4MPF A;  1F9M A;  2AB6 A;  1V9W A;  2L57 A;  4ZBD A;  1XVQ A;  1GL8 A;  1WPI A;  5JWR B;  3KGK A;  3PIN A;  5ABR A;  5BRT A;  4X0X A;  2VM1 A;  3G7J A;  3Q74 A;  4O5R A;  8GSS A;  4PNG A;  2HFD A;  4YKG A;  1JZD A;  3FR3 A;  2A4V A;  4POM A;  4YQV A;  1LJR A;  5G30 A;  2GZP A;  5FWG A;  1I9D A;  3IPZ A;  3E9J B;  2H73 A;  3HYP A;  3FRC A;  2AJQ B;  3N5O A;  2KP2 A;  4G0I A;  4N11 A;  4DSS A;  5CNW A;  1T1V A;  3KD0 A;  5DJM A;  2GZY A;  1OC9 B;  3C73 A;  3KXO A;  6GSV A;  2H76 A;  4BL7 A;  2IME A;  1EV4 A;  2LS5 A;  1PN9 A;  2OKA A;  3M0F A;  2R2J A;  2VAF A;  3HY2 A;  1V98 A;  1J9B A;  2MMN A;  1TDI A;  4ML6 A;  4WBJ A;  3CSI A;  4BVY B;  4JZQ A;  2F51 A;  1O73 A;  1GSF A;  4XS4 B;  3D0Z A;  1B9Y C;  3TRP A;  3GX8 A;  1QK8 A;  4PXO A;  2LEG A;  1BJX A;  2N5A A;  4I2U A;  4WR5 A;  2DKH A;  2CVD A;  4TR3 A;  5HQP A;  1B8X A;  4JR6 A;  3GKM A;  2XBQ A;  4AF2 A;  1A8Y A;  2C0D A;  2CZ3 A;  3ZYW A;  4KAE A;  4HJ2 A;  1W4V A;  2IMI A;  1ZYE A;  4O5Q A;  2H0H A;  1GTB A;  7GSS A;  1GH2 A;  3V1W A;  4MZB A;  4TR1 A;  2JL4 A;  5B6M A;  1G6W A;  4YAV A;  3UVH A;  3EPT A;  3CTG A;  1T4Y A;  2EIR A;  2OE0 A;  3G9B A;  2EC4 A;  4EUY A;  3H8Q A;  1SK1 A;  4EO3 A;  2HZE B;  3S9F A;  3GHA A;  4MCU A;  2C4J A;  4KX4 A;  1FW1 A;  1DUG A;  2O7K A;  4J56 E;  2YV7 A;  2JZT A;  2ON7 A;  3GA4 A;  2NTO A;  2AHE A;  1BX9 A;  5KOX A;  4EF0 A;  1Z6M A;  1O8W A;  3P7X A;  3ERW A;  3QFB C;  4F9Z A;  1WMJ A;  1VF2 A;  4RQX A;  1FAA A;  5GAP D;  1GTU A;  5ID2 A;  2VCT A;  4BWS A;  2HRK A;  3MIX A;  3WGX A;  4K5R A;  2KUC A;  3J7Y k;  2XPD A;  3F6F A;  4MF7 A;  4ZIJ A;  3MWH A;  18GS A;  3VI7 A;  3TCO A;  1IYI A;  2JAC A;  3FY7 A;  1R5A A;  2C0E A;  1HNC A;  1M2B A;  1NSW A;  5IO0 A;  1Z6N A;  3FEU A;  1G0T A;  2RUF A;  1T3B A;  3TB2 A;  2FHE A;  3HXS A;  3APQ A;  4NAX A;  1EOH A;  2FWF A;  1SL1 B;  4ILF A;  2TRX A;  4RI6 A;  2VL2 C;  4KW6 A;  3QAG A;  4MF5 A;  1WWJ A;  2VUP A;  1B9X C;  3N9J A;  3IK9 A;  1HD2 A;  5D9W A;  4ZXG A;  1TJD A;  2HE3 A;  1XWC A;  2X8G A;  2L6C A;  2O89 A;  3MSZ A;  2KOK A;  3DYR A;  1KNG A;  1BG5 A;  3L9S A;  2B3S A;  1X9S B;  2VCX A;  2Z9S A;  3CRU A;  5DQS A;  1TI3 A;  1GLP A;  1R7H A;  4GSS A;  5A4V A;  2GDR A;  4YH2 A;  1ZYQ B;  1EOG A;  2I81 A;  1K0C A;  2HRN A;  1WJK A;  1F6M C;  3VWV A;  2B5X A;  2YJ7 A;  2FWH A;  1AW9 A;  4BL7 B;  4PQI A;  3KMN A;  19GS A;  4HI7 A;  3GNJ A;  1ERT A;  2G0F A;  2H6Z A;  3IBH A;  5DAL A;  5A4W A;  3J7Y b;  2MMO A;  5AIV A;  3IR4 A;  2ZNM A;  3FR9 A;  4JED A;  1SU9 A;  2CX3 A;  2PUK C;  3GTU A;  3RPN A;  2VL3 A;  5G1L A;  1EP8 A;  6GSU A;  3DVW A;  3HVN A;  4NPB A;  1K3L A;  4WET A;  3FZ5 A;  5GST A;  2GT6 A;  1TTZ A;  4CDO A;  4HDE A;  1OVN A;  1V58 A;  4NV5 A;  4IBP A;  4JRR A;  4OMV A;  3DD3 A;  4HU9 A;  2H6X A;  2I1U A;  2CZ2 A;  4ZB6 A;  4HZ4 A;  1HNB A;  1XWB A;  3O3T A;  3UVT A;  3GH9 A;  4HJM A;  3ZVJ D;  2REM A;  6GSY A;  3QAV A;  1GUH A;  3M9J A;  1AIU A;  1PX6 A;  1JLV A;  2LNT A;  5G5E A;  2H74 A;  3C71 A;  2NPB A;  2CAQ A;  5HR2 A;  1GSU A;  3UBL A;  2XPE A;  3GKN A;  5FT3 A;  2H6Y A;  1HNA A;  3E0U A;  4X1U A;  3EWL A;  3HHV A;  4TW5 A;  3F4R A;  2WRT A;  2VD1 A;  1EP7 A;  5H5Q A;  1YEP A;  2F9S A;  1V57 A;  1URM A;  3HZ8 A;  4EIP A;  2R4V A;  5ECI B;  1PX7 A;  1Z3E A;  2O87 A;  3L9V A;  1GNE A;  3DML A;  2IJY A;  3F3R A;  4XS1 A;  3GYK A;  2YWO A;  3GKK A;  4L8E A;  4K6X A;  2LNS A;  3IE3 A;  2HT9 A;  1GTI A;  4I8B A;  2LRN A;  1H4O A;  4WKW A;  1SEN A;  4MJB A;  5ELA A;  1Z7P A;  4TVE A;  4PQH A;  1PSQ A;  1YQ1 A;  1T00 A;  1A8L A;  1CQG A;  3TKS C;  4MLY A;  4MZW A;  2R0G A;  2HNL A;  4PUF C;  2OAC A;  3ERG A;  2PU9 C;  4AJ6 A;  2IWT A;  1OKT A;  5DCG A;  16GS A;  4G10 A;  2HXK A;  1A2J A;  1DE1 A;  1M2A A;  1HYU A;  2V41 A;  4BPY A;  2L59 A;  4FYU A;  4GRF A;  3WT1 A;  2AAW A;  1A24 A;  4BA7 A;  2PN8 A;  4ZL9 A;  2WFC A;  1S3R A;  2B5E A;  4WF4 A;  1B48 A;  5CRE A;  1SK0 A;  2C1Y A;  2A2R A;  4TKY A;  1FVK A;  1MEK A;  3NOF A;  4ZIL A;  4K7N A;  2HYX A;  2DLX A;  4POK A;  3VK9 A;  1ERU A;  4BVX A;  4QQ7 A;  1ST9 A;  2GTU A;  4IJI A;  5GAN D;  4OFM A;  5ECM B;  5J5N A;  1O6J A;  1RQM A;  2V32 A;  3EMP A;  2A2S A;  2GQL A;  4LL4 B;  4PUR A;  3VWW A;  3TOU A;  1QXH A;  2UZ8 A;  4POB A;  5D93 A;  3KTB A; 
#chains in the Genus database with same CATH homology
 2R0P A;  3DVX A;  2H0G A;  5F07 A;  4E8E A;  4AGS A;  5ECO B;  1XOB A;  4IJ3 A;  1CQH A;  4MJE A;  2GSS A;  3H79 A;  3C7M A;  6GSW A;  2VO4 A;  1XBS A;  3IOS A;  3LXT A;  3NIV A;  1HQO A;  2DSA A;  1PN0 A;  4K7O A;  2E2M A;  2L4Q A;  4N10 A;  3EYT A;  3KH7 A;  3RBT A;  1Y6E A;  4DSQ A;  2F8F A;  2AV4 A;  1ILO A;  1O7U A;  1OE7 A;  2X4A A;  1O8X A;  3VLN A;  2B7K A;  1K3Y A;  3JCM L;  4YQM A;  5HFK A;  3FW2 A;  3LFL A;  4E8H A;  2MBS A;  3VPQ A;  1ZCP A;  2TRC P;  1O85 A;  3DRN A;  2CX4 A;  2HRA A;  3VFI A;  1K0A A;  3GH6 A;  2GGT A;  3CYN A;  3H93 A;  2C0G A;  20GS A;  3BCK A;  5IMF A;  5J9C A;  1AQW A;  5E59 A;  3ZIT A;  2QA1 A;  4NHZ A;  1TXX A;  2YCD A;  2RLI A;  1YF1 A;  2OAD A;  4USS A;  1KEB A;  2RUE A;  4OWY A;  1ACV A;  4IP6 A;  3SBC A;  1TW9 A;  4IQ1 A;  2CA8 A;  3APO A;  1G7O A;  4MDC A;  5J9B A;  2IN3 A;  2IMD A;  1A23 A;  4PTS A;  5CO3 A;  1TU8 A;  4LL1 B;  1XWA A;  4EVM A;  4D73 A;  4HQS A;  2R6K A;  3PH9 A;  10GS A;  2PGT A;  2R37 A;  3LGC A;  2OJL A;  2H8L A;  1SK2 A;  5AIS A;  5IMV A;  4K7I A;  1C72 A;  4MF6 A;  2L6D A;  2B1K A;  1GNW A;  2DIY A;  2BJX A;  2LV3 A;  4ISD A;  2GQK A;  4Q5R A;  2K9F A;  3BJ5 A;  1FB0 A;  1YF0 A;  5CRH A;  2QA2 A;  3TJG A;  1XCC A;  3FKF A;  1S3C A;  4MNN A;  5JCU A;  2DJ1 A;  4Q5Q A;  5DAK A;  1YKC A;  1OKD A;  3A2V A;  2V6O A;  3IHQ A;  2LQQ A;  3ISO A;  1OC8 A;  2O85 A;  4NV2 A;  1GSY A;  22GS A;  3F8U A;  4OFT A;  3ZIJ A;  2IFQ A;  4F03 A;  2GZZ A;  5LNK e;  1Q4J A;  1PKZ A;  1JFU A;  3TJK A;  1XWG A;  1U3I A;  3R3E A;  2AYT A;  3TUE A;  2YJH A;  5DJL A;  3C1S A;  2I4A A;  4TXO A;  3EC3 A;  2YOI A;  5ECK B;  2H71 A;  2RM6 A;  4I6X A;  1XXU A;  2LRT A;  4Z2R A;  1VF3 A;  1M2D A;  1OAZ A;  1TK0 B;  5AN1 A;  1SYR A;  2ZCT A;  4Z7X A;  2WZ9 A;  1S3A A;  2HSY A;  3A3T A;  1THX A;  4O5U A;  4G0K A;  2YZU A;  4IEL A;  1YY7 A;  5A4U A;  2YWN A;  5JWQ B;  3O6T A;  2PBJ A;  2O8V B;  2IPA A;  2YP6 A;  2CVK A;  2PWJ A;  3UL3 A;  4AJ7 A;  4OO4 A;  3A2X A;  3HVV A;  3E3E A;  3WGD A;  5D8I A;  4F0B A;  4IKH A;  3EVI A;  1AC1 A;  2LQO A;  4FQU A;  3TKS E;  2L5L A;  3ED3 A;  3CSH A;  1M0U A;  5C04 A;  1K3O A;  1AQX A;  3ERF A;  3ZRE A;  3MAK A;  1S3D A;  1SL2 B;  3C1R A;  3L4N A;  1VF1 A;  1AUC A;  4IS0 A;  2IMK A;  3TRX A;  4KF9 A;  4H86 A;  5IQY A;  1A2L A;  4RQR A;  1WRY A;  1X5C A;  3L78 A;  2B1L A;  2HLS A;  3ZZX A;  2DBC A;  2DJ3 A;  1T8E B;  1K0M A;  3NZN A;  1X5E A;  3IC8 A;  3RAZ A;  5IO2 A;  2LTK A;  4KH7 A;  4FH8 A;  3A5W A;  3TOT A;  4MP4 A;  5E4W A;  4KGI A;  1XIY A;  4EC0 A;  1NW2 A;  5DDL A;  2FWG A;  4V2M A;  3IC4 A;  2DJJ A;  2H66 A;  2VLT A;  4KA0 A;  3FZ9 A;  3LEF A;  6GSS A;  1GTA A;  1DBY A;  4EL1 A;  1GSE A;  2YPM A;  2C3N A;  1PRX A;  3H1N A;  4DEJ A;  2NDO A;  3GST A;  3KIJ A;  3UBK A;  3H4K A;  1SKR B;  1JZO A;  2ES7 A;  5EY6 A;  5L71 A;  3KJY A;  1ERV A;  2ALB A;  4V2L A;  2K8V A;  4DVC A;  2JZS A;  4IN0 A;  2VIM A;  2KHP A;  4V2N A;  1K0N A;  5J3R A;  3C8E A;  3QCP A;  5LCZ A;  2J23 A;  1LU4 A;  1A0F A;  2VL9 A;  3DIE A;  4Q5F A;  5GSS A;  4K2D A;  5DVB A;  4D73 B;  4DSS B;  1VRS D;  3L0H A;  4MJC A;  2H1B A;  5DCH A;  4ZBB A;  1MDJ A;  3ME8 A;  4XS6 A;  1NHY A;  1PA3 A;  4OO5 A;  3D4M A;  3GIX A;  4YAP A;  5CAX A;  5CYY A;  3DEX A;  1PGT A;  2N5B A;  4KDY A;  4DSR A;  1TU7 A;  2KLX A;  3TJF A;  4NXI A;  2VD0 A;  3LG6 A;  2IFQ B;  4KB3 A;  5D9V A;  4LMV A;  4P3Y B;  4TR0 A;  4K8M A;  2CT6 A;  4LLR A;  1TI1 A;  4TXO B;  17GS A;  1EGR A;  5G2Z A;  1F37 A;  1FB6 A;  3SWL A;  3UAR A;  1X9M B;  4ID0 A;  2R5G A;  2YZH A;  5JCG A;  5IPH A;  1M99 A;  5CRD A;  3VPT A;  4F0C A;  3QR6 A;  5JWO B;  1GSD A;  1OC3 A;  1USB A;  1G7E A;  5AGY A;  4TR1 B;  3RDW A;  2A2P A;  2OBK A;  2X49 A;  4BWQ A;  2VCV A;  4KE3 A;  3DWV A;  2XC2 A;  3KMO A;  4TXV A;  3OR5 A;  4GSN A;  4KSM A;  3CBU A;  4IQA A;  4G2E A;  2XHF A;  4CHS A;  4JBB A;  4K0G A;  1N8J A;  3HA9 A;  3F63 A;  2NVL A;  2MZC A;  3TJJ A;  1BAY A;  1FG4 A;  3GSS A;  3L9U A;  1YZX A;  3GRX A;  1FO5 A;  4I97 A;  1ZYP A;  4PGT A;  5ID2 B;  1ERW A;  4I5Q A;  2FUG 2;  1XFL A;  4GTU A;  5H5S A;  4KUN A;  1OC9 A;  2PVQ A;  3P2A A;  1J08 A;  1EGO A;  4CY6 A;  1QFN A;  2VLV A;  4A5P A;  2H01 A;  3F3Q A;  3UAP A;  2J9H A;  4X4J A;  3EMX A;  5IOW A;  2M72 A;  2JSZ A;  1GUM A;  4XS4 A;  1RK4 A;  2GLR A;  5LD0 A;  4KSO A;  3HCZ A;  5INY A;  3I69 A;  4O32 A;  3TRQ A;  3BCI A;  3IAS 2;  3I6A A;  3WD6 A;  4GXZ A;  1JZR A;  4RUV A;  2DKI A;  3WT2 A;  2BTO T;  3F4S A;  4G9H A;  2WDU A;  4LMW A;  3WGE A;  3A2W A;  1MDI A;  4O7H A;  4OCF A;  2KP1 A;  4ZB9 A;  1PL1 A;  3K8N A;  4XIH A;  2H19 A;  2CVB A;  2R0C A;  2C0F A;  4L0W A;  2X64 A;  3GV1 A;  4EDZ A;  4CW9 A;  1PL2 A;  3EU3 A;  5G31 A;  3EU4 A;  1ZYN A;  1K0O A;  2P31 A;  3GL3 A;  2G2Q A;  1VGL A;  4L0U A;  2BMX A;  2VOC A;  4KCE A;  3IK7 A;  2HZE A;  5IIZ A;  2CV4 A;  4HU7 A;  2P5R A;  1UVZ A;  4JU5 A;  2FA4 A;  5IMA A;  1IYH A;  1XOA A;  5IMC A;  1U87 A;  4XRA A;  3KCM A;  3HZ4 A;  4L5O A;  3HJO A;  4GCI A;  3Q6O A;  2FY6 A;  4EKZ A;  5DAL B;  3FR6 A;  2DML A;  4N0Z A;  5HFI A;  3CTF A;  3A5I A;  1XW5 A;  1R5P A;  1UA5 A;  2YAN A;  3GTU B;  2CAI A;  4MK3 A;  4IGJ A;  1I5G A;  1BYE A;  2YN1 A;  1JLW A;  3Q18 A;  2F8A A;  5KN2 A;  1TKD B;  5FHI A;  3ZL5 A;  3TJB A;  2I3Y A;  1KTE A;  5IOX A;  1E2Y A;  4Z2U A;  2V1M A;  3KTL A;  1AQV A;  3QFA C;  3IAM 2;  4HZ2 A;  3U6V A;  3CRT A;  3KEB A;  4PUA A;  2LJR A;  1GLQ A;  1JZW A;  2H0I A;  1GSS A;  5GZZ B;  1ZGN A;  2HSM A;  2PPT A;  2IMF A;  1JHB A;  5EPF A;  3AY8 A;  2LJK A;  1R4W A;  5ECN B;  2LST A;  3FZ4 A;  2ON5 A;  3TKR A;  5HR3 A;  3LYK A;  2C3T A;  1QUW A;  3LOR A;  1YJ6 A;  2DMM A;  3ZFL A;  4KCA A;  1PD2 1;  5KN1 A;  4ZB8 A;  4ECJ A;  2TIR A;  1FOH A;  4MH2 A;  4QL7 A;  4POL A;  9GSS A;  1AXD A;  1PKW A;  1MTC A;  4I2T A;  2L5O A;  2HZF A;  3QPM A;  1A0R P;  3VI5 A;  3D4T A;  4XTS A;  1SJ6 A;  1TK8 B;  3QAW A;  4K2X A;  2IIY A;  3LQ7 A;  2LUS A;  2WUL A;  3KH9 A;  3FZA A;  3GN3 A;  4MZC A;  3F0I A;  3TGZ A;  1EZK A;  1X5D A;  3RHB A;  3LXZ A;  3APS A;  3LJR A;  4MJA A;  5F0G A;  1FOV A;  2C80 A;  3IA1 A;  1E6B A;  4K9Z A;  4ACS A;  1MD3 A;  1J0F A;  3G7I A;  3GUR A;  3GFK A;  3ZML A;  3US3 A;  5BMU A;  5D9X A;  2PER A;  2E2G A;  3FYG A;  1O81 A;  1XZO A;  5F06 A;  2X99 A;  5G5F A;  3MNG A;  4ZL7 A;  4FIW A;  2OA7 A;  1EEM A;  1XW6 A;  2FA8 A;  3RPP A;  2A4H A;  2C8U A;  1GWC A;  1Z7R A;  3ZIV A;  1H75 A;  12GS A;  1ZMA A;  4NMU A;  5D96 A;  3M8N A;  5H5R A;  4F2I A;  3EE2 A;  5AIX A;  1XW9 A;  3UEM A;  5ECQ B;  2WGR A;  3TDG A;  3W8S A;  1WOU A;  2C3Q A;  2QC7 A;  3Q19 A;  4BVX B;  3IV4 A;  3UOM A;  4IHU A;  1G6Y A;  1FVJ A;  4EDY A;  1ABA A;  3ZFB A;  2VM2 A;  3I9V 2;  4MPG A;  3IHG A;  6GST A;  2P5Q A;  3TKQ A;  5ECR B;  3ZLP A;  3W6G A;  5CP1 A;  4N30 A;  4KDU A;  3O76 A;  5JCW A;  3ZVJ A;  2RII A;  4J2F A;  1UN2 A;  4WXT A;  1V2A A;  1XPV A;  4EXJ A;  1NHO A;  2YWI A;  1DSB A;  3HVS A;  2EIQ A;  2H30 A;  4V1A p;  2YNX A;  2QGV A;  1WP0 A;  5B8B A;  1T7P B;  3M9K A;  1YEX A;  1AAZ A;  1MDK A;  3DXB A;  3QMX A;  4WR4 A;  1TRS A;  1F3A A;  3F6D A;  3QDN A;  2DC5 A;  1TRU A;  1OYJ A;  1QGV A;  4XCS A;  1SKW B;  1Z5Y E;  3D6I A;  4TN8 A;  1U3A A;  5KN0 A;  1EEJ A;  1X0R A;  1GUK A;  2H70 A;  3M3M A;  4K0N A;  5HR0 A;  4K1F A;  1FHE A;  4XRD A;  2GT5 A;  1XWK A;  1TRV A;  4FYB A;  3LWA A;  2DJK A;  3DGQ A;  3FHK A;  1NM3 A;  3ME7 A;  3QD9 A;  4L5L A;  5IMD A;  4ICY A;  3UMA A;  5ECP B;  5ECL B;  3GKX A;  1XVW A;  3KP8 A;  3HJM A;  2M46 A;  4ECC A;  11GS A;  5COH A;  1BED A;  1THO A;  4ULX A;  2K6V A;  4YKF A;  2R3X A;  3PR8 A;  2MMA A;  3HKR A;  2JSY A;  1ZZY A;  2GSR A;  2E7P A;  3FK8 A;  1WE0 A;  1A2M A;  5D9T A;  4YQU A;  3TKP A;  2B6M A;  1M9A A;  1W89 A;  2P0G A;  4ML1 A;  4MH3 A;  3F4T A;  1K0D A;  4GST A;  2NBS A;  1UC7 A;  5EL8 A;  5KOW A;  1BQ7 A;  2AUV A;  4KND A;  3GX0 A;  4PX1 A;  3BBY A;  3HDC A;  3R2Q A;  1V40 A;  4GQC A;  2WJU A;  5KEJ A;  2DIZ A;  2MMZ A;  4EIQ A;  5D73 A;  3D22 A;  3W8J A;  3VWU A;  2N5F A;  2H1G A;  3CMI A;  1T4Z A;  3VWX A;  2H72 A;  5DAK B;  4GWR A;  2OE1 A;  5KN3 A;  4HS1 A;  1TRW A;  4O92 A;  5B6N A;  2V6K A;  1TK5 B;  4PNF A;  3HJP A;  2YWM A;  1GUL A;  2FCH A;  4TOP A;  5HR1 A;  4JE1 A;  14GS A;  5EVO A;  4NWY A;  1TP9 A;  1KBN A;  2F3M A;  2I9H A;  3BOA A;  4NHW A;  4GQF A;  3PPU A;  4HUA A;  2H75 A;  4ECI A;  1U88 A;  3DKS A;  2GSQ A;  4ZL8 A;  5F05 A;  2E0Q A;  2VL2 A;  2MYG A;  1Y25 A;  2PVO C;  3CXG A;  2D2Z A;  5J41 A;  3UJ1 A;  1B4Q A;  1F3B A;  4XHM A;  4ECB A;  3ZMK A;  4G0L A;  1ZOF A;  1SJI A;  2HRF A;  4EE0 A;  2B7J A;  4Q5N A;  3HD5 A;  4TRX A;  5F8B A;  1F2E A;  2FNO A;  4MAB A;  3P90 A;  3LSZ A;  4CY8 A;  6GSX A;  3RHC A;  3F9U A;  4IP1 A;  1Q98 A;  5CRW A;  4QL9 A;  4HQZ A;  1M7T A;  1GP1 A;  5DQY A;  5J4U A;  3D21 A;  5CRG A;  1OE8 A;  5C00 A;  3VUR A;  4N0V A;  2OBI A;  5IMZ A;  1ML6 A;  2FLS A;  1SJZ A;  2H1D A;  3IRA A;  4HEA 2;  5DBQ A;  2HSH A;  3EIN A;  2FWE A;  2JAD A;  2X8C A;  3FMW A;  3P8W A;  4PQ1 A;  1GSQ A;  2VLU A;  2JU5 A;  4HOJ A;  4IVF A;  4OD7 A;  3CSJ A;  4FYC A;  3IXR A;  3QOU A;  1R26 A;  1WIK A;  3WYW A;  2B5Y A;  4J57 E;  3MDK A;  2M80 A;  4Z2T A;  4WBR D;  3I43 A;  2DJ0 A;  4X43 A;  2IL3 A;  4JR4 A;  4BVY A;  5ELG A;  3GUS A;  1U6T A;  3MYD A;  3KM6 A;  4WF5 A;  5G1K A;  2GVP A;  2QKE A;  3KP9 A;  2JZR A;  1YKA A;  4V1A g;  13GS A;  2X8H A;  5HFG A;  1K0B A;  1ON4 A;  4K5S A;  1RW1 A;  4F82 A;  2QSI A;  2K8S A;  3ZTL A;  2EIO A;  2VCQ A;  2DJ2 A;  3LYP A;  3KZQ A;  2FD3 A;  1TOF A;  3PGT A;  2XBI A;  2HI7 A;  1VF4 A;  1SD9 A;  5B8A A;  2V2G A;  3EUR A;  1ZL9 A;  4GLT A;  2LRC A;  3GMF A;  4OFN A;  2PMT A;  4TR4 A;  1SYX A;  1SKS B;  2H1A A;  3LW9 A;  3D5J A;  3GL5 A;  3HVX A;  1Z9H A;  3M1G A;  2LJA A;  4KDX A;  2VCW A;  2K18 A;  2OE3 A;  4LA1 A;  4AJ8 A;  1YDK A;  3U5R E;  5ECS A;  1X9W B;  1LBK A;  3IDV A;  4FO5 A;  1SL0 B;  1SD8 A;  1QMV A;  1MD4 A;  4WEY A;  4RI7 A;  4OCE A;  3G7Y A;  5A5K A;  2MBT A;  2FGX A;  2LKU A;  3TKS A;  4GF0 A;  2GST A;  3ZRD A;  4ZBA A;  1PQN A;  1GRX A;  4G19 A;  2CQ9 A;  2YV9 A;  5ENU A;  4IW9 A;  2GS3 A;  1B4P A;  5B7C A;  2GQM A;  4MMM A;  3UIW A;  3BD2 A;  2WCI A;  2WB9 A;  1EWX A;  1PMT A;  2VCZ A;  2WS2 A;  2RM5 A;  5IPG A;  2ZUP A;  1M9B A;  5ECH B;  5IM9 A;  1EV9 A;  1QQ2 A;  1N2A A;  1DE2 A;  4MA9 A;  2L4C A;  4MPF A;  1F9M A;  2AB6 A;  1V9W A;  2L57 A;  4ZBD A;  1XVQ A;  1GL8 A;  1WPI A;  5JWR B;  3KGK A;  3PIN A;  5ABR A;  5BRT A;  4X0X A;  2VM1 A;  3G7J A;  3Q74 A;  4O5R A;  8GSS A;  4PNG A;  2HFD A;  4YKG A;  1JZD A;  3FR3 A;  2A4V A;  4POM A;  4YQV A;  1LJR A;  5G30 A;  2GZP A;  5FWG A;  1I9D A;  3IPZ A;  3E9J B;  2H73 A;  3HYP A;  3FRC A;  2AJQ B;  3N5O A;  2KP2 A;  4G0I A;  4N11 A;  4DSS A;  5CNW A;  1T1V A;  3KD0 A;  5DJM A;  2GZY A;  1OC9 B;  3C73 A;  3KXO A;  6GSV A;  2H76 A;  4BL7 A;  2IME A;  1EV4 A;  2LS5 A;  1PN9 A;  2OKA A;  3M0F A;  2R2J A;  2VAF A;  3HY2 A;  1V98 A;  1J9B A;  2MMN A;  1TDI A;  4ML6 A;  4WBJ A;  3CSI A;  4BVY B;  4JZQ A;  2F51 A;  1O73 A;  1GSF A;  4XS4 B;  3D0Z A;  1B9Y C;  3TRP A;  3GX8 A;  1QK8 A;  4PXO A;  2LEG A;  1BJX A;  2N5A A;  4I2U A;  4WR5 A;  2DKH A;  2CVD A;  4TR3 A;  5HQP A;  1B8X A;  4JR6 A;  3GKM A;  2XBQ A;  4AF2 A;  1A8Y A;  2C0D A;  2CZ3 A;  3ZYW A;  4KAE A;  4HJ2 A;  1W4V A;  2IMI A;  1ZYE A;  4O5Q A;  2H0H A;  1GTB A;  7GSS A;  1GH2 A;  3V1W A;  4MZB A;  4TR1 A;  2JL4 A;  5B6M A;  1G6W A;  4YAV A;  3UVH A;  3EPT A;  3CTG A;  1T4Y A;  2EIR A;  2OE0 A;  3G9B A;  2EC4 A;  4EUY A;  3H8Q A;  1SK1 A;  4EO3 A;  2HZE B;  3S9F A;  3GHA A;  4MCU A;  2C4J A;  4KX4 A;  1FW1 A;  1DUG A;  2O7K A;  4J56 E;  2YV7 A;  2JZT A;  2ON7 A;  3GA4 A;  2NTO A;  2AHE A;  1BX9 A;  5KOX A;  4EF0 A;  1Z6M A;  1O8W A;  3P7X A;  3ERW A;  3QFB C;  4F9Z A;  1WMJ A;  1VF2 A;  4RQX A;  1FAA A;  5GAP D;  1GTU A;  5ID2 A;  2VCT A;  4BWS A;  2HRK A;  3MIX A;  3WGX A;  4K5R A;  2KUC A;  3J7Y k;  2XPD A;  3F6F A;  4MF7 A;  4ZIJ A;  3MWH A;  18GS A;  3VI7 A;  3TCO A;  1IYI A;  2JAC A;  3FY7 A;  1R5A A;  2C0E A;  1HNC A;  1M2B A;  1NSW A;  5IO0 A;  1Z6N A;  3FEU A;  1G0T A;  2RUF A;  1T3B A;  3TB2 A;  2FHE A;  3HXS A;  3APQ A;  4NAX A;  1EOH A;  2FWF A;  1SL1 B;  4ILF A;  2TRX A;  4RI6 A;  2VL2 C;  4KW6 A;  3QAG A;  4MF5 A;  1WWJ A;  2VUP A;  1B9X C;  3N9J A;  3IK9 A;  1HD2 A;  5D9W A;  4ZXG A;  1TJD A;  2HE3 A;  1XWC A;  2X8G A;  2L6C A;  2O89 A;  3MSZ A;  2KOK A;  3DYR A;  1KNG A;  1BG5 A;  3L9S A;  2B3S A;  1X9S B;  2VCX A;  2Z9S A;  3CRU A;  5DQS A;  1TI3 A;  1GLP A;  1R7H A;  4GSS A;  5A4V A;  2GDR A;  4YH2 A;  1ZYQ B;  1EOG A;  2I81 A;  1K0C A;  2HRN A;  1WJK A;  1F6M C;  3VWV A;  2B5X A;  2YJ7 A;  2FWH A;  1AW9 A;  4BL7 B;  4PQI A;  3KMN A;  19GS A;  4HI7 A;  3GNJ A;  1ERT A;  2G0F A;  2H6Z A;  3IBH A;  5DAL A;  5A4W A;  3J7Y b;  2MMO A;  5AIV A;  3IR4 A;  2ZNM A;  3FR9 A;  4JED A;  1SU9 A;  2CX3 A;  2PUK C;  3GTU A;  3RPN A;  2VL3 A;  5G1L A;  1EP8 A;  6GSU A;  3DVW A;  4NPB A;  1K3L A;  4WET A;  3FZ5 A;  5GST A;  2GT6 A;  1TTZ A;  4CDO A;  4HDE A;  1OVN A;  1V58 A;  4NV5 A;  4IBP A;  4JRR A;  4OMV A;  3DD3 A;  4HU9 A;  2H6X A;  2I1U A;  2CZ2 A;  4ZB6 A;  4HZ4 A;  1HNB A;  1XWB A;  3O3T A;  3UVT A;  3GH9 A;  4HJM A;  3ZVJ D;  2REM A;  6GSY A;  3QAV A;  1GUH A;  3M9J A;  1AIU A;  1PX6 A;  1JLV A;  2LNT A;  5G5E A;  2H74 A;  3C71 A;  2NPB A;  2CAQ A;  5HR2 A;  1GSU A;  3UBL A;  2XPE A;  3GKN A;  5FT3 A;  2H6Y A;  1HNA A;  3E0U A;  4X1U A;  3EWL A;  3HHV A;  4TW5 A;  3F4R A;  2WRT A;  2VD1 A;  1EP7 A;  5H5Q A;  1YEP A;  2F9S A;  1V57 A;  1URM A;  3HZ8 A;  4EIP A;  2R4V A;  5ECI B;  1PX7 A;  1Z3E A;  2O87 A;  3L9V A;  1GNE A;  3DML A;  2IJY A;  3F3R A;  4XS1 A;  3GYK A;  2YWO A;  3GKK A;  4L8E A;  4K6X A;  2LNS A;  3IE3 A;  2HT9 A;  1GTI A;  4I8B A;  2LRN A;  1H4O A;  4WKW A;  1SEN A;  4MJB A;  5ELA A;  1Z7P A;  4TVE A;  4PQH A;  1PSQ A;  1YQ1 A;  1T00 A;  1A8L A;  1CQG A;  3TKS C;  4MLY A;  4MZW A;  2R0G A;  2HNL A;  4PUF C;  2OAC A;  3ERG A;  2PU9 C;  4AJ6 A;  2IWT A;  1OKT A;  5DCG A;  16GS A;  4G10 A;  2HXK A;  1A2J A;  1DE1 A;  1M2A A;  1HYU A;  2V41 A;  4BPY A;  2L59 A;  4FYU A;  4GRF A;  3WT1 A;  2AAW A;  1A24 A;  4BA7 A;  2PN8 A;  4ZL9 A;  2WFC A;  2B5E A;  4WF4 A;  1B48 A;  5CRE A;  1SK0 A;  2C1Y A;  2A2R A;  4TKY A;  1FVK A;  1MEK A;  3NOF A;  4ZIL A;  4K7N A;  2HYX A;  2DLX A;  4POK A;  3VK9 A;  1ERU A;  4BVX A;  4QQ7 A;  1ST9 A;  2GTU A;  4IJI A;  5GAN D;  4OFM A;  5ECM B;  5J5N A;  1O6J A;  1RQM A;  2V32 A;  3EMP A;  2A2S A;  2GQL A;  4LL4 B;  4PUR A;  3VWW A;  3TOU A;  1QXH A;  2UZ8 A;  4POB A;  5D93 A;  3KTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...