3IA1A

Crystal structure of thio-disulfide isomerase from thermus thermophilus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
143
structure length
143
Chain Sequence
AVKPGEPLPDFLLLDPKGQPVTPATVSKPAVIVFWASWCTVCKAEFPGLHRVAEETGVPFYVISREPRDTREVVLEYMKTYPRFIPLLASDRDRPHEVAARFKVLGQPWTFVVDREGKVVALFAGRAGREALLDALLLAGADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thio-disulfide isomerase/thioredoxin
publication title Crystal structure of thio-disulfide isomerase from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 39
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ia1A00
1GSUA 1PQNA 1XVQA 3C1RA 3M8NA 1MTCA 2GZPA 1S3CA 3GTUB 3J7Yb 4Z7XA 2FLSA 5D93A 3DVXA 5CRHA 3FZAA 4HOJA 5IMCA 4NV2A 3BJ5A 5IIZA 3VPTA 3CYNA 4G19A 3RPPA 2K9FA 4EL1A 1E6BA 5A4WA 2LJKA 4XIHA 2GSSA 4MH3A 5JWQB 1GUMA 2MYGA 3ISOA 3FK8A 1K0AA 1TXXA 2C3TA 4WR4A 4XS6A 5G1KA 5J3RA 3TKPA 3KP9A 4EO3A 2K6VA 1K0BA 4IHUA 2LRCA 5ABRA 4ZL7A 3VWUA 1TRWA 2YWNA 5ECPB 4XCSA 3VURA 3FKFA 5CRGA 3HZ4A 2DMMA 2VL2A 3LWAA 4OO5A 3GV1A 2PN8A 3VK9A 2IWTA 1XWGA 1YY7A 2FWGA 4JR6A 5KN1A 2PMTA 1U6TA 4PNGA 3KM6A 1QFNA 1V57A 1KEBA 4IW9A 1QXHA 3ZVJA 2N5AA 2C8UA 2H30A 5J4UA 4NV5A 3TJBA 1A8YA 2WFCA 5AISA 3F4RA 1MD3A 3IV4A 3HY2A 2O87A 1FB0A 3EU3A 5DALB 1ZZYA 2LTKA 4ML6A 2LRNA 3KEBA 2LQOA 3HJPA 4GSSA 4L8EA 2AJQB 3FW2A 1S3AA 4EVMA 4KCAA 1WRYA 3GKNA 2YANA 3QMXA 3Q6OA 2MBTA 3IK7A 1UVZA 4FYUA 1Z3EA 2WRTA 1WWJA 4ECCA 1O6JA 3IR4A 2JACA 1SJIA 3LXTA 1DE2A 3UIWA 4CW9A 2WJUA 4K0GA 5CREA 1BYEA 1ABAA 1T4ZA 3IOSA 3VFIA 1ZMAA 2G2QA 1EP8A 4O5RA 5J5NA 1V40A 2D2ZA 3P90A 6GSVA 3HVXA 3HXSA 4IS0A 4L0UA 1G6YA 3QPMA 3KMNA 3F3RA 4RI6A 2H66A 2VL3A 2H72A 3LXZA 3KTLA 3BBYA 1PKWA 3UMAA 2KHPA 2H1AA 1B8XA 2B5YA 1HQOA 3ME8A 1OYJA 1EP7A 5ELAA 1EEJA 2I81A 4JU5A 3UBKA 2V41A 2F9SA 2CT6A 4NPBA 3TJGA 1DUGA 2ZNMA 3DRNA 3F0IA 4IKHA 2YJ7A 5IQYA 2B7JA 3TKSA 3EVIA 3KIJA 5DQYA 3ZZXA 5EPFA 4EXJA 4MPFA 1GLPA 1TI1A 4TKYA 2GZYA 3KTBA 5AIVA 2VAFA 5JWRB 4TW5A 2C1YA 2VM1A 3RBTA 5GSTA 2CZ2A 6GSTA 1TK8B 3DEXA 2AHEA 3IDVA 2P5QA 3R2QA 4I97A 1TU8A 3P7XA 4K7IA 2DJ0A 4PURA 1GP1A 1TI3A 2CA8A 4GQCA 1PL1A 1TOFA 4V1Ag 16GSA 1A24A 1EGRA 1YEPA 4ZBDA 2LUSA 2HNLA 5B6MA 1ERVA 2FWFA 2YV9A 2RM5A 3D5JA 3FY7A 5C00A 3IRAA 2MZCA 1THOA 2RUFA 2HT9A 1F9MA 3APQA 2C0DA 3MDKA 2F51A 3O6TA 4Q5QA 2PVOC 2IL3A 1NHOA 5COHA 1Z9HA 4GXZA 3VLNA 3TB2A 2ON5A 3ZTLA 5B7CA 4RI7A 4NMUA 4BL7A 1GSYA 1XW6A 3VWWA 1G7EA 5IO0A 4KH7A 3TUEA 3GKMA 2A2SA 4GQFA 1SK2A 1URMA 1GULA 1GTUA 1LBKA 2MMAA 2VLUA 1BAYA 3ZIJA 3W8SA 2MMZA 1J0FA 2HXKA 3D0ZA 3GH9A 3HVSA 3GUSA 3WYWA 1BQ7A 3KZQA 2CX3A 2YOIA 3GNJA 4KNDA 4FH8A 4XRDA 1DE1A 3TKRA 1EOGA 6GSXA 5IM9A 1OKTA 2YP6A 2EIOA 4XRAA 4KAEA 1OC3A 3ZREA 5JCWA 5G1LA 3GMFA 5HR2A 2E2MA 3WGDA 3E9JB 3ZMKA 3CMIA 1FVJA 3KH7A 5GSSA 2Z9SA 2MBSA 5ECNB 4K9ZA 5DJMA 5DALA 3IA1A 2HE3A 2CQ9A 4X0XA 4ACSA 2HFDA 2C3QA 4JE1A 2XC2A 1N2AA 4OFNA 3IE3A 5HR3A 3QCPA 1QUWA 2PU9C 3C8EA 3F8UA 2WZ9A 2QKEA 4X1UA 1JFUA 4OCEA 3RAZA 1YKAA 3WD6A 3KXOA 1SD8A 3GURA 4J57E 3MWHA 4MF7A 2YCDA 3JCML 1JZWA 3CTFA 1TU7A 1SYRA 1Q4JA 4WBRD 3N5OA 4HS1A 2IMEA 1O7UA 2YZUA 3D6IA 4ZBBA 2PWJA 5F0GA 2OKAA 3ED3A 4JR4A 2TRXA 2AB6A 3NZNA 1G6WA 2GT6A 1GNWA 4L5OA 3CBUA 2GSQA 1DBYA 2ZCTA 4MH2A 5DCGA 3G7JA 3UAPA 1SL1B 5JCUA 1K3OA 1T3BA 2GVPA 2YPMA 2IMFA 4OWYA 4V2MA 2LKUA 1XWCA 4BA7A 1JLWA 2RIIA 5D9VA 3LJRA 4NHWA 2R3XA 4QL7A 1NHYA 3G9BA 4KE3A 10GSA 1PGTA 4RUVA 4HDEA 2TRCP 5DJLA 1GUHA 5HR0A 1Z6NA 2PUKC 5D73A 1K0DA 3LQ7A 4O92A 5ECIB 3EWLA 1NW2A 2B5EA 2C0GA 2V32A 4WKWA 1VGLA 2V6OA 1LJRA 5F05A 2AAWA 3TOUA 4I8BA 2N5FA 1SJ6A 5DDLA 4CHSA 3U6VA 2B5XA 1H4OA 3A3TA 4ZBAA 4F2IA 3F3QA 4OFMA 4K1FA 2XHFA 1N8JA 5ECRB 5IOWA 5B8AA 5IMFA 4DVCA 1R26A 4G2EA 1GH2A 2PGTA 2F3MA 1GTAA 2OACA 4MZCA 1J08A 3HDCA 1QQ2A 4TRXA 4XS4B 2BMXA 2KLXA 5HQPA 4JEDA 3TKSE 1GSSA 2H6XA 4IJIA 9GSSA 4E8HA 3KP8A 4LA1A 3VPQA 3K8NA 1T7PB 3LORA 3LFLA 2L4CA 5IPHA 1AAZA 4CDOA 1TK5B 2FNOA 3ZLPA 4EF0A 5DBQA 3GL5A 1I9DA 2C80A 3VI5A 3L0HA 4TR3A 1GTIA 2NDOA 4AJ8A 5EVOA 2WB9A 2YWIA 1BX9A 1M9BA 1OVNA 2V1MA 2J9HA 5G30A 3H93A 1JLVA 4I2TA 2P31A 4HUAA 4K7OA 2JADA 5F8BA 2O85A 2WGRA 5GAND 2REMA 2N5BA 4EC0A 3F9UA 5IPGA 4N10A 2FA8A 4DSRA 1WMJA 4KUNA 4K2DA 3N9JA 5KN3A 4TVEA 11GSA 4JBBA 2VL2C 4N0ZA 5D9XA 2GTUA 1R7HA 3ZITA 4KDUA 5G2ZA 2GQKA 3L9SA 3HA9A 3LEFA 3ME7A 4YQVA 4KSOA 4MJCA 3VWVA 1XOBA 1PD21 2GQMA 1A8LA 4FO5A 2RLIA 5CRDA 4ZILA 5IMZA 3EE2A 4FYCA 1XW9A 2IMKA 4IN0A 5JWOB 4EUYA 2M80A 1TP9A 1EGOA 5IO2A 2IFQB 1EWXA 2DJ3A 3GHAA 3GIXA 1MDKA 5IOXA 2GGTA 3IXRA 2DJKA 2HLSA 2QGVA 3DGQA 4BWQA 4KX4A 3A5WA 2FY6A 3APSA 3V1WA 1GSFA 3RPNA 4N30A 2YN1A 3F6FA 3IK9A 2CAQA 3KD0A 2RM6A 5HFGA 2BJXA 5IMAA 3E3EA 4O32A 1GSEA 3CSJA 1VF1A 3L78A 2DC5A 3TDGA 2GQLA 4L5LA 3TOTA 3MAKA 2WCIA 3F4TA 1B48A 2A4VA 1SK0A 4I6XA 3M1GA 1AC1A 1M2DA 2H01A 2DJ1A 3DYRA 5E59A 4K0NA 4ECJA 2H76A 1GTBA 4TXOB 1YDKA 4ULXA 2PPTA 1K0CA 8GSSA 1GWCA 2PERA 4HQZA 4MJEA 2KP2A 4E8EA 4MZWA 1HNCA 1K0MA 4GLTA 3BCKA 4K8MA 2R4VA 3M3MA 3UARA 3H4KA 2R37A 1U3IA 2KP1A 5CNWA 4KDYA 5DQSA 1ON4A 1VF4A 4PUFC 3P2AA 3CXGA 5CP1A 3DMLA 3KCMA 4BWSA 5AN1A 1XOAA 3E0UA 4OFTA 3TKSC 2CVBA 5EL8A 1SD9A 3M9JA 4TN8A 1TW9A 2YZHA 3DIEA 1YF1A 1M2BA 2XBIA 6GSYA 3D21A 2H0HA 5G31A 3LGCA 3CRTA 5HR1A 3F63A 5AGYA 2H0GA 4IBPA 2EIRA 4AJ6A 4WXTA 4XS4A 1PX6A 2X8HA 3HHVA 4IQ1A 5ECSA 2IJYA 1TRUA 1GNEA 4KB3A 3QR6A 3WGEA 4QL9A 4ZB6A 5JCGA 5EY6A 3HJMA 1KBNA 1LU4A 2VCZA 3ERFA 4YH2A 5B8BA 4MCUA 2XBQA 1AW9A 1GSQA 4NHZA 1ZYEA 3KH9A 4MJBA 3W6GA 3I6AA 3C71A 3FR6A 3CSHA 2B7KA 5KN2A 3QOUA 1Z6MA 2X8GA 1GSDA 2F8FA 1C72A 5CRWA 2VCWA 3FEUA 3GYKA 3TCOA 1OAZA 19GSA 1W89A 4HI7A 2JSZA 1G7OA 1YZXA 1Z7RA 2FD3A 1SKRB 4KDXA 3M0FA 3TRPA 2VD1A 3UBLA 5J9CA 4F03A 1PRXA 5ENUA 4NAXA 5FWGA 3ZFBA 5ID2A 2EIQA 1Z5YE 5ECKB 3C73A 1V98A 2XPDA 5ECHB 4POLA 1PL2A 3SBCA 3NOFA 4PQ1A 4ISDA 3FZ9A 3CSIA 1EZKA 2VCTA 4ID0A 1TTZA 2DSAA 3LSZA 2B1LA 3HKRA 5LD0A 1HYUA 5H5RA 4PX1A 5G5FA 2LNSA 4IQAA 5H5SA 2VD0A 3Q19A 4AF2A 2IPAA 3FZ5A 4GCIA 4YQUA 3IHQA 1PN9A 4FIWA 4MPGA 4EDZA 2CX4A 1NM3A 3GKXA 3P8WA 3TJFA 4V1Ap 1YKCA 1A2JA 1U87A 4N11A 3WGXA 2A2RA 2IFQA 1F37A 1JHBA 4NWYA 1T4YA 3QAGA 1R5AA 3HZ8A 1EV9A 4GSNA 3QFAC 1FW1A 7GSSA 1O85A 1UC7A 1EEMA 1QGVA 4YAVA 5DAKB 4PUAA 3UJ1A 4MF5A 4DSQA 2GSRA 4OMVA 2K8SA 3DXBA 4HEA2 1FHEA 5INYA 3FR9A 4POMA 4HZ2A 4JRRA 2KUCA 4K6XA 2HRFA 1O8XA 2DLXA 2I3YA 3ZFLA 1EOHA 1SL0B 2NBSA 2VLVA 2JZSA 5GZZB 5LCZA 3ZVJD 2LJRA 2M72A 2P5RA 1V2AA 3ZL5A 4NXIA 1M99A 4BVXA 1WP0A 1OE8A 1THXA 1TJDA 1AXDA 2GS3A 4ZL9A 4WEYA 1SL2B 2CVKA 2JZRA 2FGXA 4TXOA 2HZEA 3QFBC 3FHKA 3I9V2 2GZZA 1TDIA 12GSA 1ERUA 2B1KA 1HD2A 2ZUPA 5A5KA 1FAAA 1CQHA 4MABA 1OKDA 2CZ3A 2H1DA 5KEJA 2X64A 1GUKA 3KGKA 3DD3A 3TGZA 3UVTA 4I5QA 2FWHA 5LNKe 1Y6EA 5ECLB 2HI7A 3EINA 2H70A 1Q98A 1KNGA 2KOKA 2H74A 3DKSA 2J23A 2FWEA 5DVBA 4WETA 3GX8A 1SENA 4OD7A 1FVKA 2H1GA 3I69A 4KW6A 2JU5A 2O7KA 1T1VA 3PINA 1B4QA 3OR5A 4KGIA 1FB6A 4Q5NA 1BJXA 2OA7A 3FRCA 2OBIA 3WT1A 3HD5A 2IMDA 3AY8A 2I9HA 4AJ7A 2VOCA 4RQXA 1ML6A 5D9TA 2OE0A 1XCCA 1SJZA 1X9MB 4TR1B 2WULA 4N0VA 3S9FA 3L4NA 3ERWA 4MJAA 3QDNA 5HFKA 4HJ2A 2DJ2A 4IVFA 1A23A 3DVWA 5FHIA 2DMLA 2NVLA 3F6DA 4GTUA 5CAXA 1AQWA 3BCIA 3W8JA 1ZL9A 3IBHA 4P3YB 1YEXA 3GA4A 4OCFA 3M9KA 1GRXA 3IC4A 3D4MA 1XZOA 5E4WA 2C3NA 4XTSA 4EDYA 4FYBA 3UL3A 5ID2B 2GT5A 3A2WA 3RHCA 3I43A 3EMXA 22GSA 2H0IA 5J9BA 3GN3A 3FZ4A 2X99A 1QMVA 2H73A 2CV4A 1AIUA 2C4JA 4ZXGA 4F0CA 5ELGA 2VUPA 4POBA 3TRQA 4XHMA 1T8EB 4O7HA 3RDWA 1VRSD 3GKKA 1V58A 2TIRA 2AUVA 1F6MC 5G5EA 1I5GA 1QK8A 3GX0A 1HNAA 1OE7A 1XPVA 2L5OA 3TKQA 2L5LA 3APOA 5IMVA 3A2VA 1SU9A 3EU4A 4Q5RA 3GL3A 4WR5A 4KA0A 1B9XC 3ZIVA 1S3DA 1OC8A 4I2UA 1A2MA 2R2JA 2R6KA 1X5DA 2IIYA 4H86A 3LYPA 5CYYA 1R4WA 3A2XA 5DCHA 1X5CA 2DIYA 1X5EA 1ILOA 1F3AA 3G7YA 4PGTA 2WDUA 6GSWA 3C7MA 1FO5A 1IYHA 3BOAA 3FR3A 1AUCA 1E2YA 5A4VA 4IELA 2FHEA 5GAPD 4D73B 1XWBA 2VL9A 3ERGA 2OE1A 2H1BA 1K0OA 1DSBA 1ZCPA 2M46A 2DJJA 5KN0A 4JZQA 1JZRA 3IAM2 1EV4A 1MDJA 1ST9A 1OC9A 5DAKA 3GSSA 4TOPA 3H79A 2EC4A 1AQVA 2NTOA 4BVYA 4ZB8A 2K8VA 3UVHA 3MNGA 2L57A 4MZBA 2LRTA 1A2LA 1K0NA 4HZ4A 3ZMLA 2OE3A 3O76A 2L59A 5F06A 1R5PA 4V2LA 1JZOA 5AIXA 2HSYA 2B6MA 4EE0A 4PXOA 3H8QA 3QAWA 1PA3A 2HZEB 2NPBA 1WOUA 1G0TA 1ERWA 2L6DA 2QSIA 1SYXA 3KMOA 2LJAA 3US3A 1X9SB 1TKDB 1BEDA 1V9WA 2L6CA 2LNTA 4EKZA 4HU9A 2V6KA 2E2GA 4GF0A 2IN3A 1VF3A 1YF0A 4LMWA 4PNFA 1KTEA 5CO3A 2P0GA 4WBJA 1XWAA 1SKSB 6GSSA 1Z7PA 4DSSA 5J41A 5ECQB 1K3YA 17GSA 2HSHA 1U88A 3PR8A 2PVQA 4J2FA 1MDIA 4PQIA 3NIVA 4BPYA 1RW1A 4LL1B 1YQ1A 5D8IA 5FT3A 2YWOA 1PKZA 3D4TA 1WJKA 2C0FA 4TXVA 3H1NA 2LEGA 1O81A 4WF5A 2OBKA 2VCQA 1YJ6A 3GH6A 2GSTA 1ACVA 4MP4A 2MMNA 1AQXA 4L0WA 4Q5FA 1GL8A 2YNXA 1M7TA 2FUG2 1BG5A 3CRUA 2H19A 4GRFA 1IYIA 3EYTA 3F4SA 5L71A 2LS5A 1A0RP 3IPZA 5ECMB 2YWMA 4IP6A 3GTUA 4F82A 1CQGA 2OJLA 4MMMA 4TR1A 4K7NA 4IGJA 3SWLA 4DEJA 2LSTA 4LMVA 1B4PA 1H75A 1FG4A 1XVWA 2LV3A 1F2EA 1RQMA 4ZIJA 3U5RE 4X43A 1HNBA 3DWVA 1GLQA 4ILFA 1O8WA 1TRVA 4ZL8A 3J7Yk 1XBSA 4AGSA 1Y25A 2H75A 4XS1A 3VI7A 5B6NA 13GSA 4G10A 1J9BA 1XXUA 2OADA 3O3TA 1X0RA 3IAS2 1WE0A 3HYPA 3L9UA 3GSTA 1MD4A 2JSYA 2VCXA 4MA9A 3L9VA 1WPIA 1TK0B 2JZTA 1XW5A 2F8AA 4HU7A 5D9WA 4GWRA 4ZB9A 2H8LA 1XIYA 2ALBA 1JZDA 1U3AA 1RK4A 3UEMA 1SK1A 2O8VB 4ECBA 1ZYQB 3G7IA 1UN2A 4MDCA 2E7PA 2I4AA 4IJ3A 20GSA 1PX7A 3VWXA 4WF4A 4TR4A 4MF6A 3CTGA 2C0EA 3TJJA 4ECIA 1XFLA 4GSTA 2HYXA 2LQQA 3Q74A 4KCEA 4YQMA 4HQSA 1F3BA 2HRNA 2YJHA 2H71A 2E0QA 3D22A 2DIZA 1MEKA 1USBA 2CVDA 2L4QA 3EMPA 1OC9B 1B9YC 3TJKA 2DBCA 3GRXA 4YAPA 3PGTA 2FA4A 4ML1A 2FCHA 6GSUA 2CAIA 4D73A 3Q18A 3HCZA 3EURA 2JL4A 4OO4A 1T00A 2AV4A 2GLRA 2K18A 4RQRA 4J56E 2ON7A 18GSA 3GFKA 2XPEA 3FYGA 3LG6A 1WIKA 1X9WB 1FOVA 5F07A 3RHBA 3HJOA 1ZOFA 2HZFA 1PMTA 5A4UA 4TR0A 3UOMA 1O73A 3HVVA 1A0FA 1PSQA 2X8CA 1M2AA 14GSA 2WS2A 3ZYWA 4MK3A 1UA5A 2I1UA 1K3LA 2VCVA 2VM2A 3TRXA 3C1SA 2BTOT 5IMDA 4DSSB 4LL4B 1TRSA 2H6ZA 2H6YA 1NSWA 2PBJA 3PH9A 3KJYA 4MLYA 2B3SA 2MMOA 1W4VA 2VO4A 3MSZA 4HJMA 2IMIA 2ES7A 1M0UA 4F9ZA 5HFIA 2YV7A 5ECOB 1SKWB 4PQHA 2O89A 2VIMA 4KSMA 3QAVA 4F0BA 2G0FA 3EC3A 2GDRA 4LLRA 3BD2A 4QQ7A 3ZRDA 2QC7A 4IP1A 3QD9A 5C04A 4V2NA 2VLTA 1ZGNA 4G9HA 2AYTA 1VF2A 5D96A 3LYKA 3WT2A 1M9AA 1ERTA 4POKA 2RUEA 5H5QA 1XWKA 2R5GA 2V2GA
chains in the Genus database with same CATH superfamily
1GSUA 5BMUA 1PQNA 1XVQA 3C1RA 3M8NA 1MTCA 2GZPA 1S3CA 3GTUB 3J7Yb 4Z7XA 2FLSA 5D93A 3DVXA 5CRHA 3FZAA 4HOJA 5IMCA 4NV2A 3BJ5A 5IIZA 3VPTA 3CYNA 4KF9A 4G19A 3RPPA 2K9FA 4EL1A 1E6BA 5A4WA 2LJKA 4XIHA 2GSSA 4MH3A 5JWQB 1GUMA 2MYGA 3ISOA 3FK8A 1K0AA 1TXXA 2C3TA 4WR4A 4XS6A 5G1KA 5J3RA 3TKPA 3KP9A 4EO3A 2K6VA 1K0BA 4IHUA 2LRCA 5ABRA 4ZL7A 3VWUA 1TRWA 2YWNA 5ECPB 4XCSA 5KOXA 3VURA 3FKFA 5CRGA 3HZ4A 2DMMA 2VL2A 3LWAA 4OO5A 3GV1A 2PN8A 3VK9A 2IWTA 1XWGA 1YY7A 2FWGA 4JR6A 5KN1A 2PMTA 1U6TA 4PNGA 3KM6A 1QFNA 1V57A 1KEBA 4IW9A 1QXHA 2UZ8A 2N5AA 3ZVJA 2C8UA 2H30A 5J4UA 4NV5A 3TJBA 1A8YA 2WFCA 5AISA 3F4RA 1MD3A 3IV4A 3HY2A 2O87A 1FB0A 3EU3A 5DALB 1ZZYA 2LTKA 4ML6A 2LRNA 3KEBA 2LQOA 3HJPA 4GSSA 4L8EA 2AJQB 3FW2A 1S3AA 4EVMA 4KCAA 1WRYA 3GKNA 2YANA 3QMXA 3Q6OA 2MBTA 3IK7A 1UVZA 4FYUA 1Z3EA 2WRTA 1WWJA 4ECCA 1O6JA 3IR4A 2JACA 1SJIA 3LXTA 1DE2A 3UIWA 4CW9A 1FOHA 2WJUA 4A5PA 4K0GA 5CREA 1BYEA 1ABAA 1T4ZA 3IOSA 3VFIA 1ZMAA 2G2QA 1EP8A 4O5RA 5J5NA 1V40A 2D2ZA 3P90A 6GSVA 3HVXA 3HXSA 4IS0A 4L0UA 1G6YA 2A4HA 2DKHA 3QPMA 3KMNA 3F3RA 4RI6A 2H66A 2VL3A 2H72A 3LXZA 3KTLA 3BBYA 1PKWA 3UMAA 2KHPA 2H1AA 1B8XA 2B5YA 1HQOA 3ME8A 1OYJA 1EP7A 5ELAA 1EEJA 2I81A 4JU5A 3UBKA 2V41A 2F9SA 2CT6A 4NPBA 3TJGA 1DUGA 2ZNMA 3DRNA 3F0IA 4IKHA 2YJ7A 5IQYA 2B7JA 3TKSA 2DKIA 3EVIA 3KIJA 5DQYA 3ZZXA 5EPFA 4EXJA 4MPFA 1GLPA 1TI1A 4TKYA 2GZYA 3KTBA 5AIVA 2VAFA 5JWRB 4TW5A 2C1YA 2VM1A 3RBTA 5GSTA 2CZ2A 6GSTA 1TK8B 3DEXA 2AHEA 3IDVA 2P5QA 3R2QA 4I97A 1TU8A 3P7XA 4K7IA 2DJ0A 4PURA 4MNNA 1GP1A 1TI3A 2CA8A 4GQCA 1PL1A 1TOFA 4V1Ag 3MYDA 16GSA 1A24A 1EGRA 1YEPA 4ZBDA 2LUSA 2HNLA 5B6MA 1ERVA 2FWFA 2YV9A 2RM5A 3D5JA 3FY7A 5C00A 3IRAA 2MZCA 1THOA 2RUFA 2HT9A 1F9MA 3APQA 2C0DA 1ZYPA 3MDKA 2F51A 3O6TA 4Q5QA 2PVOC 2R0PA 2IL3A 1NHOA 5COHA 1Z9HA 4GXZA 3VLNA 3TB2A 2ON5A 3ZTLA 5B7CA 4RI7A 4NMUA 4BL7A 1GSYA 1XW6A 3VWWA 1G7EA 5IO0A 4KH7A 3TUEA 3GKMA 2A2SA 4GQFA 1SK2A 1URMA 1GULA 1GTUA 1LBKA 2MMAA 2VLUA 1BAYA 3ZIJA 3W8SA 2MMZA 1J0FA 2HXKA 3D0ZA 3GH9A 3HVSA 3GUSA 3WYWA 1BQ7A 3KZQA 2CX3A 4G0IA 2YOIA 3GNJA 4KNDA 4FH8A 4XRDA 1DE1A 3TKRA 1EOGA 6GSXA 5IM9A 1OKTA 2YP6A 4YKFA 2EIOA 4XRAA 4KAEA 1OC3A 3ZREA 5JCWA 5G1LA 3GMFA 5HR2A 2E2MA 3WGDA 3E9JB 3ZMKA 3CMIA 1FVJA 3KH7A 5GSSA 2Z9SA 2MBSA 5ECNB 2X4AA 4K9ZA 5DJMA 5DALA 3IA1A 2HE3A 2CQ9A 4X0XA 4ACSA 2HFDA 2C3QA 4JE1A 2XC2A 1N2AA 4OFNA 3IE3A 5HR3A 3QCPA 1QUWA 3MIXA 2PU9C 3C8EA 3F8UA 2WZ9A 2QKEA 4X1UA 1JFUA 4OCEA 3RAZA 1YKAA 3WD6A 3KXOA 1SD8A 3GURA 4J57E 3MWHA 4MF7A 2YCDA 3JCML 1JZWA 3CTFA 1TU7A 1SYRA 1Q4JA 4WBRD 3N5OA 4HS1A 2IMEA 1O7UA 2YZUA 3D6IA 4ZBBA 2PWJA 4Z2RA 5F0GA 2OKAA 3ED3A 4JR4A 2TRXA 2AB6A 3NZNA 3IHGA 1G6WA 2GT6A 1GNWA 4L5OA 3CBUA 2GSQA 1DBYA 2ZCTA 4MH2A 5DCGA 3G7JA 3UAPA 1SL1B 5JCUA 1K3OA 1T3BA 2GVPA 2YPMA 2IMFA 4OWYA 4V2MA 2LKUA 1XWCA 2X49A 4BA7A 1JLWA 2RIIA 5D9VA 3LJRA 4NHWA 2R3XA 4QL7A 1NHYA 3G9BA 4KE3A 10GSA 1PGTA 4RUVA 4HDEA 2TRCP 5DJLA 1GUHA 5HR0A 1Z6NA 2PUKC 5D73A 1K0DA 3LQ7A 4O92A 5ECIB 3EWLA 1NW2A 2B5EA 2C0GA 2V32A 4WKWA 1VGLA 4YKGA 2V6OA 1LJRA 5F05A 2AAWA 3TOUA 4I8BA 2N5FA 1SJ6A 5DDLA 4CHSA 3U6VA 2B5XA 1H4OA 3A3TA 4ZBAA 4F2IA 3F3QA 4OFMA 4K1FA 2XHFA 1N8JA 5ECRB 5IOWA 5B8AA 5IMFA 4DVCA 1R26A 4G2EA 1GH2A 2PGTA 2F3MA 4O5QA 1GTAA 2OACA 4MZCA 1J08A 3HDCA 1QQ2A 4TRXA 4XS4B 2BMXA 2KLXA 5HQPA 4JEDA 3TKSE 1GSSA 2H6XA 4IJIA 9GSSA 4EIQA 4E8HA 3KP8A 4LA1A 3VPQA 3K8NA 1T7PB 3LORA 3LFLA 1PN0A 2L4CA 5IPHA 1AAZA 4CDOA 1TK5B 2FNOA 3ZLPA 1M3IA 4EF0A 5DBQA 3GL5A 1I9DA 2C80A 4BL7B 3VI5A 4HSCX 3L0HA 4TR3A 1GTIA 2NDOA 4AJ8A 5EVOA 2WB9A 4K5SA 2YWIA 1BX9A 1M9BA 1OVNA 2V1MA 2J9HA 5G30A 3H93A 1JLVA 4I2TA 4CY8A 2P31A 3A5IA 4HUAA 4K7OA 2JADA 5F8BA 2O85A 2WGRA 5GAND 2REMA 2N5BA 4EC0A 3F9UA 5IPGA 4N10A 2FA8A 4DSRA 1WMJA 4KUNA 4K2DA 3N9JA 4Z2UA 5KN3A 4TVEA 11GSA 4JBBA 2VL2C 4N0ZA 5D9XA 2GTUA 1R7HA 3ZITA 4KDUA 5G2ZA 2GQKA 3L9SA 3HA9A 3LEFA 3ME7A 4YQVA 4KSOA 4MJCA 3VWVA 1XOBA 1PD21 2GQMA 1A8LA 4FO5A 2RLIA 5CRDA 4ZILA 5IMZA 3EE2A 4FYCA 1XW9A 2IMKA 4IN0A 5JWOB 4EUYA 2M80A 1TP9A 1EGOA 5IO2A 2IFQB 1EWXA 2DJ3A 3GHAA 3GIXA 1MDKA 5IOXA 2GGTA 3IXRA 2DJKA 2HLSA 2QGVA 3DGQA 4BWQA 4KX4A 3A5WA 2FY6A 3APSA 3V1WA 1GSFA 3RPNA 4N30A 2YN1A 3F6FA 3IK9A 2CAQA 3KD0A 2RM6A 5HFGA 2BJXA 5IMAA 5KOWA 3E3EA 4O32A 4X4JA 1GSEA 3CSJA 1VF1A 3L78A 2DC5A 3TDGA 2GQLA 4L5LA 3TOTA 3MAKA 2WCIA 3F4TA 1B48A 2A4VA 1SK0A 3FMWA 4I6XA 3M1GA 1AC1A 1M2DA 4USSA 2H01A 2DJ1A 3DYRA 5E59A 4K0NA 3CQFA 4ECJA 4FQUA 2H76A 1GTBA 4TXOB 1YDKA 4ULXA 2PPTA 1K0CA 8GSSA 1GWCA 4MJEA 2PERA 4HQZA 2KP2A 4E8EA 4MZWA 1HNCA 1K0MA 4K2XA 4GLTA 3BCKA 4K8MA 2R4VA 3M3MA 3UARA 3H4KA 2R37A 1U3IA 2KP1A 5CNWA 4KDYA 5DQSA 1ON4A 1VF4A 4PUFC 3P2AA 3CXGA 5CP1A 3DMLA 3KCMA 4BWSA 5AN1A 1XOAA 3E0UA 4OFTA 3TKSC 2CVBA 5EL8A 1SD9A 3M9JA 4TN8A 1TW9A 2YZHA 3DIEA 1YF1A 1M2BA 2XBIA 6GSYA 3D21A 2H0HA 5G31A 3LGCA 3CRTA 5HR1A 3F63A 5AGYA 2H0GA 4IBPA 2EIRA 4AJ6A 4WXTA 4XS4A 1PX6A 2X8HA 3HHVA 4IQ1A 5ECSA 2IJYA 1TRUA 1GNEA 4KB3A 3QR6A 3WGEA 4QL9A 4ZB6A 5JCGA 2QA2A 5EY6A 3HJMA 1KBNA 1LU4A 2VCZA 3ERFA 4YH2A 5B8BA 4MCUA 2XBQA 1AW9A 1GSQA 4NHZA 1ZYEA 3KH9A 4MJBA 3W6GA 3I6AA 3C71A 3FR6A 3CSHA 2B7KA 5KN2A 3QOUA 1Z6MA 2X8GA 1GSDA 2F8FA 1C72A 5CRWA 2VCWA 3FEUA 3GYKA 3TCOA 1OAZA 19GSA 1W89A 4HI7A 2JSZA 1G7OA 1YZXA 1Z7RA 2FD3A 1SKRB 4KDXA 3M0FA 3TRPA 2VD1A 3UBLA 5J9CA 4F03A 1PRXA 4O5UA 5ENUA 4NAXA 5FWGA 3ZFBA 5ID2A 2EIQA 1Z5YE 5ECKB 3C73A 1V98A 2XPDA 5ECHB 4POLA 1PL2A 3SBCA 3NOFA 3R3EA 4PQ1A 4ISDA 3FZ9A 3CSIA 1EZKA 2VCTA 4ID0A 1TTZA 2DSAA 2R0GA 3LSZA 2B1LA 3HKRA 5LD0A 1HYUA 5H5RA 4PX1A 5G5FA 2LNSA 4IQAA 5H5SA 2VD0A 3Q19A 4AF2A 2IPAA 3FZ5A 4GCIA 4YQUA 3IHQA 1PN9A 4FIWA 4MPGA 4EDZA 2CX4A 1NM3A 3GKXA 3P8WA 3TJFA 4V1Ap 1YKCA 1A2JA 1U87A 4N11A 3WGXA 2A2RA 2IFQA 1F37A 1JHBA 4NWYA 1T4YA 3QAGA 1R5AA 3HZ8A 1EV9A 4GSNA 3QFAC 1FW1A 1XG8A 7GSSA 1O85A 1UC7A 1EEMA 1QGVA 4YAVA 5DAKB 4PUAA 3UJ1A 4MF5A 4DSQA 4BVYB 2GSRA 4OMVA 2K8SA 3DXBA 4HEA2 1FHEA 5INYA 3FR9A 4POMA 4HZ2A 4JRRA 2KUCA 4K6XA 2HRFA 1O8XA 2DLXA 2I3YA 3ZFLA 1EOHA 1SL0B 2NBSA 2VLVA 2JZSA 5GZZB 5LCZA 3ZVJD 2LJRA 2M72A 2P5RA 1V2AA 3ZL5A 4NXIA 1M99A 4BVXA 1WP0A 1OE8A 1THXA 1TJDA 1AXDA 2GS3A 4ZL9A 4WEYA 1SL2B 2CVKA 2JZRA 2QA1A 2FGXA 4TXOA 2HZEA 3QFBC 3FHKA 3I9V2 2GZZA 1TDIA 12GSA 1ERUA 2B1KA 1HD2A 2ZUPA 5A5KA 1FAAA 1CQHA 4MABA 1OKDA 2CZ3A 2H1DA 5KEJA 2X64A 1GUKA 3KGKA 3DD3A 3TGZA 3UVTA 4I5QA 2FWHA 5LNKe 1Y6EA 5ECLB 2HI7A 3EINA 2H70A 1Q98A 3LW9A 1KNGA 4CY6A 2KOKA 2H74A 3DKSA 2J23A 2FWEA 5DVBA 4WETA 3GX8A 1SENA 4OD7A 1FVKA 2H1GA 1M3JA 3I69A 4KW6A 2JU5A 2O7KA 1T1VA 3PINA 1B4QA 3OR5A 4KGIA 1FB6A 4K5RA 4Q5NA 1BJXA 2OA7A 3FRCA 2OBIA 3WT1A 3HD5A 2IMDA 3AY8A 2I9HA 4AJ7A 2VOCA 4RQXA 1ML6A 5D9TA 2OE0A 1XCCA 1SJZA 4G0KA 4TR1B 1X9MB 2WULA 4N0VA 3S9FA 3L4NA 3ERWA 4MJAA 3QDNA 5HFKA 4HJ2A 2DJ2A 4IVFA 1A23A 3HVNA 3DVWA 5FHIA 2DMLA 2NVLA 3F6DA 4GTUA 5CAXA 1AQWA 3BCIA 3W8JA 1ZL9A 3IBHA 4P3YB 1YEXA 3GA4A 4OCFA 3M9KA 1GRXA 3IC4A 3D4MA 1XZOA 5E4WA 2C3NA 4XTSA 4EDYA 4FYBA 3UL3A 5ID2B 2GT5A 3A2WA 3RHCA 3I43A 3EMXA 3EPTA 22GSA 2H0IA 5J9BA 3GN3A 3FZ4A 2X99A 1QMVA 2H73A 2CV4A 1AIUA 2C4JA 4ZXGA 4F0CA 5ELGA 2VUPA 4POBA 3TRQA 4XHMA 1T8EB 4O7HA 3RDWA 1VRSD 3GKKA 1V58A 2TIRA 2AUVA 1F6MC 5G5EA 1I5GA 1QK8A 3GX0A 1HNAA 1OE7A 1XPVA 2L5OA 3TKQA 2L5LA 3APOA 5IMVA 3A2VA 1SU9A 3EU4A 4Q5RA 3GL3A 4WR5A 4KA0A 1B9XC 3ZIVA 1S3DA 1OC8A 4I2UA 1A2MA 2R2JA 2R6KA 1X5DA 2IIYA 4H86A 3LYPA 5CYYA 1R4WA 3A2XA 5DCHA 1X5CA 2DIYA 1X5EA 1ILOA 1F3AA 3G7YA 4PGTA 2WDUA 6GSWA 3C7MA 1FO5A 1IYHA 3BOAA 3FR3A 1AUCA 5BRTA 1E2YA 5A4VA 4IELA 2FHEA 5GAPD 4D73B 1XWBA 2VL9A 3ERGA 2OE1A 2H1BA 1K0OA 1DSBA 1ZCPA 2M46A 2DJJA 5KN0A 4JZQA 1JZRA 3IAM2 2HSMA 1EV4A 1MDJA 1ST9A 1OC9A 5DAKA 3GSSA 4TOPA 3H79A 2EC4A 1AQVA 4G0LA 2NTOA 4BVYA 4ZB8A 2K8VA 3UVHA 3MNGA 2L57A 4MZBA 2LRTA 1A2LA 1K0NA 4HZ4A 3ZMLA 2OE3A 3O76A 2L59A 4BVXB 5F06A 1R5PA 4V2LA 1JZOA 5AIXA 2HSYA 2B6MA 4EE0A 4PXOA 3H8QA 3QAWA 1PA3A 2HZEB 2NPBA 1WOUA 1G0TA 1ERWA 2L6DA 2QSIA 1SYXA 3KMOA 2LJAA 3US3A 1X9SB 1TKDB 1BEDA 1V9WA 2L6CA 2LNTA 4EKZA 4HU9A 2V6KA 2E2GA 2R0CA 4GF0A 2IN3A 1VF3A 1YF0A 1S3RA 4LMWA 4PNFA 1KTEA 5CO3A 2P0GA 4WBJA 1XWAA 1SKSB 6GSSA 1Z7PA 4DSSA 5J41A 5ECQB 1K3YA 17GSA 2HSHA 1U88A 3PR8A 2PVQA 4J2FA 1MDIA 3IC8A 4PQIA 3NIVA 2HRKA 4BPYA 1RW1A 4LL1B 1YQ1A 5D8IA 5FT3A 2YWOA 1PKZA 3D4TA 1WJKA 2C0FA 4TXVA 3H1NA 2LEGA 1O81A 4WF5A 2OBKA 2VCQA 1YJ6A 3GH6A 2GSTA 1ACVA 4MP4A 2MMNA 1AQXA 4L0WA 4Q5FA 1GL8A 2YNXA 1M7TA 2FUG2 1BG5A 3CRUA 2H19A 4GRFA 1IYIA 3EYTA 3F4SA 5L71A 2LS5A 1A0RP 3IPZA 5ECMB 2YWMA 4IP6A 3GTUA 4F82A 1CQGA 2OJLA 4MMMA 4TR1A 4K7NA 4IGJA 3SWLA 4DEJA 2LSTA 4LMVA 1B4PA 1H75A 1FG4A 1XVWA 3PPUA 1PFOA 2LV3A 1F2EA 1RQMA 4ZIJA 3U5RE 4X43A 1HNBA 3DWVA 1GLQA 4ILFA 1O8WA 1TRVA 4ZL8A 3J7Yk 1XBSA 4AGSA 1Y25A 2H75A 4XS1A 3VI7A 5B6NA 13GSA 4Z2TA 4G10A 1J9BA 1XXUA 2OADA 3O3TA 1X0RA 3IAS2 1WE0A 3HYPA 3L9UA 3GSTA 1MD4A 2JSYA 2VCXA 4MA9A 3L9VA 1WPIA 1TK0B 2JZTA 1XW5A 2F8AA 4HU7A 4PTSA 5D9WA 4GWRA 4ZB9A 2H8LA 1XIYA 2ALBA 1JZDA 1U3AA 1RK4A 3UEMA 1SK1A 2O8VB 4ECBA 1ZYQB 3G7IA 1UN2A 4MDCA 2E7PA 2I4AA 4IJ3A 20GSA 1PX7A 3VWXA 4WF4A 4ICYA 4TR4A 4MF6A 3CTGA 2C0EA 3TJJA 4ECIA 1XFLA 4GSTA 2HYXA 2LQQA 3Q74A 4KCEA 4YQMA 4HQSA 1F3BA 2HRNA 2YJHA 2H71A 2E0QA 3D22A 2DIZA 1MEKA 1USBA 2CVDA 2L4QA 3EMPA 1OC9B 1B9YC 3TJKA 2DBCA 3GRXA 4YAPA 3PGTA 2FA4A 4ML1A 2FCHA 6GSUA 2CAIA 4D73A 3Q18A 3HCZA 3EURA 2JL4A 4OO4A 1T00A 2AV4A 2GLRA 2K18A 4RQRA 4J56E 2ON7A 18GSA 3GFKA 2XPEA 3FYGA 3LG6A 1WIKA 1X9WB 1FOVA 5F07A 3RHBA 3HJOA 1ZOFA 2HZFA 1PMTA 5A4UA 4TR0A 3UOMA 1O73A 3HVVA 1A0FA 1PSQA 2X8CA 1M2AA 14GSA 2WS2A 3ZYWA 4MK3A 1UA5A 2I1UA 1ZYNA 1K3LA 2VCVA 2VM2A 3TRXA 3C1SA 2BTOT 2A2PA 5IMDA 4DSSB 4LL4B 1TRSA 2H6ZA 2H6YA 1NSWA 2PBJA 3PH9A 3KJYA 4MLYA 2B3SA 2MMOA 1W4VA 2VO4A 3MSZA 4HJMA 2IMIA 2ES7A 1M0UA 4F9ZA 5HFIA 2YV7A 5ECOB 1SKWB 4PQHA 2O89A 2HRAA 2VIMA 4KSMA 3QAVA 4F0BA 2G0FA 3EC3A 2GDRA 4LLRA 3BD2A 4QQ7A 3ZRDA 2QC7A 4EIPA 4IP1A 3QD9A 5C04A 4V2NA 2VLTA 1ZGNA 4G9HA 2AYTA 1VF2A 5D96A 3LYKA 3WT2A 1M9AA 1ERTA 4POKA 2RUEA 5H5QA 1XWKA 4BIKA 2R5GA 2V2GA
chains in the Genus database with same CATH topology
1GSUA 5BMUA 1PQNA 1XVQA 3C1RA 3M8NA 1MTCA 2GZPA 1S3CA 3GTUB 3J7Yb 4Z7XA 2FLSA 5D93A 3DVXA 5CRHA 3FZAA 4HOJA 5IMCA 4NV2A 3BJ5A 5IIZA 3VPTA 3CYNA 4KF9A 4G19A 3RPPA 2K9FA 4EL1A 1E6BA 5A4WA 2LJKA 4XIHA 2GSSA 4MH3A 5JWQB 1GUMA 2MYGA 3ISOA 3FK8A 1K0AA 1TXXA 2C3TA 4WR4A 4XS6A 5G1KA 5J3RA 3TKPA 3KP9A 4EO3A 2K6VA 1K0BA 4IHUA 2LRCA 5ABRA 4ZL7A 3VWUA 1TRWA 2YWNA 5ECPB 4XCSA 5KOXA 3VURA 3FKFA 5CRGA 3HZ4A 2DMMA 2VL2A 3LWAA 4OO5A 3GV1A 2PN8A 3VK9A 2IWTA 1XWGA 1YY7A 2FWGA 4JR6A 5KN1A 2PMTA 1U6TA 4PNGA 3KM6A 1QFNA 1V57A 1KEBA 4IW9A 1QXHA 2UZ8A 2N5AA 3ZVJA 2C8UA 2H30A 5J4UA 4NV5A 3TJBA 1A8YA 2WFCA 5AISA 3F4RA 1MD3A 3IV4A 3HY2A 2O87A 1FB0A 3EU3A 5DALB 1ZZYA 2LTKA 4ML6A 2LRNA 3KEBA 2LQOA 3HJPA 4GSSA 4L8EA 2AJQB 3FW2A 1S3AA 4EVMA 4KCAA 1WRYA 3GKNA 2YANA 3QMXA 3Q6OA 2MBTA 3IK7A 1UVZA 4FYUA 1Z3EA 2WRTA 1WWJA 4ECCA 1O6JA 3IR4A 2JACA 1SJIA 3LXTA 1DE2A 3UIWA 4CW9A 1FOHA 2WJUA 4A5PA 4K0GA 5CREA 1BYEA 1ABAA 1T4ZA 3IOSA 3VFIA 1ZMAA 2G2QA 1EP8A 4O5RA 5J5NA 1V40A 2D2ZA 3P90A 6GSVA 3HVXA 3HXSA 4IS0A 4L0UA 1G6YA 2A4HA 2DKHA 3QPMA 3KMNA 3F3RA 4RI6A 2H66A 2VL3A 2H72A 3LXZA 3KTLA 3BBYA 1PKWA 3UMAA 2KHPA 2H1AA 1B8XA 2B5YA 1HQOA 3ME8A 1OYJA 1EP7A 5ELAA 1EEJA 2I81A 4JU5A 3UBKA 2V41A 2F9SA 2CT6A 4NPBA 3TJGA 1DUGA 2ZNMA 3DRNA 3F0IA 4IKHA 2YJ7A 5IQYA 2B7JA 3TKSA 2DKIA 3EVIA 3KIJA 5DQYA 3ZZXA 5EPFA 4EXJA 4MPFA 1GLPA 1TI1A 4TKYA 2GZYA 3KTBA 5AIVA 2VAFA 5JWRB 4TW5A 2C1YA 2VM1A 3RBTA 5GSTA 2CZ2A 6GSTA 1TK8B 3DEXA 2AHEA 3IDVA 2P5QA 3R2QA 4I97A 1TU8A 3P7XA 4K7IA 2DJ0A 4PURA 4MNNA 1GP1A 1TI3A 2CA8A 4GQCA 1PL1A 1TOFA 4V1Ag 3MYDA 16GSA 1A24A 1EGRA 1YEPA 4ZBDA 2LUSA 2HNLA 5B6MA 1ERVA 2FWFA 2YV9A 2RM5A 3D5JA 3FY7A 5C00A 3IRAA 2MZCA 1THOA 2RUFA 2HT9A 1F9MA 3APQA 2C0DA 1ZYPA 3MDKA 2F51A 3O6TA 4Q5QA 2PVOC 2R0PA 2IL3A 1NHOA 5COHA 1Z9HA 4GXZA 3VLNA 3TB2A 2ON5A 3ZTLA 5B7CA 4RI7A 4NMUA 4BL7A 1GSYA 1XW6A 3VWWA 1G7EA 5IO0A 4KH7A 3TUEA 3GKMA 2A2SA 4GQFA 1SK2A 1URMA 1GULA 1GTUA 1LBKA 2MMAA 2VLUA 1BAYA 3ZIJA 3W8SA 2MMZA 1J0FA 2HXKA 3D0ZA 3GH9A 3HVSA 3GUSA 3WYWA 1BQ7A 3KZQA 2CX3A 4G0IA 2YOIA 3GNJA 4KNDA 4FH8A 4XRDA 1DE1A 3TKRA 1EOGA 6GSXA 5IM9A 1OKTA 2YP6A 4YKFA 2EIOA 4XRAA 4KAEA 1OC3A 3ZREA 5JCWA 5G1LA 3GMFA 5HR2A 2E2MA 3WGDA 3E9JB 3ZMKA 3CMIA 1FVJA 3KH7A 5GSSA 2Z9SA 2MBSA 5ECNB 2X4AA 4K9ZA 5DJMA 5DALA 3IA1A 2HE3A 2CQ9A 4X0XA 4ACSA 2HFDA 2C3QA 4JE1A 2XC2A 1N2AA 4OFNA 3IE3A 5HR3A 3QCPA 1QUWA 3MIXA 2PU9C 3C8EA 3F8UA 2WZ9A 2QKEA 4X1UA 1JFUA 4OCEA 3RAZA 1YKAA 3WD6A 3KXOA 1SD8A 3GURA 4J57E 3MWHA 4MF7A 2YCDA 3JCML 1JZWA 3CTFA 1TU7A 1SYRA 1Q4JA 4WBRD 3N5OA 4HS1A 2IMEA 1O7UA 2YZUA 3D6IA 4ZBBA 2PWJA 4Z2RA 5F0GA 2OKAA 3ED3A 4JR4A 2TRXA 2AB6A 3NZNA 3IHGA 1G6WA 2GT6A 1GNWA 4L5OA 3CBUA 2GSQA 1DBYA 2ZCTA 4MH2A 5DCGA 3G7JA 3UAPA 1SL1B 5JCUA 1K3OA 1T3BA 2GVPA 2YPMA 2IMFA 4OWYA 4V2MA 2LKUA 1XWCA 2X49A 4BA7A 1JLWA 2RIIA 5D9VA 3LJRA 4NHWA 2R3XA 4QL7A 1NHYA 3G9BA 4KE3A 10GSA 1PGTA 4RUVA 4HDEA 2TRCP 5DJLA 1GUHA 5HR0A 1Z6NA 2PUKC 5D73A 1K0DA 3LQ7A 4O92A 5ECIB 3EWLA 1NW2A 2B5EA 2C0GA 2V32A 4WKWA 1VGLA 4YKGA 2V6OA 1LJRA 5F05A 2AAWA 3TOUA 4I8BA 2N5FA 1SJ6A 5DDLA 4CHSA 3U6VA 2B5XA 1H4OA 3A3TA 4ZBAA 4F2IA 3F3QA 4OFMA 4K1FA 2XHFA 1N8JA 5ECRB 5IOWA 5B8AA 5IMFA 4DVCA 1R26A 4G2EA 1GH2A 2PGTA 2F3MA 4O5QA 1GTAA 2OACA 4MZCA 1J08A 3HDCA 1QQ2A 4TRXA 4XS4B 2BMXA 2KLXA 5HQPA 4JEDA 3TKSE 1GSSA 2H6XA 4IJIA 9GSSA 4EIQA 4E8HA 3KP8A 4LA1A 3VPQA 3K8NA 1T7PB 3LORA 3LFLA 1PN0A 2L4CA 5IPHA 1AAZA 4CDOA 1TK5B 2FNOA 3ZLPA 4EF0A 5DBQA 3GL5A 1I9DA 2C80A 4BL7B 3VI5A 3L0HA 4TR3A 1GTIA 2NDOA 4AJ8A 5EVOA 2WB9A 4K5SA 2YWIA 1BX9A 1M9BA 1OVNA 2V1MA 2J9HA 5G30A 3H93A 1JLVA 4I2TA 4CY8A 2P31A 3A5IA 4HUAA 4K7OA 2JADA 5F8BA 2O85A 2WGRA 5GAND 2REMA 2N5BA 4EC0A 3F9UA 5IPGA 4N10A 2FA8A 4DSRA 1WMJA 4KUNA 4K2DA 3N9JA 4Z2UA 5KN3A 4TVEA 11GSA 4JBBA 2VL2C 4N0ZA 5D9XA 2GTUA 1R7HA 3ZITA 4KDUA 5G2ZA 2GQKA 3L9SA 3HA9A 3LEFA 3ME7A 4YQVA 4KSOA 4MJCA 3VWVA 1XOBA 1PD21 2GQMA 1A8LA 4FO5A 2RLIA 5CRDA 4ZILA 5IMZA 3EE2A 4FYCA 1XW9A 2IMKA 4IN0A 5JWOB 4EUYA 2M80A 1TP9A 1EGOA 5IO2A 2IFQB 1EWXA 2DJ3A 3GHAA 3GIXA 1MDKA 5IOXA 2GGTA 3IXRA 2DJKA 2HLSA 2QGVA 3DGQA 4BWQA 4KX4A 3A5WA 2FY6A 3APSA 3V1WA 1GSFA 3RPNA 4N30A 2YN1A 3F6FA 3IK9A 2CAQA 3KD0A 2RM6A 5HFGA 2BJXA 5IMAA 5KOWA 3E3EA 4O32A 4X4JA 1GSEA 3CSJA 1VF1A 3L78A 2DC5A 3TDGA 2GQLA 4L5LA 3TOTA 3MAKA 2WCIA 3F4TA 1B48A 2A4VA 1SK0A 3FMWA 4I6XA 3M1GA 1AC1A 1M2DA 4USSA 2H01A 2DJ1A 3DYRA 5E59A 4K0NA 4ECJA 4FQUA 2H76A 1GTBA 4TXOB 1YDKA 4ULXA 2PPTA 1K0CA 8GSSA 1GWCA 4MJEA 2PERA 4HQZA 2KP2A 4E8EA 4MZWA 1HNCA 1K0MA 4K2XA 4GLTA 3BCKA 4K8MA 2R4VA 3M3MA 3UARA 3H4KA 2R37A 1U3IA 2KP1A 5CNWA 4KDYA 5DQSA 1ON4A 1VF4A 4PUFC 3P2AA 3CXGA 5CP1A 3DMLA 3KCMA 4BWSA 5AN1A 1XOAA 3E0UA 4OFTA 3TKSC 2CVBA 5EL8A 1SD9A 3M9JA 4TN8A 1TW9A 2YZHA 3DIEA 1YF1A 1M2BA 2XBIA 6GSYA 3D21A 2H0HA 5G31A 3LGCA 3CRTA 5HR1A 3F63A 5AGYA 2H0GA 4IBPA 2EIRA 4AJ6A 4WXTA 4XS4A 1PX6A 2X8HA 3HHVA 4IQ1A 5ECSA 2IJYA 1TRUA 1GNEA 4KB3A 3QR6A 3WGEA 4QL9A 4ZB6A 5JCGA 2QA2A 5EY6A 3HJMA 1KBNA 1LU4A 2VCZA 3ERFA 4YH2A 5B8BA 4MCUA 2XBQA 1AW9A 1GSQA 4NHZA 1ZYEA 3KH9A 4MJBA 3W6GA 3I6AA 3C71A 3FR6A 3CSHA 2B7KA 5KN2A 3QOUA 1Z6MA 2X8GA 1GSDA 2F8FA 1C72A 5CRWA 2VCWA 3FEUA 3GYKA 3TCOA 1OAZA 19GSA 1W89A 4HI7A 2JSZA 1G7OA 1YZXA 1Z7RA 2FD3A 1SKRB 4KDXA 3M0FA 3TRPA 2VD1A 3UBLA 5J9CA 4F03A 1PRXA 4O5UA 5ENUA 4NAXA 5FWGA 3ZFBA 5ID2A 2EIQA 1Z5YE 5ECKB 3C73A 1V98A 2XPDA 5ECHB 4POLA 1PL2A 3SBCA 3NOFA 3R3EA 4PQ1A 4ISDA 3FZ9A 3CSIA 1EZKA 2VCTA 4ID0A 1TTZA 2DSAA 2R0GA 3LSZA 2B1LA 3HKRA 5LD0A 1HYUA 5H5RA 4PX1A 5G5FA 2LNSA 4IQAA 5H5SA 2VD0A 3Q19A 4AF2A 2IPAA 3FZ5A 4GCIA 4YQUA 3IHQA 1PN9A 4FIWA 4MPGA 4EDZA 2CX4A 1NM3A 3GKXA 3P8WA 3TJFA 4V1Ap 1YKCA 1A2JA 1U87A 4N11A 3WGXA 2A2RA 2IFQA 1F37A 1JHBA 4NWYA 1T4YA 3QAGA 1R5AA 3HZ8A 1EV9A 4GSNA 3QFAC 1FW1A 7GSSA 1O85A 1UC7A 1EEMA 1QGVA 4YAVA 5DAKB 4PUAA 3UJ1A 4MF5A 4DSQA 4BVYB 2GSRA 4OMVA 2K8SA 3DXBA 4HEA2 1FHEA 5INYA 3FR9A 4POMA 4HZ2A 4JRRA 2KUCA 4K6XA 2HRFA 1O8XA 2DLXA 2I3YA 3ZFLA 1EOHA 1SL0B 2NBSA 2VLVA 2JZSA 5GZZB 5LCZA 3ZVJD 2LJRA 2M72A 2P5RA 1V2AA 3ZL5A 4NXIA 1M99A 4BVXA 1WP0A 1OE8A 1THXA 1TJDA 1AXDA 2GS3A 4ZL9A 4WEYA 1SL2B 2CVKA 2JZRA 2QA1A 2FGXA 4TXOA 2HZEA 3QFBC 3FHKA 3I9V2 2GZZA 1TDIA 12GSA 1ERUA 2B1KA 1HD2A 2ZUPA 5A5KA 1FAAA 1CQHA 4MABA 1OKDA 2CZ3A 2H1DA 5KEJA 2X64A 1GUKA 3KGKA 3DD3A 3TGZA 3UVTA 4I5QA 2FWHA 5LNKe 1Y6EA 5ECLB 2HI7A 3EINA 2H70A 1Q98A 3LW9A 1KNGA 4CY6A 2KOKA 2H74A 3DKSA 2J23A 2FWEA 5DVBA 4WETA 3GX8A 1SENA 4OD7A 1FVKA 2H1GA 3I69A 4KW6A 2JU5A 2O7KA 1T1VA 3PINA 1B4QA 3OR5A 4KGIA 1FB6A 4K5RA 4Q5NA 1BJXA 2OA7A 3FRCA 2OBIA 3WT1A 3HD5A 2IMDA 3AY8A 2I9HA 4AJ7A 2VOCA 4RQXA 1ML6A 5D9TA 2OE0A 1XCCA 1SJZA 4G0KA 4TR1B 1X9MB 2WULA 4N0VA 3S9FA 3L4NA 3ERWA 4MJAA 3QDNA 5HFKA 4HJ2A 2DJ2A 4IVFA 1A23A 3DVWA 5FHIA 2DMLA 2NVLA 3F6DA 4GTUA 5CAXA 1AQWA 3BCIA 3W8JA 1ZL9A 3IBHA 4P3YB 1YEXA 3GA4A 4OCFA 3M9KA 1GRXA 3IC4A 3D4MA 1XZOA 5E4WA 2C3NA 4XTSA 4EDYA 4FYBA 3UL3A 5ID2B 2GT5A 3A2WA 3RHCA 3I43A 3EMXA 3EPTA 22GSA 2H0IA 5J9BA 3GN3A 3FZ4A 2X99A 1QMVA 2H73A 2CV4A 1AIUA 2C4JA 4ZXGA 4F0CA 5ELGA 2VUPA 4POBA 3TRQA 4XHMA 1T8EB 4O7HA 3RDWA 1VRSD 3GKKA 1V58A 2TIRA 2AUVA 1F6MC 5G5EA 1I5GA 1QK8A 3GX0A 1HNAA 1OE7A 1XPVA 2L5OA 3TKQA 2L5LA 3APOA 5IMVA 3A2VA 1SU9A 3EU4A 4Q5RA 3GL3A 4WR5A 4KA0A 1B9XC 3ZIVA 1S3DA 1OC8A 4I2UA 1A2MA 2R2JA 2R6KA 1X5DA 2IIYA 4H86A 3LYPA 5CYYA 1R4WA 3A2XA 5DCHA 1X5CA 2DIYA 1X5EA 1ILOA 1F3AA 3G7YA 4PGTA 2WDUA 6GSWA 3C7MA 1FO5A 1IYHA 3BOAA 3FR3A 1AUCA 5BRTA 1E2YA 5A4VA 4IELA 2FHEA 5GAPD 4D73B 1XWBA 2VL9A 3ERGA 2OE1A 2H1BA 1K0OA 1DSBA 1ZCPA 2M46A 2DJJA 5KN0A 4JZQA 1JZRA 3IAM2 2HSMA 1EV4A 1MDJA 1ST9A 1OC9A 5DAKA 3GSSA 4TOPA 3H79A 2EC4A 1AQVA 4G0LA 2NTOA 4BVYA 4ZB8A 2K8VA 3UVHA 3MNGA 2L57A 4MZBA 2LRTA 1A2LA 1K0NA 4HZ4A 3ZMLA 2OE3A 3O76A 2L59A 4BVXB 5F06A 1R5PA 4V2LA 1JZOA 5AIXA 2HSYA 2B6MA 4EE0A 4PXOA 3H8QA 3QAWA 1PA3A 2HZEB 2NPBA 1WOUA 1G0TA 1ERWA 2L6DA 2QSIA 1SYXA 3KMOA 2LJAA 3US3A 1X9SB 1TKDB 1BEDA 1V9WA 2L6CA 2LNTA 4EKZA 4HU9A 2V6KA 2E2GA 2R0CA 4GF0A 2IN3A 1VF3A 1YF0A 4LMWA 4PNFA 1KTEA 5CO3A 2P0GA 4WBJA 1XWAA 1SKSB 6GSSA 1Z7PA 4DSSA 5J41A 5ECQB 1K3YA 17GSA 2HSHA 1U88A 3PR8A 2PVQA 4J2FA 1MDIA 3IC8A 4PQIA 3NIVA 2HRKA 4BPYA 1RW1A 4LL1B 1YQ1A 5D8IA 5FT3A 2YWOA 1PKZA 3D4TA 1WJKA 2C0FA 4TXVA 3H1NA 2LEGA 1O81A 4WF5A 2OBKA 2VCQA 1YJ6A 3GH6A 2GSTA 1ACVA 4MP4A 2MMNA 1AQXA 4L0WA 4Q5FA 1GL8A 2YNXA 1M7TA 2FUG2 1BG5A 3CRUA 2H19A 4GRFA 1IYIA 3EYTA 3F4SA 5L71A 2LS5A 1A0RP 3IPZA 5ECMB 2YWMA 4IP6A 3GTUA 4F82A 1CQGA 2OJLA 4MMMA 4TR1A 4K7NA 4IGJA 3SWLA 4DEJA 2LSTA 4LMVA 1B4PA 1H75A 1FG4A 1XVWA 3PPUA 2LV3A 1F2EA 1RQMA 4ZIJA 3U5RE 4X43A 1HNBA 3DWVA 1GLQA 4ILFA 1O8WA 1TRVA 4ZL8A 3J7Yk 1XBSA 4AGSA 1Y25A 2H75A 4XS1A 3VI7A 5B6NA 13GSA 4Z2TA 4G10A 1J9BA 1XXUA 2OADA 3O3TA 1X0RA 3IAS2 1WE0A 3HYPA 3L9UA 3GSTA 1MD4A 2JSYA 2VCXA 4MA9A 3L9VA 1WPIA 1TK0B 2JZTA 1XW5A 2F8AA 4HU7A 4PTSA 5D9WA 4GWRA 4ZB9A 2H8LA 1XIYA 2ALBA 1JZDA 1U3AA 1RK4A 3UEMA 1SK1A 2O8VB 4ECBA 1ZYQB 3G7IA 1UN2A 4MDCA 2E7PA 2I4AA 4IJ3A 20GSA 1PX7A 3VWXA 4WF4A 4ICYA 4TR4A 4MF6A 3CTGA 2C0EA 3TJJA 4ECIA 1XFLA 4GSTA 2HYXA 2LQQA 3Q74A 4KCEA 4YQMA 4HQSA 1F3BA 2HRNA 2YJHA 2H71A 2E0QA 3D22A 2DIZA 1MEKA 1USBA 2CVDA 2L4QA 3EMPA 1OC9B 1B9YC 3TJKA 2DBCA 3GRXA 4YAPA 3PGTA 2FA4A 4ML1A 2FCHA 6GSUA 2CAIA 4D73A 3Q18A 3HCZA 3EURA 2JL4A 4OO4A 1T00A 2AV4A 2GLRA 2K18A 4RQRA 4J56E 2ON7A 18GSA 3GFKA 2XPEA 3FYGA 3LG6A 1WIKA 1X9WB 1FOVA 5F07A 3RHBA 3HJOA 1ZOFA 2HZFA 1PMTA 5A4UA 4TR0A 3UOMA 1O73A 3HVVA 1A0FA 1PSQA 2X8CA 1M2AA 14GSA 2WS2A 3ZYWA 4MK3A 1UA5A 2I1UA 1ZYNA 1K3LA 2VCVA 2VM2A 3TRXA 3C1SA 2BTOT 2A2PA 5IMDA 4DSSB 4LL4B 1TRSA 2H6ZA 2H6YA 1NSWA 2PBJA 3PH9A 3KJYA 4MLYA 2B3SA 2MMOA 1W4VA 2VO4A 3MSZA 4HJMA 2IMIA 2ES7A 1M0UA 4F9ZA 5HFIA 2YV7A 5ECOB 1SKWB 4PQHA 2O89A 2HRAA 2VIMA 4KSMA 3QAVA 4F0BA 2G0FA 3EC3A 2GDRA 4LLRA 3BD2A 4QQ7A 3ZRDA 2QC7A 4EIPA 4IP1A 3QD9A 5C04A 4V2NA 2VLTA 1ZGNA 4G9HA 2AYTA 1VF2A 5D96A 3LYKA 3WT2A 1M9AA 1ERTA 4POKA 2RUEA 5H5QA 1XWKA 2R5GA 2V2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSU A;  1PQN A;  1XVQ A;  3C1R A;  3M8N A;  1MTC A;  2GZP A;  1S3C A;  3GTU B;  3J7Y b;  4Z7X A;  2FLS A;  5D93 A;  3DVX A;  5CRH A;  3FZA A;  4HOJ A;  5IMC A;  4NV2 A;  3BJ5 A;  5IIZ A;  3VPT A;  3CYN A;  4G19 A;  3RPP A;  2K9F A;  4EL1 A;  1E6B A;  5A4W A;  2LJK A;  4XIH A;  2GSS A;  4MH3 A;  5JWQ B;  1GUM A;  2MYG A;  3ISO A;  3FK8 A;  1K0A A;  1TXX A;  2C3T A;  4WR4 A;  4XS6 A;  5G1K A;  5J3R A;  3TKP A;  3KP9 A;  4EO3 A;  2K6V A;  1K0B A;  4IHU A;  2LRC A;  5ABR A;  4ZL7 A;  3VWU A;  1TRW A;  2YWN A;  5ECP B;  4XCS A;  3VUR A;  3FKF A;  5CRG A;  3HZ4 A;  2DMM A;  2VL2 A;  3LWA A;  4OO5 A;  3GV1 A;  2PN8 A;  3VK9 A;  2IWT A;  1XWG A;  1YY7 A;  2FWG A;  4JR6 A;  5KN1 A;  2PMT A;  1U6T A;  4PNG A;  3KM6 A;  1QFN A;  1V57 A;  1KEB A;  4IW9 A;  1QXH A;  3ZVJ A;  2N5A A;  2C8U A;  2H30 A;  5J4U A;  4NV5 A;  3TJB A;  1A8Y A;  2WFC A;  5AIS A;  3F4R A;  1MD3 A;  3IV4 A;  3HY2 A;  2O87 A;  1FB0 A;  3EU3 A;  5DAL B;  1ZZY A;  2LTK A;  4ML6 A;  2LRN A;  3KEB A;  2LQO A;  3HJP A;  4GSS A;  4L8E A;  2AJQ B;  3FW2 A;  1S3A A;  4EVM A;  4KCA A;  1WRY A;  3GKN A;  2YAN A;  3QMX A;  3Q6O A;  2MBT A;  3IK7 A;  1UVZ A;  4FYU A;  1Z3E A;  2WRT A;  1WWJ A;  4ECC A;  1O6J A;  3IR4 A;  2JAC A;  1SJI A;  3LXT A;  1DE2 A;  3UIW A;  4CW9 A;  2WJU A;  4K0G A;  5CRE A;  1BYE A;  1ABA A;  1T4Z A;  3IOS A;  3VFI A;  1ZMA A;  2G2Q A;  1EP8 A;  4O5R A;  5J5N A;  1V40 A;  2D2Z A;  3P90 A;  6GSV A;  3HVX A;  3HXS A;  4IS0 A;  4L0U A;  1G6Y A;  3QPM A;  3KMN A;  3F3R A;  4RI6 A;  2H66 A;  2VL3 A;  2H72 A;  3LXZ A;  3KTL A;  3BBY A;  1PKW A;  3UMA A;  2KHP A;  2H1A A;  1B8X A;  2B5Y A;  1HQO A;  3ME8 A;  1OYJ A;  1EP7 A;  5ELA A;  1EEJ A;  2I81 A;  4JU5 A;  3UBK A;  2V41 A;  2F9S A;  2CT6 A;  4NPB A;  3TJG A;  1DUG A;  2ZNM A;  3DRN A;  3F0I A;  4IKH A;  2YJ7 A;  5IQY A;  2B7J A;  3TKS A;  3EVI A;  3KIJ A;  5DQY A;  3ZZX A;  5EPF A;  4EXJ A;  4MPF A;  1GLP A;  1TI1 A;  4TKY A;  2GZY A;  3KTB A;  5AIV A;  2VAF A;  5JWR B;  4TW5 A;  2C1Y A;  2VM1 A;  3RBT A;  5GST A;  2CZ2 A;  6GST A;  1TK8 B;  3DEX A;  2AHE A;  3IDV A;  2P5Q A;  3R2Q A;  4I97 A;  1TU8 A;  3P7X A;  4K7I A;  2DJ0 A;  4PUR A;  1GP1 A;  1TI3 A;  2CA8 A;  4GQC A;  1PL1 A;  1TOF A;  4V1A g;  16GS A;  1A24 A;  1EGR A;  1YEP A;  4ZBD A;  2LUS A;  2HNL A;  5B6M A;  1ERV A;  2FWF A;  2YV9 A;  2RM5 A;  3D5J A;  3FY7 A;  5C00 A;  3IRA A;  2MZC A;  1THO A;  2RUF A;  2HT9 A;  1F9M A;  3APQ A;  2C0D A;  3MDK A;  2F51 A;  3O6T A;  4Q5Q A;  2PVO C;  2IL3 A;  1NHO A;  5COH A;  1Z9H A;  4GXZ A;  3VLN A;  3TB2 A;  2ON5 A;  3ZTL A;  5B7C A;  4RI7 A;  4NMU A;  4BL7 A;  1GSY A;  1XW6 A;  3VWW A;  1G7E A;  5IO0 A;  4KH7 A;  3TUE A;  3GKM A;  2A2S A;  4GQF A;  1SK2 A;  1URM A;  1GUL A;  1GTU A;  1LBK A;  2MMA A;  2VLU A;  1BAY A;  3ZIJ A;  3W8S A;  2MMZ A;  1J0F A;  2HXK A;  3D0Z A;  3GH9 A;  3HVS A;  3GUS A;  3WYW A;  1BQ7 A;  3KZQ A;  2CX3 A;  2YOI A;  3GNJ A;  4KND A;  4FH8 A;  4XRD A;  1DE1 A;  3TKR A;  1EOG A;  6GSX A;  5IM9 A;  1OKT A;  2YP6 A;  2EIO A;  4XRA A;  4KAE A;  1OC3 A;  3ZRE A;  5JCW A;  5G1L A;  3GMF A;  5HR2 A;  2E2M A;  3WGD A;  3E9J B;  3ZMK A;  3CMI A;  1FVJ A;  3KH7 A;  5GSS A;  2Z9S A;  2MBS A;  5ECN B;  4K9Z A;  5DJM A;  5DAL A;  3IA1 A;  2HE3 A;  2CQ9 A;  4X0X A;  4ACS A;  2HFD A;  2C3Q A;  4JE1 A;  2XC2 A;  1N2A A;  4OFN A;  3IE3 A;  5HR3 A;  3QCP A;  1QUW A;  2PU9 C;  3C8E A;  3F8U A;  2WZ9 A;  2QKE A;  4X1U A;  1JFU A;  4OCE A;  3RAZ A;  1YKA A;  3WD6 A;  3KXO A;  1SD8 A;  3GUR A;  4J57 E;  3MWH A;  4MF7 A;  2YCD A;  3JCM L;  1JZW A;  3CTF A;  1TU7 A;  1SYR A;  1Q4J A;  4WBR D;  3N5O A;  4HS1 A;  2IME A;  1O7U A;  2YZU A;  3D6I A;  4ZBB A;  2PWJ A;  5F0G A;  2OKA A;  3ED3 A;  4JR4 A;  2TRX A;  2AB6 A;  3NZN A;  1G6W A;  2GT6 A;  1GNW A;  4L5O A;  3CBU A;  2GSQ A;  1DBY A;  2ZCT A;  4MH2 A;  5DCG A;  3G7J A;  3UAP A;  1SL1 B;  5JCU A;  1K3O A;  1T3B A;  2GVP A;  2YPM A;  2IMF A;  4OWY A;  4V2M A;  2LKU A;  1XWC A;  4BA7 A;  1JLW A;  2RII A;  5D9V A;  3LJR A;  4NHW A;  2R3X A;  4QL7 A;  1NHY A;  3G9B A;  4KE3 A;  10GS A;  1PGT A;  4RUV A;  4HDE A;  2TRC P;  5DJL A;  1GUH A;  5HR0 A;  1Z6N A;  2PUK C;  5D73 A;  1K0D A;  3LQ7 A;  4O92 A;  5ECI B;  3EWL A;  1NW2 A;  2B5E A;  2C0G A;  2V32 A;  4WKW A;  1VGL A;  2V6O A;  1LJR A;  5F05 A;  2AAW A;  3TOU A;  4I8B A;  2N5F A;  1SJ6 A;  5DDL A;  4CHS A;  3U6V A;  2B5X A;  1H4O A;  3A3T A;  4ZBA A;  4F2I A;  3F3Q A;  4OFM A;  4K1F A;  2XHF A;  1N8J A;  5ECR B;  5IOW A;  5B8A A;  5IMF A;  4DVC A;  1R26 A;  4G2E A;  1GH2 A;  2PGT A;  2F3M A;  1GTA A;  2OAC A;  4MZC A;  1J08 A;  3HDC A;  1QQ2 A;  4TRX A;  4XS4 B;  2BMX A;  2KLX A;  5HQP A;  4JED A;  3TKS E;  1GSS A;  2H6X A;  4IJI A;  9GSS A;  4E8H A;  3KP8 A;  4LA1 A;  3VPQ A;  3K8N A;  1T7P B;  3LOR A;  3LFL A;  2L4C A;  5IPH A;  1AAZ A;  4CDO A;  1TK5 B;  2FNO A;  3ZLP A;  4EF0 A;  5DBQ A;  3GL5 A;  1I9D A;  2C80 A;  3VI5 A;  3L0H A;  4TR3 A;  1GTI A;  2NDO A;  4AJ8 A;  5EVO A;  2WB9 A;  2YWI A;  1BX9 A;  1M9B A;  1OVN A;  2V1M A;  2J9H A;  5G30 A;  3H93 A;  1JLV A;  4I2T A;  2P31 A;  4HUA A;  4K7O A;  2JAD A;  5F8B A;  2O85 A;  2WGR A;  5GAN D;  2REM A;  2N5B A;  4EC0 A;  3F9U A;  5IPG A;  4N10 A;  2FA8 A;  4DSR A;  1WMJ A;  4KUN A;  4K2D A;  3N9J A;  5KN3 A;  4TVE A;  11GS A;  4JBB A;  2VL2 C;  4N0Z A;  5D9X A;  2GTU A;  1R7H A;  3ZIT A;  4KDU A;  5G2Z A;  2GQK A;  3L9S A;  3HA9 A;  3LEF A;  3ME7 A;  4YQV A;  4KSO A;  4MJC A;  3VWV A;  1XOB A;  1PD2 1;  2GQM A;  1A8L A;  4FO5 A;  2RLI A;  5CRD A;  4ZIL A;  5IMZ A;  3EE2 A;  4FYC A;  1XW9 A;  2IMK A;  4IN0 A;  5JWO B;  4EUY A;  2M80 A;  1TP9 A;  1EGO A;  5IO2 A;  2IFQ B;  1EWX A;  2DJ3 A;  3GHA A;  3GIX A;  1MDK A;  5IOX A;  2GGT A;  3IXR A;  2DJK A;  2HLS A;  2QGV A;  3DGQ A;  4BWQ A;  4KX4 A;  3A5W A;  2FY6 A;  3APS A;  3V1W A;  1GSF A;  3RPN A;  4N30 A;  2YN1 A;  3F6F A;  3IK9 A;  2CAQ A;  3KD0 A;  2RM6 A;  5HFG A;  2BJX A;  5IMA A;  3E3E A;  4O32 A;  1GSE A;  3CSJ A;  1VF1 A;  3L78 A;  2DC5 A;  3TDG A;  2GQL A;  4L5L A;  3TOT A;  3MAK A;  2WCI A;  3F4T A;  1B48 A;  2A4V A;  1SK0 A;  4I6X A;  3M1G A;  1AC1 A;  1M2D A;  2H01 A;  2DJ1 A;  3DYR A;  5E59 A;  4K0N A;  4ECJ A;  2H76 A;  1GTB A;  4TXO B;  1YDK A;  4ULX A;  2PPT A;  1K0C A;  8GSS A;  1GWC A;  2PER A;  4HQZ A;  4MJE A;  2KP2 A;  4E8E A;  4MZW A;  1HNC A;  1K0M A;  4GLT A;  3BCK A;  4K8M A;  2R4V A;  3M3M A;  3UAR A;  3H4K A;  2R37 A;  1U3I A;  2KP1 A;  5CNW A;  4KDY A;  5DQS A;  1ON4 A;  1VF4 A;  4PUF C;  3P2A A;  3CXG A;  5CP1 A;  3DML A;  3KCM A;  4BWS A;  5AN1 A;  1XOA A;  3E0U A;  4OFT A;  3TKS C;  2CVB A;  5EL8 A;  1SD9 A;  3M9J A;  4TN8 A;  1TW9 A;  2YZH A;  3DIE A;  1YF1 A;  1M2B A;  2XBI A;  6GSY A;  3D21 A;  2H0H A;  5G31 A;  3LGC A;  3CRT A;  5HR1 A;  3F63 A;  5AGY A;  2H0G A;  4IBP A;  2EIR A;  4AJ6 A;  4WXT A;  4XS4 A;  1PX6 A;  2X8H A;  3HHV A;  4IQ1 A;  5ECS A;  2IJY A;  1TRU A;  1GNE A;  4KB3 A;  3QR6 A;  3WGE A;  4QL9 A;  4ZB6 A;  5JCG A;  5EY6 A;  3HJM A;  1KBN A;  1LU4 A;  2VCZ A;  3ERF A;  4YH2 A;  5B8B A;  4MCU A;  2XBQ A;  1AW9 A;  1GSQ A;  4NHZ A;  1ZYE A;  3KH9 A;  4MJB A;  3W6G A;  3I6A A;  3C71 A;  3FR6 A;  3CSH A;  2B7K A;  5KN2 A;  3QOU A;  1Z6M A;  2X8G A;  1GSD A;  2F8F A;  1C72 A;  5CRW A;  2VCW A;  3FEU A;  3GYK A;  3TCO A;  1OAZ A;  19GS A;  1W89 A;  4HI7 A;  2JSZ A;  1G7O A;  1YZX A;  1Z7R A;  2FD3 A;  1SKR B;  4KDX A;  3M0F A;  3TRP A;  2VD1 A;  3UBL A;  5J9C A;  4F03 A;  1PRX A;  5ENU A;  4NAX A;  5FWG A;  3ZFB A;  5ID2 A;  2EIQ A;  1Z5Y E;  5ECK B;  3C73 A;  1V98 A;  2XPD A;  5ECH B;  4POL A;  1PL2 A;  3SBC A;  3NOF A;  4PQ1 A;  4ISD A;  3FZ9 A;  3CSI A;  1EZK A;  2VCT A;  4ID0 A;  1TTZ A;  2DSA A;  3LSZ A;  2B1L A;  3HKR A;  5LD0 A;  1HYU A;  5H5R A;  4PX1 A;  5G5F A;  2LNS A;  4IQA A;  5H5S A;  2VD0 A;  3Q19 A;  4AF2 A;  2IPA A;  3FZ5 A;  4GCI A;  4YQU A;  3IHQ A;  1PN9 A;  4FIW A;  4MPG A;  4EDZ A;  2CX4 A;  1NM3 A;  3GKX A;  3P8W A;  3TJF A;  4V1A p;  1YKC A;  1A2J A;  1U87 A;  4N11 A;  3WGX A;  2A2R A;  2IFQ A;  1F37 A;  1JHB A;  4NWY A;  1T4Y A;  3QAG A;  1R5A A;  3HZ8 A;  1EV9 A;  4GSN A;  3QFA C;  1FW1 A;  7GSS A;  1O85 A;  1UC7 A;  1EEM A;  1QGV A;  4YAV A;  5DAK B;  4PUA A;  3UJ1 A;  4MF5 A;  4DSQ A;  2GSR A;  4OMV A;  2K8S A;  3DXB A;  4HEA 2;  1FHE A;  5INY A;  3FR9 A;  4POM A;  4HZ2 A;  4JRR A;  2KUC A;  4K6X A;  2HRF A;  1O8X A;  2DLX A;  2I3Y A;  3ZFL A;  1EOH A;  1SL0 B;  2NBS A;  2VLV A;  2JZS A;  5GZZ B;  5LCZ A;  3ZVJ D;  2LJR A;  2M72 A;  2P5R A;  1V2A A;  3ZL5 A;  4NXI A;  1M99 A;  4BVX A;  1WP0 A;  1OE8 A;  1THX A;  1TJD A;  1AXD A;  2GS3 A;  4ZL9 A;  4WEY A;  1SL2 B;  2CVK A;  2JZR A;  2FGX A;  4TXO A;  2HZE A;  3QFB C;  3FHK A;  3I9V 2;  2GZZ A;  1TDI A;  12GS A;  1ERU A;  2B1K A;  1HD2 A;  2ZUP A;  5A5K A;  1FAA A;  1CQH A;  4MAB A;  1OKD A;  2CZ3 A;  2H1D A;  5KEJ A;  2X64 A;  1GUK A;  3KGK A;  3DD3 A;  3TGZ A;  3UVT A;  4I5Q A;  2FWH A;  5LNK e;  1Y6E A;  5ECL B;  2HI7 A;  3EIN A;  2H70 A;  1Q98 A;  1KNG A;  2KOK A;  2H74 A;  3DKS A;  2J23 A;  2FWE A;  5DVB A;  4WET A;  3GX8 A;  1SEN A;  4OD7 A;  1FVK A;  2H1G A;  3I69 A;  4KW6 A;  2JU5 A;  2O7K A;  1T1V A;  3PIN A;  1B4Q A;  3OR5 A;  4KGI A;  1FB6 A;  4Q5N A;  1BJX A;  2OA7 A;  3FRC A;  2OBI A;  3WT1 A;  3HD5 A;  2IMD A;  3AY8 A;  2I9H A;  4AJ7 A;  2VOC A;  4RQX A;  1ML6 A;  5D9T A;  2OE0 A;  1XCC A;  1SJZ A;  1X9M B;  4TR1 B;  2WUL A;  4N0V A;  3S9F A;  3L4N A;  3ERW A;  4MJA A;  3QDN A;  5HFK A;  4HJ2 A;  2DJ2 A;  4IVF A;  1A23 A;  3DVW A;  5FHI A;  2DML A;  2NVL A;  3F6D A;  4GTU A;  5CAX A;  1AQW A;  3BCI A;  3W8J A;  1ZL9 A;  3IBH A;  4P3Y B;  1YEX A;  3GA4 A;  4OCF A;  3M9K A;  1GRX A;  3IC4 A;  3D4M A;  1XZO A;  5E4W A;  2C3N A;  4XTS A;  4EDY A;  4FYB A;  3UL3 A;  5ID2 B;  2GT5 A;  3A2W A;  3RHC A;  3I43 A;  3EMX A;  22GS A;  2H0I A;  5J9B A;  3GN3 A;  3FZ4 A;  2X99 A;  1QMV A;  2H73 A;  2CV4 A;  1AIU A;  2C4J A;  4ZXG A;  4F0C A;  5ELG A;  2VUP A;  4POB A;  3TRQ A;  4XHM A;  1T8E B;  4O7H A;  3RDW A;  1VRS D;  3GKK A;  1V58 A;  2TIR A;  2AUV A;  1F6M C;  5G5E A;  1I5G A;  1QK8 A;  3GX0 A;  1HNA A;  1OE7 A;  1XPV A;  2L5O A;  3TKQ A;  2L5L A;  3APO A;  5IMV A;  3A2V A;  1SU9 A;  3EU4 A;  4Q5R A;  3GL3 A;  4WR5 A;  4KA0 A;  1B9X C;  3ZIV A;  1S3D A;  1OC8 A;  4I2U A;  1A2M A;  2R2J A;  2R6K A;  1X5D A;  2IIY A;  4H86 A;  3LYP A;  5CYY A;  1R4W A;  3A2X A;  5DCH A;  1X5C A;  2DIY A;  1X5E A;  1ILO A;  1F3A A;  3G7Y A;  4PGT A;  2WDU A;  6GSW A;  3C7M A;  1FO5 A;  1IYH A;  3BOA A;  3FR3 A;  1AUC A;  1E2Y A;  5A4V A;  4IEL A;  2FHE A;  5GAP D;  4D73 B;  1XWB A;  2VL9 A;  3ERG A;  2OE1 A;  2H1B A;  1K0O A;  1DSB A;  1ZCP A;  2M46 A;  2DJJ A;  5KN0 A;  4JZQ A;  1JZR A;  3IAM 2;  1EV4 A;  1MDJ A;  1ST9 A;  1OC9 A;  5DAK A;  3GSS A;  4TOP A;  3H79 A;  2EC4 A;  1AQV A;  2NTO A;  4BVY A;  4ZB8 A;  2K8V A;  3UVH A;  3MNG A;  2L57 A;  4MZB A;  2LRT A;  1A2L A;  1K0N A;  4HZ4 A;  3ZML A;  2OE3 A;  3O76 A;  2L59 A;  5F06 A;  1R5P A;  4V2L A;  1JZO A;  5AIX A;  2HSY A;  2B6M A;  4EE0 A;  4PXO A;  3H8Q A;  3QAW A;  1PA3 A;  2HZE B;  2NPB A;  1WOU A;  1G0T A;  1ERW A;  2L6D A;  2QSI A;  1SYX A;  3KMO A;  2LJA A;  3US3 A;  1X9S B;  1TKD B;  1BED A;  1V9W A;  2L6C A;  2LNT A;  4EKZ A;  4HU9 A;  2V6K A;  2E2G A;  4GF0 A;  2IN3 A;  1VF3 A;  1YF0 A;  4LMW A;  4PNF A;  1KTE A;  5CO3 A;  2P0G A;  4WBJ A;  1XWA A;  1SKS B;  6GSS A;  1Z7P A;  4DSS A;  5J41 A;  5ECQ B;  1K3Y A;  17GS A;  2HSH A;  1U88 A;  3PR8 A;  2PVQ A;  4J2F A;  1MDI A;  4PQI A;  3NIV A;  4BPY A;  1RW1 A;  4LL1 B;  1YQ1 A;  5D8I A;  5FT3 A;  2YWO A;  1PKZ A;  3D4T A;  1WJK A;  2C0F A;  4TXV A;  3H1N A;  2LEG A;  1O81 A;  4WF5 A;  2OBK A;  2VCQ A;  1YJ6 A;  3GH6 A;  2GST A;  1ACV A;  4MP4 A;  2MMN A;  1AQX A;  4L0W A;  4Q5F A;  1GL8 A;  2YNX A;  1M7T A;  2FUG 2;  1BG5 A;  3CRU A;  2H19 A;  4GRF A;  1IYI A;  3EYT A;  3F4S A;  5L71 A;  2LS5 A;  1A0R P;  3IPZ A;  5ECM B;  2YWM A;  4IP6 A;  3GTU A;  4F82 A;  1CQG A;  2OJL A;  4MMM A;  4TR1 A;  4K7N A;  4IGJ A;  3SWL A;  4DEJ A;  2LST A;  4LMV A;  1B4P A;  1H75 A;  1FG4 A;  1XVW A;  2LV3 A;  1F2E A;  1RQM A;  4ZIJ A;  3U5R E;  4X43 A;  1HNB A;  3DWV A;  1GLQ A;  4ILF A;  1O8W A;  1TRV A;  4ZL8 A;  3J7Y k;  1XBS A;  4AGS A;  1Y25 A;  2H75 A;  4XS1 A;  3VI7 A;  5B6N A;  13GS A;  4G10 A;  1J9B A;  1XXU A;  2OAD A;  3O3T A;  1X0R A;  3IAS 2;  1WE0 A;  3HYP A;  3L9U A;  3GST A;  1MD4 A;  2JSY A;  2VCX A;  4MA9 A;  3L9V A;  1WPI A;  1TK0 B;  2JZT A;  1XW5 A;  2F8A A;  4HU7 A;  5D9W A;  4GWR A;  4ZB9 A;  2H8L A;  1XIY A;  2ALB A;  1JZD A;  1U3A A;  1RK4 A;  3UEM A;  1SK1 A;  2O8V B;  4ECB A;  1ZYQ B;  3G7I A;  1UN2 A;  4MDC A;  2E7P A;  2I4A A;  4IJ3 A;  20GS A;  1PX7 A;  3VWX A;  4WF4 A;  4TR4 A;  4MF6 A;  3CTG A;  2C0E A;  3TJJ A;  4ECI A;  1XFL A;  4GST A;  2HYX A;  2LQQ A;  3Q74 A;  4KCE A;  4YQM A;  4HQS A;  1F3B A;  2HRN A;  2YJH A;  2H71 A;  2E0Q A;  3D22 A;  2DIZ A;  1MEK A;  1USB A;  2CVD A;  2L4Q A;  3EMP A;  1OC9 B;  1B9Y C;  3TJK A;  2DBC A;  3GRX A;  4YAP A;  3PGT A;  2FA4 A;  4ML1 A;  2FCH A;  6GSU A;  2CAI A;  4D73 A;  3Q18 A;  3HCZ A;  3EUR A;  2JL4 A;  4OO4 A;  1T00 A;  2AV4 A;  2GLR A;  2K18 A;  4RQR A;  4J56 E;  2ON7 A;  18GS A;  3GFK A;  2XPE A;  3FYG A;  3LG6 A;  1WIK A;  1X9W B;  1FOV A;  5F07 A;  3RHB A;  3HJO A;  1ZOF A;  2HZF A;  1PMT A;  5A4U A;  4TR0 A;  3UOM A;  1O73 A;  3HVV A;  1A0F A;  1PSQ A;  2X8C A;  1M2A A;  14GS A;  2WS2 A;  3ZYW A;  4MK3 A;  1UA5 A;  2I1U A;  1K3L A;  2VCV A;  2VM2 A;  3TRX A;  3C1S A;  2BTO T;  5IMD A;  4DSS B;  4LL4 B;  1TRS A;  2H6Z A;  2H6Y A;  1NSW A;  2PBJ A;  3PH9 A;  3KJY A;  4MLY A;  2B3S A;  2MMO A;  1W4V A;  2VO4 A;  3MSZ A;  4HJM A;  2IMI A;  2ES7 A;  1M0U A;  4F9Z A;  5HFI A;  2YV7 A;  5ECO B;  1SKW B;  4PQH A;  2O89 A;  2VIM A;  4KSM A;  3QAV A;  4F0B A;  2G0F A;  3EC3 A;  2GDR A;  4LLR A;  3BD2 A;  4QQ7 A;  3ZRD A;  2QC7 A;  4IP1 A;  3QD9 A;  5C04 A;  4V2N A;  2VLT A;  1ZGN A;  4G9H A;  2AYT A;  1VF2 A;  5D96 A;  3LYK A;  3WT2 A;  1M9A A;  1ERT A;  4POK A;  2RUE A;  5H5Q A;  1XWK A;  2R5G A;  2V2G A; 
#chains in the Genus database with same CATH topology
 1GSU A;  5BMU A;  1PQN A;  1XVQ A;  3C1R A;  3M8N A;  1MTC A;  2GZP A;  1S3C A;  3GTU B;  3J7Y b;  4Z7X A;  2FLS A;  5D93 A;  3DVX A;  5CRH A;  3FZA A;  4HOJ A;  5IMC A;  4NV2 A;  3BJ5 A;  5IIZ A;  3VPT A;  3CYN A;  4KF9 A;  4G19 A;  3RPP A;  2K9F A;  4EL1 A;  1E6B A;  5A4W A;  2LJK A;  4XIH A;  2GSS A;  4MH3 A;  5JWQ B;  1GUM A;  2MYG A;  3ISO A;  3FK8 A;  1K0A A;  1TXX A;  2C3T A;  4WR4 A;  4XS6 A;  5G1K A;  5J3R A;  3TKP A;  3KP9 A;  4EO3 A;  2K6V A;  1K0B A;  4IHU A;  2LRC A;  5ABR A;  4ZL7 A;  3VWU A;  1TRW A;  2YWN A;  5ECP B;  4XCS A;  5KOX A;  3VUR A;  3FKF A;  5CRG A;  3HZ4 A;  2DMM A;  2VL2 A;  3LWA A;  4OO5 A;  3GV1 A;  2PN8 A;  3VK9 A;  2IWT A;  1XWG A;  1YY7 A;  2FWG A;  4JR6 A;  5KN1 A;  2PMT A;  1U6T A;  4PNG A;  3KM6 A;  1QFN A;  1V57 A;  1KEB A;  4IW9 A;  1QXH A;  2UZ8 A;  2N5A A;  3ZVJ A;  2C8U A;  2H30 A;  5J4U A;  4NV5 A;  3TJB A;  1A8Y A;  2WFC A;  5AIS A;  3F4R A;  1MD3 A;  3IV4 A;  3HY2 A;  2O87 A;  1FB0 A;  3EU3 A;  5DAL B;  1ZZY A;  2LTK A;  4ML6 A;  2LRN A;  3KEB A;  2LQO A;  3HJP A;  4GSS A;  4L8E A;  2AJQ B;  3FW2 A;  1S3A A;  4EVM A;  4KCA A;  1WRY A;  3GKN A;  2YAN A;  3QMX A;  3Q6O A;  2MBT A;  3IK7 A;  1UVZ A;  4FYU A;  1Z3E A;  2WRT A;  1WWJ A;  4ECC A;  1O6J A;  3IR4 A;  2JAC A;  1SJI A;  3LXT A;  1DE2 A;  3UIW A;  4CW9 A;  1FOH A;  2WJU A;  4A5P A;  4K0G A;  5CRE A;  1BYE A;  1ABA A;  1T4Z A;  3IOS A;  3VFI A;  1ZMA A;  2G2Q A;  1EP8 A;  4O5R A;  5J5N A;  1V40 A;  2D2Z A;  3P90 A;  6GSV A;  3HVX A;  3HXS A;  4IS0 A;  4L0U A;  1G6Y A;  2A4H A;  2DKH A;  3QPM A;  3KMN A;  3F3R A;  4RI6 A;  2H66 A;  2VL3 A;  2H72 A;  3LXZ A;  3KTL A;  3BBY A;  1PKW A;  3UMA A;  2KHP A;  2H1A A;  1B8X A;  2B5Y A;  1HQO A;  3ME8 A;  1OYJ A;  1EP7 A;  5ELA A;  1EEJ A;  2I81 A;  4JU5 A;  3UBK A;  2V41 A;  2F9S A;  2CT6 A;  4NPB A;  3TJG A;  1DUG A;  2ZNM A;  3DRN A;  3F0I A;  4IKH A;  2YJ7 A;  5IQY A;  2B7J A;  3TKS A;  2DKI A;  3EVI A;  3KIJ A;  5DQY A;  3ZZX A;  5EPF A;  4EXJ A;  4MPF A;  1GLP A;  1TI1 A;  4TKY A;  2GZY A;  3KTB A;  5AIV A;  2VAF A;  5JWR B;  4TW5 A;  2C1Y A;  2VM1 A;  3RBT A;  5GST A;  2CZ2 A;  6GST A;  1TK8 B;  3DEX A;  2AHE A;  3IDV A;  2P5Q A;  3R2Q A;  4I97 A;  1TU8 A;  3P7X A;  4K7I A;  2DJ0 A;  4PUR A;  4MNN A;  1GP1 A;  1TI3 A;  2CA8 A;  4GQC A;  1PL1 A;  1TOF A;  4V1A g;  3MYD A;  16GS A;  1A24 A;  1EGR A;  1YEP A;  4ZBD A;  2LUS A;  2HNL A;  5B6M A;  1ERV A;  2FWF A;  2YV9 A;  2RM5 A;  3D5J A;  3FY7 A;  5C00 A;  3IRA A;  2MZC A;  1THO A;  2RUF A;  2HT9 A;  1F9M A;  3APQ A;  2C0D A;  1ZYP A;  3MDK A;  2F51 A;  3O6T A;  4Q5Q A;  2PVO C;  2R0P A;  2IL3 A;  1NHO A;  5COH A;  1Z9H A;  4GXZ A;  3VLN A;  3TB2 A;  2ON5 A;  3ZTL A;  5B7C A;  4RI7 A;  4NMU A;  4BL7 A;  1GSY A;  1XW6 A;  3VWW A;  1G7E A;  5IO0 A;  4KH7 A;  3TUE A;  3GKM A;  2A2S A;  4GQF A;  1SK2 A;  1URM A;  1GUL A;  1GTU A;  1LBK A;  2MMA A;  2VLU A;  1BAY A;  3ZIJ A;  3W8S A;  2MMZ A;  1J0F A;  2HXK A;  3D0Z A;  3GH9 A;  3HVS A;  3GUS A;  3WYW A;  1BQ7 A;  3KZQ A;  2CX3 A;  4G0I A;  2YOI A;  3GNJ A;  4KND A;  4FH8 A;  4XRD A;  1DE1 A;  3TKR A;  1EOG A;  6GSX A;  5IM9 A;  1OKT A;  2YP6 A;  4YKF A;  2EIO A;  4XRA A;  4KAE A;  1OC3 A;  3ZRE A;  5JCW A;  5G1L A;  3GMF A;  5HR2 A;  2E2M A;  3WGD A;  3E9J B;  3ZMK A;  3CMI A;  1FVJ A;  3KH7 A;  5GSS A;  2Z9S A;  2MBS A;  5ECN B;  2X4A A;  4K9Z A;  5DJM A;  5DAL A;  3IA1 A;  2HE3 A;  2CQ9 A;  4X0X A;  4ACS A;  2HFD A;  2C3Q A;  4JE1 A;  2XC2 A;  1N2A A;  4OFN A;  3IE3 A;  5HR3 A;  3QCP A;  1QUW A;  3MIX A;  2PU9 C;  3C8E A;  3F8U A;  2WZ9 A;  2QKE A;  4X1U A;  1JFU A;  4OCE A;  3RAZ A;  1YKA A;  3WD6 A;  3KXO A;  1SD8 A;  3GUR A;  4J57 E;  3MWH A;  4MF7 A;  2YCD A;  3JCM L;  1JZW A;  3CTF A;  1TU7 A;  1SYR A;  1Q4J A;  4WBR D;  3N5O A;  4HS1 A;  2IME A;  1O7U A;  2YZU A;  3D6I A;  4ZBB A;  2PWJ A;  4Z2R A;  5F0G A;  2OKA A;  3ED3 A;  4JR4 A;  2TRX A;  2AB6 A;  3NZN A;  3IHG A;  1G6W A;  2GT6 A;  1GNW A;  4L5O A;  3CBU A;  2GSQ A;  1DBY A;  2ZCT A;  4MH2 A;  5DCG A;  3G7J A;  3UAP A;  1SL1 B;  5JCU A;  1K3O A;  1T3B A;  2GVP A;  2YPM A;  2IMF A;  4OWY A;  4V2M A;  2LKU A;  1XWC A;  2X49 A;  4BA7 A;  1JLW A;  2RII A;  5D9V A;  3LJR A;  4NHW A;  2R3X A;  4QL7 A;  1NHY A;  3G9B A;  4KE3 A;  10GS A;  1PGT A;  4RUV A;  4HDE A;  2TRC P;  5DJL A;  1GUH A;  5HR0 A;  1Z6N A;  2PUK C;  5D73 A;  1K0D A;  3LQ7 A;  4O92 A;  5ECI B;  3EWL A;  1NW2 A;  2B5E A;  2C0G A;  2V32 A;  4WKW A;  1VGL A;  4YKG A;  2V6O A;  1LJR A;  5F05 A;  2AAW A;  3TOU A;  4I8B A;  2N5F A;  1SJ6 A;  5DDL A;  4CHS A;  3U6V A;  2B5X A;  1H4O A;  3A3T A;  4ZBA A;  4F2I A;  3F3Q A;  4OFM A;  4K1F A;  2XHF A;  1N8J A;  5ECR B;  5IOW A;  5B8A A;  5IMF A;  4DVC A;  1R26 A;  4G2E A;  1GH2 A;  2PGT A;  2F3M A;  4O5Q A;  1GTA A;  2OAC A;  4MZC A;  1J08 A;  3HDC A;  1QQ2 A;  4TRX A;  4XS4 B;  2BMX A;  2KLX A;  5HQP A;  4JED A;  3TKS E;  1GSS A;  2H6X A;  4IJI A;  9GSS A;  4EIQ A;  4E8H A;  3KP8 A;  4LA1 A;  3VPQ A;  3K8N A;  1T7P B;  3LOR A;  3LFL A;  1PN0 A;  2L4C A;  5IPH A;  1AAZ A;  4CDO A;  1TK5 B;  2FNO A;  3ZLP A;  1M3I A;  4EF0 A;  5DBQ A;  3GL5 A;  1I9D A;  2C80 A;  4BL7 B;  3VI5 A;  4HSC X;  3L0H A;  4TR3 A;  1GTI A;  2NDO A;  4AJ8 A;  5EVO A;  2WB9 A;  4K5S A;  2YWI A;  1BX9 A;  1M9B A;  1OVN A;  2V1M A;  2J9H A;  5G30 A;  3H93 A;  1JLV A;  4I2T A;  4CY8 A;  2P31 A;  3A5I A;  4HUA A;  4K7O A;  2JAD A;  5F8B A;  2O85 A;  2WGR A;  5GAN D;  2REM A;  2N5B A;  4EC0 A;  3F9U A;  5IPG A;  4N10 A;  2FA8 A;  4DSR A;  1WMJ A;  4KUN A;  4K2D A;  3N9J A;  4Z2U A;  5KN3 A;  4TVE A;  11GS A;  4JBB A;  2VL2 C;  4N0Z A;  5D9X A;  2GTU A;  1R7H A;  3ZIT A;  4KDU A;  5G2Z A;  2GQK A;  3L9S A;  3HA9 A;  3LEF A;  3ME7 A;  4YQV A;  4KSO A;  4MJC A;  3VWV A;  1XOB A;  1PD2 1;  2GQM A;  1A8L A;  4FO5 A;  2RLI A;  5CRD A;  4ZIL A;  5IMZ A;  3EE2 A;  4FYC A;  1XW9 A;  2IMK A;  4IN0 A;  5JWO B;  4EUY A;  2M80 A;  1TP9 A;  1EGO A;  5IO2 A;  2IFQ B;  1EWX A;  2DJ3 A;  3GHA A;  3GIX A;  1MDK A;  5IOX A;  2GGT A;  3IXR A;  2DJK A;  2HLS A;  2QGV A;  3DGQ A;  4BWQ A;  4KX4 A;  3A5W A;  2FY6 A;  3APS A;  3V1W A;  1GSF A;  3RPN A;  4N30 A;  2YN1 A;  3F6F A;  3IK9 A;  2CAQ A;  3KD0 A;  2RM6 A;  5HFG A;  2BJX A;  5IMA A;  5KOW A;  3E3E A;  4O32 A;  4X4J A;  1GSE A;  3CSJ A;  1VF1 A;  3L78 A;  2DC5 A;  3TDG A;  2GQL A;  4L5L A;  3TOT A;  3MAK A;  2WCI A;  3F4T A;  1B48 A;  2A4V A;  1SK0 A;  3FMW A;  4I6X A;  3M1G A;  1AC1 A;  1M2D A;  4USS A;  2H01 A;  2DJ1 A;  3DYR A;  5E59 A;  4K0N A;  3CQF A;  4ECJ A;  4FQU A;  2H76 A;  1GTB A;  4TXO B;  1YDK A;  4ULX A;  2PPT A;  1K0C A;  8GSS A;  1GWC A;  4MJE A;  2PER A;  4HQZ A;  2KP2 A;  4E8E A;  4MZW A;  1HNC A;  1K0M A;  4K2X A;  4GLT A;  3BCK A;  4K8M A;  2R4V A;  3M3M A;  3UAR A;  3H4K A;  2R37 A;  1U3I A;  2KP1 A;  5CNW A;  4KDY A;  5DQS A;  1ON4 A;  1VF4 A;  4PUF C;  3P2A A;  3CXG A;  5CP1 A;  3DML A;  3KCM A;  4BWS A;  5AN1 A;  1XOA A;  3E0U A;  4OFT A;  3TKS C;  2CVB A;  5EL8 A;  1SD9 A;  3M9J A;  4TN8 A;  1TW9 A;  2YZH A;  3DIE A;  1YF1 A;  1M2B A;  2XBI A;  6GSY A;  3D21 A;  2H0H A;  5G31 A;  3LGC A;  3CRT A;  5HR1 A;  3F63 A;  5AGY A;  2H0G A;  4IBP A;  2EIR A;  4AJ6 A;  4WXT A;  4XS4 A;  1PX6 A;  2X8H A;  3HHV A;  4IQ1 A;  5ECS A;  2IJY A;  1TRU A;  1GNE A;  4KB3 A;  3QR6 A;  3WGE A;  4QL9 A;  4ZB6 A;  5JCG A;  2QA2 A;  5EY6 A;  3HJM A;  1KBN A;  1LU4 A;  2VCZ A;  3ERF A;  4YH2 A;  5B8B A;  4MCU A;  2XBQ A;  1AW9 A;  1GSQ A;  4NHZ A;  1ZYE A;  3KH9 A;  4MJB A;  3W6G A;  3I6A A;  3C71 A;  3FR6 A;  3CSH A;  2B7K A;  5KN2 A;  3QOU A;  1Z6M A;  2X8G A;  1GSD A;  2F8F A;  1C72 A;  5CRW A;  2VCW A;  3FEU A;  3GYK A;  3TCO A;  1OAZ A;  19GS A;  1W89 A;  4HI7 A;  2JSZ A;  1G7O A;  1YZX A;  1Z7R A;  2FD3 A;  1SKR B;  4KDX A;  3M0F A;  3TRP A;  2VD1 A;  3UBL A;  5J9C A;  4F03 A;  1PRX A;  4O5U A;  5ENU A;  4NAX A;  5FWG A;  3ZFB A;  5ID2 A;  2EIQ A;  1Z5Y E;  5ECK B;  3C73 A;  1V98 A;  2XPD A;  5ECH B;  4POL A;  1PL2 A;  3SBC A;  3NOF A;  3R3E A;  4PQ1 A;  4ISD A;  3FZ9 A;  3CSI A;  1EZK A;  2VCT A;  4ID0 A;  1TTZ A;  2DSA A;  2R0G A;  3LSZ A;  2B1L A;  3HKR A;  5LD0 A;  1HYU A;  5H5R A;  4PX1 A;  5G5F A;  2LNS A;  4IQA A;  5H5S A;  2VD0 A;  3Q19 A;  4AF2 A;  2IPA A;  3FZ5 A;  4GCI A;  4YQU A;  3IHQ A;  1PN9 A;  4FIW A;  4MPG A;  4EDZ A;  2CX4 A;  1NM3 A;  3GKX A;  3P8W A;  3TJF A;  4V1A p;  1YKC A;  1A2J A;  1U87 A;  4N11 A;  3WGX A;  2A2R A;  2IFQ A;  1F37 A;  1JHB A;  4NWY A;  1T4Y A;  3QAG A;  1R5A A;  3HZ8 A;  1EV9 A;  4GSN A;  3QFA C;  1FW1 A;  1XG8 A;  7GSS A;  1O85 A;  1UC7 A;  1EEM A;  1QGV A;  4YAV A;  5DAK B;  4PUA A;  3UJ1 A;  4MF5 A;  4DSQ A;  4BVY B;  2GSR A;  4OMV A;  2K8S A;  3DXB A;  4HEA 2;  1FHE A;  5INY A;  3FR9 A;  4POM A;  4HZ2 A;  4JRR A;  2KUC A;  4K6X A;  2HRF A;  1O8X A;  2DLX A;  2I3Y A;  3ZFL A;  1EOH A;  1SL0 B;  2NBS A;  2VLV A;  2JZS A;  5GZZ B;  5LCZ A;  3ZVJ D;  2LJR A;  2M72 A;  2P5R A;  1V2A A;  3ZL5 A;  4NXI A;  1M99 A;  4BVX A;  1WP0 A;  1OE8 A;  1THX A;  1TJD A;  1AXD A;  2GS3 A;  4ZL9 A;  4WEY A;  1SL2 B;  2CVK A;  2JZR A;  2QA1 A;  2FGX A;  4TXO A;  2HZE A;  3QFB C;  3FHK A;  3I9V 2;  2GZZ A;  1TDI A;  12GS A;  1ERU A;  2B1K A;  1HD2 A;  2ZUP A;  5A5K A;  1FAA A;  1CQH A;  4MAB A;  1OKD A;  2CZ3 A;  2H1D A;  5KEJ A;  2X64 A;  1GUK A;  3KGK A;  3DD3 A;  3TGZ A;  3UVT A;  4I5Q A;  2FWH A;  5LNK e;  1Y6E A;  5ECL B;  2HI7 A;  3EIN A;  2H70 A;  1Q98 A;  3LW9 A;  1KNG A;  4CY6 A;  2KOK A;  2H74 A;  3DKS A;  2J23 A;  2FWE A;  5DVB A;  4WET A;  3GX8 A;  1SEN A;  4OD7 A;  1FVK A;  2H1G A;  1M3J A;  3I69 A;  4KW6 A;  2JU5 A;  2O7K A;  1T1V A;  3PIN A;  1B4Q A;  3OR5 A;  4KGI A;  1FB6 A;  4K5R A;  4Q5N A;  1BJX A;  2OA7 A;  3FRC A;  2OBI A;  3WT1 A;  3HD5 A;  2IMD A;  3AY8 A;  2I9H A;  4AJ7 A;  2VOC A;  4RQX A;  1ML6 A;  5D9T A;  2OE0 A;  1XCC A;  1SJZ A;  4G0K A;  4TR1 B;  1X9M B;  2WUL A;  4N0V A;  3S9F A;  3L4N A;  3ERW A;  4MJA A;  3QDN A;  5HFK A;  4HJ2 A;  2DJ2 A;  4IVF A;  1A23 A;  3HVN A;  3DVW A;  5FHI A;  2DML A;  2NVL A;  3F6D A;  4GTU A;  5CAX A;  1AQW A;  3BCI A;  3W8J A;  1ZL9 A;  3IBH A;  4P3Y B;  1YEX A;  3GA4 A;  4OCF A;  3M9K A;  1GRX A;  3IC4 A;  3D4M A;  1XZO A;  5E4W A;  2C3N A;  4XTS A;  4EDY A;  4FYB A;  3UL3 A;  5ID2 B;  2GT5 A;  3A2W A;  3RHC A;  3I43 A;  3EMX A;  3EPT A;  22GS A;  2H0I A;  5J9B A;  3GN3 A;  3FZ4 A;  2X99 A;  1QMV A;  2H73 A;  2CV4 A;  1AIU A;  2C4J A;  4ZXG A;  4F0C A;  5ELG A;  2VUP A;  4POB A;  3TRQ A;  4XHM A;  1T8E B;  4O7H A;  3RDW A;  1VRS D;  3GKK A;  1V58 A;  2TIR A;  2AUV A;  1F6M C;  5G5E A;  1I5G A;  1QK8 A;  3GX0 A;  1HNA A;  1OE7 A;  1XPV A;  2L5O A;  3TKQ A;  2L5L A;  3APO A;  5IMV A;  3A2V A;  1SU9 A;  3EU4 A;  4Q5R A;  3GL3 A;  4WR5 A;  4KA0 A;  1B9X C;  3ZIV A;  1S3D A;  1OC8 A;  4I2U A;  1A2M A;  2R2J A;  2R6K A;  1X5D A;  2IIY A;  4H86 A;  3LYP A;  5CYY A;  1R4W A;  3A2X A;  5DCH A;  1X5C A;  2DIY A;  1X5E A;  1ILO A;  1F3A A;  3G7Y A;  4PGT A;  2WDU A;  6GSW A;  3C7M A;  1FO5 A;  1IYH A;  3BOA A;  3FR3 A;  1AUC A;  5BRT A;  1E2Y A;  5A4V A;  4IEL A;  2FHE A;  5GAP D;  4D73 B;  1XWB A;  2VL9 A;  3ERG A;  2OE1 A;  2H1B A;  1K0O A;  1DSB A;  1ZCP A;  2M46 A;  2DJJ A;  5KN0 A;  4JZQ A;  1JZR A;  3IAM 2;  2HSM A;  1EV4 A;  1MDJ A;  1ST9 A;  1OC9 A;  5DAK A;  3GSS A;  4TOP A;  3H79 A;  2EC4 A;  1AQV A;  4G0L A;  2NTO A;  4BVY A;  4ZB8 A;  2K8V A;  3UVH A;  3MNG A;  2L57 A;  4MZB A;  2LRT A;  1A2L A;  1K0N A;  4HZ4 A;  3ZML A;  2OE3 A;  3O76 A;  2L59 A;  4BVX B;  5F06 A;  1R5P A;  4V2L A;  1JZO A;  5AIX A;  2HSY A;  2B6M A;  4EE0 A;  4PXO A;  3H8Q A;  3QAW A;  1PA3 A;  2HZE B;  2NPB A;  1WOU A;  1G0T A;  1ERW A;  2L6D A;  2QSI A;  1SYX A;  3KMO A;  2LJA A;  3US3 A;  1X9S B;  1TKD B;  1BED A;  1V9W A;  2L6C A;  2LNT A;  4EKZ A;  4HU9 A;  2V6K A;  2E2G A;  2R0C A;  4GF0 A;  2IN3 A;  1VF3 A;  1YF0 A;  1S3R A;  4LMW A;  4PNF A;  1KTE A;  5CO3 A;  2P0G A;  4WBJ A;  1XWA A;  1SKS B;  6GSS A;  1Z7P A;  4DSS A;  5J41 A;  5ECQ B;  1K3Y A;  17GS A;  2HSH A;  1U88 A;  3PR8 A;  2PVQ A;  4J2F A;  1MDI A;  3IC8 A;  4PQI A;  3NIV A;  2HRK A;  4BPY A;  1RW1 A;  4LL1 B;  1YQ1 A;  5D8I A;  5FT3 A;  2YWO A;  1PKZ A;  3D4T A;  1WJK A;  2C0F A;  4TXV A;  3H1N A;  2LEG A;  1O81 A;  4WF5 A;  2OBK A;  2VCQ A;  1YJ6 A;  3GH6 A;  2GST A;  1ACV A;  4MP4 A;  2MMN A;  1AQX A;  4L0W A;  4Q5F A;  1GL8 A;  2YNX A;  1M7T A;  2FUG 2;  1BG5 A;  3CRU A;  2H19 A;  4GRF A;  1IYI A;  3EYT A;  3F4S A;  5L71 A;  2LS5 A;  1A0R P;  3IPZ A;  5ECM B;  2YWM A;  4IP6 A;  3GTU A;  4F82 A;  1CQG A;  2OJL A;  4MMM A;  4TR1 A;  4K7N A;  4IGJ A;  3SWL A;  4DEJ A;  2LST A;  4LMV A;  1B4P A;  1H75 A;  1FG4 A;  1XVW A;  3PPU A;  1PFO A;  2LV3 A;  1F2E A;  1RQM A;  4ZIJ A;  3U5R E;  4X43 A;  1HNB A;  3DWV A;  1GLQ A;  4ILF A;  1O8W A;  1TRV A;  4ZL8 A;  3J7Y k;  1XBS A;  4AGS A;  1Y25 A;  2H75 A;  4XS1 A;  3VI7 A;  5B6N A;  13GS A;  4Z2T A;  4G10 A;  1J9B A;  1XXU A;  2OAD A;  3O3T A;  1X0R A;  3IAS 2;  1WE0 A;  3HYP A;  3L9U A;  3GST A;  1MD4 A;  2JSY A;  2VCX A;  4MA9 A;  3L9V A;  1WPI A;  1TK0 B;  2JZT A;  1XW5 A;  2F8A A;  4HU7 A;  4PTS A;  5D9W A;  4GWR A;  4ZB9 A;  2H8L A;  1XIY A;  2ALB A;  1JZD A;  1U3A A;  1RK4 A;  3UEM A;  1SK1 A;  2O8V B;  4ECB A;  1ZYQ B;  3G7I A;  1UN2 A;  4MDC A;  2E7P A;  2I4A A;  4IJ3 A;  20GS A;  1PX7 A;  3VWX A;  4WF4 A;  4ICY A;  4TR4 A;  4MF6 A;  3CTG A;  2C0E A;  3TJJ A;  4ECI A;  1XFL A;  4GST A;  2HYX A;  2LQQ A;  3Q74 A;  4KCE A;  4YQM A;  4HQS A;  1F3B A;  2HRN A;  2YJH A;  2H71 A;  2E0Q A;  3D22 A;  2DIZ A;  1MEK A;  1USB A;  2CVD A;  2L4Q A;  3EMP A;  1OC9 B;  1B9Y C;  3TJK A;  2DBC A;  3GRX A;  4YAP A;  3PGT A;  2FA4 A;  4ML1 A;  2FCH A;  6GSU A;  2CAI A;  4D73 A;  3Q18 A;  3HCZ A;  3EUR A;  2JL4 A;  4OO4 A;  1T00 A;  2AV4 A;  2GLR A;  2K18 A;  4RQR A;  4J56 E;  2ON7 A;  18GS A;  3GFK A;  2XPE A;  3FYG A;  3LG6 A;  1WIK A;  1X9W B;  1FOV A;  5F07 A;  3RHB A;  3HJO A;  1ZOF A;  2HZF A;  1PMT A;  5A4U A;  4TR0 A;  3UOM A;  1O73 A;  3HVV A;  1A0F A;  1PSQ A;  2X8C A;  1M2A A;  14GS A;  2WS2 A;  3ZYW A;  4MK3 A;  1UA5 A;  2I1U A;  1ZYN A;  1K3L A;  2VCV A;  2VM2 A;  3TRX A;  3C1S A;  2BTO T;  2A2P A;  5IMD A;  4DSS B;  4LL4 B;  1TRS A;  2H6Z A;  2H6Y A;  1NSW A;  2PBJ A;  3PH9 A;  3KJY A;  4MLY A;  2B3S A;  2MMO A;  1W4V A;  2VO4 A;  3MSZ A;  4HJM A;  2IMI A;  2ES7 A;  1M0U A;  4F9Z A;  5HFI A;  2YV7 A;  5ECO B;  1SKW B;  4PQH A;  2O89 A;  2HRA A;  2VIM A;  4KSM A;  3QAV A;  4F0B A;  2G0F A;  3EC3 A;  2GDR A;  4LLR A;  3BD2 A;  4QQ7 A;  3ZRD A;  2QC7 A;  4EIP A;  4IP1 A;  3QD9 A;  5C04 A;  4V2N A;  2VLT A;  1ZGN A;  4G9H A;  2AYT A;  1VF2 A;  5D96 A;  3LYK A;  3WT2 A;  1M9A A;  1ERT A;  4POK A;  2RUE A;  5H5Q A;  1XWK A;  4BIK A;  2R5G A;  2V2G A; 
#chains in the Genus database with same CATH homology
 1GSU A;  5BMU A;  1PQN A;  1XVQ A;  3C1R A;  3M8N A;  1MTC A;  2GZP A;  1S3C A;  3GTU B;  3J7Y b;  4Z7X A;  2FLS A;  5D93 A;  3DVX A;  5CRH A;  3FZA A;  4HOJ A;  5IMC A;  4NV2 A;  3BJ5 A;  5IIZ A;  3VPT A;  3CYN A;  4KF9 A;  4G19 A;  3RPP A;  2K9F A;  4EL1 A;  1E6B A;  5A4W A;  2LJK A;  4XIH A;  2GSS A;  4MH3 A;  5JWQ B;  1GUM A;  2MYG A;  3ISO A;  3FK8 A;  1K0A A;  1TXX A;  2C3T A;  4WR4 A;  4XS6 A;  5G1K A;  5J3R A;  3TKP A;  3KP9 A;  4EO3 A;  2K6V A;  1K0B A;  4IHU A;  2LRC A;  5ABR A;  4ZL7 A;  3VWU A;  1TRW A;  2YWN A;  5ECP B;  4XCS A;  5KOX A;  3VUR A;  3FKF A;  5CRG A;  3HZ4 A;  2DMM A;  2VL2 A;  3LWA A;  4OO5 A;  3GV1 A;  2PN8 A;  3VK9 A;  2IWT A;  1XWG A;  1YY7 A;  2FWG A;  4JR6 A;  5KN1 A;  2PMT A;  1U6T A;  4PNG A;  3KM6 A;  1QFN A;  1V57 A;  1KEB A;  4IW9 A;  1QXH A;  2UZ8 A;  2N5A A;  3ZVJ A;  2C8U A;  2H30 A;  5J4U A;  4NV5 A;  3TJB A;  1A8Y A;  2WFC A;  5AIS A;  3F4R A;  1MD3 A;  3IV4 A;  3HY2 A;  2O87 A;  1FB0 A;  3EU3 A;  5DAL B;  1ZZY A;  2LTK A;  4ML6 A;  2LRN A;  3KEB A;  2LQO A;  3HJP A;  4GSS A;  4L8E A;  2AJQ B;  3FW2 A;  1S3A A;  4EVM A;  4KCA A;  1WRY A;  3GKN A;  2YAN A;  3QMX A;  3Q6O A;  2MBT A;  3IK7 A;  1UVZ A;  4FYU A;  1Z3E A;  2WRT A;  1WWJ A;  4ECC A;  1O6J A;  3IR4 A;  2JAC A;  1SJI A;  3LXT A;  1DE2 A;  3UIW A;  4CW9 A;  1FOH A;  2WJU A;  4A5P A;  4K0G A;  5CRE A;  1BYE A;  1ABA A;  1T4Z A;  3IOS A;  3VFI A;  1ZMA A;  2G2Q A;  1EP8 A;  4O5R A;  5J5N A;  1V40 A;  2D2Z A;  3P90 A;  6GSV A;  3HVX A;  3HXS A;  4IS0 A;  4L0U A;  1G6Y A;  2A4H A;  2DKH A;  3QPM A;  3KMN A;  3F3R A;  4RI6 A;  2H66 A;  2VL3 A;  2H72 A;  3LXZ A;  3KTL A;  3BBY A;  1PKW A;  3UMA A;  2KHP A;  2H1A A;  1B8X A;  2B5Y A;  1HQO A;  3ME8 A;  1OYJ A;  1EP7 A;  5ELA A;  1EEJ A;  2I81 A;  4JU5 A;  3UBK A;  2V41 A;  2F9S A;  2CT6 A;  4NPB A;  3TJG A;  1DUG A;  2ZNM A;  3DRN A;  3F0I A;  4IKH A;  2YJ7 A;  5IQY A;  2B7J A;  3TKS A;  2DKI A;  3EVI A;  3KIJ A;  5DQY A;  3ZZX A;  5EPF A;  4EXJ A;  4MPF A;  1GLP A;  1TI1 A;  4TKY A;  2GZY A;  3KTB A;  5AIV A;  2VAF A;  5JWR B;  4TW5 A;  2C1Y A;  2VM1 A;  3RBT A;  5GST A;  2CZ2 A;  6GST A;  1TK8 B;  3DEX A;  2AHE A;  3IDV A;  2P5Q A;  3R2Q A;  4I97 A;  1TU8 A;  3P7X A;  4K7I A;  2DJ0 A;  4PUR A;  4MNN A;  1GP1 A;  1TI3 A;  2CA8 A;  4GQC A;  1PL1 A;  1TOF A;  4V1A g;  3MYD A;  16GS A;  1A24 A;  1EGR A;  1YEP A;  4ZBD A;  2LUS A;  2HNL A;  5B6M A;  1ERV A;  2FWF A;  2YV9 A;  2RM5 A;  3D5J A;  3FY7 A;  5C00 A;  3IRA A;  2MZC A;  1THO A;  2RUF A;  2HT9 A;  1F9M A;  3APQ A;  2C0D A;  1ZYP A;  3MDK A;  2F51 A;  3O6T A;  4Q5Q A;  2PVO C;  2R0P A;  2IL3 A;  1NHO A;  5COH A;  1Z9H A;  4GXZ A;  3VLN A;  3TB2 A;  2ON5 A;  3ZTL A;  5B7C A;  4RI7 A;  4NMU A;  4BL7 A;  1GSY A;  1XW6 A;  3VWW A;  1G7E A;  5IO0 A;  4KH7 A;  3TUE A;  3GKM A;  2A2S A;  4GQF A;  1SK2 A;  1URM A;  1GUL A;  1GTU A;  1LBK A;  2MMA A;  2VLU A;  1BAY A;  3ZIJ A;  3W8S A;  2MMZ A;  1J0F A;  2HXK A;  3D0Z A;  3GH9 A;  3HVS A;  3GUS A;  3WYW A;  1BQ7 A;  3KZQ A;  2CX3 A;  4G0I A;  2YOI A;  3GNJ A;  4KND A;  4FH8 A;  4XRD A;  1DE1 A;  3TKR A;  1EOG A;  6GSX A;  5IM9 A;  1OKT A;  2YP6 A;  4YKF A;  2EIO A;  4XRA A;  4KAE A;  1OC3 A;  3ZRE A;  5JCW A;  5G1L A;  3GMF A;  5HR2 A;  2E2M A;  3WGD A;  3E9J B;  3ZMK A;  3CMI A;  1FVJ A;  3KH7 A;  5GSS A;  2Z9S A;  2MBS A;  5ECN B;  2X4A A;  4K9Z A;  5DJM A;  5DAL A;  3IA1 A;  2HE3 A;  2CQ9 A;  4X0X A;  4ACS A;  2HFD A;  2C3Q A;  4JE1 A;  2XC2 A;  1N2A A;  4OFN A;  3IE3 A;  5HR3 A;  3QCP A;  1QUW A;  3MIX A;  2PU9 C;  3C8E A;  3F8U A;  2WZ9 A;  2QKE A;  4X1U A;  1JFU A;  4OCE A;  3RAZ A;  1YKA A;  3WD6 A;  3KXO A;  1SD8 A;  3GUR A;  4J57 E;  3MWH A;  4MF7 A;  2YCD A;  3JCM L;  1JZW A;  3CTF A;  1TU7 A;  1SYR A;  1Q4J A;  4WBR D;  3N5O A;  4HS1 A;  2IME A;  1O7U A;  2YZU A;  3D6I A;  4ZBB A;  2PWJ A;  4Z2R A;  5F0G A;  2OKA A;  3ED3 A;  4JR4 A;  2TRX A;  2AB6 A;  3NZN A;  3IHG A;  1G6W A;  2GT6 A;  1GNW A;  4L5O A;  3CBU A;  2GSQ A;  1DBY A;  2ZCT A;  4MH2 A;  5DCG A;  3G7J A;  3UAP A;  1SL1 B;  5JCU A;  1K3O A;  1T3B A;  2GVP A;  2YPM A;  2IMF A;  4OWY A;  4V2M A;  2LKU A;  1XWC A;  2X49 A;  4BA7 A;  1JLW A;  2RII A;  5D9V A;  3LJR A;  4NHW A;  2R3X A;  4QL7 A;  1NHY A;  3G9B A;  4KE3 A;  10GS A;  1PGT A;  4RUV A;  4HDE A;  2TRC P;  5DJL A;  1GUH A;  5HR0 A;  1Z6N A;  2PUK C;  5D73 A;  1K0D A;  3LQ7 A;  4O92 A;  5ECI B;  3EWL A;  1NW2 A;  2B5E A;  2C0G A;  2V32 A;  4WKW A;  1VGL A;  4YKG A;  2V6O A;  1LJR A;  5F05 A;  2AAW A;  3TOU A;  4I8B A;  2N5F A;  1SJ6 A;  5DDL A;  4CHS A;  3U6V A;  2B5X A;  1H4O A;  3A3T A;  4ZBA A;  4F2I A;  3F3Q A;  4OFM A;  4K1F A;  2XHF A;  1N8J A;  5ECR B;  5IOW A;  5B8A A;  5IMF A;  4DVC A;  1R26 A;  4G2E A;  1GH2 A;  2PGT A;  2F3M A;  4O5Q A;  1GTA A;  2OAC A;  4MZC A;  1J08 A;  3HDC A;  1QQ2 A;  4TRX A;  4XS4 B;  2BMX A;  2KLX A;  5HQP A;  4JED A;  3TKS E;  1GSS A;  2H6X A;  4IJI A;  9GSS A;  4EIQ A;  4E8H A;  3KP8 A;  4LA1 A;  3VPQ A;  3K8N A;  1T7P B;  3LOR A;  3LFL A;  1PN0 A;  2L4C A;  5IPH A;  1AAZ A;  4CDO A;  1TK5 B;  2FNO A;  3ZLP A;  4EF0 A;  5DBQ A;  3GL5 A;  1I9D A;  2C80 A;  4BL7 B;  3VI5 A;  3L0H A;  4TR3 A;  1GTI A;  2NDO A;  4AJ8 A;  5EVO A;  2WB9 A;  4K5S A;  2YWI A;  1BX9 A;  1M9B A;  1OVN A;  2V1M A;  2J9H A;  5G30 A;  3H93 A;  1JLV A;  4I2T A;  4CY8 A;  2P31 A;  3A5I A;  4HUA A;  4K7O A;  2JAD A;  5F8B A;  2O85 A;  2WGR A;  5GAN D;  2REM A;  2N5B A;  4EC0 A;  3F9U A;  5IPG A;  4N10 A;  2FA8 A;  4DSR A;  1WMJ A;  4KUN A;  4K2D A;  3N9J A;  4Z2U A;  5KN3 A;  4TVE A;  11GS A;  4JBB A;  2VL2 C;  4N0Z A;  5D9X A;  2GTU A;  1R7H A;  3ZIT A;  4KDU A;  5G2Z A;  2GQK A;  3L9S A;  3HA9 A;  3LEF A;  3ME7 A;  4YQV A;  4KSO A;  4MJC A;  3VWV A;  1XOB A;  1PD2 1;  2GQM A;  1A8L A;  4FO5 A;  2RLI A;  5CRD A;  4ZIL A;  5IMZ A;  3EE2 A;  4FYC A;  1XW9 A;  2IMK A;  4IN0 A;  5JWO B;  4EUY A;  2M80 A;  1TP9 A;  1EGO A;  5IO2 A;  2IFQ B;  1EWX A;  2DJ3 A;  3GHA A;  3GIX A;  1MDK A;  5IOX A;  2GGT A;  3IXR A;  2DJK A;  2HLS A;  2QGV A;  3DGQ A;  4BWQ A;  4KX4 A;  3A5W A;  2FY6 A;  3APS A;  3V1W A;  1GSF A;  3RPN A;  4N30 A;  2YN1 A;  3F6F A;  3IK9 A;  2CAQ A;  3KD0 A;  2RM6 A;  5HFG A;  2BJX A;  5IMA A;  5KOW A;  3E3E A;  4O32 A;  4X4J A;  1GSE A;  3CSJ A;  1VF1 A;  3L78 A;  2DC5 A;  3TDG A;  2GQL A;  4L5L A;  3TOT A;  3MAK A;  2WCI A;  3F4T A;  1B48 A;  2A4V A;  1SK0 A;  3FMW A;  4I6X A;  3M1G A;  1AC1 A;  1M2D A;  4USS A;  2H01 A;  2DJ1 A;  3DYR A;  5E59 A;  4K0N A;  4ECJ A;  4FQU A;  2H76 A;  1GTB A;  4TXO B;  1YDK A;  4ULX A;  2PPT A;  1K0C A;  8GSS A;  1GWC A;  4MJE A;  2PER A;  4HQZ A;  2KP2 A;  4E8E A;  4MZW A;  1HNC A;  1K0M A;  4K2X A;  4GLT A;  3BCK A;  4K8M A;  2R4V A;  3M3M A;  3UAR A;  3H4K A;  2R37 A;  1U3I A;  2KP1 A;  5CNW A;  4KDY A;  5DQS A;  1ON4 A;  1VF4 A;  4PUF C;  3P2A A;  3CXG A;  5CP1 A;  3DML A;  3KCM A;  4BWS A;  5AN1 A;  1XOA A;  3E0U A;  4OFT A;  3TKS C;  2CVB A;  5EL8 A;  1SD9 A;  3M9J A;  4TN8 A;  1TW9 A;  2YZH A;  3DIE A;  1YF1 A;  1M2B A;  2XBI A;  6GSY A;  3D21 A;  2H0H A;  5G31 A;  3LGC A;  3CRT A;  5HR1 A;  3F63 A;  5AGY A;  2H0G A;  4IBP A;  2EIR A;  4AJ6 A;  4WXT A;  4XS4 A;  1PX6 A;  2X8H A;  3HHV A;  4IQ1 A;  5ECS A;  2IJY A;  1TRU A;  1GNE A;  4KB3 A;  3QR6 A;  3WGE A;  4QL9 A;  4ZB6 A;  5JCG A;  2QA2 A;  5EY6 A;  3HJM A;  1KBN A;  1LU4 A;  2VCZ A;  3ERF A;  4YH2 A;  5B8B A;  4MCU A;  2XBQ A;  1AW9 A;  1GSQ A;  4NHZ A;  1ZYE A;  3KH9 A;  4MJB A;  3W6G A;  3I6A A;  3C71 A;  3FR6 A;  3CSH A;  2B7K A;  5KN2 A;  3QOU A;  1Z6M A;  2X8G A;  1GSD A;  2F8F A;  1C72 A;  5CRW A;  2VCW A;  3FEU A;  3GYK A;  3TCO A;  1OAZ A;  19GS A;  1W89 A;  4HI7 A;  2JSZ A;  1G7O A;  1YZX A;  1Z7R A;  2FD3 A;  1SKR B;  4KDX A;  3M0F A;  3TRP A;  2VD1 A;  3UBL A;  5J9C A;  4F03 A;  1PRX A;  4O5U A;  5ENU A;  4NAX A;  5FWG A;  3ZFB A;  5ID2 A;  2EIQ A;  1Z5Y E;  5ECK B;  3C73 A;  1V98 A;  2XPD A;  5ECH B;  4POL A;  1PL2 A;  3SBC A;  3NOF A;  3R3E A;  4PQ1 A;  4ISD A;  3FZ9 A;  3CSI A;  1EZK A;  2VCT A;  4ID0 A;  1TTZ A;  2DSA A;  2R0G A;  3LSZ A;  2B1L A;  3HKR A;  5LD0 A;  1HYU A;  5H5R A;  4PX1 A;  5G5F A;  2LNS A;  4IQA A;  5H5S A;  2VD0 A;  3Q19 A;  4AF2 A;  2IPA A;  3FZ5 A;  4GCI A;  4YQU A;  3IHQ A;  1PN9 A;  4FIW A;  4MPG A;  4EDZ A;  2CX4 A;  1NM3 A;  3GKX A;  3P8W A;  3TJF A;  4V1A p;  1YKC A;  1A2J A;  1U87 A;  4N11 A;  3WGX A;  2A2R A;  2IFQ A;  1F37 A;  1JHB A;  4NWY A;  1T4Y A;  3QAG A;  1R5A A;  3HZ8 A;  1EV9 A;  4GSN A;  3QFA C;  1FW1 A;  7GSS A;  1O85 A;  1UC7 A;  1EEM A;  1QGV A;  4YAV A;  5DAK B;  4PUA A;  3UJ1 A;  4MF5 A;  4DSQ A;  4BVY B;  2GSR A;  4OMV A;  2K8S A;  3DXB A;  4HEA 2;  1FHE A;  5INY A;  3FR9 A;  4POM A;  4HZ2 A;  4JRR A;  2KUC A;  4K6X A;  2HRF A;  1O8X A;  2DLX A;  2I3Y A;  3ZFL A;  1EOH A;  1SL0 B;  2NBS A;  2VLV A;  2JZS A;  5GZZ B;  5LCZ A;  3ZVJ D;  2LJR A;  2M72 A;  2P5R A;  1V2A A;  3ZL5 A;  4NXI A;  1M99 A;  4BVX A;  1WP0 A;  1OE8 A;  1THX A;  1TJD A;  1AXD A;  2GS3 A;  4ZL9 A;  4WEY A;  1SL2 B;  2CVK A;  2JZR A;  2QA1 A;  2FGX A;  4TXO A;  2HZE A;  3QFB C;  3FHK A;  3I9V 2;  2GZZ A;  1TDI A;  12GS A;  1ERU A;  2B1K A;  1HD2 A;  2ZUP A;  5A5K A;  1FAA A;  1CQH A;  4MAB A;  1OKD A;  2CZ3 A;  2H1D A;  5KEJ A;  2X64 A;  1GUK A;  3KGK A;  3DD3 A;  3TGZ A;  3UVT A;  4I5Q A;  2FWH A;  5LNK e;  1Y6E A;  5ECL B;  2HI7 A;  3EIN A;  2H70 A;  1Q98 A;  3LW9 A;  1KNG A;  4CY6 A;  2KOK A;  2H74 A;  3DKS A;  2J23 A;  2FWE A;  5DVB A;  4WET A;  3GX8 A;  1SEN A;  4OD7 A;  1FVK A;  2H1G A;  3I69 A;  4KW6 A;  2JU5 A;  2O7K A;  1T1V A;  3PIN A;  1B4Q A;  3OR5 A;  4KGI A;  1FB6 A;  4K5R A;  4Q5N A;  1BJX A;  2OA7 A;  3FRC A;  2OBI A;  3WT1 A;  3HD5 A;  2IMD A;  3AY8 A;  2I9H A;  4AJ7 A;  2VOC A;  4RQX A;  1ML6 A;  5D9T A;  2OE0 A;  1XCC A;  1SJZ A;  4G0K A;  4TR1 B;  1X9M B;  2WUL A;  4N0V A;  3S9F A;  3L4N A;  3ERW A;  4MJA A;  3QDN A;  5HFK A;  4HJ2 A;  2DJ2 A;  4IVF A;  1A23 A;  3DVW A;  5FHI A;  2DML A;  2NVL A;  3F6D A;  4GTU A;  5CAX A;  1AQW A;  3BCI A;  3W8J A;  1ZL9 A;  3IBH A;  4P3Y B;  1YEX A;  3GA4 A;  4OCF A;  3M9K A;  1GRX A;  3IC4 A;  3D4M A;  1XZO A;  5E4W A;  2C3N A;  4XTS A;  4EDY A;  4FYB A;  3UL3 A;  5ID2 B;  2GT5 A;  3A2W A;  3RHC A;  3I43 A;  3EMX A;  3EPT A;  22GS A;  2H0I A;  5J9B A;  3GN3 A;  3FZ4 A;  2X99 A;  1QMV A;  2H73 A;  2CV4 A;  1AIU A;  2C4J A;  4ZXG A;  4F0C A;  5ELG A;  2VUP A;  4POB A;  3TRQ A;  4XHM A;  1T8E B;  4O7H A;  3RDW A;  1VRS D;  3GKK A;  1V58 A;  2TIR A;  2AUV A;  1F6M C;  5G5E A;  1I5G A;  1QK8 A;  3GX0 A;  1HNA A;  1OE7 A;  1XPV A;  2L5O A;  3TKQ A;  2L5L A;  3APO A;  5IMV A;  3A2V A;  1SU9 A;  3EU4 A;  4Q5R A;  3GL3 A;  4WR5 A;  4KA0 A;  1B9X C;  3ZIV A;  1S3D A;  1OC8 A;  4I2U A;  1A2M A;  2R2J A;  2R6K A;  1X5D A;  2IIY A;  4H86 A;  3LYP A;  5CYY A;  1R4W A;  3A2X A;  5DCH A;  1X5C A;  2DIY A;  1X5E A;  1ILO A;  1F3A A;  3G7Y A;  4PGT A;  2WDU A;  6GSW A;  3C7M A;  1FO5 A;  1IYH A;  3BOA A;  3FR3 A;  1AUC A;  5BRT A;  1E2Y A;  5A4V A;  4IEL A;  2FHE A;  5GAP D;  4D73 B;  1XWB A;  2VL9 A;  3ERG A;  2OE1 A;  2H1B A;  1K0O A;  1DSB A;  1ZCP A;  2M46 A;  2DJJ A;  5KN0 A;  4JZQ A;  1JZR A;  3IAM 2;  2HSM A;  1EV4 A;  1MDJ A;  1ST9 A;  1OC9 A;  5DAK A;  3GSS A;  4TOP A;  3H79 A;  2EC4 A;  1AQV A;  4G0L A;  2NTO A;  4BVY A;  4ZB8 A;  2K8V A;  3UVH A;  3MNG A;  2L57 A;  4MZB A;  2LRT A;  1A2L A;  1K0N A;  4HZ4 A;  3ZML A;  2OE3 A;  3O76 A;  2L59 A;  4BVX B;  5F06 A;  1R5P A;  4V2L A;  1JZO A;  5AIX A;  2HSY A;  2B6M A;  4EE0 A;  4PXO A;  3H8Q A;  3QAW A;  1PA3 A;  2HZE B;  2NPB A;  1WOU A;  1G0T A;  1ERW A;  2L6D A;  2QSI A;  1SYX A;  3KMO A;  2LJA A;  3US3 A;  1X9S B;  1TKD B;  1BED A;  1V9W A;  2L6C A;  2LNT A;  4EKZ A;  4HU9 A;  2V6K A;  2E2G A;  2R0C A;  4GF0 A;  2IN3 A;  1VF3 A;  1YF0 A;  4LMW A;  4PNF A;  1KTE A;  5CO3 A;  2P0G A;  4WBJ A;  1XWA A;  1SKS B;  6GSS A;  1Z7P A;  4DSS A;  5J41 A;  5ECQ B;  1K3Y A;  17GS A;  2HSH A;  1U88 A;  3PR8 A;  2PVQ A;  4J2F A;  1MDI A;  3IC8 A;  4PQI A;  3NIV A;  2HRK A;  4BPY A;  1RW1 A;  4LL1 B;  1YQ1 A;  5D8I A;  5FT3 A;  2YWO A;  1PKZ A;  3D4T A;  1WJK A;  2C0F A;  4TXV A;  3H1N A;  2LEG A;  1O81 A;  4WF5 A;  2OBK A;  2VCQ A;  1YJ6 A;  3GH6 A;  2GST A;  1ACV A;  4MP4 A;  2MMN A;  1AQX A;  4L0W A;  4Q5F A;  1GL8 A;  2YNX A;  1M7T A;  2FUG 2;  1BG5 A;  3CRU A;  2H19 A;  4GRF A;  1IYI A;  3EYT A;  3F4S A;  5L71 A;  2LS5 A;  1A0R P;  3IPZ A;  5ECM B;  2YWM A;  4IP6 A;  3GTU A;  4F82 A;  1CQG A;  2OJL A;  4MMM A;  4TR1 A;  4K7N A;  4IGJ A;  3SWL A;  4DEJ A;  2LST A;  4LMV A;  1B4P A;  1H75 A;  1FG4 A;  1XVW A;  3PPU A;  2LV3 A;  1F2E A;  1RQM A;  4ZIJ A;  3U5R E;  4X43 A;  1HNB A;  3DWV A;  1GLQ A;  4ILF A;  1O8W A;  1TRV A;  4ZL8 A;  3J7Y k;  1XBS A;  4AGS A;  1Y25 A;  2H75 A;  4XS1 A;  3VI7 A;  5B6N A;  13GS A;  4Z2T A;  4G10 A;  1J9B A;  1XXU A;  2OAD A;  3O3T A;  1X0R A;  3IAS 2;  1WE0 A;  3HYP A;  3L9U A;  3GST A;  1MD4 A;  2JSY A;  2VCX A;  4MA9 A;  3L9V A;  1WPI A;  1TK0 B;  2JZT A;  1XW5 A;  2F8A A;  4HU7 A;  4PTS A;  5D9W A;  4GWR A;  4ZB9 A;  2H8L A;  1XIY A;  2ALB A;  1JZD A;  1U3A A;  1RK4 A;  3UEM A;  1SK1 A;  2O8V B;  4ECB A;  1ZYQ B;  3G7I A;  1UN2 A;  4MDC A;  2E7P A;  2I4A A;  4IJ3 A;  20GS A;  1PX7 A;  3VWX A;  4WF4 A;  4ICY A;  4TR4 A;  4MF6 A;  3CTG A;  2C0E A;  3TJJ A;  4ECI A;  1XFL A;  4GST A;  2HYX A;  2LQQ A;  3Q74 A;  4KCE A;  4YQM A;  4HQS A;  1F3B A;  2HRN A;  2YJH A;  2H71 A;  2E0Q A;  3D22 A;  2DIZ A;  1MEK A;  1USB A;  2CVD A;  2L4Q A;  3EMP A;  1OC9 B;  1B9Y C;  3TJK A;  2DBC A;  3GRX A;  4YAP A;  3PGT A;  2FA4 A;  4ML1 A;  2FCH A;  6GSU A;  2CAI A;  4D73 A;  3Q18 A;  3HCZ A;  3EUR A;  2JL4 A;  4OO4 A;  1T00 A;  2AV4 A;  2GLR A;  2K18 A;  4RQR A;  4J56 E;  2ON7 A;  18GS A;  3GFK A;  2XPE A;  3FYG A;  3LG6 A;  1WIK A;  1X9W B;  1FOV A;  5F07 A;  3RHB A;  3HJO A;  1ZOF A;  2HZF A;  1PMT A;  5A4U A;  4TR0 A;  3UOM A;  1O73 A;  3HVV A;  1A0F A;  1PSQ A;  2X8C A;  1M2A A;  14GS A;  2WS2 A;  3ZYW A;  4MK3 A;  1UA5 A;  2I1U A;  1ZYN A;  1K3L A;  2VCV A;  2VM2 A;  3TRX A;  3C1S A;  2BTO T;  2A2P A;  5IMD A;  4DSS B;  4LL4 B;  1TRS A;  2H6Z A;  2H6Y A;  1NSW A;  2PBJ A;  3PH9 A;  3KJY A;  4MLY A;  2B3S A;  2MMO A;  1W4V A;  2VO4 A;  3MSZ A;  4HJM A;  2IMI A;  2ES7 A;  1M0U A;  4F9Z A;  5HFI A;  2YV7 A;  5ECO B;  1SKW B;  4PQH A;  2O89 A;  2HRA A;  2VIM A;  4KSM A;  3QAV A;  4F0B A;  2G0F A;  3EC3 A;  2GDR A;  4LLR A;  3BD2 A;  4QQ7 A;  3ZRD A;  2QC7 A;  4EIP A;  4IP1 A;  3QD9 A;  5C04 A;  4V2N A;  2VLT A;  1ZGN A;  4G9H A;  2AYT A;  1VF2 A;  5D96 A;  3LYK A;  3WT2 A;  1M9A A;  1ERT A;  4POK A;  2RUE A;  5H5Q A;  1XWK A;  2R5G A;  2V2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...